1SGCA

The 1.8 angstroms structure of the complex between chymostatin and streptomyces griseus protease a. a model for serine protease catalytic tetrahedral intermediates
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE A
publication title The 1.8 A structure of the complex between chymostatin and Streptomyces griseus protease A. A model for serine protease catalytic tetrahedral intermediates.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1986-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgcA01
2XBYA 1XVOA 4WJG2 2P16A 3UOUA 1Z1IA 1O3MA 1H8IH 1RS0A 1A3BH 1AY6H 1C1OA 2CGAA 1GI7B 3BSQA 5JB8S 1W11U 5A2MH 4K5ZA 1SLWB 1Y5AT 1T32A 1MTWA 1UCYK 2F9UA 1ELCA 1O2JA 1LVMA 5EQQA 1P2JA 1GPZA 4YM9A 1KDQA 1WU1A 3A85A 4NGAH 3NKKA 2TGDA 1CQQA 3FP7E 2XBXA 8KME2 5HXFA 3M5NA 1W7XH 3SV2H 4AG2A 2AH4X 4FUFA 2EI7A 4O97A 3SJOA 5IDKA 2ASUB 3D65E 1L4ZA 1GJCB 2WPKS 5CMXH 3E0NB 3GY5A 1PYTD 2Y5HA 4FVBA 4JYUH 4Y8XA 1JRTA 1EOLA 5A8YA 1H1BA 4Y79A 5GXPA 1E0FD 4MPXA 2J9NA 4NZLA 1HGTH 1YGCH 1QBNA 1GI8B 2Q6FA 1YPGH 2V0BA 1O3KA 4O3UA 2BD7A 1C9TA 1C2JA 1QJ6B 2BYAX 3P95A 2AMPA 1K22H 1LQEA 4D9RA 1C1PA 2F9PA 4NFEA 3E1XB 2SFAA 4OS4A 3DFJA 2A5KA 1AFQC 4Y8ZA 5EPNA 1TALA 1J16A 3TJUA 3VGCB 1DSTA 5DG6A 3SGQE 3M3VA 3T2NA 1IQLA 4BTIB 1IQJA 4INLA 3EE0B 1AUJA 3SU6A 5JBCS 3C1KA 4FVDA 1GBMA 4DGJA 3KQCA 1FLEE 2C4FH 2P3UB 5AVDA 1AWFH 1K1OA 3MO6A 3GY3A 3EYDA 1DWEH 3BEFB 3KIDU 1BTHH 4MNVA 1SLUB 4X8SH 1P05A 1V2WT 4UE7H 1U6QA 3T5FH 4ABIA 1Q2WA 4B76A 4Y8YA 1LQDB 2GDDA 2FIRH 3T27A 1ZGIA 1FY5A 1DY8A 1GHBG 1MKWH 1HV7A 1O5EH 4B2AA 3P8FA 1HUTH 2OC8A 2JH0D 1CVWH 1HBTH 5E0GA 4BAKB 4Y6DA 4YESB 1F7ZA 1LHGH 1LKAA 1W0ZU 4AB9A 2Y80A 2CJIA 1PYTC 1GJ6A 2C8ZB 2BX3A 3AAVA 1K2I1 3SHAH 1O3HA 3RXPA 1DUEA 1ZRKA 2FESH 2W7SA 8LPRA 4KTUA 1LVYA 2HOBA 2XCFA 3VPKA 1MBMA 2UWPA 4FUBA 1EKBB 4WMDA 2IOTA 2FDAA 3DUXH 2ZO3H 5GWZA 1TX8A 3SJ8A 5FPTA 4BAMB 2OINA 2UWOA 2CXVA 2R9PA 1O3CA 3PV4A 2XC5A 1T4UH 1ZSKA 1QQ4A 2ZHWH 1FONA 3S69A 1AIXH 2C8WB 2BDHA 1EJAA 1P12E 3A83A 3PMJA 2YNAA 4WMFA 2ZQ1A 2DE8A 2Z3DA 4Y0YE 1SR5C 1O5GH 2OCVB 1TABE 1HJAC 3PMBB 1O2TA 2ZU2A 2QA9E 2VH0A 1JWTA 1BTWA 1UHBA 1MCVA 1CGHA 2H9HA 5EGMA 3SNDA 3A87A 7GCHG 4FUCA 1W2KH 2JETC 3PO1C 5K0HA 1ANBA 1P9UA 3LPRA 3MHWU 4AFSA 1F0TA 1TLDA 5C5NA 3T28A 4NZQA 4VGCB 3QDZB 1C5SA 3TJOA 1BBRH 4X1SU 2XRCA 4TY6A 1HAPH 1C2FA 1GBBA 1O3EA 2FI4E 1HAHH 2W3KA 4NA8A 2TGTA 1LVOA 4Q80A 5F8ZA 3U8OH 1AZ8A 2SGAA 1A2CH 1AE8H 2BY5X 1O2KA 3QGJA 4CBOA 4DJZB 4ZMAH 1BMMH 2ANMH 2SNVA 3QK1A 2PKSC 1Y5BT 3TGJE 3AASA 2QYIA 4ABEA 1ANCA 1VGCC 1ACBE 1TPSA 1A0LA 1C1MA 3SI3H 3MH6A 3TH2H 1G3EA 4XFQA 1BTPA 2BD8A 4A1TA 4ABGA 2ZNKH 4TWWA 1MQ5A 4HI3A 3SJ9A 2VWLA 1P06A 1ZPZA 2B0FA 1EJMA 3MO3A 2QXJA 3TNSA 1O3BA 2GV6A 5FX6A 4WVPE 2OXSA 1TWXB 1ETRH 1SGTA 2RDLA 1DWBH 3HKJB 2WV4A 1EJNA 1IAUA 3H7OA 3GY4A 3E0PB 3R0FA 3NWUA 2BM2A 3G01A 3E3TA 2ZCHP 2WPIS 1SSXA 1Z8IB 3KQEA 1P2KA 1OWEA 4K1EA 1A0HB 1N1LA 4FU8A 2G81E 1C5QA 2HWLB 1TGSZ 1NU7B 5FHTA 2BTCE 1TGBA 2GKVE 2D8WA 2V3OH 5E8EH 1AN1E 4JZDH 4GLYA 1P8VC 5GPIB 1ZMJA 5FXLA 1RIWC 1LPKB 5EPYA 1S6FA 1MKXH 4CRGA 1O5CB 3S9AA 4DCDA 2BLWA 1KXAA 1BJUA 1RXPA 1QL7A 1GGDB 1FIZA 3E8LA 3KNXA 3MU1A 3UY9A 6CHAC 1ZRBA 1IQEA 1PPEE 2FLBH 1XMNB 1UK2A 2QC2A 5EODA 1K9OE 3A8AA 3OU0A 1XUHA 3STIA 2PUQH 3SNEA 4INHA 2AIPA 2Z9GA 5E2OA 2NU2E 4X1NU 4AB8A 2BXTH 1ZMLA 2PHBA 2HPPH 3MU5A 3TNTA 1FMGA 4I8HA 1V3XA 3SQHE 1O2NA 5H4IB 2Y6TA 4Y11E 2I6SA 1C1NA 6LPRA 5FX5A 3ZZAA 1J9CH 2TIOA 1SGFG 2HNTF 3E90B 5F03A 4UEHH 1W8BH 4AYVB 3VFEA 1DANH 2CHAC 1GDUA 1O5BB 3LONA 1GDQA 3SNAA 5EG4A 2A4OA 1UVTH 1PPGE 1PPBH 1ELVA 1GBIA 1N8OB 1GMCG 2PFEA 2ZCLP 2W7UA 3A82A 4Y7AA 2A2QH 3P6ZB 3E16B 1MTSA 2ZDKA 1P03A 3TK6A 1SQTA 1MZAA 2ZDAH 4E05H 3GYLB 4JCNA 2ZGHA 1D4PB 5DO4H 2STAE 4B73A 1SMFE 1ZTLA 3UWIA 2F9VA 1MBQA 4IC6A 1GHYH 2Y82A 3L3TA 3ATWA 3F68H 1C5OH 3SUFA 1RTLA 4MG3A 3RMNH 1YC0A 4A7IB 2QGRA 2BDAA 5GJ4B 4XBCA 4WH6A 3A8BA 1CT4E 4AOQA 2O8WA 4GVUA 3BTWE 1A1RA 1BRBE 3UREA 1A61H 5L2ZH 2J38A 2FS8A 2VWMA 3F9FA 4RKJB 3MH7A 5SGAE 2EC9H 1GJ9B 4ZUHA 8GCHF 5DP6A 3ZZ6A 3GY8A 2YNBA 1ELEE 1VR1H 2V3HH 2JKHA 3PTNA 4ABBA 4OGXA 1NPMA 4R0IA 3W95A 3EGKH 3ZVCA 1EAUA 2P8OB 4E7RG 4YOGA 4B74A 1NFXA 1Y3XA 3FP6E 4Z6AH 3FANA 3OSYA 4YT7H 1FNIA 2XBWA 2FX4A 3SV8A 5C67A 3A7ZA 1MCTA 4PROA 1ABJH 1MTUA 1QRWA 2ZPSA 1RGQA 2XC0A 5L2YH 1BIOA 1FY1A 1GJAB 1GJBB 2FS9A 4Z0KA 5JB9S 2FOMB 3ATKA 2WUCA 1S6HA 2B8OH 4HFPB 1KXBA 3Q3YA 4BAOB 1CGIE 4KGAA 1G2MA 1B7XB 1GBCA 4MLFB 4CH2B 3JZ2B 3EAJA 3BIUH 1C5MD 1ZLRA 4LOYH 1KXEA 3M5LA 4NA7A 2A31A 3RXCA 3MNXA 4AFZA 4I31A 1B0EA 1MZDA 1TX7A 4WMEA 2VIDA 3PLBA 2P93A 1GVZA 2DUCA 2ZQ2A 1O36A 1GWAA 4KTCA 1PFXC 2A0QB 2M5TA 3SUEA 1EX3A 2H5DA 2ZTXA 3GCOA 1BB0B 3MO9A 4ZAEA 3MH4A 2GGVB 2BQ6B 4DURA 1H8DH 3V7TA 1UK3A 4ZXXH 3M37A 2OBOA 3RU4T 2FTLE 4U2WA 3SJKA 1SOTA 2ZIQH 3ATLA 2ANYA 2FMJA 1UVPA 2XWAA 3Q3XA 1F5LA 2BVRH 1L1NA 2BD4A 2XWBI 3FP8E 1J14A 4Y7BA 1FDPA 5EXMA 2PTNA 2FTMA 5C1XA 3SU2A 3UNRA 5DKMA 1A0JA 3QLPH 2CMYA 1GDNA 1DSUA 2ZWLH 1HAGE 3AW0A 4ZKNU 3U1IB 3UNQA 3RC5A 1L1GA 2FOGA 2PW8H 1SOZA 3P17H 4MDSA 2BHGA 5AF9H 4FU7A 4DOQA 3KN2A 5HGGA 1DS2E 4ISNA 2QAAA 1CSOE 4B2CA 3V3MA 2Z6BD 3HATH 4IN1A 1FPHH 3DFLA 3OTJE 5F6MA 2XNIA 3RU4D 1ABIH 2Y5GA 1XM1A 1LMWB 3QGNB 1CHGA 1GI6A 1L0ZA 1TPAE 1UVUH 2QN5T 1HIAB 4XBBA 4RSPA 4NG9H 3PWCA 4J1YA 5I25A 5C5OA 1Z6EA 2HNTE 2F9BH 1ETSH 2GCHG 3PB1E 2BY9X 1THSH 3VXFH 4AGKA 2Y7XA 1BZXE 1V2QT 1IQMA 1RD3B 2A2XH 4DT7B 1HB0B 3D49H 1KSNA 1NFWA 2XXLA 3MNSA 4TWYA 1YF4A 1C5WB 2BB4A 3UOPA 1G30B 2H9EH 3U8RH 1V2JT 2Y7ZA 2QF0A 1TYNA 3FFGA 4ABJA 3SO3A 3DA9B 5AFZH 3BEIB 1E36B 4CRDA 1O2VA 3GDSA 4BXSA 4GCHG 1BTYA 5FPYA 3MOCA 1BBRE 1TFXA 4ABAA 1FY4A 1SGIB 4OS5A 5LPEA 4CBNA 1UVOA 3RU4E 2BQ7B 4BAQB 2OLGA 5I46H 3RXJA 3K6YA 3M3SA 2ZHFH 1HAVB 3SORA 2K1QA 5TJXA 2EI6A 1SC8U 1ELGA 3URDA 2O8TA 1KY9A 1QBVH 1SGQE 2BVSH 1YCPM 1O2SA 2J34A 1O2ZA 2BY8X 1K1MA 3UUZA 1OP8A 1TNLA 1XKAC 2OTVA 2B9LA 2ZFQH 4GHTA 2O8MA 1EPTC 1QGFA 2ZPQA 2G51A 1G3CA 1P04A 2BOKA 1OP0A 8GCHG 1MTNB 2ULLA 1JRSA 4JK6A 1JMOH 3RXDA 1ZZZA 2GV7A 2H5CA 3ZZBA 3SU5A 2C8YB 3BG4B 1O2XA 3BTGE 1GJ5H 5JYIA 1ELDE 4X8UH 1HJ8A 2HALA 4KKDA 4ZKOU 2VVCA 2SGFE 2AERH 5K7RA 1UTMA 1B0FA 1Z8GA 2Z3EA 1GI5A 3ZVEA 1CBWC 1TNJA 1MU8B 1GL1A 1LHEH 2ALPA 1C5ZB 3EA8A 1O31A 1TAWA 2FOEA 3BTME 3EA7A 4KELA 2ZI2H 3LH3A 5EU8A 3B9FH 2VIOA 2ZFTA 1BCUH 1NC6A 5A0AE 3U8TH 1GHAF 2C90B 1UCYH 1P3EA 2BY7X 1UVSH 1O38A 4MQAA 3U9AH 1THRH 1TA6A 5HMAA 1Y5UT 1EAXA 1EZSC 3AAUA 1PQ5A 1SI5H 4YOIA 5LPRA 1EPTA 4X6PA 1GG6B 4A92A 4F4OC 2I6QA 2AYWA 4BTUB 1W14U 4JZFH 2ODYB 4FXGH 1EZXC 5DP7A 3VXEH 2VGCB 4Y0ZE 1H9HE 1KTSB 4I32A 4MNYA 3ITIA 1IHTH 1EP5A 1EZQA 2ZECA 3M35A 5EOKA 1AHTH 4OS2A 1OWIA 1C5PA 4JMYA 2ODQA 4I7YH 1SHHB 1GGDC 1KYNA 5TCCA 1QA0A 2SGDE 3I29A 5E2PA 1Y3VA 1YPHC 3K9XB 2ZTYA 2Q1JA 3LGWA 2GMTB 4CREA 3S7HB 4A1VA 1KLTA 2WUBA 4ISLA 3A7TA 3OY5U 1BMAA 1K1IA 1BHXF 1UO6A 3SNCA 3ELAH 1UMAH 1FAXA 4X8TH 2BMGB 1WQVH 2IJOB 4NSVA 1TX6A 1CGJE 1UK4A 1CHOF 1K1NA 1NRRH 5PTPA 2ZHQH 1C5NH 3STJA 4D7FA 2P94A 1NRPH 1GVLA 1TGNA 2QXHA 3LDXH 3DHKH 4AG1A 1VITH 1SG8B 2F9OA 4WXVA 1SFQB 3LJOA 1SGCA 1XUJA 4I8LA 1O2GH 2H1UA 3NZIA 1F92A 1W0YH 1YPKH 4E7NA 3RMOH 2WYJA 5F8XA 1TMTH 2GZ9A 1DE7H 1H4WA 1BJVA 5L6NH 5C1YA 1N8OC 1P09A 1KDQB 1OPHB 1WSSH 1WYKA 3M36A 2A4RA 4HZHA 2GZ7A 3MWIU 4UDWH 5ESBA 3UFAA 2IPHA 3UNSA 4A5TS 6ESTA 5C2ZA 1Z8RA 3ZZ4A 2ZFSA 7ESTE 2BDCA 1VJ9U 1O3DA 1SFIA 5JBAS 2QY0B 1FY3A 1P2NA 3ZVAA 1NT1A 1AU8A 1WAYB 3S9BA 2G8TA 1P2IA 2ZC9H 3BG8A 4X1RU 1O5DH 2VIVA 1ELTA 3TH3H 2QXIA 3BEUA 1BRAA 3UPEA 2FLRH 6GCHG 3UR6A 3ZZCA 1W10U 3BTEE 1WTGH 4NSYA 1LHFH 3PM3A 1BRCE 4KP0A 2BZAA 4NA9H 3SN8A 1JIRA 5FBEA 2O8LA 1KXDA 3Q00A 1N6YA 1MQ6A 4XOJA 1NY22 3R3GB 1TBRH 1C4U2 3M61U 4HGCA 1DXPA 1VCQA 1C1QA 1G3BA 3HK6B 1DUAA 2P8OC 2GVFA 3BTQE 1YCPK 3GCHB 3O8RA 1YYY1 1O3GA 1E35B 2XYAA 4ESTE 5TCAA 1GJ7B 3BV9B 7KMEH 1QL9A 3PWBA 4NWKA 2ZF0H 4LZ4B 3QO6A 5C1UA 2ESTE 2FXRA 1OWDA 2BZ6H 2G4TA 3KCGH 1KIGH 1NN6A 4AFQA 3MH5A 1TGTA 4YZUA 3VB3A 1HAYB 1RTFB 1MD8A 1FQ3A 1YPMH 2C93B 3BTFE 3LOXA 1GBDA 1D6RA 3TK9A 2BD2A 4DG4A 3ZZ8A 5FAHA 2P59A 2R3YA 1AGJA 1S83A 1AD8H 1QURH 4R8TB 4ZROA 1W13U 4ZKSU 1GHAG 5DP5A 1HCGA 1L1JA 2FODA 4JYVH 2QIQA 4K1TA 3ZZ7A 3QTOH 2FWWA 3LGIA 2AGEX 2H6MA 1DITH 1AB9B 4DY7B 1E34B 3GCTF 1F2SE 2GTBA 2XW9A 2VWOA 5E0HA 4CR9A 1ZYOA 1A5GH 1BTZA 3OX7U 4YOJA 3LGVA 1HNEE 3GDVA 3U69H 4D76A 3U1JB 3SUGA 3SGBE 4AZ2B 5IYTA 1D9IA 1GI1A 1HXEH 1HPGA 1NFUA 3PYHA 1VZQH 3AVZA 3TH4H 4Q2KA 2A4GA 2Q6DA 2ILNA 1W12U 3UQVA 1C9PA 1F0RA 1HAXB 2OUAA 1L4DA 4XDEA 2OP9A 2THFB 1AQ7A 4K69A 2KAIB 2Q6GA 3GDUA 4NCYA 1SGRE 1G3DA 1SGEE 2ZEBA 4X2XA 1W7GH 4WWYA 1V6DA 5EQSA 2R2WU 3EQ0H 1SQAA 1ANEA 1O2WA 2AIQA 1OYTH 2FOCA 3PLPA 1C1VH 3F9HA 1ZHMA 1TRYA 4OGYA 2A4QA 2ANKH 2G55A 1QJ7B 4UD9H 1HFDA 2TBSA 3IG6B 3Q76A 1P02A 1Q31A 2AGGX 2VVUA 3LH1A 1S0QA 1X7AC 2PKAA 4DIHH 1J15A 5DGJA 5LH8A 2STBE 1EUFA 3F9EA 3VEQB 1O3IA 2W5EA 2H2ZA 2BVXH 1BT7A 2VU8E 1PJPA 4YT6H 1TOMH 1OSSA 2FEQH 4BOHA 3SU4A 4Q7YA 1L2EA 5ESTE 1F0UA 1IQNA 4X2VA 4XE4A 1SVPA 3RXTA 1Y8TA 5J4SA 3BF6H 4FU9A 2OC7A 2TGAA 4IW4E 4GUXA 1BMNH 1G37A 5FPSA 1F5KU 2ZU1A 1SGNE 2JH6D 1FAKH 1TONA 1C2LA 4AORA 4CRAA 1GBKA 2HVXA 2W26A 1GI9B 1AO5A 1MAYA 1QB6A 1HAZB 1V2PT 1AZZA 2SGPE 1D3DB 1FI8A 1FY8E 2C8XB 3MNBA 5LGOA 1ZSJA 1V2ST 3DD2H 1T7CA 1EZUC 3MI4A 1WQSA 3RXVA 1WV7H 3SUDA 1Y3UA 3MFJA 4I33A 3LGYA 3LC5A 1T8OA 1MTNC 4JYTA 1DLKB 2WV5A 3E6PH 4CRBA 1MH0A 1LO6A 3BG4C 4ZHMU 1J17T 2PKSB 2A1DB 3IITA 5GCHF 1G32B 1UTQA 2C3SA 2SNWA 1DICA 1VGCB 2ZDMA 2OC0A 2TGPZ 1SGFA 3VB5A 1GI4A 1ZSLA 1G2LA 2ZHEH 4B75A 1UCYE 1YM0A 2BDBA 1K1JA 5A0BA 1TMUH 2BDIA 3MYWA 3Q3KA 1D6WA 1K21H 2RCEA 2W3IA 3RM2H 1CT2E 2PGBB 1O2IA 4DW2U 1TGCA 1HAVA 1BITA 2BDGA 3N7OA 1C2EA 2F3CE 2ZDVH 1QB9A 3UR9A 3I77A 2WPJS 3L33A 3LU9B 1NZQH 3VGCC 1GBEA 1ZTJA 3TGKE 1FUJA 1ZPBA 2GCTB 2OC1A 4K8BA 5J4QA 3A84A 5EW1H 1P11E 1GJ8B 1C5TA 1QRXA 1O2RA 1GG6C 1YKTA 1SHYA 4FUEA 1PQAA 1UJ1A 3RXEA 4H4FA 1XX9A 4WXIA 3RXGA 1HJ9A 1UTOA 2ZTZA 1RFNA 2VGCC 2VWNA 1O39A 3H5CB 4GPGA 4ISHH 4X1PU 3MTYA 1TNKA 2ZDNA 1HDTH 1GBJA 4ZHLU 3MMGA 3Q77A 1MU6B 5ABWA 1CA8B 1GBFA 3RXIA 2VJ1A 1AFEH 2ZFPH 3FVFB 5T3HA 1EAIA 4CR5A 1QRZA 5DK1A 2QCYA 4AN7A 2R0LA 3F6UH 1GBTA 1LCYA 1C2IA 2TPIZ 6CHAB 1GHBF 2CF9H 1PQ8A 1ZHRA 3P8NA 1TNHA 3GY7A 5FBIA 3RXMA 1GI0A 4NIVA 5G4BA 3RMLH 3VB6A 1C5VA 1O2HA 1G9IE 1T8NA 1Z71A 3ZVGA 3B23B 1FZZA 1V2UT 2FZZA 3BN9A 4UONA 2OQUA 2P3TB 1H9IE 3SOSA 2ZG0H 3A7XA 4OS1A 2B7DH 2ZP0H 2FI3E 1PPCE 3RXHA 4ABHA 3PMHB 2GT8A 1Z1JA 2FP7B 3RXKA 2V35A 1LPGB 4X2YA 1ANDA 3M5MA 1TNGA 3CP7A 5FCKA 1S81A 2WYGA 1UTKA 2A7HA 1C2DA 2A5AA 1O2LA 3SHCH 1O2YA 1C1WH 3TJNA 2ZZUH 2ZGXH 4A1XA 1HAOH 4K3JA 1QFKH 1C1UH 1O2OA 1V2VT 1YLCA 2CHAB 2BX4A 3HGNA 2G5VA 2FO9A 3T26A 1E38B 1GHWH 1AKSB 5C3NA 1V2NT 1GBAA 5FCRA 5JBTA 2J2UA 5DP3A 3RXOA 1CO7E 2VIPA 1KXFA 3TGIE 7GCHF 1QA7A 2BQWB 2J92A 4THNH 1GHXH 2OBQA 1Z8JB 2DE9A 2AMDA 5CE1A 1XUKA 2BXUH 4VGCC 1AVXA 1VCWA 3RC6A 1Y3YA 3S7KB 2VINA 3ZVFA 1O3PB 2PGQB 4YO9A 3GOVB 1V2LT 1ZJDA 5T6FA 2EEKA 1O2PA 2ANWA 5A8ZA 1CA0B 1ARCA 1SBWA 1DFPA 1ELAA 3L6PA 3MU4A 1ESBA 1AI8H 4TPIZ 1OWJA 3M7QA 1O37A 2XC4A 2RA3A 2ZU3A 3NPSA 5AFYH 3MU0A 3ZZ5A 4OS7A 3BTDE 2WPMS 1PPZA 1QIXB 2PSYA 1LKBA 3GCHC 3BTHE 3RMMH 4GSOA 4X2WA 5GDSH 3SV9A 1A5HA 2J95A 3P8GA 3KQDA 3QX5H 1K28D 2XCNA 2GX4A 4YTAA 1FPCH 1JOUB 4QT8C 4ISIH 5HM9A 1T8MA 1DPOA 3LC3A 1C5YB 1RJXB 4IN2A 2GT7A 1B5GH 3RC4A 1C2GA 1O3OA 1WBGB 1GMHF 1C4Y2 1C1TA 1SL3A 1T8LA 1DLEA 5GCHG 1RTKA 5EW2H 1P9SA 3BIVH 1IOEA 1SQOA 2WPLS 2RA0A 4RKOB 2BOHB 4NIWA 1Z7KA 4IMZA 5GIBA 4CHAB 1GMDF 3WY8A 3QWCH 4UFEH 4XBDA 1P57B 1GI3A 1O3JA 4CH8B 1O3FA 1A3EH 3K65B 1NS3A 2F83A 4AYYB 1YPHE 3PLKA 2FI5E 3RXAA 5JPMH 3FZDA 1PPFE 1MKWK 8ESTE 1A46H 3TLOA 1LVBA 1IQHA 2VB0A 4X1QU 1OYQA 2BY6X 1AB9C 4Q7XA 1IQGA 2FOFA 3RXLA 1MAXA 2Z9LA 4O9VA 3HKIB 1S82A 2EI8A 3IWMA 1C1RA 1D3QB 5CHAB 1YLDA 1IQKA 5A8XA 2Y5FA 5DJ7A 1XUIA 2OQ5A 3LKWA 4FUIA 1ORFA 4BNRA 1V2RT 1DX5M 4OS6A 1ELFA 1GCTB 1NRNH 1AE5A 1FXYA 3SGAE 3BTTE 1M9UA 4FUDA 3RDZA 2Z9KA 2UUYA 1HRTH 1KLIH 1NFYA 2FX6A 1BQYA 1ZGVA 1AWHB 5LPFA 1VJAU 1C5UA 1GL0E 2NU1E 4B71A 7LPRA 2UUFB 4TYDA 4YLUA 2A5IA 3SBKA 4WF8A 1O3LA 2AMQA 4U32A 1K1PA 1TIOA 4F49A 1V2KT 1ZPCA 3M7TA 4AX9H 4Y71A 1PQ7A 3HPTB 1NM6A 1ZMNA 1INCA 1GJDB 1YPJH 2V6NA 5B6OA 1EXFA 1Y59T 3LT3A 3ZZ3A 1XUFA 1LHCH 1WTHD 1UTPA 1XUGA 1A4WH 3KEEA 2EA3A 4WH8A 1BBRK 4IS5A 1UTNA 2ZCKP 1V2TT 3O8BA 2R3UA 1FJSA 4SGBE 1D3TB 1GMCF 1N6XA 4JK5A 3TITA 1CU1A 4LXBH 2AS9A 1ZR0A 1C5XB 2J4IA 1HLTH 1TPOA 1ETTH 2CN0H 2ZPRA 1TBZH 3E91A 1YBWA 1O32A 3SNBA 1C4V2 4MPWA 2NWNA 4FUHA 2FYRA 5AHGH 5BRRE 1GI2A 1KLJH 3SQEE 3LJJA 4INKA 5L30H 1W3CA 1C2HA 2KAIA 4ABFA 1EATA 1GHVH 1MTVA 3FAOA 2YOLA 4BTTB 3JZ1B 1DDJA 4IGDA 3ZVDA 4D9QA 3M3TA 1JBUH 1CT0E 1PPHE 1QB1A 3TJVA 1YP9A 3C27B 1D3PB 1TRMA 2HPQH 1HXFH 3BTKE 2R0KA 4UFGH 2PLXA 1SGDE 2BD3A 1SLVB 4K1SA 4O03A 1QJ1B 1DVAH 3MU8A 3RXQA 2WINI 4D7GA 4MNXA 3F9GA 3B8JA 4DIIH 4ZKRU 4HTCH 2QF3A 1TRNA 4BAHB 1NRSH 5JDUB 1IHSH 1OKXA 4D8NA 1EPTB 1O34A 4IBLH 1JIMA 2D2DA 3ZV9A 2ZFFH 3RUOA 1C5LH 3GYMA 3I78A 2FM2A 3TVJB 2GDEH 3URCA 2G00A 2AEIH 1Z6JH 4JZ1A 3P8OA 3ENSB 1NTPA 1P10A 2ALVA 3CENA 1GJ4H 4K60A 1SGPE 2G4UA 3NCLA 2RG3A 2Z94A 1DWDH 3RM0H 2ODPA 3GY2A 3ATIA 1AUTC 1MKXK 2A7CA 1CBWB 3SV7A 1GMHG 1ELBA 3A80A 4RN6A 3ATMA 3K2UA 4ISOA 2NU4E 1OWKA 4U01A 1A7SA 4GHQA 1QCPA 2CF8H 1Y3WA 2LPRA 3AW1A 3KQBA 4J2YB 1GMDG 1OX1A 2VH6A 4E06H 1YCPH 4BANB 1ZOMA 2VNTA 2PR3A 1QNJA 1FN8A 3TPIZ 2PTCE 1AFQB 4UFDH 3A7WA 2GCTC 4B1TA 2O9QA 1DOJA 1LHDH 2LNCA 3ZV8A 1F5RA 2Z9IA 2VIWA 3OYPA 2GZ8A 3RLWH 2Y81A 3KHVA 2G5NA 3S9CA 3O8DA 3EDXB 3V0XA 1HYLA 2AGIX 1EB2A 1MD7A 5C20A 2FPZA 3QZQA 2JH5D 4A6LA 5DP8A 1P0SH 3SZNA 1BMLA 1GVKB 3P70B 4KTSA 1O2UA 3S0NA 3V13A 3QN7A 1UTLM 5T6DA 3ZYDA 2UWLA 4AFUA 3LIWA 1TOCB 1UHBB 2QXGA 4YLQH 2D26C 1S84A 1SPJA 1NROH 1EAWA 4BXWA 2FOAA 4FUGA 3VB7A 1THPB 3A8CA 4K2YA 2H9TH 1VITF 1J8AA 3NK8A 4I8JA 1H9LB 1CHOG 5BPEA 2TRMA 3QTVH 3SU1A 2P95A 2NU3E 1SGYE 3GICB 1ARBA 1TQ7B 1EB1H 1QTFA 1ZHPA 1NU9A 3ZVBA 2UUKB 2B5TB 4X6MA 2GCHF 1T4VH 5EXNA 2P3FH 1XXFA 1SB1H 3RXSA 1QQUA 1K1LA 3GCNA 3LGUA 2BD9A 2FOBA 1KTTB 3PMAB 1BA8B 3UTUH 3SW2B 1MMJN 3UQOA 4X8VH 1F0SA 1O35A 3FZZA 1QHRB 1FV9A 1DM4B 5EXLA 5DPAA 2BLOA 1HJAB 5T6GA 4XSKU 2ZU5A 2VIQA 4ZXYH 1OOKB 1EP6A 3W94A 4O3TA 4GCHF 1P01A 2A32A 1WCZA 2BLQA 3D23A 3ZZ9A 3TU7H 1O0DH 4NIYA 2ZKSA 5JBBS 4ABDA 1C2KA 1CE5A 2BDYA 3RXBA 2JETB 3PO1B 3UIRA 3T25A 3RLYH 3A89A 2ZGCA 3ESTA 1TA2A 2PV9B 2O8UA 2PWXA 1DWCH 1TB6H 2Z9JA 1E37B 1O2MA 4Y76A 3SV6A 1HIAA 1CA0C 3V12A 4H6SB 1EOJA 5DP4A 1KXCA 3LGTA 1OP2A 5EQRA 3NUMA 1T31A 5A09A 5HM2A 4MVNA 3GISB 1UTJA 4JZEH 2R2MB 4MPVA 1O5AB 1TE0A 2SGEE 1AMHA 1HAIH 4UFFH 2ZFRH 4MTBA 3O8CA 2GD4B 1GBLA 1IQIA 4NWLA 2D1JA 3RXUA 2BLVA 3A86A 4Q7ZA 1WOFA 1P2MA 2NU0E 1BTXA 1XVMA 4CRFA 4DVAU 2J94A 2QV1A 1AKSA 1SLXB 4ZH8A 3TK5A 3VB4A 1GHZA 2GP9B 3NXPA 2WPHS 3U98H 1LDTT 1Q3XA 2G52A 2UUJB 3ODDA 4I8GA 4M7GA 4LZ1H 2HRVA 3K6ZA 4SGAE 3EA9A 3KGPA 1TNIA 1O2QA 1RRKA 4WY3A 4CHAC 3D62A 2FOHA 4NIXA 1FIWA 5F8TA 2ZGJA 3OY6U 3TIUA 1BRUP 1YPLH 3ZZDA 1AVWA 1OS8A 2Z7FE 3RXRA 4AGJA 5HYOA 1A5IA 2ZU4A 1BUIA 1AVGH 2XBVA 5A0CA 3QUMP 3CS0A 4ZHAA 3DT0H 1ZTKA 4IMQA 3M7UA 1MUEB 4TPYA 3T29A 1NO9H 1DY9A 1G36A 3HGPA 4MNWA 3GCTG 3SU3A 4B2BA 1S85A 1QBOA 4H6TA 1O33A 2ZA5A 3PTBA 1TMBH 3RXFA 4MPUA 1RIWB 3SI4H 1GBHA 4ASHA 2A45B 3KF2A 4CRCA 1C2MA 5CHAC 2PKAB 1ESTA 4FUJA 4X6OA 1V2OT 2F91A 2Z3CA 2AFQB 4X0WU 1FN6A 1DT2A 2GMTC 3A81A 2PUXB 1NESE 1ID5H 1JXPA 2F9NA 5E0JA 1OXGA 1IQFA 1XXDA 3H7TA 1EASA 3UWJH 1GCTC 3M5OA 2SGQE 2A7JA 1NRQH 1O3NA 3P92A 2CV3A 4K8YA 4U30A 4GAWA 3HK3B 1P2QA 3ZYEA 1DXWA 2ZDLA 4TY7A 1O3AA 2VVVA 4H42U 1ESAA 4I8KA 4Y10E 1GCDA 4LK4A 2HLCA 3SJIA 1VITG 4NFFA 1XKBC 3PROA 1C1SA 1LPZB 2ZHDA 1EQ9A 1VCPA 3A88A 1TQ0B 1QR3E 1BDAA 3CS7A 3A8DA 1O30A 1TBQH 1BHXB 1V2MT 1QY6A 3QZRA 3MNCA 1TPPA 3T62A 3A7YA 1BOQA 3F1SB 1P3CA 4JZIA 3GY6A 9LPRA 2IN2A 2BD5A 3A7VA 4X6NA 1QL8A 1P2OA 1YPEH 3SU0A 2FYQA 2OD3B 3KL6A 5DP9A 1S0RA 2HGTH 2PSXA 2XTTB 3ODFA 1OWHA 1LTOA 1ZJKA 1BTUA 3RP2A 2HNTC 1S5SA 2ZGBH 1WUNH 6GCHF 5ETXA 1C5RA 1O5FH 4IC5A 9ESTA
chains in the Genus database with same CATH superfamily
5B6LA 2XBYA 1XVOA 4WJG2 2P16A 3UOUA 4ACBA 1Z1IA 1O3MA 1H8IH 1RS0A 1A3BH 1AY6H 1C1OA 2CGAA 1GI7B 3BSQA 5JB8S 1W11U 5A2MH 4K5ZA 1SLWB 1Y5AT 1T32A 1MTWA 2PP6A 1UCYK 2F9UA 1ELCA 1O2JA 1LVMA 5EQQA 1P2JA 1GPZA 2WSSD 4YM9A 1KDQA 1WU1A 3A85A 4NGAH 3NKKA 1S6LA 2TGDA 1CQQA 3FP7E 2XBXA 8KME2 5HXFA 3M5NA 1W7XH 3SV2H 4AG2A 2AH4X 4P00A 4FUFA 2EI7A 4O97A 3SJOA 5IDKA 2ASUB 3D65E 1L4ZA 1GJCB 2WPKS 5CMXH 3E0NB 3GY5A 1PYTD 2Y5HA 4FVBA 4JYUH 4Y8XA 1JRTA 1EOLA 5A8YA 1H1BA 4Y79A 5GXPA 1E0FD 4MPXA 2J9NA 4NZLA 1HGTH 1YGCH 1QBNA 1GI8B 3H09A 2Q6FA 1YPGH 2V0BA 1O3KA 4O3UA 2BD7A 1C9TA 1C2JA 1QJ6B 2BYAX 3P95A 2AMPA 1K22H 1LQEA 4D9RA 3F3BA 1C1PA 2F9PA 4NFEA 3E1XB 2SFAA 4OS4A 3DFJA 2A5KA 1AFQC 4Y8ZA 5EPNA 1TALA 1J16A 3TJUA 3VGCB 1DSTA 5DG6A 3SGQE 3M3VA 3T2NA 1IQLA 4BTIB 1IQJA 4INLA 3EE0B 1AUJA 5C94A 3SU6A 5JBCS 2XNDD 3C1KA 4FVDA 1GBMA 4DGJA 3KQCA 1FLEE 2C4FH 2P3UB 5AVDA 1AWFH 1K1OA 3MO6A 3GY3A 3EYDA 4Q63A 1DWEH 3BEFB 3KIDU 1BTHH 4MNVA 1SLUB 4X8SH 1P05A 1V2WT 4UE7H 2KCAA 1U6QA 3T5FH 4ABIA 1Q2WA 4B76A 4Y8YA 1LQDB 2GDDA 2FIRH 3T27A 1ZGIA 1FY5A 1DY8A 1GHBG 1MKWH 1HV7A 1O5EH 4B2AA 3P8FA 1HUTH 2OC8A 2JH0D 1CVWH 1HBTH 1W0JD 5E0GA 4BAKB 4Y6DA 4YESB 1F7ZA 1LHGH 1LKAA 1W0ZU 4AB9A 2J98B 2Y80A 2CJIA 1PYTC 1GJ6A 2C8ZB 2BX3A 3AAVA 1K2I1 3SHAH 1O3HA 3VG8A 3RXPA 1DUEA 1ZRKA 5EJLA 2FESH 2W7SA 8LPRA 4KTUA 1LVYA 2HOBA 2XCFA 3VPKA 1MBMA 2UWPA 4FUBA 1EKBB 4WMDA 2IOTA 2FDAA 3DUXH 2ZO3H 5HIZA 5GWZA 2KM0A 2F4LA 1TX8A 3SJ8A 5FPTA 4BAMB 2OINA 2UWOA 2CXVA 2R9PA 1O3CA 3PV4A 2XC5A 1T4UH 5C0UA 1ZSKA 1QQ4A 2ZHWH 1FONA 3S69A 1AIXH 2C8WB 2BDHA 1EJAA 1P12E 3A83A 3PMJA 2YNAA 4WMFA 2ZQ1A 2DE8A 2Z3DA 4Y0YE 1SR5C 1O5GH 2OCVB 1TABE 1HJAC 3PMBB 1O2TA 2ZU2A 5EJ1A 2QA9E 2VH0A 1JWTA 2KZ4A 1BTWA 5HIYA 1UHBA 1MCVA 1CGHA 2H9HA 5EGMA 3SNDA 3A87A 7GCHG 3PV2A 4FUCA 1W2KH 2JETC 3PO1C 5K0HA 1ANBA 1P9UA 3LPRA 3MHWU 4AFSA 1F0TA 1TLDA 5C5NA 3T28A 4NZQA 4VGCB 3QDZB 1C5SA 3TJOA 1BBRH 2KR7A 4X1SU 2XRCA 4TY6A 1HAPH 1C2FA 1GBBA 1O3EA 2FI4E 1HAHH 2W3KA 4NA8A 2TGTA 1LVOA 4Q80A 5F8ZA 3U8OH 1AZ8A 2SGAA 1A2CH 1AE8H 2BY5X 1O2KA 3QGJA 4CBOA 4DJZB 4ZMAH 1BMMH 2ANMH 2SNVA 3QK1A 2PKSC 1Y5BT 3TGJE 3AASA 2QYIA 4ABEA 1ANCA 1VGCC 3KYGA 1ACBE 1TPSA 1A0LA 1C1MA 3SI3H 3MH6A 3TH2H 1G3EA 4XFQA 1BTPA 2BD8A 4A1TA 4ABGA 4I86A 2ZNKH 4TWWA 1MQ5A 4HI3A 3SJ9A 2VWLA 1P06A 1ZPZA 2B0FA 1EJMA 3MO3A 2QXJA 3TNSA 1O3BA 2RDEA 2GV6A 5FX6A 4WVPE 2OXSA 1TWXB 1ETRH 1SGTA 2RDLA 1DWBH 3HKJB 2WV4A 1EJNA 1IAUA 3H7OA 4OM9A 3GY4A 3E0PB 3R0FA 3NWUA 4RT1A 2BM2A 3G01A 3E3TA 2ZCHP 2WPIS 1SSXA 1E1QD 1Z8IB 3KQEA 1P2KA 1OWEA 4K1EA 1A0HB 1N1LA 4FU8A 2G81E 1C5QA 2HWLB 1TGSZ 1NU7B 5FHTA 2BTCE 1TGBA 2GKVE 2D8WA 2V3OH 5E8EH 1AN1E 4JZDH 4GLYA 1P8VC 5GPIB 1ZMJA 5FXLA 1RIWC 1LPKB 5EPYA 1S6FA 1MKXH 4CRGA 1O5CB 3S9AA 4DCDA 2BLWA 1KXAA 1BJUA 1RXPA 1QL7A 1GGDB 1FIZA 3E8LA 3KNXA 1VKYA 3MU1A 3UY9A 6CHAC 2YMSD 1ZRBA 1IQEA 1PPEE 2FLBH 1XMNB 1UK2A 2QC2A 5EODA 1K9OE 3A8AA 3OU0A 1XUHA 4Z1MD 3STIA 2PUQH 3SNEA 4INHA 2AIPA 2Z9GA 5E2OA 2NU2E 4X1NU 4AB8A 2BXTH 1ZMLA 2PHBA 2HPPH 3MU5A 3TNTA 1FMGA 4I8HA 1V3XA 3KYFA 3SQHE 1O2NA 5H4IB 2Y6TA 4Y11E 2I6SA 2IJD1 1C1NA 6LPRA 5FX5A 3ZZAA 1OHHD 3PV5A 1J9CH 2TIOA 4HG6A 1SGFG 2HNTF 3E90B 2JDID 5F03A 4UEHH 1W8BH 4AYVB 3VFEA 1DANH 2CHAC 1GDUA 3F2HA 1O5BB 3LONA 1GDQA 3SNAA 5EG4A 2A4OA 1UVTH 1PPGE 1PPBH 1ELVA 1GBIA 1N8OB 1GMCG 2PFEA 1E1RD 2ZCLP 2W7UA 3A82A 4Y7AA 2A2QH 3P6ZB 3E16B 1MTSA 2ZDKA 1P03A 3TK6A 1SQTA 1MZAA 2ZDAH 4E05H 3GYLB 4JCNA 2ZGHA 2LELA 1D4PB 5DO4H 2STAE 4B73A 1SMFE 1ZTLA 3UWIA 2F9VA 1MBQA 4IC6A 1GHYH 2Y82A 3L3TA 3ATWA 3F68H 1C5OH 3SUFA 1RTLA 4MG3A 3RMNH 1YC0A 4A7IB 2QGRA 2BDAA 2YMSC 5GJ4B 4XBCA 4WH6A 3A8BA 1CT4E 4AOQA 2O8WA 4GVUA 3BTWE 1A1RA 1BRBE 3UREA 1A61H 5L2ZH 2J38A 2FS8A 2VWMA 3F9FA 4RKJB 3MH7A 5SGAE 2EC9H 1GJ9B 4ZUHA 8GCHF 5DP6A 3ZZ6A 3GY8A 2YNBA 1ELEE 1VR1H 2V3HH 2JKHA 3PTNA 4ABBA 4OGXA 1NPMA 4R0IA 3W95A 3EGKH 3ZVCA 1EAUA 2P8OB 4E7RG 4YOGA 4B74A 1NFXA 2HLDD 1Y3XA 3FP6E 4Z6AH 3FANA 3OSYA 4YT7H 1FNIA 2XBWA 2FX4A 3SV8A 5C67A 3A7ZA 2RFKC 1MCTA 4PROA 1ABJH 3OTPA 1MTUA 1QRWA 2ZPSA 1RGQA 2XC0A 5L2YH 1BIOA 1FY1A 5IK2D 1GJAB 1GJBB 2FS9A 4Z0KA 5JB9S 2FOMB 3ATKA 2WUCA 1S6HA 2B8OH 4HFPB 1KXBA 3Q3YA 4BAOB 1CGIE 4KGAA 1G2MA 1B7XB 1GBCA 3DSPA 4MLFB 4CH2B 3JZ2B 3EAJA 3BIUH 1C5MD 1ZLRA 4LOYH 1KXEA 3M5LA 4NA7A 2A31A 3RXCA 3MNXA 4AFZA 4I31A 1B0EA 1MZDA 1TX7A 4WMEA 2VIDA 3PLBA 2P93A 1GVZA 2DUCA 3OE7D 2ZQ2A 1O36A 1GWAA 4KTCA 1PFXC 2A0QB 2M5TA 4B6FA 3SUEA 1EX3A 5FL7D 2H5DA 2ZTXA 3GCOA 1BB0B 3MO9A 4ZAEA 3MH4A 2GGVB 2BQ6B 4DURA 1H8DH 3V7TA 1UK3A 4ZXXH 3M37A 2OBOA 3RU4T 2FTLE 4U2WA 3SJKA 1SOTA 2ZIQH 3FOAA 3ATLA 3F2FA 2ANYA 4M9FA 2FMJA 1UVPA 2XWAA 3Q3XA 1F5LA 2BVRH 1L1NA 3EE7A 2BD4A 2XWBI 3FP8E 1J14A 4Y7BA 1FDPA 5EXMA 2PTNA 2FTMA 5C1XA 3SU2A 3UNRA 5DKMA 1A0JA 3QLPH 2CMYA 3F0PA 1GDNA 1DSUA 2ZWLH 1HAGE 3AW0A 4ZKNU 3U1IB 3UNQA 3RC5A 1L1GA 2FOGA 2PW8H 1SOZA 3P17H 4MDSA 2BHGA 5AF9H 4FU7A 4DOQA 1YY3A 3KN2A 5HGGA 1DS2E 4ISNA 2QAAA 1CSOE 4B2CA 3V3MA 2Z6BD 3HATH 3N99A 4IN1A 1FPHH 3DFLA 3OTJE 5F6MA 2XNIA 3RU4D 1ABIH 2Y5GA 1XM1A 1LMWB 3QGNB 1CHGA 1GI6A 1L0ZA 1TPAE 1UVUH 2QN5T 1HIAB 4XBBA 4RSPA 4NG9H 3PWCA 4J1YA 5I25A 5C5OA 1Z6EA 2HNTE 2F9BH 1ETSH 2GCHG 3PB1E 2BY9X 1THSH 3VXFH 4AGKA 2Y7XA 1BZXE 2XOKD 1V2QT 1IQMA 2L74A 1RD3B 2A2XH 4DT7B 1HB0B 2F43B 3D49H 1KSNA 1NFWA 2XXLA 3MNSA 4TWYA 1YF4A 1C5WB 2BB4A 3UOPA 1G30B 2H9EH 3U8RH 1V2JT 2Y7ZA 2QF0A 1TYNA 3FFGA 4ABJA 3SO3A 3DA9B 5AFZH 3BEIB 1E36B 4CRDA 1O2VA 3GDSA 4BXSA 4GCHG 1BTYA 5FPYA 3MOCA 1BBRE 1TFXA 4ABAA 1FY4A 1SGIB 4OS5A 5LPEA 4CBNA 1UVOA 3RU4E 2BQ7B 4BAQB 2OLGA 2J98A 5I46H 3RXJA 3K6YA 3M3SA 2ZHFH 1HAVB 3SORA 2K1QA 5TJXA 2EI6A 1SC8U 1ELGA 3URDA 2O8TA 1KY9A 3UB0A 1QBVH 1SGQE 2BVSH 1YCPM 1O2SA 2J34A 1O2ZA 2BY8X 1K1MA 3UUZA 1OP8A 1TNLA 1XKAC 2OTVA 2B9LA 2ZFQH 4GHTA 2O8MA 1EPTC 1QGFA 3WWBA 2ZPQA 2G51A 1G3CA 1P04A 2BOKA 1OP0A 1W0KD 8GCHG 1MTNB 2ULLA 1JRSA 4JK6A 1JMOH 3RXDA 1ZZZA 2GV7A 2H5CA 3ZZBA 3SU5A 2C8YB 3BG4B 1O2XA 3BTGE 1GJ5H 3FN8A 5JYIA 1ELDE 4X8UH 1HJ8A 2HALA 4KKDA 4ZKOU 2VVCA 2SGFE 2AERH 5K7RA 1UTMA 1B0FA 1Z8GA 2Z3EA 1GI5A 3ZVEA 1CBWC 1TNJA 1MU8B 1GL1A 1LHEH 2ALPA 1C5ZB 3EA8A 1O31A 1TAWA 2FOEA 3BTME 2KCYA 3EA7A 4KELA 2ZI2H 3LH3A 5EU8A 3B9FH 2VIOA 2ZFTA 1BCUH 1NC6A 5A0AE 3U8TH 1GHAF 2C90B 1UCYH 1P3EA 2BY7X 2K0QA 1UVSH 1O38A 4MQAA 3U9AH 1THRH 1TA6A 5HMAA 1Y5UT 1EAXA 3OFND 1EZSC 3AAUA 4P02A 1PQ5A 1SI5H 4YOIA 5LPRA 1EPTA 4X6PA 1GG6B 4A92A 4F4OC 2I6QA 5CDFE 5C0TA 2AYWA 4BTUB 1W14U 4JZFH 2ODYB 4FXGH 1EZXC 5DP7A 3VXEH 2VGCB 4Y0ZE 1H9HE 1KTSB 4I32A 4MNYA 3ITIA 1IHTH 3PRDA 1EP5A 1EZQA 2ZECA 3M35A 5EOKA 1AHTH 4OS2A 1OWIA 1C5PA 4JMYA 2ODQA 4I7YH 1SHHB 1GGDC 1KYNA 5TCCA 1QA0A 2SGDE 3I29A 5E2PA 5C17A 1Y3VA 1YPHC 3K9XB 2ZTYA 2Q1JA 3LGWA 2GMTB 4CREA 3S7HB 4A1VA 1KLTA 2WUBA 4Q4LA 4ISLA 3A7TA 3OY5U 1BMAA 1K1IA 1BHXF 1UO6A 3SNCA 2M2AA 3ELAH 1UMAH 3SYJA 2CK3D 1FAXA 4X8TH 2BMGB 1WQVH 2IJOB 4NSVA 1TX6A 1CGJE 1UK4A 1CHOF 1K1NA 1NRRH 5PTPA 2ZHQH 1C5NH 3STJA 4D7FA 2P94A 2GJGA 1NRPH 1GVLA 1TGNA 2QXHA 3LDXH 3DHKH 4AG1A 1VITH 1SG8B 3FKSD 2F9OA 4WXVA 1SFQB 3LJOA 1SGCA 1XUJA 4I8LA 1O2GH 2H1UA 2V7QD 2KX4A 3NZIA 1F92A 1W0YH 1YPKH 4E7NA 3RMOH 2WYJA 5F8XA 1TMTH 2GZ9A 1DE7H 1H4WA 1BJVA 5L6NH 5C1YA 1N8OC 1P09A 1KDQB 1OPHB 1WSSH 1WYKA 3M36A 2A4RA 4HZHA 2GZ7A 3MWIU 4UDWH 5ESBA 3UFAA 1FX0B 2IPHA 3UNSA 4A5TS 6ESTA 5C2ZA 1Z8RA 3ZZ4A 2ZFSA 7ESTE 2BDCA 1VJ9U 1O3DA 1SFIA 5JBAS 2QY0B 1FY3A 1P2NA 3ZVAA 1NT1A 1AU8A 1WAYB 3S9BA 2G8TA 1P2IA 2ZC9H 3BG8A 4X1RU 1O5DH 2VIVA 1ELTA 3TH3H 2QXIA 3BEUA 1BRAA 3UPEA 2FLRH 6GCHG 3UR6A 3ZZCA 1W10U 3BTEE 1WTGH 4NSYA 1E79D 1LHFH 3PM3A 1BRCE 4KP0A 2BZAA 4NA9H 3SN8A 1JIRA 2V3MA 5FBEA 2O8LA 1KXDA 3Q00A 1N6YA 1WXRA 1MQ6A 4XOJA 1NY22 3R3GB 1TBRH 1C4U2 3M61U 4HGCA 1DXPA 1VCQA 1C1QA 1G3BA 3HK6B 1DUAA 2P8OC 2GVFA 5HKKD 3BTQE 1YCPK 3GCHB 2QE7D 3O8RA 1YYY1 1O3GA 1E35B 2XYAA 4ESTE 5TCAA 1GJ7B 3BV9B 7KMEH 1QL9A 3PWBA 4NWKA 2ZF0H 4LZ4B 3QO6A 5C1UA 2ESTE 2FXRA 1OWDA 2BZ6H 2G4TA 2VBCA 3KCGH 1KIGH 1NN6A 4AFQA 2KCPA 3MH5A 1TGTA 4YZUA 3VB3A 1HAYB 1RTFB 1MD8A 1FQ3A 1YPMH 2C93B 3BTFE 3LOXA 1GBDA 1D6RA 3TK9A 2BD2A 4DG4A 3ZZ8A 5FAHA 2P59A 2R3YA 1AGJA 1S83A 1AD8H 1QURH 4R8TB 4ZROA 1W13U 4ZKSU 1GHAG 1YWUA 5DP5A 1HCGA 1L1JA 2FODA 4JYVH 2QIQA 4K1TA 2OK5A 3ZZ7A 3QTOH 2FWWA 3LGIA 1SQRA 2AGEX 2H6MA 1DITH 1AB9B 4DY7B 1E34B 3GCTF 1F2SE 2GTBA 2XW9A 2VWOA 5E0HA 1COWD 4CR9A 1ZYOA 1A5GH 1BTZA 3OX7U 4YOJA 3LGVA 1HNEE 3GDVA 3U69H 4D76A 4YXWD 3U1JB 3SUGA 3DSOA 3SGBE 4AZ2B 5IYTA 1D9IA 1GI1A 1HXEH 1HPGA 1NFUA 3PYHA 1VZQH 3AVZA 3TH4H 4Q2KA 2A4GA 2Q6DA 2ILNA 1W12U 3UQVA 1C9PA 1F0RA 1HAXB 2OUAA 1L4DA 4XDEA 2OP9A 2THFB 1AQ7A 4K69A 2KAIB 2Q6GA 3GDUA 4NCYA 1SGRE 1G3DA 1SGEE 2ZEBA 4X2XA 1W7GH 4WWYA 1V6DA 5EQSA 2R2WU 3EQ0H 1SQAA 1ANEA 1O2WA 3WW7A 2AIQA 1OYTH 2FOCA 1SKYE 3PLPA 1C1VH 3F9HA 1ZHMA 1TRYA 4OGYA 2A4QA 2ANKH 2G55A 1QJ7B 2J5UA 4UD9H 1HFDA 2TBSA 3IG6B 3Q76A 1P02A 1Q31A 2AGGX 2VVUA 3LH1A 2HVYB 1S0QA 1X7AC 2PKAA 4DIHH 1J15A 5DGJA 5LH8A 2STBE 1EUFA 3F9EA 3VEQB 1O3IA 2W5EA 2H2ZA 2BVXH 1YLNA 3AK5A 1BT7A 5DN6D 2VU8E 1PJPA 4RI0A 2KFWA 4YT6H 1TOMH 1OSSA 2FEQH 4BOHA 3SU4A 4Q7YA 1L2EA 5ESTE 1F0UA 1IQNA 4X2VA 4XE4A 1SVPA 3RXTA 1Y8TA 5J4SA 3BF6H 4FU9A 2OC7A 2TGAA 4IW4E 4GUXA 1BMNH 1G37A 5FPSA 1F5KU 3F2GA 2ZU1A 3OEHD 1SGNE 4ZCNA 2JH6D 1FAKH 1TONA 1C2LA 4AORA 2J97A 4CRAA 1GBKA 2HVXA 2W26A 1GI9B 1AO5A 1MAYA 1QB6A 1HAZB 1EFRD 1V2PT 1AZZA 2SGPE 1D3DB 1FI8A 1FY8E 1H8ED 2C8XB 3MNBA 5LGOA 1ZSJA 1V2ST 3DD2H 1T7CA 1EZUC 3MI4A 1WQSA 3RXVA 1WV7H 3SUDA 1Y3UA 3MFJA 4I33A 3LGYA 3LC5A 1T8OA 1MTNC 4JYTA 1DLKB 2WV5A 3E6PH 4CRBA 1MH0A 1LO6A 3BG4C 4ZHMU 1J17T 2PKSB 4F55A 2A1DB 3IITA 5GCHF 1G32B 1UTQA 2C3SA 2SNWA 2KCOA 1DICA 1VGCB 4ACAA 2ZDMA 4AC9A 2OC0A 2TGPZ 1SGFA 3VB5A 1GI4A 1ZSLA 1G2LA 2ZHEH 4B75A 1UCYE 1YM0A 2BDBA 1K1JA 5CHBA 5DSFA 1TMUH 2BDIA 3MYWA 3Q3KA 5A0BA 1D6WA 1K21H 2RCEA 4B6EA 2W3IA 3RM2H 1CT2E 2PGBB 1O2IA 4DW2U 4FOUC 1TGCA 1HAVA 1BITA 2BDGA 3N7OA 1QZ8A 1C2EA 2F3CE 3U28C 2ZDVH 1QB9A 3UR9A 3I77A 2WPJS 3L33A 3LU9B 1NZQH 3VGCC 1GBEA 1ZTJA 3TGKE 1FUJA 1ZPBA 2GCTB 2OC1A 4K8BA 5J4QA 3A84A 5EW1H 1P11E 1GJ8B 1C5TA 1QRXA 1O2RA 1GG6C 1YKTA 1SHYA 4FUEA 1PQAA 1UJ1A 3RXEA 4H4FA 1XX9A 4WXIA 3RXGA 1HJ9A 1UTOA 2ZTZA 1RFNA 2VGCC 2VWNA 4RT0A 1O39A 3H5CB 4GPGA 4ISHH 4X1PU 3MTYA 1TNKA 2ZDNA 3DCLA 1HDTH 1GBJA 4ZHLU 3MMGA 3Q77A 1MU6B 5ABWA 3N7EA 1CA8B 1GBFA 3RXIA 2VJ1A 1AFEH 2ZFPH 3FVFB 5T3HA 1EAIA 1MABB 1QRZA 5DK1A 4CR5A 2QCYA 2QF4A 2WHXA 5EJZA 2R0LA 4AN7A 3F6UH 1GBTA 1LCYA 1C2IA 2TPIZ 6CHAB 1GHBF 2CF9H 1PQ8A 1ZHRA 3P8NA 1TNHA 3GY7A 5FBIA 3RXMA 1GI0A 4NIVA 5G4BA 3RMLH 3VB6A 1C5VA 1O2HA 1G9IE 1T8NA 1Z71A 3ZVGA 3B23B 1FZZA 1V2UT 2FZZA 3BN9A 4UONA 2OQUA 2P3TB 1H9IE 3SOSA 2ZG0H 3A7XA 4OS1A 2B7DH 2ZP0H 2FI3E 1PPCE 3RXHA 4ABHA 3PMHB 2GT8A 1Z1JA 2FP7B 3RXKA 2V35A 1LPGB 4X2YA 1ANDA 3M5MA 1TNGA 3CP7A 4TSFD 5FCKA 1S81A 2WYGA 1UTKA 2A7HA 1C2DA 2A5AA 1O2LA 3SHCH 1O2YA 1C1WH 3TJNA 5KECA 2ZZUH 2ZGXH 4A1XA 1HAOH 4K3JA 1QFKH 1C1UH 1O2OA 1V2VT 1YLCA 2CHAB 2BX4A 3HGNA 2G5VA 2FO9A 3T26A 1E38B 1GHWH 1AKSB 5C3NA 1V2NT 1GBAA 5FCRA 5JBTA 2J2UA 5DP3A 3RXOA 1CO7E 2VIPA 1KXFA 3TGIE 7GCHF 1QA7A 2BQWB 2J92A 4THNH 1GHXH 2OBQA 1Z8JB 2DE9A 2AMDA 5CE1A 1XUKA 2BXUH 4VGCC 1AVXA 1VCWA 3RC6A 1Y3YA 3S7KB 2VINA 3ZVFA 1O3PB 2PGQB 4YO9A 3GOVB 1V2LT 1ZJDA 5T6FA 2EEKA 1O2PA 2ANWA 5A8ZA 1CA0B 1ARCA 1SBWA 1DFPA 1ELAA 2YMSB 1H8HD 3L6PA 3MU4A 1ESBA 2JJ2D 1AI8H 4TPIZ 1OWJA 3M7QA 1O37A 2XC4A 2RA3A 2ZU3A 3NPSA 5AFYH 3MU0A 3ZZ5A 4OS7A 3BTDE 2WPMS 1PPZA 1QIXB 2PSYA 5GNDA 1LKBA 3GCHC 3BTHE 3RMMH 4GSOA 4X2WA 5GDSH 3SV9A 1A5HA 2J95A 3P8GA 3KQDA 3QX5H 1K28D 2XCNA 2GX4A 4YTAA 1FPCH 1JOUB 4QT8C 4ISIH 5HM9A 1T8MA 1DPOA 3LC3A 1C5YB 1RJXB 4TT3D 4IN2A 2GT7A 1B5GH 3RC4A 1C2GA 1O3OA 1WBGB 1GMHF 1C4Y2 1C1TA 1SL3A 1T8LA 1DLEA 5GCHG 1RTKA 5EW2H 1P9SA 3BIVH 1IOEA 1SQOA 2WPLS 2RA0A 4RKOB 2BOHB 4NIWA 1Z7KA 4IMZA 5GIBA 4CHAB 1GMDF 3WY8A 3QWCH 4UFEH 4XBDA 1P57B 1GI3A 1O3JA 4CH8B 1O3FA 1A3EH 3K65B 1NS3A 2F83A 4AYYB 1YPHE 3PLKA 2FI5E 3RXAA 5JPMH 3FZDA 1PPFE 1MKWK 8ESTE 1A46H 3TLOA 1LVBA 1IQHA 2VB0A 4X1QU 1OYQA 2BY6X 1AB9C 4Q7XA 1IQGA 2FOFA 3RXLA 1MAXA 3KQ5A 2Z9LA 4O9VA 2L6OA 5T1VA 3HKIB 1S82A 2EI8A 3IWMA 1C1RA 1D3QB 5CHAB 1YLDA 1IQKA 5A8XA 2Y5FA 5DJ7A 1XUIA 2OQ5A 3LKWA 4FUIA 1ORFA 4BNRA 1V2RT 1DX5M 4OS6A 1WDIA 3NRLA 1ELFA 1GCTB 1NRNH 1AE5A 1FXYA 3SGAE 3BTTE 1M9UA 2LP6A 4FUDA 3RDZA 2Z9KA 2UUYA 1HRTH 1KLIH 1NFYA 2FX6A 3CNRA 1BQYA 2W6JD 1ZGVA 1AWHB 5LPFA 1VJAU 1C5UA 1GL0E 2NU1E 4B71A 7LPRA 2UUFB 4TYDA 4YLUA 2A5IA 3SBKA 4WF8A 1O3LA 2AMQA 4U32A 1K1PA 1TIOA 4F49A 1V2KT 1ZPCA 2WZQA 3M7TA 4AX9H 4Y71A 1PQ7A 3HPTB 4ASUD 1NM6A 1ZMNA 1INCA 1GJDB 1YPJH 2V6NA 5B6OA 1KMHB 1EXFA 1Y59T 3LT3A 3ZZ3A 1XUFA 1LHCH 1WTHD 1UTPA 1XUGA 1A4WH 3KEEA 2EA3A 4WH8A 1BBRK 4IS5A 1UTNA 2ZCKP 1V2TT 3O8BA 2R3UA 1FJSA 4SGBE 1D3TB 1GMCF 1N6XA 4JK5A 3TITA 1CU1A 4LXBH 2AS9A 1ZR0A 1C5XB 2J4IA 1HLTH 1TPOA 1ETTH 3SZEA 2CN0H 2ZPRA 1TBZH 3E91A 1YBWA 1O32A 3SNBA 1C4V2 4MPWA 2NWNA 4FUHA 2FYRA 5AHGH 2IPQX 5BRRE 1GI2A 1KLJH 3SQEE 3LJJA 4INKA 5L30H 1W3CA 1C2HA 2KAIA 4ABFA 1EATA 1GHVH 1MTVA 3FAOA 2YOLA 4BTTB 3JZ1B 1DDJA 4IGDA 3ZVDA 4D9QA 3M3TA 1JBUH 2AHME 1CT0E 1PPHE 1QB1A 3TJVA 1YP9A 3C27B 1D3PB 1TRMA 2HPQH 1HXFH 3BTKE 2R0KA 4UFGH 2PLXA 1SGDE 2BD3A 1SLVB 4K1SA 4O03A 1QJ1B 1DVAH 3MU8A 3RXQA 2WINI 4D7GA 4MNXA 3F9GA 3B8JA 4DIIH 4ZKRU 4HTCH 2QF3A 1TRNA 4BAHB 1NRSH 5JDUB 1IHSH 1OKXA 4DT4A 4D8NA 1EPTB 1O34A 4IBLH 1JIMA 2D2DA 3ZV9A 2QF5A 2ZFFH 3RUOA 1C5LH 3GYMA 3I78A 2FM2A 3TVJB 2GDEH 3URCA 2G00A 2AEIH 1Z6JH 4JZ1A 3P8OA 3ENSB 1NTPA 1P10A 2ALVA 3CENA 1GJ4H 4K60A 1SGPE 2EY4C 2G4UA 3NCLA 2RG3A 2Z94A 1DWDH 3RM0H 2ODPA 3GY2A 3ATIA 1AUTC 1MKXK 2A7CA 1CBWB 3SV7A 1GMHG 1ELBA 3A80A 4RN6A 3ATMA 3K2UA 4ISOA 2NU4E 1OWKA 4U01A 1A7SA 4GHQA 1QCPA 2CF8H 1Y3WA 2LPRA 3AW1A 3KQBA 4J2YB 1GMDG 1OX1A 2VH6A 4E06H 1YCPH 4BANB 1ZOMA 2VNTA 2PR3A 1QNJA 1FN8A 3TPIZ 2PTCE 1AFQB 4UFDH 3A7WA 2GCTC 4B1TA 2O9QA 1DOJA 1LHDH 2LNCA 3ZV8A 1F5RA 2Z9IA 2VIWA 4XD7D 3OYPA 2GZ8A 3RLWH 2Y81A 3KHVA 2G5NA 3S9CA 3O8DA 3EDXB 3OEED 1NBMD 3V0XA 1HYLA 2AGIX 1EB2A 1MD7A 5C20A 2FPZA 3QZQA 2JH5D 4A6LA 5DP8A 1P0SH 3SZNA 1BMLA 1GVKB 3P70B 4KTSA 1O2UA 3FO8D 3S0NA 3V13A 3QN7A 1UTLM 5T6DA 3ZYDA 2UWLA 4AFUA 3LIWA 1TOCB 1UHBB 2QXGA 4YLQH 2D26C 1S84A 1SPJA 1NROH 1EAWA 4BXWA 2FOAA 4FUGA 3VB7A 1THPB 3A8CA 2WV9A 4K2YA 2H9TH 1VITF 3W1EA 1J8AA 5F53A 3NK8A 4I8JA 1H9LB 1CHOG 5BPEA 2TRMA 3QTVH 3SU1A 2P95A 2NU3E 1SGYE 3GICB 1ARBA 1TQ7B 1EB1H 1QTFA 1ZHPA 1NU9A 3ZVBA 2UUKB 2B5TB 4X6MA 2GCHF 1T4VH 1NBME 5EXNA 2P3FH 1XXFA 1SB1H 3RXSA 1QQUA 1K1LA 3GCNA 3LGUA 2BD9A 4F48B 2FOBA 1KTTB 3PMAB 1BA8B 3UTUH 3SW2B 1MMJN 3UQOA 4X8VH 1F0SA 1K0HA 1O35A 3FZZA 1QHRB 1FV9A 1DM4B 5EXLA 5DPAA 2BLOA 1HJAB 5T6GA 4XSKU 5KEDA 2ZU5A 2VIQA 4ZXYH 1OOKB 1EP6A 4FETA 3W94A 4O3TA 4GCHF 1P01A 2A32A 1WCZA 2BLQA 3D23A 3ZZ9A 3TU7H 1O0DH 4NIYA 2ZKSA 5JBBS 4ABDA 1C2KA 1CE5A 2BDYA 3RXBA 2JETB 3PO1B 3UIRA 3T25A 3RLYH 3A89A 2ZGCA 3ESTA 2WPDD 1TA2A 2PV9B 2O8UA 2PWXA 1DWCH 2JIZD 1TB6H 2Z9JA 1E37B 2W6ID 1O2MA 4Y76A 3SV6A 1HIAA 1CA0C 3V12A 4H6SB 1EOJA 5DP4A 1KXCA 3LGTA 1OP2A 5EQRA 3NUMA 1T31A 5A09A 5HM2A 4MVNA 3GISB 1UTJA 4JZEH 2R2MB 4MPVA 1O5AB 1TE0A 2SGEE 1AMHA 1HAIH 4UFFH 2ZFRH 4MTBA 3O8CA 2GD4B 1GBLA 1IQIA 4NWLA 2D1JA 3RXUA 2BLVA 3ZIAD 2K8IA 3A86A 4Q7ZA 1WOFA 1P2MA 2NU0E 1BTXA 1XVMA 4CRFA 4DVAU 2J94A 2QV1A 1AKSA 1SLXB 4ZH8A 3TK5A 3VB4A 3WWFA 1GHZA 2GP9B 3DSGA 3NXPA 2WPHS 3U98H 1LDTT 1Q3XA 2JJ1D 2G52A 2UUJB 3ODDA 4I8GA 4M7GA 4LZ1H 2HRVA 3K6ZA 4SGAE 3EA9A 3KGPA 1TNIA 1O2QA 1RRKA 4WY3A 4CHAC 3D62A 2FOHA 4NIXA 1FIWA 5F8TA 2ZGJA 3OY6U 3TIUA 1BRUP 1YPLH 3ZZDA 1AVWA 1OS8A 2Z7FE 3RXRA 3MQKC 4AGJA 5HYOA 1A5IA 2ZU4A 1BUIA 1AVGH 2XBVA 5A0CA 3QUMP 3CS0A 4ZHAA 3DT0H 1ZTKA 3N7DA 4IMQA 3M7UA 1MUEB 4TPYA 3T29A 1NO9H 1DY9A 1G36A 3HGPA 4MNWA 3GCTG 3SU3A 4B2BA 1S85A 1QBOA 4H6TA 1O33A 1UW7A 2ZA5A 3PTBA 1TMBH 3RXFA 4MPUA 1RIWB 3SI4H 1GBHA 4ASHA 2A45B 3KF2A 1BMFD 4CRCA 1C2MA 5CHAC 2PKAB 1ESTA 4FUJA 4X6OA 1V2OT 2F91A 2Z3CA 2AFQB 4X0WU 1FN6A 5KGOA 1DT2A 2GMTC 3A81A 2PUXB 1NESE 1ID5H 1JXPA 2F9NA 5E0JA 1OXGA 1IQFA 1XXDA 3H7TA 4XRNA 1EASA 3UWJH 1GCTC 3M5OA 2SGQE 2A7JA 1NRQH 1O3NA 3P92A 2CV3A 4K8YA 4U30A 4GAWA 3HK3B 1P2QA 3ZYEA 1DXWA 2ZDLA 4TY7A 1O3AA 2VVVA 3OAAD 4H42U 1ESAA 4I8KA 4Y10E 1GCDA 4LK4A 2HLCA 3SJIA 1VITG 4NFFA 1XKBC 3PROA 1C1SA 1LPZB 3UAIC 2ZHDA 5EIYA 1EQ9A 1VCPA 3A88A 1TQ0B 1QR3E 1BDAA 3CS7A 3A8DA 1O30A 1TBQH 1BHXB 3F0OA 3GS9A 1V2MT 1QY6A 3QZRA 3MNCA 1TPPA 3T62A 3A7YA 1BOQA 3F1SB 1P3CA 4JZIA 3GY6A 9LPRA 2IN2A 2BD5A 3A7VA 4X6NA 1QL8A 1P2OA 1YPEH 3SU0A 2FYQA 2OD3B 3KL6A 5DP9A 1S0RA 2HGTH 2PSXA 2XTTB 3ODFA 1OWHA 1LTOA 1ZJKA 3PRBA 1BTUA 3RP2A 2HNTC 1S5SA 2ZGBH 1WUNH 6GCHF 5ETXA 1C5RA 1O5FH 4IC5A 2EQNA 9ESTA
chains in the Genus database with same CATH topology
2XBYA 1XVOA 4WJG2 2P16A 3UOUA 1Z1IA 1O3MA 1H8IH 1RS0A 1A3BH 1AY6H 1C1OA 2CGAA 1GI7B 3BSQA 5JB8S 1W11U 5A2MH 4K5ZA 1SLWB 1Y5AT 1T32A 1MTWA 1UCYK 2F9UA 1ELCA 1O2JA 1LVMA 5EQQA 1P2JA 1GPZA 4YM9A 1KDQA 1WU1A 3A85A 4NGAH 3NKKA 2TGDA 1CQQA 3FP7E 2XBXA 8KME2 5HXFA 3M5NA 1W7XH 3SV2H 4AG2A 2AH4X 4FUFA 2EI7A 4O97A 3SJOA 5IDKA 2ASUB 3D65E 1L4ZA 1GJCB 2WPKS 5CMXH 3E0NB 3GY5A 1PYTD 2Y5HA 4FVBA 4JYUH 4Y8XA 1JRTA 1EOLA 5A8YA 1H1BA 4Y79A 5GXPA 1E0FD 4MPXA 2J9NA 4NZLA 1HGTH 1YGCH 1QBNA 1GI8B 2Q6FA 1YPGH 2V0BA 1O3KA 4O3UA 2BD7A 1C9TA 1C2JA 1QJ6B 2BYAX 3P95A 2AMPA 1K22H 1LQEA 4D9RA 1C1PA 2F9PA 4NFEA 3E1XB 2SFAA 4OS4A 3DFJA 2A5KA 1AFQC 4Y8ZA 5EPNA 1TALA 1J16A 3TJUA 3VGCB 1DSTA 5DG6A 3SGQE 3M3VA 3T2NA 1IQLA 4BTIB 1IQJA 4INLA 3EE0B 1AUJA 3SU6A 5JBCS 3C1KA 4FVDA 1GBMA 4DGJA 3KQCA 1FLEE 2C4FH 2P3UB 5AVDA 1AWFH 1K1OA 3MO6A 3GY3A 3EYDA 1DWEH 3BEFB 3KIDU 1BTHH 4MNVA 1SLUB 4X8SH 1P05A 1V2WT 4UE7H 1U6QA 3T5FH 4ABIA 1Q2WA 4B76A 4Y8YA 1LQDB 2GDDA 2FIRH 3T27A 1ZGIA 1FY5A 1DY8A 1GHBG 1MKWH 1HV7A 1O5EH 4B2AA 3P8FA 1HUTH 2OC8A 2JH0D 1CVWH 1HBTH 5E0GA 4BAKB 4Y6DA 4YESB 1F7ZA 1LHGH 1LKAA 1W0ZU 4AB9A 2Y80A 2CJIA 1PYTC 1GJ6A 2C8ZB 2BX3A 3AAVA 1K2I1 3SHAH 1O3HA 3RXPA 1DUEA 1ZRKA 2FESH 2W7SA 8LPRA 4KTUA 1LVYA 2HOBA 2XCFA 3VPKA 1MBMA 2UWPA 4FUBA 1EKBB 4WMDA 2IOTA 2FDAA 3DUXH 2ZO3H 5GWZA 1TX8A 3SJ8A 5FPTA 4BAMB 2OINA 2UWOA 2CXVA 2R9PA 1O3CA 3PV4A 2XC5A 1T4UH 1ZSKA 1QQ4A 2ZHWH 1FONA 3S69A 1AIXH 2C8WB 2BDHA 1EJAA 1P12E 3A83A 3PMJA 2YNAA 4WMFA 2ZQ1A 2DE8A 2Z3DA 4Y0YE 1SR5C 1O5GH 2OCVB 1TABE 1HJAC 3PMBB 1O2TA 2ZU2A 2QA9E 2VH0A 1JWTA 1BTWA 1UHBA 1MCVA 1CGHA 2H9HA 5EGMA 3SNDA 3A87A 7GCHG 4FUCA 1W2KH 2JETC 3PO1C 5K0HA 1ANBA 1P9UA 3LPRA 3MHWU 4AFSA 1F0TA 1TLDA 5C5NA 3T28A 4NZQA 4VGCB 3QDZB 1C5SA 3TJOA 1BBRH 4X1SU 2XRCA 4TY6A 1HAPH 1C2FA 1GBBA 1O3EA 2FI4E 1HAHH 2W3KA 4NA8A 2TGTA 1LVOA 4Q80A 5F8ZA 3U8OH 1AZ8A 2SGAA 1A2CH 1AE8H 2BY5X 1O2KA 3QGJA 4CBOA 4DJZB 4ZMAH 1BMMH 2ANMH 2SNVA 3QK1A 2PKSC 1Y5BT 3TGJE 3AASA 2QYIA 4ABEA 1ANCA 1VGCC 1ACBE 1TPSA 1A0LA 1C1MA 3SI3H 3MH6A 3TH2H 1G3EA 4XFQA 1BTPA 2BD8A 4A1TA 4ABGA 2ZNKH 4TWWA 1MQ5A 4HI3A 3SJ9A 2VWLA 1P06A 1ZPZA 2B0FA 1EJMA 3MO3A 2QXJA 3TNSA 1O3BA 2GV6A 5FX6A 4WVPE 2OXSA 1TWXB 1ETRH 1SGTA 2RDLA 1DWBH 3HKJB 2WV4A 1EJNA 1IAUA 3H7OA 3GY4A 3E0PB 3R0FA 3NWUA 2BM2A 3G01A 3E3TA 2ZCHP 2WPIS 1SSXA 1Z8IB 3KQEA 1P2KA 1OWEA 4K1EA 1A0HB 1N1LA 4FU8A 2G81E 1C5QA 2HWLB 1TGSZ 1NU7B 5FHTA 2BTCE 1TGBA 2GKVE 2D8WA 2V3OH 5E8EH 1AN1E 4JZDH 4GLYA 1P8VC 5GPIB 1ZMJA 5FXLA 1RIWC 1LPKB 5EPYA 1S6FA 1MKXH 4CRGA 1O5CB 3S9AA 4DCDA 2BLWA 1KXAA 1BJUA 1RXPA 1QL7A 1GGDB 1FIZA 3E8LA 3KNXA 3MU1A 3UY9A 6CHAC 1ZRBA 1IQEA 1PPEE 2FLBH 1XMNB 1UK2A 2QC2A 5EODA 1K9OE 3A8AA 3OU0A 1XUHA 3STIA 2PUQH 3SNEA 4INHA 2AIPA 2Z9GA 5E2OA 2NU2E 4X1NU 4AB8A 2BXTH 1ZMLA 2PHBA 2HPPH 3MU5A 3TNTA 1FMGA 4I8HA 1V3XA 3SQHE 1O2NA 5H4IB 2Y6TA 4Y11E 2I6SA 1C1NA 6LPRA 5FX5A 3ZZAA 1J9CH 2TIOA 1SGFG 2HNTF 3E90B 5F03A 4UEHH 1W8BH 4AYVB 3VFEA 1DANH 2CHAC 1GDUA 1O5BB 3LONA 1GDQA 3SNAA 5EG4A 2A4OA 1UVTH 1PPGE 1PPBH 1ELVA 1GBIA 1N8OB 1GMCG 2PFEA 2ZCLP 2W7UA 3A82A 4Y7AA 2A2QH 3P6ZB 3E16B 1MTSA 2ZDKA 1P03A 3TK6A 1SQTA 1MZAA 2ZDAH 4E05H 3GYLB 4JCNA 2ZGHA 1D4PB 5DO4H 2STAE 4B73A 1SMFE 1ZTLA 3UWIA 2F9VA 1MBQA 4IC6A 1GHYH 2Y82A 3L3TA 3ATWA 3F68H 1C5OH 3SUFA 1RTLA 4MG3A 3RMNH 1YC0A 4A7IB 2QGRA 2BDAA 5GJ4B 4XBCA 4WH6A 3A8BA 1CT4E 4AOQA 2O8WA 4GVUA 3BTWE 1A1RA 1BRBE 3UREA 1A61H 5L2ZH 2J38A 2FS8A 2VWMA 3F9FA 4RKJB 3MH7A 5SGAE 2EC9H 1GJ9B 4ZUHA 8GCHF 5DP6A 3ZZ6A 3GY8A 2YNBA 1ELEE 1VR1H 2V3HH 2JKHA 3PTNA 4ABBA 4OGXA 1NPMA 4R0IA 3W95A 3EGKH 3ZVCA 1EAUA 2P8OB 4E7RG 4YOGA 4B74A 1NFXA 1Y3XA 3FP6E 4Z6AH 3FANA 3OSYA 4YT7H 1FNIA 2XBWA 2FX4A 3SV8A 5C67A 3A7ZA 1MCTA 4PROA 1ABJH 1MTUA 1QRWA 2ZPSA 1RGQA 2XC0A 5L2YH 1BIOA 1FY1A 1GJAB 1GJBB 2FS9A 4Z0KA 5JB9S 2FOMB 3ATKA 2WUCA 1S6HA 2B8OH 4HFPB 1KXBA 3Q3YA 4BAOB 1CGIE 4KGAA 1G2MA 1B7XB 1GBCA 4MLFB 4CH2B 3JZ2B 3EAJA 3BIUH 1C5MD 1ZLRA 4LOYH 1KXEA 3M5LA 4NA7A 2A31A 3RXCA 3MNXA 4AFZA 4I31A 1B0EA 1MZDA 1TX7A 4WMEA 2VIDA 3PLBA 2P93A 1GVZA 2DUCA 2ZQ2A 1O36A 1GWAA 4KTCA 1PFXC 2A0QB 2M5TA 3SUEA 1EX3A 2H5DA 2ZTXA 3GCOA 1BB0B 3MO9A 4ZAEA 3MH4A 2GGVB 2BQ6B 4DURA 1H8DH 3V7TA 1UK3A 4ZXXH 3M37A 2OBOA 3RU4T 2FTLE 4U2WA 3SJKA 1SOTA 2ZIQH 3ATLA 2ANYA 2FMJA 1UVPA 2XWAA 3Q3XA 1F5LA 2BVRH 1L1NA 2BD4A 2XWBI 3FP8E 1J14A 4Y7BA 1FDPA 5EXMA 2PTNA 2FTMA 5C1XA 3SU2A 3UNRA 5DKMA 1A0JA 3QLPH 2CMYA 1GDNA 1DSUA 2ZWLH 1HAGE 3AW0A 4ZKNU 3U1IB 3UNQA 3RC5A 1L1GA 2FOGA 2PW8H 1SOZA 3P17H 4MDSA 2BHGA 5AF9H 4FU7A 4DOQA 3KN2A 5HGGA 1DS2E 4ISNA 2QAAA 1CSOE 4B2CA 3V3MA 2Z6BD 3HATH 4IN1A 1FPHH 3DFLA 3OTJE 5F6MA 2XNIA 3RU4D 1ABIH 2Y5GA 1XM1A 1LMWB 3QGNB 1CHGA 1GI6A 1L0ZA 1TPAE 1UVUH 2QN5T 1HIAB 4XBBA 4RSPA 4NG9H 3PWCA 4J1YA 5I25A 5C5OA 1Z6EA 2HNTE 2F9BH 1ETSH 2GCHG 3PB1E 2BY9X 1THSH 3VXFH 4AGKA 2Y7XA 1BZXE 1V2QT 1IQMA 1RD3B 2A2XH 4DT7B 1HB0B 3D49H 1KSNA 1NFWA 2XXLA 3MNSA 4TWYA 1YF4A 1C5WB 2BB4A 3UOPA 1G30B 2H9EH 3U8RH 1V2JT 2Y7ZA 2QF0A 1TYNA 3FFGA 4ABJA 3SO3A 3DA9B 5AFZH 3BEIB 1E36B 4CRDA 1O2VA 3GDSA 4BXSA 4GCHG 1BTYA 5FPYA 3MOCA 1BBRE 1TFXA 4ABAA 1FY4A 1SGIB 4OS5A 5LPEA 4CBNA 1UVOA 3RU4E 2BQ7B 4BAQB 2OLGA 5I46H 3RXJA 3K6YA 3M3SA 2ZHFH 1HAVB 3SORA 2K1QA 5TJXA 2EI6A 1SC8U 1ELGA 3URDA 2O8TA 1KY9A 1QBVH 1SGQE 2BVSH 1YCPM 1O2SA 2J34A 1O2ZA 2BY8X 1K1MA 3UUZA 1OP8A 1TNLA 1XKAC 2OTVA 2B9LA 2ZFQH 4GHTA 2O8MA 1EPTC 1QGFA 2ZPQA 2G51A 1G3CA 1P04A 2BOKA 1OP0A 8GCHG 1MTNB 2ULLA 1JRSA 4JK6A 1JMOH 3RXDA 1ZZZA 2GV7A 2H5CA 3ZZBA 3SU5A 2C8YB 3BG4B 1O2XA 3BTGE 1GJ5H 5JYIA 1ELDE 4X8UH 1HJ8A 2HALA 4KKDA 4ZKOU 2VVCA 2SGFE 2AERH 5K7RA 1UTMA 1B0FA 1Z8GA 2Z3EA 1GI5A 3ZVEA 1CBWC 1TNJA 1MU8B 1GL1A 1LHEH 2ALPA 1C5ZB 3EA8A 1O31A 1TAWA 2FOEA 3BTME 3EA7A 4KELA 2ZI2H 3LH3A 5EU8A 3B9FH 2VIOA 2ZFTA 1BCUH 1NC6A 5A0AE 3U8TH 1GHAF 2C90B 1UCYH 1P3EA 2BY7X 1UVSH 1O38A 4MQAA 3U9AH 1THRH 1TA6A 5HMAA 1Y5UT 1EAXA 1EZSC 3AAUA 1PQ5A 1SI5H 4YOIA 5LPRA 1EPTA 4X6PA 1GG6B 4A92A 4F4OC 2I6QA 2AYWA 4BTUB 1W14U 4JZFH 2ODYB 4FXGH 1EZXC 5DP7A 3VXEH 2VGCB 4Y0ZE 1H9HE 1KTSB 4I32A 4MNYA 3ITIA 1IHTH 1EP5A 1EZQA 2ZECA 3M35A 5EOKA 1AHTH 4OS2A 1OWIA 1C5PA 4JMYA 2ODQA 4I7YH 1SHHB 1GGDC 1KYNA 5TCCA 1QA0A 2SGDE 3I29A 5E2PA 1Y3VA 1YPHC 3K9XB 2ZTYA 2Q1JA 3LGWA 2GMTB 4CREA 3S7HB 4A1VA 1KLTA 2WUBA 4ISLA 3A7TA 3OY5U 1BMAA 1K1IA 1BHXF 1UO6A 3SNCA 3ELAH 1UMAH 1FAXA 4X8TH 2BMGB 1WQVH 2IJOB 4NSVA 1TX6A 1CGJE 1UK4A 1CHOF 1K1NA 1NRRH 5PTPA 2ZHQH 1C5NH 3STJA 4D7FA 2P94A 1NRPH 1GVLA 1TGNA 2QXHA 3LDXH 3DHKH 4AG1A 1VITH 1SG8B 2F9OA 4WXVA 1SFQB 3LJOA 1SGCA 1XUJA 4I8LA 1O2GH 2H1UA 3NZIA 1F92A 1W0YH 1YPKH 4E7NA 3RMOH 2WYJA 5F8XA 1TMTH 2GZ9A 1DE7H 1H4WA 1BJVA 5L6NH 5C1YA 1N8OC 1P09A 1KDQB 1OPHB 1WSSH 1WYKA 3M36A 2A4RA 4HZHA 2GZ7A 3MWIU 4UDWH 5ESBA 3UFAA 2IPHA 3UNSA 4A5TS 6ESTA 5C2ZA 1Z8RA 3ZZ4A 2ZFSA 7ESTE 2BDCA 1VJ9U 1O3DA 1SFIA 5JBAS 2QY0B 1FY3A 1P2NA 3ZVAA 1NT1A 1AU8A 1WAYB 3S9BA 2G8TA 1P2IA 2ZC9H 3BG8A 4X1RU 1O5DH 2VIVA 1ELTA 3TH3H 2QXIA 3BEUA 1BRAA 3UPEA 2FLRH 6GCHG 3UR6A 3ZZCA 1W10U 3BTEE 1WTGH 4NSYA 1LHFH 3PM3A 1BRCE 4KP0A 2BZAA 4NA9H 3SN8A 1JIRA 5FBEA 2O8LA 1KXDA 3Q00A 1N6YA 1MQ6A 4XOJA 1NY22 3R3GB 1TBRH 1C4U2 3M61U 4HGCA 1DXPA 1VCQA 1C1QA 1G3BA 3HK6B 1DUAA 2P8OC 2GVFA 3BTQE 1YCPK 3GCHB 3O8RA 1YYY1 1O3GA 1E35B 2XYAA 4ESTE 5TCAA 1GJ7B 3BV9B 7KMEH 1QL9A 3PWBA 4NWKA 2ZF0H 4LZ4B 3QO6A 5C1UA 2ESTE 2FXRA 1OWDA 2BZ6H 2G4TA 3KCGH 1KIGH 1NN6A 4AFQA 3MH5A 1TGTA 4YZUA 3VB3A 1HAYB 1RTFB 1MD8A 1FQ3A 1YPMH 2C93B 3BTFE 3LOXA 1GBDA 1D6RA 3TK9A 2BD2A 4DG4A 3ZZ8A 5FAHA 2P59A 2R3YA 1AGJA 1S83A 1AD8H 1QURH 4R8TB 4ZROA 1W13U 4ZKSU 1GHAG 5DP5A 1HCGA 1L1JA 2FODA 4JYVH 2QIQA 4K1TA 3ZZ7A 3QTOH 2FWWA 3LGIA 2AGEX 2H6MA 1DITH 1AB9B 4DY7B 1E34B 3GCTF 1F2SE 2GTBA 2XW9A 2VWOA 5E0HA 4CR9A 1ZYOA 1A5GH 1BTZA 3OX7U 4YOJA 3LGVA 1HNEE 3GDVA 3U69H 4D76A 3U1JB 3SUGA 3SGBE 4AZ2B 5IYTA 1D9IA 1GI1A 1HXEH 1HPGA 1NFUA 3PYHA 1VZQH 3AVZA 3TH4H 4Q2KA 2A4GA 2Q6DA 2ILNA