1SGCA

The 1.8 angstroms structure of the complex between chymostatin and streptomyces griseus protease a. a model for serine protease catalytic tetrahedral intermediates
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
181
structure length
181
Chain Sequence
b'IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE A
publication title The 1.8 A structure of the complex between chymostatin and Streptomyces griseus protease A. A model for serine protease catalytic tetrahedral intermediates.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1986-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgcA01
2O8UA 3UOPA 4OS6A 2C93B 3S9AA 3TPIZ 2D2DA 1C4U2 1EZUC 1WBGB 5DKMA 1B0EA 1KSNA 3A8CA 4BAOB 3MNCA 4MNYA 5C1YA 4Y8ZA 5DP8A 1N1LA 2OBQA 1HXFH 2VIVA 1QJ6B 2SGDE 1O2ZA 1P09A 2A4RA 3VB3A 1THPB 2HLCA 2ZQ2A 1NC6A 1UCYK 4E7RG 1KYNA 4KKDA 2UUKB 4WXVA 3LKWA 1YPLH 3NZIA 2ZFRH 4GPGA 2B5TB 2GKVE 4JZFH 1GHBF 4ABDA 5F03A 6CHAC 1ZTJA 4I8KA 1BHXF 2XBWA 3A8BA 4X1PU 3VB5A 3MO6A 3SORA 1A3BH 1AWHB 1NRSH 2BLWA 2FESH 1QL7A 2FODA 1QRWA 7GCHG 1SHYA 1UTLM 2VIWA 1C1SA 1FXYA 2FYQA 1MBQA 5C2ZA 1VITF 3S69A 3HKJB 2ZHQH 2GDEH 2VVVA 2RA3A 1CGJE 1TONA 1PPCE 4IN1A 4ZAEA 4ABHA 1W12U 1GVKB 4OS2A 2ZGHA 1VCPA 1ANDA 2CF9H 1UK3A 2ZU2A 1QJ7B 3RU4E 4O97A 1ZTLA 1XMNB 3A7YA 4UEHH 3SV7A 1UVUH 1DM4B 3RMOH 1MH0A 1DT2A 4WMFA 1Z8IB 1DY9A 2Z9JA 1P11E 1V2VT 5T6DA 1K1LA 1BMLA 1TOCB 2VWNA 4H6TA 3SV2H 1SBWA 2XC5A 1CHGA 3T62A 1D4PB 2SGFE 3EA9A 1MU8B 1SGNE 4NG9H 2A5AA 1TGCA 3PTBA 1P10A 4NIVA 1OX1A 3EE0B 1UTOA 1DSTA 1ZMLA 2RA0A 3OY6U 1NFUA 1P0SH 4JYUH 3ZZBA 4FVBA 1G3EA 1TIOA 1Y3YA 1DWDH 3Q76A 4ABJA 3DHKH 1TAWA 2QXHA 1O2SA 2OP9A 4YLUA 2BXUH 2PUQH 4RN6A 1MD8A 4ABEA 1C2KA 1F2SE 4IW4E 3UPEA 1AD8H 1QRXA 1LPKB 1A5HA 1O38A 2BZAA 1ACBE 3EA8A 2FDAA 3VGCC 5L2YH 3O8DA 1GMHF 2A1DB 1ESTA 2HVXA 3D49H 1MKWH 4UE7H 4NSVA 5JBAS 3SQEE 3L33A 1O5AB 1XVMA 1S6FA 4HTCH 5DJ7A 2F9VA 6CHAB 1SC8U 3QGJA 4K1EA 4FUHA 2ZCKP 4INKA 2GTBA 1J15A 1EXFA 2O8WA 2FOCA 1TMBH 1TGSZ 4U32A 1ABIH 1FY1A 1UTMA 1ARCA 3A8DA 4XDEA 4JK6A 4Y6DA 1WSSH 4THNH 1DLEA 2BLOA 3QDZB 4ABAA 1SGYE 3ZZ6A 1NT1A 2C8XB 1O3LA 4ABFA 3LT3A 3UNQA 3BTEE 1GI4A 1O5GH 1TB6H 2BD9A 1KDQA 2XWBI 1NPMA 3OU0A 3UNRA 5C5OA 3VEQB 2SNWA 1RRKA 1A5IA 1O3BA 1YKTA 1WTHD 2D1JA 1P01A 1FN6A 3NPSA 4QT8C 4HZHA 1GCDA 1P12E 4CRCA 2ZDKA 3KN2A 5F6MA 1C9PA 1C5XB 1TMUH 2AGGX 1BQYA 1FIZA 3BG8A 1DOJA 1SL3A 2WPJS 4UD9H 3UTUH 1F5LA 1C4Y2 3BSQA 6GCHG 3T2NA 5J4QA 3VB7A 2PGQB 2A32A 2ZEBA 4OS5A 2Q6GA 1RTKA 2AYWA 2V35A 1DX5M 4YTAA 4ABIA 1INCA 4B2CA 3GY2A 1K1OA 3A81A 4K69A 1YLDA 2GGVB 2ZKSA 5TCCA 3E1XB 3A89A 1QJ1B 1BBRE 2HPQH 3GY4A 1BMNH 1YCPM 3BEFB 4X0WU 3L6PA 3Q77A 2I6SA 2GCTC 1N6YA 5EGMA 5A8ZA 1TGTA 3E16B 4H6SB 1GBAA 1ZRBA 3LJJA 3ZZ5A 1GBHA 1P9SA 2Y5HA 3RXDA 1GI6A 2ZDNA 3KQCA 1GHYH 4I8JA 3UREA 1AI8H 1NM6A 2Y5GA 1YBWA 1AE5A 4LOYH 2GCHF 1TGNA 2PKAB 1UTNA 1DUEA 2SGQE 3UQVA 3SUDA 4ISOA 1SFQB 2ZPSA 4B1TA 1O3KA 1W3CA 4X8SH 1QA7A 5AFZH 1CQQA 1NU9A 5CE1A 2Z7FE 3SNCA 2OCVB 1GL0E 3BF6H 4Y79A 1H8DH 4O03A 3SU1A 3ODDA 1SOZA 1HAOH 1O39A 3LH3A 4X2VA 3A7WA 5GCHG 5HYOA 1NO9H 5C67A 5JBTA 5LH8A 2TGDA 3MH6A 3RXEA 3RMLH 1IHTH 5TJXA 4MG3A 2Y6TA 1WQVH 2ZFSA 1QL9A 3FVFB 1OP2A 1YGCH 3T25A 1E0FD 1P2OA 1YPHC 2A4GA 5EQRA 1MTVA 2RDLA 4BTIB 3RLYH 2J92A 4K5ZA 4IN2A 2ZTXA 1K9OE 1LKBA 3P8OA 1G36A 1GHAF 8GCHG 1C5UA 1MQ6A 3ZZ9A 4MLFB 1TQ7B 3H5CB 1C2LA 1SR5C 5FHTA 2Y80A 1RFNA 1YM0A 2PTCE 2Q1JA 1TLDA 5I25A 2EA3A 1XUKA 1HDTH 4XE4A 4YO9A 1G32B 1SHHB 1P04A 3SOSA 3V12A 3QO6A 3F9HA 1PQ5A 5EU8A 2ZGCA 1KXDA 1C5PA 2BDGA 1EJMA 3BTQE 3F6UH 3K65B 3PTNA 1V2JT 1SQAA 4BNRA 4CH8B 2BDIA 1SGQE 2P8OC 1U6QA 3Q00A 1MZAA 6ESTA 5K7RA 1AVWA 4HFPB 4ZKRU 3NK8A 1ORFA 3U98H 1G3CA 3P70B 2ZA5A 3B8JA 4WVPE 3HKIB 2OQUA 2WPHS 1HAZB 1AWFH 2A4OA 2PKSC 2PUXB 4VGCC 3ATWA 1G3DA 2FOMB 1P2IA 4PROA 4JZEH 3A88A 3MU5A 2BDBA 3T27A 1SLUB 1Z8RA 2G5NA 1OXGA 8KME2 1W14U 1OWEA 3DFLA 3RXTA 4AOQA 1DWBH 3F9FA 4Q7ZA 1C5VA 3SU6A 4FU9A 1QB1A 3EAJA 1V2PT 1GGDB 2A2QH 2BZ6H 1YF4A 1QA0A 2ANYA 2WPMS 3P8GA 1O2UA 2XNIA 2ZQ1A 1O33A 1QBNA 3S7HB 3NUMA 1J17T 1HUTH 4FUGA 3GDVA 2Y5FA 2ZI2H 4KELA 5JB8S 2H5DA 1HB0B 4DIIH 1ETTH 9ESTA 5HM9A 3FZZA 3QUMP 3M36A 3EYDA 4WMEA 1Z1IA 2DUCA 1IQHA 3N7OA 1W2KH 2FLBH 3U9AH 1Q3XA 2G81E 4UFEH 2AFQB 2KAIB 3ZZCA 5EQSA 1NU7B 3SJKA 1PPHE 1AIXH 4FU7A 1HAGE 3GICB 1HAVA 3QGNB 1WCZA 2CHAC 1F0SA 2AGEX 2BXTH 3DFJA 3GCHB 3RXCA 1C5TA 2J95A 1UMAH 2AERH 1L4DA 1SB1H 3EA7A 5K0HA 1KLJH 1ZPZA 1LHFH 1MMJN 1AU8A 2BYAX 4TY6A 3RP2A 4B71A 2NU1E 3I29A 4AG1A 1E38B 3DA9B 3F9EA 2P8OB 3LONA 4K1TA 1LMWB 1TQ0B 1IQKA 2ZFPH 1TNIA 2ZZUH 1K1JA 3SNBA 1OP8A 3OSYA 4TPYA 1DANH 1W0ZU 3STIA 3ATMA 1MCTA 1V2LT 4AG2A 4K8BA 2H9EH 2I6QA 1O2MA 1QB9A 1G9IE 2OINA 2PKSB 1MQ5A 1ANBA 5C20A 1V2ST 2QXIA 2R3YA 3LDXH 1DITH 4UDWH 3GOVB 4F4OC 1FV9A 2ZPQA 4CR5A 5FCKA 2RG3A 2ZPRA 3TK9A 8ESTE 4R0IA 3RUOA 1HAIH 3CS0A 2ZFTA 3ZVEA 1GVZA 2BHGA 2V3OH 2FXRA 5L30H 4D9QA 4AYVB 2XCFA 1O2PA 2O8MA 3BTHE 2FOHA 1AHTH 2CV3A 3KGPA 1M9UA 1O3NA 1P2QA 1AO5A 1ZJKA 4DGJA 5JBCS 1C1QA 1Q31A 1C5WB 1D3PB 1AUTC 1TNLA 4O9VA 2PW8H 1O3AA 1NRQH 1KIGH 1P3CA 5EQQA 2P94A 2XC4A 3RXJA 4BAKB 2YNBA 1OYQA 1MBMA 1O35A 2WPKS 3DUXH 4GUXA 1AMHA 1AB9C 1DDJA 1LQDB 1Z6JH 4FUCA 1RGQA 3RDZA 2DE9A 2ZGJA 3ZZ7A 5DG6A 1LCYA 3R0FA 5HM2A 3ZVDA 4Y0ZE 1C1OA 1O2OA 1XM1A 2WPIS 2B7DH 1JMOH 3ATKA 2JH5D 5IDKA 2O8TA 2XBYA 1EZSC 1C2DA 2A45B 3FFGA 1HAPH 2Z9LA 1T7CA 4B2AA 1MKXK 3RXQA 1NFWA 2TBSA 2F83A 1V6DA 1ELAA 1WOFA 1AQ7A 2ZFFH 2HNTF 1ZSLA 1MTNB 3GDUA 1RTLA 1ELVA 2F9UA 2A7JA 3ODFA 2M5TA 2QGRA 3PLBA 1YPEH 4MVNA 2VIPA 3P95A 1QCPA 2ALVA 3PO1B 1NRPH 1O2YA 1KY9A 1O3JA 3BN9A 5H4IB 2GX4A 1BBRH 2VIOA 1V2RT 2B9LA 7GCHF 1CGIE 3KQBA 2F9NA 1V2MT 2ZHEH 3MH7A 3SV9A 3NWUA 2BOKA 1BTUA 2ZWLH 1L4ZA 4NZQA 5ETXA 4MPWA 1SGFG 2AH4X 1KXBA 2XBVA 1EX3A 5A2MH 1CE5A 1FJSA 5L2ZH 2ZC9H 1AKSB 1MAYA 1LDTT 2HRVA 4U2WA 4AN7A 2XYAA 3GYLB 1GJ4H 1P2MA 2B8OH 1E36B 1Y3UA 3NKKA 1MTWA 4Q7YA 1LKAA 5F8TA 4CRAA 1NZQH 3ZVCA 5DO4H 4Y76A 1OP0A 4FUDA 1AB9B 3W95A 1O3MA 1O3IA 2BVXH 1CA8B 4WF8A 1QFKH 1YCPK 3QLPH 4F49A 2Z3EA 1RIWC 1ELTA 4IS5A 2QA9E 1NROH 1O2HA 2FO9A 2H9HA 2Z3DA 4I8GA 1C1TA 5FCRA 1IQGA 1G2MA 2DE8A 4E7NA 3VXFH 2ILNA 1E34B 2O8LA 3P92A 3U8RH 2AMDA 6LPRA 5GDSH 3A7ZA 5CMXH 3LIWA 2QXGA 1YCPH 2BDYA 1TX8A 1A5GH 1TBZH 3ATIA 5C5NA 2QXJA 5EPYA 2F9BH 1F7ZA 1ELEE 9LPRA 1RTFB 1HIAA 1MCVA 3LGVA 4DOQA 1Z71A 1BJVA 1P2KA 1H4WA 3RM0H 3TLOA 2GMTB 5LGOA 2C8YB 1IQLA 1UK4A 2CN0H 1TPPA 2XWAA 1V2OT 4Y8YA 2G52A 1A7SA 4LZ1H 1C2GA 2BQWB 2ODQA 3A7XA 3SZNA 4GSOA 1CHOG 3TGKE 3RXKA 1O2WA 4JZDH 3PMHB 2TGAA 4D7GA 1PJPA 4GLYA 3IG6B 1MKWK 1O32A 2XRCA 4Y0YE 1P03A 1D6RA 2UUYA 4NIYA 1O2RA 3ZZ8A 1C9TA 2XTTB 3RXHA 3V7TA 2J94A 2P3FH 1T8MA 4FU8A 1O37A 1PQ7A 2WYJA 1EJAA 2ULLA 3SGAE 1ZOMA 5JBBS 3TJNA 3SUGA 1XKBC 1S85A 6GCHF 1S82A 1VGCB 1GDUA 5T6FA 1GJ7B 4XBCA 1VJAU 3PWCA 1TA6A 2ODYB 2BX3A 2TIOA 1UO6A 3HGPA 2FTLE 2F91A 1GJDB 2ODPA 3B23B 4RKJB 1EAIA 1TBRH 3UWIA 1VZQH 2GZ7A 1RIWB 1AZ8A 1TBQH 3M3VA 1TPOA 5B6OA 2W7SA 1QHRB 4BXWA 2P3UB 3HK6B 1W13U 1Y8TA 1XX9A 1D3TB 3BTME 4TY7A 1YPHE 1EPTA 2FEQH 4HI3A 1O3PB 3GCNA 1K22H 3MU4A 1EOLA 3BTWE 4FUJA 1CT2E 1J9CH 1GVLA 1P3EA 1XXFA 4YESB 4DIHH 1SPJA 2ZO3H 4BTUB 3GCOA 3I77A 3GY6A 7KMEH 3JZ1B 1MTUA 3FP6E 2ZCHP 2SFAA 1GBTA 1ZLRA 2UWPA 5ESTE 1PFXC 3E90B 3SI3H 2JKHA 3LGWA 1C5LH 3MTYA 2F9PA 2YOLA 1GDNA 1FY3A 4LK4A 4BXSA 2ZGXH 1MAXA 1GI2A 1HJ9A 4UFDH 1AVGH 1LQEA 1FLEE 1H9HE 1ANEA 3ENSB 4KTSA 1HYLA 1DXPA 1C1RA 2ZF0H 2GV6A 4B76A 2A0QB 1IQEA 3ZZ3A 1GCTB 5TCAA 1V2QT 3UOUA 1A0LA 5GWZA 3T29A 1DFPA 1EB1H 1ZR0A 3A8AA 2Z94A 3ZVBA 1A46H 2HOBA 4X8TH 5JB9S 1Q2WA 3LJOA 1T31A 1YPJH 2VGCC 3BG4C 1ZZZA 5E0HA 1BTYA 2EI6A 3C1KA 4B2BA 2PWXA 4FVDA 3KIDU 2J4IA 1DLKB 1UVTH 1C5QA 4MQAA 4X2WA 1UK2A 2OC0A 3A85A 5BPEA 1PPGE 1NTPA 1SGRE 3QZRA 5E2OA 3FP7E 1LVOA 1O3EA 1EAWA 3G01A 2C90B 3LU9B 3MWIU 1XVOA 1G30B 1T8LA 1PYTC 3RXFA 2D8WA 1TABE 3MFJA 2BDAA 3SNAA 2FMJA 3SU0A 4YZUA 4AX9H 2UWLA 3D23A 4I31A 1L1GA 1GBCA 4J1YA 4MPUA 4NIXA 1GHVH 1P8VC 3TU7H 1AGJA 2OC7A 1W7GH 1C1NA 2PSXA 1NY22 1T4UH 1ZYOA 2FLRH 4A1VA 1O2LA 2ZU1A 3KNXA 4OS7A 1BZXE 1BRUP 4FUBA 3RC5A 3ATLA 3VPKA 1PPEE 2WINI 4TWYA 1A61H 2IPHA 1GI3A 2BB4A 1DS2E 2R0LA 2ZDAH 1XUGA 2FYRA 2SGEE 3OX7U 4ZKNU 4CRDA 2GP9B 1JWTA 3Q3KA 3GCTF 5A0AE 5GXPA 1GGDC 1GI7B 1EAXA 3E3TA 4R8TB 4ABGA 4UFFH 1BTZA 1ZTKA 2EEKA 3DT0H 2J9NA 1CT0E 3ZZAA 1TALA 2H1UA 1QRZA 4O3TA 4IC6A 4MTBA 1GBEA 1BRCE 1N6XA 2QY0B 1SGFA 2OTVA 5ABWA 2ZP0H 1EB2A 1BHXB 2RCEA 5DP7A 3RLWH 4YOGA 4X6MA 1UHBB 3MNBA 1EOJA 1SGIB 3KL6A 2P3TB 3A83A 1C2IA 3M35A 3M3TA 1CT4E 3ZV9A 1SGEE 2ZNKH 1O2IA 5FPSA 2G4TA 2STAE 1O3FA 2A7CA 3AW1A 2VGCB 4I32A 3BG4B 1PQ8A 3TNSA 1OWJA 1P2JA 4I8LA 2BD3A 3UIRA 1O3HA 3SV8A 3VXEH 1W8BH 3GCHC 4A1TA 4RKOB 3K6YA 4JZ1A 2H2ZA 2ZGBH 2UWOA 1O2QA 1UVOA 1S83A 2GCHG 1HAXB 1CU1A 3PWBA 4WY3A 4IC5A 2R2MB 3QTVH 1Z6EA 1Y5BT 2IN2A 3M5MA 2XC0A 5DP3A 1DY8A 1G37A 1TA2A 3AW0A 1PPBH 1C1UH 2Z6BD 2AEIH 1T8OA 4AB9A 2WUCA 3M3SA 1GJ9B 1ELDE 4DURA 3H7OA 2QYIA 1V3XA 2QC2A 5FBEA 1PPFE 2IOTA 1NRNH 3PMJA 3OYPA 2B0FA 2BDCA 1ZSKA 5HGGA 4ZUHA 3GY5A 1HJAC 1HLTH 1EATA 3LGTA 5F8XA 3SJ8A 1TFXA 2PLXA 2VVUA 4Y7AA 2VVCA 2FOEA 3TIUA 2OQ5A 2FTMA 1JOUB 3V3MA 3PROA 7ESTE 1ANCA 1RS0A 1ETRH 2PKAA 1F0UA 1TNJA 3Q3YA 3SBKA 1O5DH 4RSPA 1THRH 4MNWA 4CREA 1GHAG 1ZMJA 3BEIB 1SLXB 3V13A 1TRNA 4CR9A 4NCYA 3MOCA 4HGCA 4GCHF 1WV7H 2AGIX 5PTPA 1TRYA 3SHCH 2V3HH 4WJG2 4X6NA 2FM2A 2ZG0H 4Q2KA 2CXVA 1EZQA 3K9XB 3ZYEA 2FI3E 4IMQA 3RM2H 1BTWA 3SU4A 1TX6A 2Z9KA 3PV4A 3MHWU 2SNVA 1JXPA 4MNVA 1A0HB 2BTCE 2AS9A 1D3QB 1KTSB 1C5OH 3F1SB 1OYTH 1QL8A 2TPIZ 1TPSA 1ZRKA 1SFIA 1ELBA 3D65E 3D62A 4X8UH 1ETSH 1FPCH 1ID5H 1QURH 2OLGA 2VWLA 2ZECA 1MTNC 2Y81A 1UTQA 1SVPA 1AFEH 1SGDE 1SGCA 3GY3A 1HXEH 1JIRA 5DK1A 2H9TH 5FXLA 4MPXA 3VB4A 5SGAE 1GBIA 4ZKOU 3O8RA 1J16A 2LNCA 3PO1C 4WWYA 3SHAH 1UTJA 3SJ9A 1BOQA 1GBMA 1C2HA 1Y59T 2FI4E 1FAKH 1VR1H 4TYDA 1VCWA 2G51A 1FY8E 1QGFA 3M5NA 2Y7XA 1ZJDA 1FZZA 3RC4A 3QWCH 3RXAA 3UUZA 2XCNA 1Y5UT 1K21H 1HJAB 4ISNA 2W7UA 1JIMA 5E8EH 1AY6H 2C4FH 1KXEA 1XUHA 2FOBA 4K3JA 3ZZ4A 1S81A 1WUNH 1QIXB 1IAUA 3KQDA 3KEEA 5DP6A 4B73A 2PGBB 1RXPA 2BMGB 4XFQA 2NU2E 4INLA 4ZH8A 3MMGA 1EKBB 1LHCH 3E6PH 5DP9A 3RXOA 2J38A 1S84A 3AAUA 1C1VH 1NFYA 2VU8E 1SLVB 2HALA 3E91A 1TNHA 1O5FH 1GMDF 5GJ4B 3T26A 5A0BA 1NRRH 1L1JA 2TRMA 5J4SA 3SUFA 5GPIB 2WUBA 1O30A 3NCLA 1CO7E 3I78A 1TRMA 1XUFA 4X2XA 2A4QA 3RU4D 1BUIA 1GWAA 4NA8A 3VB6A 3BEUA 1K1PA 1CBWC 1QB6A 2EI7A 2PFEA 1Z8JB 2GT7A 4AGJA 1O36A 4YM9A 1GDQA 4XSKU 5CHAB 1O5CB 1CVWH 1GG6B 1EP6A 4ZHMU 2W26A 1BBRK 1K2I1 1PYTD 1F92A 3S0NA 1EAUA 1SMFE 2A7HA 5AHGH 1SGTA 2C8ZB 1O2KA 2R2WU 3UR6A 3U1JB 3SV6A 3U8TH 1QQ4A 1VJ9U 1BIOA 1HPGA 5AVDA 2BD5A 3AVZA 3DD2H 1L0ZA 1YPGH 2QCYA 3SUEA 1DWCH 1J14A 3UFAA 1GMCG 3FAOA 1H1BA 2HWLB 1GL1A 2KAIA 5E2PA 4ZHLU 1TYNA 1O2NA 1S5SA 4CH2B 2GMTC 2VNTA 3SU2A 5JDUB 1UVSH 3A7TA 1NFXA 2XXLA 1GHZA 5GIBA 4I33A 1V2UT 3GDSA 2JH0D 1LHEH 1FY4A 4BANB 8LPRA 3U8OH 4X1SU 1MU6B 1PQAA 1XUJA 2VH6A 3A7VA 5JYIA 1OOKB 1V2NT 3M61U 1THSH 1J8AA 4A6LA 1GHWH 1O2XA 4NIWA 2QF0A 3RXBA 4DVAU 5EOKA 1TPAE 2BX4A 1C1WH 5T6GA 1EP5A 2A2XH 3PLKA 3LH1A 3SN8A 1CHOF 1VGCC 3AASA 1GJBB 2G55A 4NZLA 1XXDA 3PM3A 2V6NA 1GI1A 1W11U 1AFQC 4MDSA 1CBWB 1C4V2 1QR3E 4ABBA 1IQMA 2SGPE 1BMMH 4AGKA 5HXFA 2O9QA 4X8VH 4UONA 1KDQB 5C1UA 2OBOA 1P2NA 2PV9B 2H6MA 2ZU5A 1FMGA 1P02A 4K60A 3QX5H 5DP4A 1OWIA 3U69H 1ZMNA 2ANWA 1ZHMA 2ZHFH 4D8NA 3WY8A 1ELFA 1A2CH 5FPYA 4DY7B 4JYTA 1ELCA 2NU3E 2VH0A 1HJ8A 1YPKH 2V0BA 2ZHWH 4Y8XA 2OD3B 1DXWA 1GBLA 2FOGA 1UCYH 1TE0A 5EXMA 2CF8H 4K2YA 3CS7A 3A82A 5A8XA 3TH2H 1KXAA 1ABJH 2BQ6B 2J34A 3M7TA 1C2MA 2BQ7B 2THFB 3MO9A 4JCNA 3VFEA 5FX6A 2Z3CA 5JPMH 4UFGH 2GD4B 4WXIA 4AORA 4ZXXH 1GCTC 2W5EA 3H7TA 3O8CA 3RXUA 3HATH 2VWMA 3MYWA 5F8ZA 2P95A 4FUFA 2EI8A 3TK6A 2Q6DA 1YPMH 3TJOA 1EJNA 5LPEA 3P6ZB 1FUJA 1LHGH 5EW2H 1FNIA 2HNTC 3UY9A 1CSOE 3TH4H 3KCGH 1MZDA 5E0JA 1LPZB 3KF2A 1OKXA 3O8BA 5A0CA 1D3DB 5EG4A 1O2JA 4DG4A 3PMBB 2WV5A 1AFQB 1GHBG 1WQSA 3F68H 4NFFA 3MU1A 1UJ1A 1E35B 3TITA 3UNSA 1BRBE 1ESBA 1UTKA 4Q80A 3ZZDA 3EGKH 5A09A 2VIQA 1BTPA 3BIVH 1AKSA 1TNKA 2AMQA 1S0RA 1NESE 2ANKH 1VITG 1X7AC 5L6NH 5FAHA 1NS3A 5T3HA 1LVBA 1HNEE 2FPZA 1RD3B 1KTTB 2FX6A 4GAWA 3MU8A 4BAHB 3P8NA 1D9IA 2BY6X 3TJVA 1WAYB 1SQTA 4X2YA 1Y5AT 2OUAA 4FXGH 2Q6FA 1C5MD 3TNTA 2JETC 4IMZA 1EZXC 3ZV8A 2BY9X 2WPLS 1SI5H 1QY6A 1T4VH 1QTFA 2R0KA 3TK5A 3URDA 1A3EH 4YOJA 1P9UA 1AE8H 1BMAA 1K28D 2ZHDA 4Y11E 1FAXA 1IHSH 1Y3XA 1H9IE 1GPZA 1FI8A 1BITA 1GJ6A 1V2TT 2P16A 4E05H 3TVJB 1O5EH 3HK3B 1CGHA 3E8LA 1GJAB 3A84A 4KTCA 1MTSA 5FBIA 2FIRH 1V2KT 4Z6AH 1C5SA 2ZDMA 3KHVA 4GVUA 4ISLA 5GCHF 3RXLA 3RXVA 3EDXB 4NWKA 1DVAH 1IQJA 1O2TA 4U01A 1WYKA 5AFYH 1A0JA 1JRSA 4ZHAA 3P17H 1BDAA 1BA8B 2BVRH 2BVSH 1VCQA 3QZQA 5I46H 4ZMAH 1C2EA 1BTXA 2TGPZ 1SQOA 2VB0A 4ZKSU 1O5BB 3T28A 4AFUA 1GBJA 1DE7H 1JBUH 1C2FA 2UUJB 3B9FH 4X6OA 2GV7A 2C8WB 3A87A 4BOHA 1GMHG 1TX7A 4CHAC 3RXIA 2W3IA 2FOFA 5DP5A 2FP7B 2P59A 1DUAA 1Z7KA 1DWEH 2QF3A 2A5IA 4AYYB 1IQFA 2Y82A 4AZ2B 8GCHF 3NXPA 3UWJH 2FS9A 2ZTYA 4Y7BA 4WH6A 2OC8A 3M5LA 1H9LB 3IITA 3K2UA 4X1NU 3BTTE 3MI4A 3PLPA 3EQ0H 2ZU3A 4BTTB 2AIQA 2PHBA 3VGCB 4AFZA 1YP9A 3RXMA 2BY8X 4Y71A 1LVYA 4DT7B 5LPFA 1GJ5H 1FY5A 3RXSA 5ESBA 2SGAA 2C3SA 3QK1A 1OWHA 1KXFA 1O31A 2JETB 3LPRA 4H4FA 1QBVH 5DGJA 4ESTE 4CRFA 4K1SA 1BJUA 3SGQE 4DJZB 4B75A 4OGYA 1SOTA 3T5FH 4LXBH 1OPHB 2TGTA 2JH6D 1A4WH 2EC9H 3SNEA 2G5VA 1TGBA 3TGIE 3M7UA 1C5YB 1HAHH 1O3GA 4WH8A 1BCUH 1PPZA 7LPRA 2GZ9A 1GHXH 2FOAA 2BD8A 4ISHH 1ZSJA 2P93A 3PMAB 1FONA 4NSYA 1O34A 1P57B 2XBXA 3BV9B 1EASA 1HAVB 3LOXA 1Z8GA 4KTUA 1E37B 5A8YA 2ALPA 1Y3VA 2BLVA 5DPAA 1LPGB 1KXCA 4NFEA 2OXSA 3RXRA 3IWMA 2PTNA 1FPHH 1AVXA 2F3CE 4I8HA 4M7GA 4INHA 3BTFE 2ASUB 3QTOH 4J2YB 5HMAA 4AFQA 4OGXA 4CHAB 1GBKA 1BTHH 1ZGIA 2BD7A 2FI5E 4GHTA 1A1RA 1C2JA 4E06H 2G8TA 1UCYE 4B74A 4NA7A 2BD4A 4MPVA 1NN6A 3SI4H 1TMTH 1GI8B 2YNAA 3KQEA 1Z1JA 3ESTA 3BTDE 3FP8E 1C5ZB 1N8OC 3BIUH 4IBLH 2XW9A 2GCTB 1EQ9A 1F0TA 3RMMH 3W94A 2ZDLA 3P8FA 1DPOA 1K1NA 1DSUA 1L1NA 4XBBA 3SO3A 1WTGH 1GI5A 3LC5A 2HGTH 3GY8A 1SSXA 1FQ3A 3QN7A 1ELGA 1O2GH 3RC6A 4CRGA 4WMDA 1T32A 4X1RU 1FDPA 1O3OA 1HFDA 1ZPBA 2Z9IA 1P06A 2OC1A 4SGAE 4YT7H 3E0PB 3OY5U 2CJIA 1QQUA 4TWWA 1O3CA 3GCTG 1B5GH 1SGPE 5C1XA 1IQNA 2K1QA 4K8YA 1GBFA 1KLTA 3R3GB 4Y10E 3LGIA 2NWNA 2VIDA 1O2VA 3PYHA 4A1XA 1MD7A 3A80A 3LC3A 4IGDA 2ZCLP 1K1MA 1W10U 3GYMA 1XKAC 3TJUA 1GI0A 5G4BA 4A7IB 2BD2A 1C5NH 4D9RA 1B7XB 3OTJE 1HRTH 2ZU4A 3TGJE 4GHQA 1ZHRA 3U1IB 3RMNH 4D7FA 2GZ8A 1BB0B 4YLQH 1O0DH 1DICA 4KGAA 2BY7X 1EUFA 3F9GA 1FIWA 3URCA 2AMPA 3RXGA 2AIPA 3SNDA 1VITH 1P05A 2GDDA 1YC0A 5CHAC 3PB1E 1GG6C 3GY7A 4OS1A 3CENA 2A31A 1B0FA 2STBE 3BTKE 2FWWA 4A92A 1ZHPA 3AAVA 3CP7A 4H42U 4AB8A 4BAMB 1GI9B 1FN8A 2G4UA 5E0GA 3ZVFA 1N8OB 4CRBA 4D76A 2CMYA 4ZXYH 1AN1E 2F9OA 2LPRA 3A86A 2ZTZA 1QBOA 4YOIA 5BRRE 2UUFB 2GT8A 4JYVH 4KP0A 1UHBA 4YT6H 1C1MA 1OWDA 1BRAA 1YYY1 3UQOA 1YLCA 1F0RA 2BLQA 3HGNA 1ARBA 4SGBE 4NWLA 4BAQB 3SGBE 2QN5T 2FX4A 3HPTB 3LGUA 1W7XH 2BY5X 4CBNA 4I7YH 3ITIA 4XOJA 2PR3A 3JZ2B 1RJXB 3MU0A 2CGAA 2QIQA 1TWXB 1ESAA 4JZIA 5C3NA 1T8NA 1GJCB 3L3TA 1TNGA 1S6HA 1SLWB 4VGCB 1GMCF 2WV4A 3S9BA 4AFSA 1LTOA 1O3DA 1ZGVA 3MH4A 5EODA 2ESTE 2Z9GA 1D6WA 1F5RA 4ASHA 1GBBA 1ZPCA 3ZYDA 1OWKA 4GCHG 3MH5A 3ZVGA 1XUIA 2NU4E 1LO6A 1UVPA 2VJ1A 3MO3A 1W0YH 4NA9H 1UTPA 2D26C 1H8IH 4MNXA 1HV7A 3UR9A 5FX5A 4LZ4B 1EPTC 1CA0C 4FUEA 2VINA 1IQIA 3STJA 1TOMH 2ZIQH 3FANA 3TH3H 2R9PA 1L2EA 4ISIH 3GISB 5FPTA 3SU5A 3SU3A 2G00A 1Y3WA 4FUIA 5AF9H 3ZVAA 1GBDA 1HIAB 1LHDH 4JMYA 3SJIA 2BDHA 4Z0KA 1C5RA 4OS4A 2GVFA 3LGYA 1HCGA 1G3BA 3Q3XA 4NGAH 4TPIZ 2R3UA 2QAAA 2BOHB 2CHAB 1SG8B 2BM2A 3SJOA 2QV1A 2HPPH 4JK5A 4X6PA 1HAYB 2FS8A 5EW1H 2VWOA 3V0XA 1GJ8B 5LPRA 2NU0E 1HGTH 2HNTE 1MUEB 3K6ZA 2H5CA 1JRTA 2IJOB 5EPNA 5EXNA 2A5KA 4XBDA 3RU4T 3S9CA 1HBTH 2ANMH 4O3UA 1BT7A 1WU1A 3S7KB 1OS8A 1IOEA 1K1IA 4CBOA 2PSYA 2W3KA 4ZROA 3MNXA 1MKXH 1KLIH 4A5TS 2ZFQH 3BTGE 1S0QA 3ELAH 1AZZA 2Y7ZA 1V2WT 2J2UA 1G2LA 3RXPA 3E0NB 3MNSA 5IYTA 1QNJA 1GMDG 2FZZA 3SQHE 1OSSA 1AUJA 3C27B 5EXLA 3SW2B 4DCDA 2ZDVH 3M5OA 4DW2U 1LVMA 2WYGA 4X1QU 1C1PA 3M7QA 4U30A 3M37A 3FZDA 1F5KU 4Q7XA 1EPTB 1CA0B
chains in the Genus database with same CATH superfamily
2O8UA 3UOPA 4OS6A 2C93B 3S9AA 3TPIZ 2D2DA 1C4U2 1EZUC 1WBGB 5DKMA 3F2FA 1B0EA 1KSNA 3A8CA 4BAOB 3MNCA 4MNYA 5C1YA 4Y8ZA 3PV5A 5DP8A 1N1LA 2OBQA 1HXFH 2VIVA 1QJ6B 2SGDE 1O2ZA 4M9FA 1P09A 2A4RA 3VB3A 1THPB 2HLCA 2ZQ2A 1NC6A 1UCYK 4E7RG 1KYNA 2XNDD 4KKDA 2UUKB 4WXVA 3LKWA 1YPLH 3NZIA 2ZFRH 4YXWD 4GPGA 2B5TB 2GKVE 4JZFH 1GHBF 4ABDA 5F03A 6CHAC 1ZTJA 4I8KA 1BHXF 2XBWA 3A8BA 4X1PU 3VB5A 3MO6A 3SORA 1A3BH 1AWHB 1NRSH 2BLWA 2FESH 1QL7A 2FODA 1QRWA 7GCHG 1SHYA 1UTLM 2VIWA 1C1SA 1FXYA 2FYQA 1MBQA 5C2ZA 1VITF 5EJZA 3S69A 3HKJB 2ZHQH 2GDEH 2VVVA 2RA3A 1CGJE 1TONA 1PPCE 4IN1A 4ZAEA 4ABHA 1W12U 1GVKB 4OS2A 2ZGHA 1VCPA 1ANDA 2CF9H 1UK3A 2ZU2A 1QJ7B 3RU4E 4O97A 1ZTLA 1XMNB 3NRLA 3A7YA 4UEHH 3SV7A 1UVUH 1DM4B 3RMOH 1MH0A 1DT2A 4WMFA 1Z8IB 1DY9A 2Z9JA 1P11E 1V2VT 5T6DA 1K1LA 1BMLA 1TOCB 2VWNA 4H6TA 3SV2H 1SBWA 2XC5A 1CHGA 3T62A 3FOAA 1D4PB 2SGFE 3EA9A 1MU8B 1SGNE 4NG9H 2A5AA 1TGCA 3PTBA 1P10A 4NIVA 1OX1A 3EE0B 1UTOA 1DSTA 5HIZA 1ZMLA 2RA0A 3OY6U 3ZIAD 1NFUA 1P0SH 4JYUH 3ZZBA 4FVBA 1G3EA 1TIOA 1Y3YA 1DWDH 3Q76A 4ABJA 3DHKH 1TAWA 2QXHA 1O2SA 2OP9A 4YLUA 2BXUH 2PUQH 4RN6A 1MD8A 4ABEA 1C2KA 1F2SE 2V3MA 4IW4E 3UPEA 1AD8H 1QRXA 1YLNA 1LPKB 1A5HA 1O38A 2BZAA 2XOKD 1ACBE 3EA8A 2FDAA 3VGCC 5L2YH 3O8DA 1GMHF 2A1DB 1ESTA 2HVXA 3D49H 1MKWH 4UE7H 4NSVA 5JBAS 3SQEE 3L33A 1O5AB 1XVMA 1S6FA 2KM0A 4HTCH 5KECA 5DJ7A 2F9VA 6CHAB 1SC8U 3QGJA 4K1EA 4FUHA 2ZCKP 4INKA 2GTBA 1J15A 1EXFA 2O8WA 2FOCA 1TMBH 1TGSZ 1K0HA 4U32A 1ABIH 1FY1A 1UTMA 1ARCA 3A8DA 4XDEA 4JK6A 4Y6DA 1WSSH 4THNH 1DLEA 2BLOA 3QDZB 4ABAA 1SGYE 3ZZ6A 1NT1A 2C8XB 1O3LA 4ABFA 3LT3A 3UNQA 3BTEE 1GI4A 1O5GH 1TB6H 2BD9A 1KDQA 3KYGA 2XWBI 5C0UA 1NPMA 3OU0A 3UNRA 5C5OA 3VEQB 2SNWA 1RRKA 1A5IA 1O3BA 1YKTA 1WTHD 2D1JA 1P01A 1FN6A 3NPSA 5CHBA 4QT8C 4HZHA 1GCDA 1P12E 4CRCA 2ZDKA 3KN2A 5F6MA 1C9PA 1C5XB 1TMUH 2AGGX 1BQYA 1FIZA 3BG8A 1DOJA 1SL3A 2WPJS 4UD9H 3UTUH 1F5LA 1C4Y2 3BSQA 6GCHG 3T2NA 5J4QA 3VB7A 2PGQB 2A32A 2ZEBA 4OS5A 2Q6GA 1RTKA 2AYWA 2V35A 1DX5M 4YTAA 4ABIA 1INCA 4B2CA 3GY2A 1K1OA 3A81A 4K69A 3W1EA 1YLDA 2GGVB 2ZKSA 5TCCA 4Q63A 3E1XB 3A89A 1QJ1B 1BBRE 2HPQH 3GY4A 1BMNH 1YCPM 3BEFB 4X0WU 3L6PA 3Q77A 2I6SA 2GCTC 1N6YA 4Q4LA 5EGMA 5A8ZA 1TGTA 3E16B 4H6SB 5FL7D 1GBAA 1ZRBA 3LJJA 3ZZ5A 1GBHA 1P9SA 2Y5HA 3RXDA 1GI6A 2ZDNA 2J98A 3KQCA 1GHYH 4I8JA 3UREA 1VKYA 1AI8H 1NM6A 2Y5GA 1YBWA 1AE5A 4LOYH 2GCHF 1TGNA 2PKAB 1UTNA 1DUEA 2SGQE 3UQVA 3SUDA 4ACBA 4ISOA 1SFQB 2ZPSA 4B1TA 1O3KA 1W3CA 4X8SH 1QA7A 5AFZH 1CQQA 1NU9A 5CE1A 3GS9A 2Z7FE 3SNCA 2OCVB 1GL0E 3BF6H 4Y79A 1H8DH 4O03A 3SU1A 3ODDA 1SOZA 1HAOH 1O39A 3LH3A 4X2VA 3A7WA 5GCHG 5HYOA 1NO9H 1UW7A 5C67A 5JBTA 5LH8A 2YMSB 2TGDA 3OEED 3MH6A 3RXEA 3RMLH 1IHTH 5TJXA 4MG3A 2Y6TA 1WQVH 2ZFSA 1QL9A 3FVFB 1OP2A 1YGCH 3T25A 1E0FD 1P2OA 1YPHC 2A4GA 5EQRA 1MTVA 2RDLA 4BTIB 3RLYH 2J92A 4K5ZA 4IN2A 2ZTXA 1K9OE 1LKBA 3P8OA 4FOUC 1G36A 1GHAF 2VBCA 5KGOA 8GCHG 1C5UA 1MQ6A 3ZZ9A 4MLFB 1TQ7B 3H5CB 1C2LA 1SR5C 5FHTA 4ZCNA 2Y80A 1RFNA 1YM0A 2PTCE 2Q1JA 1TLDA 2J97A 5I25A 2EA3A 1XUKA 1HDTH 4XE4A 4YO9A 5C94A 1G32B 1SHHB 1P04A 2KX4A 3SOSA 3V12A 3QO6A 4F55A 3F9HA 3FKSD 1PQ5A 5EU8A 2ZGCA 1KXDA 3OE7D 1C5PA 2BDGA 1EJMA 3BTQE 3F6UH 3K65B 3PTNA 1V2JT 1SQAA 4BNRA 4CH8B 2BDIA 1SGQE 2P8OC 1U6QA 3Q00A 1MZAA 6ESTA 5K7RA 1AVWA 4HFPB 4ZKRU 3NK8A 1ORFA 3U98H 1G3CA 3P70B 2ZA5A 3B8JA 4WVPE 3HKIB 2OQUA 2WPHS 1HAZB 1AWFH 2A4OA 2PKSC 2PUXB 4VGCC 3ATWA 1G3DA 2FOMB 1P2IA 4PROA 4JZEH 3A88A 3MU5A 2BDBA 3T27A 1SLUB 1Z8RA 2G5NA 1OHHD 1OXGA 8KME2 1W14U 1OWEA 3DFLA 3RXTA 4AOQA 1DWBH 3F9FA 4Q7ZA 1C5VA 3SU6A 4FU9A 1QB1A 3EAJA 1V2PT 1GGDB 2A2QH 2BZ6H 1YF4A 1QA0A 2ANYA 2WPMS 3P8GA 1O2UA 2XNIA 2ZQ1A 1O33A 1QBNA 2KR7A 3S7HB 1W0JD 3NUMA 1J17T 1HUTH 4FUGA 3GDVA 2Y5FA 2ZI2H 4KELA 5JB8S 2H5DA 1HB0B 4DIIH 1ETTH 9ESTA 5HM9A 3FZZA 3QUMP 3M36A 4B6EA 3UB0A 3H09A 3PRDA 3EYDA 4WMEA 1Z1IA 2DUCA 1IQHA 3N7OA 1W2KH 2FLBH 3U9AH 1Q3XA 2G81E 4UFEH 2AFQB 2KAIB 3ZZCA 5EQSA 1NU7B 3SJKA 1PPHE 1AIXH 4FU7A 1HAGE 3GICB 1HAVA 3QGNB 1WCZA 2CHAC 1F0SA 2AGEX 2BXTH 3DFJA 3GCHB 3RXCA 1C5TA 2J95A 1UMAH 2AERH 1L4DA 1SB1H 3DSGA 3EA7A 5K0HA 1KLJH 1ZPZA 1LHFH 1MMJN 1AU8A 2BYAX 4TY6A 3RP2A 4B71A 2NU1E 3I29A 4AG1A 1E38B 3DA9B 3F9EA 2P8OB 3LONA 4K1TA 1LMWB 1TQ0B 1IQKA 2ZFPH 1SQRA 1TNIA 2ZZUH 1K1JA 3SNBA 1OP8A 3OSYA 4TPYA 1DANH 1W0ZU 3STIA 3ATMA 1MCTA 1V2LT 4AG2A 4K8BA 2H9EH 3VG8A 2I6QA 2YMSD 4AC9A 1O2MA 1QB9A 1G9IE 2OINA 2PKSB 1MQ5A 1ANBA 5C20A 1V2ST 2QXIA 2R3YA 3LDXH 1DITH 4UDWH 3GOVB 4F4OC 1FV9A 2ZPQA 4CR5A 5FCKA 2WSSD 2RG3A 2ZPRA 3TK9A 8ESTE 4R0IA 3RUOA 1HAIH 3CS0A 2ZFTA 3ZVEA 1GVZA 2BHGA 2V3OH 5EJLA 2HVYB 2FXRA 5L30H 4D9QA 4AYVB 2XCFA 1O2PA 2O8MA 3BTHE 2FOHA 1AHTH 2CV3A 3KGPA 1M9UA 1O3NA 1P2QA 1AO5A 1ZJKA 4DGJA 5JBCS 1C1QA 1Q31A 1C5WB 1D3PB 1AUTC 1TNLA 4O9VA 2PW8H 3EE7A 1O3AA 1NRQH 1KIGH 1P3CA 5EQQA 2P94A 2XC4A 3RXJA 4BAKB 2YNBA 1OYQA 1MBMA 1O35A 2WPKS 3DUXH 4GUXA 1AMHA 1AB9C 1DDJA 1LQDB 1Z6JH 4FUCA 1RGQA 3RDZA 2DE9A 2ZGJA 3ZZ7A 5DG6A 1LCYA 3R0FA 5HM2A 3ZVDA 1H8ED 4Y0ZE 1C1OA 1O2OA 1XM1A 2WPIS 2B7DH 1JMOH 3ATKA 2JH5D 2L74A 5IDKA 2O8TA 3FO8D 2XBYA 1EZSC 1C2DA 2A45B 3FFGA 1HAPH 2OK5A 2Z9LA 1T7CA 4P02A 4B2AA 1MKXK 3RXQA 1NFWA 2TBSA 2F83A 1V6DA 1ELAA 1WOFA 2KCOA 1AQ7A 2ZFFH 2HNTF 1ZSLA 1MTNB 3GDUA 1RTLA 1ELVA 2F9UA 2W6JD 2A7JA 3ODFA 2M5TA 2QGRA 3PLBA 1YPEH 4MVNA 3WW7A 2VIPA 3P95A 1QCPA 2ALVA 2HLDD 3PO1B 1NRPH 1O2YA 1KY9A 1O3JA 3BN9A 2EY4C 5H4IB 2GX4A 1BBRH 2VIOA 1V2RT 2B9LA 7GCHF 1CGIE 4OM9A 3KQBA 2F9NA 1V2MT 2ZHEH 3MH7A 3SV9A 3NWUA 2BOKA 1BTUA 2ZWLH 1L4ZA 4NZQA 5ETXA 4MPWA 1SGFG 2AH4X 1KXBA 2XBVA 1EX3A 5A2MH 1CE5A 1FJSA 5L2ZH 2ZC9H 1AKSB 1MAYA 1LDTT 2HRVA 4U2WA 4AN7A 2XYAA 3GYLB 1GJ4H 1P2MA 2B8OH 1E36B 1Y3UA 3NKKA 1MTWA 4Q7YA 1LKAA 5F8TA 4CRAA 1NZQH 3ZVCA 5DO4H 4Y76A 1OP0A 4FUDA 1AB9B 1NBME 3W95A 1O3MA 1O3IA 2BVXH 1CA8B 4WF8A 1QFKH 1YCPK 3QLPH 4F49A 2Z3EA 1RIWC 1ELTA 4IS5A 1E1RD 2LELA 2QA9E 1NROH 1O2HA 2FO9A 2H9HA 2Z3DA 4I8GA 1C1TA 5FCRA 1IQGA 1G2MA 4RI0A 2DE8A 4E7NA 3VXFH 2ILNA 1E34B 2O8LA 3P92A 3U8RH 2AMDA 2KCPA 6LPRA 5GDSH 3A7ZA 5CMXH 3LIWA 2QXGA 1YCPH 2BDYA 5C17A 1TX8A 1A5GH 1TBZH 3ATIA 5C5NA 2QXJA 5EPYA 2F9BH 1F7ZA 1ELEE 9LPRA 1RTFB 1HIAA 1MCVA 3LGVA 4DOQA 1Z71A 1BJVA 1P2KA 1H4WA 3RM0H 4RT0A 3TLOA 2GMTB 5LGOA 2C8YB 1IQLA 1UK4A 2CN0H 1TPPA 2XWAA 1V2OT 4Y8YA 2G52A 1A7SA 4LZ1H 1C2GA 4F48B 2BQWB 2ODQA 3A7XA 3SZNA 4GSOA 1CHOG 3TGKE 3RXKA 1O2WA 4JZDH 3PMHB 2TGAA 4D7GA 1PJPA 4GLYA 3IG6B 1MKWK 1O32A 2XRCA 4Y0YE 1P03A 1D6RA 2UUYA 1KMHB 4NIYA 1O2RA 3ZZ8A 1C9TA 2XTTB 2KFWA 3RXHA 2J94A 2P3FH 3V7TA 1T8MA 4FU8A 2J98B 1O37A 1PQ7A 2WYJA 1EJAA 2ULLA 3SGAE 4FETA 1ZOMA 5JBBS 3TJNA 3SUGA 1XKBC 1S85A 6GCHF 1S82A 4I86A 1VGCB 1GDUA 5T6FA 1GJ7B 4XBCA 1VJAU 3PWCA 1TA6A 2ODYB 5IK2D 2BX3A 2TIOA 1UO6A 3HGPA 2FTLE 2F91A 1GJDB 2ODPA 3B23B 4RKJB 1EAIA 1TBRH 3UWIA 1W0KD 1VZQH 2GZ7A 1RIWB 1AZ8A 1TBQH 3M3VA 1TPOA 5B6OA 2W7SA 1QHRB 4BXWA 2P3UB 3PV2A 3HK6B 1W13U 1Y8TA 1YY3A 1XX9A 1D3TB 3BTME 4TY7A 1YPHE 1EPTA 2FEQH 4HI3A 2KCAA 1O3PB 3GCNA 1K22H 3MU4A 1EOLA 3BTWE 4FUJA 1CT2E 1J9CH 1GVLA 1P3EA 2QE7D 1XXFA 4YESB 4DIHH 1SPJA 2ZO3H 4BTUB 3GCOA 3I77A 3GY6A 7KMEH 3JZ1B 1MTUA 3FP6E 2ZCHP 2SFAA 2YMSC 1GBTA 1ZLRA 2UWPA 5ESTE 1PFXC 3E90B 3SI3H 2JKHA 3LGWA 1C5LH 3MTYA 2F9PA 2YOLA 1GDNA 1FY3A 4LK4A 4BXSA 2ZGXH 1MAXA 1GI2A 1HJ9A 4UFDH 1AVGH 3UAIC 2QF5A 1LQEA 4XRNA 1FLEE 1H9HE 1ANEA 3ENSB 4KTSA 1HYLA 1DXPA 1C1RA 2ZF0H 2GV6A 4B76A 2A0QB 1IQEA 3ZZ3A 1GCTB 5TCAA 1V2QT 3UOUA 1A0LA 5GWZA 3T29A 1DFPA 1EB1H 1ZR0A 3A8AA 1WDIA 2Z94A 3ZVBA 1A46H 2HOBA 4X8TH 2F43B 5JB9S 2IJD1 1Q2WA 3LJOA 1T31A 1YPJH 2VGCC 3BG4C 1ZZZA 5E0HA 1BTYA 2EI6A 3C1KA 4B2BA 2PWXA 4FVDA 3KIDU 2J4IA 1DLKB 1UVTH 1C5QA 4MQAA 4X2WA 1UK2A 2OC0A 3A85A 5BPEA 1PPGE 1NTPA 1SGRE 3QZRA 5E2OA 3FP7E 1LVOA 1O3EA 1EAWA 3G01A 2C90B 3LU9B 3MWIU 1XVOA 1G30B 1T8LA 1PYTC 3RXFA 2D8WA 1TABE 3MFJA 2BDAA 3SNAA 2FMJA 3SU0A 4YZUA 4AX9H 2UWLA 3D23A 4I31A 1L1GA 1GBCA 4J1YA 4MPUA 4NIXA 1GHVH 1P8VC 3TU7H 1AGJA 2OC7A 1W7GH 1C1NA 2PSXA 1NY22 1T4UH 1ZYOA 2FLRH 4A1VA 1O2LA 2ZU1A 3KNXA 4OS7A 1BZXE 1BRUP 2RDEA 4FUBA 3RC5A 3ATLA 3VPKA 1PPEE 2WINI 4TWYA 1A61H 2IPHA 1GI3A 2BB4A 1DS2E 2R0LA 2ZDAH 1XUGA 2FYRA 2SGEE 3OX7U 4ZKNU 4CRDA 2GP9B 1JWTA 3Q3KA 3GCTF 5A0AE 5GXPA 1GGDC 1GI7B 1EAXA 3E3TA 4R8TB 4ABGA 4UFFH 1BTZA 1ZTKA 2EEKA 3DT0H 2J9NA 1CT0E 3ZZAA 1TALA 2H1UA 3SZEA 1QRZA 4O3TA 4IC6A 4MTBA 1GBEA 1BRCE 1N6XA 2QY0B 1SGFA 2OTVA 5ABWA 2ZP0H 1EB2A 1BHXB 2RCEA 5DP7A 3RLWH 4YOGA 4X6MA 1UHBB 3MNBA 1EOJA 1SGIB 1MABB 3KL6A 2P3TB 3A83A 1C2IA 3M35A 3M3TA 1CT4E 3ZV9A 1SGEE 2ZNKH 1O2IA 5FPSA 2G4TA 2STAE 1O3FA 2A7CA 3AW1A 2VGCB 4I32A 3BG4B 1PQ8A 3TNSA 1OWJA 1P2JA 4I8LA 2BD3A 3UIRA 1O3HA 3SV8A 3VXEH 1W8BH 3GCHC 4A1TA 4RKOB 3K6YA 4JZ1A 2H2ZA 2ZGBH 2UWOA 1O2QA 1UVOA 1S83A 2GCHG 1HAXB 1CU1A 3PWBA 4WY3A 4IC5A 2R2MB 3QTVH 1Z6EA 1Y5BT 2IN2A 3M5MA 2XC0A 5DP3A 2J5UA 1DY8A 1G37A 1TA2A 3AW0A 1PPBH 1C1UH 2Z6BD 2AEIH 1T8OA 4AB9A 2WUCA 3M3SA 1GJ9B 1ELDE 2KZ4A 4DURA 3H7OA 2QYIA 1V3XA 2QC2A 5FBEA 1PPFE 2IOTA 1NRNH 3PMJA 3OYPA 2B0FA 2BDCA 1ZSKA 3OEHD 4ZUHA 5HGGA 3GY5A 5B6LA 1HJAC 1HLTH 1EATA 3LGTA 5F8XA 3SJ8A 1TFXA 2PLXA 2VVUA 4Y7AA 2VVCA 2FOEA 3TIUA 2OQ5A 2FTMA 1JOUB 3V3MA 3PROA 7ESTE 1ANCA 1RS0A 1ETRH 2PKAA 1F0UA 1TNJA 3Q3YA 3SBKA 1O5DH 3OFND 4RSPA 1THRH 4MNWA 4CREA 1GHAG 1ZMJA 3BEIB 1SLXB 3V13A 1TRNA 4CR9A 4NCYA 3MOCA 4HGCA 4GCHF 1WV7H 2AGIX 5PTPA 1TRYA 3SHCH 2V3HH 4WJG2 4X6NA 2FM2A 2ZG0H 4Q2KA 2CXVA 1EZQA 3K9XB 3ZYEA 2FI3E 4IMQA 3RM2H 1BTWA 3SU4A 1TX6A 2Z9KA 3PV4A 4TSFD 3MHWU 2SNVA 1JXPA 4MNVA 1A0HB 2BTCE 2AS9A 1D3QB 1KTSB 1C5OH 3F1SB 1OYTH 1QL8A 2TPIZ 1TPSA 1ZRKA 1SFIA 1ELBA 3D65E 3D62A 4X8UH 1ETSH 1FPCH 1ID5H 1QURH 2OLGA 2VWLA 2ZECA 1MTNC 2Y81A 1UTQA 1SVPA 1AFEH 1SGDE 1SGCA 3GY3A 1HXEH 1JIRA 5DK1A 2H9TH 5FXLA 4MPXA 3VB4A 5SGAE 1GBIA 1QZ8A 4ZKOU 3O8RA 1J16A 1H8HD 2LNCA 3PO1C 4WWYA 5EIYA 3SHAH 1UTJA 3SJ9A 1BOQA 1GBMA 1C2HA 1Y59T 2FI4E 1FAKH 1VR1H 4TYDA 1VCWA 2G51A 1FY8E 1QGFA 3M5NA 2Y7XA 1ZJDA 1FZZA 3RC4A 3QWCH 1E1QD 3RXAA 3UUZA 2XCNA 1Y5UT 4P00A 1K21H 1HJAB 4ISNA 2W7UA 1JIMA 5E8EH 1AY6H 2C4FH 1KXEA 1XUHA 2FOBA 4K3JA 3ZZ4A 1S81A 1WUNH 1QIXB 1IAUA 3KQDA 3KEEA 5DP6A 4B73A 2PGBB 1RXPA 2BMGB 4XFQA 2NU2E 4INLA 4ZH8A 2JJ1D 3MMGA 1EKBB 1LHCH 3E6PH 3MQKC 5DP9A 3RXOA 2J38A 1S84A 3AAUA 1C1VH 1NFYA 2VU8E 1SLVB 2HALA 3E91A 1TNHA 1O5FH 1GMDF 1COWD 5GJ4B 3T26A 5A0BA 1NRRH 1L1JA 2TRMA 5J4SA 3SUFA 5GPIB 2WUBA 1O30A 3NCLA 1CO7E 3I78A 1TRMA 1XUFA 4X2XA 2A4QA 3RU4D 1BUIA 1GWAA 4NA8A 3VB6A 3BEUA 1K1PA 1CBWC 1QB6A 2EI7A 2PFEA 1Z8JB 2GT7A 4AGJA 1O36A 4YM9A 1GDQA 4XSKU 5CHAB 1O5CB 1CVWH 1GG6B 1EP6A 4ZHMU 2W26A 1BBRK 1K2I1 1PYTD 1F92A 3S0NA 1EAUA 1SMFE 3AK5A 5T1VA 2A7HA 5AHGH 1SGTA 2C8ZB 1O2KA 2R2WU 3UR6A 3KYFA 3U1JB 3SV6A 3U8TH 1QQ4A 1VJ9U 1BIOA 1HPGA 2JDID 5AVDA 2BD5A 3AVZA 3DD2H 1L0ZA 1YPGH 2QCYA 3SUEA 1DWCH 1J14A 3UFAA 1GMCG 3FAOA 1H1BA 2HWLB 1GL1A 2KAIA 5E2PA 4ZHLU 1TYNA 2V7QD 3N99A 1O2NA 1S5SA 4CH2B 2GMTC 2VNTA 3WWFA 3SU2A 5JDUB 1UVSH 3A7TA 1NFXA 3WWBA 2XXLA 1GHZA 5GIBA 4I33A 1V2UT 3GDSA 2JH0D 1LHEH 1FY4A 4BANB 8LPRA 3U8OH 4X1SU 1MU6B 1PQAA 1XUJA 2VH6A 3A7VA 5JYIA 1OOKB 1V2NT 3M61U 1THSH 3DSPA 3FN8A 1J8AA 4A6LA 1GHWH 1O2XA 4NIWA 2QF0A 3RXBA 4DVAU 5EOKA 1TPAE 2BX4A 2QF4A 1C1WH 1E79D 5T6GA 1EP5A 2A2XH 3PLKA 3LH1A 3DCLA 3SN8A 1CHOF 1VGCC 3AASA 1GJBB 2G55A 4NZLA 1XXDA 3PM3A 2V6NA 1GI1A 1W11U 3F0OA 1AFQC 4MDSA 1CBWB 1C4V2 1QR3E 4ABBA 1IQMA 2SGPE 1BMMH 4AGKA 5HXFA 2O9QA 4X8VH 4UONA 1KDQB 1SKYE 5C1UA 2OBOA 1P2NA 2PV9B 2H6MA 2ZU5A 1FMGA 1P02A 4K60A 3OAAD 3QX5H 4DT4A 5DP4A 2GJGA 1OWIA 3U69H 1ZMNA 2ANWA 1ZHMA 2ZHFH 4D8NA 3WY8A 5DN6D 1ELFA 1A2CH 5FPYA 4DY7B 4JYTA 1ELCA 2NU3E 2VH0A 1HJ8A 1YPKH 2V0BA 2ZHWH 4Y8XA 2OD3B 1DXWA 1GBLA 2FOGA 1UCYH 1TE0A 5KEDA 5EXMA 2CF8H 4K2YA 3CS7A 3A82A 5A8XA 3TH2H 1KXAA 1S6LA 1ABJH 4XD7D 2BQ6B 2J34A 3M7TA 1C2MA 2BQ7B 2THFB 3MO9A 4JCNA 3VFEA 4ACAA 5FX6A 2Z3CA 5JPMH 4TT3D 4UFGH 2GD4B 4WXIA 4AORA 4ZXXH 1GCTC 2W5EA 3H7TA 3O8CA 3RXUA 3HATH 2VWMA 3MYWA 5F8ZA 2P95A 4FUFA 2EI8A 3TK6A 2Q6DA 1YPMH 3TJOA 2K8IA 1EJNA 5LPEA 3P6ZB 1FUJA 1LHGH 5EW2H 1FNIA 2HNTC 3UY9A 1CSOE 3TH4H 3KCGH 1MZDA 5E0JA 1LPZB 3KF2A 1OKXA 3O8BA 5A0CA 3N7DA 1D3DB 5EG4A 1O2JA 4DG4A 3PMBB 2WV5A 1AFQB 1GHBG 1WQSA 3F68H 4NFFA 3MU1A 1UJ1A 1E35B 3TITA 3UNSA 1BRBE 1ESBA 1UTKA 1BMFD 4Q80A 3ZZDA 3EGKH 5EJ1A 5A09A 2VIQA 1BTPA 3BIVH 1AKSA 1TNKA 2AMQA 1FX0B 1S0RA 1NESE 2ANKH 1VITG 1X7AC 5L6NH 5FAHA 1NS3A 5T3HA 1LVBA 1HNEE 2FPZA 1RD3B 1KTTB 2FX6A 4GAWA 3MU8A 4BAHB 3P8NA 1D9IA 2BY6X 3TJVA 1WAYB 1SQTA 4X2YA 1Y5AT 2OUAA 4FXGH 2Q6FA 1C5MD 3TNTA 2JETC 4IMZA 2F4LA 1EZXC 3ZV8A 2BY9X 2WPLS 1SI5H 1QY6A 1T4VH 1QTFA 2R0KA 3TK5A 3URDA 1A3EH 4YOJA 1P9UA 1AE8H 1BMAA 1K28D 2ZHDA 4Y11E 1FAXA 1IHSH 1Y3XA 1H9IE 1GPZA 1FI8A 1BITA 1GJ6A 1V2TT 2P16A 4E05H 3TVJB 1O5EH 4HG6A 3HK3B 1CGHA 3E8LA 1GJAB 3A84A 2JIZD 1MTSA 4KTCA 5FBIA 2FIRH 1V2KT 4Z6AH 1C5SA 2ZDMA 3KHVA 4GVUA 4ISLA 5GCHF 3RXLA 3RXVA 3EDXB 4NWKA 1DVAH 1IQJA 2IPQX 1O2TA 4U01A 1WYKA 5AFYH 1A0JA 1JRSA 3OTPA 4ZHAA 3P17H 1BDAA 1BA8B 2BVRH 2BVSH 1VCQA 3QZQA 5I46H 4ZMAH 1C2EA 1BTXA 2TGPZ 1SQOA 2VB0A 4ZKSU 1O5BB 3T28A 4AFUA 1GBJA 1DE7H 1JBUH 1C2FA 5CDFE 2UUJB 3B9FH 4X6OA 2GV7A 2C8WB 3A87A 4BOHA 1GMHG 1TX7A 4CHAC 3RXIA 2W3IA 2FOFA 5DP5A 2FP7B 3SYJA 2P59A 1DUAA 1Z7KA 1DWEH 2QF3A 2A5IA 4AYYB 1IQFA 2Y82A 4AZ2B 8GCHF 3NXPA 3UWJH 2FS9A 2ZTYA 4Y7BA 4WH6A 2OC8A 3M5LA 1H9LB 3IITA 2M2AA 3K2UA 4X1NU 3BTTE 3MI4A 3PLPA 3EQ0H 2ZU3A 4BTTB 2AIQA 2PHBA 3VGCB 4AFZA 1YP9A 3RXMA 2BY8X 4Y71A 1LVYA 4DT7B 5LPFA 1GJ5H 1FY5A 3RXSA 5ESBA 2SGAA 2C3SA 3QK1A 1OWHA 1KXFA 1O31A 2JETB 3LPRA 4H4FA 1QBVH 5DGJA 4ESTE 4CRFA 4K1SA 1BJUA 3SGQE 4DJZB 4B75A 4OGYA 1SOTA 3T5FH 4LXBH 1OPHB 2TGTA 2JH6D 1A4WH 2EC9H 3SNEA 2G5VA 1TGBA 3TGIE 3M7UA 1C5YB 1HAHH 1O3GA 4WH8A 1BCUH 2PP6A 1PPZA 7LPRA 2GZ9A 1GHXH 2FOAA 2BD8A 4ISHH 1ZSJA 2P93A 3PMAB 1FONA 4NSYA 1O34A 1P57B 2XBXA 3BV9B 1EASA 1HAVB 3LOXA 1YWUA 1Z8GA 4KTUA 1E37B 5A8YA 2ALPA 1Y3VA 2BLVA 5DPAA 1LPGB 1KXCA 4NFEA 2OXSA 3RXRA 3IWMA 2PTNA 1FPHH 1AVXA 2F3CE 4I8HA 4M7GA 4INHA 3BTFE 2ASUB 3QTOH 4J2YB 5HMAA 4AFQA 4OGXA 4CHAB 1GBKA 1BTHH 1ZGIA 2BD7A 2FI5E 4GHTA 1A1RA 1C2JA 5DSFA 4E06H 2G8TA 1UCYE 4B74A 4NA7A 2BD4A 4MPVA 1NN6A 3SI4H 1TMTH 1GI8B 2YNAA 3KQEA 3DSOA 1Z1JA 3ESTA 3BTDE 3FP8E 1C5ZB 2L6OA 1N8OC 3BIUH 4IBLH 2XW9A 2GCTB 1EQ9A 1F0TA 3RMMH 3W94A 2ZDLA 3P8FA 1DPOA 1K1NA 1DSUA 1L1NA 4XBBA 3SO3A 1WTGH 1GI5A 3LC5A 2HGTH 3GY8A 1SSXA 2JJ2D 1FQ3A 3QN7A 1ELGA 1O2GH 3RC6A 4CRGA 4WMDA 1T32A 4X1RU 1FDPA 1O3OA 1HFDA 1ZPBA 2Z9IA 1P06A 4Z1MD 2OC1A 4SGAE 4YT7H 3E0PB 3OY5U 2CJIA 1QQUA 2WZQA 4TWWA 1O3CA 3GCTG 1B5GH 1SGPE 5C1XA 1IQNA 2K1QA 4K8YA 1GBFA 1KLTA 3R3GB 4Y10E 3LGIA 2NWNA 2VIDA 1O2VA 3PYHA 4A1XA 1MD7A 3A80A 3LC3A 4IGDA 2ZCLP 1K1MA 1W10U 3GYMA 1XKAC 3TJUA 1GI0A 5G4BA 5HKKD 4A7IB 2BD2A 1C5NH 4D9RA 1B7XB 3OTJE 1HRTH 2ZU4A 3TGJE 4GHQA 3F0PA 1ZHRA 3U1IB 3RMNH 4D7FA 2GZ8A 1BB0B 4YLQH 2WV9A 1O0DH 1DICA 4KGAA 2BY7X 1EUFA 3F9GA 1FIWA 3URCA 2AMPA 3RXGA 2AIPA 3SNDA 1VITH 1P05A 2GDDA 1YC0A 5CHAC 3PB1E 1GG6C 3GY7A 4OS1A 3CENA 2A31A 1B0FA 2STBE 3BTKE 2FWWA 4A92A 1ZHPA 3AAVA 3CP7A 4H42U 4AB8A 4BAMB 1GI9B 2AHME 1FN8A 2G4UA 3F3BA 1EFRD 5E0GA 3ZVFA 1N8OB 4CRBA 4D76A 2CMYA 4ZXYH 1AN1E 2F9OA 2LPRA 3A86A 2ZTZA 1QBOA 4YOIA 5BRRE 2UUFB 2GT8A 4JYVH 4KP0A 1UHBA 4YT6H 1C1MA 1OWDA 1BRAA 1YYY1 5GNDA 3UQOA 1YLCA 1F0RA 2BLQA 3HGNA 1ARBA 5HIYA 4SGBE 4NWLA 1WXRA 1NBMD 4BAQB 3SGBE 2QN5T 2FX4A 3HPTB 3LGUA 1W7XH 2BY5X 4CBNA 4I7YH 3ITIA 4XOJA 2PR3A 3JZ2B 1RJXB 3MU0A 2CGAA 2QIQA 1TWXB 1ESAA 4JZIA 5C3NA 1T8NA 1GJCB 3L3TA 1TNGA 1S6HA 1SLWB 4VGCB 1GMCF 2WV4A 3S9BA 4AFSA 1LTOA 1O3DA 1ZGVA 3MH4A 5EODA 2ESTE 2Z9GA 1D6WA 1F5RA 4ASHA 1GBBA 1ZPCA 3ZYDA 1OWKA 4GCHG 3MH5A 3ZVGA 1XUIA 2NU4E 1LO6A 1UVPA 2VJ1A 3MO3A 1W0YH 4NA9H 5C0TA 1UTPA 2D26C 1H8IH 4MNXA 1HV7A 3UR9A 5FX5A 3N7EA 4LZ4B 1EPTC 1CA0C 4FUEA 2VINA 1IQIA 3STJA 1TOMH 2ZIQH 3KQ5A 3FANA 3TH3H 2R9PA 1L2EA 4ISIH 3GISB 5FPTA 3SU5A 3SU3A 2G00A 5F53A 1Y3WA 4FUIA 3F2GA 2K0QA 5AF9H 3ZVAA 1GBDA 1HIAB 1LHDH 4JMYA 3SJIA 2BDHA 4Z0KA 1C5RA 2CK3D 4OS4A 2GVFA 3LGYA 1HCGA 1G3BA 3F2HA 2W6ID 3Q3XA 4NGAH 4TPIZ 2R3UA 2QAAA 2BOHB 2CHAB 1SG8B 2BM2A 3SJOA 2QV1A 2HPPH 2EQNA 4JK5A 4X6PA 1HAYB 3PRBA 2FS8A 5EW1H 2VWOA 3V0XA 1GJ8B 5LPRA 2NU0E 1HGTH 3CNRA 2HNTE 1MUEB 4ASUD 3K6ZA 2H5CA 1JRTA 2IJOB 5EPNA 5EXNA 2A5KA 4XBDA 3RU4T 3S9CA 1HBTH 2ANMH 4O3UA 1BT7A 1WU1A 3S7KB 1OS8A 2LP6A 1IOEA 1K1IA 4CBOA 2PSYA 2W3KA 4ZROA 3MNXA 1MKXH 1KLIH 4B6FA 3U28C 4A5TS 2ZFQH 3BTGE 1S0QA 3ELAH 2RFKC 1AZZA 2Y7ZA 1V2WT 2J2UA 1G2LA 3RXPA 3E0NB 3MNSA 5IYTA 1QNJA 1GMDG 2FZZA 3SQHE 1OSSA 1AUJA 3C27B 5EXLA 3SW2B 4DCDA 2WPDD 2KCYA 2ZDVH 2WHXA 3M5OA 4DW2U 1LVMA 2WYGA 4X1QU 1C1PA 3M7QA 4U30A 3M37A 3FZDA 1F5KU 4RT1A 4Q7XA 1EPTB 1CA0B
chains in the Genus database with same CATH topology
2O8UA 3UOPA 4OS6A 2C93B 3S9AA 3TPIZ 2D2DA 1C4U2 1EZUC 1WBGB 5DKMA 1B0EA 1KSNA 3A8CA 4BAOB 3MNCA 4MNYA 5C1YA 4Y8ZA 5DP8A 1N1LA 2OBQA 1HXFH 2VIVA 1QJ6B 2SGDE 1O2ZA 1P09A 2A4RA 3VB3A 1THPB 2HLCA 2ZQ2A 1NC6A 1UCYK 4E7RG 1KYNA 4KKDA 2UUKB 4WXVA 3LKWA 1YPLH 3NZIA 2ZFRH 4GPGA 2B5TB 2GKVE 4JZFH 1GHBF 4ABDA 5F03A 6CHAC 1ZTJA 4I8KA 1BHXF 2XBWA 3A8BA 4X1PU 3VB5A 3MO6A 3SORA 1A3BH 1AWHB 1NRSH 2BLWA 2FESH 1QL7A 2FODA 1QRWA 7GCHG 1SHYA 1UTLM 2VIWA 1C1SA 1FXYA 2FYQA 1MBQA 5C2ZA 1VITF 3S69A 3HKJB 2ZHQH 2GDEH 2VVVA 2RA3A 1CGJE 1TONA 1PPCE 4IN1A 4ZAEA 4ABHA 1W12U 1GVKB 4OS2A 2ZGHA 1VCPA 1ANDA 2CF9H 1UK3A 2ZU2A 1QJ7B 3RU4E 4O97A 1ZTLA 1XMNB 3A7YA 4UEHH 3SV7A 1UVUH 1DM4B 3RMOH 1MH0A 1DT2A 4WMFA 1Z8IB 1DY9A 2Z9JA 1P11E 1V2VT 5T6DA 1K1LA 1BMLA 1TOCB 2VWNA 4H6TA 3SV2H 1SBWA 2XC5A 1CHGA 3T62A 1D4PB 2SGFE 3EA9A 1MU8B 1SGNE 4NG9H 2A5AA 1TGCA 3PTBA 1P10A 4NIVA 1OX1A 3EE0B 1UTOA 1DSTA 1ZMLA 2RA0A 3OY6U 1NFUA 1P0SH 4JYUH 3ZZBA 4FVBA 1G3EA 1TIOA 1Y3YA 1DWDH 3Q76A 4ABJA 3DHKH 1TAWA 2QXHA 1O2SA 2OP9A 4YLUA 2BXUH 2PUQH 4RN6A 1MD8A 4ABEA 1C2KA 1F2SE 4IW4E 3UPEA 1AD8H 1QRXA 1LPKB 1A5HA 1O38A 2BZAA 1ACBE 3EA8A 2FDAA 3VGCC 5L2YH 3O8DA 1GMHF 2A1DB 1ESTA 2HVXA 3D49H 1MKWH 4UE7H 4NSVA 5JBAS 3SQEE 3L33A 1O5AB 1XVMA 1S6FA 4HTCH 5DJ7A 2F9VA 6CHAB 1SC8U 3QGJA 4K1EA 4FUHA 2ZCKP 4INKA 2GTBA 1J15A 1EXFA 2O8WA 2FOCA 1TMBH 1TGSZ 4U32A 1ABIH 1FY1A 1UTMA 1ARCA 3A8DA 4XDEA 4JK6A 4Y6DA 1WSSH 4THNH 1DLEA 2BLOA 3QDZB 4ABAA 1SGYE 3ZZ6A 1NT1A 2C8XB 1O3LA 4ABFA 3LT3A 3UNQA 3BTEE 1GI4A 1O5GH 1TB6H 2BD9A 1KDQA 2XWBI 1NPMA 3OU0A 3UNRA 5C5OA 3VEQB 2SNWA 1RRKA 1A5IA 1O3BA 1YKTA 1WTHD 2D1JA 1P01A 1FN6A 3NPSA 4QT8C 4HZHA 1GCDA 1P12E 4CRCA 2ZDKA 3KN2A 5F6MA 1C9PA 1C5XB 1TMUH 2AGGX 1BQYA 1FIZA 3BG8A 1DOJA 1SL3A 2WPJS 4UD9H 3UTUH 1F5LA 1C4Y2 3BSQA 6GCHG 3T2NA 5J4QA 3VB7A 2PGQB 2A32A 2ZEBA 4OS5A 2Q6GA 1RTKA 2AYWA 2V35A 1DX5M 4YTAA 4ABIA 1INCA 4B2CA 3GY2A 1K1OA 3A81A 4K69A 1YLDA 2GGVB 2ZKSA 5TCCA 3E1XB 3A89A 1QJ1B 1BBRE 2HPQH 3GY4A 1BMNH 1YCPM 3BEFB 4X0WU 3L6PA 3Q77A 2I6SA 2GCTC 1N6YA 5EGMA 5A8ZA 1TGTA 3E16B 4H6SB 1GBAA 1ZRBA 3LJJA 3ZZ5A 1GBHA 1P9SA 2Y5HA 3RXDA 1GI6A 2ZDNA 3KQCA 1GHYH 4I8JA 3UREA 1AI8H 1NM6A 2Y5GA 1YBWA 1AE5A 4LOYH 2GCHF 1TGNA 2PKAB 1UTNA 1DUEA 2SGQE 3UQVA 3SUDA 4ISOA 1SFQB 2ZPSA 4B1TA 1O3KA 1W3CA 4X8SH 1QA7A 5AFZH 1CQQA 1NU9A 5CE1A 2Z7FE 3SNCA 2OCVB 1GL0E 3BF6H 4Y79A 1H8DH 4O03A 3SU1A 3ODDA 1SOZA 1HAOH 1O39A 3LH3A 4X2VA 3A7WA 5GCHG 5HYOA 1NO9H 5C67A 5JBTA 5LH8A 2TGDA 3MH6A 3RXEA 3RMLH 1IHTH 5TJXA 4MG3A 2Y6TA 1WQVH 2ZFSA 1QL9A 3FVFB 1OP2A 1YGCH 3T25A 1E0FD 1P2OA 1YPHC 2A4GA 5EQRA 1MTVA 2RDLA 4BTIB 3RLYH 2J92A 4K5ZA 4IN2A 2ZTXA 1K9OE 1LKBA 3P8OA 1G36A 1GHAF 8GCHG 1C5UA 1MQ6A 3ZZ9A 4MLFB 1TQ7B 3H5CB 1C2LA 1SR5C 5FHTA 2Y80A 1RFNA 1YM0A 2PTCE 2Q1JA 1TLDA 5I25A 2EA3A 1XUKA 1HDTH 4XE4A 4YO9A 1G32B 1SHHB 1P04A 3SOSA 3V12A 3QO6A 3F9HA 1PQ5A 5EU8A 2ZGCA 1KXDA 1C5PA 2BDGA 1EJMA 3BTQE 3F6UH 3K65B 3PTNA 1V2JT 1SQAA 4BNRA 4CH8B 2BDIA 1SGQE 2P8OC 1U6QA 3Q00A 1MZAA 6ESTA 5K7RA 1AVWA 4HFPB 4ZKRU 3NK8A 1ORFA 3U98H 1G3CA 3P70B 2ZA5A 3B8JA 4WVPE 3HKIB 2OQUA 2WPHS 1HAZB 1AWFH 2A4OA 2PKSC 2PUXB 4VGCC 3ATWA 1G3DA 2FOMB 1P2IA 4PROA 4JZEH 3A88A 3MU5A 2BDBA 3T27A 1SLUB 1Z8RA 2G5NA 1OXGA 8KME2 1W14U 1OWEA 3DFLA 3RXTA 4AOQA 1DWBH 3F9FA 4Q7ZA 1C5VA 3SU6A 4FU9A 1QB1A 3EAJA 1V2PT 1GGDB 2A2QH 2BZ6H 1YF4A 1QA0A 2ANYA 2WPMS 3P8GA 1O2UA 2XNIA 2ZQ1A 1O33A 1QBNA 3S7HB 3NUMA 1J17T 1HUTH 4FUGA 3GDVA 2Y5FA 2ZI2H 4KELA 5JB8S 2H5DA 1HB0B 4DIIH 1ETTH 9ESTA 5HM9A 3FZZA 3QUMP 3M36A 3EYDA 4WMEA 1Z1IA 2DUCA 1IQHA 3N7OA 1W2KH 2FLBH 3U9AH 1Q3XA 2G81E 4UFEH 2AFQB 2KAIB 3ZZCA 5EQSA 1NU7B 3SJKA 1PPHE 1AIXH 4FU7A 1HAGE 3GICB 1HAVA 3QGNB 1WCZA 2CHAC 1F0SA 2AGEX 2BXTH 3DFJA 3GCHB 3RXCA 1C5TA 2J95A 1UMAH 2AERH 1L4DA 1SB1H 3EA7A 5K0HA 1KLJH 1ZPZA 1LHFH 1MMJN 1AU8A 2BYAX 4TY6A 3RP2A 4B71A 2NU1E 3I29A 4AG1A 1E38B 3DA9B 3F9EA 2P8OB 3LONA 4K1TA 1LMWB 1TQ0B 1IQKA 2ZFPH 1TNIA 2ZZUH 1K1JA 3SNBA 1OP8A 3OSYA 4TPYA 1DANH 1W0ZU 3STIA 3ATMA 1MCTA 1V2LT 4AG2A 4K8BA 2H9EH 2I6QA 1O2MA 1QB9A 1G9IE 2OINA 2PKSB 1MQ5A 1ANBA 5C20A 1V2ST 2QXIA 2R3YA 3LDXH 1DITH 4UDWH 3GOVB 4F4OC 1FV9A 2ZPQA 4CR5A 5FCKA 2RG3A 2ZPRA 3TK9A 8ESTE 4R0IA 3RUOA 1HAIH 3CS0A 2ZFTA 3ZVEA 1GVZA 2BHGA 2V3OH 2FXRA 5L30H 4D9QA 4AYVB 2XCFA 1O2PA 2O8MA 3BTHE 2FOHA 1AHTH 2CV3A 3KGPA 1M9UA 1O3NA 1P2QA 1AO5A 1ZJKA 4DGJA 5JBCS 1C1QA 1Q31A 1C5WB 1D3PB 1AUTC 1TNLA 4O9VA 2PW8H 1O3AA 1NRQH 1KIGH 1P3CA 5EQQA 2P94A 2XC4A 3RXJA 4BAKB 2YNBA 1OYQA 1MBMA 1O35A 2WPKS 3DUXH 4GUXA 1AMHA 1AB9C 1DDJA 1LQDB 1Z6JH 4FUCA 1RGQA 3RDZA 2DE9A 2ZGJA 3ZZ7A 5DG6A 1LCYA 3R0FA 5HM2A 3ZVDA 4Y0ZE 1C1OA 1O2OA 1XM1A 2WPIS 2B7DH 1JMOH 3ATKA 2JH5D 5IDKA 2O8TA 2XBYA 1EZSC 1C2DA 2A45B 3FFGA 1HAPH 2Z9LA 1T7CA 4B2AA 1MKXK 3RXQA 1NFWA 2TBSA 2F83A 1V6DA 1ELAA 1WOFA 1AQ7A 2ZFFH 2HNTF 1ZSLA 1MTNB 3GDUA 1RTLA 1ELVA 2F9UA 2A7JA 3ODFA 2M5TA 2QGRA 3PLBA 1YPEH 4MVNA 2VIPA 3P95A 1QCPA 2ALVA 3PO1B 1NRPH 1O2YA 1KY9A 1O3JA 3BN9A 5H4IB 2GX4A 1BBRH 2VIOA 1V2RT 2B9LA 7GCHF 1CGIE 3KQBA 2F9NA 1V2MT 2ZHEH 3MH7A 3SV9A 3NWUA 2BOKA 1BTUA 2ZWLH 1L4ZA 4NZQA 5ETXA 4MPWA 1SGFG 2AH4X 1KXBA 2XBVA 1EX3A 5A2MH 1CE5A 1FJSA 5L2ZH 2ZC9H 1AKSB 1MAYA 1LDTT 2HRVA 4U2WA 4AN7A 2XYAA 3GYLB 1GJ4H 1P2MA 2B8OH 1E36B 1Y3UA 3NKKA 1MTWA 4Q7YA 1LKAA 5F8TA 4CRAA 1NZQH 3ZVCA 5DO4H 4Y76A 1OP0A 4FUDA 1AB9B 3W95A 1O3MA 1O3IA 2BVXH 1CA8B 4WF8A 1QFKH 1YCPK 3QLPH 4F49A 2Z3EA 1RIWC 1ELTA 4IS5A 2QA9E 1NROH 1O2HA 2FO9A 2H9HA 2Z3DA 4I8GA 1C1TA 5FCRA 1IQGA 1G2MA 2DE8A 4E7NA 3VXFH 2ILNA 1E34B 2O8LA 3P92A 3U8RH 2AMDA 6LPRA 5GDSH 3A7ZA 5CMXH 3LIWA 2QXGA 1YCPH 2BDYA 1TX8A 1A5GH 1TBZH 3ATIA 5C5NA 2QXJA 5EPYA 2F9BH 1F7ZA 1ELEE 9LPRA 1RTFB 1HIAA 1MCVA 3LGVA 4DOQA 1Z71A 1BJVA 1P2KA 1H4WA 3RM0H 3TLOA 2GMTB 5LGOA 2C8YB 1IQLA 1UK4A 2CN0H 1TPPA 2XWAA 1V2OT 4Y8YA 2G52A 1A7SA 4LZ1H 1C2GA 2BQWB 2ODQA 3A7XA 3SZNA 4GSOA 1CHOG 3TGKE 3RXKA 1O2WA 4JZDH 3PMHB 2TGAA 4D7GA 1PJPA 4GLYA 3IG6B 1MKWK 1O32A 2XRCA 4Y0YE 1P03A 1D6RA 2UUYA 4NIYA 1O2RA 3ZZ8A 1C9TA 2XTTB 3RXHA 3V7TA 2J94A 2P3FH 1T8MA 4FU8A 1O37A 1PQ7A 2WYJA 1EJAA 2ULLA 3SGAE 1ZOMA 5JBBS 3TJNA 3SUGA 1XKBC 1S85A 6GCHF 1S82A 1VGCB 1GDUA 5T6FA 1GJ7B 4XBCA 1VJAU 3PWCA 1TA6A 2ODYB 2BX3A 2TIOA 1UO6A 3HGPA 2FTLE 2F91A 1GJDB 2ODPA 3B23B 4RKJB 1EAIA 1TBRH 3UWIA 1VZQH 2GZ7A 1RIWB 1AZ8A 1TBQH 3M3VA 1TPOA 5B6OA 2W7SA 1QHRB 4BXWA 2P3UB 3HK6B 1W13U 1Y8TA 1XX9A 1D3TB 3BTME 4TY7A 1YPHE 1EPTA 2FEQH 4HI3A 1O3PB 3GCNA 1K22H 3MU4A 1EOLA 3BTWE 4FUJA 1CT2E 1J9CH 1GVLA 1P3EA 1XXFA 4YESB 4DIHH 1SPJA 2ZO3H 4BTUB 3GCOA 3I77A 3GY6A 7KMEH 3JZ1B 1MTUA 3FP6E 2ZCHP 2SFAA 1GBTA 1ZLRA 2UWPA 5ESTE 1PFXC 3E90B 3SI3H 2JKHA 3LGWA 1C5LH 3MTYA 2F9PA 2YOLA 1GDNA 1FY3A 4LK4A 4BXSA 2ZGXH 1MAXA 1GI2A 1HJ9A 4UFDH 1AVGH 1LQEA 1FLEE 1H9HE 1ANEA 3ENSB 4KTSA 1HYLA 1DXPA 1C1RA 2ZF0H 2GV6A 4B76A 2A0QB 1IQEA 3ZZ3A 1GCTB 5TCAA 1V2QT 3UOUA 1A0LA 5GWZA 3T29A 1DFPA 1EB1H 1ZR0A 3A8AA 2Z94A 3ZVBA 1A46H 2HOBA 4X8TH 5JB9S 1Q2WA 3LJOA 1T31A 1YPJH 2VGCC 3BG4C 1ZZZA 5E0HA 1BTYA 2EI6A 3C1KA 4B2BA 2PWXA 4FVDA 3KIDU 2J4IA 1DLKB 1UVTH 1C5QA 4MQAA 4X2WA 1UK2A 2OC0A 3A85A 5BPEA 1PPGE 1NTPA 1SGRE 3QZRA 5E2OA 3FP7E 1LVOA 1O3EA 1EAWA 3G01A 2C90B 3LU9B 3MWIU 1XVOA 1G30B 1T8LA 1PYTC 3RXFA 2D8WA 1TABE 3MFJA 2BDAA 3SNAA 2FMJA 3SU0A 4YZUA 4AX9H 2UWLA 3D23A 4I31A 1L1GA 1GBCA 4J1YA 4MPUA 4NIXA 1GHVH 1P8VC 3TU7H 1AGJA 2OC7A 1W7GH 1C1NA 2PSXA 1NY22 1T4UH 1ZYOA 2FLRH 4A1VA 1O2LA 2ZU1A 3KNXA 4OS7A 1BZXE 1BRUP 4FUBA 3RC5A 3ATLA 3VPKA 1PPEE 2WINI 4TWYA 1A61H 2IPHA 1GI3A 2BB4A 1DS2E 2R0LA 2ZDAH 1XUGA 2FYRA 2SGEE 3OX7U 4ZKNU 4CRDA 2GP9B 1JWTA 3Q3KA 3GCTF 5A0AE 5GXPA 1GGDC 1GI7B 1EAXA 3E3TA 4R8TB 4ABGA 4UFFH 1BTZA 1ZTKA 2EEKA 3DT0H 2J9NA 1CT0E 3ZZAA 1TALA 2H1UA 1QRZA 4O3TA 4IC6A 4MTBA 1GBEA 1BRCE 1N6XA 2QY0B 1SGFA 2OTVA 5ABWA 2ZP0H 1EB2A 1BHXB 2RCEA 5DP7A 3RLWH 4YOGA 4X6MA 1UHBB 3MNBA 1EOJA 1SGIB 3KL6A 2P3TB 3A83A 1C2IA 3M35A 3M3TA 1CT4E 3ZV9A 1SGEE 2ZNKH