1P10A

Structural plasticity as a determinant of enzyme specificity. creating broadly specific proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural plasticity broadens the specificity of an engineered protease.
pubmed doi rcsb
source organism Lysobacter enzymogenes
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1989-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p10A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p10A01
4FVDA 4X1PU 1Z8GA 1QFKH 5TJXA 4TWWA 2WPHS 1A1RA 2BDHA 1AHTH 1S84A 1HJAC 2ZO3H 1DFPA 1GHAG 1Y5UT 1BZXE 4K1SA 3HKIB 1O3JA 2BQ7B 3QGNB 3EA9A 5C67A 2J34A 2ZGXH 1O5EH 5EQSA 4CR5A 1YCPK 4INKA 1PJPA 3P17H 4O9VA 3VB5A 1FUJA 1GDNA 2Z3DA 2PHBA 3VXEH 3BSQA 3LC3A 4I8KA 1HAZB 3PLPA 2A45B 3NUMA 3SO3A 1YPLH 4NGAH 2Q6GA 3SU4A 2VWMA 3IITA 5FX6A 2FTMA 5TCAA 1C2GA 1AN1E 3RU4E 5AF9H 3MNSA 1DXWA 1LVMA 1O5GH 1YPJH 1CHOG 2THFB 2F9UA 3E1XB 1O3BA 1HAGE 4Y7BA 3E90B 4B75A 3BG4B 1TA6A 1CVWH 1O2QA 2XTTB 3VEQB 2FYRA 1TQ0B 1P02A 1O39A 1SQOA 1CSOE 1P2KA 1ID5H 4YTAA 1SLXB 2ZIQH 5BPEA 3KHVA 1AU8A 3V12A 3NK8A 2BD5A 3SBKA 3QZRA 1GJDB 1XUKA 3HGNA 1C5NH 2XBXA 3ZVAA 2BX4A 2W7UA 2BQWB 5FX5A 3MNBA 2B0FA 1FY4A 1Y5BT 1TGBA 1LQEA 2FOFA 1O2GH 1O3AA 1D6WA 1JMOH 1VZQH 3U9AH 1TX6A 1NU7B 1UK3A 3QDZB 2FODA 1GBCA 2FOCA 2O8LA 1P03A 1EJAA 3TNTA 2SFAA 4AZ2B 2UUYA 4UDWH 1S0RA 4WMEA 4YT6H 1GI4A 1C1RA 4HI3A 1O3KA 3BTQE 1CE5A 1C1UH 2PTCE 7GCHG 1GHAF 5JBAS 2O8UA 3ZVEA 1G2LA 1WAYB 4UFEH 1MTNB 1XXFA 1EAWA 3GDSA 5FBIA 1A61H 4NWKA 2BD2A 1YBWA 3HK3B 4I33A 1ELAA 3MYWA 2B8OH 1MU6B 1KXAA 4U32A 8GCHG 3MU5A 4FUJA 1V2TT 2BY7X 3LIWA 1V2QT 1P2OA 2J4IA 3LGIA 2SNVA 3VB3A 2H1UA 1YPKH 3TJUA 3DHKH 3S9AA 4YLUA 4CHAC 3GDVA 4UD9H 3SUEA 2ZDKA 1EB2A 2AFQB 3QX5H 5AFZH 4MLFB 1UVUH 1ZHRA 4CRBA 2ILNA 4XE4A 4R0IA 1BHXB 1C2KA 4DG4A 1K22H 1V2WT 3TJNA 1S0QA 1GBBA 2FS9A 1GI5A 1LVOA 1RJXB 1KLIH 5LPFA 4KP0A 3BV9B 5CHAB 2BLQA 1GGDC 1PFXC 3M36A 2YNBA 3U8OH 3GCNA 1BBRH 2Y82A 3F6UH 3GY6A 4FVBA 2ZFTA 1D3PB 3ATKA 5EXMA 1JOUB 1O3LA 1HPGA 1P05A 2V6NA 1BJVA 3PMHB 1PQAA 4MNXA 1ZTJA 1SG8B 1GBFA 1P04A 2P16A 2A4QA 1EP5A 1N6XA 1ESBA 2PSXA 3RXJA 6CHAB 1L1GA 5C1YA 1Q3XA 4BTIB 1C4V2 2OBQA 3URDA 4E06H 3TGJE 1DY8A 1V2LT 1SL3A 4KTUA 1ANBA 4ZKNU 1Z6EA 2CJIA 2FWWA 1J15A 1ZHPA 4Y79A 2BOKA 4TY7A 3P92A 4X1NU 2EI6A 1DLEA 1O30A 4X6NA 1C9TA 1LHFH 2NU3E 1HIAA 1O2IA 2BLOA 3P8GA 1W7GH 2BD3A 3ZVDA 3RXHA 4AYVB 2HLCA 2ZFFH 2ZP0H 2R2MB 1B7XB 3BTTE 2ZFSA 1BTPA 1SGRE 3ZZ6A 1XUHA 1NZQH 7GCHF 2AIQA 2FI3E 1BTHH 4IC6A 2XC4A 1QB6A 8ESTE 1UJ1A 1C5TA 3F9FA 4LZ4B 1UCYK 1UHBB 4IC5A 5EXLA 6GCHF 2FX4A 1L2EA 2A4OA 4O97A 2AMQA 4A5TS 4MPWA 1TNGA 5CMXH 3S9BA 2WUBA 2FYQA 5C20A 1P9UA 1GG6C 2AGIX 1MUEB 3SJOA 1OWEA 1WUNH 1ANDA 4NFFA 5ESTE 3S7KB 3OTJE 1THPB 1MTVA 3HGPA 1C5XB 3FAOA 3LT3A 1UTLM 3EA7A 3IWMA 1Y3XA 1J16A 1TGSZ 2UWOA 2OLGA 2C8ZB 3EQ0H 4LK4A 3U69H 1G3EA 2FEQH 1WQSA 1EJNA 1EOLA 1MTSA 4XFQA 4CRGA 1O38A 4MPUA 1PPCE 2B9LA 2GZ7A 2C8XB 1H9IE 1YP9A 3QO6A 2J2UA 1FAXA 3RXAA 3RMOH 2QXGA 2QY0B 1L1JA 1TNHA 3RM2H 3T26A 3MI4A 4AGJA 1AZ8A 3VGCC 4AOQA 1MKWK 2P3TB 1RTKA 3SJ9A 1G36A 1MKXH 4CR9A 2H9TH 4XBCA 1ABJH 2J95A 2V3OH 3PWBA 2HPQH 3D23A 1K9OE 3BEUA 1C1QA 3MTYA 2UUJB 1N6YA 1HAYB 2P8OB 1NRPH 1BHXF 1H4WA 2G52A 1HXEH 4ABGA 3UR9A 1J8AA 3EDXB 1CU1A 5L2ZH 3DFJA 3ZYDA 1HAVB 3S0NA 1ELCA 1SGEE 4IN2A 3GCTG 1Z1IA 2BDGA 1XUJA 1T4UH 2ANMH 3A8CA 1EPTA 2ZDLA 2FI4E 3L33A 4B2BA 4UFDH 1RRKA 1GDQA 5EW1H 2FX6A 4DIIH 4NFEA 3BTDE 3ZZ3A 4ABAA 2W3IA 2ZC9H 2TRMA 1KXBA 7KMEH 1EJMA 4ISOA 2G00A 2DUCA 3LGWA 4AYYB 4JK6A 2VJ1A 3GCHC 2GCTB 1NS3A 3RXPA 2WPLS 1NESE 3TIUA 4H6SB 2ZGHA 3RXGA 2IN2A 1K1MA 1TAWA 1S6FA 2ZGBH 2VINA 3ZVFA 2AMDA 1CO7E 5EG4A 1NO9H 1D9IA 1P8VC 1GDUA 1GHYH 1TMUH 1DITH 1ORFA 5E0JA 1O2TA 4DURA 2XC0A 1W3CA 2W7SA 1DUEA 1A0LA 3ZYEA 3LU9B 1MAXA 3HPTB 1RGQA 1VITG 4GAWA 3UQOA 2Z6BD 1S82A 1IOEA 4BAHB 1AB9B 2WV5A 3UPEA 3ZZ7A 1W0ZU 4BTTB 1TBZH 5FBEA 3RLWH 1DSTA 1LDTT 2ZPSA 1F92A 1A5GH 1GJ8B 2FMJA 2OINA 2PTNA 4H42U 4FUDA 2GX4A 4A92A 2C3SA 5LH8A 1T31A 4JYVH 2ZA5A 1TGNA 4X2WA 1TIOA 3TNSA 1GPZA 1HNEE 1AIXH 4K1EA 2BY5X 1TRNA 2GMTB 3LOXA 2A31A 3K6ZA 1C1TA 1EB1H 3TH2H 4CRFA 4CH8B 4B1TA 1TBQH 1QJ6B 2D8WA 3A83A 1QGFA 5LPRA 3GCTF 3OU0A 1HRTH 2QC2A 2B5TB 1FN6A 1FLEE 1D3DB 1C5UA 3U8TH 1MBQA 3NXPA 3I77A 1N1LA 2F91A 1EZSC 1HXFH 2Q6DA 2KAIA 4AN7A 1QBNA 2ZPRA 4B73A 1INCA 5C1UA 3RXBA 1X7AC 1O3DA 3M3TA 5K0HA 1V2KT 2PSYA 4X6PA 1E37B 4NIXA 4ZUHA 1OWJA 1O3GA 5IYTA 1QCPA 3R0FA 2F9NA 2AEIH 4MG3A 1HJAB 1YM0A 1G37A 1ZSJA 3DUXH 1TABE 3SNDA 2JETC 4XDEA 3OX7U 2O8MA 2CMYA 3VB4A 2OTVA 4FU8A 2OC1A 3SV7A 1WTHD 4BANB 3EAJA 5G4BA 1OP2A 2ODPA 1VITF 3RC6A 1KXFA 2EA3A 3RXIA 3RXSA 1HGTH 4ABJA 2ZCKP 4I32A 1TOMH 2BLWA 3MU8A 4GVUA 1FPHH 1HUTH 1WYKA 2R0LA 4WWYA 1IQIA 1AWFH 5EODA 5DP6A 2DE9A 8LPRA 1CA8B 1XVOA 3QWCH 4ISLA 2H5DA 1H1BA 4HGCA 4UONA 4AORA 1KSNA 4ABDA 1QR3E 1ZHMA 2A1DB 2R3UA 4UEHH 5F8ZA 1S81A 4JZDH 3MH5A 3ZVCA 3A88A 1LMWB 3MNCA 3F68H 2TBSA 2BD7A 1GMCG 1PPHE 1EOJA 1C5WB 2EI7A 4O3UA 4ABBA 1ELGA 1O3OA 3ATWA 4NSYA 1YPEH 3QGJA 3T2NA 5A2MH 1NTPA 4BNRA 1C2LA 5DO4H 1SOTA 4MQAA 3Q3XA 1A46H 1IQMA 1O3EA 4BOHA 1FY5A 3R3GB 3M5NA 1WBGB 2IOTA 5F8TA 3ZZ5A 1AGJA 1K1IA 4Z6AH 1SGFG 3ESTA 4FU9A 2XC5A 4X1QU 3A7VA 5ETXA 1BTYA 1O37A 2ALVA 1PQ7A 5E8EH 3PB1E 1A5IA 1AKSB 2I6QA 2K1QA 2RCEA 1HDTH 5JB9S 4IBLH 1ZMNA 5FPYA 1J17T 3MFJA 2FDAA 1P57B 2FOHA 3GISB 3TK9A 1QB1A 3MOCA 1C5LH 1XKAC 1BIOA 2A4RA 3UNQA 1EZUC 2WYJA 1EX3A 1NROH 5SGAE 1SGYE 1YPHC 1KTTB 1VJ9U 1HJ9A 2Q1JA 1JBUH 1O2MA 2FXRA 3RXOA 1MMJN 1O2RA 1OPHB 1P2QA 2OD3B 1JIMA 2ZFPH 3SU3A 1E34B 1SQAA 1NRRH 1Y3WA 2BVXH 3O8BA 4GCHF 1TOCB 2Y5FA 3UY9A 1FQ3A 1MTWA 1K2I1 1NRNH 3EA8A 5T6FA 4B71A 1YLDA 1NM6A 2HNTC 1AE8H 1IQNA 1O3NA 1KIGH 2R0KA 5EGMA 3PMAB 4OS7A 1O3CA 4A1TA 5A0CA 4CHAB 4Q7XA 1WU1A 4THNH 1FXYA 1AMHA 1AY6H 2ZKSA 2QN5T 1DM4B 1O2ZA 1LHDH 1GI9B 1O2PA 2Z3EA 3A7XA 2A5KA 1A7SA 2UWLA 3PROA 1QQ4A 2GV6A 2HVXA 2XCFA 3CS0A 3RXFA 5K7RA 1SGPE 1F0RA 4KTCA 1DWBH 3BIUH 5DP9A 4JCNA 4KKDA 1GMCF 1GGDB 3O8RA 4OS6A 3P70B 1T8OA 3P8NA 1KXEA 4RKOB 3M37A 3NPSA 2XYAA 2NU1E 2G81E 1YPGH 1SB1H 2ANYA 2XW9A 1B0FA 2GZ8A 1YCPM 1AO5A 3A86A 1O35A 2Z94A 4FUGA 3RMLH 4E05H 2BLVA 1A5HA 2XWBI 1W14U 2F3CE 1OWHA 1BRAA 2GZ9A 5IDKA 1BDAA 1UK4A 4RKJB 4UFGH 1BMLA 4DCDA 3F1SB 3P8OA 1PPFE 5DPAA 3W95A 5L6NH 1W13U 2OP9A 5E0HA 1O2SA 1HAXB 3SJIA 1FJSA 5DP4A 3RXMA 1C5OH 2BDYA 2BY9X 3EYDA 1HCGA 2EEKA 1VR1H 2G51A 4B76A 1YF4A 3QUMP 1TALA 1FIZA 3LDXH 3STIA 3W94A 4ABEA 2P93A 3LC5A 3QK1A 3PMBB 5GPIB 1W0YH 1V2PT 3M5OA 4JZIA 3TH3H 1IQFA 3U1IB 4DIHH 2SGFE 1WQVH 1Z1JA 1BT7A 1JRTA 2V3HH 4DVAU 1ESTA 1ACBE 1ETRH 1LQDB 1GCTC 2HOBA 1RS0A 5C5NA 5TCCA 4FUHA 1GG6B 1G9IE 2XBWA 1BBRE 5DP3A 2Y5HA 2JH5D 2OC0A 4JK5A 4AX9H 3LKWA 3M7TA 1CA0C 2OQUA 3MU4A 1D6RA 1IQGA 3UUZA 3SHCH 3EGKH 4ZXYH 4YT7H 1NRSH 2ZQ2A 1AD8H 1HBTH 3RXLA 2ZHDA 2OCVB 4NWLA 3H7TA 2XRCA 4HZHA 4YOIA 4ASHA 1CHOF 1QA7A 3TGIE 1K1LA 2VIVA 3FZDA 2HALA 3FP6E 2M5TA 2YOLA 4Q7YA 1ZMJA 1HAPH 2ZHWH 3MH6A 1TNLA 2ZFRH 1DT2A 1TE0A 1XX9A 4BAMB 3GYLB 2Y5GA 1HB0B 3UREA 2XWAA 1C2EA 1XM1A 3UQVA 1O2OA 1XUGA 1HFDA 1C2HA 3M61U 1BTUA 3MH7A 3SUGA 1GJ4H 3M7UA 3ZZ8A 2TGDA 4TPYA 1TONA 2HWLB 2Z9LA 4JZEH 3ZV9A 1BITA 2BZ6H 3AAVA 3BTKE 2ODYB 2G5VA 4X8VH 4MNVA 2ZNKH 2C4FH 4ZHMU 4JZ1A 4GHQA 2VIOA 4TPIZ 4F49A 6ESTA 1L4DA 2GT8A 3H5CB 2PUQH 1BRBE 1OX1A 1EAUA 2Z9IA 1SLUB 3FANA 1FONA 1SGCA 1QL9A 2ZZUH 1L0ZA 2P3FH 4MPXA 2PR3A 4BXSA 3ELAH 2FOAA 4J2YB 1TMBH 4HFPB 2PW8H 1GBTA 3N7OA 1UTJA 2VVCA 4AFZA 3ZV8A 4KGAA 2FOBA 3GCHB 1MZDA 1C2IA 1C2MA 5I46H 1C1PA 8GCHF 1GI3A 2AERH 3VB6A 1JXPA 1O2UA 1H9HE 4Q7ZA 1GI8B 1NFYA 2RA3A 3MO3A 1SLWB 1FMGA 4DW2U 3E6PH 5DP5A 1K1OA 2FIRH 1SVPA 1BUIA 4H6TA 3NZIA 4ZHAA 2UWPA 1OXGA 1PYTD 1AVWA 4WH8A 1K1NA 3TLOA 1ZGVA 5EPYA 2ZU1A 1EKBB 3KQDA 1O5DH 1N8OC 3STJA 1HJ8A 2ZDMA 4ZMAH 1CT4E 1PPGE 4K69A 3TVJB 3ZZDA 2CF9H 2GT7A 4I8GA 4ZH8A 2ZTXA 1GBIA 2V0BA 3T62A 1GVZA 1W10U 4VGCC 1LCYA 4IGDA 3E3TA 3PYHA 1SGQE 1HLTH 2ZDNA 4OS4A 1VGCC 3RXKA 1EATA 1CGJE 3SOSA 4A1XA 4X0WU 3Q76A 5EQQA 3SU2A 2GKVE 4GSOA 2A7HA 3QLPH 2SGEE 1XMNB 1S6HA 2I6SA 2WPJS 1O5CB 2QAAA 2AGEX 3ODFA 4NA7A 3UOUA 2Y80A 2ZGJA 4XBDA 1Y3YA 1LPZB 1A0HB 1P09A 1DANH 3L6PA 3KN2A 3NKKA 5C2ZA 4XBBA 1AVXA 2ZG0H 2A4GA 1QNJA 4B74A 3SV9A 1DSUA 1G3DA 5DP7A 4BAQB 1TBRH 1BMMH 2BXTH 1YPMH 3SORA 3RDZA 1T4VH 3RXCA 1BA8B 1P3EA 5GDSH 1F5RA 5BRRE 1GMDG 2ZFQH 2VH0A 4E7RG 2W5EA 1KXDA 2OBOA 4BAOB 3DA9B 1TPAE 1UHBA 2J9NA 1OWIA 4WH6A 2ZU4A 5E2PA 3SQHE 1AFQC 1XUIA 2FZZA 1GJ9B 3I78A 4AG2A 1LVBA 1NU9A 2Z9JA 1ZZZA 1YPHE 1TNJA 1TWXB 2BQ6B 3I29A 2LNCA 5EXNA 1EAXA 1L4ZA 2RDLA 1YGCH 2BXUH 1P2NA 1V6DA 1YCPH 2ZTZA 2VNTA 1EUFA 1G32B 2ASUB 1KDQB 3LGTA 3GY4A 1L1NA 2GD4B 3LH3A 5ESBA 2JETB 1T8MA 1P01A 1OS8A 2QYIA 3BTGE 1CGIE 1U6QA 4WY3A 5FXLA 3SGQE 1TX7A 3K2UA 2H2ZA 1EPTC 3PTNA 3GICB 5DJ7A 2OC8A 1IHTH 2HNTE 1HV7A 1ZRKA 2Y7XA 1YLCA 1MH0A 3GY3A 1SLVB 1ZRBA 4X8UH 2QIQA 3SUDA 3ZZAA 2FPZA 4WVPE 3ENSB 1OSSA 2CXVA 4LXBH 1K21H 3RXVA 4ISHH 1DDJA 1TRYA 4TY6A 8KME2 3SI3H 1TPSA 2W26A 4JYTA 5T6DA 2BB4A 4OS5A 3PO1C 4WMFA 3LH1A 5HM2A 1IQLA 2J38A 4M7GA 1THSH 1LPKB 2CHAC 4UE7H 3Q00A 1TB6H 4O03A 1C2JA 3KF2A 2FOGA 2R9PA 3JZ1B 1O31A 4WXVA 2ODQA 3RC4A 3URCA 4YOJA 3LJOA 5JBCS 3KIDU 5GXPA 4B2AA 4X1RU 1HAOH 3T25A 5FPTA 1ZPBA 3KL6A 1DXPA 4DT7B 1HAVA 3HATH 3PLBA 1GJBB 2A2QH 2HRVA 1VCWA 3ATLA 5L30H 2BVRH 1V2NT 4CRDA 1P12E 3BEFB 1FZZA 2ZU3A 1GJAB 2ZU2A 1GMDF 3SU5A 4NIVA 2H5CA 4MVNA 3UTUH 2WPIS 2Z7FE 2V35A 1BBRK 1GBJA 4ZKSU 5FCRA 3Q77A 5C5OA 1FAKH 2Z9KA 1MCVA 2J94A 3PLKA 4MTBA 5JBTA 1Y3VA 2WINI 1DICA 3MMGA 4Y0YE 4ESTE 1TNIA 3SU0A 1ANCA 2VIQA 1TGTA 3T27A 2WPMS 1C1VH 4CBOA 1NC6A 1AE5A 4FXGH 3MO6A 1ETSH 4Q80A 1GBLA 5T3HA 3SGBE 1TX8A 3CS7A 1QRWA 1SGNE 4JMYA 2GDEH 4J1YA 2AMPA 1CT0E 4B2CA 1UVSH 3A87A 2GP9B 3NCLA 1F5LA 4BAKB 2ALPA 1SHYA 4ZAEA 4U2WA 3M35A 4JZFH 2NU2E 3RXTA 1RIWC 1FPCH 4CREA 2BX3A 2FOEA 1QJ7B 3FP8E 2A0QB 3K9XB 1K28D 3LGYA 4PROA 3M5MA 2OQ5A 1TNKA 1W8BH 2P95A 1AUJA 1UVOA 2WV4A 1ZYOA 4INLA 2H6MA 3ZZ9A 2EC9H 2FP7B 1IQEA 1CQQA 1C5VA 3D65E 3U1JB 3BF6H 1AVGH 1O2KA 2STBE 1MAYA 1DE7H 1GL0E 3IG6B 2ANWA 1MD8A 3RP2A 3KQBA 3TU7H 3E16B 1QB9A 5A8ZA 1FNIA 2WYGA 2BM2A 2FLBH 4XOJA 1O3MA 1RD3B 3GCOA 1Z8RA 3PM3A 5FAHA 5A8XA 3QN7A 2GDDA 1C5MD 3P95A 1P11E 3QTVH 1O34A 2VIPA 1UTQA 3T28A 1O5BB 1ELVA 3P6ZB 1O3HA 2G8TA 1GHXH 5FCKA 4I8HA 1F2SE 1OWDA 1FIWA 2G4TA 2QXIA 2QXHA 4K1TA 3PTBA 1LO6A 2ZHEH 2H9EH 5I25A 3ITIA 4X6MA 3RU4D 1FN8A 1Y3UA 3SW2B 4A6LA 2UUFB 3SNBA 4YESB 4YM9A 4CRAA 1UCYH 1MBMA 1ZMLA 1ZPZA 3A8AA 3SU6A 1AFEH 1MKXK 1Y8TA 1A2CH 4ISNA 4FUCA 4OS1A 3AAUA 1F0SA 1C1NA 5J4QA 4WJG2 1PYTC 1ZR0A 1WOFA 2BVSH 5LGOA 4BXWA 2TGPZ 4FUIA 4I7YH 2OXSA 2VIWA 3RM0H 1T32A 4DOQA 2B7DH 5LPEA 1QJ1B 1GCTB 1SGFA 4U30A 1AQ7A 1THRH 2P59A 2O9QA 1ANEA 2Y81A 2CV3A 3QTOH 3A84A 3GY7A 2XXLA 1J14A 2BZAA 2BY6X 2VWOA 2CN0H 4ABHA 4F4OC 2H9HA 1TPPA 4AB9A 3TGKE 1C1WH 1CA0B 4MDSA 4OGXA 1O36A 1KYNA 3VB7A 1TPOA 3SU1A 2ZDVH 1Z71A 1IQKA 1A4WH 3VFEA 2AYWA 2ESTE 4K2YA 1ZJDA 4AB8A 1C1MA 1O2HA 2HGTH 1TMTH 1AWHB 2BD9A 4X2VA 1MKWH 3LGVA 1V2VT 1OOKB 3U98H 2QF0A 1KY9A 4K8BA 3T29A 3V7TA 4UFFH 1UTOA 1ABIH 4D76A 3S9CA 3MU1A 1Z7KA 1O5AB 1J9CH 1UTPA 2JH6D 1GI7B 3TK5A 2W3KA 3SJKA 1MCTA 1OP0A 1ZSLA 5DGJA 3FZZA 1MZAA 5HMAA 1DPOA 5ABWA 1D4PB 4KELA 2TPIZ 2HNTF 3M3SA 5JB8S 1GBDA 1C4U2 1T8NA 2FI5E 1AKSA 3SV8A 3PWCA 2C90B 2C8WB 2GTBA 3DD2H 2DE8A 1EXFA 1UO6A 3A82A 4D7GA 1JIRA 3F9EA 1ZTKA 4ABIA 5AHGH 1BMNH 1DY9A 1O2LA 1Y59T 1SGDE 1MTUA 4X2XA 3TK6A 1EP6A 2P3UB 1LKBA 1PPBH 2C8YB 1BJUA 1SQTA 3UOPA 2QGRA 4WMDA 4NSVA 1WTGH 3LONA 1BQYA 2EI8A 2OUAA 1C5QA 2STAE 4K60A 3RXQA 2F9BH 4E7NA 4NG9H 2GVFA 3G01A 1SI5H 4SGAE 4ZKRU 3UR6A 2BD8A 3A7ZA 1CBWC 4U01A 3GOVB 2ZWLH 1TRMA 3FVFB 5HM9A 1C5RA 3SV2H 4MPVA 3PV4A 1E0FD 2BDAA 1TLDA 1V2OT 2ZU5A 4Y7AA 3GY2A 1QL7A 2PKSC 1XUFA 4INHA 1RTLA 2D1JA 3O8DA 3CP7A 4GHTA 4LOYH 2VGCC 1GBAA 2C93B 1ZPCA 1CGHA 2ANKH 1HIAB 4FUEA 1P06A 3QZQA 1KLTA 1S83A 2AGGX 3FFGA 4I8LA 4IMQA 2IPHA 1LTOA 2G5NA 5B6OA 4IW4E 1H9LB 3KQEA 1DLKB 2BHGA 1QRXA 2A5IA 5E2OA 3ZVBA 5F6MA 5J4SA 2CGAA 1AUTC 3BG8A 3P8FA 2FS8A 4D7FA 6GCHG 1TFXA 2FM2A 3M3VA 1ETTH 1SMFE 3BN9A 1N8OB 2ZHFH 2GV7A 1FY3A 2PGBB 5EW2H 2Y6TA 4NZLA 1XVMA 2ZDAH 2F83A 1KTSB 1ELDE 2BDBA 1A3BH 1V3XA 1BRCE 4WF8A 2QF3A 3V0XA 4VGCB 1ELTA 4ABFA 1KLJH 3GDUA 5DKMA 1SFIA 4ISIH 4WXIA 4TWYA 3TJOA 4GUXA 1VGCB 2ZCLP 2PV9B 3D62A 1QHRB 3MU0A 4Z0KA 1IQJA 1QQUA 1C5PA 4AG1A 1MQ6A 4QT8C 1Y5AT 1SGTA 4GPGA 1GBKA 3CENA 3RMNH 1GBHA 3TITA 2TIOA 3SJ8A 2P94A 3AASA 1GJCB 3BG4C 1ELBA 1O0DH 3DT0H 1F7ZA 1JWTA 1P2MA 1Q2WA 1GHWH 4Y71A 3S69A 2VU8E 3TH4H 1FY1A 4D8NA 2O8TA 4DGJA 3ZZCA 2R3YA 2NU4E 1KXCA 3A7YA 1LHGH 3OSYA 1FDPA 2Z3CA 3BTME 1O32A 3OY5U 4Y8ZA 1GI0A 3OY6U 4TYDA 2XBVA 1PPZA 1CT2E 3EE0B 3SGAE 2FTLE 1OWKA 1GMHG 2ZTYA 4CBNA 1AFQB 1O2XA 4AGKA 3B23B 1TYNA 2SGDE 1V2MT 3E0PB 4R8TB 1FY8E 1QIXB 1GHBG 4ZXXH 1JRSA 4XSKU 9LPRA 1P2JA 3BIVH 1NT1A 3SNEA 5DG6A 2ZI2H 3SNCA 1UTKA 1NFUA 5T6GA 5CE1A 1UVPA 1EAIA 1B5GH 2A2XH 1PQ5A 1UTMA 3KEEA 1V2ST 3ZZBA 2Q6FA 1S5SA 3LGUA 4Y11E 2PUXB 3VGCB 3C1KA 3U8RH 2QCYA 1T7CA 1EPTB 2JKHA 5JYIA 4RSPA 1V2RT 1MTNC 4YLQH 4X8SH 1HAHH 3RLYH 3RXUA 1A3EH 1HYLA 1E38B 1C1OA 1NY22 2O8WA 1O2WA 1ZOMA 3F9HA 5FHTA 3SN8A 4NA9H 1W2KH 2VH6A 1VITH 2VWNA 4IMZA 3HKJB 3ATIA 3RXRA 5JPMH 4KTSA 2OC7A 1ZLRA 5F03A 2BY8X 1T8LA 3H7OA 3PO1B 1ZSKA 1NFXA 1WCZA 1LVYA 1UK2A 1OP8A 3T5FH 3PMJA 2CHAB 2ZF0H 5GCHG 2AH4X 1FV9A 1GI6A 5AFYH 1SOZA 2BDCA 1GI2A 1ESAA 2D26C 1GI1A 4FU7A 1LPGB 3ZVGA 1O3PB 1EQ9A 3KQCA 5CHAC 1DVAH 5C1XA 1GCDA 3A81A 3NWUA 4YO9A 2VVUA 2GCHG 3MHWU 2SGPE 3HK6B 1BCUH 3K65B 3UWIA 3E91A 5GJ4B 4FUFA 1G3CA 3AW0A 1MD7A 4DY7B 1A0JA 1NFWA 3TPIZ 3MO9A 1YKTA 3RXEA 6CHAC 3MNXA 3A85A 2XBYA 1GMHF 3A7TA 1F5KU 5DK1A 2BDIA 1SFQB 1D3QB 1PQ8A 2UUKB 3SV6A 3DFLA 1GHBF 1YYY1 2BOHB 2XCNA 3SZNA 5HXFA 5EPNA 3AVZA 4ZKOU 3A8DA 4Q2KA 2ZECA 4SGBE 1BOQA 1O33A 2HPPH 4YZUA 1ELFA 3RUOA 2RA0A 2AS9A 3Q3KA 3RXDA 4BTUB 2ZPQA 4JYUH 4D9QA 1EASA 3AW1A 4YOGA 4Y8XA 1LHCH 1RIWB 1Q31A 2KAIB 5EOKA 5PTPA 1W12U 1NRQH 3VXFH 3BTFE 5AVDA 1C5ZB 1ZGIA 3LJJA 4O3TA 1SR5C 1GJ5H 2FLRH 2A32A 1BRUP 2A7JA 4I8JA 2F9OA 4K5ZA 2QA9E 1SHHB 1C1SA 2FESH 5GCHF 2PGQB 1GBEA 4A7IB 4RN6A 1M9UA 2ZCHP 1QY6A 3WY8A 4H4FA 4MNWA 1XKBC 5HGGA 1Z8IB 2PLXA 1FI8A 1C2DA 4X6OA 1ELEE 1W11U 1V2UT 2VWLA 4ZHLU 1ZJKA 1BTWA 1DX5M 3ZZ4A 1QRZA 4Y8YA 2SGQE 1O5FH 1QL8A 3GYMA 1Z6JH 4Y0ZE 1GHZA 2WUCA 2GCHF 1LKAA 4OGYA 1QTFA 2F9VA 2QXJA 2FOMB 3BTHE 5A8YA 1W7XH 1GHVH 3UIRA 3KGPA 2BYAX 1GL1A 1K1JA 1ZTLA 1ARBA 2ZHQH 3E8LA 2ZEBA 1F0TA 2ZGCA 1DUAA 1SC8U 1QURH 2Y7ZA 3A8BA 1O2VA 3MWIU 4Y10E 1P0SH 2JH0D 1QBVH 5EU8A 2A7CA 1C5YB 3SHAH 1NN6A 3UNSA 3TJVA 1AZZA 3FP7E 5A0AE 1DWEH 1UVTH 1C2FA 2PFEA 1P9SA 1DS2E 4I31A 1YC0A 4X2YA 4CH2B 1QA0A 1BB0B 2P8OC 5E0GA 4NZQA 1CHGA 1OKXA 3O8CA 7LPRA 3SUFA 3M7QA 1RTFB 1E35B 1HAIH 3RC5A 1S85A 1KDQA 4ZROA 1G30B 1GWAA 1P2IA 2VVVA 4Y76A 4AFUA 2RG3A 4FUBA 3BTWE 3UNRA 3E0NB 4NA8A 1G3BA 1O3FA 2FO9A 1TGCA 4GLYA 2F9PA 1RFNA 1GVLA 1LHEH 3SI4H 1BTXA 4AFSA 3OYPA 2AIPA 1Z8JB 5JBBS 1G2MA 2ZQ1A 3RU4T 1O3IA 3MH4A 1ARCA 9ESTA 1C4Y2 5A09A 4LZ1H 3D49H 3A89A 2D2DA 2PKAB 2GCTC 5L2YH 1P3CA 1WSSH 2VB0A 3UWJH 3LPRA 1EZQA 5JDUB 1O2JA 2A5AA 2G4UA 1TQ7B 3K6YA 4GCHG 1V2JT 4NIYA 5GWZA 5HYOA 1MU8B 2IJOB 1K1PA 1UTNA 4IS5A 2Z9GA 3JZ2B 1IHSH 1UMAH 4K8YA 1C9PA 1OYTH 1SPJA 3C27B 1P10A 5FPSA 2BTCE 1QBOA 1DOJA 2SNWA 3KNXA 2YNAA 1AB9C 3ODDA 3GY5A 3SNAA 1OYQA 2TGAA 4MNYA 4AFQA 1DWCH 4HTCH 1SSXA 1UCYE 1H8IH 3V3MA 3VPKA 1D3TB 2NU0E 3A80A 1AI8H 4NIWA 1GJ6A 1H8DH 3B9FH 1C5SA 1GVKB 3GY8A 1SBWA 4Y6DA 4IN1A 3Q3YA 2SGAA 1IAUA 2PWXA 3F9GA 1PPEE 5F8XA 6LPRA 1EZXC 2GMTC 1BMAA 3A7WA 1O2NA 1F0UA 5C3NA 1MQ5A 1WV7H 1RXPA 2VIDA 3B8JA 2G55A 2BD4A 3SQEE 4X1SU 2J92A 1IQHA 2GGVB 2BMGB 3L3TA 3S7HB 5GIBA 1BTZA 2ULLA 4A1VA 1CBWB 5A0BA 1SGIB 3BEIB 4CRCA 1GBMA 4DJZB 1GJ7B 3ATMA 2WPKS 1TA2A 1O2YA 3RMMH 3V13A 2PKSB 1XXDA 4K3JA 2CF8H 3BTEE 1DWDH 7ESTE 1NPMA 2LPRA 5H4IB 1VJAU 1B0EA 2R2WU 2PKAA 2VGCB 4NCYA 2QV1A 3UFAA 2TGTA 1E36B 1VCPA 4OS2A 2XNIA 1VCQA 3KCGH 5EQRA 3M5LA 4X8TH 4D9RA 5DP8A 2NWNA
chains in the Genus database with same CATH superfamily
4FVDA 4X1PU 1Z8GA 1QFKH 5TJXA 4TWWA 2WPHS 1A1RA 2BDHA 1AHTH 1S84A 4HG6A 1HJAC 2ZO3H 1DFPA 1GHAG 1Y5UT 1BZXE 4K1SA 3DSOA 3HKIB 1O3JA 2BQ7B 3QGNB 3EA9A 5C67A 2J34A 2ZGXH 1O5EH 5EQSA 4CR5A 1YCPK 4INKA 1PJPA 5B6LA 3P17H 4O9VA 3VB5A 1FUJA 1GDNA 2Z3DA 2PHBA 3VXEH 3BSQA 3LC3A 4I8KA 1HAZB 3PLPA 2A45B 3NUMA 3SO3A 1YPLH 4NGAH 2Q6GA 4Q4LA 3SU4A 2XNDD 2VWMA 3IITA 5FX6A 2FTMA 5TCAA 1C2GA 1AN1E 3RU4E 5AF9H 3MNSA 1DXWA 1LVMA 1O5GH 1YPJH 1CHOG 2THFB 2F9UA 3E1XB 5EJ1A 1O3BA 1HAGE 4Y7BA 3E90B 4B75A 3BG4B 1TA6A 1CVWH 1O2QA 2XTTB 3VEQB 2FYRA 1TQ0B 1P02A 1O39A 1SQOA 1CSOE 1P2KA 1ID5H 4YTAA 1SLXB 2ZIQH 5BPEA 4Z1MD 3KHVA 1AU8A 3V12A 3NK8A 2BD5A 3SBKA 3QZRA 1GJDB 1XUKA 2WZQA 2HVYB 3HGNA 1C5NH 2XBXA 3ZVAA 2BX4A 2W7UA 2BQWB 5FX5A 3MNBA 2B0FA 1FY4A 1Y5BT 1TGBA 1LQEA 2FOFA 1O2GH 1O3AA 4RT1A 1D6WA 1JMOH 1VZQH 3U9AH 1TX6A 2JIZD 1NU7B 1UK3A 1SKYE 5CHBA 3QDZB 2FODA 1GBCA 2FOCA 2O8LA 1P03A 1EJAA 3TNTA 4TSFD 2SFAA 4AZ2B 2UUYA 4UDWH 1S0RA 4WMEA 4YT6H 1GI4A 1C1RA 3W1EA 4HI3A 3F2FA 1O3KA 3BTQE 1CE5A 1C1UH 2PTCE 7GCHG 1GHAF 5JBAS 2O8UA 3ZVEA 1G2LA 1WAYB 4UFEH 1MTNB 4FETA 1XXFA 1EAWA 3GDSA 5FBIA 1A61H 4NWKA 2BD2A 3FOAA 1YBWA 3HK3B 3N7EA 4I33A 1ELAA 3MYWA 2B8OH 1MU6B 1KXAA 4U32A 8GCHG 3MU5A 4FUJA 1V2TT 2BY7X 3LIWA 1V2QT 1P2OA 2J4IA 5EJZA 3LGIA 2SNVA 3VB3A 2H1UA 1YPKH 3TJUA 3DHKH 3S9AA 4YLUA 4CHAC 3GDVA 4UD9H 3SUEA 2ZDKA 1S6LA 1EB2A 2AFQB 3QX5H 5AFZH 4MLFB 1UVUH 1ZHRA 4CRBA 2ILNA 4XE4A 4R0IA 1BHXB 1C2KA 4DG4A 1K22H 1V2WT 3F0OA 3TJNA 1S0QA 1GBBA 2FS9A 1GI5A 1LVOA 1RJXB 1KLIH 5LPFA 4KP0A 3BV9B 5CHAB 2BLQA 1GGDC 1PFXC 3M36A 2YNBA 3U8OH 3GCNA 1BBRH 2Y82A 3F6UH 3GY6A 4FVBA 2ZFTA 1D3PB 3ATKA 5EXMA 1JOUB 1O3LA 1HPGA 1P05A 2V6NA 1BJVA 3PMHB 1PQAA 2J97A 4MNXA 1ZTJA 1H8HD 3KYGA 1SG8B 1GBFA 1P04A 2P16A 2A4QA 1EP5A 1N6XA 1ESBA 2PSXA 2M2AA 3RXJA 6CHAB 1L1GA 2CK3D 5C1YA 1Q3XA 4BTIB 2K0QA 1C4V2 2OBQA 3URDA 4E06H 3TGJE 1DY8A 2F43B 1V2LT 1SL3A 5IK2D 4KTUA 1ANBA 4ZKNU 1Z6EA 2CJIA 2FWWA 1J15A 1ZHPA 4Y79A 2BOKA 4TY7A 3P92A 4X1NU 2EI6A 1DLEA 2XOKD 1O30A 4X6NA 1C9TA 1LHFH 2NU3E 1HIAA 2QE7D 1O2IA 2BLOA 5CDFE 3P8GA 1W7GH 2BD3A 1E1QD 3ZVDA 2V7QD 3RXHA 4AYVB 2HLCA 2ZFFH 2ZP0H 2R2MB 1B7XB 3BTTE 2ZFSA 1BTPA 1SGRE 3ZZ6A 1XUHA 1NZQH 7GCHF 2AIQA 2FI3E 1BTHH 4IC6A 2YMSC 2XC4A 1QB6A 8ESTE 1UJ1A 1C5TA 3F9FA 4LZ4B 1UCYK 1UHBB 4IC5A 5EXLA 3WWBA 6GCHF 2FX4A 1L2EA 2A4OA 4O97A 2AMQA 4A5TS 4MPWA 1TNGA 5CMXH 3S9BA 2WUBA 2FYQA 5C20A 1P9UA 1GG6C 2AGIX 1MUEB 3SJOA 1OWEA 1WUNH 1ANDA 4NFFA 5ESTE 3S7KB 3OTJE 1THPB 1MTVA 3HGPA 1C5XB 3FAOA 3LT3A 1UTLM 4B6EA 3EA7A 3IWMA 1Y3XA 1J16A 1TGSZ 2UWOA 2OLGA 2C8ZB 3EQ0H 4LK4A 3U69H 1G3EA 2FEQH 1WQSA 1EJNA 1EOLA 1MTSA 4XFQA 4CRGA 1O38A 4MPUA 5KGOA 1PPCE 2B9LA 2GZ7A 2C8XB 3UB0A 1H9IE 1YP9A 3QO6A 2J2UA 1FAXA 3RXAA 3RMOH 2QXGA 2QY0B 1L1JA 1TNHA 2JJ2D 3RM2H 3T26A 3MI4A 4AGJA 1AZ8A 3VGCC 4AOQA 1MKWK 2P3TB 1RTKA 3SJ9A 1G36A 1MKXH 4CR9A 2H9TH 4XBCA 1ABJH 2J95A 2V3OH 3PWBA 2HPQH 3D23A 1K9OE 3BEUA 1C1QA 3MTYA 2UUJB 1N6YA 1HAYB 2G52A 1NRPH 1BHXF 1H4WA 2P8OB 1HXEH 4ABGA 3UR9A 1J8AA 3EDXB 1CU1A 5L2ZH 3DFJA 3ZYDA 1HAVB 3S0NA 3DCLA 1ELCA 1SGEE 4IN2A 5C0UA 3GCTG 1Z1IA 2BDGA 1XUJA 1T4UH 2ANMH 3A8CA 1EPTA 2ZDLA 2FI4E 3L33A 4B2BA 4UFDH 1RRKA 1GDQA 5EW1H 2FX6A 4DIIH 4NFEA 3BTDE 3ZZ3A 4ABAA 2W3IA 2ZC9H 2TRMA 1KXBA 7KMEH 1EJMA 4ISOA 2G00A 2DUCA 3LGWA 4AYYB 4JK6A 2VJ1A 3GCHC 2GCTB 1NS3A 3RXPA 2WPLS 1NESE 3TIUA 4H6SB 2ZGHA 3RXGA 2IN2A 1K1MA 1TAWA 1S6FA 2ZGBH 2VINA 3ZVFA 2AMDA 1CO7E 5EG4A 1NO9H 1VKYA 1D9IA 1P8VC 1GDUA 1GHYH 1TMUH 1DITH 1ORFA 5E0JA 1O2TA 4DURA 2XC0A 1W3CA 2W7SA 1DUEA 1A0LA 3ZYEA 3LU9B 1MAXA 3HPTB 1RGQA 1VITG 4GAWA 3UQOA 2Z6BD 1S82A 1IOEA 4BAHB 1AB9B 2WV5A 3UPEA 3ZZ7A 1W0ZU 4BTTB 1TBZH 5FBEA 3RLWH 1DSTA 1LDTT 2ZPSA 1F92A 1A5GH 1GJ8B 2FMJA 2OINA 2PTNA 4H42U 4FUDA 2LP6A 2GX4A 4A92A 2C3SA 5LH8A 1T31A 4JYVH 2ZA5A 1TGNA 4X2WA 1TIOA 3TNSA 1GPZA 1HNEE 5EJLA 1AIXH 4K1EA 2BY5X 1TRNA 2GMTB 3LOXA 2A31A 3K6ZA 1C1TA 1EB1H 3TH2H 4CRFA 3FN8A 4CH8B 4B1TA 1TBQH 1QJ6B 2D8WA 3A83A 1QGFA 5LPRA 3GCTF 3OU0A 1HRTH 2QC2A 2B5TB 1FN6A 1FLEE 1D3DB 1C5UA 3U8TH 1MBQA 3NXPA 3I77A 1N1LA 2F91A 1EZSC 1HXFH 2Q6DA 2KAIA 4AN7A 1QBNA 2ZPRA 4B73A 1INCA 5C1UA 3RXBA 1X7AC 1O3DA 3M3TA 5K0HA 1V2KT 2PSYA 4X6PA 1E37B 4NIXA 4ZUHA 1OWJA 1O3GA 5IYTA 1QCPA 2W6ID 3R0FA 2F9NA 2AEIH 4MG3A 1HJAB 1YM0A 1G37A 1ZSJA 3DUXH 1TABE 3SNDA 2JETC 4XDEA 3OX7U 2O8MA 2CMYA 3WW7A 3VB4A 2OTVA 4FU8A 2OC1A 3SV7A 1WTHD 4BANB 2RDEA 3EAJA 5G4BA 1OP2A 2ODPA 4DT4A 1VITF 3RC6A 1KXFA 2EA3A 3RXIA 3RXSA 1HGTH 4ABJA 2ZCKP 4I32A 1TOMH 2BLWA 3MU8A 4GVUA 1FPHH 1HUTH 1WYKA 2R0LA 4WWYA 3SZEA 1IQIA 1AWFH 2QF5A 5EODA 5DP6A 2DE9A 8LPRA 1CA8B 1XVOA 3QWCH 4ISLA 2H5DA 1H1BA 4HGCA 4UONA 4AORA 1KSNA 4ABDA 1QR3E 1ZHMA 2A1DB 2R3UA 4UEHH 3F2HA 5F8ZA 3GS9A 1S81A 4JZDH 3MH5A 3ZVCA 3A88A 1LMWB 3MNCA 3F68H 2TBSA 2BD7A 1GMCG 1PPHE 1EOJA 1C5WB 2EI7A 3OEED 4O3UA 4ABBA 1ELGA 1O3OA 3ATWA 4NSYA 1YPEH 3QGJA 3T2NA 5A2MH 1NTPA 4BNRA 1C2LA 5DO4H 1SOTA 4MQAA 3Q3XA 1A46H 1IQMA 1O3EA 4BOHA 1FY5A 3R3GB 3M5NA 1WBGB 2IOTA 5F8TA 3ZZ5A 1AGJA 1K1IA 4Z6AH 1SGFG 3ESTA 4FU9A 2XC5A 4X1QU 3A7VA 5ETXA 1BTYA 1O37A 2ALVA 1PQ7A 5E8EH 3PB1E 1A5IA 1AKSB 2I6QA 2K1QA 2RCEA 1HDTH 5JB9S 4IBLH 1ZMNA 5FPYA 1J17T 3MFJA 2FDAA 1P57B 1YY3A 2FOHA 3GISB 3TK9A 1QB1A 3MOCA 1C5LH 1XKAC 1BIOA 2A4RA 3UNQA 1EZUC 2WYJA 1EX3A 1NROH 2KCYA 5SGAE 1SGYE 1YPHC 1KTTB 1VJ9U 2EQNA 3PV5A 1HJ9A 2Q1JA 1JBUH 1O2MA 2FXRA 3U28C 3RXOA 1MMJN 1O2RA 1OPHB 1P2QA 2OD3B 1JIMA 2ZFPH 3SU3A 1E34B 1SQAA 1NRRH 1Y3WA 2BVXH 3O8BA 4GCHF 1TOCB 2Y5FA 3UY9A 1FQ3A 1MTWA 1K2I1 1NRNH 3EA8A 5T6FA 2K8IA 1YLDA 4B71A 1NM6A 2HNTC 1AE8H 1IQNA 1O3NA 1KIGH 2R0KA 5EGMA 3PMAB 4OS7A 1O3CA 4A1TA 5A0CA 4CHAB 4Q7XA 4XRNA 1WU1A 4THNH 1FXYA 1AMHA 1AY6H 2ZKSA 1COWD 2QN5T 1DM4B 1O2ZA 1LHDH 1GI9B 1O2PA 2Z3EA 3A7XA 2A5KA 1A7SA 2UWLA 3PROA 1QQ4A 2GV6A 2HVXA 2XCFA 3FKSD 3CS0A 3RXFA 5K7RA 1SGPE 1F0RA 4KTCA 1DWBH 3BIUH 5DP9A 4JCNA 4KKDA 1GMCF 1GGDB 3O8RA 4OS6A 3P70B 2KCAA 1T8OA 3P8NA 1KXEA 4RKOB 3M37A 3NPSA 2XYAA 2NU1E 2G81E 1YPGH 1SB1H 2ANYA 2XW9A 1B0FA 2GZ8A 1YCPM 1AO5A 3A86A 1O35A 2Z94A 4FUGA 3RMLH 4E05H 2BLVA 1A5HA 2XWBI 1W14U 2F3CE 1OWHA 1BRAA 4B6FA 2GZ9A 5IDKA 1BDAA 1UK4A 4RKJB 4UFGH 1BMLA 4DCDA 3F1SB 3P8OA 1PPFE 5DPAA 3W95A 5L6NH 1W13U 2OP9A 5E0HA 1O2SA 3UAIC 1HAXB 3SJIA 1FJSA 5DP4A 3RXMA 1C5OH 2BDYA 2BY9X 3EYDA 1HCGA 2EEKA 1VR1H 2G51A 4B76A 1YF4A 3QUMP 1TALA 1FIZA 2F4LA 3LDXH 3STIA 3W94A 4ABEA 2P93A 3LC5A 3QK1A 3PMBB 5GPIB 1W0YH 1V2PT 3M5OA 4JZIA 2J98B 2YMSB 5T1VA 3TH3H 1IQFA 3U1IB 4DIHH 2SGFE 1WQVH 1Z1JA 1BT7A 1JRTA 2V3HH 4DVAU 1ESTA 1ACBE 1ETRH 1LQDB 1GCTC 2HOBA 1RS0A 5C5NA 5TCCA 1W0JD 4FUHA 1GG6B 1G9IE 2XBWA 1BBRE 5DP3A 2Y5HA 2JH5D 2OC0A 4JK5A 4AX9H 3LKWA 3M7TA 1CA0C 2OQUA 2L74A 1D6RA 3MU4A 1IQGA 3UUZA 3SHCH 3EGKH 4ZXYH 4YT7H 1NRSH 2ZQ2A 1AD8H 1HBTH 3RXLA 2ZHDA 2OCVB 4NWLA 3H7TA 2XRCA 4HZHA 4YOIA 4ASHA 1CHOF 1QA7A 3TGIE 1K1LA 2VIVA 3FZDA 2HALA 3FP6E 2M5TA 2YOLA 4Q7YA 2JJ1D 1ZMJA 5HIZA 1HAPH 2ZHWH 3MH6A 1TNLA 2ZFRH 1DT2A 5F53A 1TE0A 1XX9A 2LELA 4BAMB 3GYLB 2Y5GA 1HB0B 3UREA 2XWAA 1C2EA 1XM1A 3UQVA 1O2OA 1XUGA 1HFDA 1C2HA 3M61U 1BTUA 3MH7A 3SUGA 1GJ4H 3M7UA 3ZZ8A 2TGDA 4TPYA 5C17A 1TONA 2HWLB 2Z9LA 4JZEH 3ZV9A 1BITA 2BZ6H 3AAVA 3BTKE 2ODYB 2G5VA 4X8VH 4MNVA 2ZNKH 2C4FH 4ZHMU 4JZ1A 4GHQA 2KZ4A 2VIOA 4TPIZ 4F49A 6ESTA 1L4DA 2GT8A 3H5CB 2PUQH 1BRBE 1OX1A 1EAUA 2Z9IA 2QF4A 1SLUB 3FANA 1FONA 1SGCA 1QL9A 2ZZUH 2GJGA 1L0ZA 2EY4C 2P3FH 4MPXA 2PR3A 4BXSA 3ELAH 2FOAA 4J2YB 1TMBH 4HFPB 2PW8H 1GBTA 3N7OA 1UTJA 1OHHD 2VVCA 4AFZA 3ZV8A 3FO8D 4KGAA 2FOBA 3GCHB 1MZDA 1C2IA 1C2MA 5I46H 1C1PA 8GCHF 1GI3A 2AERH 3VB6A 1JXPA 3WWFA 1O2UA 1H9HE 4Q7ZA 1GI8B 1NFYA 2RA3A 3MO3A 1SLWB 1FMGA 4DW2U 3E6PH 5DP5A 1K1OA 2FIRH 1YLNA 1SVPA 1BUIA 4H6TA 3NZIA 4ZHAA 2UWPA 1OXGA 1PYTD 1AVWA 4WH8A 1K1NA 3TLOA 1ZGVA 5EPYA 2ZU1A 1EKBB 3KQDA 1O5DH 1N8OC 3STJA 1HJ8A 2ZDMA 4ZMAH 1CT4E 1PPGE 4K69A 3TVJB 3ZZDA 2CF9H 2GT7A 4I8GA 4ZH8A 2ZTXA 1GBIA 2V0BA 3T62A 1GVZA 1W10U 4VGCC 1LCYA 3DSPA 4IGDA 3E3TA 3PYHA 1SGQE 1HLTH 2ZDNA 4OS4A 1VGCC 3RXKA 1EATA 3AK5A 1CGJE 3SOSA 4A1XA 4X0WU 3Q76A 5EQQA 3SU2A 2GKVE 4GSOA 2A7HA 3QLPH 2SGEE 1XMNB 1S6HA 2I6SA 2WPJS 1O5CB 2QAAA 2AGEX 3ODFA 4NA7A 3UOUA 2Y80A 2ZGJA 4XBDA 1NBMD 1Y3YA 1LPZB 1A0HB 1P09A 1DANH 3L6PA 3KN2A 3NKKA 5C2ZA 4XBBA 1AVXA 2ZG0H 2A4GA 1QNJA 4B74A 3SV9A 4F48B 1DSUA 1G3DA 5DP7A 4BAQB 1TBRH 1BMMH 2BXTH 1YPMH 3SORA 3RDZA 1T4VH 3N7DA 3RXCA 1BA8B 1P3EA 5GDSH 1F5RA 5BRRE 1GMDG 2ZFQH 2VH0A 4E7RG 2W5EA 1KXDA 2OBOA 4BAOB 3DA9B 2L6OA 1TPAE 1UHBA 2J9NA 4FOUC 1OWIA 4WH6A 2ZU4A 5E2PA 3SQHE 1AFQC 1XUIA 1K0HA 2FZZA 1GJ9B 2KR7A 3I78A 4AG2A 1LVBA 1NU9A 2Z9JA 1ZZZA 1YPHE 1TNJA 1TWXB 2BQ6B 3I29A 2LNCA 5EXNA 1EAXA 1L4ZA 2RDLA 1YGCH 2BXUH 1YWUA 1P2NA 1V6DA 1YCPH 2ZTZA 2VNTA 1EUFA 2KX4A 1G32B 3SYJA 2ASUB 1KDQB 3LGTA 3GY4A 1L1NA 2GD4B 3LH3A 5ESBA 5KEDA 2JETB 1T8MA 1P01A 1OS8A 2QYIA 3BTGE 1CGIE 1U6QA 4WY3A 5FXLA 3SGQE 1TX7A 3K2UA 2H2ZA 1EPTC 3PTNA 3GICB 5DJ7A 2OC8A 1IHTH 2HNTE 1HV7A 1ZRKA 2Y7XA 1YLCA 1MH0A 3GY3A 1SLVB 1ZRBA 4X8UH 2QIQA 3SUDA 3ZZAA 2FPZA 5HKKD 4WVPE 3ENSB 1OSSA 2CXVA 4LXBH 1K21H 3OFND 3RXVA 4ISHH 1DDJA 1TRYA 4TY6A 8KME2 3SI3H 1TPSA 2W26A 4JYTA 5T6DA 2BB4A 4OS5A 3PO1C 4WMFA 3LH1A 5HM2A 1IQLA 2J38A 4M7GA 1THSH 1LPKB 2CHAC 4UE7H 3Q00A 1TB6H 4O03A 1C2JA 3KF2A 2FOGA 2R9PA 3JZ1B 1O31A 4WXVA 2ODQA 3RC4A 2WV9A 3URCA 4YOJA 3LJOA 5JBCS 3KIDU 5GXPA 4B2AA 4X1RU 1HAOH 3T25A 5FPTA 1ZPBA 3KL6A 1DXPA 4DT7B 1HAVA 3HATH 3PLBA 1GJBB 2A2QH 2HRVA 1VCWA 3ATLA 5L30H 2BVRH 1V2NT 4CRDA 1P12E 1SQRA 3BEFB 1FZZA 2ZU3A 1GJAB 2ZU2A 1GMDF 3SU5A 4NIVA 2H5CA 4MVNA 3UTUH 2WPIS 2Z7FE 2V35A 1BBRK 1GBJA 4ZKSU 5FCRA 3Q77A 5C5OA 1FAKH 2Z9KA 1MCVA 2J94A 3PLKA 4MTBA 5JBTA 1Y3VA 2WINI 1DICA 3MMGA 4Y0YE 4ESTE 1TNIA 3SU0A 1ANCA 2VIQA 1TGTA 3T27A 2WPMS 1C1VH 4CBOA 1NC6A 1AE5A 4FXGH 3MO6A 1ETSH 4Q80A 1GBLA 5T3HA 3SGBE 1TX8A 3CS7A 2KM0A 1QRWA 1SGNE 4JMYA 2GDEH 4J1YA 2AMPA 1CT0E 4B2CA 1UVSH 3A87A 2GP9B 3NCLA 1F5LA 4BAKB 2ALPA 1SHYA 4AC9A 4ZAEA 4U2WA 3M35A 4JZFH 2NU2E 3RXTA 1RIWC 1FPCH 4CREA 2BX3A 2FOEA 1QJ7B 3FP8E 2A0QB 3K9XB 1K28D 3LGYA 4PROA 3M5MA 2OQ5A 1TNKA 4ACBA 1W8BH 2P95A 1AUJA 1UVOA 2WV4A 1ZYOA 4INLA 2H6MA 3ZZ9A 2EC9H 2FP7B 1IQEA 1CQQA 1C5VA 3D65E 5GNDA 3U1JB 3BF6H 1AVGH 1O2KA 2STBE 1MAYA 3F0PA 1DE7H 1GL0E 3IG6B 2ANWA 1MD8A 3RP2A 3KQBA 3TU7H 3E16B 1QB9A 5A8ZA 1FNIA 2IJD1 1WXRA 2WYGA 2BM2A 2FLBH 4XOJA 1O3MA 1RD3B 3GCOA 1Z8RA 3PM3A 5FAHA 5A8XA 3QN7A 2GDDA 1C5MD 3P95A 1P11E 3QTVH 1O34A 2VIPA 1UTQA 3T28A 1O5BB 1ELVA 3P6ZB 1O3HA 2G8TA 1GHXH 5FCKA 4I8HA 3PRBA 1F2SE 1OWDA 1FIWA 2G4TA 2QXIA 2QXHA 4K1TA 3PTBA 1LO6A 2ZHEH 2H9EH 5I25A 3ITIA 4X6MA 3RU4D 1FN8A 1Y3UA 5DSFA 3SW2B 4A6LA 4ASUD 2UUFB 3SNBA 4YESB 4YM9A 4CRAA 1UCYH 1MBMA 1ZMLA 1ZPZA 3A8AA 3SU6A 1AFEH 1MKXK 1Y8TA 1A2CH 1W0KD 4ISNA 4FUCA 4OS1A 3AAUA 1F0SA 1C1NA 1KMHB 5J4QA 3MQKC 4WJG2 1PYTC 1ZR0A 1WOFA 2V3MA 1QZ8A 2BVSH 5LGOA 4BXWA 2TGPZ 4FUIA 4I7YH 3NRLA 2OXSA 2VIWA 3RM0H 3CNRA 1T32A 4DOQA 2B7DH 4RT0A 5LPEA 1QJ1B 1GCTB 1SGFA 4U30A 1AQ7A 1THRH 2P59A 2O9QA 1ANEA 2Y81A 2CV3A 4P02A 3QTOH 3A84A 3GY7A 2XXLA 1J14A 2BZAA 2BY6X 2VWOA 2CN0H 4ABHA 4F4OC 2H9HA 1TPPA 4AB9A 3TGKE 1C1WH 1CA0B 3H09A 4MDSA 4OGXA 1O36A 1KYNA 3VB7A 1TPOA 3SU1A 2ZDVH 1Z71A 1IQKA 1A4WH 3VFEA 2AYWA 2ESTE 4K2YA 1ZJDA 4AB8A 1C1MA 1O2HA 5EIYA 2HGTH 1TMTH 1AWHB 2BD9A 4X2VA 1MKWH 4P00A 3LGVA 1V2VT 1OOKB 3U98H 2QF0A 1KY9A 4K8BA 3T29A 3V7TA 4UFFH 1UTOA 1ABIH 4D76A 3S9CA 3MU1A 1Z7KA 1O5AB 1J9CH 1UTPA 2JH6D 1GI7B 3TK5A 2W3KA 3SJKA 1MCTA 1OP0A 1ZSLA 5DGJA 3FZZA 1MZAA 5HMAA 1DPOA 5ABWA 1D4PB 4KELA 2TPIZ 5HIYA 2HNTF 3M3SA 5JB8S 1GBDA 1C4U2 1T8NA 2FI5E 1AKSA 3SV8A 3PWCA 2C90B 2C8WB 1WDIA 2GTBA 3DD2H 2DE8A 1EXFA 1UO6A 3A82A 4D7GA 1JIRA 3F9EA 1ZTKA 4ABIA 5AHGH 1BMNH 1DY9A 1O2LA 1Y59T 1SGDE 1MTUA 4X2XA 3TK6A 1EP6A 2P3UB 1LKBA 1PPBH 2C8YB 1BJUA 3DSGA 1SQTA 3UOPA 2QGRA 4WMDA 4NSVA 1WTGH 3LONA 1BQYA 2KCOA 2EI8A 2OUAA 1C5QA 2STAE 4K60A 3RXQA 2F9BH 4E7NA 2KFWA 4NG9H 2GVFA 3G01A 1SI5H 3PV2A 4SGAE 4ZKRU 3UR6A 2BD8A 3A7ZA 1CBWC 4U01A 3GOVB 2ZWLH 1TRMA 3FVFB 5HM9A 1C5RA 3SV2H 4MPVA 3PV4A 1E0FD 2BDAA 1TLDA 1V2OT 1E1RD 2ZU5A 4Y7AA 3GY2A 1QL7A 2PKSC 1XUFA 4INHA 1RTLA 2D1JA 3O8DA 3CP7A 5C94A 4GHTA 4LOYH 4YXWD 2VGCC 1GBAA 2C93B 1ZPCA 4XD7D 1CGHA 2ANKH 1HIAB 4FUEA 1P06A 3QZQA 1KLTA 1S83A 2AGGX 3FFGA 4I8LA 4IMQA 2IPHA 1LTOA 2G5NA 5B6OA 4IW4E 1H9LB 3KQEA 1DLKB 2BHGA 1QRXA 2A5IA 5E2OA 3ZVBA 5F6MA 5J4SA 2CGAA 1AUTC 3BG8A 3P8FA 2FS8A 4D7FA 6GCHG 1TFXA 2FM2A 3M3VA 1ETTH 1SMFE 3BN9A 1N8OB 2ZHFH 2GV7A 1FY3A 2PGBB 5EW2H 2Y6TA 4NZLA 1XVMA 2W6JD 2ZDAH 2F83A 1KTSB 2OK5A 1UW7A 1ELDE 2BDBA 1A3BH 1V3XA 1BRCE 3KQ5A 4M9FA 4WF8A 2QF3A 3V0XA 3KYFA 4VGCB 1ELTA 4ABFA 1KLJH 3GDUA 5DKMA 1SFIA 4ISIH 4WXIA 4TWYA 3TJOA 4GUXA 1VGCB 3N99A 2ZCLP 2PV9B 2WHXA 3D62A 1QHRB 3MU0A 4Z0KA 1IQJA 1QQUA 1C5PA 4AG1A 1MQ6A 4QT8C 1Y5AT 1SGTA 4GPGA 1GBKA 3CENA 3RMNH 4TT3D 1GBHA 3TITA 2TIOA 3SJ8A 2P94A 3AASA 1GJCB 3BG4C 1ELBA 1O0DH 3DT0H 1F7ZA 1JWTA 1P2MA 1Q2WA 1GHWH 2WPDD 4Y71A 3S69A 2J5UA 2VU8E 3TH4H 1FY1A 4D8NA 2O8TA 4DGJA 3ZZCA 2R3YA 2NU4E 1KXCA 2IPQX 3A7YA 1LHGH 3OSYA 1BMFD 1FDPA 2Z3CA 3BTME 1O32A 3OY5U 4Y8ZA 2J98A 1GI0A 3OY6U 2HLDD 4TYDA 2XBVA 1PPZA 1CT2E 5KECA 3EE0B 3SGAE 2FTLE 1OWKA 1GMHG 2ZTYA 4CBNA 1AFQB 1O2XA 4AGKA 3B23B 1TYNA 2SGDE 1V2MT 3E0PB 4R8TB 2JDID 1FY8E 1QIXB 1GHBG 4ZXXH 3OAAD 1JRSA 4XSKU 9LPRA 1P2JA 3BIVH 1NT1A 3SNEA 5DG6A 2ZI2H 3SNCA 1UTKA 1NFUA 5T6GA 5CE1A 1UVPA 1EAIA 1B5GH 2A2XH 3EE7A 1PQ5A 1UTMA 3KEEA 1V2ST 3ZZBA 2Q6FA 1S5SA 3LGUA 4Y11E 2PUXB 3VGCB 3C1KA 3U8RH 2QCYA 3OTPA 1T7CA 1EPTB 2JKHA 5JYIA 4RSPA 1V2RT 5C0TA 1MTNC 4YLQH 4X8SH 1HAHH 3RLYH 3RXUA 1A3EH 1HYLA 1E38B 1C1OA 1NY22 2O8WA 1O2WA 1ZOMA 3F9HA 2PP6A 5FHTA 3SN8A 4NA9H 1W2KH 2VH6A 1VITH 2VWNA 4IMZA 3HKJB 3ATIA 3RXRA 5JPMH 4KTSA 2OC7A 1ZLRA 5F03A 2BY8X 1T8LA 3H7OA 3PO1B 1ZSKA 1NFXA 3F3BA 1WCZA 1LVYA 1UK2A 1OP8A 3T5FH 3PMJA 2CHAB 2ZF0H 5GCHG 2AH4X 1FV9A 3F2GA 1GI6A 5AFYH 1SOZA 2BDCA 1GI2A 1ESAA 2D26C 1GI1A 4FU7A 1LPGB 3ZVGA 1O3PB 1EQ9A 3KQCA 5CHAC 3VG8A 1DVAH 5C1XA 2VBCA 1GCDA 3A81A 3NWUA 4YO9A 2VVUA 2GCHG 3MHWU 2SGPE 3HK6B 1BCUH 3K65B 3UWIA 3E91A 5GJ4B 4FUFA 1G3CA 3AW0A 1MD7A 4DY7B 1A0JA 1NFWA 4RI0A 3TPIZ 3MO9A 1YKTA 3RXEA 6CHAC 3MNXA 3A85A 2XBYA 1GMHF 3A7TA 1F5KU 2AHME 2RFKC 5DK1A 2BDIA 1SFQB 1D3QB 1PQ8A 2UUKB 3SV6A 3DFLA 1GHBF 1YYY1 2BOHB 2XCNA 3SZNA 5HXFA 5EPNA 3AVZA 4ZKOU 3A8DA 4Q2KA 2ZECA 4SGBE 1BOQA 1O33A 2HPPH 4YZUA 1ELFA 3RUOA 2RA0A 2AS9A 3OE7D 4OM9A 3Q3KA 3RXDA 4BTUB 2ZPQA 4JYUH 4D9QA 1EASA 3AW1A 4YOGA 4Y8XA 1LHCH 1RIWB 1Q31A 2KAIB 5EOKA 5PTPA 1W12U 1NRQH 3VXFH 3BTFE 5AVDA 1C5ZB 1ZGIA 3LJJA 4O3TA 1SR5C 1GJ5H 2FLRH 2A32A 1BRUP 2A7JA 3ZIAD 4I8JA 2F9OA 4K5ZA 2QA9E 1NBME 1SHHB 1C1SA 2FESH 4I86A 5GCHF 1MABB 2PGQB 1GBEA 4A7IB 4RN6A 1M9UA 2ZCHP 1QY6A 3WY8A 5DN6D 4H4FA 4MNWA 1XKBC 5HGGA 1Z8IB 2PLXA 1FI8A 1C2DA 4X6OA 1ELEE 1W11U 1V2UT 2VWLA 4ZHLU 1ZJKA 1BTWA 1DX5M 3ZZ4A 4ZCNA 1QRZA 4Y8YA 1H8ED 2SGQE 1O5FH 1QL8A 3GYMA 1Z6JH 4Y0ZE 1GHZA 2WUCA 2GCHF 1LKAA 4OGYA 1QTFA 2F9VA 2QXJA 2FOMB 3BTHE 5A8YA 1W7XH 1GHVH 3UIRA 3KGPA 2BYAX 1GL1A 1K1JA 1ZTLA 1ARBA 2ZHQH 3E8LA 2ZEBA 1F0TA 2ZGCA 1DUAA 1SC8U 1QURH 2Y7ZA 3A8BA 1O2VA 3MWIU 4Y10E 1P0SH 2JH0D 1QBVH 5EU8A 2A7CA 1C5YB 3SHAH 1NN6A 3UNSA 3TJVA 1AZZA 3FP7E 5A0AE 1DWEH 1UVTH 1C2FA 2PFEA 1P9SA 1DS2E 4I31A 1YC0A 4X2YA 4CH2B 1QA0A 1BB0B 2P8OC 5E0GA 4NZQA 1CHGA 4Q63A 1OKXA 3O8CA 7LPRA 3SUFA 3M7QA 1RTFB 1E35B 1HAIH 3RC5A 1S85A 1KDQA 4ZROA 1G30B 1GWAA 1P2IA 2VVVA 4Y76A 4AFUA 2RG3A 4FUBA 3BTWE 3UNRA 3E0NB 4NA8A 1G3BA 1O3FA 2FO9A 1TGCA 4GLYA 2F9PA 1RFNA 1GVLA 1LHEH 3SI4H 1BTXA 5FL7D 4AFSA 3OYPA 2AIPA 1Z8JB 5JBBS 1G2MA 2ZQ1A 3RU4T 1O3IA 3MH4A 1ARCA 9ESTA 4ACAA 1C4Y2 5A09A 4LZ1H 3D49H 3A89A 2D2DA 2PKAB 2GCTC 5L2YH 1P3CA 1WSSH 2VB0A 3UWJH 3LPRA 1EZQA 5JDUB 1O2JA 2A5AA 2G4UA 1TQ7B 3K6YA 4GCHG 1V2JT 4NIYA 5GWZA 5HYOA 1MU8B 2IJOB 1K1PA 1UTNA 2YMSD 4IS5A 2Z9GA 3JZ2B 1IHSH 1UMAH 4K8YA 1C9PA 1FX0B 1OYTH 1SPJA 3C27B 1P10A 5FPSA 2BTCE 1QBOA 1DOJA 2SNWA 3KNXA 2YNAA 1AB9C 3ODDA 3GY5A 3SNAA 1OYQA 2TGAA 4MNYA 4AFQA 1DWCH 4HTCH 1SSXA 1UCYE 1H8IH 3PRDA 4F55A 3V3MA 3VPKA 1D3TB 2NU0E 3A80A 1AI8H 4NIWA 1GJ6A 1H8DH 3B9FH 1C5SA 1GVKB 3GY8A 1SBWA 3OEHD 4Y6DA 4IN1A 3Q3YA 2SGAA 1IAUA 2PWXA 3F9GA 1PPEE 5F8XA 6LPRA 1EZXC 2GMTC 1BMAA 3A7WA 1O2NA 1F0UA 5C3NA 1MQ5A 1WV7H 2WSSD 1RXPA 2VIDA 3B8JA 2G55A 2BD4A 3SQEE 4X1SU 2J92A 1IQHA 2GGVB 2BMGB 3L3TA 3S7HB 5GIBA 1BTZA 2ULLA 4A1VA 1CBWB 5A0BA 1SGIB 3BEIB 2KCPA 4CRCA 1GBMA 4DJZB 1GJ7B 3ATMA 2WPKS 1TA2A 1O2YA 3RMMH 3V13A 2PKSB 1XXDA 4K3JA 2CF8H 3BTEE 1DWDH 7ESTE 1NPMA 2LPRA 5H4IB 1VJAU 1B0EA 2R2WU 1E79D 2PKAA 2VGCB 4NCYA 2QV1A 3UFAA 1EFRD 2TGTA 1E36B 1VCPA 4OS2A 2XNIA 1VCQA 3KCGH 5EQRA 3M5LA 4X8TH 4D9RA 5DP8A 2NWNA
chains in the Genus database with same CATH topology
4FVDA 4X1PU 1Z8GA 1QFKH 5TJXA 4TWWA 2WPHS 1A1RA 2BDHA 1AHTH 1S84A 1HJAC 2ZO3H 1DFPA 1GHAG 1Y5UT 1BZXE 4K1SA 3HKIB 1O3JA 2BQ7B 3QGNB 3EA9A 5C67A 2J34A 2ZGXH 1O5EH 5EQSA 4CR5A 1YCPK 4INKA 1PJPA 3P17H 4O9VA 3VB5A 1FUJA 1GDNA 2Z3DA 2PHBA 3VXEH 3BSQA 3LC3A 4I8KA 1HAZB 3PLPA 2A45B 3NUMA 3SO3A 1YPLH 4NGAH 2Q6GA 3SU4A 2VWMA 3IITA 5FX6A 2FTMA 5TCAA 1C2GA 1AN1E 3RU4E 5AF9H 3MNSA 1DXWA 1LVMA 1O5GH 1YPJH 1CHOG 2THFB 2F9UA 3E1XB 1O3BA 1HAGE 4Y7BA 3E90B 4B75A 3BG4B 1TA6A 1CVWH 1O2QA 2XTTB 3VEQB 2FYRA 1TQ0B 1P02A 1O39A 1SQOA 1CSOE 1P2KA 1ID5H 4YTAA 1SLXB 2ZIQH 5BPEA 3KHVA 1AU8A 3V12A 3NK8A 2BD5A 3SBKA 3QZRA 1GJDB 1XUKA 3HGNA 1C5NH 2XBXA 3ZVAA 2BX4A 2W7UA 2BQWB 5FX5A 3MNBA 2B0FA 1FY4A 1Y5BT 1TGBA 1LQEA 2FOFA 1O2GH 1O3AA 1D6WA 1JMOH 1VZQH 3U9AH 1TX6A 1NU7B 1UK3A 3QDZB 2FODA 1GBCA 2FOCA 2O8LA 1P03A 1EJAA 3TNTA 2SFAA 4AZ2B 2UUYA 4UDWH 1S0RA 4WMEA 4YT6H 1GI4A 1C1RA 4HI3A 1O3KA 3BTQE 1CE5A 1C1UH 2PTCE 7GCHG 1GHAF 5JBAS 2O8UA 3ZVEA 1G2LA 1WAYB 4UFEH 1MTNB 1XXFA 1EAWA 3GDSA 5FBIA 1A61H 4NWKA 2BD2A 1YBWA 3HK3B 4I33A 1ELAA 3MYWA 2B8OH 1MU6B 1KXAA 4U32A 8GCHG 3MU5A 4FUJA 1V2TT 2BY7X 3LIWA 1V2QT 1P2OA 2J4IA 3LGIA 2SNVA 3VB3A 2H1UA 1YPKH 3TJUA 3DHKH 3S9AA 4YLUA 4CHAC 3GDVA 4UD9H 3SUEA 2ZDKA 1EB2A 2AFQB 3QX5H 5AFZH 4MLFB 1UVUH 1ZHRA 4CRBA 2ILNA 4XE4A 4R0IA 1BHXB 1C2KA 4DG4A 1K22H 1V2WT 3TJNA 1S0QA 1GBBA 2FS9A 1GI5A 1LVOA 1RJXB 1KLIH 5LPFA 4KP0A 3BV9B 5CHAB 2BLQA 1GGDC 1PFXC 3M36A 2YNBA 3U8OH 3GCNA 1BBRH 2Y82A 3F6UH 3GY6A 4FVBA 2ZFTA 1D3PB 3ATKA 5EXMA 1JOUB 1O3LA 1HPGA 1P05A 2V6NA 1BJVA 3PMHB 1PQAA 4MNXA 1ZTJA 1SG8B 1GBFA 1P04A 2P16A 2A4QA 1EP5A 1N6XA 1ESBA 2PSXA 3RXJA 6CHAB 1L1GA 5C1YA 1Q3XA 4BTIB 1C4V2 2OBQA 3URDA 4E06H 3TGJE 1DY8A 1V2LT 1SL3A 4KTUA 1ANBA 4ZKNU 1Z6EA 2CJIA 2FWWA 1J15A 1ZHPA 4Y79A 2BOKA 4TY7A 3P92A 4X1NU 2EI6A 1DLEA 1O30A 4X6NA 1C9TA 1LHFH 2NU3E 1HIAA 1O2IA 2BLOA 3P8GA 1W7GH 2BD3A 3ZVDA 3RXHA 4AYVB 2HLCA 2ZFFH 2ZP0H 2R2MB 1B7XB 3BTTE 2ZFSA 1BTPA 1SGRE 3ZZ6A 1XUHA 1NZQH 7GCHF 2AIQA 2FI3E 1BTHH 4IC6A 2XC4A 1QB6A 8ESTE 1UJ1A 1C5TA 3F9FA 4LZ4B 1UCYK 1UHBB 4IC5A 5EXLA 6GCHF 2FX4A 1L2EA 2A4OA 4O97A 2AMQA 4A5TS 4MPWA 1TNGA 5CMXH 3S9BA 2WUBA 2FYQA 5C20A 1P9UA 1GG6C 2AGIX 1MUEB 3SJOA 1OWEA 1WUNH 1ANDA 4NFFA 5ESTE 3S7KB 3OTJE 1THPB 1MTVA 3HGPA 1C5XB 3FAOA 3LT3A 1UTLM 3EA7A 3IWMA 1Y3XA 1J16A 1TGSZ 2UWOA 2OLGA 2C8ZB 3EQ0H 4LK4A 3U69H 1G3EA 2FEQH 1WQSA 1EJNA 1EOLA 1MTSA 4XFQA 4CRGA 1O38A 4MPUA 1PPCE 2B9LA 2GZ7A 2C8XB 1H9IE 1YP9A 3QO6A 2J2UA 1FAXA 3RXAA 3RMOH 2QXGA 2QY0B 1L1JA 1TNHA 3RM2H 3T26A 3MI4A 4AGJA 1AZ8A 3VGCC 4AOQA 1MKWK 2P3TB 1RTKA 3SJ9A 1G36A 1MKXH 4CR9A 2H9TH 4XBCA 1ABJH 2J95A 2V3OH 3PWBA 2HPQH 3D23A 1K9OE 3BEUA 1C1QA 3MTYA 2UUJB 1N6YA 1HAYB 2P8OB 1NRPH 1BHXF 1H4WA 2G52A 1HXEH 4ABGA 3UR9A 1J8AA 3EDXB 1CU1A 5L2ZH 3DFJA 3ZYDA 1HAVB 3S0NA 1ELCA 1SGEE 4IN2A 3GCTG 1Z1IA 2BDGA 1XUJA 1T4UH 2ANMH 3A8CA 1EPTA 2ZDLA 2FI4E 3L33A 4B2BA 4UFDH 1RRKA 1GDQA 5EW1H 2FX6A 4DIIH 4NFEA 3BTDE 3ZZ3A 4ABAA 2W3IA 2ZC9H 2TRMA 1KXBA 7KMEH 1EJMA 4ISOA 2G00A 2DUCA 3LGWA 4AYYB 4JK6A 2VJ1A 3GCHC 2GCTB 1NS3A 3RXPA 2WPLS 1NESE 3TIUA 4H6SB 2ZGHA 3RXGA 2IN2A 1K1MA 1TAWA 1S6FA 2ZGBH 2VINA 3ZVFA 2AMDA 1CO7E 5EG4A 1NO9H 1D9IA 1P8VC 1GDUA 1GHYH 1TMUH 1DITH 1ORFA 5E0JA 1O2TA 4DURA 2XC0A 1W3CA 2W7SA 1DUEA 1A0LA 3ZYEA 3LU9B 1MAXA 3HPTB 1RGQA 1VITG 4GAWA 3UQOA 2Z6BD 1S82A 1IOEA 4BAHB 1AB9B 2WV5A 3UPEA 3ZZ7A 1W0ZU 4BTTB 1TBZH 5FBEA 3RLWH 1DSTA 1LDTT 2ZPSA 1F92A 1A5GH 1GJ8B 2FMJA 2OINA 2PTNA 4H42U 4FUDA 2GX4A 4A92A 2C3SA 5LH8A 1T31A 4JYVH 2ZA5A 1TGNA 4X2WA 1TIOA 3TNSA 1GPZA 1HNEE 1AIXH 4K1EA 2BY5X 1TRNA 2GMTB 3LOXA 2A31A 3K6ZA 1C1TA 1EB1H 3TH2H 4CRFA 4CH8B 4B1TA 1TBQH 1QJ6B 2D8WA 3A83A 1QGFA 5LPRA 3GCTF 3OU0A 1HRTH 2QC2A 2B5TB 1FN6A 1FLEE 1D3DB 1C5UA 3U8TH 1MBQA 3NXPA 3I77A 1N1LA 2F91A 1EZSC 1HXFH 2Q6DA 2KAIA 4AN7A 1QBNA 2ZPRA 4B73A 1INCA 5C1UA 3RXBA 1X7AC 1O3DA 3M3TA 5K0HA 1V2KT 2PSYA 4X6PA 1E37B 4NIXA 4ZUHA 1OWJA 1O3GA 5IYTA 1QCPA 3R0FA 2F9NA 2AEIH 4MG3A 1HJAB 1YM0A 1G37A 1ZSJA 3DUXH 1TABE 3SNDA 2JETC 4XDEA 3OX7U 2O8MA 2CMYA 3VB4A 2OTVA 4FU8A 2OC1A 3SV7A 1WTHD 4BANB 3EAJA 5G4BA 1OP2A 2ODPA 1VITF 3RC6A 1KXFA 2EA3A 3RXIA 3RXSA 1HGTH 4ABJA 2ZCKP 4I32A 1TOMH 2BLWA 3MU8A 4GVUA 1FPHH 1HUTH 1WYKA 2R0LA 4WWYA 1IQIA 1AWFH 5EODA 5DP6A 2DE9A 8LPRA 1CA8B 1XVOA 3QWCH 4ISLA 2H5DA 1H1BA 4HGCA 4UONA 4AORA 1KSNA 4ABDA 1QR3E 1ZHMA 2A1DB 2R3UA 4UEHH 5F8ZA 1S81A 4JZDH 3MH5A 3ZVCA 3A88A 1LMWB 3MNCA 3F68H 2TBSA 2BD7A 1GMCG 1PPHE 1EOJA 1C5WB 2EI7A 4O3UA 4ABBA 1ELGA 1O3OA 3ATWA 4NSYA 1YPEH 3QGJA 3T2NA 5A2MH 1NTPA 4BNRA 1C2LA 5DO4H 1SOTA 4MQAA 3Q3XA 1A46H 1IQMA 1O3EA 4BOHA 1FY5A 3R3GB 3M5NA 1WBGB 2IOTA 5F8TA 3ZZ5A 1AGJA 1K1IA 4Z6AH 1SGFG 3ESTA 4FU9A 2XC5A 4X1QU 3A7VA 5ETXA 1BTYA 1O37A 2ALVA 1PQ7A 5E8EH 3PB1E 1A5IA 1AKSB 2I6QA 2K1QA 2RCEA 1HDTH 5JB9S 4IBLH 1ZMNA 5FPYA 1J17T 3MFJA 2FDAA 1P57B 2FOHA 3GISB 3TK9A 1QB1A 3MOCA 1C5LH 1XKAC 1BIOA 2A4RA 3UNQA 1EZUC 2WYJA 1EX3A 1NROH 5SGAE 1SGYE 1YPHC 1KTTB 1VJ9U 1HJ9A 2Q1JA 1JBUH 1O2MA 2FXRA 3RXOA 1MMJN 1O2RA 1OPHB 1P2QA 2OD3B 1JIMA 2ZFPH 3SU3A 1E34B 1SQAA 1NRRH 1Y3WA 2BVXH 3O8BA 4GCHF 1TOCB 2Y5FA 3UY9A 1FQ3A 1MTWA 1K2I1 1NRNH 3EA8A 5T6FA 4B71A 1YLDA 1NM6A 2HNTC 1AE8H 1IQNA 1O3NA 1KIGH 2R0KA 5EGMA 3PMAB 4OS7A 1O3CA 4A1TA 5A0CA 4CHAB 4Q7XA 1WU1A 4THNH 1FXYA 1AMHA 1AY6H 2ZKSA 2QN5T 1DM4B 1O2ZA 1LHDH 1GI9B 1O2PA 2Z3EA 3A7XA 2A5KA 1A7SA 2UWLA 3PROA 1QQ4A 2GV6A 2HVXA 2XCFA 3CS0A 3RXFA 5K7RA 1SGPE 1F0RA 4KTCA 1DWBH 3BIUH 5DP9A 4JCNA 4KKDA 1GMCF 1GGDB 3O8RA 4OS6A 3P70B 1T8OA 3P8NA 1KXEA 4RKOB 3M37A 3NPSA 2XYAA 2NU1E 2G81E 1YPGH 1SB1H 2ANYA 2XW9A 1B0FA 2GZ8A 1YCPM 1AO5A 3A86A 1O35A 2Z94A 4FUGA 3RMLH 4E05H 2BLVA 1A5HA 2XWBI 1W14U 2F3CE 1OWHA 1BRAA 2GZ9A 5IDKA 1BDAA 1UK4A 4RKJB 4UFGH 1BMLA 4DCDA 3F1SB 3P8OA 1PPFE 5DPAA 3W95A 5L6NH 1W13U 2OP9A 5E0HA 1O2SA 1HAXB 3SJIA 1FJSA 5DP4A 3RXMA 1C5OH 2BDYA 2BY9X 3EYDA 1HCGA 2EEKA 1VR1H 2G51A 4B76A 1YF4A 3QUMP 1TALA 1FIZA 3LDXH 3STIA 3W94A 4ABEA 2P93A 3LC5A 3QK1A 3PMBB 5GPIB 1W0YH 1V2PT 3M5OA 4JZIA 3TH3H 1IQFA 3U1IB 4DIHH 2SGFE 1WQVH 1Z1JA 1BT7A 1JRTA 2V3HH 4DVAU 1ESTA 1ACBE 1ETRH 1LQDB 1GCTC 2HOBA 1RS0A 5C5NA 5TCCA 4FUHA 1GG6B 1G9IE 2XBWA 1BBRE 5DP3A 2Y5HA 2JH5D 2OC0A 4JK5A 4AX9H 3LKWA 3M7TA 1CA0C 2OQUA 3MU4A 1D6RA 1IQGA 3UUZA 3SHCH 3EGKH 4ZXYH 4YT7H 1NRSH 2ZQ2A 1AD8H 1HBTH 3RXLA 2ZHDA 2OCVB 4NWLA 3H7TA 2XRCA 4HZHA 4YOIA 4ASHA 1CHOF 1QA7A 3TGIE 1K1LA 2VIVA 3FZDA 2HALA 3FP6E 2M5TA 2YOLA 4Q7YA 1ZMJA 1HAPH 2ZHWH 3MH6A 1TNLA 2ZFRH 1DT2A 1TE0A 1XX9A 4BAMB 3GYLB 2Y5GA 1HB0B 3UREA 2XWAA 1C2EA 1XM1A 3UQVA 1O2OA 1XUGA 1HFDA 1C2HA 3M61U 1BTUA 3MH7A 3SUGA 1GJ4H 3M7UA 3ZZ8A 2TGDA 4TPYA 1TONA 2HWLB 2Z9LA 4JZEH 3ZV9A 1BITA 2BZ6H 3AAVA 3BTKE 2ODYB 2G5VA 4X8VH 4MNVA 2ZNKH 2C4FH 4ZHMU 4JZ1A 4GHQA 2VIOA 4TPIZ 4F49A 6ESTA 1L4DA 2GT8A 3H5CB 2PUQH 1BRBE 1OX1A 1EAUA 2Z9IA 1SLUB 3FANA 1FONA 1SGCA 1QL9A 2ZZUH 1L0ZA 2P3FH 4MPXA 2PR3A 4BXSA 3ELAH 2FOAA 4J2YB 1TMBH 4HFPB 2PW8H 1GBTA 3N7OA 1UTJA 2VVCA 4AFZA 3ZV8A 4KGAA 2FOBA 3GCHB 1MZDA 1C2IA 1C2MA 5I46H 1C1PA 8GCHF 1GI3A 2AERH 3VB6A 1JXPA 1O2UA 1H9HE 4Q7ZA 1GI8B 1NFYA 2RA3A 3MO3A 1SLWB 1FMGA 4DW2U 3E6PH 5DP5A 1K1OA 2FIRH 1SVPA 1BUIA 4H6TA 3NZIA 4ZHAA 2UWPA 1OXGA 1PYTD 1AVWA 4WH8A 1K1NA 3TLOA 1ZGVA 5EPYA 2ZU1A 1EKBB 3KQDA 1O5DH 1N8OC 3STJA 1HJ8A 2ZDMA 4ZMAH 1CT4E 1PPGE 4K69A 3TVJB 3ZZDA 2CF9H 2GT7A 4I8GA 4ZH8A 2ZTXA 1GBIA 2V0BA 3T62A 1GVZA 1W10U 4VGCC 1LCYA 4IGDA 3E3TA 3PYHA 1SGQE 1HLTH 2ZDNA 4OS4A 1VGCC 3RXKA 1EATA 1CGJE 3SOSA 4A1XA 4X0WU 3Q76A 5EQQA 3SU2A 2GKVE 4GSOA 2A7HA 3QLPH 2SGEE 1XMNB 1S6HA 2I6SA 2WPJS 1O5CB 2QAAA 2AGEX 3ODFA 4NA7A 3UOUA 2Y80A 2ZGJA 4XBDA 1Y3YA 1LPZB 1A0HB 1P09A 1DANH 3L6PA 3KN2A 3NKKA 5C2ZA 4XBBA 1AVXA 2ZG0H 2A4GA 1QNJA 4B74A 3SV9A 1DSUA 1G3DA 5DP7A 4BAQB 1TBRH 1BMMH 2BXTH 1YPMH 3SORA 3RDZA 1T4VH 3RXCA 1BA8B 1P3EA 5GDSH 1F5RA 5BRRE 1GMDG 2ZFQH 2VH0A 4E7RG 2W5EA 1KXDA 2OBOA 4BAOB 3DA9B 1TPAE 1UHBA 2J9NA 1OWIA