1P10A

Structural plasticity as a determinant of enzyme specificity. creating broadly specific proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural plasticity broadens the specificity of an engineered protease.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1989-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p10A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p10A01
1GHWH 1K1PA 5A0CA 2R3UA 2VGCB 1YCPK 2WPKS 1C2JA 3ENSB 3ZZAA 8LPRA 3LPRA 4K8BA 1CA0C 1NFXA 1TGCA 1GI3A 1PPEE 1W8BH 1RS0A 4K1TA 1T31A 4JK6A 3SBKA 4AORA 1ANBA 1XVOA 1SR5C 4ABAA 7GCHF 1WU1A 2LPRA 4NIVA 3GISB 4NIYA 1QJ6B 2BHGA 3FP8E 4SGBE 2C8ZB 3HGPA 4OS2A 4I8KA 1C5UA 1U6QA 1L2EA 2HNTC 1ZMLA 1O2KA 3K6YA 2OQ5A 2WUBA 2F9UA 3FAOA 3NPSA 4TWWA 4BANB 1FLEE 4K1SA 1O2YA 2BDCA 1C1WH 1NU9A 3NWUA 4RSPA 2BD7A 5LPRA 2QIQA 3SGAE 5EW2H 1L1NA 1ZZZA 1SPJA 2GCHF 1A3BH 4XSKU 4AYVB 1O3MA 5DGJA 2O8UA 3GDVA 3QGJA 1N8OC 1EPTC 3PROA 4MNVA 3BSQA 1OWDA 1O2NA 3D65E 3LKWA 2UWLA 2HALA 2IN2A 2PKAA 4HGCA 2G8TA 2Z9JA 2W26A 3EA8A 3EDXB 1FMGA 1ZTKA 1HLTH 3NUMA 2VIPA 1O3KA 1O5EH 1GJ8B 4BAOB 2PTCE 3GOVB 1O3OA 4Y11E 3SHCH 1NRQH 2ZFRH 3P6ZB 3NCLA 2IJOB 1YC0A 3OSYA 4AB8A 2CJIA 5BPEA 3ZZCA 4ZROA 1MTSA 3DD2H 1QL7A 3KQDA 2SGEE 7KMEH 2FZZA 1Z8IB 4AB9A 1Z8RA 4NCYA 1NROH 1OXGA 2FMJA 1TALA 1IQEA 2EI8A 1FAKH 2OCVB 4CREA 1C1TA 3SUDA 1EAXA 1MBMA 1DS2E 3FANA 1T4UH 2QGRA 3KQEA 3QUMP 1ZPCA 1AB9B 1LPKB 4Q7YA 2NU4E 1DOJA 1K1JA 6ESTA 3SU2A 1O3CA 3UOPA 2GV7A 1GBAA 4BAHB 3Q3YA 1HAYB 1QIXB 1QR3E 2PWXA 1ELGA 3DA9B 1GHXH 3IWMA 3OYPA 4YZUA 4D9RA 2ZU2A 1GBCA 1WTHD 1RGQA 3T5FH 1D6WA 1VCWA 2NU0E 4MG3A 1AD8H 1CT4E 4JYUH 3GY2A 1GBIA 4J1YA 4Z6AH 1NFUA 4NFFA 3NK8A 2ZFSA 5HYOA 4LZ1H 2D8WA 1JRTA 1B0EA 1TMBH 1BTZA 2ZO3H 5F8ZA 2ZGJA 1LVYA 3ZYDA 3BTKE 3BIVH 1G2MA 3ZVAA 2V0BA 2QY0B 1C4U2 1QA7A 3VXFH 8GCHF 5ESTE 1LVOA 1GBHA 1QBVH 2PKSB 3TJNA 3A86A 3P8NA 2FI4E 1FPHH 4X8TH 4Y8YA 3M3TA 1UK4A 2FOHA 1SG8B 2H9TH 1JIMA 3F9EA 1PPFE 1FIZA 1Z8GA 1THSH 1SLWB 3PMBB 1EOLA 2VJ1A 1S84A 1SB1H 1AUJA 4O9VA 3SV6A 1W13U 1QRZA 1CBWC 4D7GA 1PPCE 1TE0A 2GX4A 3SNEA 2KAIB 2BD5A 1PFXC 2O9QA 1EAUA 1TOMH 1XUIA 5EOKA 1THPB 3RC5A 1H9IE 4THNH 4YM9A 2W7UA 5I46H 1TNHA 1CT0E 3PLPA 1YP9A 5I25A 1F0UA 1E0FD 1V2UT 2CN0H 2O8WA 1UTOA 1ZGIA 1OS8A 2ZG0H 1FJSA 2TGDA 3FVFB 4MDSA 5H4IB 2FXRA 2BYAX 1GMDF 3D23A 3PO1C 3QTVH 2AIQA 1PPZA 1A5IA 1W0ZU 2D1JA 3BTDE 4A7IB 2GZ7A 3GY6A 4IBLH 1YLDA 1NFYA 2P3TB 1W14U 3VGCB 1KSNA 3TLOA 4YOJA 1N8OB 1PJPA 1P9UA 2AGIX 1TRNA 3T25A 3BEFB 3EQ0H 3MYWA 5JB9S 4XBDA 3F9HA 1HXEH 4YTAA 2G55A 2D26C 4HFPB 2ALPA 4CRCA 1K2I1 3KN2A 1RIWB 2ZPRA 1C1MA 1F5RA 3A8DA 3RP2A 3RXVA 2BLWA 3V0XA 3RU4E 3LT3A 1TQ7B 1HAVA 1CVWH 2BD8A 3TH3H 2O8MA 2WV5A 2UUYA 2VWLA 3HK3B 5TCAA 1MTNB 4FUHA 4OS7A 4Q7ZA 1TX7A 5A09A 2OC7A 3GCTG 3KIDU 4WF8A 2FOCA 1J14A 3QTOH 1TONA 2A5AA 2ASUB 4X0WU 1BMNH 4X1NU 3BG4B 4SGAE 2TIOA 1A61H 2BD2A 4ZXXH 1YKTA 2V3OH 1SGFG 1O2GH 3SU1A 1UTKA 1E37B 3CP7A 4Y10E 1W10U 3A84A 1TOCB 4B76A 4ISIH 3RC4A 4KGAA 2PSYA 1V2JT 1G36A 2WPHS 1A0JA 4XDEA 1G37A 1J8AA 2HGTH 1BMMH 1Z6JH 3Q76A 1F5KU 2FLBH 1XUFA 1LKAA 1ZLRA 4BNRA 3RC6A 1Y3VA 1TNJA 3T27A 1D3TB 3BTWE 3N7OA 2FWWA 3GYMA 1AB9C 2G00A 2ZDMA 4Y8XA 5A8YA 2STBE 3UWIA 1EZXC 1QB9A 3UR9A 1K21H 3E91A 3OX7U 3DFJA 4MVNA 3EA9A 2AMDA 2ZFFH 2FS9A 2QA9E 3RUOA 1IHTH 2VB0A 2XC0A 5LH8A 1QGFA 1SOZA 2OC1A 1SFQB 1O2HA 1ORFA 1DVAH 3SU6A 4KP0A 2A2QH 3M5LA 4X8UH 3FFGA 3DT0H 4AFZA 3S69A 3MTYA 1QB1A 1NC6A 2ZA5A 3ZV9A 4LXBH 5EG4A 4KKDA 5EPYA 1NM6A 5J4SA 1OKXA 1RD3B 1SGYE 3M5OA 1O2OA 1EXFA 2GT8A 2BVXH 3H7TA 1RJXB 3PLKA 2WV4A 2HPPH 3V3MA 1QJ7B 5DJ7A 1MCTA 3EAJA 3RMMH 3ZVDA 1TQ0B 1XUHA 3SOSA 1F92A 4HI3A 2V35A 2BX4A 2JH0D 2OBQA 2XYAA 1UVSH 6LPRA 1C5TA 3QX5H 4E7NA 3S7HB 4YT6H 3PM3A 4B73A 2ZC9H 1KYNA 1TMUH 3K6ZA 1RTLA 2Z3EA 1AVXA 1GI2A 2ZTXA 3ZZ5A 3E90B 2FI5E 3QWCH 4FVDA 1K1LA 4IW4E 2F83A 1NRNH 2BY9X 4K69A 3LONA 1HAPH 1GMCF 1UJ1A 1GVKB 3GICB 2A5KA 1MCVA 1SLXB 1YPGH 2TRMA 1FI8A 1IQFA 3UOUA 3MH6A 1QRWA 2RA3A 1T32A 1THRH 3KHVA 1BT7A 4K60A 5SGAE 1GBFA 4Q7XA 1ZOMA 2BZ6H 3PYHA 3SI4H 2D2DA 1OYQA 2UWOA 3ATWA 2FIRH 4FUDA 4TYDA 3Q3XA 4ZKSU 2O8TA 4ZKRU 1JRSA 1SSXA 2DE8A 5K7RA 2QYIA 2H9HA 1O2QA 1ZMNA 3SQHE 1XUJA 3V12A 2P93A 1SGTA 1L1JA 2B5TB 3MNBA 2IOTA 1UCYK 4MPXA 3SU4A 1LQDB 5A8XA 1QTFA 1TRYA 1EKBB 2J34A 1LPGB 1HBTH 2R2WU 2F91A 3MI4A 4CH8B 1ELVA 2GMTB 2OBOA 1NN6A 2XC5A 1QQUA 3TH4H 1FQ3A 3RXUA 1WV7H 4WH6A 1OOKB 3RDZA 4H4FA 4AYYB 5JYIA 1GJ5H 1QBOA 4A1VA 3E0NB 1O2JA 2C90B 4ABHA 1Q31A 3EE0B 3SJ9A 4I31A 1GVLA 3LDXH 2BOHB 1AWFH 4X1PU 2BQ6B 3RXGA 2A7JA 1WUNH 1O5BB 2GT7A 3UREA 1KDQA 5IYTA 7GCHG 3VPKA 4A6LA 5JBAS 1ESAA 3MHWU 3LJOA 1Z1JA 1O2MA 4BTUB 1WTGH 1KXFA 1KLTA 2F9OA 1L0ZA 5DPAA 1C1VH 1LHCH 9ESTA 1HAGE 1O5CB 4Z0KA 1AFQB 1C5QA 2ZHFH 2PUQH 1OWKA 1FY4A 4RN6A 2Y7XA 2YOLA 3LH1A 2XBYA 5GCHG 3MH5A 1O2IA 3R3GB 4RKOB 2EC9H 1V3XA 3TPIZ 3ZZ3A 4GHQA 3M37A 3UNQA 3LOXA 2CXVA 1VJAU 1TIOA 5EXLA 2BXTH 5FXLA 3LGYA 1X7AC 3GCHB 1BBRK 3M5MA 5FBIA 3SU0A 4CBNA 1AZZA 1CA8B 4PROA 1A5HA 3NXPA 1SGNE 1MKXK 1Z1IA 1O32A 1G32B 2J92A 1HAOH 4O03A 2J9NA 5DP5A 1GL0E 1O2RA 2VH0A 4GVUA 1IQLA 5E0JA 4DCDA 1O3PB 1QL9A 2BLVA 3SJIA 2BY7X 2VIDA 1K9OE 2JETC 3F68H 4AGJA 1K1IA 2ZFTA 1C2GA 2WPLS 1EJNA 2ZQ2A 5EXNA 2VINA 4UFDH 2JETB 2ANMH 3AAUA 3LGVA 3TH2H 1NY22 2SGDE 4R0IA 4K8YA 2FOEA 2BY5X 1Y8TA 3MH4A 1S5SA 4Y0YE 1HPGA 1HAXB 1ABJH 2OXSA 1OYTH 5DP9A 5G4BA 4Y7AA 2GZ9A 2C8WB 1KXCA 2B0FA 3HGNA 3BEUA 1H8DH 1OSSA 1P2OA 4MPUA 1GJ9B 3BF6H 1BCUH 5C5OA 4Y7BA 1CSOE 1W7XH 1SFIA 2UUFB 4X6MA 2FOAA 1AFEH 2ZTZA 4B2CA 1GDUA 4GLYA 3HK6B 3ZZBA 2ZGHA 2W3KA 1AZ8A 3URCA 4QT8C 2FI3E 5LPFA 3MU4A 4MTBA 2FM2A 1L4ZA 1ZJDA 3PWCA 2SNVA 4YLQH 1O38A 4X8VH 1GJ6A 2GMTC 2F9PA 2ZU5A 3ZYEA 3M7QA 3T28A 1UK3A 5EQRA 1PQ8A 1HYLA 2HRVA 2F9NA 1PPBH 2J38A 3BTEE 2ZEBA 4FVBA 1BRUP 1WCZA 1HV7A 4LZ4B 4INKA 1QJ1B 4INLA 5A2MH 2VGCC 3BN9A 1G3CA 2ESTE 5AF9H 2GGVB 4A92A 2ZWLH 2GD4B 2QAAA 1V2OT 4FU8A 4OGYA 1VITF 2QXIA 1XMNB 1NRRH 6GCHF 5T6DA 1SGPE 2H9EH 3TNTA 2JH6D 3BIUH 4ABBA 2VVVA 4WJG2 3UTUH 1GBMA 1BDAA 4NIXA 1OWHA 5F03A 3TIUA 4NSYA 1HJ9A 3VEQB 1ZHRA 1RRKA 2VIVA 1DITH 1P02A 1G30B 2A2XH 4WMDA 4YT7H 3MU5A 1O2LA 4ISOA 1P12E 4BAKB 5JBBS 4FUEA 2TGTA 1SQTA 4YO9A 4ABJA 1WQSA 2BLQA 1IQMA 5EXMA 4DJZB 1S6FA 1SMFE 3LGUA 4AG1A 3GCHC 1LVBA 4A5TS 4K2YA 1LPZB 5DK1A 2A31A 1LHDH 3UR6A 2A7CA 3UPEA 3RLYH 1CHOG 2Z9GA 4IN2A 1XKAC 1YPHE 4ZHLU 1NS3A 2Z94A 3RXKA 1LMWB 4WY3A 2JKHA 2HOBA 1TRMA 1P06A 2BM2A 5B6OA 4ABFA 1EPTB 1MQ6A 1SVPA 3T62A 2BTCE 3MOCA 1P01A 2Z9KA 1TABE 1H1BA 1N6XA 1AY6H 2ANKH 2RCEA 1O3FA 2GVFA 4DVAU 3MU0A 1V2KT 1E35B 1ZR0A 3RXFA 1FONA 5C1YA 1C2EA 5JDUB 1K1OA 3SJ8A 1QB6A 1C1QA 1T4VH 3RM0H 2FPZA 3LGWA 1DM4B 3GDSA 4NZLA 1EZQA 1C5OH 2G4UA 3AW0A 4B74A 1GG6B 4AG2A 1JMOH 1O3HA 3OTJE 2FOGA 3STJA 1F7ZA 1G2LA 1GI8B 2SFAA 2Y5HA 2FX6A 3C27B 5EQSA 5GXPA 3BTQE 3P8FA 4VGCB 4NWKA 1PQ5A 1DXPA 4K3JA 1XXDA 3AASA 3RM2H 1L4DA 1O0DH 4FUCA 1GBLA 2PGBB 4IMZA 1A0LA 4IC5A 1Z7KA 1O2SA 2BLOA 3M7UA 4KTSA 1P8VC 2F9VA 3B8JA 2YNBA 3VFEA 2ZU4A 1FPCH 1D4PB 2VIQA 3B23B 1C2MA 1CU1A 1EZSC 1O34A 7LPRA 2GCHG 1W7GH 2A7HA 4H42U 3RU4T 5GWZA 3PLBA 3O8DA 1YYY1 2ODPA 5C1UA 4AOQA 3QN7A 3S9BA 2A4GA 5DO4H 1YBWA 3EA7A 1SGQE 4HZHA 3OY5U 1DY9A 1IQNA 1AWHB 2ZHQH 3BTME 1IQJA 2G4TA 3A85A 1AI8H 3ZVFA 5TJXA 1MU8B 1VCPA 3ZV8A 2WUCA 4X1SU 3SQEE 1UCYH 2WYJA 1C2HA 2IPHA 1V2VT 2ANWA 1C5MD 1CQQA 3SNBA 1AFQC 1UMAH 4Y76A 2PSXA 3TK6A 1DWEH 2A32A 2C93B 1UVOA 1BRCE 4DY7B 1YF4A 3DFLA 9LPRA 1W11U 1ETSH 1VZQH 4IN1A 4MPWA 3VXEH 3PWBA 1MKWK 4MNWA 1FIWA 3PO1B 4ABIA 1D3PB 1L1GA 4CRBA 1C1NA 4U01A 2CF8H 3BEIB 1LVMA 3AW1A 1O3NA 2Z7FE 1XUKA 2SGFE 4AGKA 1AVGH 5ESBA 2TGPZ 1C5ZB 3KEEA 1P2NA 1AO5A 3UFAA 4MNXA 2ZGXH 4XOJA 1FY1A 1T8LA 5FAHA 1D3QB 2NU1E 3S9CA 4X6NA 4O3UA 1RIWC 3QGNB 4NGAH 3OY6U 1ZRKA 1GI0A 1GL1A 3RLWH 3VGCC 4JZFH 2UWPA 3SNDA 1V2WT 2RA0A 5L6NH 2AGGX 2JH5D 3C1KA 2GV6A 1LQEA 1CT2E 3ATLA 5AFYH 2XNIA 4TPYA 4UEHH 5HM2A 1HJ8A 2VWMA 1DWBH 1PPGE 2ZZUH 1E34B 3URDA 2FTLE 1P0SH 4WH8A 1GHAG 1SGCA 4I8GA 1G3DA 1V2PT 1GBJA 3JZ2B 2ZCHP 1RXPA 2LNCA 5FCKA 5FHTA 1J9CH 4XE4A 1GBBA 3U8OH 5DG6A 3A7WA 4X8SH 1KDQB 2J2UA 1FN8A 1QCPA 1O3DA 4BOHA 1ETTH 2HNTE 3GCOA 1A3EH 1GWAA 1CGIE 1BTXA 3OU0A 1UVPA 5DP8A 1GHVH 1DXWA 3I77A 2QXHA 4DT7B 2PV9B 1DPOA 2GDEH 3LGTA 5GIBA 2WYGA 4GCHG 2BZAA 1Y3WA 4FUGA 1QL8A 1WBGB 1P05A 3G01A 1GG6C 1TNKA 2BVSH 3TK9A 5DP6A 1O2TA 1VGCC 1UCYE 1GHAF 1SQOA 4MPVA 5HM9A 2VWOA 1O3EA 4MNYA 4D7FA 3U1JB 2OQUA 3F1SB 2QN5T 1H9HE 3RXEA 1GCDA 1P3CA 5DP7A 3RXCA 1QFKH 4X6PA 3P70B 2Z9IA 1SI5H 1CGJE 1GJBB 1HFDA 1GBEA 4A1TA 1HAZB 1GHBF 1SC8U 2TPIZ 1VJ9U 2ALVA 1T8MA 1W12U 2B9LA 3RXQA 3BG4C 1MTWA 4JCNA 1ELEE 3K9XB 2BDBA 2DUCA 1DANH 3SHAH 1UK2A 1Y3UA 5E8EH 1AUTC 4ZH8A 5E2OA 2CMYA 2G5VA 1TBZH 2FO9A 2I6SA 1A1RA 2ZTYA 1TPPA 3SV8A 4TY7A 4UDWH 5L2ZH 2ZCLP 4MLFB 1O3IA 3ZZ7A 1XKBC 1O2VA 5JBCS 5AHGH 2I6QA 3TNSA 1KLIH 1J17T 2XTTB 3M7TA 4CR9A 1GJDB 1SGDE 4X2YA 3O8RA 3Q3KA 4NIWA 3RU4D 1C2DA 1B7XB 2CV3A 3TJOA 3VB6A 1GI6A 1MBQA 1TGTA 2NWNA 2XCFA 3VB3A 1SGEE 1Y5BT 4GHTA 2BVRH 1S0RA 2ZDAH 2DE9A 3F9FA 1O3LA 1RTFB 2BMGB 1GHBG 4JZDH 3L3TA 3K65B 3A89A 1LHGH 3LC3A 3HATH 3E8LA 3SO3A 1IQGA 2ZCKP 1K1MA 1ESTA 2H2ZA 1YPKH 1F5LA 1A4WH 1ZTLA 2FYQA 3RMOH 1VITH 2XC4A 3TITA 2XCNA 2RG3A 1C9PA 1P3EA 4DIIH 1CHOF 3PTNA 2AIPA 1O2ZA 1A7SA 1MD7A 1P11E 1TAWA 4Y6DA 3NKKA 1GCTB 1V2TT 1LHFH 1BB0B 4VGCC 1GDNA 4GPGA 5GJ4B 4KTCA 3VB4A 2SGAA 1UTQA 1O35A 1GGDB 3P95A 5E0HA 1HIAB 4YOGA 4MQAA 2B8OH 3ITIA 8GCHG 1WOFA 1C5XB 3SUGA 3SN8A 1K22H 1ELCA 2AMPA 1NRSH 1EAIA 1C5WB 2RDLA 3HKJB 1AKSA 4FUJA 5L2YH 1GBDA 3KCGH 2GTBA 3AVZA 1DLKB 3A7ZA 2G81E 1BJVA 1MKWH 2Y81A 1SOTA 1GHZA 1P10A 2QF0A 2WPMS 1MTVA 2ZHDA 4ZKNU 2A4RA 3UY9A 1MMJN 4WXIA 5AVDA 4DG4A 1CHGA 5A8ZA 3KQBA 4AX9H 1ACBE 4LK4A 1O3BA 1TNLA 4WWYA 1JXPA 3L6PA 2BDIA 4F49A 1Y59T 1ELDE 1O36A 5ETXA 2FOFA 2THFB 1EJAA 2P8OB 1GJ4H 3STIA 1UTLM 2ZI2H 1ZYOA 3ATIA 3A7TA 4X2WA 1UTPA 2BY8X 1EASA 2A5IA 4NA9H 1WAYB 4GUXA 1BIOA 3P8OA 4X1QU 2BQWB 3V13A 1VGCB 1LHEH 3SJKA 1W3CA 4NWLA 1P2KA 1QURH 1ZSLA 1DFPA 1N1LA 3SZNA 1GPZA 3Q00A 4BAQB 1P09A 2HWLB 1FUJA 3P92A 4CRDA 1TLDA 1AU8A 2HVXA 3TJVA 1RTKA 1XUGA 1EP5A 3SUEA 3E1XB 1JWTA 1NT1A 1TX6A 5AFZH 6CHAB 4I8HA 2VIWA 2TBSA 1HIAA 1VR1H 3M5NA 1MAXA 1UVUH 1BHXF 2XRCA 1AIXH 3MWIU 4OS5A 6CHAC 5T6GA 2W7SA 1FDPA 1DT2A 2P59A 4WMEA 4H6TA 1GI9B 4AFQA 3MNXA 5TCCA 2BD9A 1ARBA 4CR5A 2ZDKA 1O2WA 1O33A 1Y5AT 1TB6H 4OS6A 2QV1A 2FYRA 1V2ST 3IITA 2FESH 3W94A 1SGRE 1UHBB 1GDQA 1QY6A 5EODA 4U30A 5EGMA 1BTUA 4B1TA 2AGEX 2AEIH 1AHTH 2R0KA 1O2UA 5PTPA 1BTHH 3LGIA 4Y79A 1C5YB 1NZQH 3ZVEA 3UWJH 1NO9H 4Y0ZE 4XBBA 2M5TA 3ELAH 3SV9A 1TX8A 2VVCA 1AE8H 1Y5UT 1CGHA 3PMAB 3GY7A 5FPSA 1TBQH 5HXFA 1FXYA 3A7XA 1YM0A 4NG9H 2A0QB 1BZXE 3D62A 1NPMA 2UUJB 5T3HA 1MU6B 4IGDA 2VIOA 4DURA 1DUAA 2EI7A 2TGAA 2XWBI 4I7YH 2FP7B 1EUFA 3KL6A 2Z9LA 2R2MB 1P2QA 2BDAA 1ANEA 3ODDA 2R9PA 1KY9A 4Y8ZA 3RXRA 1MZAA 1ZJKA 3MFJA 1MZDA 2H6MA 2ZNKH 2KAIA 3I29A 1EATA 1JOUB 2AFQB 3ATKA 3SORA 4OS4A 3CS0A 1CO7E 1ELBA 2NU3E 3QO6A 3MO3A 4NA7A 3UNRA 3LJJA 1A46H 1G3BA 3S9AA 2ZIQH 1DWDH 2GCTC 1V2MT 3SU3A 3S0NA 2BDYA 2ZECA 2XW9A 1YCPH 2ZGBH 3BTTE 2HLCA 4UFFH 1ID5H 4UD9H 5E2PA 3GY5A 4CHAB 2ZDVH 1TYNA 5BRRE 1DLEA 1ABIH 4WVPE 3TVJB 1SQAA 2EI6A 3HKIB 1KTSB 4UFGH 1GJCB 1V2QT 3KQCA 4ZXYH 3MO6A 2FTMA 3A83A 2Q6FA 1SL3A 3QDZB 1K28D 3IG6B 1HAVB 1BTWA 4GSOA 1O2PA 3A82A 4JZEH 2A45B 4YESB 3TJUA 1FY3A 2R0LA 1ETRH 4UE7H 1C1RA 5IDKA 5HMAA 1HAHH 4WMFA 2A4OA 4B71A 3U9AH 1BOQA 4AFSA 3FZDA 5EW1H 2P95A 1O30A 2ULLA 1SLUB 2P8OC 1K1NA 3SI3H 4BAMB 2FS8A 3EYDA 2C3SA 1S6HA 3E16B 4IC6A 1OP0A 1V6DA 2NU2E 1HRTH 1W0YH 1GMCG 1JIRA 1S0QA 3VB5A 3U8RH 3FP6E 1KXAA 4X1RU 4YOIA 1XM1A 2EEKA 1F0SA 5HGGA 1HNEE 2ZP0H 1YPHC 1O5GH 3RXPA 1OWIA 3UUZA 5FBEA 1F2SE 1QQ4A 1OPHB 3UQVA 4FUIA 3SUFA 1UHBA 1CE5A 1EAWA 2CHAC 2Z3DA 1M9UA 3PV4A 3ZZ4A 1TGNA 5K0HA 1CBWB 1PYTC 2ZHEH 5JBTA 1QNJA 1FY8E 1TPAE 2GDDA 3RXJA 1FAXA 2F3CE 2PTNA 4ISNA 3TGKE 3NZIA 4ABDA 1LCYA 3U69H 4Y71A 5JPMH 2K1QA 1NTPA 1D6RA 4HTCH 5FX6A 3SNAA 1HCGA 4YLUA 5CHAC 1MUEB 4K5ZA 1C2FA 2YNAA 4BXSA 4ISLA 3ODFA 2HPQH 3O8CA 4X2VA 2ZDNA 2BDGA 3M35A 1ZHMA 3HPTB 4ZUHA 4DOQA 1VITG 2H5CA 5GDSH 1OX1A 3V7TA 4CRAA 4ASHA 1BJUA 8ESTE 4X2XA 3A8AA 3CENA 3SGQE 4GAWA 1EQ9A 1O3AA 4XBCA 2FLRH 2WPJS 2ODYB 1HB0B 1O31A 1LO6A 1T8NA 1UTMA 1GHYH 4I32A 1ELAA 3RXOA 1Q2WA 1EX3A 1PQ7A 2VH6A 3BTGE 4RKJB 1SBWA 1MKXH 1GJAB 1QA0A 3SW2B 1C2LA 1TGBA 3MO9A 1YPMH 2BQ7B 2HNTF 4ZAEA 4ESTE 4JZ1A 5C5NA 5E0GA 2FOMB 2SGQE 1MTUA 1MQ5A 1YPEH 3MU1A 1QBNA 1WSSH 1E38B 1EP6A 3U1IB 4I8LA 1P2JA 1OWJA 4CRGA 1HGTH 1FNIA 1FZZA 1O5DH 1OWEA 2VU8E 3ATMA 1NESE 2PKSC 3DHKH 3I78A 1FN6A 1GMHG 1DSTA 1IQHA 1J15A 1LTOA 2G52A 2PKAB 1UO6A 4TPIZ 1C2IA 1V2RT 1ARCA 3KGPA 5FCRA 3LIWA 2PW8H 2H5DA 3PMHB 1TMTH 3GCNA 4I33A 4U32A 2OD3B 1F0RA 1A0HB 2FOBA 4Q2KA 3AAVA 3T29A 1ZGVA 2PHBA 2GP9B 2EA3A 3A8CA 2Y82A 4WXVA 4J2YB 1YCPM 1GI5A 5C3NA 5F8TA 3R0FA 3L33A 1ZTJA 1IQIA 2W3IA 1KTTB 3RXMA 3VB7A 1EJMA 1B0FA 3SNCA 1AQ7A 4AN7A 5FX5A 3A7YA 1CA0B 1H8IH 1O3JA 2OTVA 4K1EA 5DP3A 4IS5A 3ZVCA 1YPLH 2J94A 5F8XA 1QHRB 1W2KH 3RXIA 2OINA 1ANCA 2QF3A 5CHAB 1EZUC 4X6OA 3GDUA 3MNCA 3RXSA 3T26A 2J95A 3K2UA 2VVUA 1XVMA 1F0TA 1DUEA 1DWCH 1S83A 1A2CH 3FZZA 2OP9A 1KXBA 1PYTD 1S81A 2ZDLA 1SLVB 1GMHF 5EQQA 1DICA 1OP2A 2CHAB 3JZ1B 1LDTT 2Y5GA 5ABWA 1O3GA 4ABGA 2Y6TA 1BMLA 2QC2A 2GKVE 2ZPSA 2AYWA 3TU7H 1EOJA 1UVTH 1LKBA 2Q1JA 3KNXA 4ISHH 3RXAA 2FEQH 3H5CB 1T8OA 2XXLA 3QZRA 2ZKSA 3MNSA 5L30H 1C4Y2 1C1SA 1JBUH 4IMQA 4ZMAH 1IQKA 1V2LT 5C67A 1HAIH 1C1UH 2ZHWH 5C2ZA 3BTHE 1YGCH 1MTNC 3A80A 3SGBE 5GCHF 3W95A 3TK5A 1MAYA 2VWNA 3EGKH 5LGOA 1YLCA 1P2IA 4OGXA 2ZQ1A 1P9SA 2Y7ZA 1DDJA 5C1XA 1XX9A 4DIHH 1G9IE 4NZQA 1UTJA 4JK5A 3SV7A 1BBRE 1BUIA 3U98H 2OLGA 2WINI 2BD4A 8KME2 3SJOA 1C5RA 3BTFE 2FDAA 1P57B 3DUXH 2QXJA 1B5GH 4ZKOU 3ESTA 4XFQA 2VNTA 5EPNA 2ZPQA 1MH0A 3A7VA 4D76A 1C5NH 1HJAC 2OC8A 3CS7A 4GCHF 5DKMA 1EB1H 4B2AA 2XBWA 4I8JA 4CH2B 1ZPBA 1HJAB 3FP7E 3SU5A 4JMYA 1ESBA 2OC0A 1AMHA 3ZVGA 1ELFA 2V6NA 4NA8A 3A87A 1SHHB 3S7KB 5CE1A 1GGDC 4Q80A 4BXWA 4AFUA 1GBTA 3TGJE 4JYTA 1NFWA 4JZIA 1KIGH 4JYVH 1SGIB 4FXGH 2ILNA 3A81A 4H6SB 5C20A 1BHXB 1SHYA 1ZHPA 2BB4A 3E6PH 2BDHA 3LH3A 3RMNH 4D9QA 3E0PB 1GI4A 1ZPZA 1IOEA 2XWAA 4FUBA 2GCTB 1AKSB 1ELTA 4LOYH 2ZF0H 2R3YA 3QK1A 1OP8A 5F6MA 3GY4A 1BA8B 1IAUA 1AN1E 1D9IA 1WQVH 1HDTH 2PFEA 4E05H 2AH4X 1SGFA 2SNWA 1BRBE 1G3EA 3LU9B 1DSUA 5EU8A 4KTUA 1A5GH 3UIRA 2A1DB 4E7RG 2B7DH 4TY6A 5A0AE 2GZ8A 3GY3A 2P3FH 2Y5FA 3Q77A 3ZZ8A 1Z71A 4UONA 4CRFA 1AE5A 2P3UB 2WPIS 1GJ7B 1V2NT 4DW2U 4U2WA 1GBKA 4O97A 1H4WA 3UQOA 2ANYA 1O39A 5FPTA 4BTTB 1BITA 2PUXB 2P16A 1DY8A 3BV9B 1P04A 5J4QA 1O5FH 2PLXA 4R8TB 3ZVBA 2BD3A 7ESTE 2UUKB 1ZSJA 4O3TA 2BOKA 1HXFH 3RXDA 4NFEA 1Y3YA 3M3SA 6GCHG 1ZMJA 3QZQA 5LPEA 4KELA 2OUAA 3BG8A 1C1PA 2C4FH 1TNIA 1NU7B 4B75A 3UNSA 1XXFA 3P17H 1EB2A 5FPYA 2ZFPH 3GYLB 1GCTC 1HUTH 4ZHMU 1Y3XA 3GY8A 1D3DB 3TGIE 1S82A 3MH7A 4CBOA 1PPHE 3B9FH 3RXLA 2F9BH 3PB1E 3E3TA 3M3VA 1TNGA 3ZZDA 3RXBA 2BY6X 1INCA 2PGQB 1O5AB 1GI7B 2SGPE 2CF9H 1MD8A 1P03A 1T7CA 2H1UA 1PQAA 4E06H 3LC5A 4INHA 3M36A 2CGAA 1TA6A 1C4V2 4B2BA 1O37A 1C5VA 2AERH 2C8YB 1AVWA 5JB8S 1O2XA 2AS9A 3ZZ6A 1WYKA 1VCQA 1FY5A 3F9GA 2ODQA 3H7OA 4D8NA 1BRAA 3PTBA 1QRXA 2G51A 3D49H 2XBXA 4OS1A 1ZSKA 1C9TA 1DE7H 1BQYA 2G5NA 1TA2A 1BTPA 4M7GA 3MU8A 1IHSH 1Z6EA 3RXHA 1TFXA 3GCTF 1BBRH 4CHAC 2Q6GA 2QXGA 1KLJH 1C5LH 2A4QA 2P94A 1TGSZ 4UFEH 2Q6DA 3F6UH 4TWYA 1BTYA 3ZZ9A 2W5EA 4F4OC 1C5PA 1TPSA 1KXDA 3KF2A 3WY8A 4A1XA 3SV2H 5CMXH 2Z3CA 5A0BA 3P8GA 2Y80A 1C5SA 1H9LB 1Q3XA 1TBRH 4BTIB 1YPJH 5T6FA 3RMLH 1KXEA 1DX5M 1ZRBA 3QLPH 2Z6BD 2ZU1A 2QCYA 2O8LA 4ZHAA 2STAE 4ABEA 2BX3A 1EPTA 4FU7A 1Z8JB 2ZFQH 4FU9A 2AMQA 2ZU3A 5DP4A 3PMJA 1FV9A 2XBVA 1E36B 2V3HH 2BXUH 2FODA 1C1OA 3A8BA 4FUFA 4NSVA 3U8TH 3RXTA 3M61U 1NRPH 3MMGA 4AZ2B 1RFNA 1GMDG 1GI1A 1AGJA 1TPOA 2PR3A 1GVZA 4DGJA 1N6YA 2ZGCA 3A88A 1ANDA 1BMAA 2C8XB 1S85A 5GPIB 3O8BA 1P2MA 2J4IA 1J16A 1TWXB 2FX4A 1C2KA 3T2NA 1UTNA
chains in the Genus database with same CATH superfamily
1GHWH 1K1PA 5A0CA 2R3UA 2VGCB 1YCPK 2WPKS 1C2JA 3ENSB 3ZZAA 8LPRA 3LPRA 4K8BA 1CA0C 1NFXA 1TGCA 1GI3A 1PPEE 1W8BH 1RS0A 4K1TA 1T31A 4JK6A 4B6EA 3SBKA 4AORA 1ANBA 1XVOA 1SR5C 3WWBA 4ABAA 7GCHF 1WU1A 2LPRA 4NIVA 2XNDD 3GISB 4NIYA 1QJ6B 2BHGA 3FP8E 4SGBE 2C8ZB 3HGPA 4OS2A 4I8KA 1C5UA 1U6QA 1L2EA 2HNTC 1ZMLA 1O2KA 3K6YA 2OQ5A 2WUBA 2F9UA 2J98B 3FAOA 3NPSA 4TWWA 4BANB 1FLEE 4K1SA 1O2YA 4RI0A 2BDCA 1C1WH 1NU9A 3NWUA 4RSPA 2BD7A 5LPRA 2QIQA 2V7QD 3SGAE 5EW2H 1L1NA 1ZZZA 1SPJA 4I86A 2GCHF 1A3BH 4XSKU 4AYVB 1O3MA 5DN6D 5DGJA 2O8UA 5CHBA 3GDVA 3QGJA 1N8OC 1EPTC 3PV2A 3PROA 4MNVA 3BSQA 1OWDA 1O2NA 3D65E 3LKWA 2UWLA 2HALA 2IN2A 2PKAA 4HGCA 2G8TA 2Z9JA 2W26A 3EA8A 3EDXB 1FMGA 1ZTKA 1HLTH 3NUMA 2VIPA 1O3KA 1O5EH 1GJ8B 4BAOB 2KCOA 2PTCE 3GOVB 1O3OA 4Y11E 3SHCH 1NRQH 2ZFRH 3P6ZB 3NCLA 2IJOB 1YC0A 3F0OA 3OSYA 4AB8A 2CJIA 5BPEA 3ZZCA 4ZROA 1MTSA 3DD2H 1QL7A 3KQDA 2SGEE 7KMEH 2FZZA 1Z8IB 4AB9A 1Z8RA 4NCYA 1NROH 1OXGA 2FMJA 2WHXA 1TALA 1IQEA 2EI8A 1FAKH 2OCVB 4CREA 1C1TA 3SUDA 1EAXA 1MBMA 1DS2E 3FANA 1T4UH 2QGRA 3KQEA 3QUMP 1ZPCA 1AB9B 1LPKB 4Q7YA 2NU4E 1DOJA 1K1JA 6ESTA 3SU2A 1O3CA 3UOPA 2GV7A 1GBAA 4BAHB 3Q3YA 1HAYB 1QIXB 1QR3E 2PWXA 1ELGA 3DA9B 1GHXH 3IWMA 3OYPA 4YZUA 4D9RA 2ZU2A 1GBCA 1WTHD 1RGQA 3T5FH 1D6WA 1VCWA 2NU0E 4MG3A 1AD8H 1CT4E 4JYUH 3GY2A 1GBIA 4J1YA 4Z6AH 1NFUA 4NFFA 5C94A 3NK8A 2ZFSA 5HYOA 1QZ8A 4LZ1H 2D8WA 1JRTA 1B0EA 1TMBH 1BTZA 2ZO3H 5F8ZA 2ZGJA 3DSGA 1LVYA 3ZYDA 3BTKE 3BIVH 1G2MA 3ZVAA 2V0BA 2QY0B 1C4U2 1QA7A 3VXFH 8GCHF 5ESTE 1LVOA 1GBHA 1QBVH 2PKSB 3TJNA 3A86A 3P8NA 2FI4E 1FPHH 4X8TH 4Y8YA 3M3TA 1UK4A 2FOHA 1SG8B 2H9TH 1JIMA 3F9EA 1PPFE 1FIZA 1Z8GA 1THSH 1SLWB 3PMBB 1EOLA 2VJ1A 1S84A 1SB1H 1AUJA 4O9VA 3SV6A 1W13U 1QRZA 1W0KD 1CBWC 4D7GA 1PPCE 1TE0A 3WW7A 2GX4A 3SNEA 2KAIB 2BD5A 1PFXC 2O9QA 1EAUA 1TOMH 1XUIA 5EOKA 1THPB 3RC5A 1H9IE 4THNH 4YM9A 2W7UA 5KEDA 5I46H 1TNHA 1CT0E 3PLPA 1YP9A 5I25A 1F0UA 1E0FD 1V2UT 2CN0H 2O8WA 1UTOA 1ZGIA 1OS8A 2ZG0H 1FJSA 2TGDA 3FVFB 4MDSA 5H4IB 2FXRA 2BYAX 1GMDF 3D23A 3PO1C 3QTVH 5CDFE 2AIQA 1PPZA 1A5IA 1W0ZU 2D1JA 3BTDE 4A7IB 2GZ7A 3GY6A 4IBLH 1YLDA 1NFYA 2P3TB 2M2AA 1W14U 3VGCB 1KSNA 3TLOA 4YOJA 4ZCNA 1N8OB 1PJPA 1P9UA 2AGIX 1TRNA 5HIZA 3BEFB 3T25A 3EQ0H 3MYWA 5JB9S 4XBDA 3F9HA 1HXEH 2F43B 4YTAA 2G55A 2D26C 4HFPB 3OFND 2ALPA 4CRCA 1K2I1 3KN2A 1RIWB 2ZPRA 2HVYB 1C1MA 1F5RA 3A8DA 3RP2A 3RXVA 2BLWA 3V0XA 1H8ED 3RU4E 3LT3A 1TQ7B 1HAVA 1CVWH 2BD8A 3TH3H 2O8MA 2WV5A 2UUYA 2VWLA 3HK3B 5TCAA 1MTNB 4FUHA 4OS7A 4Q7ZA 1TX7A 1YWUA 5A09A 2OC7A 4F55A 3GCTG 3KIDU 4WF8A 2FOCA 1J14A 3QTOH 1TONA 2A5AA 2ASUB 4X0WU 1BMNH 4X1NU 3BG4B 4SGAE 2JDID 2TIOA 1A61H 2BD2A 4ZXXH 1YKTA 2V3OH 1SGFG 1O2GH 3SU1A 3GS9A 1UTKA 1E37B 3CP7A 4Y10E 1W10U 3A84A 3UAIC 1TOCB 4B76A 4ISIH 3RC4A 4KGAA 2PSYA 1V2JT 1G36A 2WPHS 1A0JA 4XDEA 1G37A 1NBME 1J8AA 2HGTH 3OE7D 1BMMH 1Z6JH 3Q76A 1F5KU 2FLBH 3KYFA 1XUFA 1LKAA 1ZLRA 4BNRA 4ASUD 3RC6A 1Y3VA 1TNJA 4F48B 3T27A 1D3TB 3BTWE 3N7OA 2FWWA 3GYMA 1AB9C 2G00A 2ZDMA 4Y8XA 5A8YA 2STBE 3UWIA 1EZXC 1QB9A 3UR9A 1K21H 3E91A 3OX7U 3DFJA 4MVNA 3EA9A 2AMDA 2ZFFH 2QA9E 2FS9A 3RUOA 1IHTH 3OTPA 2YMSC 2VB0A 2XC0A 5LH8A 1QGFA 1SOZA 2OC1A 1SFQB 1O2HA 1ORFA 1DVAH 3SU6A 5HIYA 4KP0A 2A2QH 3M5LA 4X8UH 3FFGA 3DT0H 4AFZA 3S69A 3MTYA 1QB1A 1NC6A 2ZA5A 3ZV9A 4LXBH 5EG4A 4KKDA 5EPYA 1NM6A 3WWFA 5J4SA 1OKXA 1RD3B 1SGYE 3M5OA 2K8IA 1O2OA 1EXFA 2GT8A 2BVXH 3F0PA 3H7TA 1RJXB 3PLKA 2WV4A 2HPPH 3V3MA 1QJ7B 5DJ7A 1MCTA 3EAJA 3RMMH 5HKKD 3ZVDA 1TQ0B 1XUHA 3SOSA 1F92A 4HI3A 2V35A 2BX4A 2JH0D 2OBQA 2XYAA 1UVSH 2KCAA 1C5TA 3QX5H 4E7NA 6LPRA 3S7HB 4YT6H 2JJ1D 3PM3A 4B73A 2ZC9H 1KYNA 1TMUH 3K6ZA 1RTLA 2Z3EA 1AVXA 1GI2A 2ZTXA 3ZZ5A 3E90B 2FI5E 1UW7A 3QWCH 4FVDA 1K1LA 4IW4E 2F83A 1NRNH 2BY9X 4K69A 3LONA 1HAPH 1GMCF 1UJ1A 1GVKB 3GICB 2A5KA 1MCVA 1SLXB 1YPGH 2TRMA 1FI8A 1IQFA 3UOUA 3MH6A 1QRWA 2RA3A 1T32A 1THRH 3KHVA 1BT7A 4K60A 5SGAE 1GBFA 4Q7XA 1ZOMA 2BZ6H 3PYHA 3SI4H 2D2DA 1OYQA 2UWOA 3ATWA 2FIRH 4FUDA 3H09A 4TYDA 3Q3XA 4ZKSU 2O8TA 4ZKRU 1JRSA 1SSXA 2DE8A 5K7RA 2QYIA 2H9HA 1O2QA 1ZMNA 3SQHE 1XUJA 3V12A 2P93A 1SGTA 1H8HD 1L1JA 2B5TB 3MNBA 2IOTA 1UCYK 4MPXA 3SU4A 1LQDB 5A8XA 2YMSB 1QTFA 1TRYA 1EKBB 2J34A 1LPGB 1HBTH 2R2WU 2F91A 3MI4A 4CH8B 1ELVA 2GMTB 2IPQX 2OBOA 1NN6A 1E79D 2XC5A 1QQUA 3TH4H 4B6FA 1FQ3A 3RXUA 1WV7H 4WH6A 1OOKB 3RDZA 4H4FA 4AYYB 5JYIA 1GJ5H 2KFWA 1QBOA 4A1VA 3E0NB 1O2JA 2C90B 4ABHA 1Q31A 3EE0B 3SJ9A 4I31A 1GVLA 3N99A 3LDXH 2BOHB 1AWFH 4X1PU 2BQ6B 3RXGA 2XOKD 2A7JA 1WUNH 1O5BB 2GT7A 4OM9A 3UREA 1KDQA 5IYTA 7GCHG 3VPKA 4A6LA 5JBAS 1ESAA 3MHWU 3LJOA 1Z1JA 1O2MA 2KCYA 4BTUB 1WTGH 1KXFA 1KLTA 4AC9A 2F9OA 1L0ZA 5DPAA 1C1VH 1LHCH 9ESTA 1HAGE 1O5CB 4Z0KA 1AFQB 1C5QA 2ZHFH 2PUQH 1OWKA 1FY4A 4RN6A 2Y7XA 2YOLA 3LH1A 2XBYA 5GCHG 3MH5A 1O2IA 3R3GB 4RKOB 2EC9H 2QF5A 1V3XA 3TPIZ 3ZZ3A 4GHQA 3M37A 3UNQA 3LOXA 2CXVA 1VJAU 1TIOA 5EXLA 2BXTH 5FXLA 3LGYA 1X7AC 3GCHB 1BBRK 3M5MA 5FBIA 3SU0A 4CBNA 1AZZA 1CA8B 4PROA 1A5HA 3NXPA 1SGNE 1MKXK 1Z1IA 1O32A 1G32B 2J92A 1HAOH 4O03A 2J9NA 5DP5A 1GL0E 1O2RA 2VH0A 4GVUA 1MABB 1IQLA 5E0JA 4DCDA 1O3PB 1QL9A 3DCLA 4YXWD 2BLVA 3SJIA 2BY7X 2VIDA 1K9OE 2JETC 3F68H 4AGJA 1K1IA 2ZFTA 3F2HA 4FOUC 2HLDD 1C2GA 2WPLS 1EJNA 2ZQ2A 5EXNA 2VINA 4UFDH 2JETB 2ANMH 3AAUA 3LGVA 3TH2H 1NY22 2SGDE 4R0IA 4K8YA 3F3BA 2FOEA 2BY5X 1Y8TA 3MH4A 1S5SA 4Y0YE 1HPGA 1HAXB 1ABJH 2OXSA 1OYTH 5DP9A 5G4BA 4Y7AA 2GZ9A 2C8WB 1KXCA 2B0FA 3HGNA 3BEUA 1H8DH 1OSSA 1P2OA 4MPUA 1GJ9B 3BF6H 1BCUH 5C5OA 4Y7BA 1CSOE 1W7XH 1SFIA 2UUFB 4X6MA 2FOAA 1AFEH 2ZTZA 4B2CA 1GDUA 4GLYA 3HK6B 3ZZBA 2ZGHA 2W3KA 1AZ8A 3URCA 4QT8C 2FI3E 5LPFA 3MU4A 4MTBA 2FM2A 1L4ZA 1ZJDA 3PWCA 1WDIA 2SNVA 4YLQH 1O38A 4X8VH 1GJ6A 2GMTC 2F9PA 2ZU5A 3ZYEA 3M7QA 3T28A 1UK3A 5EQRA 1PQ8A 1HYLA 2HRVA 2F9NA 1PPBH 2J38A 3BTEE 2ZEBA 4FVBA 1BRUP 1WCZA 1HV7A 4LZ4B 4INKA 1QJ1B 3KYGA 4INLA 5A2MH 2KCPA 2VGCC 3BN9A 5C17A 1G3CA 2ESTE 5AF9H 2GGVB 4A92A 2ZWLH 2GD4B 2QAAA 1V2OT 4FU8A 1KMHB 4OGYA 1VITF 2QXIA 1XMNB 1NRRH 6GCHF 5T6DA 1SGPE 2H9EH 3TNTA 2JH6D 3BIUH 4ABBA 2VVVA 4WJG2 3UTUH 1GBMA 1BDAA 4NIXA 1OWHA 5F03A 3TIUA 4NSYA 1HJ9A 3VEQB 1ZHRA 1RRKA 2VIVA 1DITH 1P02A 1G30B 2A2XH 4WMDA 4YT7H 3MU5A 1O2LA 4ISOA 1P12E 4BAKB 5JBBS 4FUEA 2TGTA 1SQTA 4YO9A 4ABJA 1WQSA 2J98A 2BLQA 1IQMA 3F2FA 5EXMA 4DJZB 1S6FA 2JIZD 1SMFE 3LGUA 4AG1A 3GCHC 1LVBA 4A5TS 4K2YA 1LPZB 5DK1A 2A31A 3OAAD 1LHDH 3UR6A 2A7CA 3UPEA 3RLYH 1CHOG 2Z9GA 4IN2A 1COWD 1XKAC 1YPHE 4ZHLU 1NS3A 4ACAA 2Z94A 3RXKA 1LMWB 4WY3A 2JKHA 2HOBA 4RT0A 1TRMA 3FOAA 1P06A 2BM2A 5B6OA 4ABFA 1EPTB 1MQ6A 1S6LA 1SVPA 3T62A 2BTCE 3MOCA 1P01A 2Z9KA 5FL7D 1TABE 1H1BA 1N6XA 1AY6H 2ANKH 2RCEA 1O3FA 2GVFA 3KQ5A 3MU0A 1OHHD 4DVAU 2KM0A 1V2KT 1E35B 1ZR0A 3RXFA 1FONA 5C1YA 1C2EA 5JDUB 1K1OA 3SJ8A 1QB6A 1C1QA 1T4VH 3RM0H 2FPZA 3LGWA 1DM4B 3GDSA 4NZLA 1EZQA 1C5OH 2G4UA 3AW0A 4B74A 1GG6B 4AG2A 1JMOH 1O3HA 3OTJE 2LELA 2FOGA 4Z1MD 3STJA 1F7ZA 1G2LA 1GI8B 2SFAA 2Y5HA 2FX6A 3C27B 1BMFD 2LP6A 5EQSA 5GXPA 3BTQE 3P8FA 4VGCB 3OEED 4NWKA 1PQ5A 1DXPA 2AHME 4K3JA 1XXDA 3AASA 3RM2H 1L4DA 1O0DH 4FUCA 1GBLA 2PGBB 4IMZA 1A0LA 4IC5A 1Z7KA 2EY4C 4P02A 1O2SA 2BLOA 3M7UA 4KTSA 1P8VC 2F9VA 3B8JA 2YNBA 3VFEA 2ZU4A 1FPCH 1D4PB 2VIQA 5C0UA 3B23B 1C2MA 1CU1A 1EZSC 1O34A 7LPRA 2GCHG 1W7GH 2A7HA 4H42U 3RU4T 5GWZA 3PLBA 3O8DA 1YYY1 2ODPA 5C1UA 4AOQA 3QN7A 3S9BA 2A4GA 5DO4H 1YBWA 3EA7A 1SGQE 4HZHA 3OY5U 1DY9A 1IQNA 1AWHB 2ZHQH 3BTME 4M9FA 1IQJA 2G4TA 3A85A 1AI8H 3ZVFA 5TJXA 1MU8B 1VCPA 3ZV8A 2WUCA 4X1SU 3SQEE 5T1VA 1UCYH 2WYJA 1C2HA 2IPHA 1V2VT 2ANWA 3FO8D 1C5MD 1CQQA 3SNBA 1AFQC 1UMAH 4Y76A 2PSXA 3TK6A 1DWEH 2A32A 2C93B 1UVOA 1BRCE 4DY7B 1YF4A 3DFLA 9LPRA 1W11U 1ETSH 1VZQH 4IN1A 4MPWA 3VXEH 3PWBA 1MKWK 4MNWA 1FIWA 3PO1B 4ABIA 1D3PB 1L1GA 4CRBA 2WPDD 1C1NA 4U01A 2CF8H 3BEIB 1LVMA 3AW1A 1O3NA 2Z7FE 1XUKA 2SGFE 4AGKA 1AVGH 5ESBA 1SKYE 2TGPZ 1C5ZB 3KEEA 1P2NA 1AO5A 3UFAA 4MNXA 2ZGXH 4XOJA 1FY1A 1T8LA 5FAHA 1D3QB 2NU1E 3S9CA 4X6NA 4O3UA 1RIWC 2W6ID 3QGNB 4NGAH 3OY6U 1ZRKA 1GI0A 1GL1A 3RLWH 3VGCC 4JZFH 2UWPA 2K0QA 3SNDA 1SQRA 1V2WT 2RA0A 5L6NH 2AGGX 2JH5D 3C1KA 2GV6A 1LQEA 1CT2E 3ATLA 5AFYH 2XNIA 5EJZA 4TPYA 4UEHH 5HM2A 1HJ8A 2VWMA 1DWBH 1PPGE 2KX4A 2W6JD 2ZZUH 1E34B 3URDA 2FTLE 1P0SH 4WH8A 1GHAG 1SGCA 4I8GA 1G3DA 1V2PT 1GBJA 3JZ2B 2ZCHP 1RXPA 2LNCA 5FCKA 5FHTA 1J9CH 4XE4A 1GBBA 3U8OH 5DG6A 3A7WA 4X8SH 4ACBA 2OK5A 1KDQB 2J2UA 1FN8A 1QCPA 1O3DA 4BOHA 1ETTH 2HNTE 3GCOA 1A3EH 1GWAA 1CGIE 1BTXA 3OU0A 1UVPA 5DP8A 1GHVH 1DXWA 3I77A 2QXHA 4DT7B 2PV9B 1DPOA 2GDEH 5DSFA 3LGTA 5GIBA 2WYGA 4GCHG 2BZAA 1Y3WA 4FUGA 2VBCA 1QL8A 1WBGB 1P05A 3G01A 1GG6C 1TNKA 1YY3A 2BVSH 3TK9A 5DP6A 1O2TA 1VGCC 1UCYE 1GHAF 1SQOA 4Q4LA 4MPVA 5HM9A 2VWOA 1O3EA 4MNYA 4D7FA 3U1JB 2OQUA 3F1SB 2QN5T 1H9HE 3RXEA 1GCDA 1P3CA 5DP7A 3RXCA 1QFKH 4X6PA 3P70B 2Z9IA 1SI5H 1CGJE 1GJBB 1HFDA 1GBEA 4A1TA 1HAZB 1GHBF 1SC8U 2TPIZ 1VJ9U 2ALVA 1T8MA 1W12U 1YLNA 2B9LA 3FN8A 3PRDA 3RXQA 3BG4C 1MTWA 4JCNA 1ELEE 3K9XB 2BDBA 2DUCA 1DANH 3SHAH 1UK2A 1Y3UA 5E8EH 1AUTC 4ZH8A 5E2OA 2CMYA 2G5VA 1TBZH 2FO9A 2I6SA 1A1RA 2ZTYA 1TPPA 3SV8A 4TY7A 4UDWH 5L2ZH 2ZCLP 4MLFB 1O3IA 3ZZ7A 1XKBC 1O2VA 5JBCS 5AHGH 1E1RD 2I6QA 2QE7D 3TNSA 1KLIH 5GNDA 1J17T 2XTTB 3M7TA 4CR9A 2L6OA 1GJDB 1SGDE 4X2YA 3O8RA 3Q3KA 4NIWA 3RU4D 1C2DA 1B7XB 2CV3A 3TJOA 3VB6A 1GI6A 1MBQA 1TGTA 2NWNA 2XCFA 3VB3A 1SGEE 1Y5BT 4GHTA 2BVRH 1S0RA 2ZDAH 2DE9A 3F9FA 5EIYA 1O3LA 1RTFB 2BMGB 1GHBG 4JZDH 3L3TA 3K65B 3A89A 1LHGH 3LC3A 3HATH 3E8LA 3SO3A 1IQGA 2ZCKP 1K1MA 1ESTA 2H2ZA 1YPKH 1F5LA 1A4WH 1ZTLA 2FYQA 3RMOH 1VITH 3SYJA 2XC4A 3TITA 2XCNA 2RG3A 1C9PA 1P3EA 4DIIH 1CHOF 3PTNA 2AIPA 1O2ZA 1A7SA 1MD7A 1P11E 1TAWA 4Y6DA 3NKKA 1GCTB 1V2TT 1LHFH 1BB0B 4VGCC 1GDNA 4GPGA 5GJ4B 4KTCA 3VB4A 2SGAA 1UTQA 1O35A 1GGDB 3P95A 5E0HA 1HIAB 5EJ1A 2QF4A 4YOGA 4MQAA 2B8OH 3ITIA 8GCHG 1WOFA 1C5XB 3SUGA 3SN8A 1K22H 1ELCA 2AMPA 1NRSH 1EAIA 2CK3D 1C5WB 2RFKC 2RDLA 3HKJB 1AKSA 4FUJA 2RDEA 3SZEA 5L2YH 1GBDA 3KCGH 2GTBA 3AVZA 1DLKB 3A7ZA 2G81E 1BJVA 1MKWH 2Y81A 1SOTA 1GHZA 1P10A 2QF0A 2WPMS 1MTVA 2ZHDA 4ZKNU 2A4RA 3UY9A 1MMJN 4WXIA 5AVDA 4DG4A 1CHGA 5A8ZA 3KQBA 4AX9H 5B6LA 1ACBE 4LK4A 1O3BA 1TNLA 4WWYA 1JXPA 3L6PA 2BDIA 4F49A 1VKYA 1Y59T 4XD7D 1ELDE 1O36A 3NRLA 5ETXA 2FOFA 2THFB 1EJAA 2P8OB 1GJ4H 2F4LA 3STIA 1UTLM 2ZI2H 1ZYOA 3ATIA 3A7TA 4X2WA 1UTPA 2BY8X 1EASA 2A5IA 5EJLA 4NA9H 1WAYB 4GUXA 1BIOA 3P8OA 4X1QU 2BQWB 3V13A 3U28C 1VGCB 1LHEH 3SJKA 1W3CA 4NWLA 1P2KA 1QURH 1ZSLA 1DFPA 1N1LA 3SZNA 1GPZA 3Q00A 4BAQB 1P09A 2HWLB 1FUJA 3P92A 4CRDA 1TLDA 1AU8A 2HVXA 3TJVA 1RTKA 1XUGA 1EP5A 3SUEA 3E1XB 1JWTA 1NT1A 1TX6A 5AFZH 6CHAB 4I8HA 2VIWA 2TBSA 1HIAA 1VR1H 3M5NA 1MAXA 1UVUH 1BHXF 2XRCA 1AIXH 3MWIU 4OS5A 6CHAC 5T6GA 2W7SA 1FDPA 1DT2A 2P59A 4WMEA 4H6TA 1GI9B 4AFQA 3MNXA 5TCCA 2BD9A 1ARBA 4CR5A 2ZDKA 3FKSD 1O2WA 1O33A 1Y5AT 1TB6H 4OS6A 2QV1A 2FYRA 1V2ST 2IJD1 3IITA 2FESH 3W94A 1SGRE 1UHBB 1GDQA 1QY6A 5EODA 4U30A 5EGMA 2J5UA 1BTUA 4B1TA 2AGEX 2AEIH 1AHTH 2R0KA 1O2UA 5PTPA 1BTHH 3N7EA 3LGIA 4Y79A 1C5YB 1NZQH 3ZVEA 3UWJH 1NO9H 4Y0ZE 4XBBA 2M5TA 3DSOA 3ELAH 2GJGA 3SV9A 1TX8A 2VVCA 1AE8H 1Y5UT 1CGHA 3PMAB 3GY7A 5FPSA 1TBQH 5HXFA 3ZIAD 1FXYA 3A7XA 1YM0A 4NG9H 2A0QB 1BZXE 3D62A 1NPMA 2UUJB 5T3HA 1MU6B 4IGDA 2VIOA 4DURA 1DUAA 3OEHD 2EI7A 2TGAA 2XWBI 4I7YH 2FP7B 1EUFA 3KL6A 2Z9LA 2R2MB 1P2QA 2BDAA 1ANEA 3ODDA 2R9PA 1KY9A 4Y8ZA 3RXRA 1MZAA 1ZJKA 3MFJA 1MZDA 2H6MA 2ZNKH 2KAIA 3I29A 1EATA 1JOUB 2AFQB 2V3MA 3ATKA 3SORA 4OS4A 3CS0A 1CO7E 1ELBA 2NU3E 3QO6A 3MO3A 4NA7A 3UNRA 3LJJA 1A46H 1G3BA 3S9AA 2ZIQH 1DWDH 2GCTC 1V2MT 3SU3A 2EQNA 3S0NA 2BDYA 2ZECA 2XW9A 1YCPH 2ZGBH 3BTTE 2HLCA 4UFFH 1ID5H 4UD9H 5E2PA 3GY5A 4CHAB 2ZDVH 1TYNA 5BRRE 1DLEA 1ABIH 4WVPE 3TVJB 1SQAA 2EI6A 3HKIB 1KTSB 4UFGH 1GJCB 1V2QT 3KQCA 4ZXYH 3MO6A 2FTMA 3A83A 2Q6FA 1SL3A 3QDZB 1K28D 3IG6B 1HAVB 1BTWA 4GSOA 1O2PA 3A82A 4JZEH 2A45B 4YESB 3TJUA 1FY3A 2R0LA 1ETRH 4UE7H 1C1RA 5IDKA 5HMAA 1HAHH 4WMFA 2A4OA 4B71A 3U9AH 1BOQA 4AFSA 3FZDA 5EW1H 1EFRD 2P95A 1O30A 2ULLA 1SLUB 2P8OC 1K1NA 3SI3H 4BAMB 2FS8A 3EE7A 3EYDA 2C3SA 1S6HA 3E16B 4IC6A 1OP0A 1V6DA 2NU2E 1HRTH 1W0YH 1GMCG 1JIRA 1S0QA 3VB5A 3U8RH 3FP6E 1KXAA 4X1RU 4YOIA 3MQKC 1XM1A 2EEKA 1F0SA 5HGGA 1HNEE 2ZP0H 1YPHC 1O5GH 3RXPA 5IK2D 1OWIA 3UUZA 5FBEA 1F2SE 1QQ4A 1OPHB 3UB0A 3UQVA 4FUIA 3SUFA 1UHBA 2KZ4A 1CE5A 1EAWA 2CHAC 2Z3DA 1M9UA 1NBMD 3PV4A 3ZZ4A 1TGNA 5K0HA 1CBWB 1PYTC 2ZHEH 4FETA 5JBTA 1QNJA 1FY8E 1TPAE 2GDDA 3RXJA 1FAXA 2F3CE 2PTNA 4ISNA 3TGKE 3NZIA 4ABDA 1LCYA 3U69H 4Y71A 5JPMH 2K1QA 1NTPA 1D6RA 4HTCH 5FX6A 3SNAA 1HCGA 4YLUA 5CHAC 1MUEB 4K5ZA 1C2FA 1FX0B 2YNAA 4BXSA 4ISLA 3ODFA 2HPQH 3O8CA 4X2VA 2WZQA 2BDGA 2ZDNA 3M35A 1ZHMA 1W0JD 3HPTB 4ZUHA 4DOQA 1VITG 2H5CA 5GDSH 1OX1A 3V7TA 4CRAA 4ASHA 1BJUA 8ESTE 4X2XA 3A8AA 3CENA 3SGQE 4GAWA 1EQ9A 1O3AA 4XBCA 2FLRH 2WPJS 2ODYB 1HB0B 1O31A 1LO6A 1T8NA 1UTMA 1GHYH 4I32A 1ELAA 3PV5A 3RXOA 1Q2WA 1EX3A 1PQ7A 2VH6A 3BTGE 4RKJB 1SBWA 1MKXH 1GJAB 1QA0A 3SW2B 1C2LA 1TGBA 3MO9A 1YPMH 2BQ7B 2HNTF 4ZAEA 4ESTE 4JZ1A 5C5NA 5E0GA 2FOMB 2SGQE 1MTUA 1MQ5A 1YPEH 3MU1A 1QBNA 1WSSH 1E38B 1EP6A 3N7DA 3U1IB 4I8LA 1P2JA 1OWJA 4CRGA 1HGTH 1FNIA 1FZZA 1O5DH 5F53A 1E1QD 1OWEA 2VU8E 3ATMA 1NESE 2PKSC 3DHKH 3I78A 1FN6A 5KECA 1GMHG 1DSTA 1IQHA 1J15A 1LTOA 2G52A 2PKAB 1UO6A 4TPIZ 1C2IA 1V2RT 1ARCA 3KGPA 5FCRA 3LIWA 2PW8H 2H5DA 3PMHB 1TMTH 3GCNA 4I33A 4U32A 2OD3B 1F0RA 1A0HB 2FOBA 4Q2KA 3AAVA 3T29A 1ZGVA 2PHBA 2GP9B 2EA3A 3A8CA 2Y82A 4WXVA 4J2YB 1YCPM 1GI5A 5C3NA 5F8TA 3R0FA 3L33A 1ZTJA 1IQIA 2W3IA 1KTTB 3RXMA 3VB7A 1EJMA 1B0FA 3SNCA 1AQ7A 4AN7A 5FX5A 3A7YA 1CA0B 1H8IH 1O3JA 2OTVA 4K1EA 5DP3A 4IS5A 3ZVCA 3AK5A 1K0HA 1YPLH 4Q63A 2J94A 5F8XA 1QHRB 1W2KH 2L74A 3RXIA 2OINA 1ANCA 2QF3A 5CHAB 1EZUC 2WV9A 4X6OA 3GDUA 3MNCA 3RXSA 3T26A 2J95A 3K2UA 2VVUA 1XVMA 1F0TA 1DUEA 1DWCH 1S83A 1A2CH 3FZZA 2OP9A 1KXBA 1WXRA 1PYTD 1S81A 2ZDLA 1SLVB 1GMHF 2KR7A 5EQQA 1DICA 4XRNA 1OP2A 2CHAB 3JZ1B 1LDTT 2Y5GA 2YMSD 1O3GA 5ABWA 4ABGA 2Y6TA 1BMLA 2QC2A 2GKVE 2ZPSA 2AYWA 3TU7H 1EOJA 1UVTH 1LKBA 2Q1JA 3KNXA 4ISHH 3RXAA 2FEQH 3H5CB 1T8OA 2XXLA 3QZRA 2ZKSA 3MNSA 5L30H 1C4Y2 1C1SA 1JBUH 4IMQA 4ZMAH 1IQKA 1V2LT 5C67A 1HAIH 1C1UH 2ZHWH 5C2ZA 3BTHE 1YGCH 1MTNC 3A80A 3SGBE 5GCHF 3W95A 3TK5A 1MAYA 2VWNA 3EGKH 5LGOA 1YLCA 1P2IA 4OGXA 2ZQ1A 1P9SA 2Y7ZA 1DDJA 5C1XA 1XX9A 4DIHH 1G9IE 4NZQA 1UTJA 4JK5A 3SV7A 1BBRE 1BUIA 3U98H 2OLGA 2WINI 2BD4A 8KME2 3SJOA 1C5RA 3BTFE 2FDAA 1P57B 3DUXH 2QXJA 1B5GH 4ZKOU 3ESTA 4XFQA 2VNTA 5EPNA 3F2GA 2ZPQA 1MH0A 3A7VA 4D76A 1C5NH 1HJAC 2OC8A 3CS7A 4GCHF 5DKMA 1EB1H 4B2AA 2XBWA 4I8JA 4CH2B 1ZPBA 1HJAB 3FP7E 3SU5A 4JMYA 1ESBA 2OC0A 1AMHA 5KGOA 3ZVGA 1ELFA 2V6NA 4NA8A 3A87A 1SHHB 3S7KB 5CE1A 1GGDC 4Q80A 4BXWA 4AFUA 1GBTA 3TGJE 4JYTA 1NFWA 4HG6A 4JZIA 1KIGH 4JYVH 1SGIB 4FXGH 2ILNA 3A81A 4H6SB 5C20A 1BHXB 1SHYA 1ZHPA 2BB4A 3E6PH 2BDHA 3LH3A 3RMNH 4D9QA 3E0PB 1GI4A 1ZPZA 1IOEA 2XWAA 4FUBA 2GCTB 1AKSB 1ELTA 4LOYH 2ZF0H 2R3YA 3QK1A 1OP8A 5F6MA 3GY4A 1BA8B 1IAUA 1AN1E 1D9IA 1WQVH 1HDTH 2PFEA 4E05H 2AH4X 1SGFA 2SNWA 1BRBE 1G3EA 3LU9B 1DSUA 5EU8A 4KTUA 1A5GH 3UIRA 3CNRA 2A1DB 4DT4A 4E7RG 2B7DH 4TY6A 5A0AE 2GZ8A 3GY3A 2P3FH 3PRBA 2J97A 2Y5FA 3Q77A 4RT1A 3ZZ8A 1Z71A 4UONA 4CRFA 1AE5A 2P3UB 1GJ7B 2WPIS 1V2NT 4DW2U 4U2WA 1GBKA 4O97A 1H4WA 3UQOA 2ANYA 1O39A 5FPTA 4BTTB 1BITA 2PUXB 2P16A 1DY8A 3BV9B 1P04A 5J4QA 2PP6A 1O5FH 2PLXA 4R8TB 3ZVBA 2BD3A 7ESTE 2UUKB 1ZSJA 4O3TA 3DSPA 3W1EA 2BOKA 1HXFH 3RXDA 4NFEA 1Y3YA 3M3SA 6GCHG 1ZMJA 3QZQA 5LPEA 4KELA 2OUAA 3BG8A 1C1PA 2C4FH 1TNIA 1NU7B 4B75A 3UNSA 1XXFA 3P17H 1EB2A 5FPYA 2ZFPH 3GYLB 1GCTC 1HUTH 4ZHMU 1Y3XA 3GY8A 1D3DB 3TGIE 1S82A 3MH7A 4CBOA 1PPHE 3B9FH 3RXLA 2F9BH 3PB1E 3E3TA 3M3VA 1TNGA 3ZZDA 3RXBA 2BY6X 1INCA 2PGQB 1O5AB 1GI7B 2SGPE 2CF9H 1MD8A 1P03A 1T7CA 2H1UA 1PQAA 4E06H 3LC5A 4INHA 3M36A 2CGAA 1TA6A 1C4V2 4B2BA 1O37A 1C5VA 2AERH 2C8YB 1AVWA 5JB8S 1O2XA 2AS9A 3ZZ6A 1WYKA 3VG8A 1VCQA 1FY5A 3F9GA 2ODQA 3H7OA 4D8NA 1BRAA 3PTBA 1QRXA 2G51A 3D49H 2XBXA 4OS1A 1ZSKA 1C9TA 1DE7H 4P00A 1BQYA 2G5NA 1TA2A 1BTPA 4M7GA 4TT3D 3MU8A 1IHSH 1Z6EA 3RXHA 1TFXA 3GCTF 1BBRH 4CHAC 2Q6GA 2QXGA 1KLJH 1C5LH 2A4QA 2P94A 1TGSZ 5C0TA 4UFEH 2Q6DA 3F6UH 4TWYA 1BTYA 3ZZ9A 2W5EA 4F4OC 1C5PA 1TPSA 1KXDA 3KF2A 3WY8A 4A1XA 3SV2H 5CMXH 2Z3CA 5A0BA 3P8GA 2Y80A 1C5SA 1H9LB 1Q3XA 1TBRH 4BTIB 1YPJH 2JJ2D 5T6FA 3RMLH 1KXEA 1DX5M 1ZRBA 3QLPH 2Z6BD 2ZU1A 2QCYA 2O8LA 4ZHAA 2STAE 4ABEA 2BX3A 1EPTA 4FU7A 1Z8JB 2ZFQH 4FU9A 2AMQA 2ZU3A 5DP4A 3PMJA 1FV9A 2XBVA 1E36B 2V3HH 2BXUH 2FODA 1C1OA 2WSSD 3A8BA 4FUFA 4NSVA 3U8TH 3RXTA 3M61U 1NRPH 3MMGA 4AZ2B 1RFNA 1GMDG 1GI1A 1AGJA 1TPOA 2PR3A 1GVZA 4DGJA 1N6YA 2ZGCA 3A88A 1ANDA 1BMAA 2C8XB 1S85A 5GPIB 3O8BA 1P2MA 2J4IA 1J16A 1TWXB 2FX4A 1C2KA 4TSFD 3T2NA 1UTNA
chains in the Genus database with same CATH topology
1GHWH 1K1PA 5A0CA 2R3UA 2VGCB 1YCPK 2WPKS 1C2JA 3ENSB 3ZZAA 8LPRA 3LPRA 4K8BA 1CA0C 1NFXA 1TGCA 1GI3A 1PPEE 1W8BH 1RS0A 4K1TA 1T31A 4JK6A 3SBKA 4AORA 1ANBA 1XVOA 1SR5C 4ABAA 7GCHF 1WU1A 2LPRA 4NIVA 3GISB 4NIYA 1QJ6B 2BHGA 3FP8E 4SGBE 2C8ZB 3HGPA 4OS2A 4I8KA 1C5UA 1U6QA 1L2EA 2HNTC 1ZMLA 1O2KA 3K6YA 2OQ5A 2WUBA 2F9UA 3FAOA 3NPSA 4TWWA 4BANB 1FLEE 4K1SA 1O2YA 2BDCA 1C1WH 1NU9A 3NWUA 4RSPA 2BD7A 5LPRA 2QIQA 3SGAE 5EW2H 1L1NA 1ZZZA 1SPJA 2GCHF 1A3BH 4XSKU 4AYVB 1O3MA 5DGJA 2O8UA 3GDVA 3QGJA 1N8OC 1EPTC 3PROA 4MNVA 3BSQA 1OWDA 1O2NA 3D65E 3LKWA 2UWLA 2HALA 2IN2A 2PKAA 4HGCA 2G8TA 2Z9JA 2W26A 3EA8A 3EDXB 1FMGA 1ZTKA 1HLTH 3NUMA 2VIPA 1O3KA 1O5EH 1GJ8B 4BAOB 2PTCE 3GOVB 1O3OA 4Y11E 3SHCH 1NRQH 2ZFRH 3P6ZB 3NCLA 2IJOB 1YC0A 3OSYA 4AB8A 2CJIA 5BPEA 3ZZCA 4ZROA 1MTSA 3DD2H 1QL7A 3KQDA 2SGEE 7KMEH 2FZZA 1Z8IB 4AB9A 1Z8RA 4NCYA 1NROH 1OXGA 2FMJA 1TALA 1IQEA 2EI8A 1FAKH 2OCVB 4CREA 1C1TA 3SUDA 1EAXA 1MBMA 1DS2E 3FANA 1T4UH 2QGRA 3KQEA 3QUMP 1ZPCA 1AB9B 1LPKB 4Q7YA 2NU4E 1DOJA 1K1JA 6ESTA 3SU2A 1O3CA 3UOPA 2GV7A 1GBAA 4BAHB 3Q3YA 1HAYB 1QIXB 1QR3E 2PWXA 1ELGA 3DA9B 1GHXH 3IWMA 3OYPA 4YZUA 4D9RA 2ZU2A 1GBCA 1WTHD 1RGQA 3T5FH 1D6WA 1VCWA 2NU0E 4MG3A 1AD8H 1CT4E 4JYUH 3GY2A 1GBIA 4J1YA 4Z6AH 1NFUA 4NFFA 3NK8A 2ZFSA 5HYOA 4LZ1H 2D8WA 1JRTA 1B0EA 1TMBH 1BTZA 2ZO3H 5F8ZA 2ZGJA 1LVYA 3ZYDA 3BTKE 3BIVH 1G2MA 3ZVAA 2V0BA 2QY0B 1C4U2 1QA7A 3VXFH 8GCHF 5ESTE 1LVOA 1GBHA 1QBVH 2PKSB 3TJNA 3A86A 3P8NA 2FI4E 1FPHH 4X8TH 4Y8YA 3M3TA 1UK4A 2FOHA 1SG8B 2H9TH 1JIMA 3F9EA 1PPFE 1FIZA 1Z8GA 1THSH 1SLWB 3PMBB 1EOLA 2VJ1A 1S84A 1SB1H 1AUJA 4O9VA 3SV6A 1W13U 1QRZA 1CBWC 4D7GA 1PPCE 1TE0A 2GX4A 3SNEA 2KAIB 2BD5A 1PFXC 2O9QA 1EAUA 1TOMH 1XUIA 5EOKA 1THPB 3RC5A 1H9IE 4THNH 4YM9A 2W7UA 5I46H 1TNHA 1CT0E 3PLPA 1YP9A 5I25A 1F0UA 1E0FD 1V2UT 2CN0H 2O8WA 1UTOA 1ZGIA 1OS8A 2ZG0H 1FJSA 2TGDA 3FVFB 4MDSA 5H4IB 2FXRA 2BYAX 1GMDF 3D23A 3PO1C 3QTVH 2AIQA 1PPZA 1A5IA 1W0ZU 2D1JA 3BTDE 4A7IB 2GZ7A 3GY6A 4IBLH 1YLDA 1NFYA 2P3TB 1W14U 3VGCB 1KSNA 3TLOA 4YOJA 1N8OB 1PJPA 1P9UA 2AGIX 1TRNA 3T25A 3BEFB 3EQ0H 3MYWA 5JB9S 4XBDA 3F9HA 1HXEH 4YTAA 2G55A 2D26C 4HFPB 2ALPA 4CRCA 1K2I1 3KN2A 1RIWB 2ZPRA 1C1MA 1F5RA 3A8DA 3RP2A 3RXVA 2BLWA 3V0XA 3RU4E 3LT3A 1TQ7B 1HAVA 1CVWH 2BD8A 3TH3H 2O8MA 2WV5A 2UUYA 2VWLA 3HK3B 5TCAA 1MTNB 4FUHA 4OS7A 4Q7ZA 1TX7A 5A09A 2OC7A 3GCTG 3KIDU 4WF8A 2FOCA 1J14A 3QTOH 1TONA 2A5AA 2ASUB 4X0WU 1BMNH 4X1NU 3BG4B 4SGAE 2TIOA 1A61H 2BD2A 4ZXXH 1YKTA 2V3OH 1SGFG 1O2GH 3SU1A 1UTKA 1E37B 3CP7A 4Y10E 1W10U 3A84A 1TOCB 4B76A 4ISIH 3RC4A 4KGAA 2PSYA 1V2JT 1G36A 2WPHS 1A0JA 4XDEA 1G37A 1J8AA 2HGTH 1BMMH 1Z6JH 3Q76A 1F5KU 2FLBH 1XUFA 1LKAA 1ZLRA 4BNRA 3RC6A 1Y3VA 1TNJA 3T27A 1D3TB 3BTWE 3N7OA 2FWWA 3GYMA 1AB9C 2G00A 2ZDMA 4Y8XA 5A8YA 2STBE 3UWIA 1EZXC 1QB9A 3UR9A 1K21H 3E91A 3OX7U 3DFJA 4MVNA 3EA9A 2AMDA 2ZFFH 2FS9A 2QA9E 3RUOA 1IHTH 2VB0A 2XC0A 5LH8A 1QGFA 1SOZA 2OC1A 1SFQB 1O2HA 1ORFA 1DVAH 3SU6A 4KP0A 2A2QH 3M5LA 4X8UH 3FFGA 3DT0H 4AFZA 3S69A 3MTYA 1QB1A 1NC6A 2ZA5A 3ZV9A 4LXBH 5EG4A 4KKDA 5EPYA 1NM6A 5J4SA 1OKXA 1RD3B 1SGYE 3M5OA 1O2OA 1EXFA 2GT8A 2BVXH 3H7TA 1RJXB 3PLKA 2WV4A 2HPPH 3V3MA 1QJ7B 5DJ7A 1MCTA 3EAJA 3RMMH 3ZVDA 1TQ0B 1XUHA 3SOSA 1F92A 4HI3A 2V35A 2BX4A 2JH0D 2OBQA 2XYAA 1UVSH 6LPRA 1C5TA 3QX5H 4E7NA 3S7HB 4YT6H 3PM3A 4B73A 2ZC9H 1KYNA 1TMUH 3K6ZA 1RTLA 2Z3EA 1AVXA 1GI2A 2ZTXA 3ZZ5A 3E90B 2FI5E 3QWCH 4FVDA 1K1LA 4IW4E 2F83A 1NRNH 2BY9X 4K69A 3LONA 1HAPH 1GMCF 1UJ1A 1GVKB 3GICB 2A5KA 1MCVA 1SLXB 1YPGH 2TRMA 1FI8A 1IQFA 3UOUA 3MH6A 1QRWA 2RA3A 1T32A 1THRH 3KHVA 1BT7A 4K60A 5SGAE 1GBFA 4Q7XA 1ZOMA 2BZ6H 3PYHA 3SI4H 2D2DA 1OYQA 2UWOA 3ATWA 2FIRH 4FUDA 4TYDA 3Q3XA 4ZKSU 2O8TA 4ZKRU 1JRSA 1SSXA 2DE8A 5K7RA 2QYIA 2H9HA 1O2QA 1ZMNA 3SQHE 1XUJA 3V12A 2P93A 1SGTA 1L1JA 2B5TB 3MNBA 2IOTA 1UCYK 4MPXA 3SU4A 1LQDB 5A8XA 1QTFA 1TRYA 1EKBB 2J34A 1LPGB 1HBTH 2R2WU 2F91A 3MI4A 4CH8B 1ELVA 2GMTB 2OBOA 1NN6A 2XC5A 1QQUA 3TH4H 1FQ3A 3RXUA 1WV7H 4WH6A 1OOKB 3RDZA 4H4FA 4AYYB 5JYIA 1GJ5H 1QBOA 4A1VA 3E0NB 1O2JA 2C90B 4ABHA 1Q31A 3EE0B 3SJ9A 4I31A 1GVLA 3LDXH 2BOHB 1AWFH 4X1PU 2BQ6B 3RXGA 2A7JA 1WUNH 1O5BB 2GT7A 3UREA 1KDQA 5IYTA 7GCHG 3VPKA 4A6LA 5JBAS 1ESAA 3MHWU 3LJOA 1Z1JA 1O2MA 4BTUB 1WTGH 1KXFA 1KLTA 2F9OA 1L0ZA 5DPAA 1C1VH 1LHCH 9ESTA 1HAGE 1O5CB 4Z0KA 1AFQB 1C5QA 2ZHFH 2PUQH 1OWKA 1FY4A 4RN6A 2Y7XA 2YOLA 3LH1A 2XBYA 5GCHG 3MH5A 1O2IA 3R3GB 4RKOB 2EC9H 1V3XA 3TPIZ 3ZZ3A 4GHQA 3M37A 3UNQA 3LOXA 2CXVA 1VJAU 1TIOA 5EXLA 2BXTH 5FXLA 3LGYA 1X7AC 3GCHB 1BBRK 3M5MA 5FBIA 3SU0A 4CBNA 1AZZA 1CA8B 4PROA 1A5HA 3NXPA 1SGNE 1MKXK 1Z1IA 1O32A 1G32B 2J92A 1HAOH 4O03A 2J9NA 5DP5A 1GL0E 1O2RA 2VH0A 4GVUA 1IQLA 5E0JA 4DCDA 1O3PB 1QL9A 2BLVA 3SJIA 2BY7X 2VIDA 1K9OE 2JETC 3F68H 4AGJA 1K1IA 2ZFTA 1C2GA 2WPLS 1EJNA 2ZQ2A 5EXNA 2VINA 4UFDH 2JETB 2ANMH 3AAUA 3LGVA 3TH2H 1NY22 2SGDE 4R0IA 4K8YA 2FOEA 2BY5X 1Y8TA 3MH4A 1S5SA 4Y0YE 1HPGA 1HAXB 1ABJH 2OXSA 1OYTH 5DP9A 5G4BA 4Y7AA 2GZ9A 2C8WB 1KXCA 2B0FA 3HGNA 3BEUA 1H8DH 1OSSA 1P2OA 4MPUA 1GJ9B 3BF6H 1BCUH 5C5OA 4Y7BA 1CSOE 1W7XH 1SFIA 2UUFB 4X6MA 2FOAA 1AFEH 2ZTZA 4B2CA 1GDUA 4GLYA 3HK6B 3ZZBA 2ZGHA 2W3KA 1AZ8A 3URCA 4QT8C 2FI3E 5LPFA 3MU4A 4MTBA 2FM2A 1L4ZA 1ZJDA 3PWCA 2SNVA 4YLQH 1O38A 4X8VH 1GJ6A 2GMTC 2F9PA 2ZU5A 3ZYEA 3M7QA 3T28A 1UK3A 5EQRA 1PQ8A 1HYLA 2HRVA 2F9NA 1PPBH 2J38A 3BTEE 2ZEBA 4FVBA 1BRUP 1WCZA 1HV7A 4LZ4B 4INKA 1QJ1B 4INLA 5A2MH 2VGCC 3BN9A 1G3CA 2ESTE 5AF9H 2GGVB 4A92A 2ZWLH 2GD4B 2QAAA 1V2OT 4FU8A 4OGYA 1VITF 2QXIA 1XMNB 1NRRH 6GCHF 5T6DA 1SGPE 2H9EH 3TNTA 2JH6D 3BIUH 4ABBA 2VVVA 4WJG2 3UTUH 1GBMA 1BDAA 4NIXA 1OWHA 5F03A 3TIUA 4NSYA 1HJ9A 3VEQB 1ZHRA 1RRKA 2VIVA 1DITH 1P02A 1G30B 2A2XH 4WMDA 4YT7H 3MU5A 1O2LA 4ISOA 1P12E 4BAKB 5JBBS 4FUEA 2TGTA 1SQTA 4YO9A 4ABJA 1WQSA 2BLQA 1IQMA 5EXMA 4DJZB 1S6FA 1SMFE 3LGUA 4AG1A 3GCHC 1LVBA 4A5TS 4K2YA 1LPZB 5DK1A 2A31A 1LHDH 3UR6A 2A7CA 3UPEA 3RLYH 1CHOG 2Z9GA 4IN2A 1XKAC 1YPHE 4ZHLU 1NS3A 2Z94A 3RXKA 1LMWB 4WY3A 2JKHA 2HOBA 1TRMA 1P06A 2BM2A 5B6OA 4ABFA 1EPTB 1MQ6A 1SVPA 3T62A 2BTCE 3MOCA 1P01A 2Z9KA 1TABE 1H1BA 1N6XA 1AY6H 2ANKH 2RCEA 1O3FA 2GVFA 4DVAU 3MU0A 1V2KT 1E35B 1ZR0A 3RXFA 1FONA 5C1YA 1C2EA 5JDUB 1K1OA 3SJ8A 1QB6A 1C1QA 1T4VH 3RM0H 2FPZA 3LGWA 1DM4B 3GDSA 4NZLA 1EZQA 1C5OH 2G4UA 3AW0A 4B74A 1GG6B 4AG2A 1JMOH 1O3HA 3OTJE 2FOGA 3STJA 1F7ZA 1G2LA 1GI8B 2SFAA 2Y5HA 2FX6A 3C27B 5EQSA 5GXPA 3BTQE 3P8FA 4VGCB 4NWKA 1PQ5A 1DXPA 4K3JA 1XXDA 3AASA 3RM2H 1L4DA 1O0DH 4FUCA 1GBLA 2PGBB 4IMZA 1A0LA 4IC5A 1Z7KA 1O2SA 2BLOA 3M7UA 4KTSA 1P8VC 2F9VA 3B8JA 2YNBA 3VFEA 2ZU4A 1FPCH 1D4PB 2VIQA 3B23B 1C2MA 1CU1A 1EZSC 1O34A 7LPRA 2GCHG 1W7GH 2A7HA 4H42U 3RU4T 5GWZA 3PLBA 3O8DA 1YYY1 2ODPA 5C1UA 4AOQA 3QN7A 3S9BA 2A4GA 5DO4H 1YBWA 3EA7A 1SGQE 4HZHA 3OY5U 1DY9A 1IQNA 1AWHB 2ZHQH 3BTME 1IQJA 2G4TA 3A85A 1AI8H 3ZVFA 5TJXA 1MU8B 1VCPA 3ZV8A 2WUCA 4X1SU 3SQEE 1UCYH 2WYJA 1C2HA 2IPHA 1V2VT 2ANWA 1C5MD 1CQQA 3SNBA 1AFQC 1UMAH 4Y76A 2PSXA 3TK6A 1DWEH 2A32A 2C93B 1UVOA 1BRCE 4DY7B 1YF4A 3DFLA 9LPRA 1W11U 1ETSH 1VZQH 4IN1A 4MPWA 3VXEH 3PWBA 1MKWK 4MNWA 1FIWA 3PO1B 4ABIA 1D3PB 1L1GA 4CRBA 1C1NA 4U01A 2CF8H 3BEIB 1LVMA 3AW1A 1O3NA 2Z7FE 1XUKA 2SGFE 4AGKA 1AVGH 5ESBA 2TGPZ 1C5ZB 3KEEA 1P2NA 1AO5A 3UFAA 4MNXA 2ZGXH 4XOJA 1FY1A 1T8LA 5FAHA 1D3QB 2NU1E 3S9CA 4X6NA 4O3UA 1RIWC 3QGNB 4NGAH 3OY6U 1ZRKA 1GI0A 1GL1A 3RLWH 3VGCC 4JZFH 2UWPA 3SNDA 1V2WT 2RA0A 5L6NH 2AGGX 2JH5D 3C1KA 2GV6A 1LQEA 1CT2E 3ATLA 5AFYH 2XNIA 4TPYA 4UEHH 5HM2A 1HJ8A 2VWMA 1DWBH 1PPGE 2ZZUH 1E34B 3URDA 2FTLE 1P0SH 4WH8A 1GHAG 1SGCA 4I8GA 1G3DA 1V2PT 1GBJA 3JZ2B 2ZCHP 1RXPA 2LNCA 5FCKA 5FHTA 1J9CH 4XE4A 1GBBA 3U8OH 5DG6A 3A7WA 4X8SH 1KDQB 2J2UA 1FN8A 1QCPA 1O3DA 4BOHA 1ETTH 2HNTE 3GCOA 1A3EH 1GWAA 1CGIE 1BTXA 3OU0A 1UVPA 5DP8A 1GHVH 1DXWA 3I77A 2QXHA 4DT7B 2PV9B 1DPOA 2GDEH 3LGTA 5GIBA 2WYGA 4GCHG 2BZAA 1Y3WA 4FUGA 1QL8A 1WBGB 1P05A 3G01A 1GG6C 1TNKA 2BVSH 3TK9A 5DP6A 1O2TA 1VGCC<