1P10A

Structural plasticity as a determinant of enzyme specificity. creating broadly specific proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural plasticity broadens the specificity of an engineered protease.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1989-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p10A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p10A01
2F83A 2Z94A 2ZDKA 3MO9A 3P8FA 5G4BA 2V3HH 2P94A 5C5OA 5ETXA 2BD4A 2BD8A 2XBVA 1O5EH 1EXFA 3HK6B 1GVLA 3RXLA 3S7HB 1C9PA 1GI2A 1GL1A 1O2PA 4ABGA 4E7NA 1N6XA 2FXRA 5DP7A 1J17T 4JYUH 1DT2A 1C5PA 2OTVA 1TGSZ 1BCUH 1NS3A 2ZWLH 2V3OH 4ZKRU 1J14A 1C2KA 1RXPA 1SG8B 2QV1A 1FN8A 3U8OH 1QY6A 1IHTH 1KXBA 3ZV8A 2Y6TA 1S82A 5JB8S 4A5TS 1BTZA 1MCVA 1ZOMA 1CA0C 1XKBC 3V0XA 1VITG 5DP6A 2NU3E 4YLUA 1K9OE 3ZZ7A 1O32A 1W12U 6ESTA 1J9CH 3SV7A 2C8WB 1TGBA 2BY8X 3C1KA 1GWAA 2WV5A 1V2PT 1B5GH 3GYLB 5HGGA 1LPZB 1OKXA 3TVJB 4ABIA 3BN9A 5FPSA 2QXHA 3GCOA 4JZDH 1TX7A 2J94A 1PJPA 1P2OA 2ZQ2A 1JRTA 2SGEE 2OCVB 2ODYB 4JZEH 1P01A 2ZTZA 1CO7E 5EW1H 4WY3A 1EB1H 2Y81A 3SNDA 3BTTE 1TGCA 2Y82A 1H9LB 4JK5A 1JIRA 3PTBA 1QURH 3P8GA 1NN6A 2H5CA 2HNTF 1BRCE 2QXIA 1AI8H 1E35B 3NCLA 2W26A 1YGCH 4X8UH 4UONA 8LPRA 2FESH 1V2RT 5T6DA 3SGQE 2DUCA 1LDTT 1CBWB 1UTKA 1D3QB 1V2TT 3VGCC 1SBWA 2Y80A 1EJMA 2C8YB 3ATLA 2WV4A 2H2ZA 3DA9B 1JWTA 2A7CA 2A4QA 1ELBA 2GZ7A 1SFIA 4AFUA 3QGJA 1BRBE 1DWDH 3BIUH 5ABWA 1GGDC 2Y7ZA 2PUQH 5CHAC 1AZZA 1C4U2 1HB0B 3QLPH 2Y5HA 1TRMA 1ORFA 1ZR0A 1OPHB 1B0EA 1O5GH 1FJSA 2VH6A 1DXWA 4JYTA 1S6HA 1O3NA 4D8NA 5C5NA 2R3UA 2Z9IA 3JZ1B 4CR5A 3RXIA 1F2SE 3SHCH 4BNRA 4XDEA 1TMBH 2GDDA 3TJUA 5FAHA 3EE0B 1MAYA 1E37B 3SNAA 5L30H 3BV9B 1UVPA 5DP9A 4YOJA 1QL8A 1ZYOA 1W7XH 3KQBA 3RXDA 1V2KT 3D65E 2SGPE 4I8KA 3U1JB 4GHQA 1QA7A 3FAOA 2TIOA 1HAOH 2GV6A 2A4GA 1CHOF 1FN6A 1PPBH 2Q6GA 3H5CB 2OBOA 2VWNA 1WQVH 1MTNC 2OXSA 2BY5X 5EOKA 5DG6A 1VGCC 1GBKA 3SNBA 4I8LA 1O5DH 1CQQA 4FUGA 2H1UA 1WAYB 1WUNH 2HNTC 2PFEA 3P8NA 2VB0A 4AB9A 1O2TA 1J8AA 1V2MT 3HKJB 3U98H 1TPOA 5JPMH 2FEQH 3F6UH 4BAHB 1Z8RA 1QJ6B 1N8OC 3A87A 1C5ZB 3SUDA 3KCGH 3RXTA 1WCZA 2V35A 3EA8A 1PQ7A 5FXLA 1S0RA 1WSSH 2GTBA 1FZZA 1H1BA 1X7AC 2JH5D 1NROH 1DLKB 1C5LH 4FUJA 1SQTA 4JYVH 5T6GA 3BEFB 1MZAA 3A8CA 2P93A 4NWLA 5L2YH 1FQ3A 2ZHWH 1V3XA 2G4UA 3SU6A 1C2DA 2FM2A 2ILNA 7GCHF 5DKMA 3MNBA 3RDZA 1W0YH 1IQIA 1CT4E 4A1XA 2O8LA 1GI5A 1Y8TA 2PLXA 3RXPA 3CS0A 7KMEH 1TE0A 3E3TA 3GY7A 1NO9H 4IS5A 1P04A 4NA8A 1HAIH 1EAXA 1XKAC 1GCDA 3A8AA 1C1MA 1EAIA 1V2OT 1C1VH 1GHBF 3FVFB 1B7XB 1RTLA 1LHEH 1C4V2 4TWWA 1B0FA 1O2LA 3TJNA 4FVBA 4WF8A 1BDAA 4I31A 3LGVA 1GI6A 1LQEA 4KTUA 1DXPA 3E91A 4UFGH 1CA0B 3LONA 2FI3E 2R0LA 3Q3KA 2F3CE 3BIVH 2RA0A 4FUHA 1AVWA 2XC4A 1P09A 1A61H 2YOLA 1PYTC 3U9AH 3UR9A 2H9EH 2BDGA 2GGVB 2G51A 1O3PB 4DVAU 4O03A 3URDA 3U8RH 1DSUA 3A89A 2XTTB 1HBTH 3OY6U 3BF6H 1BQYA 3PMBB 1NFWA 3TK9A 4WXIA 1YPHC 1A2CH 1ZMJA 1DLEA 4ISNA 3UR6A 3H7OA 1QHRB 1YM0A 1L0ZA 1C2MA 3QGNB 5E0GA 4NZQA 1VZQH 1RGQA 2JH6D 1A4WH 2STAE 4X6OA 1V2QT 1L2EA 5FCRA 2ZCKP 3WY8A 2CHAC 3FFGA 1CHGA 1GHYH 3VXEH 2ZCHP 1PQ8A 1TRNA 2CMYA 4GSOA 1P02A 1GHVH 2VIQA 1BTWA 1GBCA 4A1VA 5LGOA 3ZZ3A 2ZECA 3M37A 2VWMA 4DW2U 1GMHG 3TJVA 3MO3A 1PPZA 4IC6A 1VCWA 1CSOE 3GCNA 1Y3VA 1TYNA 3VGCB 3KN2A 3SO3A 1BTUA 4OS4A 3L6PA 3A7YA 4ZXYH 2ZFPH 1TWXB 3T62A 3SU3A 3ATWA 2G5NA 2TGPZ 1LVMA 3V13A 3MU5A 1DWBH 1C5WB 1GGDB 1NU7B 1E0FD 5CHAB 3RXCA 1WTHD 4ABDA 2ZPQA 1O5BB 1AB9C 1XUFA 1AUTC 1GI9B 1W7GH 1BRAA 3TNTA 4DIIH 3NXPA 4D76A 3KEEA 3VB7A 4ZHAA 4ZAEA 4R0IA 1PQ5A 2BY6X 3P95A 5K0HA 5GIBA 3RMMH 1LVBA 4O3UA 2J92A 3FP6E 3M61U 1P9UA 3ZZ8A 1J15A 1ESBA 1ANBA 1LTOA 2HGTH 1LHDH 3PMHB 1ZPBA 3RXMA 5C3NA 1AU8A 2EA3A 2BDHA 3LC3A 1GJ7B 3SORA 1IQHA 4OS7A 5EW2H 3VB3A 4LXBH 1KTSB 3DT0H 1BZXE 1P57B 4Y6DA 1OYTH 1SGRE 4ZKOU 3KF2A 3BTME 2B7DH 4AZ2B 3UQOA 2AH4X 1GDNA 1P10A 1QBNA 4GCHG 1PFXC 1QBVH 3QUMP 1AE5A 3BTEE 1SB1H 3M36A 1VGCB 1P11E 1G3CA 1O5FH 5B6OA 1QQ4A 4MQAA 2FLRH 2HVXA 3PWCA 1FY3A 4NFFA 5GWZA 1G3DA 2OC1A 1UTPA 4ABJA 4ZROA 2M5TA 1AN1E 2PGQB 3TNSA 1ESAA 2SGAA 2ZHDA 4JCNA 1ESTA 1ELGA 1N8OB 2P3FH 3DUXH 5ESBA 2BOKA 4MNXA 1A5GH 1DUAA 3RU4D 4TY7A 1CA8B 3S0NA 2FWWA 1C1SA 1Z1IA 1W3CA 1C5TA 1ARBA 4OS1A 2GMTC 2Q6FA 4ABFA 1YKTA 1RTKA 2GVFA 1EJAA 1YPEH 2RG3A 4XBDA 4AG1A 2BVXH 4D7FA 5HM9A 3ZVBA 8GCHG 1F5LA 1TALA 4U01A 1GMDG 2PWXA 1HAPH 3SZNA 1KTTB 3GY2A 4ABEA 1V2JT 3Q77A 3CP7A 3UUZA 3VFEA 1SLWB 3TK6A 3MNXA 6LPRA 1DITH 3RU4E 5AF9H 3FZDA 4O97A 2FOEA 3A7WA 4X1QU 3MHWU 1P12E 3PV4A 2F9PA 1DUEA 1P3CA 1A1RA 1TNIA 4AOQA 1EOLA 1O2IA 1QRXA 3M5OA 1KDQB 4H4FA 2FX4A 1C5SA 3ZYEA 4K1SA 4TY6A 2EI8A 3EA9A 4IGDA 1XMNB 2Z6BD 3O8CA 1ZSJA 4KTSA 4I8JA 1LVYA 3G01A 1YCPM 1GHAF 4KTCA 2BLOA 4ISOA 1MD8A 4MLFB 1UCYE 1ZGIA 2F9OA 1TLDA 4I7YH 3BG4C 3ZVEA 3E0PB 1QB6A 1SGFA 2TGTA 3KGPA 2G81E 1L4DA 2BXUH 1GBAA 1MBMA 2PGBB 1WTGH 2ZCLP 3K6ZA 3W95A 4FUEA 4UE7H 2IOTA 4U32A 2XW9A 6CHAC 1FIWA 1QNJA 2Q6DA 3GOVB 4UFFH 3EA7A 2CHAB 1MD7A 1JMOH 2ZEBA 4NA9H 2AS9A 2WPKS 4Y7BA 1ZMLA 1K1PA 2BX3A 3RM0H 1UJ1A 2V0BA 3MI4A 3NUMA 3FZZA 1XVMA 5EQQA 1L1JA 3PMJA 7ESTE 3M7QA 3UWJH 1LO6A 1C1TA 5DPAA 1UTOA 2PSXA 2AIPA 1O39A 1SMFE 4CRBA 2BOHB 3TIUA 4FU9A 1E34B 3A81A 3LGIA 1F0SA 1WOFA 4Q7ZA 2XBWA 2AMQA 5EQRA 5AHGH 4GHTA 1GVZA 2QXJA 4A6LA 1Z6JH 1H9HE 1GHXH 4XSKU 3Q00A 3RMNH 4CH2B 2FPZA 3A7XA 5TJXA 1HGTH 1C2HA 2GCHF 3HATH 2YNBA 3SU4A 3UFAA 1H8DH 1EAWA 4WMFA 3EDXB 1AB9B 2PV9B 2R0KA 1P2KA 3KHVA 4LZ4B 2FDAA 4AFZA 2H6MA 2PR3A 3F9HA 4AX9H 3QN7A 1GJ9B 5L2ZH 5TCAA 4Y76A 4TYDA 4Y8XA 3BSQA 1WQSA 5FX5A 4X6MA 5LH8A 2B5TB 2ZDVH 1GJCB 2W7SA 1Z8JB 1HAVA 1CGJE 4Y79A 3SU2A 1AGJA 4IMZA 4KP0A 2ALPA 1F0TA 1QA0A 4ABAA 1GJBB 3OX7U 3P92A 2HPPH 1C5XB 3A80A 1O5AB 1UVSH 4MNWA 1TONA 1AFEH 2AGGX 2ZU5A 4OS2A 1UK3A 1GBMA 1BTHH 5C1UA 1C9TA 2ASUB 3CENA 1E36B 1AIXH 4R8TB 1OWJA 3VPKA 2ESTE 1O3BA 3MH6A 1DSTA 2LNCA 4NIXA 1SGIB 1NESE 1EKBB 3AASA 5DJ7A 3ATKA 3SOSA 1HLTH 1QRWA 1FY5A 1THPB 1IQMA 4I8GA 1NTPA 3LGTA 1YPLH 2VGCC 5JDUB 1P06A 5DP5A 1GJ6A 2A2XH 1IQNA 2GDEH 4PROA 1SQAA 2V6NA 3GCHC 4MDSA 5E0JA 1UMAH 1M9UA 2I6SA 4X2YA 2ZTYA 2A4RA 4TPYA 1DWCH 1V2NT 1JXPA 1UCYH 1GBFA 1O3JA 2P3UB 3S69A 3A85A 5C67A 1ETSH 2WPHS 1L1NA 5JBTA 3LC5A 1T4UH 1GBLA 1TFXA 3LH3A 2GMTB 1SI5H 1E38B 1OWKA 1BBRE 5F8ZA 2XBXA 4X8TH 1HIAB 1GBJA 2O8WA 2BLVA 1THSH 1KY9A 1FMGA 3LJOA 1CHOG 2AGIX 3SUEA 3QWCH 2BD2A 1DY8A 1XM1A 2OC7A 1FNIA 1ZJDA 4B2CA 1NRRH 4IW4E 3GISB 4FUFA 1MTVA 3HGNA 1ID5H 2P8OB 2TGDA 1EOJA 2AEIH 1NT1A 2QF0A 2VINA 3SU5A 3SJOA 2ZGHA 1OWIA 3RXAA 2OC8A 1BIOA 4X1NU 4NFEA 3SV8A 1D3PB 1VJ9U 2G4TA 1IQLA 2W5EA 3M5LA 3MTYA 1G36A 1LHGH 3PLBA 3LGWA 4K8YA 1O2NA 1IHSH 1D6WA 1K28D 1W13U 2ZHEH 4Z0KA 4DURA 2VVUA 1ABIH 1MH0A 1ZSKA 2J4IA 2VIVA 4AN7A 3D62A 3BG4B 2ZDLA 1AVXA 2BZAA 8ESTE 3I77A 2Q1JA 4INLA 2OUAA 4BTIB 2PHBA 1OP0A 2NU0E 2BDCA 7GCHG 1RIWB 4Y7AA 1DY9A 3E1XB 2A32A 1T4VH 1GDUA 4RKJB 3SV9A 1P9SA 5JBBS 3UOPA 6CHAB 4Q7YA 2OP9A 3TGIE 1GMCF 4UEHH 3IITA 1GHBG 1BHXF 2ZPRA 2ZPSA 4NG9H 8KME2 3SV6A 3Q3XA 4GVUA 3E0NB 3VB4A 2NU1E 5I46H 4JK6A 3TH4H 1S84A 1BOQA 3A88A 4FUDA 3VXFH 2AGEX 3LIWA 1NZQH 4TPIZ 2P3TB 2WINI 1C1PA 2Y5GA 1TBRH 1FONA 1ZJKA 5ESTE 2RCEA 3RXUA 4JZ1A 1AVGH 2BZ6H 2ZFFH 1Y3YA 3LPRA 1O2WA 1O2QA 4YOGA 2FX6A 2ODQA 3SI4H 3P6ZB 1FAXA 1TA2A 1Z71A 3PM3A 3Q76A 3UY9A 4ZH8A 3C27B 3BTFE 2XCNA 5EXLA 1O3MA 1TPPA 4WJG2 3A7ZA 1T7CA 3EQ0H 1EB2A 1O3OA 3KL6A 4MNVA 4I33A 1O2UA 3AAVA 2J95A 3TGKE 3M3VA 2ALVA 1MKWH 2VIWA 1SLUB 4AG2A 3EYDA 3A84A 2ZGJA 1P2NA 1SGCA 5HYOA 1W11U 3AVZA 1OP8A 2K1QA 1GBHA 3TH2H 1PQAA 1RD3B 3AW0A 4ISLA 1BJVA 1NFXA 4K60A 2ZDAH 5E2PA 2CF9H 5K7RA 1S81A 2RA3A 3H7TA 5F6MA 4RKOB 2XYAA 4U30A 4RN6A 4CBNA 1HNEE 1XXFA 3HPTB 1FXYA 2A0QB 1OOKB 5HM2A 1QTFA 4DGJA 5J4SA 1SOTA 1ZPCA 1AE8H 5AFZH 5C20A 1W14U 1C2GA 4B76A 1MTWA 3RLYH 2VGCB 1AKSB 4BAMB 1O2JA 1UVTH 3T2NA 2XC5A 1OWEA 3PLPA 1XUJA 2D2DA 1GBDA 3GCHB 2A5KA 1Q3XA 1C5VA 5T3HA 3LGUA 1HAXB 1A3BH 3MH7A 2ANMH 3LJJA 3ZVFA 3NWUA 3OY5U 4O9VA 1DM4B 1CU1A 1NRPH 2BVSH 1A46H 2CXVA 1ZMNA 5A09A 1KXCA 1EPTC 1O5CB 4BANB 2O9QA 1A5HA 4ZMAH 5FX6A 1L1GA 2B8OH 3SU1A 2WYGA 1UK4A 3TJOA 3SJIA 1F0UA 3STJA 1Z1JA 4B75A 2BD9A 1TPSA 1ETTH 3RM2H 1O38A 4IBLH 1O36A 4Y0ZE 1C1OA 2BDIA 2PTCE 1JRSA 1OWDA 2ULLA 3SHAH 3ZZBA 1KLTA 1AD8H 1ZRKA 4K1EA 2PKAB 1CT0E 2AIQA 1W10U 1FPCH 1ANCA 1KDQA 3RXFA 1G3BA 1O2HA 2VVVA 5EGMA 4YOIA 2A4OA 3EAJA 3S7KB 3KIDU 1RJXB 1UVOA 1UK2A 1FIZA 3M7UA 1U6QA 5AFYH 1Z8IB 3D49H 1DDJA 1G2LA 3SI3H 3KQCA 3F1SB 1VCQA 1Y3UA 2ZU2A 4ABHA 4D9RA 1FPHH 3DHKH 2G5VA 2CF8H 3PO1C 3RXRA 2WUCA 1K22H 2GV7A 2SNVA 3SGBE 1TOCB 2J38A 3B8JA 2YNAA 2KAIB 4MPWA 1GI1A 3E6PH 1LCYA 2HWLB 5LPFA 3UNSA 1INCA 3S9AA 1TNLA 2FOAA 4FXGH 1O0DH 2BLQA 3IG6B 6GCHF 1SVPA 1TGNA 1UTQA 2R2MB 5C1YA 3PROA 2VNTA 4WMEA 2D8WA 1ZHMA 2A5AA 1QR3E 2Z3EA 2J9NA 4GUXA 2A7HA 1O2MA 3A86A 1C5YB 1MBQA 1XUHA 1F7ZA 3ZZ6A 3ZVDA 1ZSLA 1QJ7B 5A2MH 2EC9H 2O8TA 4IN1A 1O3CA 2PTNA 1NRSH 3P17H 5T6FA 2IN2A 5FBEA 2ZHFH 1UTNA 3A82A 4ISIH 1MMJN 1GHAG 1HJ8A 1ELTA 1S6FA 3LT3A 4CRDA 1T32A 3F9EA 3UNRA 2UWPA 5C1XA 1GJ8B 4CRCA 5FPYA 1GI7B 4WH6A 3F9GA 4UFDH 5DP4A 2PSYA 1H9IE 1V2LT 2UUKB 1D3DB 3MH4A 2VWLA 3RUOA 2VVCA 3RU4T 1N1LA 2GX4A 1SHHB 1KXDA 3RXBA 1SSXA 1W0ZU 2A1DB 2FLBH 1TNJA 4D7GA 4GAWA 3SQHE 3T29A 2OINA 1K1OA 5DP3A 1CT2E 1O31A 1TABE 1DWEH 3SNEA 1EZUC 3A7TA 1K2I1 2BDBA 2H9TH 1EX3A 5EXNA 3V3MA 3RXKA 4CBOA 2ZP0H 2P8OC 4MNYA 2SGDE 3OSYA 1WBGB 1OYQA 1TX8A 2VH0A 1HAYB 3A8DA 2ZF0H 3HK3B 1ZRBA 2VIPA 3A7VA 3NPSA 1GL0E 3TITA 2BX4A 4NCYA 4ZHMU 3GY5A 1BMNH 2JH0D 1FY4A 1FAKH 2BYAX 9ESTA 3ATMA 1WYKA 2SFAA 3QX5H 4H6SB 1K1IA 2ZIQH 4JZIA 1BHXB 4F4OC 4XFQA 1QQUA 1DICA 3L33A 4Y11E 3TH3H 2HNTE 1GBEA 2GCHG 1HJAC 2VU8E 3LKWA 3DD2H 3T26A 1NM6A 3GCTF 2CGAA 1S0QA 1O3LA 4NSVA 1ZHPA 1RIWC 5GCHF 4X1SU 4ZXXH 4AB8A 4CH8B 2BQ6B 1A7SA 1MQ6A 1GI4A 4CRGA 2UUJB 2UUFB 1O3AA 3EGKH 7LPRA 2FI5E 2XXLA 2TPIZ 1G32B 1T8LA 3TK5A 1EPTB 4INKA 4BOHA 4UD9H 3RXHA 3S9BA 3GY8A 2WPIS 3SJ8A 2GD4B 2C8ZB 1UTLM 1HIAA 1GVKB 4IC5A 5A0AE 3MOCA 1FY1A 4H6TA 2AMDA 1H4WA 2GCTC 3MU0A 3ODFA 4ASHA 3VEQB 3ZZCA 1HAGE 1F5RA 2ZU4A 4X6NA 3MNSA 2Y5FA 3A8BA 5JBCS 2I6QA 4WWYA 2VIOA 4B1TA 1PYTD 1ZPZA 5SGAE 1XVOA 5GJ4B 2OQ5A 1PPGE 3ELAH 5HMAA 1BTXA 1BMAA 1HJ9A 2FMJA 3MH5A 2ZFQH 4U2WA 2DE9A 1G3EA 4BXWA 2Z9KA 2WPLS 1QGFA 1GJDB 2OC0A 3GY4A 2ANWA 1O2VA 5GPIB 1GJ5H 2EEKA 2UUYA 3B23B 2BQWB 4WH8A 1GI0A 1LKAA 4GPGA 1QIXB 2PKSC 3JZ2B 4Y71A 5EQSA 2BDAA 1MU6B 1O3GA 3PO1B 2Z3DA 4YLQH 4YTAA 2ZTXA 1HXFH 4AYVB 2FS9A 2XBYA 1UO6A 1YPHE 4K69A 2FOMB 2UWLA 3ZZAA 1SR5C 1P05A 4AGKA 3ZVAA 4YO9A 2QY0B 3SUGA 1ZTLA 1EZXC 2PW8H 1EZQA 2ZFRH 2ODPA 5FCKA 5LPEA 3RXSA 3U69H 4FUBA 3LDXH 4CREA 3I78A 1K1LA 3ZVCA 2A5IA 3E16B 1TNGA 1C2LA 2R2WU 1XUGA 1O33A 4CHAB 9LPRA 3GICB 1AMHA 4TWYA 5F03A 1TIOA 2FO9A 3GDVA 1T8NA 1QFKH 1TX6A 1VJAU 1HAZB 1F0RA 3P8OA 1TMUH 5L6NH 2TRMA 3UNQA 4B73A 4YT7H 3ODDA 3SUFA 1LHCH 4YM9A 1AWFH 1F5KU 5A8ZA 4B2AA 4UFEH 3BG8A 2ZKSA 4ZHLU 3MMGA 1JOUB 1OXGA 2C3SA 3B9FH 2OLGA 3GDUA 2BTCE 1SGPE 3STIA 4K1TA 4F49A 1TAWA 5H4IB 5A8YA 4ESTE 3T27A 3E90B 3QO6A 3SJKA 2FIRH 4IN2A 3ZV9A 2BHGA 4LZ1H 1IOEA 1DE7H 3LU9B 3MWIU 5F8TA 3O8DA 4LOYH 1HV7A 1VITH 2GZ8A 3SU0A 5I25A 1EJNA 1HAHH 3V7TA 3QZQA 1LMWB 1GMCG 4IMQA 3SW2B 3F68H 2P16A 1TQ0B 1G37A 5BPEA 3TGJE 2ZI2H 3ZZ5A 1SGEE 5EU8A 1SFQB 5DP8A 5FHTA 4K8BA 1FUJA 1G2MA 4Q2KA 5E0HA 4B74A 1V2UT 3F9FA 1TNHA 2DE8A 1FI8A 3ESTA 3M3TA 1O3KA 1JIMA 2BY7X 3RXOA 3KQEA 3ZYDA 4K5ZA 1MAXA 1WV7H 1KXEA 1AO5A 1O3DA 4ZKNU 4MPVA 1CGIE 1HRTH 4DG4A 1C1QA 1VITF 3UREA 4J2YB 1FV9A 1RRKA 1ZTKA 3QK1A 1GHZA 3SN8A 4OS6A 1GJAB 4OS5A 2QCYA 1AKSA 3RXEA 2BQ7B 3FP8E 1GHWH 1MTUA 1GI8B 1P2IA 2BXTH 1HJAB 4MPXA 4AORA 1AFQC 1EQ9A 3RMOH 3LOXA 3V12A 1Q31A 2BD7A 1MUEB 2VWOA 3OU0A 2H5DA 2F9BH 1ELFA 1ZLRA 2XC0A 4MTBA 1UHBB 3VB5A 1DVAH 4AGJA 2UWOA 1AY6H 1KLJH 3S9CA 1P03A 4E06H 1D4PB 1GDQA 1GPZA 2FOCA 4NSYA 5HXFA 2QYIA 2JETC 5A0BA 4NZLA 3K9XB 5PTPA 3ITIA 1DS2E 1KXAA 1ARCA 2FS8A 1IQEA 1SGYE 3N7OA 1T8OA 1LQDB 1HAVB 1NFUA 1QB9A 1EP5A 1Q2WA 2FODA 1LKBA 3R3GB 4BAOB 1ZGVA 2QC2A 4VGCC 1SGTA 1ACBE 2GCTB 3T25A 2AMPA 2A2QH 1AHTH 1DFPA 3RXQA 1UTJA 1QL7A 4HGCA 2H9HA 2PKAA 2ZU1A 1UTMA 4A1TA 1EZSC 3UIRA 4UDWH 4Y8ZA 1YC0A 1W8BH 4MG3A 1MU8B 1GBBA 2OD3B 3TPIZ 1O2ZA 1QBOA 5EG4A 5DGJA 3ZZ9A 1YPGH 5FBIA 3UQVA 1Z7KA 5FPTA 1THRH 4HFPB 1D6RA 4AYYB 3K65B 2HALA 1ELEE 1P3EA 4BTUB 1A0LA 2AFQB 1GG6C 1ELVA 1JBUH 3HGPA 2IJOB 3O8RA 1YLCA 3RC4A 2O8UA 3PB1E 1ELCA 3MU4A 1OSSA 1QJ1B 5CMXH 1TGTA 2ANKH 3UOUA 4B2BA 2SGQE 3FANA 4XBBA 3QDZB 1TBZH 1V2ST 2PKSB 2W7UA 4X8VH 4X2VA 1AWHB 3E8LA 2ZGXH 2FTLE 1A0JA 3TU7H 2KAIA 2WPJS 1XUIA 1C1WH 5GXPA 1PPEE 3VB6A 1FY8E 1TRYA 1BBRH 2G55A 4JMYA 1H8IH 1TB6H 2SNWA 4FVDA 4K2YA 1GBIA 2C90B 4FU8A 4CR9A 1O37A 3PTNA 5TCCA 1S5SA 1YCPH 1PPHE 1OS8A 5IYTA 1NPMA 4QT8C 1BITA 1O34A 4HI3A 2ZFTA 1AZ8A 4NIVA 1HUTH 1TQ7B 1G30B 1VR1H 1V2WT 4X6PA 2HPQH 5A0CA 1C5MD 4D9QA 4KELA 1J16A 5EXMA 1MKXH 1IQGA 5BRRE 1SQOA 2ZZUH 3DFLA 3PYHA 1SGFG 5EODA 1OP2A 1A0HB 2OBQA 1BJUA 2CV3A 1P2QA 3ATIA 1O35A 3UWIA 4XBCA 1Y3XA 1MZDA 1ELAA 1K1NA 3M5MA 1TOMH 1HFDA 1D3TB 1RS0A 1HYLA 2GKVE 2TGAA 3AAUA 1NRNH 4DJZB 2OQUA 1YPJH 3M3SA 1O2GH 4O3TA 4CRFA 2C8XB 4H42U 1SLVB 2HRVA 2FTMA 4ISHH 1O2OA 6GCHG 3GYMA 4WVPE 3QTOH 4Y10E 4B71A 1C1UH 5E8EH 4X2XA 3OTJE 1C1NA 2XWAA 3PMAB 2XRCA 3PWBA 3GDSA 1QB1A 4X2WA 1SPJA 3BTWE 2P59A 1N6YA 1YP9A 2G52A 1QRZA 2VIDA 4M7GA 1BT7A 3R0FA 5EPYA 1DPOA 1O3FA 4FUIA 1GCTC 2RDLA 2Z9JA 2BD3A 2STBE 4X1RU 3BTKE 5AVDA 2ZDNA 1CGHA 4DCDA 1LHFH 2WYJA 2O8MA 4A7IB 3MFJA 4DY7B 3URCA 4ABBA 2ZHQH 1HDTH 3A83A 1LPKB 4JZFH 3BTGE 1ZZZA 3P70B 1ANEA 1TMTH 1NFYA 4BAQB 4YESB 1NRQH 1C5UA 1C2EA 2C93B 2ZO3H 1SC8U 1C4Y2 5GDSH 1MTSA 2W3IA 3MYWA 1P0SH 4SGBE 2A31A 1TBQH 1UCYK 2R9PA 2QGRA 2EI7A 1DANH 1AFQB 1P2MA 1UVUH 1Y3WA 4HZHA 1VCPA 1HXEH 3SNCA 1BTPA 2F9UA 2JKHA 5DK1A 3D23A 3SQEE 1YPMH 1IQFA 3KNXA 1KXFA 4Y8YA 1EASA 4HTCH 5J4QA 2TBSA 1EPTA 1NU9A 5A8XA 4X8SH 2Z9GA 2A7JA 3MNCA 5C2ZA 3BTDE 2JETB 4XE4A 2IPHA 2NWNA 3L3TA 1C5RA 2BM2A 4CHAC 1C5NH 4NA7A 4KKDA 4ZKSU 2ZU3A 2B0FA 2FOHA 1SOZA 3DFJA 3PLKA 4X0WU 5CE1A 3KQDA 1KSNA 2D26C 2W3KA 4DT7B 1EP6A 2SGFE 4VGCB 1C5OH 2GT8A 2J34A 3RMLH 2FYQA 1O2YA 3MO6A 1YYY1 1SGNE 1YPKH 1GMHF 2CN0H 3RXJA 3ZZ4A 4OGYA 1G9IE 2EI6A 2BMGB 2Y7XA 1S85A 2GT7A 1MTNB 2PUXB 2HLCA 4INHA 4BTTB 2QIQA 1KIGH 4MPUA 4THNH 1BUIA 1C2IA 1BTYA 1YLDA 1ANDA 3O8BA 4OGXA 5F8XA 2QXGA 3RLWH 3SBKA 2BDYA 4I8HA 2WUBA 1SHYA 3U1IB 1XUKA 1BA8B 1EAUA 4Q80A 3GCTG 1K1MA 4YT6H 2BD5A 2BB4A 1HPGA 1C2FA 5GCHG 1O2XA 4E05H 1XXDA 5IDKA 2A45B 2ZDMA 1WU1A 3NK8A 1GG6B 2QA9E 3TLOA 4E7RG 1TA6A 2QN5T 3LGYA 3M35A 1Y5BT 1GJ4H 2VJ1A 3FP7E 2AYWA 3MU1A 1BMMH 2C4FH 4Z6AH 2BY9X 1AUJA 1ELDE 2HOBA 4KGAA 1P8VC 2FP7B 4FUCA 4XOJA 4NIWA 1KLIH 3Q3YA 1PPFE 2Z7FE 4GLYA 5EPNA 1O2RA 1RFNA 2GP9B 4J1YA 3RC5A 2FOBA 3SGAE 3T28A 1MCTA 3IWMA 2F91A 1CBWC 3W94A 1K1JA 3SJ9A 4NIYA 3ZVGA 1O2SA 2F9VA 3UTUH 1Y5UT 3BTQE 1ZTJA 1IQJA 2FYRA 2R3YA 3GY6A 2ZFSA 1ABJH 1Z6EA 4GCHF 1BB0B 1SGQE 4X1PU 2ZNKH 4YZUA 1ZHRA 3ENSB 1O3EA 1FDPA 1OX1A 1SLXB 2B9LA 2QF3A 3K6YA 1Y5AT 3T5FH 2ZQ1A 2G8TA 3I29A 2BLWA 4NWKA 1TNKA 1GI3A 1BMLA 1C1RA 2FOFA 1ETRH 5DO4H 5JYIA 2FOGA 5JB9S 1NC6A 2ZGBH 1K21H 1QL9A 2AERH 4RSPA 1QCPA 2FI4E 3M7TA 3U8TH 1MKWK 1EATA 1XX9A 2ANYA 3QTVH 2THFB 5JBAS 4AFQA 3CS7A 1Y59T 2QAAA 3MU8A 1F92A 3QZRA 1FLEE 1KYNA 1HCGA 1S83A 1O3HA 1T31A 2LPRA 1A5IA 2J2UA 1BBRK 2ZG0H 2ZC9H 4WMDA 4ZUHA 3RXGA 4Q7XA 1V6DA 4CRAA 2ZGCA 2Z3CA 8GCHF 1CVWH 2BVRH 1TPAE 1GMDF 1YCPK 1P2JA 2NU4E 1L4ZA 5LPRA 4SGAE 1O2KA 3NZIA 3K2UA 1SL3A 2WPMS 3OYPA 2CJIA 4MVNA 3ZZDA 2FZZA 1W2KH 4I32A 2XWBI 4WXVA 1GCTB 2P95A 1Z8GA 4NGAH 1DOJA 3RC6A 4DOQA 1V2VT 3BTHE 4LK4A 4BAKB 1MKXK 3M5NA 1NY22 3GY3A 5E2OA 1PPCE 1CE5A 1C2JA 2ZA5A 3RXVA 2Z9LA 4AFSA 3NKKA 3HKIB 4BXSA 3BEUA 1EUFA 3UPEA 1OWHA 1A3EH 4K3JA 1LPGB 3AW1A 2G00A 1YBWA 1MQ5A 1RTFB 4DIHH 3LH1A 1O3IA 4Y0YE 1LVOA 3RP2A 1DX5M 1AQ7A 1YF4A 1GBTA 2F9NA 1BRUP 1D9IA 3SV2H 2GZ9A 2XCFA 2XNIA 4FU7A 1O30A 2D1JA 1T8MA 1IAUA 1UHBA 1SGDE 1C5QA 1IQKA 3BEIB 4A92A 2NU2E
chains in the Genus database with same CATH superfamily
2F83A 2Z94A 2ZDKA 3MO9A 3P8FA 5G4BA 2V3HH 2P94A 5C5OA 3DSPA 5ETXA 2BD4A 4Q4LA 2BD8A 2XBVA 1O5EH 1EXFA 3HK6B 1GVLA 3RXLA 3S7HB 1C9PA 1GI2A 1GL1A 1O2PA 4ABGA 4E7NA 1N6XA 2FXRA 5DP7A 1J17T 4JYUH 1DT2A 1C5PA 2OTVA 1TGSZ 1BCUH 1NS3A 4ACBA 2ZWLH 2V3OH 4ZKRU 1J14A 1C2KA 1RXPA 1SG8B 2QV1A 1FN8A 3U8OH 1QY6A 1IHTH 1KXBA 3ZV8A 2Y6TA 1S82A 5JB8S 4B6FA 4A5TS 1BTZA 1MCVA 1ZOMA 1CA0C 2W6ID 1XKBC 3V0XA 1VITG 5DP6A 2NU3E 4YLUA 1K9OE 3ZZ7A 1O32A 1W12U 6ESTA 1J9CH 3SV7A 2C8WB 1TGBA 2BY8X 3C1KA 1GWAA 2WV5A 1V2PT 1B5GH 3GYLB 5HGGA 1LPZB 1OKXA 3TVJB 4ABIA 3BN9A 5FPSA 2QXHA 3GCOA 4JZDH 1TX7A 2J94A 1PJPA 1P2OA 2ZQ2A 2KCPA 1JRTA 2SGEE 2OCVB 2ODYB 4JZEH 1P01A 2ZTZA 1CO7E 5EW1H 4WY3A 1EB1H 2Y81A 3SNDA 2EQNA 3BTTE 1TGCA 2Y82A 1H9LB 4JK5A 1JIRA 3PTBA 1QURH 3P8GA 1NN6A 4TT3D 2H5CA 2HNTF 1BRCE 2QXIA 1AI8H 1E35B 3NCLA 2W26A 1YGCH 4X8UH 4UONA 8LPRA 2FESH 1V2RT 5T6DA 3SGQE 2DUCA 1LDTT 1CBWB 1UTKA 1D3QB 1V2TT 3VGCC 1SBWA 2Y80A 1EJMA 2C8YB 3ATLA 2WV4A 2H2ZA 3DA9B 1JWTA 2A7CA 2A4QA 1ELBA 2GZ7A 1SFIA 4AFUA 3QGJA 1BRBE 1DWDH 3BIUH 5ABWA 1GGDC 2Y7ZA 2PUQH 5CHAC 1AZZA 1C4U2 3F2GA 1HB0B 3QLPH 2Y5HA 1TRMA 1ORFA 1ZR0A 1OPHB 1B0EA 1O5GH 1FJSA 2VH6A 1DXWA 4JYTA 1S6HA 1O3NA 4D8NA 5C5NA 2R3UA 2Z9IA 3JZ1B 4CR5A 3RXIA 1F2SE 3N7EA 3N7DA 3SHCH 4BNRA 4XDEA 1TMBH 2GDDA 3TJUA 5FAHA 3EE0B 1MAYA 1E37B 3SNAA 5L30H 3BV9B 1UVPA 5DP9A 4YOJA 1QL8A 1ZYOA 2KZ4A 1W7XH 3KQBA 3RXDA 1V2KT 3D65E 2SGPE 4I8KA 3U1JB 4GHQA 1QA7A 3FAOA 2TIOA 1HAOH 2GV6A 2A4GA 1CHOF 1FN6A 1PPBH 2Q6GA 3H5CB 2OBOA 1YLNA 2VWNA 1WQVH 1MTNC 2OXSA 2BY5X 5EOKA 5DG6A 5CDFE 1VGCC 1GBKA 3SNBA 4I8LA 2GJGA 1O5DH 1CQQA 4FUGA 2H1UA 1WAYB 1WUNH 2HNTC 2PFEA 3P8NA 2VB0A 4AB9A 1O2TA 1J8AA 1V2MT 3HKJB 3U98H 1TPOA 5JPMH 4B6EA 3WW7A 2FEQH 3F6UH 4BAHB 1Z8RA 1QJ6B 1N8OC 3A87A 1C5ZB 3SUDA 3KCGH 3RXTA 1WCZA 2V35A 3EA8A 1PQ7A 5FXLA 1S0RA 1WSSH 2GTBA 2L6OA 1FZZA 1H1BA 1X7AC 2JH5D 1NROH 1DLKB 1C5LH 4FUJA 1SQTA 4JYVH 5T6GA 3BEFB 1MZAA 3A8CA 2P93A 4NWLA 5L2YH 1FQ3A 2ZHWH 1V3XA 2G4UA 3SU6A 1C2DA 2FM2A 2ILNA 7GCHF 5DKMA 3MNBA 3RDZA 1W0YH 1IQIA 1CT4E 1FX0B 4A1XA 1GI5A 2O8LA 1Y8TA 2PLXA 3RXPA 3CS0A 7KMEH 1TE0A 3E3TA 3GY7A 1NO9H 4IS5A 1P04A 4NA8A 1HAIH 1EAXA 1XKAC 1GCDA 3A8AA 1C1MA 1EAIA 1V2OT 1C1VH 1GHBF 3FVFB 1B7XB 1RTLA 1LHEH 1C4V2 4TWWA 1B0FA 1O2LA 3TJNA 4FVBA 4WF8A 1BDAA 4I31A 3LGVA 1GI6A 1LQEA 4KTUA 1DXPA 3E91A 4UFGH 1CA0B 3LONA 2FI3E 2R0LA 3Q3KA 2F3CE 3BIVH 2RA0A 4FUHA 1AVWA 2XC4A 1P09A 1A61H 2YOLA 1PYTC 3U9AH 3UR9A 2H9EH 2BDGA 2GGVB 2G51A 1O3PB 4DVAU 2JDID 3PRBA 4O03A 3URDA 3U8RH 1DSUA 3A89A 2XTTB 1HBTH 3OY6U 3BF6H 1BQYA 3PMBB 1NFWA 3TK9A 4WXIA 1YPHC 1A2CH 1ZMJA 1DLEA 4ISNA 3UR6A 3H7OA 1QHRB 1YM0A 1L0ZA 1C2MA 3QGNB 5E0GA 4NZQA 1VZQH 1RGQA 2JH6D 1A4WH 2STAE 4X6OA 1V2QT 1L2EA 5FCRA 2ZCKP 3WY8A 2CHAC 3FFGA 1CHGA 1GHYH 3VXEH 2ZCHP 1PQ8A 1TRNA 2CMYA 4GSOA 1P02A 1GHVH 2VIQA 1BTWA 1GBCA 4A1VA 5LGOA 3ZZ3A 2ZECA 3M37A 2VWMA 2V3MA 4DW2U 1GMHG 3TJVA 3MO3A 1PPZA 4IC6A 1VCWA 1CSOE 3GCNA 5C0TA 1Y3VA 1TYNA 3VGCB 3KN2A 3SO3A 1BTUA 4OS4A 3L6PA 3A7YA 4ZXYH 2ZFPH 1TWXB 3T62A 3SU3A 3ATWA 2G5NA 2TGPZ 1LVMA 3V13A 3OEHD 3MU5A 1DWBH 1C5WB 1GGDB 1NU7B 1E0FD 5CHAB 3RXCA 1WTHD 4ABDA 2ZPQA 1O5BB 1AB9C 1XUFA 1AUTC 1GI9B 1W7GH 1BRAA 3TNTA 3UAIC 3NXPA 4DIIH 4D76A 3KEEA 3VB7A 4ZHAA 4ZAEA 1COWD 4R0IA 1PQ5A 2BY6X 3P95A 5K0HA 5GIBA 3RMMH 1LVBA 4O3UA 2J92A 3FP6E 3M61U 1P9UA 3ZZ8A 1J15A 1ESBA 1ANBA 1LTOA 2HGTH 1LHDH 3PMHB 1ZPBA 3RXMA 5C3NA 1AU8A 2EA3A 2BDHA 3LC3A 1GJ7B 3SORA 1IQHA 4OS7A 5EW2H 3VB3A 4LXBH 1KTSB 3DT0H 1BZXE 1P57B 4Y6DA 1OYTH 1SGRE 4ZKOU 3KF2A 3BTME 2B7DH 4AZ2B 3UQOA 2AH4X 1GDNA 1P10A 1QBNA 4GCHG 1PFXC 1QBVH 3QUMP 1AE5A 3BTEE 1SB1H 3M36A 1VGCB 1P11E 4ACAA 1G3CA 1O5FH 5B6OA 1QQ4A 4MQAA 2FLRH 2HVXA 3PWCA 1FY3A 4NFFA 5GWZA 1G3DA 2OC1A 1UTPA 4ABJA 4ZROA 2M5TA 1AN1E 2PGQB 3TNSA 1ESAA 2SGAA 2ZHDA 4JCNA 1ESTA 1ELGA 1N8OB 2P3FH 3DUXH 5ESBA 2BOKA 4MNXA 1A5GH 1DUAA 3RU4D 4TY7A 1CA8B 3S0NA 2FWWA 1C1SA 1Z1IA 1W3CA 1C5TA 1ARBA 4OS1A 2GMTC 2Q6FA 4ABFA 1YKTA 1RTKA 2GVFA 1EJAA 1YPEH 2RG3A 4XBDA 4AG1A 2BVXH 4D7FA 5HM9A 3ZVBA 8GCHG 1F5LA 1TALA 2LP6A 4U01A 1GMDG 2PWXA 1HAPH 3SZNA 1KTTB 3GY2A 4ABEA 1V2JT 3Q77A 3CP7A 3UUZA 3VFEA 2YMSC 1SLWB 3TK6A 3MNXA 6LPRA 1DITH 3RU4E 5AF9H 3FZDA 4O97A 2FOEA 3A7WA 4X1QU 3MHWU 1P12E 3PV4A 2F9PA 1DUEA 1P3CA 1A1RA 1TNIA 4AOQA 1EOLA 1O2IA 1QRXA 3M5OA 1KDQB 4H4FA 2FX4A 1C5SA 3ZYEA 4K1SA 4TY6A 2EI8A 3EA9A 4IGDA 2WSSD 2OK5A 1XMNB 2Z6BD 3O8CA 1ZSJA 4KTSA 4I8JA 1LVYA 3G01A 1YCPM 1GHAF 4KTCA 2BLOA 4ISOA 1MD8A 4MLFB 4FETA 1UCYE 1ZGIA 2F9OA 1TLDA 4I7YH 3BG4C 3ZVEA 3E0PB 1QB6A 1SGFA 2TGTA 3KGPA 2G81E 1L4DA 2BXUH 1GBAA 1MBMA 2PGBB 1WTGH 2ZCLP 3K6ZA 3W95A 4FUEA 4UE7H 2IOTA 4U32A 2XW9A 6CHAC 1FIWA 1QNJA 2Q6DA 3GOVB 4UFFH 3EA7A 2CHAB 1MD7A 1JMOH 2ZEBA 4NA9H 2AS9A 2WPKS 4Y7BA 1ZMLA 1K1PA 2BX3A 3RM0H 1UJ1A 2V0BA 3MI4A 3NUMA 3FZZA 1XVMA 3KQ5A 5EQQA 1L1JA 3PMJA 2QF5A 7ESTE 3M7QA 2WV9A 3UWJH 1LO6A 1C1TA 5DPAA 1UTOA 2PSXA 2AIPA 1O39A 1SMFE 4CRBA 3DCLA 2BOHB 3TIUA 4FU9A 3OE7D 5C17A 1E34B 3A81A 3LGIA 1F0SA 1WOFA 4Q7ZA 2XBWA 2AMQA 5EQRA 5AHGH 4GHTA 1GVZA 2QXJA 4A6LA 1Z6JH 1H9HE 1GHXH 4XSKU 3Q00A 3RMNH 4CH2B 1YY3A 2FPZA 3A7XA 5TJXA 1HGTH 2J98B 1C2HA 2GCHF 3HATH 2M2AA 2YNBA 3SU4A 1H8DH 3UFAA 1EAWA 4WMFA 3EDXB 1AB9B 2PV9B 2R0KA 1P2KA 3KHVA 4LZ4B 2FDAA 4AFZA 2H6MA 2PR3A 3F9HA 4AX9H 5KECA 3QN7A 1GJ9B 5L2ZH 5TCAA 4Y76A 4TYDA 4Y8XA 3BSQA 1WQSA 5FX5A 4X6MA 5LH8A 2B5TB 2ZDVH 1GJCB 2W7SA 1Z8JB 2K0QA 3KYFA 1HAVA 1CGJE 4Y79A 3SU2A 1AGJA 4IMZA 4KP0A 2ALPA 1F0TA 1QA0A 4ABAA 1GJBB 3OX7U 3P92A 2HPPH 1C5XB 3A80A 1O5AB 1UVSH 4MNWA 1TONA 1AFEH 2AGGX 2ZU5A 4OS2A 1UK3A 1GBMA 1KMHB 1BTHH 5C1UA 1C9TA 2ASUB 3CENA 1E36B 1AIXH 4R8TB 1OWJA 3VPKA 2ESTE 1O3BA 3MH6A 1DSTA 2LNCA 4NIXA 1SGIB 1NESE 1EKBB 3AASA 5DJ7A 3ATKA 3SOSA 1HLTH 1QRWA 1FY5A 1THPB 1IQMA 4I8GA 3DSGA 1NTPA 3LGTA 1YPLH 2VGCC 5JDUB 1P06A 1WDIA 5DP5A 1GJ6A 2A2XH 1IQNA 2GDEH 4PROA 1SQAA 2V6NA 3GCHC 1SKYE 4MDSA 4TSFD 3F3BA 5E0JA 1UMAH 1M9UA 2I6SA 4X2YA 2ZTYA 2A4RA 4TPYA 1DWCH 1V2NT 1JXPA 1UCYH 1GBFA 1O3JA 2P3UB 3S69A 3A85A 5C67A 1ETSH 3OTPA 3WWBA 2WPHS 1L1NA 2RFKC 5JBTA 3LC5A 1T4UH 1GBLA 1SQRA 1TFXA 3LH3A 2GMTB 1SI5H 1E38B 1OWKA 1BBRE 5F8ZA 2XBXA 4X8TH 1HIAB 1GBJA 2O8WA 2BLVA 1THSH 1KY9A 1FMGA 1QZ8A 1CHOG 2AGIX 3LJOA 3SUEA 3QWCH 2BD2A 1DY8A 1XM1A 2OC7A 1FNIA 1ZJDA 4B2CA 1NRRH 4IW4E 2YMSB 3GISB 4FUFA 1MTVA 3HGNA 1ID5H 2P8OB 2TGDA 1EOJA 2AEIH 1NT1A 2QF0A 2VINA 3SU5A 1H8HD 3SJOA 2ZGHA 1OWIA 3RXAA 2OC8A 1BIOA 4X1NU 4NFEA 3SV8A 1D3PB 1VJ9U 2G4TA 1IQLA 2W5EA 3M5LA 3MTYA 1G36A 1LHGH 3PLBA 3LGWA 4K8YA 1O2NA 3WWFA 1IHSH 1D6WA 1K28D 1W13U 2ZHEH 4Z0KA 4DURA 2VVUA 1ABIH 1MH0A 1ZSKA 2J4IA 2VIVA 4AN7A 3D62A 3PV2A 3BG4B 2ZDLA 1AVXA 2BZAA 8ESTE 3I77A 2Q1JA 4INLA 2OUAA 4BTIB 2PHBA 1OP0A 2BDCA 2NU0E 7GCHG 1RIWB 4Y7AA 1DY9A 3E1XB 2A32A 1T4VH 1GDUA 4RKJB 3SV9A 1P9SA 5JBBS 3UOPA 6CHAB 4Q7YA 2OP9A 3TGIE 1GMCF 4UEHH 3IITA 1GHBG 1BHXF 2ZPRA 2ZPSA 4NG9H 8KME2 3SV6A 3Q3XA 4GVUA 3SYJA 3E0NB 3VB4A 2NU1E 5I46H 4JK6A 3TH4H 5KGOA 1S84A 1BOQA 3A88A 4FUDA 3VXFH 2AGEX 3LIWA 1NZQH 4TPIZ 2P3TB 2WINI 1C1PA 2Y5GA 1TBRH 1FONA 1ZJKA 5ESTE 2RCEA 3RXUA 4JZ1A 1AVGH 2BZ6H 2ZFFH 4YXWD 1Y3YA 3LPRA 1O2WA 1O2QA 4YOGA 2FX6A 2ODQA 3SI4H 3P6ZB 1FAXA 1TA2A 1Z71A 2AHME 3PM3A 3Q76A 3UY9A 4ZH8A 3C27B 3BTFE 2XCNA 5EXLA 1O3MA 1TPPA 4WJG2 3A7ZA 1T7CA 3EQ0H 1EB2A 1O3OA 3KL6A 4MNVA 4I33A 1O2UA 3AAVA 2J95A 3TGKE 3M3VA 2ALVA 1MKWH 2VIWA 1SLUB 4AG2A 3EYDA 3A84A 2KFWA 2ZGJA 1P2NA 1SGCA 3UB0A 5HYOA 2K8IA 5HIYA 1W11U 3AVZA 3ZIAD 1OP8A 2K1QA 1GBHA 3TH2H 1PQAA 1RD3B 3AW0A 4ISLA 1BJVA 1NFXA 4K60A 2ZDAH 5E2PA 2CF9H 5K7RA 1S81A 2RA3A 3H7TA 5F6MA 3OEED 4RKOB 2XYAA 4U30A 1S6LA 4RN6A 4CBNA 1HNEE 5DN6D 1XXFA 3HPTB 1FXYA 2A0QB 1OOKB 5HM2A 1QTFA 4DGJA 5J4SA 1SOTA 1ZPCA 1AE8H 5AFZH 5C20A 1W14U 1C2GA 4HG6A 4B76A 1MTWA 3RLYH 2VGCB 1AKSB 4BAMB 1O2JA 1UVTH 3T2NA 2WHXA 2XC5A 1OWEA 3PLPA 1XUJA 2D2DA 1GBDA 3GCHB 2A5KA 1Q3XA 1C5VA 5T3HA 3LGUA 1HAXB 4OM9A 1A3BH 3MH7A 2ANMH 3LJJA 3ZVFA 3NWUA 3OY5U 4O9VA 1DM4B 1CU1A 1NRPH 2BVSH 1A46H 2CXVA 1ZMNA 5A09A 1KXCA 1EPTC 1VKYA 1O5CB 4BANB 2O9QA 1A5HA 4ZMAH 5FX6A 1L1GA 2B8OH 3SU1A 2WYGA 5CHBA 1UK4A 3TJOA 3SJIA 1F0UA 3STJA 1Z1JA 4B75A 2BD9A 1TPSA 1ETTH 3RM2H 1O38A 4IBLH 1O36A 4Y0ZE 1C1OA 2BDIA 2PTCE 3F0PA 1JRSA 1OWDA 2ULLA 3SHAH 3ZZBA 1KLTA 1AD8H 1ZRKA 3H09A 4K1EA 2J5UA 2PKAB 1CT0E 2AIQA 1W10U 1FPCH 1ANCA 1KDQA 3RXFA 1G3BA 1O2HA 2VVVA 5EGMA 4YOIA 2A4OA 3FN8A 3EAJA 3S7KB 3KIDU 1RJXB 1UVOA 1UK2A 1FIZA 3M7UA 1U6QA 5AFYH 1Z8IB 3D49H 1DDJA 1G2LA 3SI3H 3KQCA 3F1SB 1VCQA 1Y3UA 2ZU2A 4ABHA 1WXRA 4D9RA 1FPHH 3DHKH 2G5VA 2CF8H 3PO1C 3RXRA 2WUCA 1K22H 2GV7A 2SNVA 3SGBE 1TOCB 2J38A 3B8JA 2YNAA 2JIZD 2KAIB 4MPWA 1GI1A 3E6PH 1LCYA 2HWLB 5LPFA 3UNSA 1INCA 3S9AA 2IPQX 1TNLA 2FOAA 4FXGH 1O0DH 2BLQA 3IG6B 6GCHF 1SVPA 1TGNA 1UTQA 2R2MB 5C1YA 3PROA 2VNTA 4WMEA 2D8WA 1ZHMA 2A5AA 1QR3E 2KCOA 1E1RD 2Z3EA 2J9NA 4GUXA 3NRLA 2A7HA 1O2MA 3A86A 1C5YB 1MBQA 1XUHA 1F7ZA 3ZZ6A 3ZVDA 1ZSLA 1QJ7B 5A2MH 2EC9H 2O8TA 4IN1A 1O3CA 2PTNA 1NRSH 3P17H 5T6FA 2IN2A 5FBEA 1EFRD 2ZHFH 1UTNA 3A82A 4ISIH 1MMJN 1GHAG 1HJ8A 1ELTA 1S6FA 3LT3A 4CRDA 1T32A 3F9EA 3UNRA 2UWPA 3OAAD 5C1XA 1GJ8B 4CRCA 5FPYA 1GI7B 4WH6A 3F9GA 4UFDH 5DP4A 2PSYA 1H9IE 1V2LT 2UUKB 1D3DB 3MH4A 2VWLA 1E79D 3RUOA 2VVCA 3RU4T 1N1LA 2GX4A 1SHHB 1KXDA 3RXBA 1SSXA 1W0ZU 2A1DB 2FLBH 1TNJA 4D7GA 4GAWA 3SQHE 3T29A 2OINA 1K1OA 5DP3A 1CT2E 1O31A 1TABE 1DWEH 3SNEA 1EZUC 3A7TA 3N99A 1K2I1 2BDBA 2H9TH 1K0HA 1EX3A 5EXNA 3V3MA 3RXKA 4CBOA 2ZP0H 2P8OC 4MNYA 2SGDE 3OSYA 1WBGB 1OYQA 1TX8A 2VH0A 1HAYB 3A8DA 2ZF0H 3HK3B 1ZRBA 2VIPA 3PRDA 3A7VA 3NPSA 1GL0E 3TITA 2BX4A 4NCYA 4ZHMU 3GY5A 1BMNH 2JH0D 1FY4A 1FAKH 1UW7A 2BYAX 9ESTA 3ATMA 1WYKA 2SFAA 3QX5H 4H6SB 1K1IA 2ZIQH 4JZIA 1BHXB 4F4OC 4XFQA 1QQUA 1DICA 3L33A 4Y11E 3TH3H 2HNTE 1GBEA 2GCHG 1HJAC 2VU8E 3LKWA 3DD2H 3T26A 2KCYA 1NM6A 3GCTF 2CGAA 5EJ1A 1S0QA 1O3LA 4NSVA 1ZHPA 1RIWC 5GCHF 4X1SU 4ZXXH 4AB8A 4CH8B 2BQ6B 1A7SA 1MQ6A 1GI4A 4CRGA 2UUJB 2UUFB 1O3AA 3EGKH 2KCAA 7LPRA 2FI5E 2XXLA 2TPIZ 4FOUC 5HKKD 1G32B 1T8LA 3TK5A 1EPTB 4INKA 4BOHA 4UD9H 3RXHA 3S9BA 3GY8A 2WPIS 2WPDD 2GD4B 3SJ8A 2C8ZB 1UTLM 1HIAA 1GVKB 4IC5A 5A0AE 3MOCA 1FY1A 4H6TA 2AMDA 1H4WA 2GCTC 3MU0A 3ODFA 4ASHA 3VEQB 3ZZCA 1HAGE 1F5RA 2ZU4A 5C94A 4X6NA 3MNSA 2Y5FA 3A8BA 5JBCS 2I6QA 4WWYA 2VIOA 4B1TA 1PYTD 1ZPZA 3KYGA 5SGAE 1XVOA 5GJ4B 2OQ5A 1PPGE 3ELAH 5HMAA 1BTXA 1BMAA 1HJ9A 2FMJA 3MH5A 2ZFQH 4U2WA 2DE9A 1G3EA 4BXWA 2Z9KA 2WPLS 1QGFA 1H8ED 4RT1A 1GJDB 2OC0A 3GY4A 2ANWA 3VG8A 1O2VA 5GPIB 1GJ5H 2EEKA 2UUYA 2EY4C 3B23B 2BQWB 4WH8A 1GI0A 1LKAA 4GPGA 4I86A 1QIXB 2PKSC 3JZ2B 4Y71A 5EQSA 2BDAA 1MU6B 1O3GA 3PO1B 2Z3DA 4YLQH 4YTAA 2ZTXA 1HXFH 1W0KD 4AYVB 2FS9A 2XBYA 1UO6A 1YPHE 4K69A 1MABB 2FOMB 2UWLA 3ZZAA 1SR5C 1P05A 4AGKA 3ZVAA 4YO9A 2QY0B 3SUGA 1ZTLA 1EZXC 2QE7D 2PW8H 1EZQA 2ZFRH 2ODPA 5FCKA 5LPEA 3RXSA 3U69H 4FUBA 3LDXH 2IJD1 4CREA 3I78A 1K1LA 3ZVCA 2A5IA 3E16B 1TNGA 1C2LA 2R2WU 1XUGA 1O33A 4CHAB 9LPRA 3GICB 1AMHA 4TWYA 2F4LA 5F03A 5T1VA 1TIOA 2FO9A 3GDVA 1NBMD 1T8NA 1QFKH 1TX6A 1VJAU 1HAZB 1F0RA 3P8OA 1TMUH 2LELA 5L6NH 2TRMA 3UNQA 4B73A 4YT7H 3ODDA 3SUFA 1LHCH 4YM9A 1AWFH 1F5KU 5A8ZA 4B2AA 4UFEH 3BG8A 2ZKSA 4ZHLU 3W1EA 3MMGA 1JOUB 1OXGA 1E1QD 2C3SA 3B9FH 2OLGA 3GDUA 2BTCE 1SGPE 3STIA 4K1TA 4F49A 1TAWA 5H4IB 5A8YA 4ESTE 3T27A 3E90B 3QO6A 3SJKA 1NBME 2FIRH 4IN2A 3ZV9A 4DT4A 2BHGA 4LZ1H 1IOEA 1DE7H 3LU9B 3MWIU 5F8TA 3O8DA 4LOYH 1HV7A 1VITH 2GZ8A 3SU0A 5I25A 1EJNA 1HAHH 3V7TA 3QZQA 1LMWB 1GMCG 1OHHD 5EJLA 4IMQA 3SW2B 3F68H 2P16A 1TQ0B 1G37A 5BPEA 3TGJE 2ZI2H 3ZZ5A 1SGEE 5EU8A 1SFQB 5DP8A 5FHTA 4K8BA 1FUJA 1G2MA 4Q2KA 5E0HA 4B74A 1V2UT 3F2FA 3F9FA 1TNHA 2DE8A 1FI8A 3ESTA 3M3TA 4XD7D 2KM0A 1O3KA 1JIMA 2BY7X 3RXOA 3KQEA 3ZYDA 4K5ZA 1MAXA 1WV7H 1KXEA 1AO5A 1O3DA 4ZKNU 4MPVA 3U28C 1CGIE 1HRTH 4DG4A 5EIYA 1C1QA 1VITF 3UREA 4J2YB 1FV9A 1RRKA 1ZTKA 3QK1A 1GHZA 3SN8A 4OS6A 1GJAB 4OS5A 2QCYA 1AKSA 3RXEA 1BMFD 2BQ7B 3FP8E 1GHWH 1MTUA 1GI8B 1P2IA 2BXTH 1HJAB 4MPXA 4AORA 1AFQC 2L74A 5DSFA 1EQ9A 3RMOH 3LOXA 3V12A 1Q31A 2BD7A 1MUEB 2VWOA 3OU0A 2H5DA 2F9BH 1ELFA 1ZLRA 2XC0A 4MTBA 1UHBB 3VB5A 4P02A 1DVAH 4AGJA 2UWOA 1AY6H 1KLJH 3GS9A 1P03A 3S9CA 4E06H 1D4PB 1GDQA 1GPZA 2FOCA 4NSYA 5HXFA 2YMSD 2QYIA 2JETC 5A0BA 4NZLA 3K9XB 5PTPA 3ITIA 1DS2E 1KXAA 1ARCA 2FS8A 1IQEA 1SGYE 3N7OA 1T8OA 1LQDB 1HAVB 1NFUA 1QB9A 1EP5A 1Q2WA 2FODA 1LKBA 3R3GB 4BAOB 1ZGVA 2QC2A 4VGCC 1SGTA 1ACBE 2GCTB 3FOAA 3T25A 5FL7D 2AMPA 2A2QH 1AHTH 1DFPA 3RXQA 1UTJA 1QL7A 4HGCA 2H9HA 2PKAA 2ZU1A 1UTMA 4A1TA 1EZSC 3UIRA 4UDWH 4Y8ZA 1YC0A 1W8BH 4MG3A 1MU8B 1GBBA 2OD3B 3TPIZ 1O2ZA 1QBOA 5EG4A 5DGJA 3ZZ9A 1YPGH 3EE7A 5FBIA 3UQVA 5EJZA 1Z7KA 5FPTA 1THRH 4HFPB 1D6RA 4AYYB 3K65B 2HALA 1ELEE 1P3EA 4BTUB 1A0LA 2AFQB 1GG6C 1ELVA 1JBUH 3HGPA 2IJOB 3O8RA 1YLCA 3RC4A 2O8UA 3PB1E 1ELCA 3MU4A 1OSSA 1QJ1B 5CMXH 1TGTA 2ANKH 3UOUA 4B2BA 2SGQE 3FANA 4XBBA 3QDZB 1TBZH 1V2ST 2PKSB 2W7UA 4X8VH 4X2VA 1AWHB 3E8LA 2ZGXH 2FTLE 1A0JA 3TU7H 2KAIA 2WPJS 4ZCNA 2KR7A 1XUIA 1C1WH 5GXPA 1PPEE 3VB6A 1FY8E 1TRYA 1BBRH 2G55A 2J97A 1H8IH 1TB6H 2SNWA 4FVDA 4JMYA 4K2YA 1GBIA 2C90B 4FU8A 4CR9A 1O37A 3PTNA 5TCCA 1S5SA 1YCPH 1PPHE 1OS8A 5IYTA 1NPMA 4Q63A 1BITA 1O34A 4QT8C 4HI3A 2ZFTA 1AZ8A 4NIVA 1HUTH 1TQ7B 1G30B 1VR1H 1V2WT 4X6PA 2HPQH 2KX4A 2V7QD 5A0CA 2JJ1D 1C5MD 4D9QA 4KELA 1J16A 5EXMA 1MKXH 1IQGA 5BRRE 1SQOA 2ZZUH 3DFLA 3PYHA 4M9FA 1SGFG 5EODA 1OP2A 2JJ2D 1A0HB 2OBQA 1BJUA 2CV3A 1P2QA 3ATIA 1O35A 3UWIA 4XBCA 1Y3XA 2HVYB 2CK3D 1MZDA 1ELAA 4RI0A 1K1NA 3M5MA 3OFND 1TOMH 1HFDA 1D3TB 1RS0A 1HYLA 2GKVE 2TGAA 3AAUA 1NRNH 4DJZB 2OQUA 1YPJH 3M3SA 1O2GH 4O3TA 4CRFA 2C8XB 4H42U 1SLVB 2HRVA 2FTMA 4ISHH 1O2OA 3AK5A 6GCHG 3GYMA 4WVPE 2QF4A 3QTOH 4Y10E 2WZQA 4B71A 1C1UH 5E8EH 4X2XA 3OTJE 1C1NA 2XWAA 3PMAB 2XRCA 3PWBA 4P00A 3GDSA 1QB1A 4X2WA 1SPJA 3BTWE 2VBCA 2P59A 1N6YA 3F0OA 1YP9A 2G52A 1QRZA 2VIDA 4M7GA 1BT7A 3R0FA 5EPYA 1DPOA 1O3FA 4FUIA 1GCTC 2RDLA 2Z9JA 3PV5A 2BD3A 2STBE 3FO8D 4X1RU 3BTKE 5AVDA 2ZDNA 1CGHA 4DCDA 1LHFH 2WYJA 2O8MA 4A7IB 3MFJA 4DY7B 3URCA 4ABBA 2ZHQH 1HDTH 3A83A 1LPKB 4JZFH 3BTGE 1ZZZA 3P70B 1ANEA 1TMTH 1NFYA 4BAQB 4YESB 1NRQH 3DSOA 1C5UA 1C2EA 2C93B 2ZO3H 1SC8U 1C4Y2 5GDSH 1MTSA 2W3IA 3MYWA 1P0SH 4SGBE 2A31A 1TBQH 1UCYK 2R9PA 2QGRA 2EI7A 1DANH 1AFQB 1P2MA 1UVUH 1Y3WA 4HZHA 1VCPA 1HXEH 5F53A 1BTPA 3SNCA 2F9UA 3SZEA 2JKHA 5DK1A 3D23A 3SQEE 1YPMH 1IQFA 3KNXA 1KXFA 4Y8YA 1EASA 4HTCH 5C0UA 5KEDA 5J4QA 2TBSA 1EPTA 1NU9A 5A8XA 4X8SH 2Z9GA 2A7JA 3MNCA 5C2ZA 3BTDE 2JETB 4XE4A 2IPHA 2NWNA 3L3TA 1C5RA 2BM2A 4CHAC 1C5NH 4NA7A 4KKDA 4ZKSU 2ZU3A 2B0FA 2FOHA 1SOZA 3DFJA 3PLKA 4X0WU 5CE1A 3KQDA 1KSNA 2D26C 2W3KA 4DT7B 1EP6A 2SGFE 4VGCB 1C5OH 2GT8A 2J34A 5GNDA 3RMLH 2FYQA 1O2YA 3MQKC 3MO6A 1YYY1 1SGNE 1YPKH 1GMHF 2CN0H 3RXJA 2XNDD 3ZZ4A 4OGYA 1G9IE 2EI6A 2BMGB 2Y7XA 1S85A 2GT7A 1MTNB 2PUXB 2HLCA 4INHA 4XRNA 4BTTB 2QIQA 1KIGH 4MPUA 4THNH 1BUIA 1C2IA 1BTYA 1YLDA 1ANDA 2J98A 3O8BA 4OGXA 5F8XA 2QXGA 3RLWH 3SBKA 2BDYA 4I8HA 2WUBA 1SHYA 3U1IB 1XUKA 1BA8B 1EAUA 4Q80A 3GCTG 1K1MA 4YT6H 2BD5A 2RDEA 2BB4A 1HPGA 1C2FA 5GCHG 1O2XA 4E05H 1XXDA 5IDKA 2A45B 2ZDMA 1WU1A 3NK8A 1GG6B 2QA9E 3TLOA 4E7RG 1TA6A 2QN5T 3LGYA 3M35A 1Y5BT 1GJ4H 2VJ1A 3FP7E 2AYWA 3MU1A 1BMMH 2C4FH 4Z6AH 2BY9X 1AUJA 1ELDE 2HOBA 4KGAA 1P8VC 2FP7B 4FUCA 4XOJA 4NIWA 1KLIH 3Q3YA 1PPFE 2Z7FE 4GLYA 5EPNA 1YWUA 1O2RA 5HIZA 1RFNA 2GP9B 4J1YA 3RC5A 2FOBA 3SGAE 3T28A 1MCTA 3IWMA 2F91A 1CBWC 3W94A 1W0JD 1K1JA 3SJ9A 4NIYA 3ZVGA 1O2SA 2F9VA 3UTUH 4Z1MD 1Y5UT 3BTQE 1ZTJA 1IQJA 2FYRA 2R3YA 3GY6A 2ZFSA 1ABJH 1Z6EA 4F48B 4GCHF 1BB0B 1SGQE 4X1PU 2ZNKH 3FKSD 4YZUA 1ZHRA 3ENSB 1O3EA 1FDPA 1OX1A 4F55A 1SLXB 2B9LA 2QF3A 3K6YA 3F2HA 1Y5AT 3T5FH 2ZQ1A 2G8TA 3I29A 2BLWA 4NWKA 1TNKA 1GI3A 1BMLA 1C1RA 2FOFA 1ETRH 5DO4H 5JYIA 2HLDD 2FOGA 5JB9S 1NC6A 2ZGBH 1K21H 1QL9A 2AERH 4RSPA 1QCPA 2FI4E 3M7TA 3U8TH 2W6JD 1MKWK 1EATA 1XX9A 2ANYA 3QTVH 2THFB 5JBAS 4AFQA 3CS7A 1Y59T 2QAAA 3MU8A 1F92A 3QZRA 1FLEE 1KYNA 1HCGA 1S83A 1O3HA 1T31A 2LPRA 1A5IA 2J2UA 1BBRK 2ZG0H 2ZC9H 4WMDA 4ZUHA 3RXGA 4Q7XA 1V6DA 2PP6A 4CRAA 2ZGCA 2Z3CA 4AC9A 8GCHF 1CVWH 2BVRH 1TPAE 1GMDF 1YCPK 1P2JA 2NU4E 1L4ZA 5LPRA 4SGAE 1O2KA 3NZIA 3K2UA 1SL3A 2WPMS 3OYPA 2CJIA 4MVNA 3ZZDA 2XOKD 2FZZA 1W2KH 4I32A 5B6LA 2XWBI 4WXVA 1GCTB 2P95A 1Z8GA 4NGAH 1DOJA 3RC6A 4DOQA 1V2VT 3BTHE 4LK4A 4BAKB 1MKXK 3M5NA 1NY22 3GY3A 5E2OA 1PPCE 1CE5A 1C2JA 2ZA5A 3RXVA 4RT0A 2Z9LA 4AFSA 3NKKA 3HKIB 4BXSA 2F43B 1EUFA 3BEUA 3UPEA 1OWHA 1A3EH 4K3JA 4ASUD 1LPGB 3AW1A 2G00A 1YBWA 1MQ5A 1RTFB 4DIHH 3LH1A 1O3IA 4Y0YE 1LVOA 3RP2A 1DX5M 1AQ7A 3CNRA 1YF4A 1GBTA 2F9NA 1BRUP 1D9IA 3SV2H 2GZ9A 2XCFA 2XNIA 5IK2D 4FU7A 1O30A 2D1JA 1T8MA 1IAUA 1UHBA 1SGDE 1C5QA 1IQKA 3BEIB 4A92A 2NU2E
chains in the Genus database with same CATH topology
2F83A 2Z94A 2ZDKA 3MO9A 3P8FA 5G4BA 2V3HH 2P94A 5C5OA 5ETXA 2BD4A 2BD8A 2XBVA 1O5EH 1EXFA 3HK6B 1GVLA 3RXLA 3S7HB 1C9PA 1GI2A 1GL1A 1O2PA 4ABGA 4E7NA 1N6XA 2FXRA 5DP7A 1J17T 4JYUH 1DT2A 1C5PA 2OTVA 1TGSZ 1BCUH 1NS3A 2ZWLH 2V3OH 4ZKRU 1J14A 1C2KA 1RXPA 1SG8B 2QV1A 1FN8A 3U8OH 1QY6A 1IHTH 1KXBA 3ZV8A 2Y6TA 1S82A 5JB8S 4A5TS 1BTZA 1MCVA 1ZOMA 1CA0C 1XKBC 3V0XA 1VITG 5DP6A 2NU3E 4YLUA 1K9OE 3ZZ7A 1O32A 1W12U 6ESTA 1J9CH 3SV7A 2C8WB 1TGBA 2BY8X 3C1KA 1GWAA 2WV5A 1V2PT 1B5GH 3GYLB 5HGGA 1LPZB 1OKXA 3TVJB 4ABIA 3BN9A 5FPSA 2QXHA 3GCOA 4JZDH 1TX7A 2J94A 1PJPA 1P2OA 2ZQ2A 1JRTA 2SGEE 2OCVB 2ODYB 4JZEH 1P01A 2ZTZA 1CO7E 5EW1H 4WY3A 1EB1H 2Y81A 3SNDA 3BTTE 1TGCA 2Y82A 1H9LB 4JK5A 1JIRA 3PTBA 1QURH 3P8GA 1NN6A 2H5CA 2HNTF 1BRCE 2QXIA 1AI8H 1E35B 3NCLA 2W26A 1YGCH 4X8UH 4UONA 8LPRA 2FESH 1V2RT 5T6DA 3SGQE 2DUCA 1LDTT 1CBWB 1UTKA 1D3QB 1V2TT 3VGCC 1SBWA 2Y80A 1EJMA 2C8YB 3ATLA 2WV4A 2H2ZA 3DA9B 1JWTA 2A7CA 2A4QA 1ELBA 2GZ7A 1SFIA 4AFUA 3QGJA 1BRBE 1DWDH 3BIUH 5ABWA 1GGDC 2Y7ZA 2PUQH 5CHAC 1AZZA 1C4U2 1HB0B 3QLPH 2Y5HA 1TRMA 1ORFA 1ZR0A 1OPHB 1B0EA 1O5GH 1FJSA 2VH6A 1DXWA 4JYTA 1S6HA 1O3NA 4D8NA 5C5NA 2R3UA 2Z9IA 3JZ1B 4CR5A 3RXIA 1F2SE 3SHCH 4BNRA 4XDEA 1TMBH 2GDDA 3TJUA 5FAHA 3EE0B 1MAYA 1E37B 3SNAA 5L30H 3BV9B 1UVPA 5DP9A 4YOJA 1QL8A 1ZYOA 1W7XH 3KQBA 3RXDA 1V2KT 3D65E 2SGPE 4I8KA 3U1JB 4GHQA 1QA7A 3FAOA 2TIOA 1HAOH 2GV6A 2A4GA 1CHOF 1FN6A 1PPBH 2Q6GA 3H5CB 2OBOA 2VWNA 1WQVH 1MTNC 2OXSA 2BY5X 5EOKA 5DG6A 1VGCC 1GBKA 3SNBA 4I8LA 1O5DH 1CQQA 4FUGA 2H1UA 1WAYB 1WUNH 2HNTC 2PFEA 3P8NA 2VB0A 4AB9A 1O2TA 1J8AA 1V2MT 3HKJB 3U98H 1TPOA 5JPMH 2FEQH 3F6UH 4BAHB 1Z8RA 1QJ6B 1N8OC 3A87A 1C5ZB 3SUDA 3KCGH 3RXTA 1WCZA 2V35A 3EA8A 1PQ7A 5FXLA 1S0RA 1WSSH 2GTBA 1FZZA 1H1BA 1X7AC 2JH5D 1NROH 1DLKB 1C5LH 4FUJA 1SQTA 4JYVH 5T6GA 3BEFB 1MZAA 3A8CA 2P93A 4NWLA 5L2YH 1FQ3A 2ZHWH 1V3XA 2G4UA 3SU6A 1C2DA 2FM2A 2ILNA 7GCHF 5DKMA 3MNBA 3RDZA 1W0YH 1IQIA 1CT4E 4A1XA 2O8LA 1GI5A 1Y8TA 2PLXA 3RXPA 3CS0A 7KMEH 1TE0A 3E3TA 3GY7A 1NO9H 4IS5A 1P04A 4NA8A 1HAIH 1EAXA 1XKAC 1GCDA 3A8AA 1C1MA 1EAIA 1V2OT 1C1VH 1GHBF 3FVFB 1B7XB 1RTLA 1LHEH 1C4V2 4TWWA 1B0FA 1O2LA 3TJNA 4FVBA 4WF8A 1BDAA 4I31A 3LGVA 1GI6A 1LQEA 4KTUA 1DXPA 3E91A 4UFGH 1CA0B 3LONA 2FI3E 2R0LA 3Q3KA 2F3CE 3BIVH 2RA0A 4FUHA 1AVWA 2XC4A 1P09A 1A61H 2YOLA 1PYTC 3U9AH 3UR9A 2H9EH 2BDGA 2GGVB 2G51A 1O3PB 4DVAU 4O03A 3URDA 3U8RH 1DSUA 3A89A 2XTTB 1HBTH 3OY6U 3BF6H 1BQYA 3PMBB 1NFWA 3TK9A 4WXIA 1YPHC 1A2CH 1ZMJA 1DLEA 4ISNA 3UR6A 3H7OA 1QHRB 1YM0A 1L0ZA 1C2MA 3QGNB 5E0GA 4NZQA 1VZQH 1RGQA 2JH6D 1A4WH 2STAE 4X6OA 1V2QT 1L2EA 5FCRA 2ZCKP 3WY8A 2CHAC 3FFGA 1CHGA 1GHYH 3VXEH 2ZCHP 1PQ8A 1TRNA 2CMYA 4GSOA 1P02A 1GHVH 2VIQA 1BTWA 1GBCA 4A1VA 5LGOA 3ZZ3A 2ZECA 3M37A 2VWMA 4DW2U 1GMHG 3TJVA 3MO3A 1PPZA 4IC6A 1VCWA 1CSOE 3GCNA 1Y3VA 1TYNA 3VGCB 3KN2A 3SO3A 1BTUA 4OS4A 3L6PA 3A7YA 4ZXYH 2ZFPH 1TWXB 3T62A 3SU3A 3ATWA 2G5NA 2TGPZ 1LVMA 3V13A 3MU5A 1DWBH 1C5WB 1GGDB 1NU7B 1E0FD 5CHAB 3RXCA 1WTHD 4ABDA 2ZPQA 1O5BB 1AB9C 1XUFA 1AUTC 1GI9B 1W7GH 1BRAA 3TNTA 4DIIH 3NXPA 4D76A 3KEEA 3VB7A 4ZHAA 4ZAEA 4R0IA 1PQ5A 2BY6X 3P95A 5K0HA 5GIBA 3RMMH 1LVBA 4O3UA 2J92A 3FP6E 3M61U 1P9UA 3ZZ8A 1J15A 1ESBA 1ANBA 1LTOA 2HGTH 1LHDH 3PMHB 1ZPBA 3RXMA 5C3NA 1AU8A 2EA3A 2BDHA 3LC3A 1GJ7B 3SORA 1IQHA 4OS7A 5EW2H 3VB3A 4LXBH 1KTSB 3DT0H 1BZXE 1P57B 4Y6DA 1OYTH 1SGRE 4ZKOU 3KF2A 3BTME 2B7DH 4AZ2B 3UQOA 2AH4X 1GDNA 1P10A 1QBNA 4GCHG 1PFXC 1QBVH 3QUMP 1AE5A 3BTEE 1SB1H 3M36A 1VGCB 1P11E 1G3CA 1O5FH 5B6OA 1QQ4A 4MQAA 2FLRH 2HVXA 3PWCA 1FY3A 4NFFA 5GWZA 1G3DA 2OC1A 1UTPA 4ABJA 4ZROA 2M5TA 1AN1E 2PGQB 3TNSA 1ESAA 2SGAA 2ZHDA 4JCNA 1ESTA 1ELGA 1N8OB 2P3FH 3DUXH 5ESBA 2BOKA 4MNXA 1A5GH 1DUAA 3RU4D 4TY7A 1CA8B 3S0NA 2FWWA 1C1SA 1Z1IA 1W3CA 1C5TA 1ARBA 4OS1A 2GMTC 2Q6FA 4ABFA 1YKTA 1RTKA 2GVFA 1EJAA 1YPEH 2RG3A 4XBDA 4AG1A 2BVXH 4D7FA 5HM9A 3ZVBA 8GCHG 1F5LA 1TALA 4U01A 1GMDG 2PWXA 1HAPH 3SZNA 1KTTB 3GY2A 4ABEA 1V2JT 3Q77A 3CP7A 3UUZA 3VFEA 1SLWB 3TK6A 3MNXA 6LPRA 1DITH 3RU4E 5AF9H 3FZDA 4O97A 2FOEA 3A7WA 4X1QU 3MHWU 1P12E 3PV4A 2F9PA 1DUEA 1P3CA 1A1RA 1TNIA 4AOQA 1EOLA 1O2IA 1QRXA 3M5OA 1KDQB 4H4FA 2FX4A 1C5SA 3ZYEA 4K1SA 4TY6A 2EI8A 3EA9A 4IGDA 1XMNB 2Z6BD 3O8CA 1ZSJA 4KTSA 4I8JA 1LVYA 3G01A 1YCPM 1GHAF 4KTCA 2BLOA 4ISOA 1MD8A 4MLFB 1UCYE 1ZGIA 2F9OA 1TLDA 4I7YH 3BG4C 3ZVEA 3E0PB 1QB6A 1SGFA 2TGTA 3KGPA 2G81E 1L4DA 2BXUH 1GBAA 1MBMA 2PGBB 1WTGH 2ZCLP 3K6ZA 3W95A 4FUEA 4UE7H 2IOTA 4U32A 2XW9A 6CHAC 1FIWA 1QNJA 2Q6DA 3GOVB 4UFFH 3EA7A 2CHAB 1MD7A 1JMOH 2ZEBA 4NA9H 2AS9A 2WPKS 4Y7BA 1ZMLA 1K1PA 2BX3A 3RM0H 1UJ1A 2V0BA 3MI4A 3NUMA 3FZZA 1XVMA 5EQQA 1L1JA 3PMJA 7ESTE 3M7QA 3UWJH 1LO6A 1C1TA 5DPAA 1UTOA 2PSXA 2AIPA 1O39A 1SMFE 4CRBA 2BOHB 3TIUA 4FU9A 1E34B 3A81A 3LGIA 1F0SA 1WOFA 4Q7ZA 2XBWA 2AMQA 5EQRA 5AHGH 4GHTA 1GVZA 2QXJA 4A6LA 1Z6JH 1H9HE 1GHXH 4XSKU 3Q00A 3RMNH 4CH2B 2FPZA 3A7XA 5TJXA 1HGTH 1C2HA 2GCHF 3HATH 2YNBA 3SU4A 3UFAA 1H8DH 1EAWA 4WMFA 3EDXB 1AB9B 2PV9B 2R0KA 1P2KA 3KHVA 4LZ4B 2FDAA 4AFZA 2H6MA 2PR3A 3F9HA 4AX9H 3QN7A 1GJ9B 5L2ZH 5TCAA 4Y76A 4TYDA 4Y8XA 3BSQA 1WQSA 5FX5A 4X6MA 5LH8A 2B5TB 2ZDVH 1GJCB 2W7SA 1Z8JB 1HAVA 1CGJE 4Y79A 3SU2A 1AGJA 4IMZA 4KP0A 2ALPA 1F0TA 1QA0A 4ABAA 1GJBB 3OX7U 3P92A 2HPPH 1C5XB 3A80A 1O5AB 1UVSH 4MNWA 1TONA 1AFEH 2AGGX 2ZU5A 4OS2A 1UK3A 1GBMA 1BTHH 5C1UA 1C9TA 2ASUB 3CENA 1E36B 1AIXH 4R8TB 1OWJA 3VPKA 2ESTE 1O3BA 3MH6A 1DSTA 2LNCA 4NIXA 1SGIB 1NESE 1EKBB 3AASA 5DJ7A 3ATKA 3SOSA 1HLTH 1QRWA 1FY5A 1THPB 1IQMA 4I8GA 1NTPA 3LGTA 1YPLH 2VGCC 5JDUB 1P06A 5DP5A 1GJ6A 2A2XH 1IQNA 2GDEH 4PROA 1SQAA 2V6NA 3GCHC 4MDSA 5E0JA 1UMAH 1M9UA 2I6SA 4X2YA 2ZTYA 2A4RA 4TPYA 1DWCH 1V2NT 1JXPA 1UCYH 1GBFA 1O3JA 2P3UB 3S69A 3A85A 5C67A 1ETSH 2WPHS 1L1NA 5JBTA 3LC5A 1T4UH 1GBLA 1TFXA 3LH3A 2GMTB 1SI5H 1E38B 1OWKA 1BBRE 5F8ZA 2XBXA 4X8TH 1HIAB 1GBJA 2O8WA 2BLVA 1THSH 1KY9A 1FMGA 3LJOA 1CHOG 2AGIX 3SUEA 3QWCH 2BD2A 1DY8A 1XM1A 2OC7A 1FNIA 1ZJDA 4B2CA 1NRRH 4IW4E 3GISB 4FUFA 1MTVA 3HGNA 1ID5H 2P8OB 2TGDA 1EOJA 2AEIH 1NT1A 2QF0A 2VINA 3SU5A 3SJOA 2ZGHA 1OWIA 3RXAA 2OC8A 1BIOA 4X1NU 4NFEA 3SV8A 1D3PB 1VJ9U 2G4TA 1IQLA 2W5EA 3M5LA 3MTYA 1G36A 1LHGH 3PLBA 3LGWA 4K8YA 1O2NA 1IHSH 1D6WA 1K28D 1W13U 2ZHEH 4Z0KA 4DURA 2VVUA 1ABIH 1MH0A 1ZSKA 2J4IA 2VIVA 4AN7A 3D62A 3BG4B 2ZDLA 1AVXA 2BZAA 8ESTE 3I77A 2Q1JA 4INLA 2OUAA 4BTIB 2PHBA 1OP0A 2NU0E 2BDCA 7GCHG 1RIWB 4Y7AA 1DY9A 3E1XB 2A32A 1T4VH 1GDUA 4RKJB 3SV9A 1P9SA 5JBBS 3UOPA 6CHAB 4Q7YA 2OP9A 3TGIE 1GMCF 4UEHH 3IITA 1GHBG 1BHXF 2ZPRA 2ZPSA 4NG9H 8KME2 3SV6A 3Q3XA 4GVUA 3E0NB 3VB4A 2NU1E 5I46H 4JK6A 3TH4H 1S84A 1BOQA 3A88A 4FUDA 3VXFH 2AGEX 3LIWA 1NZQH 4TPIZ 2P3TB 2WINI 1C1PA 2Y5GA 1TBRH 1FONA 1ZJKA 5ESTE 2RCEA 3RXUA 4JZ1A 1AVGH 2BZ6H 2ZFFH 1Y3YA 3LPRA 1O2WA 1O2QA 4YOGA 2FX6A 2ODQA 3SI4H 3P6ZB 1FAXA 1TA2A 1Z71A 3PM3A 3Q76A 3UY9A 4ZH8A 3C27B 3BTFE 2XCNA 5EXLA 1O3MA 1TPPA 4WJG2 3A7ZA 1T7CA 3EQ0H 1EB2A 1O3OA 3KL6A 4MNVA 4I33A 1O2UA 3AAVA 2J95A 3TGKE 3M3VA 2ALVA 1MKWH 2VIWA 1SLUB 4AG2A 3EYDA 3A84A 2ZGJA 1P2NA 1SGCA 5HYOA 1W11U 3AVZA 1OP8A 2K1QA 1GBHA 3TH2H 1PQAA 1RD3B 3AW0A 4ISLA 1BJVA 1NFXA 4K60A 2ZDAH 5E2PA 2CF9H 5K7RA 1S81A 2RA3A 3H7TA 5F6MA 4RKOB 2XYAA 4U30A 4RN6A 4CBNA 1HNEE 1XXFA 3HPTB 1FXYA 2A0QB 1OOKB 5HM2A 1QTFA 4DGJA 5J4SA 1SOTA 1ZPCA 1AE8H 5AFZH 5C20A 1W14U 1C2GA 4B76A 1MTWA 3RLYH 2VGCB 1AKSB 4BAMB 1O2JA 1UVTH 3T2NA 2XC5A 1OWEA 3PLPA 1XUJA 2D2DA 1GBDA 3GCHB 2A5KA 1Q3XA 1C5VA 5T3HA 3LGUA 1HAXB 1A3BH 3MH7A 2ANMH 3LJJA 3ZVFA 3NWUA 3OY5U 4O9VA 1DM4B 1CU1A 1NRPH 2BVSH 1A46H 2CXVA 1ZMNA 5A09A 1KXCA 1EPTC 1O5CB 4BANB 2O9QA 1A5HA 4ZMAH 5FX6A 1L1GA 2B8OH 3SU1A 2WYGA 1UK4A 3TJOA 3SJIA 1F0UA 3STJA 1Z1JA 4B75A 2BD9A 1TPSA 1ETTH 3RM2H 1O38A 4IBLH 1O36A 4Y0ZE 1C1OA 2BDIA 2PTCE 1JRSA 1OWDA 2ULLA 3SHAH 3ZZBA 1KLTA 1AD8H 1ZRKA 4K1EA 2PKAB 1CT0E 2AIQA 1W10U 1FPCH 1ANCA 1KDQA 3RXFA 1G3BA 1O2HA 2VVVA 5EGMA 4YOIA 2A4OA 3EAJA 3S7KB 3KIDU 1RJXB