1SGCA

The 1.8 angstroms structure of the complex between chymostatin and streptomyces griseus protease a. a model for serine protease catalytic tetrahedral intermediates
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE A
publication title The 1.8 A structure of the complex between chymostatin and Streptomyces griseus protease A. A model for serine protease catalytic tetrahedral intermediates.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 54
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1986-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgcA01
1P12E 3TJOA 3NK8A 3RXUA 2OUAA 6CHAB 3KQCA 4XDEA 3MWIU 1RTLA 1IQIA 4TWYA 5DGJA 1BB0B 2P59A 3NKKA 2R0KA 1AN1E 1JIMA 3BEUA 3ZVEA 2DE8A 1P10A 1NPMA 3LDXH 1NZQH 3FP6E 4FUHA 2WPMS 4KGAA 3SJKA 2C8ZB 1S81A 3RXFA 2SGFE 1V3XA 2ZU1A 1MTNB 3ATIA 3T28A 1YF4A 3L3TA 1XXFA 1JBUH 1GJAB 1OWDA 1YPMH 4FUBA 3SU0A 5C1YA 1UCYE 2O9QA 1OP0A 1YPLH 1DUEA 1O2HA 1SHYA 3SOSA 1EP5A 1SGIB 1GVLA 1QJ6B 3SV2H 2XBXA 3TITA 1Z1JA 2CN0H 4Y8ZA 1TNIA 1Y8TA 4WXIA 1RTFB 1K22H 7LPRA 2ODYB 3BG8A 5FPTA 2PUQH 1RS0A 1LPKB 1T7CA 1YCPH 1MQ5A 1FY3A 2H2ZA 1H9HE 4ZKNU 1MKXH 4X1SU 2Y81A 1A0LA 1SGDE 3MU4A 3MYWA 2ZPQA 3UUZA 1G3CA 1TRNA 2OC1A 1GGDB 1MKWH 4Y11E 2PKSB 2FLBH 1YP9A 3A82A 2BLWA 1T31A 1MZAA 2QXGA 1AY6H 1T4VH 1C1SA 1YKTA 2G51A 3ZZ4A 1AKSB 1AUJA 4NGAH 3MMGA 1QRXA 4GAWA 1DWBH 2Y6TA 1BMLA 2H5CA 3F9GA 4JZ1A 1UTNA 2BVRH 5C20A 3ZVGA 3SORA 1YPEH 2GTBA 3HATH 4MNWA 1LKAA 1DLEA 3UWIA 1O39A 3L6PA 1SSXA 1BTZA 4ZROA 5GCHG 3TK5A 8LPRA 5SGAE 2FESH 3TJUA 1LVYA 1P2JA 4BNRA 1GHXH 1PQ7A 3TNSA 1AD8H 3KF2A 1QB1A 3A8DA 2WPJS 2Y80A 3R3GB 1TOCB 4DG4A 3M61U 3EYDA 2ILNA 5DO4H 3A84A 1T8LA 1YLDA 3OTJE 1WV7H 3QUMP 1C1VH 1RIWB 4PROA 1GI3A 4Y71A 1VCQA 2EI7A 2ANYA 2J2UA 1EATA 4KELA 4BANB 3E90B 1O2UA 5TCAA 4UFEH 5LPFA 3ZZDA 2ZQ2A 3SNBA 1O3CA 1O2IA 3D65E 1TPOA 2F9NA 1FPHH 1F0UA 5EOKA 1FONA 1F5LA 4NZLA 5JB9S 5I46H 2A4RA 3ZV9A 1VCWA 3KCGH 3RXGA 1J8AA 1HJAC 8KME2 1N8OB 4IN2A 2R0LA 2FOMB 2YNBA 2C8WB 1HNEE 2CMYA 4X8UH 4X6PA 2VGCC 3MO6A 5C1UA 2QA9E 4DURA 4UFGH 3PMBB 4ABIA 2P95A 1CVWH 1QCPA 2JH5D 1BZXE 3LH3A 3KEEA 1ELBA 1O0DH 3LT3A 1WSSH 2BM2A 1LVBA 4AGJA 2C8YB 1T8MA 2OQ5A 3M5MA 1JIRA 2QCYA 5GJ4B 1E35B 3AASA 1OPHB 1GDQA 2FXRA 2VVVA 4FVBA 2QGRA 3BTME 3Q00A 1ACBE 1H8IH 3TGJE 2HNTF 4E7NA 1OWKA 1NY22 2FMJA 5E8EH 4BXSA 4JCNA 1A0HB 1UVTH 3PMAB 1MH0A 1GI1A 2RA3A 1O3IA 1PPZA 2CF8H 4ZXYH 3LJJA 1SC8U 3ZVDA 5A8XA 2P94A 1VITF 3CS7A 2XTTB 2BZAA 3PWBA 1EB1H 3OU0A 1EASA 4ZKSU 3EDXB 1LVOA 4XSKU 1CE5A 3RXHA 3SQHE 4BAQB 2O8WA 3ATMA 3OYPA 2RG3A 1BRUP 2XC5A 1BMAA 1IQJA 2Y5HA 3AAVA 1OWIA 1WQVH 1XMNB 1G30B 1ZSKA 5CMXH 3ATLA 2GZ8A 2HRVA 1TBRH 3F9EA 3FZZA 1WTGH 1ZRKA 3RXEA 3ZZ7A 3BG4C 1LDTT 1NO9H 2GDEH 1ZGIA 1PYTD 1O2SA 3STJA 3WY8A 1P3EA 1VGCC 3LOXA 4K1EA 4ESTE 1MBQA 1ZTLA 1H9IE 2VIWA 3URCA 1ZJDA 3LU9B 4X1QU 1A7SA 5EW2H 1ZRBA 4FUGA 1L4ZA 2M5TA 1ANEA 2Y7ZA 1O2PA 1UCYH 2B8OH 1TGCA 1YC0A 1U6QA 2CXVA 2O8LA 1HJ9A 2UUJB 5IYTA 5LPRA 5FPSA 1GBTA 1SFQB 3RC5A 3VPKA 4NFEA 1J9CH 1J17T 5DP8A 3P17H 4NCYA 3QTVH 3P92A 2ZU3A 3GCTF 1HAVB 1V2MT 1B5GH 1O2KA 4MG3A 2W7SA 1LQDB 4LK4A 2XW9A 4CH2B 1C2HA 1O37A 1PPHE 1H9LB 1KDQA 3ZZAA 3MU0A 1O3MA 1ZPZA 3QGJA 2Z9IA 4K69A 1NC6A 1V2LT 5G4BA 2Y7XA 1ESBA 2PV9B 4DY7B 2A2XH 1SGNE 3I77A 1BA8B 3KQDA 1S0RA 1J16A 4CRDA 1GJDB 1D3TB 3TPIZ 1AFQB 4Y8YA 4IS5A 1SQTA 2XC0A 1C2KA 1BTHH 2Q1JA 5E2OA 4Y0YE 1GMHG 1V2TT 8GCHF 5JDUB 4RN6A 1TPSA 2FEQH 1MTNC 1FJSA 1UVOA 4YT7H 2VJ1A 1ETTH 4NWKA 1QBOA 4D9QA 5C2ZA 2XBWA 1UK3A 3OSYA 5DP3A 1O3NA 2RA0A 4IW4E 1ESTA 4X2WA 3UPEA 4AN7A 3A7XA 1G37A 1GVZA 1XXDA 2P3TB 2I6SA 1FIZA 1O2QA 4GCHF 1FQ3A 2EEKA 3LJOA 1YCPK 1PQ5A 3CENA 1TGNA 3K65B 1V2VT 6GCHF 1HAXB 2EI8A 1JMOH 3P8OA 1A3BH 3RC6A 3UQOA 4JK6A 1P06A 3UREA 1THRH 2BOHB 4TPIZ 1MKWK 3DA9B 3RM0H 1VR1H 2AFQB 1MD7A 3TJVA 3W94A 1AI8H 1YGCH 2NU4E 3BTTE 1DITH 3ODDA 1MD8A 2GT7A 4INHA 2WYJA 3RU4D 4E06H 5L30H 1GI4A 1E36B 1O3HA 1RRKA 1HXEH 2BXTH 1SLWB 1QY6A 2ZECA 1C1UH 2JH0D 1EB2A 4CH8B 1K1LA 4I8GA 1PPGE 1Y3VA 2Q6FA 1GJBB 4B76A 1O2VA 3GY2A 1GL1A 1Z6EA 4MNXA 3ZZ6A 3HKIB 2ZA5A 2QV1A 3A7TA 1Y3UA 1YBWA 4LOYH 2ZHDA 1ZTJA 1HRTH 1G36A 4HFPB 3FANA 1NFXA 1NM6A 2ZQ1A 1GG6B 3T27A 3QX5H 2FOEA 2ZTXA 2VIDA 2Z9LA 3F6UH 3QDZB 5FCKA 4AGKA 1HAHH 1O3AA 1C5RA 1O3BA 4SGAE 1GI8B 2ZU5A 4A7IB 3BEIB 1QQUA 3T29A 1SGYE 2D2DA 1GJ9B 3V12A 2GMTC 3OX7U 2QXHA 2WYGA 1TRMA 5AFYH 1FZZA 3EA9A 1Z1IA 3RLWH 5T3HA 1FIWA 1AZ8A 4E7RG 1HJ8A 4OGYA 5EQQA 3ZZBA 2BZ6H 1GHBF 3GY7A 1C1TA 2B7DH 4NG9H 4CR9A 1LKBA 4TPYA 1MQ6A 2ZO3H 4MVNA 2D26C 4WY3A 1HYLA 1MCVA 2FO9A 1XVOA 3RXKA 3SGQE 1ETSH 4I8LA 1L1JA 3O8DA 1TX8A 1VCPA 1D6RA 3BTQE 2BHGA 2HGTH 3PO1B 1S6HA 3GYLB 2RDLA 1DICA 1FAKH 3ZZ5A 1C5MD 2W7UA 1C1PA 4Y7BA 4FU9A 2OQUA 2WPLS 2HNTC 1NN6A 1BJUA 3MO3A 5GIBA 1A2CH 1EP6A 1A5IA 1ZSJA 1W13U 2TPIZ 5FXLA 1TFXA 1GVKB 2GD4B 3KQEA 1V2OT 4WF8A 3NZIA 5EW1H 4AFSA 3ITIA 1FY8E 1Y5AT 3ZZ9A 2Q6DA 3SNAA 4BAHB 4CRCA 1LHEH 2BMGB 2ZTZA 3AAUA 1DWDH 1TB6H 4WH6A 4A1XA 3NCLA 1ARBA 2Z6BD 5EPNA 1O30A 2FIRH 2PUXB 2ZGXH 1C5WB 2BY6X 2VIOA 1NRRH 2XBYA 2GT8A 1O2TA 4O9VA 3NUMA 1GBCA 2QXIA 1QTFA 1C2JA 1FN8A 3U8TH 1TAWA 5E0GA 2BY9X 1Z8RA 4AX9H 1A46H 1UJ1A 3SGBE 1WBGB 5ABWA 1DS2E 1K1NA 3U9AH 1D4PB 1AB9B 4B71A 4FUFA 2G55A 5ETXA 1GDUA 2XC4A 1THPB 3P95A 3C1KA 1UO6A 2TGTA 2O8UA 5ESTE 1YM0A 2TIOA 2H6MA 1KDQB 1TNJA 3GDUA 1CHOG 1EZUC 2NU3E 4I32A 2F3CE 1T8NA 4A1VA 4VGCB 1BTYA 3MFJA 1TGBA 2AMDA 1TONA 1UCYK 1BHXF 3RXPA 5EPYA 3FZDA 4Q7XA 1ANCA 3LC3A 1MCTA 1AIXH 2Z7FE 3MH7A 2FS8A 1QQ4A 1WCZA 1O36A 2BLQA 4GPGA 2HLCA 4IBLH 1CHGA 3U8OH 4ABDA 1Q3XA 3VGCB 3UR6A 1RXPA 1MUEB 3BTDE 4Y6DA 3A8AA 1SOTA 3S7HB 1QIXB 4XOJA 2ZIQH 3M36A 1EAIA 1BTWA 5HYOA 1OP2A 3KL6A 1UVSH 1N6XA 3M5OA 1OYQA 4AFUA 2FYRA 1K2I1 2YOLA 1GI0A 1PQAA 1KXAA 1F2SE 2Z9JA 3K6YA 3PMJA 1P11E 4D7GA 2CJIA 4YOJA 4AG2A 1P8VC 1GCTB 2BXUH 1AWFH 1O35A 2ZGHA 3RP2A 3UOUA 1AFQC 1DY8A 1SOZA 2QN5T 4X8SH 1CBWB 1UVUH 3GYMA 4HZHA 2UUKB 4JZFH 1GI9B 3V13A 1HFDA 2FX4A 1CA8B 4DGJA 1KTSB 1SGPE 1JRSA 2ASUB 2SGQE 2P3UB 2GV7A 1DX5M 3P8GA 1F92A 1CA0B 1V2KT 3F9HA 1IQLA 3S0NA 1P03A 5PTPA 1O5GH 2V3HH 1K1PA 2A7HA 1HAVA 2NU2E 3S7KB 1FY1A 1NFWA 2BD7A 1BMNH 1O5FH 3TLOA 1EX3A 2AGGX 2QYIA 3SUFA 2IJOB 2PSXA 1UTQA 1YPGH 5AF9H 1S6FA 1BQYA 1TNHA 2BLOA 4X6NA 1GI2A 2FOFA 5EQSA 4ISOA 3RXOA 4Y7AA 1LHFH 1D3PB 2ANWA 1P2NA 1FPCH 2VIQA 2XWBI 1GBLA 1MAXA 2B0FA 3M7TA 1WU1A 3MH5A 4O97A 2VINA 3ELAH 3SBKA 1LPGB 1FNIA 1M9UA 1EAXA 4RKJB 1DXWA 4NIYA 2UWLA 4XFQA 2PHBA 5F03A 3A89A 1NTPA 1NT1A 2RCEA 1LVMA 5EG4A 7KMEH 1BJVA 2ZDAH 2OTVA 1RD3B 5DPAA 5TCCA 1BTXA 1E37B 1FLEE 1GBEA 1MTUA 4X1NU 1CT4E 5EXMA 1INCA 1KLTA 2W5EA 2GCTB 1HAYB 2BX3A 1SGRE 3RMLH 1O3PB 2CHAC 4Y79A 5J4QA 1EPTA 3M3TA 1V2RT 5C5NA 2Z3CA 5LPEA 5GWZA 4CRFA 3U1JB 5CE1A 4X6MA 1IQKA 4H42U 2NWNA 1ARCA 1C2GA 2G4UA 4KP0A 4NSVA 2BDCA 1LMWB 3EA8A 1TMUH 1BMMH 3PB1E 1O2YA 3VXEH 5A8ZA 3SGAE 2ZG0H 1O2NA 1P9SA 1GHAF 4NIVA 2AS9A 1P01A 4INLA 4B2BA 1FI8A 3SI3H 5ESBA 1X7AC 2P3FH 2FTMA 2ZFFH 1C1RA 2ZI2H 3RLYH 1TWXB 1RJXB 1ELAA 1C4U2 2C4FH 1VZQH 4LZ1H 3BEFB 1O2ZA 3RXVA 2ZDNA 1FN6A 1MU8B 4I33A 3VB6A 2JETB 1O31A 2FX6A 1SPJA 4NZQA 3A86A 2AGEX 4ISHH 5FBIA 4ABGA 1DSUA 3UTUH 1O33A 2PR3A 1XX9A 2ZKSA 2H9EH 1C9TA 1G9IE 4MTBA 1BITA 3HGNA 1QJ1B 1TBQH 3EA7A 1S82A 4IN1A 3RM2H 2WV4A 2OLGA 3D49H 3BIUH 4HGCA 4WMEA 3ZVCA 4Q2KA 1W7XH 3PWCA 2BDAA 2VWNA 1LQEA 3ZYDA 1P9UA 3U98H 1K1MA 4Q80A 4YOGA 1GBJA 2DE9A 3MTYA 3PROA 4ABFA 3TK6A 4TY7A 1EKBB 3GY3A 1HAZB 4YM9A 4WH8A 2P8OC 4TWWA 4DIIH 3LKWA 1VITG 1DLKB 1GBHA 2IOTA 4MPXA 1AGJA 1BBRE 2XYAA 2F9UA 3D62A 4BAOB 1XUGA 1P04A 3ZZ3A 4GLYA 2BDHA 1S5SA 3U1IB 1F0SA 2QAAA 1ABIH 1SMFE 2UWOA 4FU7A 1J14A 5T6FA 5TJXA 4Y0ZE 3SV7A 1AHTH 3TNTA 2EC9H 1D9IA 3QK1A 4U2WA 1W7GH 5F8TA 4F49A 1UMAH 1QB6A 1C2LA 2A7JA 1KLIH 1VJ9U 2ZFRH 5CHAB 1NESE 1UK4A 2ZWLH 1YCPM 2F9BH 1C5YB 5AFZH 2VNTA 5AVDA 1NRNH 4CBOA 1YPJH 4CRGA 2AMPA 1AB9C 1ANDA 1C5LH 3ZVBA 4FUEA 4UEHH 2BD9A 1HDTH 1MAYA 4D76A 4BTIB 1EJAA 1TRYA 4AORA 1TMTH 4M7GA 2HNTE 1CGIE 2ZC9H 2ZHQH 1TA2A 1WOFA 3MNCA 3P70B 1TE0A 2OXSA 3GCTG 3SJ9A 1KXEA 5K0HA 2ZTYA 1O2JA 2SGPE 1GBDA 5A09A 4ABEA 3RXMA 2GGVB 1UTKA 4IMZA 1QL7A 3VGCC 1O2RA 2C90B 4ZHLU 1TPPA 2OC0A 3VB5A 1DOJA 4THNH 3HK6B 1RTKA 3SU3A 3E16B 1IQEA 3SV8A 3KN2A 3ESTA 3LGTA 4MPUA 2G81E 2V6NA 4WJG2 1NRQH 2AIPA 5HMAA 3GCHC 1HUTH 1ETRH 1OS8A 2R3YA 4JZDH 4YLUA 1LHDH 4X2XA 3UR9A 2CGAA 4IMQA 2QF3A 4JYUH 3KNXA 2QXJA 4U32A 1BT7A 2WPKS 1YLCA 1O3DA 1TQ0B 1IAUA 3A7WA 2FYQA 1HGTH 3RC4A 3GDVA 4YZUA 1ELCA 1AE5A 2ALVA 2VWLA 1W12U 3K2UA 2QIQA 3OY6U 6CHAC 1O3FA 5GXPA 4D7FA 4X1PU 1TGTA 3P8NA 5F8XA 3C27B 1EJMA 2BQWB 2B5TB 3GDSA 1C5VA 1TNLA 5T6GA 1C5PA 2V35A 2PSYA 4GCHG 5EXNA 5C5OA 2A7CA 3QTOH 2LNCA 2A32A 3A7ZA 6GCHG 1P2MA 2FI4E 4UFDH 1LPZB 1TA6A 1LHCH 5B6OA 3GCOA 3LC5A 4FUCA 2WINI 1ABJH 5HM9A 3BTKE 1C2EA 1EPTB 4JYVH 1C5NH 1HIAB 1DUAA 1C5SA 2F9VA 2PFEA 3HK3B 2TGPZ 9ESTA 3RXSA 1SI5H 1O5CB 3M5LA 4FXGH 2ZF0H 1F0TA 4MPWA 3VB7A 1GL0E 2VU8E 2P93A 4Y76A 5A0CA 4BOHA 3BF6H 5LH8A 1GGDC 4BTTB 2TRMA 2PKSC 2WV5A 4J2YB 1THSH 1XUJA 1OWEA 4XBDA 3GICB 4AFQA 2ZFTA 4JK5A 4K60A 4NSYA 3IITA 1F5RA 4FUDA 2PGQB 3BTHE 1G2MA 1W0ZU 2GCTC 2OC7A 1TNKA 5HXFA 1A3EH 1YPKH 3EE0B 5AHGH 3SN8A 1GMHF 3T62A 2O8MA 2H9TH 2XBVA 1SR5C 1GMCG 1XUHA 1MTVA 1OWJA 1XKBC 4B2CA 3SU6A 1DSTA 1C5XB 1QA7A 3MU5A 2STBE 2BD2A 4CBNA 1NFYA 2FOCA 2FP7B 3RU4E 2HPQH 1S84A 1V2ST 2XXLA 5A0AE 4B73A 3QN7A 1Y3WA 5DK1A 5F6MA 1MZDA 4QT8C 1GI7B 3SU1A 3SUGA 1C2MA 3B8JA 5JB8S 1RIWC 2GCHF 3LGWA 2AEIH 3MI4A 2JETC 3BSQA 4DJZB 3TVJB 1ORFA 1Y59T 1Z8IB 2ZHEH 4R8TB 1O5DH 2BX4A 4AFZA 5K7RA 2AGIX 2LPRA 2BB4A 1F5KU 1G3BA 4BAMB 1AU8A 2ZDMA 2VB0A 2ZCHP 6LPRA 1NU9A 3A80A 1SGEE 3RXDA 2FS9A 2ODPA 2OCVB 4GHQA 2XWAA 4HTCH 1ZYOA 2ZU2A 1N8OC 4I8KA 2BY5X 1AWHB 3SZNA 3SJOA 1K1JA 2BD4A 3DFJA 2G8TA 4CREA 1ZGVA 4K5ZA 1XUFA 4AG1A 3A83A 1K1IA 3PMHB 1WAYB 2BYAX 2Q6GA 3DT0H 1C5TA 3HKJB 4AOQA 4WMFA 2ZDLA 4UFFH 5BRRE 2SNVA 1N1LA 2UWPA 3B9FH 3UNSA 3TH3H 1C1QA 1GBBA 4MDSA 2ZFSA 1A5HA 4FU8A 1VITH 2ODQA 1FDPA 1QRWA 1HPGA 1O2MA 3TU7H 1NRSH 1AQ7A 1PPFE 2XNIA 2BD8A 1O3KA 2ZGCA 2OBOA 3IG6B 2G00A 2R9PA 1GJ6A 5FCRA 5DKMA 3ZZCA 5J4SA 1PYTC 5FX5A 2VGCB 2SGEE 2A45B 1CGJE 1BDAA 1XKAC 2BDGA 3A85A 2BTCE 5L6NH 3LPRA 3SV6A 1ELDE 3SNDA 1O2OA 2W26A 4D8NA 3QZQA 1B0FA 4ZKOU 2I6QA 2PLXA 4ZMAH 1GJCB 3D23A 1NU7B 5DG6A 2BQ6B 4ISLA 1W2KH 4ZKRU 4YLQH 2GVFA 3ZYEA 3T5FH 4O3TA 2W3KA 4YT6H 4UONA 1UTLM 4CR5A 2ZFPH 1DWEH 2ZDKA 5GDSH 1TIOA 1HCGA 1AFEH 7ESTE 2ZGBH 1GBAA 1GHYH 4K8BA 4ZH8A 4K2YA 2XRCA 1HB0B 2BOKA 2ZDVH 1JRTA 2VH6A 1A4WH 3LH1A 3M3SA 3RXTA 2F9OA 1GHVH 1V2QT 3FAOA 1BRCE 1B7XB 1ID5H 4OS7A 1GJ4H 3KIDU 3V0XA 3W95A 1TABE 4NA8A 4JYTA 2GX4A 4NIWA 4Y10E 3BG4B 1IQNA 3RMOH 3SUEA 1ZTKA 3TJNA 4DCDA 1TALA 1TNGA 4X2VA 5GPIB 4A92A 2FDAA 3LGUA 1GDNA 5FHTA 5EGMA 3MOCA 1SVPA 2VWOA 5A2MH 2ZPSA 1L1NA 3KHVA 4X0WU 1UTPA 2ZP0H 1GI5A 2ANKH 2ZCKP 3PLKA 1TLDA 4KTSA 1WUNH 1E38B 2OD3B 4OGXA 5I25A 5DP5A 1TBZH 4CRAA 1T32A 2V3OH 3KQBA 1OOKB 1LHGH 4K1SA 1E0FD 1ZMNA 1UHBB 2QF0A 1Q2WA 1CQQA 2CF9H 3L33A 1BTUA 1A1RA 4BXWA 3FP7E 3MHWU 1SL3A 5EU8A 3TK9A 3RUOA 4XE4A 3VFEA 1ZMJA 2OBQA 1G3DA 4U30A 3A7YA 2AH4X 1PPEE 2HALA 3GY5A 5LGOA 2TGDA 4WVPE 5FBEA 3VB3A 2GKVE 1IOEA 1EPTC 3URDA 1TGSZ 2UUYA 4X1RU 7GCHF 1NFUA 3PTBA 2ZGJA 4TYDA 4B2AA 1J15A 1CU1A 3RXLA 2F91A 1C4V2 2J4IA 5JBTA 1JWTA 3O8CA 1BCUH 1EJNA 2ZCLP 5A8YA 2UUFB 4OS4A 3F9FA 1E34B 3SNCA 2FPZA 3ENSB 1WQSA 4H4FA 3TGIE 4BTUB 3CP7A 3BTFE 1O3LA 3Q3YA 2P16A 1FV9A 3QWCH 1O5AB 2WPIS 1GMDF 1PQ8A 4X6OA 3NPSA 2BDYA 3TH4H 2AMQA 1PPBH 1W11U 3GY6A 4O03A 2BD5A 3O8BA 1GJ7B 1P2QA 2BLVA 3Q3XA 4GUXA 1GHAG 1OXGA 4A6LA 4A1TA 1GPZA 3MNSA 4Q7YA 1HAPH 1SG8B 3B23B 3OY5U 1SGFG 2JKHA 2ZPRA 4MNYA 1DWCH 1GJ5H 5DP7A 2FLRH 3PYHA 1A61H 1SLXB 4MPVA 4E05H 4LXBH 1HIAA 1SFIA 1F0RA 3ATWA 1ZHMA 4GHTA 3VEQB 5JPMH 2WUBA 4INKA 1GG6C 1P05A 4NA9H 2H9HA 1BBRK 2A4OA 5C3NA 1QHRB 3STIA 4CHAB 1Z8JB 1UTMA 3UFAA 3LONA 2VIVA 4Z6AH 3S69A 3M5NA 2YNAA 4X8TH 1OSSA 1UVPA 1EAUA 2FODA 2C93B 2K1QA 5DP6A 2GZ9A 3DD2H 1A5GH 1KXBA 1AO5A 1D3QB 1UTJA 1PJPA 1V2JT 5JYIA 1YPHC 4UE7H 1HV7A 1P2KA 3ODFA 3A81A 4F4OC 4ZHMU 2R3UA 1IHTH 2BD3A 3FVFB 2GDDA 5E2PA 1N6YA 1O2XA 1TMBH 3E0NB 3TH2H 1SLVB 1S83A 5HM2A 1CSOE 4YOIA 3AW1A 1CGHA 3T2NA 2GV6A 2BDIA 3PO1C 1D3DB 1ESAA 1Y5UT 2WUCA 1SHHB 4X2YA 1XUKA 2PW8H 3QGNB 1V2UT 2EI6A 5GCHF 2GMTB 2Z3EA 5EXLA 3GY8A 3MH6A 2FOAA 1O3GA 1FAXA 3E3TA 1GBFA 2ANMH 2BY8X 3RMMH 3NXPA 3RXQA 5DP4A 3UQVA 2PTCE 1ZPCA 3N7OA 4DW2U 1D6WA 1TYNA 1C2IA 1BIOA 1C2FA 4IC6A 3UWJH 4AYYB 4K1TA 4I31A 3ZVFA 2C3SA 2A31A 2HVXA 3RXBA 1S0QA 3RXAA 3LGIA 2HPPH 1FY4A 1PFXC 3M7UA 1HLTH 3SU4A 1AUTC 3BTEE 2D1JA 2OC8A 3GY4A 3MU1A 2ZZUH 1ZHRA 4NA7A 3EGKH 1EQ9A 1EZQA 1UK2A 4TY6A 2SNWA 3UNQA 1GCDA 1Z7KA 3M37A 3IWMA 1L0ZA 4JZIA 3Q77A 2H5DA 2FOGA 3T25A 1ZJKA 2F9PA 1BRBE 3E6PH 1RFNA 4I8HA 1SLUB 5FX6A 3TGKE 3UIRA 1AZZA 3BIVH 1ELGA 4IC5A 1C5UA 3MO9A 5L2YH 3DHKH 3EAJA 2C8XB 1F7ZA 1O34A 1P0SH 1OYTH 3LIWA 1OP8A 1QFKH 2O8TA 4U01A 4VGCC 3LGVA 2BVXH 1P2IA 4RKOB 1V2WT 2QC2A 3HPTB 2OINA 2KAIB 3SW2B 1ZOMA 4FVDA 4JZEH 2ALPA 1TOMH 3PM3A 3RXCA 4MLFB 3MNBA 1BRAA 1OX1A 1K21H 2J92A 1SQOA 2FOHA 1DT2A 1AMHA 5FPYA 2R2WU 4AB9A 1T8OA 5E0JA 4B75A 2J95A 3S9CA 1ELVA 4I7YH 1DFPA 3QLPH 1JOUB 1P57B 3I29A 3M3VA 1AVGH 3Q76A 5A0BA 4D9RA 8ESTE 1K1OA 2VH0A 1BTPA 2ULLA 4KTUA 4B74A 1ELTA 5C1XA 4DVAU 1HAIH 1DY9A 4FUIA 1C1NA 1O38A 4IGDA 3P6ZB 1GCTC 1UTOA 3RXJA 8GCHG 1QJ7B 4ZAEA 3SJIA 4WWYA 2AERH 3QZRA 3VB4A 4YO9A 1CBWC 3M35A 3DFLA 5JBBS 4FUJA 3HGPA 4NFFA 1O3EA 3A8CA 1XVMA 2A2QH 3RXRA 3JZ2B 1HAGE 2ESTE 1AVWA 1S85A 4CRBA 1CA0C 3U69H 1P02A 1YYY1 1IQGA 2Y5FA 1GJ8B 4UDWH 4ABAA 4KKDA 1AVXA 3ATKA 2GP9B 1C9PA 1QRZA 1KLJH 1P09A 3F1SB 2TGAA 4BAKB 1OKXA 1O5EH 1QURH 1O2WA 1IQHA 2VIPA 1QNJA 3LGYA 1ELEE 1G32B 2PWXA 1ZLRA 3AVZA 2XCNA 2PKAA 3O8RA 1DE7H 2G5NA 2PTNA 3H7OA 1GHZA 3A88A 3SNEA 1DXPA 2FWWA 3P8FA 2BDBA 4ZXXH 1KIGH 1SGTA 1O2LA 9LPRA 2F83A 1GWAA 1UHBA 3BV9B 1FMGA 3PTNA 1C5OH 1FY5A 2A0QB 2XCFA 4SGBE 2A1DB 3A87A 1AE8H 4Y8XA 2FTLE 4KTCA 4DOQA 2BQ7B 2GZ7A 4X8VH 1MKXK 1EXFA 3E91A 1EOLA 3ZVAA 1PPCE 4XBCA 2V0BA 2D8WA 1C1OA 1WYKA 1ZR0A 1WTHD 4ASHA 1SGQE 1L4DA 2GCHG 1SBWA 3QO6A 3PLPA 1W3CA 3E1XB 1KYNA 1O5BB 1TX6A 1W8BH 4OS1A 3SUDA 1JXPA 4CHAC 4DIHH 3KGPA 4NIXA 4YTAA 1QA0A 2J94A 2SFAA 1MMJN 4Q7ZA 1ZPBA 3GISB 1BBRH 1GHBG 1XUIA 3A8BA 2FI3E 4K8YA 4R0IA 1NRPH 2SGAA 4K3JA 5JBCS 2ZEBA 3G01A 3DUXH 3SV9A 2CHAB 3NWUA 3S9BA 3I78A 1FXYA 2ZFQH 4J1YA 4ZHAA 3RDZA 1C4Y2 2W3IA 4NWLA 1W10U 1Z8GA 1W0YH 1KXDA 2IPHA 2Z94A 1GMCF 3RMNH 2ZU4A 3ZZ8A 1C2DA 3PV4A 3T26A 2WPHS 3MU8A 1C1MA 3F68H 5C67A 1H8DH 1KSNA 1ZMLA 4ABBA 1VJAU 3SI4H 2Z9KA 3V7TA 2R2MB 1HAOH 2H1UA 3GCNA 2FM2A 4ISIH 1AKSA 2TBSA 1ANBA 3BTWE 1GHWH 1A0JA 3U8RH 5FAHA 1IHSH 1L2EA 1QGFA 2Z3DA 4OS2A 4UD9H 3FP8E 1MU6B 4A5TS 5EQRA 2G52A 1DDJA 3E0PB 4ABJA 2FOBA 1C5QA 1KY9A 4HI3A 1QB9A 2J9NA 3MH4A 1MTSA 4RSPA 1SGFA 2FI5E 2BVSH 4ISNA 1NROH 4AZ2B 3UNRA 1KTTB 1NS3A 1YPHE 1EOJA 1GBIA 1BUIA 1HJAB 2Y82A 4B1TA 3UOPA 1K9OE 1BOQA 1Y5BT 1SQAA 3CS0A 1ZZZA 1O3OA 2A5KA 1RGQA 2EA3A 4O3UA 4YESB 1QL9A 3AW0A 3S9AA 4MNVA 2J38A 4H6TA 5CHAC 1LCYA 1O32A 4Z0KA 1G3EA 3K9XB 2ZHWH 2DUCA 2P8OB 1QR3E 1P2OA 1ZHPA 1CO7E 1TX7A 3BN9A 1QBNA 1O2GH 4MQAA 1EZXC 2CV3A 2FZZA 1CT2E 5H4IB 4ABHA 1KXCA 2THFB 1SB1H 2OP9A 5T6DA 3TIUA 2PGBB 2VVUA 1Z6JH 1P3CA 1TPAE 2HWLB 5EODA 1V2NT 3K6ZA 4ZUHA 1C1WH 1MTWA 1DANH 3EQ0H 3MNXA 4DT7B 1Y3XA 1QBVH 5F8ZA 1DPOA 3A7VA 2ZHFH 2A5IA 2BY7X 1EAWA 1TQ7B 1GBMA 2JH6D 1EUFA 5JBAS 1ZSLA 3FFGA 2B9LA 3VXFH 1H4WA 4OS5A 1KXFA 5BPEA 2Z9GA 1K28D 2G4TA 2A4GA 5E0HA 3SU5A 1EZSC 1V6DA 1SGCA 2NU0E 3R0FA 2IN2A 1BHXB 1G2LA 3SHCH 3H7TA 1W14U 1VGCB 2SGDE 3Q3KA 3H5CB 5DP9A 2AYWA 1Q31A 1LTOA 2A5AA 4WXVA 3ZV8A 1DVAH 3E8LA 4GVUA 2ZNKH 1CT0E 2AIQA 1GBKA 2J34A 2VWMA 3PLBA 2PKAB 3M7QA 6ESTA 2STAE 1HXFH 1IQMA 3SHAH 4JMYA 1HBTH 1IQFA 2KAIA 2A4QA 1LO6A 4GSOA 1Z71A 1CHOF 3SU2A 3GOVB 3RU4T 4WMDA 4AYVB 1OWHA 3SJ8A 2VVCA 4OS6A 5HGGA 3GCHB 7GCHG 1DM4B 1MBMA 3JZ1B 1H1BA 1FUJA 2QY0B 3SQEE 1GI6A 1L1GA 4I8JA 2NU1E 1QL8A 4XBBA 1C5ZB 1T4UH 1O3JA 1B0EA 1ELFA 2Y5GA 5IDKA 3BTGE 2HOBA 1XM1A 3RXIA 3UY9A 3V3MA 1Y3YA 2G5VA 5DJ7A 4AB8A 3SO3A 1V2PT 4LZ4B 5L2ZH 4H6SB 1GMDG
chains in the Genus database with same CATH superfamily
1P12E 3TJOA 3NK8A 3RXUA 2OUAA 6CHAB 4RT0A 3KQCA 4XDEA 3MWIU 1RTLA 1IQIA 4TWYA 5DGJA 1BB0B 2P59A 3NKKA 2R0KA 1AN1E 1JIMA 3BEUA 3ZVEA 2DE8A 1P10A 1NPMA 3LDXH 1NZQH 3FP6E 4FUHA 2WPMS 4KGAA 3SJKA 2C8ZB 1S81A 3RXFA 2SGFE 1V3XA 2ZU1A 1MTNB 3ATIA 3T28A 1YF4A 3L3TA 1XXFA 1JBUH 1GJAB 1OWDA 1YPMH 4FUBA 3SU0A 5C1YA 1UCYE 2O9QA 1OP0A 1YPLH 1DUEA 1O2HA 1SHYA 3SOSA 1EP5A 1SGIB 1GVLA 1QJ6B 3SV2H 2XBXA 3TITA 1Z1JA 2CN0H 4Y8ZA 1TNIA 4XD7D 1Y8TA 4WXIA 1RTFB 1K22H 7LPRA 4FOUC 2ODYB 3BG8A 5FPTA 2PUQH 1RS0A 1LPKB 1T7CA 1YCPH 1MQ5A 1FY3A 2H2ZA 1H9HE 4ZKNU 1MKXH 4X1SU 2Y81A 1A0LA 1SGDE 3MU4A 3MYWA 2ZPQA 3UUZA 1G3CA 1TRNA 2OC1A 1GGDB 1MKWH 4Y11E 2PKSB 2FLBH 1YP9A 3A82A 2BLWA 1T31A 1MZAA 2QXGA 1AY6H 1T4VH 1C1SA 1YKTA 2G51A 3ZZ4A 1AKSB 1AUJA 4NGAH 3MMGA 1QRXA 4GAWA 1DWBH 2Y6TA 1BMLA 2H5CA 3F9GA 4JZ1A 1UTNA 2BVRH 5C20A 3ZVGA 3SORA 1YPEH 2GTBA 3HATH 4MNWA 1LKAA 1DLEA 3UWIA 1O39A 3L6PA 1SSXA 1BTZA 4ZROA 5GCHG 3TK5A 8LPRA 3FKSD 5SGAE 2FESH 3TJUA 1LVYA 1P2JA 4BNRA 1GHXH 1PQ7A 3TNSA 1AD8H 3KF2A 1QB1A 3A8DA 2WPJS 2Y80A 3R3GB 1TOCB 4DG4A 3M61U 3EYDA 2ILNA 5DO4H 3A84A 1T8LA 1YLDA 3OTJE 1WV7H 3QUMP 1C1VH 1RIWB 4PROA 1GI3A 4Y71A 1VCQA 2EI7A 2ANYA 5HKKD 2J2UA 5C17A 1EATA 4KELA 4BANB 3E90B 1O2UA 5TCAA 4UFEH 5LPFA 3ZZDA 2ZQ2A 3SNBA 1O3CA 1O2IA 3D65E 1TPOA 3CNRA 2F9NA 1FPHH 1F0UA 5EOKA 1FONA 1F5LA 4NZLA 5JB9S 5I46H 2A4RA 3ZV9A 1VCWA 3KCGH 3RXGA 1J8AA 1HJAC 8KME2 1N8OB 4B6FA 4IN2A 2R0LA 2FOMB 2YNBA 2C8WB 1HNEE 2CMYA 4X8UH 4X6PA 2VGCC 3MO6A 5C1UA 2QA9E 4DURA 4UFGH 3PMBB 4ABIA 5KEDA 2IPQX 2P95A 1CVWH 1QCPA 2JH5D 1BZXE 3LH3A 3KEEA 1ELBA 1O0DH 1FX0B 1WSSH 3LT3A 2BM2A 1LVBA 4AGJA 2C8YB 1T8MA 2OQ5A 3M5MA 1JIRA 2QCYA 5GJ4B 1E35B 3AASA 1OPHB 1GDQA 2FXRA 2VVVA 4FVBA 2QGRA 3BTME 3Q00A 1ACBE 1H8IH 3TGJE 2HNTF 4E7NA 1OWKA 1NY22 2FMJA 5E8EH 4BXSA 4JCNA 1A0HB 1UVTH 3PMAB 1MH0A 1GI1A 2RA3A 1O3IA 1PPZA 2CF8H 4ZXYH 3LJJA 1SC8U 3ZVDA 5A8XA 2P94A 2L6OA 1VITF 3CS7A 2XTTB 2BZAA 3PWBA 1EB1H 3OU0A 1EASA 4ZKSU 3EDXB 1LVOA 4XSKU 1CE5A 3RXHA 3SQHE 4BAQB 2O8WA 3ATMA 3OYPA 2RG3A 1BRUP 2XC5A 1BMAA 1IQJA 2Y5HA 3AAVA 1OWIA 1WQVH 1XMNB 1G30B 1ZSKA 5CMXH 3ATLA 2GZ8A 2HRVA 1TBRH 3F9EA 3FZZA 1WTGH 1ZRKA 3RXEA 3ZZ7A 3BG4C 1LDTT 1NO9H 2GDEH 1ZGIA 3U28C 1PYTD 1O2SA 3STJA 3WY8A 1P3EA 1VGCC 3LOXA 4K1EA 4ESTE 1MBQA 1ZTLA 1H9IE 2VIWA 3URCA 1ZJDA 3LU9B 4X1QU 1A7SA 5EW2H 1ZRBA 3OAAD 4FUGA 1L4ZA 2M5TA 1ANEA 2Y7ZA 1O2PA 1UCYH 2B8OH 1TGCA 1YC0A 3UB0A 1U6QA 2CXVA 2O8LA 1HJ9A 2UUJB 5IYTA 5LPRA 5FPSA 1GBTA 1SFQB 3RC5A 3VPKA 4NFEA 1J9CH 1J17T 5DP8A 3P17H 2KR7A 4NCYA 3QTVH 3P92A 2J98B 2ZU3A 3GCTF 1HAVB 1V2MT 1B5GH 1O2KA 4MG3A 2W7SA 1LQDB 4LK4A 2XW9A 4CH2B 1C2HA 1O37A 1PPHE 3FO8D 1H9LB 1KDQA 3ZZAA 3MU0A 1O3MA 1ZPZA 3QGJA 2Z9IA 4K69A 1NC6A 1V2LT 5G4BA 2Y7XA 1ESBA 2PV9B 4DY7B 2A2XH 1SGNE 3I77A 3F0OA 1BA8B 3KQDA 1S0RA 1J16A 4CRDA 1GJDB 1QZ8A 1D3TB 3TPIZ 5HIYA 1AFQB 4Y8YA 4IS5A 1SQTA 2XC0A 1C2KA 1BTHH 2Q1JA 5E2OA 4Y0YE 1GMHG 1V2TT 8GCHF 5JDUB 4RN6A 1TPSA 2FEQH 1MTNC 1FJSA 1UVOA 4YT7H 2VJ1A 1ETTH 4NWKA 1QBOA 4D9QA 4ACAA 5C2ZA 2XBWA 1UK3A 3OSYA 5DP3A 1O3NA 4RT1A 2RA0A 3F0PA 4IW4E 1ESTA 4X2WA 3UPEA 4AN7A 3A7XA 1G37A 1GVZA 1XXDA 2P3TB 2I6SA 1FIZA 1O2QA 4GCHF 1FQ3A 2EEKA 3LJOA 2LELA 1YCPK 1PQ5A 3CENA 1TGNA 3K65B 1V2VT 6GCHF 1HAXB 2EI8A 1JMOH 3P8OA 1A3BH 3RC6A 3UQOA 4JK6A 1P06A 3UREA 1THRH 2BOHB 4TPIZ 1MKWK 3DA9B 3RM0H 1VR1H 2AFQB 1MD7A 3TJVA 3W94A 1AI8H 1YGCH 2NU4E 3BTTE 1DITH 3ODDA 1MD8A 2GT7A 4INHA 5C94A 2WYJA 3RU4D 4E06H 5L30H 1GI4A 1E36B 1O3HA 1RRKA 1HXEH 2BXTH 1SLWB 1QY6A 2ZECA 1C1UH 2JH0D 1EB2A 4CH8B 5FL7D 2JJ1D 1K1LA 4I8GA 1PPGE 1Y3VA 2Q6FA 1GJBB 4B76A 1O2VA 3GY2A 1GL1A 1Z6EA 4MNXA 3ZZ6A 3HKIB 2ZA5A 2QV1A 3A7TA 1Y3UA 1YBWA 4LOYH 3FOAA 2ZHDA 1ZTJA 1HRTH 1G36A 4HFPB 3FANA 1NFXA 1NM6A 2ZQ1A 1GG6B 3T27A 3QX5H 2FOEA 2ZTXA 1W0KD 5T1VA 2VIDA 2Z9LA 3F6UH 3H09A 3QDZB 4FETA 5FCKA 4AGKA 2YMSC 1HAHH 1O3AA 1C5RA 1O3BA 4SGAE 1GI8B 2ZU5A 4A7IB 3BEIB 1QQUA 3T29A 1SGYE 2D2DA 1GJ9B 3V12A 2GMTC 3OX7U 2QXHA 2WYGA 1TRMA 5AFYH 1FZZA 3EA9A 1Z1IA 3RLWH 5T3HA 1NBME 1FIWA 1AZ8A 4E7RG 1HJ8A 4OGYA 5EQQA 3ZZBA 2BZ6H 1GHBF 3GY7A 1C1TA 2M2AA 2KCPA 2B7DH 4NG9H 4CR9A 1LKBA 4TPYA 1MQ6A 2ZO3H 4MVNA 2D26C 4WY3A 1HYLA 1MCVA 2FO9A 1XVOA 3RXKA 3SGQE 1ETSH 4I8LA 1L1JA 3O8DA 1TX8A 1VCPA 1D6RA 3BTQE 2BHGA 2HGTH 1OHHD 3PO1B 1S6HA 3GYLB 2RDLA 1DICA 1FAKH 3ZZ5A 1C5MD 2W7UA 1C1PA 4Y7BA 4FU9A 2OQUA 2WPLS 2HNTC 1NN6A 1BJUA 3MO3A 5GIBA 1A2CH 1EP6A 5F53A 1A5IA 1ZSJA 1W13U 2TPIZ 5FXLA 1TFXA 1GVKB 2GD4B 3KQEA 2JDID 1V2OT 4WF8A 3NZIA 5EW1H 4AFSA 3ITIA 1FY8E 1Y5AT 3ZZ9A 2Q6DA 3SNAA 4BAHB 4CRCA 1LHEH 2BMGB 2ZTZA 3AAUA 1DWDH 1TB6H 4WH6A 4A1XA 3NCLA 1ARBA 2Z6BD 5EPNA 1O30A 2FIRH 2PUXB 2ZGXH 1C5WB 2BY6X 5C0TA 2VIOA 1NRRH 2XBYA 2GT8A 1O2TA 4O9VA 3NUMA 1GBCA 2QXIA 1QTFA 1C2JA 1FN8A 3U8TH 1TAWA 5E0GA 2BY9X 1Z8RA 4AX9H 1A46H 1UJ1A 3SGBE 1WBGB 5ABWA 1DS2E 1K1NA 3U9AH 1D4PB 1AB9B 4B71A 4FUFA 2G55A 5ETXA 1GDUA 2XC4A 1THPB 3P95A 3C1KA 1UO6A 2TGTA 2O8UA 5ESTE 1YM0A 2TIOA 2H6MA 1KDQB 1TNJA 3GDUA 1CHOG 1EZUC 2NU3E 4I32A 2F3CE 1T8NA 4A1VA 1COWD 4VGCB 1BTYA 3MFJA 1TGBA 2AMDA 1TONA 1UCYK 1BHXF 3RXPA 5EPYA 3FZDA 4Q7XA 1ANCA 3LC3A 1MCTA 1AIXH 2Z7FE 3MH7A 2FS8A 1QQ4A 1WCZA 1O36A 2BLQA 4GPGA 2HLCA 4IBLH 1CHGA 3U8OH 4ABDA 1Q3XA 3VGCB 3UR6A 1RXPA 3AK5A 2QE7D 3UAIC 1MUEB 3BTDE 4Y6DA 3A8AA 3SYJA 1SOTA 3S7HB 1QIXB 4XOJA 2ZIQH 3M36A 1EAIA 1BTWA 5HYOA 1OP2A 3KL6A 1UVSH 1N6XA 1EFRD 3M5OA 1OYQA 3DCLA 4AFUA 2FYRA 1K2I1 2YOLA 1GI0A 1PQAA 1KXAA 1F2SE 2Z9JA 3K6YA 3PMJA 1P11E 4D7GA 3KQ5A 2CJIA 4YOJA 4AG2A 2L74A 1P8VC 1GCTB 2BXUH 1AWFH 1O35A 2ZGHA 3RP2A 2HVYB 3PV5A 3UOUA 1AFQC 1DY8A 1SOZA 2QN5T 4X8SH 1CBWB 1UVUH 3GYMA 4HZHA 2UUKB 4JZFH 1GI9B 3V13A 1HFDA 2FX4A 1CA8B 4DGJA 1KTSB 1SGPE 1JRSA 2ASUB 2SGQE 2P3UB 2GV7A 1DX5M 3P8GA 2PP6A 1F92A 1CA0B 1V2KT 3F9HA 1IQLA 3S0NA 1P03A 5PTPA 1S6LA 1O5GH 2V3HH 4HG6A 2J98A 1K1PA 2A7HA 3F2FA 5KECA 1HAVA 2NU2E 2KCAA 3S7KB 1FY1A 1NFWA 2BD7A 1BMNH 1O5FH 3TLOA 1EX3A 2AGGX 1KMHB 2QYIA 3SUFA 2IJOB 2PSXA 1UTQA 1YPGH 5AF9H 1S6FA 2J5UA 1BQYA 1TNHA 2BLOA 4X6NA 1GI2A 2FOFA 5EQSA 4ISOA 3RXOA 4Y7AA 1LHFH 1D3PB 2ANWA 1P2NA 1FPCH 2VIQA 2XWBI 1GBLA 1MAXA 2B0FA 3M7TA 1WU1A 3MH5A 4O97A 2VINA 3ELAH 3SBKA 1LPGB 1FNIA 1M9UA 1EAXA 4RKJB 1DXWA 4NIYA 2UWLA 4XFQA 2PHBA 3N99A 5F03A 3A89A 1NTPA 1NT1A 2RCEA 2WSSD 1LVMA 5EG4A 7KMEH 1BJVA 2ZDAH 2OTVA 1RD3B 5DPAA 5TCCA 1BTXA 1E37B 1FLEE 1GBEA 1MTUA 4X1NU 1CT4E 5EXMA 1INCA 1KLTA 2W5EA 2GCTB 1HAYB 2KX4A 2BX3A 1SGRE 3RMLH 1O3PB 2CHAC 4Y79A 5J4QA 1EPTA 3M3TA 1V2RT 5C5NA 2Z3CA 5LPEA 5GWZA 4CRFA 3U1JB 5CE1A 4X6MA 1IQKA 4H42U 2NWNA 1ARCA 1C2GA 2G4UA 4KP0A 4NSVA 2BDCA 1LMWB 3EA8A 4TSFD 1TMUH 1BMMH 3PB1E 1O2YA 3VXEH 5A8ZA 3SGAE 2ZG0H 1O2NA 1P9SA 1GHAF 4NIVA 2AS9A 1P01A 4INLA 4F48B 4B2BA 1FI8A 3SI3H 5ESBA 1X7AC 2P3FH 5EIYA 2FTMA 2ZFFH 1C1RA 2ZI2H 3RLYH 1TWXB 1RJXB 1ELAA 1C4U2 2C4FH 1VZQH 4LZ1H 3BEFB 1O2ZA 3RXVA 2ZDNA 1FN6A 1MU8B 4I33A 3VB6A 2JETB 1O31A 2FX6A 1SPJA 4NZQA 3A86A 2AGEX 4ISHH 2JJ2D 5FBIA 4ABGA 1DSUA 3UTUH 2RFKC 1O33A 2PR3A 1XX9A 2ZKSA 2H9EH 1C9TA 1G9IE 4MTBA 1BITA 3HGNA 1QJ1B 1TBQH 3EA7A 1S82A 4IN1A 3RM2H 2WV4A 2OLGA 3D49H 3BIUH 4HGCA 4WMEA 3ZVCA 4Q2KA 1W7XH 3PWCA 2BDAA 2VWNA 1LQEA 3ZYDA 1P9UA 3U98H 1K1MA 4Q80A 4YOGA 1GBJA 2DE9A 2WPDD 1WXRA 3MTYA 3PROA 4ABFA 3TK6A 1SKYE 4TY7A 1EKBB 3GY3A 1HAZB 4YM9A 4WH8A 2P8OC 4TWWA 4DIIH 3LKWA 1VITG 1DLKB 1GBHA 2IOTA 4MPXA 1AGJA 1BBRE 2XYAA 2F9UA 3D62A 4BAOB 1XUGA 1P04A 3ZZ3A 4GLYA 2BDHA 1S5SA 3U1IB 1F0SA 2QAAA 1ABIH 1SMFE 2UWOA 4FU7A 1J14A 5T6FA 5TJXA 4Y0ZE 3SV7A 1AHTH 3TNTA 2EC9H 1D9IA 3QK1A 4U2WA 1W7GH 5F8TA 4F49A 1UMAH 1QB6A 1C2LA 2A7JA 1KLIH 1VJ9U 2ZFRH 5CHAB 1NESE 1UK4A 2ZWLH 1YCPM 2F9BH 1C5YB 5AFZH 2VNTA 5AVDA 1NRNH 4CBOA 1YPJH 4CRGA 2AMPA 1AB9C 1ANDA 1C5LH 3ZVBA 4FUEA 4UEHH 2BD9A 1HDTH 1MAYA 4D76A 4BTIB 1EJAA 1TRYA 4AORA 1TMTH 4M7GA 2HNTE 1CGIE 3SZEA 2ZC9H 2ZHQH 1TA2A 1WOFA 3MNCA 3P70B 1TE0A 2OXSA 3GCTG 3SJ9A 1KXEA 5K0HA 2ZTYA 1O2JA 2SGPE 1GBDA 5A09A 4ABEA 3RXMA 2GGVB 4Z1MD 1UTKA 4IMZA 1QL7A 3VGCC 1O2RA 2C90B 4ZHLU 5HIZA 1TPPA 2OC0A 3VB5A 1DOJA 4THNH 3HK6B 4AC9A 1RTKA 3SU3A 3E16B 1IQEA 3SV8A 3KN2A 3ESTA 3LGTA 4MPUA 2G81E 2V6NA 4WJG2 1NRQH 2AIPA 5HMAA 3GCHC 1HUTH 1ETRH 1OS8A 2R3YA 4JZDH 4YLUA 1LHDH 4X2XA 3UR9A 2CGAA 4IMQA 2QF3A 4JYUH 3KNXA 2QXJA 3W1EA 4U32A 4ZCNA 1BT7A 2WPKS 1YLCA 1O3DA 3OTPA 1TQ0B 1IAUA 3A7WA 2FYQA 1HGTH 3RC4A 3GDVA 4YZUA 1ELCA 1AE5A 2ALVA 2VWLA 1W12U 3K2UA 2QIQA 3OY6U 6CHAC 1O3FA 5GXPA 4D7FA 4X1PU 1TGTA 3P8NA 5F8XA 3C27B 1EJMA 2BQWB 2B5TB 3GDSA 1C5VA 1TNLA 5T6GA 5EJLA 1C5PA 2V35A 2PSYA 5DSFA 4GCHG 5EXNA 5C5OA 2A7CA 2GJGA 3QTOH 2LNCA 2A32A 3A7ZA 6GCHG 1P2MA 2FI4E 4UFDH 1LPZB 1TA6A 1LHCH 1K0HA 5B6OA 1W0JD 3GCOA 3LC5A 4FUCA 2WINI 1ABJH 5HM9A 3BTKE 1C2EA 1EPTB 4JYVH 1VKYA 2KM0A 1C5NH 1E1QD 1HIAB 1DUAA 1C5SA 2F9VA 2PFEA 3HK3B 2TGPZ 9ESTA 1YY3A 1SI5H 3RXSA 1O5CB 3M5LA 4FXGH 2ZF0H 1F0TA 4MPWA 3VB7A 1GL0E 2XNDD 2VU8E 2P93A 4Y76A 5A0CA 4BOHA 3BF6H 5LH8A 3DSOA 1GGDC 4BTTB 2TRMA 2PKSC 2WV5A 4J2YB 1THSH 1XUJA 1OWEA 4XBDA 3GICB 4AFQA 2ZFTA 4JK5A 4K60A 4NSYA 3IITA 1F5RA 4FUDA 2PGQB 3BTHE 1G2MA 1W0ZU 2GCTC 2OC7A 1TNKA 5HXFA 1A3EH 1YPKH 3EE0B 5AHGH 3SN8A 1GMHF 3T62A 2O8MA 2H9TH 2XBVA 1SR5C 1GMCG 1XUHA 1MTVA 1OWJA 1XKBC 4B2CA 3SU6A 1DSTA 1C5XB 1QA7A 3MU5A 2STBE 2BD2A 4CBNA 1NFYA 2FOCA 2FP7B 2WZQA 3RU4E 2HPQH 1S84A 2F4LA 1V2ST 2XXLA 5A0AE 4B73A 3QN7A 1Y3WA 5DK1A 5F6MA 1MZDA 4QT8C 1GI7B 3SU1A 3SUGA 1C2MA 3B8JA 5JB8S 1RIWC 2GCHF 3LGWA 2AEIH 3MI4A 2JETC 3BSQA 4DJZB 3TVJB 1ORFA 1Y59T 1Z8IB 2ZHEH 4R8TB 1O5DH 2BX4A 4AFZA 5K7RA 2AGIX 2LPRA 2BB4A 1F5KU 1G3BA 4BAMB 1AU8A 2ZDMA 2VB0A 2QF5A 2ZCHP 3F2HA 6LPRA 1NU9A 3A80A 1SGEE 3RXDA 2FS9A 2ODPA 2OCVB 4GHQA 2XWAA 4HTCH 1ZYOA 2ZU2A 1N8OC 4I8KA 2BY5X 4XRNA 1AWHB 3SZNA 2XOKD 1K1JA 2BD4A 3SJOA 3DFJA 2G8TA 4CREA 1ZGVA 4K5ZA 1XUFA 4AG1A 4M9FA 3A83A 1K1IA 3PMHB 1WAYB 2BYAX 2Q6GA 3DT0H 1C5TA 3HKJB 4AOQA 4WMFA 2ZDLA 4UFFH 5BRRE 2SNVA 1N1LA 2WHXA 2UWPA 3B9FH 3UNSA 3TH3H 1C1QA 1GBBA 4MDSA 2ZFSA 1A5HA 4FU8A 1VITH 2ODQA 1FDPA 1QRWA 1HPGA 1O2MA 5GNDA 3TU7H 2KCYA 1NRSH 1AQ7A 1PPFE 2XNIA 2BD8A 1O3KA 2ZGCA 2OBOA 3IG6B 2G00A 2R9PA 1GJ6A 5FCRA 5DKMA 3ZZCA 5J4SA 1PYTC 5FX5A 2VGCB 2SGEE 2A45B 1CGJE 2W6JD 1BDAA 1XKAC 2BDGA 3A85A 2BTCE 5L6NH 3LPRA 3SV6A 1ELDE 3SNDA 1O2OA 2W26A 4D8NA 4Q4LA 3QZQA 3OEHD 1B0FA 4ZKOU 2I6QA 2PLXA 4ZMAH 1GJCB 3D23A 1NU7B 5DG6A 2BQ6B 4ISLA 1W2KH 4ZKRU 4YLQH 2GVFA 3ZYEA 3T5FH 4O3TA 4Q63A 2W3KA 4YT6H 4UONA 1UTLM 3PRDA 4CR5A 2ZFPH 1DWEH 2ZDKA 5GDSH 1TIOA 1HCGA 5KGOA 1AFEH 7ESTE 2ZGBH 1GBAA 1GHYH 4K8BA 4ZH8A 4K2YA 2XRCA 1HB0B 2BOKA 2ZDVH 1JRTA 2VH6A 1A4WH 3LH1A 3M3SA 3RXTA 2F9OA 1GHVH 1V2QT 3FAOA 1BRCE 1B7XB 1ID5H 3OEED 4OS7A 1GJ4H 3KIDU 3V0XA 3DSGA 3W95A 1TABE 4NA8A 4JYTA 2GX4A 4NIWA 4Y10E 3BG4B 1IQNA 3RMOH 2RDEA 2F43B 3SUEA 1ZTKA 3TJNA 4DCDA 1TALA 1TNGA 4X2VA 5GPIB 4A92A 2FDAA 3LGUA 1GDNA 5FHTA 5EGMA 3MOCA 1SVPA 2VWOA 5A2MH 2ZPSA 1L1NA 3KHVA 4X0WU 1UTPA 2ZP0H 1GI5A 2ANKH 2ZCKP 3PLKA 1TLDA 4KTSA 1WUNH 1E38B 2OD3B 4OGXA 5I25A 5DP5A 1TBZH 4CRAA 1T32A 2KZ4A 2V3OH 3KQBA 1OOKB 1LHGH 4K1SA 1E0FD 1ZMNA 1UHBB 2QF0A 1Q2WA 1CQQA 2CF9H 3L33A 1BTUA 1A1RA 4BXWA 3FP7E 3MHWU 1SL3A 4ACBA 5EU8A 3TK9A 3RUOA 4XE4A 3VFEA 1ZMJA 3VG8A 2OBQA 1G3DA 4U30A 3A7YA 5EJZA 2AH4X 1PPEE 2HALA 3GY5A 5LGOA 2TGDA 4WVPE 5FBEA 3VB3A 2GKVE 1IOEA 1EPTC 3URDA 1TGSZ 2UUYA 4X1RU 7GCHF 1NFUA 3PTBA 2ZGJA 4TYDA 4B2AA 1J15A 1CU1A 3RXLA 2F91A 1C4V2 2J4IA 2OK5A 1JWTA 5JBTA 3O8CA 1BCUH 1EJNA 2ZCLP 5A8YA 2UUFB 4OS4A 3F9FA 1E34B 3SNCA 2FPZA 3ENSB 1WQSA 4H4FA 3TGIE 4BTUB 3CP7A 3BTFE 1O3LA 3Q3YA 2P16A 1FV9A 3QWCH 1O5AB 2WPIS 1GMDF 1PQ8A 4X6OA 3NPSA 2BDYA 3TH4H 2AMQA 1PPBH 1W11U 2EQNA 3GY6A 4O03A 2BD5A 3O8BA 1GJ7B 1P2QA 2BLVA 3Q3XA 4GUXA 1GHAG 1OXGA 4A6LA 4A1TA 1GPZA 3MNSA 4Q7YA 1HAPH 1SG8B 3B23B 3OY5U 1SGFG 2JKHA 2ZPRA 4MNYA 1DWCH 1GJ5H 5DP7A 2FLRH 3PYHA 1A61H 1SLXB 4MPVA 4E05H 4LXBH 1HIAA 1SFIA 1F0RA 3ATWA 1ZHMA 4GHTA 3VEQB 5JPMH 2WUBA 4INKA 1GG6C 1P05A 4NA9H 2H9HA 1BBRK 2A4OA 5C3NA 1QHRB 3STIA 4CHAB 1BMFD 1Z8JB 1UTMA 3UFAA 3LONA 2VIVA 4Z6AH 3S69A 3M5NA 2YNAA 4X8TH 1OSSA 1UVPA 1EAUA 2FODA 2C93B 2K1QA 5DP6A 2GZ9A 3DD2H 1A5GH 1KXBA 1AO5A 1D3QB 1UTJA 1PJPA 1V2JT 5JYIA 1YPHC 4UE7H 1HV7A 1P2KA 5EJ1A 3ODFA 5CDFE 3A81A 4F4OC 4ZHMU 2R3UA 1IHTH 2BD3A 3FVFB 2GDDA 5E2PA 1N6YA 1O2XA 1TMBH 3E0NB 3TH2H 1SLVB 1S83A 5HM2A 1CSOE 4YOIA 3AW1A 1CGHA 3T2NA 2GV6A 2BDIA 2YMSB 3PO1C 1D3DB 1ESAA 1Y5UT 2WUCA 1SHHB 4X2YA 1XUKA 2PW8H 3QGNB 1V2UT 2EI6A 5GCHF 2GMTB 2Z3EA 5EXLA 3GY8A 3MH6A 2FOAA 1O3GA 1FAXA 3E3TA 1GBFA 2ANMH 2BY8X 3RMMH 3NXPA 3RXQA 5DP4A 3UQVA 2PTCE 1ZPCA 3N7OA 4DW2U 1D6WA 1TYNA 1C2IA 3ZIAD 1BIOA 1C2FA 4IC6A 1WDIA 3UWJH 2VBCA 2YMSD 4AYYB 4K1TA 4I31A 3ZVFA 2C3SA 2A31A 2HVXA 3RXBA 1S0QA 3RXAA 3LGIA 2HPPH 1FY4A 1PFXC 3M7UA 1HLTH 3SU4A 1AUTC 3N7EA 3BTEE 2D1JA 2OC8A 3GY4A 3MU1A 2ZZUH 1ZHRA 4NA7A 3EGKH 1EQ9A 1EZQA 1UK2A 4TY6A 2SNWA 3UNQA 1GCDA 1Z7KA 3M37A 3IWMA 1L0ZA 4JZIA 5B6LA 3Q77A 2H5DA 3KYFA 2FOGA 3T25A 1ZJKA 2F9PA 1BRBE 3E6PH 1RFNA 4I8HA 1SLUB 5FX6A 3TGKE 3UIRA 1AZZA 3NRLA 3BIVH 1ELGA 4IC5A 1C5UA 3MO9A 5L2YH 3DHKH 3EAJA 2C8XB 1F7ZA 1O34A 1P0SH 1OYTH 3LIWA 1OP8A 1QFKH 2O8TA 3PV2A 4U01A 4VGCC 3LGVA 2BVXH 1P2IA 4RKOB 1V2WT 2QC2A 3HPTB 2OINA 2KAIB 3SW2B 1ZOMA 4FVDA 4JZEH 2ALPA 1TOMH 3PM3A 3RXCA 4MLFB 3MNBA 1BRAA 1OX1A 1E1RD 1K21H 2J92A 1SQOA 2FOHA 1DT2A 1AMHA 5FPYA 2R2WU 4AB9A 1T8OA 5E0JA 4B75A 2J95A 3S9CA 1ELVA 4I7YH 1DFPA 3QLPH 1JOUB 1P57B 3I29A 3M3VA 1AVGH 3Q76A 5A0BA 4D9RA 8ESTE 1K1OA 2VH0A 1BTPA 2ULLA 4KTUA 2LP6A 4B74A 1ELTA 5C1XA 4DVAU 1HAIH 1DY9A 2AHME 4FUIA 1C1NA 1O38A 4IGDA 3P6ZB 1GCTC 1UTOA 3RXJA 8GCHG 1QJ7B 2KFWA 4ZAEA 3SJIA 4WWYA 2AERH 3QZRA 3VB4A 4YO9A 1CBWC 3M35A 1SQRA 3DFLA 5JBBS 4FUJA 3HGPA 4NFFA 1O3EA 3A8CA 1XVMA 2A2QH 2JIZD 3RXRA 3JZ2B 1HAGE 2ESTE 3EE7A 1AVWA 1S85A 1UW7A 4CRBA 1CA0C 3U69H 1P02A 1YYY1 1IQGA 2Y5FA 1GJ8B 4UDWH 4ABAA 4KKDA 1AVXA 3ATKA 2GP9B 1C9PA 1QRZA 1KLJH 1P09A 3F1SB 2TGAA 4BAKB 1OKXA 1O5EH 1QURH 1O2WA 1IQHA 2VIPA 1QNJA 3LGYA 1ELEE 1G32B 2K8IA 2PWXA 1ZLRA 3AVZA 2XCNA 2PKAA 3O8RA 1DE7H 2G5NA 2PTNA 2QF4A 3H7OA 1GHZA 3A88A 3SNEA 1DXPA 2FWWA 3OE7D 3P8FA 2BDBA 4ZXXH 1KIGH 2V3MA 1SGTA 1O2LA 9LPRA 3MQKC 2F83A 1GWAA 1UHBA 3BV9B 4P02A 1FMGA 3PTNA 1C5OH 1FY5A 2A0QB 2XCFA 4SGBE 1H8HD 2A1DB 3DSPA 3N7DA 3A87A 1AE8H 4Y8XA 2FTLE 4KTCA 4DOQA 2BQ7B 5C0UA 2GZ7A 4X8VH 1MKXK 1EXFA 3E91A 1EOLA 3ZVAA 2CK3D 4RI0A 1PPCE 4XBCA 2V0BA 2D8WA 1C1OA 1YLNA 1WYKA 1ZR0A 1WTHD 4ASHA 1SGQE 1L4DA 2GCHG 1SBWA 3QO6A 3PLPA 4YXWD 1W3CA 3E1XB 1KYNA 1O5BB 1TX6A 1W8BH 4OS1A 3SUDA 1JXPA 4CHAC 4DIHH 2W6ID 3GS9A 3KGPA 4NIXA 4YTAA 1QA0A 2J94A 2SFAA 1MMJN 4Q7ZA 1ZPBA 3GISB 1BBRH 3F2GA 1GHBG 1XUIA 3A8BA 2FI3E 4K8YA 4R0IA 1NRPH 2SGAA 4K3JA 5JBCS 2ZEBA 3FN8A 3G01A 3DUXH 3SV9A 2CHAB 3NWUA 3S9BA 3I78A 1FXYA 2ZFQH 4J1YA 4ZHAA 3RDZA 1C4Y2 2W3IA 4NWLA 1W10U 1Z8GA 1W0YH 1KXDA 2IPHA 2KCOA 2Z94A 1GMCF 3RMNH 2ZU4A 3ZZ8A 1C2DA 3PV4A 3T26A 2WPHS 1NBMD 3MU8A 1C1MA 3F68H 5C67A 1H8DH 1KSNA 4B6EA 1ZMLA 4ABBA 1VJAU 3SI4H 2Z9KA 3V7TA 2R2MB 3F3BA 1HAOH 2H1UA 3GCNA 2FM2A 4ISIH 3WW7A 1AKSA 2TBSA 1ANBA 3BTWE 1GHWH 1A0JA 3U8RH 5FAHA 1IHSH 1L2EA 1QGFA 2Z3DA 4OS2A 5DN6D 2EY4C 3FP8E 4UD9H 1MU6B 4A5TS 5EQRA 2G52A 1DDJA 3E0PB 4ABJA 2FOBA 1C5QA 1KY9A 4HI3A 1QB9A 2J9NA 3MH4A 3WWFA 1MTSA 4RSPA 1SGFA 2FI5E 2BVSH 4ISNA 1NROH 4AZ2B 5CHBA 3UNRA 4DT4A 1KTTB 3OFND 1NS3A 1YPHE 1EOJA 1GBIA 1BUIA 1HJAB 2Y82A 4B1TA 3UOPA 1K9OE 1BOQA 1Y5BT 1SQAA 3CS0A 1ZZZA 1O3OA 2A5KA 1RGQA 2EA3A 4O3UA 4YESB 1QL9A 3AW0A 3S9AA 4MNVA 2J38A 4H6TA 4F55A 5CHAC 1LCYA 1O32A 4Z0KA 1G3EA 3K9XB 2ZHWH 2V7QD 2DUCA 2P8OB 1QR3E 3WWBA 1P2OA 1ZHPA 1CO7E 1TX7A 3BN9A 2IJD1 1QBNA 1O2GH 4MQAA 1EZXC 2CV3A 2FZZA 1CT2E 5H4IB 4ABHA 1KXCA 2THFB 1SB1H 2OP9A 5T6DA 1YWUA 3TIUA 2PGBB 2VVUA 1Z6JH 1P3CA 1TPAE 2HWLB 4P00A 5EODA 1V2NT 3K6ZA 4ZUHA 1C1WH 1MTWA 1DANH 3EQ0H 3MNXA 4DT7B 1E79D 1Y3XA 1QBVH 5F8ZA 3PRBA 1DPOA 3A7VA 1H8ED 2ZHFH 2A5IA 2HLDD 2BY7X 1EAWA 1TQ7B 1GBMA 2JH6D 1EUFA 5JBAS 1ZSLA 3FFGA 2B9LA 3VXFH 1H4WA 4OS5A 1KXFA 5BPEA 2Z9GA 1K28D 2G4TA 4OM9A 2A4GA 1MABB 5E0HA 1EZSC 1V6DA 1SGCA 2NU0E 3SU5A 3R0FA 2J97A 2IN2A 1BHXB 1G2LA 3SHCH 3H7TA 1W14U 2K0QA 1VGCB 2SGDE 3Q3KA 3H5CB 5DP9A 2AYWA 1Q31A 1LTOA 2A5AA 4WXVA 3ZV8A 1DVAH 3E8LA 4GVUA 2ZNKH 1CT0E 2AIQA 1GBKA 2J34A 2VWMA 3PLBA 2PKAB 3M7QA 4TT3D 2STAE 6ESTA 1HXFH 1IQMA 3SHAH 4JMYA 1HBTH 3KYGA 1IQFA 2KAIA 2A4QA 1LO6A 4GSOA 1Z71A 1CHOF 5IK2D 3SU2A 3GOVB 3RU4T 4WMDA 4AYVB 1OWHA 3SJ8A 2VVCA 4OS6A 5HGGA 3GCHB 7GCHG 1DM4B 1MBMA 3JZ1B 1H1BA 1FUJA 2QY0B 3SQEE 1GI6A 1L1GA 4I8JA 2NU1E 1QL8A 4XBBA 1C5ZB 1T4UH 1O3JA 1B0EA 1ELFA 2Y5GA 5IDKA 2WV9A 3BTGE 4I86A 2HOBA 1XM1A 3RXIA 3UY9A 3V3MA 1Y3YA 2G5VA 5DJ7A 4AB8A 4ASUD 3SO3A 1V2PT 4LZ4B 5L2ZH 4H6SB 1GMDG
chains in the Genus database with same CATH topology
1P12E 3TJOA 3NK8A 3RXUA 2OUAA 6CHAB 3KQCA 4XDEA 3MWIU 1RTLA 1IQIA 4TWYA 5DGJA 1BB0B 2P59A 3NKKA 2R0KA 1AN1E 1JIMA 3BEUA 3ZVEA 2DE8A 1P10A 1NPMA 3LDXH 1NZQH 3FP6E 4FUHA 2WPMS 4KGAA 3SJKA 2C8ZB 1S81A 3RXFA 2SGFE 1V3XA 2ZU1A 1MTNB 3ATIA 3T28A 1YF4A 3L3TA 1XXFA 1JBUH 1GJAB 1OWDA 1YPMH 4FUBA 3SU0A 5C1YA 1UCYE 2O9QA 1OP0A 1YPLH 1DUEA 1O2HA 1SHYA 3SOSA 1EP5A 1SGIB 1GVLA 1QJ6B 3SV2H 2XBXA 3TITA 1Z1JA 2CN0H 4Y8ZA 1TNIA 1Y8TA 4WXIA 1RTFB 1K22H 7LPRA 2ODYB 3BG8A 5FPTA 2PUQH 1RS0A 1LPKB 1T7CA 1YCPH 1MQ5A 1FY3A 2H2ZA 1H9HE 4ZKNU 1MKXH 4X1SU 2Y81A 1A0LA 1SGDE 3MU4A 3MYWA 2ZPQA 3UUZA 1G3CA 1TRNA 2OC1A 1GGDB 1MKWH 4Y11E 2PKSB 2FLBH 1YP9A 3A82A 2BLWA 1T31A 1MZAA 2QXGA 1AY6H 1T4VH 1C1SA 1YKTA 2G51A 3ZZ4A 1AKSB 1AUJA 4NGAH 3MMGA 1QRXA 4GAWA 1DWBH 2Y6TA 1BMLA 2H5CA 3F9GA 4JZ1A 1UTNA 2BVRH 5C20A 3ZVGA 3SORA 1YPEH 2GTBA 3HATH 4MNWA 1LKAA 1DLEA 3UWIA 1O39A 3L6PA 1SSXA 1BTZA 4ZROA 5GCHG 3TK5A 8LPRA 5SGAE 2FESH 3TJUA 1LVYA 1P2JA 4BNRA 1GHXH 1PQ7A 3TNSA 1AD8H 3KF2A 1QB1A 3A8DA 2WPJS 2Y80A 3R3GB 1TOCB 4DG4A 3M61U 3EYDA 2ILNA 5DO4H 3A84A 1T8LA 1YLDA 3OTJE 1WV7H 3QUMP 1C1VH 1RIWB 4PROA 1GI3A 4Y71A 1VCQA 2EI7A 2ANYA 2J2UA 1EATA 4KELA 4BANB 3E90B 1O2UA 5TCAA 4UFEH 5LPFA 3ZZDA 2ZQ2A 3SNBA 1O3CA 1O2IA 3D65E 1TPOA 2F9NA 1FPHH 1F0UA 5EOKA 1FONA 1F5LA 4NZLA 5JB9S 5I46H 2A4RA 3ZV9A 1VCWA 3KCGH 3RXGA 1J8AA 1HJAC 8KME2 1N8OB 4IN2A 2R0LA 2FOMB 2YNBA 2C8WB 1HNEE 2CMYA 4X8UH 4X6PA 2VGCC 3MO6A 5C1UA 2QA9E 4DURA 4UFGH 3PMBB 4ABIA 2P95A 1CVWH 1QCPA 2JH5D 1BZXE 3LH3A 3KEEA 1ELBA 1O0DH 3LT3A 1WSSH 2BM2A 1LVBA 4AGJA 2C8YB 1T8MA 2OQ5A 3M5MA 1JIRA 2QCYA 5GJ4B 1E35B 3AASA 1OPHB 1GDQA 2FXRA 2VVVA 4FVBA 2QGRA 3BTME 3Q00A 1ACBE 1H8IH 3TGJE 2HNTF 4E7NA 1OWKA 1NY22 2FMJA 5E8EH 4BXSA 4JCNA 1A0HB 1UVTH 3PMAB 1MH0A 1GI1A 2RA3A 1O3IA 1PPZA 2CF8H 4ZXYH 3LJJA 1SC8U 3ZVDA 5A8XA 2P94A 1VITF 3CS7A 2XTTB 2BZAA 3PWBA 1EB1H 3OU0A 1EASA 4ZKSU 3EDXB 1LVOA 4XSKU 1CE5A 3RXHA 3SQHE 4BAQB 2O8WA 3ATMA 3OYPA 2RG3A 1BRUP 2XC5A 1BMAA 1IQJA 2Y5HA 3AAVA 1OWIA 1WQVH 1XMNB 1G30B 1ZSKA 5CMXH 3ATLA 2GZ8A 2HRVA 1TBRH 3F9EA 3FZZA 1WTGH 1ZRKA 3RXEA 3ZZ7A 3BG4C 1LDTT 1NO9H 2GDEH 1ZGIA 1PYTD 1O2SA 3STJA 3WY8A 1P3EA 1VGCC 3LOXA 4K1EA 4ESTE 1MBQA 1ZTLA 1H9IE 2VIWA 3URCA 1ZJDA 3LU9B 4X1QU 1A7SA 5EW2H 1ZRBA 4FUGA 1L4ZA 2M5TA 1ANEA 2Y7ZA 1O2PA 1UCYH 2B8OH 1TGCA 1YC0A 1U6QA 2CXVA 2O8LA 1HJ9A 2UUJB 5IYTA 5LPRA 5FPSA 1GBTA 1SFQB 3RC5A 3VPKA 4NFEA 1J9CH 1J17T 5DP8A 3P17H 4NCYA 3QTVH 3P92A 2ZU3A 3GCTF 1HAVB 1V2MT 1B5GH 1O2KA 4MG3A 2W7SA 1LQDB 4LK4A 2XW9A 4CH2B 1C2HA 1O37A 1PPHE 1H9LB 1KDQA 3ZZAA 3MU0A 1O3MA 1ZPZA 3QGJA 2Z9IA 4K69A 1NC6A 1V2LT 5G4BA 2Y7XA 1ESBA 2PV9B 4DY7B 2A2XH 1SGNE 3I77A 1BA8B 3KQDA 1S0RA 1J16A 4CRDA 1GJDB 1D3TB 3TPIZ 1AFQB 4Y8YA 4IS5A 1SQTA 2XC0A 1C2KA 1BTHH 2Q1JA 5E2OA 4Y0YE 1GMHG 1V2TT 8GCHF 5JDUB 4RN6A 1TPSA 2FEQH 1MTNC 1FJSA 1UVOA 4YT7H 2VJ1A 1ETTH 4NWKA 1QBOA 4D9QA 5C2ZA 2XBWA 1UK3A 3OSYA 5DP3A 1O3NA 2RA0A 4IW4E 1ESTA 4X2WA 3UPEA 4AN7A 3A7XA 1G37A 1GVZA 1XXDA 2P3TB 2I6SA 1FIZA 1O2QA 4GCHF 1FQ3A 2EEKA 3LJOA 1YCPK 1PQ5A 3CENA 1TGNA 3K65B 1V2VT 6GCHF 1HAXB 2EI8A 1JMOH 3P8OA 1A3BH 3RC6A 3UQOA 4JK6A 1P06A 3UREA 1THRH 2BOHB 4TPIZ 1MKWK 3DA9B 3RM0H 1VR1H 2AFQB 1MD7A 3TJVA 3W94A 1AI8H 1YGCH 2NU4E 3BTTE 1DITH 3ODDA 1MD8A 2GT7A 4INHA 2WYJA 3RU4D 4E06H 5L30H 1GI4A 1E36B 1O3HA 1RRKA 1HXEH 2BXTH 1SLWB 1QY6A 2ZECA 1C1UH 2JH0D 1EB2A 4CH8B 1K1LA 4I8GA 1PPGE 1Y3VA 2Q6FA 1GJBB 4B76A 1O2VA 3GY2A 1GL1A 1Z6EA 4MNXA 3ZZ6A 3HKIB 2ZA5A 2QV1A 3A7TA 1Y3UA 1YBWA 4LOYH 2ZHDA 1ZTJA 1HRTH 1G36A 4HFPB 3FANA 1NFXA 1NM6A 2ZQ1A 1GG6B 3T27A 3QX5H 2FOEA 2ZTXA 2VIDA 2Z9LA 3F6UH 3QDZB 5FCKA 4AGKA 1HAHH 1O3AA 1C5RA 1O3BA 4SGAE 1GI8B 2ZU5A 4A7IB 3BEIB 1QQUA 3T29A 1SGYE 2D2DA 1GJ9B 3V12A 2GMTC 3OX7U 2QXHA 2WYGA 1TRMA 5AFYH 1FZZA 3EA9A 1Z1IA 3RLWH 5T3HA 1FIWA 1AZ8A 4E7RG 1HJ8A 4OGYA 5EQQA 3ZZBA 2BZ6H 1GHBF 3GY7A 1C1TA 2B7DH 4NG9H 4CR9A 1LKBA 4TPYA 1MQ6A 2ZO3H 4MVNA 2D26C 4WY3A 1HYLA 1MCVA 2FO9A 1XVOA 3RXKA 3SGQE 1ETSH 4I8LA 1L1JA 3O8DA 1TX8A 1VCPA 1D6RA 3BTQE 2BHGA 2HGTH 3PO1B 1S6HA 3GYLB 2RDLA 1DICA 1FAKH 3ZZ5A 1C5MD 2W7UA 1C1PA 4Y7BA 4FU9A 2OQUA 2WPLS 2HNTC 1NN6A 1BJUA 3MO3A 5GIBA 1A2CH 1EP6A 1A5IA 1ZSJA 1W13U 2TPIZ 5FXLA 1TFXA 1GVKB 2GD4B 3KQEA 1V2OT 4WF8A 3NZIA 5EW1H 4AFSA 3ITIA 1FY8E 1Y5AT 3ZZ9A 2Q6DA 3SNAA 4BAHB 4CRCA 1LHEH 2BMGB 2ZTZA 3AAUA 1DWDH 1TB6H 4WH6A 4A1XA 3NCLA 1ARBA 2Z6BD 5EPNA 1O30A 2FIRH 2PUXB 2ZGXH 1C5WB 2BY6X 2VIOA 1NRRH 2XBYA 2GT8A 1O2TA 4O9VA 3NUMA 1GBCA 2QXIA 1QTFA 1C2JA 1FN8A 3U8TH 1TAWA 5E0GA 2BY9X 1Z8RA 4AX9H 1A46H 1UJ1A 3SGBE 1WBGB 5ABWA 1DS2E 1K1NA 3U9AH 1D4PB 1AB9B 4B71A 4FUFA 2G55A 5ETXA 1GDUA 2XC4A 1THPB 3P95A 3C1KA 1UO6A 2TGTA 2O8UA 5ESTE 1YM0A 2TIOA 2H6MA 1KDQB 1TNJA 3GDUA 1CHOG 1EZUC 2NU3E 4I32A 2F3CE 1T8NA 4A1VA 4VGCB 1BTYA 3MFJA 1TGBA 2AMDA 1TONA 1UCYK 1BHXF 3RXPA 5EPYA 3FZDA 4Q7XA 1ANCA 3LC3A 1MCTA 1AIXH 2Z7FE 3MH7A 2FS8A 1QQ4A 1WCZA 1O36A 2BLQA 4GPGA 2HLCA 4IBLH 1CHGA 3U8OH 4ABDA 1Q3XA 3VGCB 3UR6A 1RXPA 1MUEB 3BTDE 4Y6DA 3A8AA 1SOTA 3S7HB 1QIXB 4XOJA 2ZIQH 3M36A 1EAIA 1BTWA 5HYOA 1OP2A 3KL6A 1UVSH 1N6XA 3M5OA 1OYQA 4AFUA 2FYRA 1K2I1 2YOLA 1GI0A 1PQAA 1KXAA 1F2SE 2Z9JA 3K6YA 3PMJA 1P11E 4D7GA 2CJIA 4YOJA 4AG2A 1P8VC 1GCTB 2BXUH 1AWFH 1O35A 2ZGHA 3RP2A 3UOUA 1AFQC 1DY8A 1SOZA 2QN5T 4X8SH 1CBWB 1UVUH 3GYMA 4HZHA 2UUKB 4JZFH 1GI9B 3V13A 1HFDA 2FX4A 1CA8B 4DGJA 1KTSB 1SGPE 1JRSA 2ASUB 2SGQE 2P3UB 2GV7A 1DX5M 3P8GA 1F92A 1CA0B 1V2KT 3F9HA 1IQLA 3S0NA 1P03A 5PTPA 1O5GH 2V3HH 1K1PA 2A7HA 1HAVA 2NU2E 3S7KB 1FY1A 1NFWA 2BD7A 1BMNH 1O5FH 3TLOA 1EX3A 2AGGX 2QYIA 3SUFA 2IJOB 2PSXA 1UTQA 1YPGH 5AF9H 1S6FA 1BQYA 1TNHA 2BLOA 4X6NA 1GI2A 2FOFA 5EQSA 4ISOA 3RXOA 4Y7AA 1LHFH 1D3PB 2ANWA 1P2NA 1FPCH 2VIQA 2XWBI 1GBLA 1MAXA 2B0FA 3M7TA 1WU1A 3MH5A 4O97A 2VINA 3ELAH 3SBKA 1LPGB 1FNIA 1M9UA 1EAXA 4RKJB 1DXWA 4NIYA 2UWLA 4XFQA 2PHBA 5F03A 3A89A 1NTPA 1NT1A 2RCEA 1LVMA 5EG4A 7KMEH 1BJVA 2ZDAH 2OTVA 1RD3B 5DPAA 5TCCA 1BTXA 1E37B 1FLEE 1GBEA 1MTUA 4X1NU 1CT4E 5EXMA 1INCA 1KLTA 2W5EA 2GCTB 1HAYB 2BX3A 1SGRE 3RMLH 1O3PB 2CHAC 4Y79A 5J4QA 1EPTA 3M3TA 1V2RT 5C5NA 2Z3CA 5LPEA 5GWZA 4CRFA 3U1JB 5CE1A 4X6MA 1IQKA 4H42U 2NWNA 1ARCA 1C2GA 2G4UA 4KP0A 4NSVA 2BDCA 1LMWB 3EA8A 1TMUH 1BMMH 3PB1E 1O2YA 3VXEH 5A8ZA 3SGAE 2ZG0H 1O2NA 1P9SA 1GHAF 4NIVA 2AS9A 1P01A 4INLA 4B2BA 1FI8A 3SI3H 5ESBA 1X7AC 2P3FH 2FTMA 2ZFFH 1C1RA 2ZI2H 3RLYH 1TWXB 1RJXB 1ELAA 1C4U2 2C4FH 1VZQH 4LZ1H 3BEFB 1O2ZA 3RXVA 2ZDNA 1FN6A 1MU8B 4I33A 3VB6A 2JETB 1O31A 2FX6A 1SPJA 4NZQA 3A86A 2AGEX 4ISHH 5FBIA 4ABGA 1DSUA 3UTUH 1O33A 2PR3A 1XX9A 2ZKSA 2H9EH 1C9TA 1G9IE 4MTBA 1BITA 3HGNA 1QJ1B 1TBQH 3EA7A 1S82A 4IN1A 3RM2H 2WV4A 2OLGA 3D49H 3BIUH 4HGCA 4WMEA 3ZVCA 4Q2KA 1W7XH 3PWCA 2BDAA 2VWNA 1LQEA 3ZYDA 1P9UA 3U98H 1K1MA 4Q80A 4YOGA 1GBJA 2DE9A 3MTYA 3PROA 4ABFA 3TK6A 4TY7A 1EKBB 3GY3A 1HAZB 4YM9A 4WH8A 2P8OC 4TWWA 4DIIH 3LKWA 1VITG 1DLKB 1GBHA 2IOTA 4MPXA 1AGJA 1BBRE 2XYAA 2F9UA 3D62A 4BAOB 1XUGA 1P04A 3ZZ3A 4GLYA 2BDHA 1S5SA 3U1IB 1F0SA 2QAAA 1ABIH 1SMFE 2UWOA 4FU7A 1J14A 5T6FA 5TJXA 4Y0ZE 3SV7A 1AHTH 3TNTA 2EC9H 1D9IA 3QK1A 4U2WA 1W7GH 5F8TA 4F49A 1UMAH 1QB6A 1C2LA 2A7JA 1KLIH 1VJ9U 2ZFRH 5CHAB 1NESE 1UK4A 2ZWLH 1YCPM 2F9BH 1C5YB 5AFZH 2VNTA 5AVDA 1NRNH 4CBOA 1YPJH 4CRGA 2AMPA 1AB9C 1ANDA 1C5LH 3ZVBA 4FUEA 4UEHH 2BD9A 1HDTH 1MAYA 4D76A 4BTIB 1EJAA 1TRYA 4AORA 1TMTH 4M7GA 2HNTE 1CGIE 2ZC9H 2ZHQH 1TA2A 1WOFA 3MNCA 3P70B 1TE0A 2OXSA 3GCTG 3SJ9A 1KXEA 5K0HA 2ZTYA 1O2JA 2SGPE 1GBDA 5A09A 4ABEA 3RXMA 2GGVB 1UTKA 4IMZA 1QL7A 3VGCC 1O2RA 2C90B 4ZHLU 1TPPA 2OC0A 3VB5A 1DOJA 4THNH 3HK6B 1RTKA 3SU3A 3E16B 1IQEA 3SV8A 3KN2A 3ESTA 3LGTA 4MPUA 2G81E 2V6NA 4WJG2 1NRQH 2AIPA 5HMAA 3GCHC 1HUTH 1ETRH 1OS8A 2R3YA 4JZDH 4YLUA 1LHDH 4X2XA 3UR9A 2CGAA 4IMQA 2QF3A 4JYUH 3KNXA 2QXJA 4U32A 1BT7A 2WPKS 1YLCA 1O3DA 1TQ0B 1IAUA 3A7WA 2FYQA 1HGTH 3RC4A 3GDVA 4YZUA 1ELCA 1AE5A 2ALVA 2VWLA 1W12U 3K2UA 2QIQA 3OY6U 6CHAC 1O3F