1SGCA

The 1.8 angstroms structure of the complex between chymostatin and streptomyces griseus protease a. a model for serine protease catalytic tetrahedral intermediates
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE A
publication title The 1.8 A structure of the complex between chymostatin and Streptomyces griseus protease A. A model for serine protease catalytic tetrahedral intermediates.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1986-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgcA01
5EW1H 4AFQA 2FO9A 1N8OC 2AMDA 2IOTA 2BVXH 3S7KB 1O2JA 1GI0A 2ZFQH 2BD3A 1DVAH 1GI9B 1OWDA 3PV4A 4MDSA 3RXAA 4BXSA 1BMAA 1H8DH 1QURH 3E8LA 1TNGA 5DK1A 3S0NA 3O8CA 1MAXA 2P95A 1EZXC 3FFGA 1TQ7B 3HPTB 3ZZBA 3SORA 3FP6E 3LC5A 1SGYE 2BY7X 5E2PA 1IQEA 1SGDE 4X1QU 1A2CH 3ZVEA 2SGDE 2B0FA 3KCGH 1AFQB 1DFPA 2A45B 5L6NH 2Y5HA 2F9OA 1CT0E 1FY1A 1C1MA 2A0QB 3RP2A 5T3HA 3GISB 1VJAU 1UHBA 4D9RA 4FUCA 1GMHG 3A7YA 3P70B 4MPWA 1A4WH 1GVZA 8ESTE 3ITIA 3BEIB 2ZQ1A 1G3EA 2A7HA 1VITG 2BD5A 5T6DA 3MO3A 2FTLE 1RTKA 3SQEE 1O3LA 4TWWA 2PR3A 4MNYA 3CP7A 4UFDH 5FHTA 1GGDB 2JH0D 4HZHA 3TNTA 1TA2A 1Y5BT 3DA9B 2QY0B 1IQLA 2FI5E 1VZQH 4MNWA 1O2VA 4FUHA 3KN2A 3U98H 1L1JA 1P01A 2ZHDA 3CENA 1G30B 1G36A 4IN1A 5A0CA 1C5PA 1CO7E 2IJOB 1RXPA 2CHAC 3GDUA 2ZHFH 1XVOA 4UE7H 5E0GA 5FCKA 4OGXA 1KSNA 1ETRH 3AVZA 2QXHA 2SGEE 1HJ8A 1TRNA 3VEQB 3MU0A 3ZYEA 3M61U 2ILNA 5E8EH 4UFEH 4MNVA 1F7ZA 3P8GA 4MPXA 1GI7B 2ZNKH 2A5IA 2CN0H 1SMFE 3VB4A 1GHBF 3UNSA 1QTFA 4AX9H 4K60A 3HK6B 4X8UH 1ETSH 2WPIS 4FUDA 2OTVA 3A82A 2H9EH 2PGBB 4B2CA 2XC5A 5F6MA 1O2MA 4ZKSU 1A3BH 1TNLA 2BMGB 1IQJA 1H9LB 3RXVA 3DD2H 1UVOA 1FPHH 7LPRA 1YCPK 2GD4B 3SU6A 3SU2A 1XKBC 1EJMA 3RXOA 1FV9A 1A7SA 4YLQH 1N8OB 3A86A 1WTHD 5EW2H 1FNIA 4MNXA 1SI5H 2FM2A 1YLCA 2BLWA 3U8RH 3PLKA 1AKSA 1YYY1 2KAIB 1TQ0B 2FXRA 3ZZDA 2FI4E 2JH5D 2A4GA 2ODQA 4DY7B 1TFXA 3QGJA 2TRMA 3GDVA 1H8IH 4TYDA 1CT4E 1FMGA 2HWLB 3NKKA 1GJDB 4YM9A 2BD8A 4K69A 3P92A 1LHFH 2ODPA 1EASA 2D1JA 2G4UA 2GKVE 3EQ0H 1BMLA 2ZO3H 1SSXA 1P2NA 5HGGA 1Y8TA 2W3KA 1GMDG 2Z7FE 4LXBH 1F5KU 1EXFA 1FXYA 1YPLH 1MAYA 4ABAA 3S9CA 4AYVB 4A5TS 2TGPZ 3ZVAA 1PFXC 2WUCA 2H9HA 3K6YA 1W2KH 2Z3DA 1IQIA 4ASHA 3MFJA 1LVBA 3RDZA 1E35B 2UUKB 1C5SA 1AO5A 4Y7AA 2FWWA 2ZU2A 1MZAA 1NFYA 4FUJA 4Y0YE 5AF9H 3IITA 1LO6A 1ZTJA 4BANB 4YESB 3H7TA 2BTCE 4ISIH 3D49H 1TGTA 3P95A 3TJOA 1HAZB 2PKSC 2D8WA 3EAJA 1DUEA 3GCHC 4GCHG 3SJ9A 3OSYA 3HGPA 1ORFA 1AI8H 2CHAB 4B1TA 4TPIZ 4X6PA 4K1EA 1SB1H 2HPQH 3SI4H 3WY8A 2Q6FA 1NRSH 4KKDA 3M5NA 1YGCH 4F49A 1RRKA 3B8JA 1AB9C 1MU8B 3VXFH 2FYRA 2ZDNA 4JYTA 1QA0A 4XSKU 1GJ8B 1A0JA 2ZDKA 1NM6A 2ZGJA 1W0ZU 1GMHF 2Z9GA 1ETTH 3ZVCA 1J9CH 1CGIE 2FZZA 3W95A 1CQQA 4GSOA 1XXFA 3LONA 1NFXA 3B9FH 1TBRH 4I31A 4CRGA 3S7HB 4FUGA 3DFJA 1BTZA 5GIBA 2Z9JA 4Y79A 3PMJA 3UREA 3QWCH 1UTKA 2EI8A 1O2XA 3MNXA 4K1TA 1UCYH 2BVRH 1SGRE 2PTCE 3KHVA 4IGDA 4A1TA 2SGPE 3ZZAA 1AE8H 1BBRK 2G5NA 5L2ZH 2J34A 1HAVA 2OBQA 5GDSH 1SQTA 3BF6H 1D3PB 1KDQA 1MKXH 1SGTA 4X1RU 5GCHG 1WBGB 3GCTG 1S83A 3ATIA 2P3TB 1TLDA 2VH0A 1GBLA 3TH2H 4O9VA 3BTHE 1FI8A 2HOBA 1CU1A 1GHYH 2R3YA 4HI3A 4BXWA 1VGCC 2ZCKP 3TK6A 4YT7H 1T8NA 1O3CA 3O8RA 4TPYA 1GBEA 2C8ZB 8KME2 1KLTA 1H1BA 4ZKOU 1W10U 1QL8A 1ZMNA 1QB9A 1WOFA 5T6GA 1GI4A 1IAUA 3GY3A 1O2LA 2FS8A 3BTEE 1ABJH 1S85A 3URDA 1C1QA 1C1TA 1LQDB 2O8WA 2BY9X 1A5IA 1P2JA 5DGJA 1W7GH 4AYYB 5HM9A 1XXDA 1PJPA 4J1YA 2R2MB 3C1KA 1BMMH 1ZRKA 1C9TA 4A92A 4KP0A 1KXAA 3GY7A 1TPOA 1SVPA 2CXVA 2OC1A 2BX4A 2PKSB 1VITH 3A7ZA 2YOLA 3GCHB 2F3CE 1QIXB 2TBSA 2ZFRH 3SGQE 2QC2A 1HNEE 3A8AA 1O5CB 4HGCA 5DKMA 2A5KA 3FZDA 4TY7A 1KXFA 1T32A 3PWBA 4NZLA 2SNVA 1BTYA 4CRDA 5DP7A 4M7GA 5CMXH 1S0QA 1AB9B 4U30A 3RU4D 9ESTA 4RN6A 1GMDF 4ABJA 1RJXB 5HM2A 1MTNC 1P2KA 1V2UT 4CRFA 1Y3UA 5FBEA 2ZHWH 7KMEH 2C8WB 2H2ZA 4WMEA 3SZNA 1H9IE 1DPOA 2OC8A 1GCDA 1TNIA 2VIDA 1DOJA 5A0AE 1DICA 1YKTA 2P3FH 3TJUA 3GOVB 3PMBB 4UDWH 1B5GH 3UR6A 2PUQH 1TE0A 1IQKA 2ZF0H 4UD9H 2ZU5A 3A7WA 1JMOH 1O2QA 5EODA 1XUHA 1FLEE 2ZPSA 2Z9IA 1UVSH 2XWAA 4CR5A 1TGCA 1AUJA 1QRWA 3OU0A 1C2GA 2ZWLH 3K2UA 1W12U 2PSYA 1DSUA 4AOQA 5BPEA 1HXEH 3M3SA 7ESTE 4D76A 1T7CA 1UJ1A 3CS7A 3LIWA 1INCA 1SFIA 1FAKH 1KIGH 2BDIA 1FDPA 1PYTC 2HVXA 1Z6EA 1LQEA 1SGCA 3RU4E 3SU5A 4MPVA 3LJOA 2QA9E 2QF3A 4BTUB 1QNJA 1GBFA 1AIXH 1GJ9B 4KTUA 1VGCB 2THFB 4H4FA 1ZOMA 3MU5A 1AZZA 2ZGCA 1O31A 2A7CA 2RG3A 2P93A 4DT7B 2XBVA 1EZSC 1JBUH 1TAWA 4JZDH 3EGKH 1VCPA 2ZQ2A 3RXHA 1TOCB 2CMYA 4DJZB 4GLYA 3UUZA 4ABDA 1PPFE 4NG9H 5C2ZA 5FCRA 1C2JA 1GG6C 1O3OA 3M35A 1GBAA 1KLJH 2Y5GA 1QJ7B 1BOQA 3BSQA 3LJJA 5C5NA 5FX5A 4H42U 1O3FA 3DUXH 5T6FA 3I77A 2W5EA 2XCFA 4O3TA 2FYQA 3RLWH 2GMTC 1PPGE 2ZDLA 1O3DA 1BJVA 3URCA 2AIQA 4OS6A 2FLRH 8LPRA 5SGAE 4D7GA 1PPBH 1UTMA 2RDLA 4B74A 1AVGH 1BZXE 4X2XA 1XX9A 4UFGH 4GUXA 3QX5H 1ZTLA 4I7YH 4AORA 2HPPH 5C67A 4AB9A 1GHBG 1P10A 4JK6A 1CVWH 1OP8A 4SGAE 3ATKA 4D7FA 3BTGE 2VWLA 4B75A 1HV7A 2RA3A 3T2NA 4WWYA 2A31A 1G3DA 4A7IB 4NWLA 3E0NB 4I32A 3U8OH 1MTNB 2GCTC 4O3UA 1V2RT 1O2PA 3PB1E 5EQQA 4ABFA 2AMQA 4WVPE 1DM4B 1MD8A 2CGAA 1GBKA 3VB7A 3RM2H 5C1UA 5DP3A 5FBIA 1FAXA 2B9LA 3QTVH 4Y71A 1KTTB 2Z9KA 1GBBA 2HNTE 1SGFA 1B0FA 1O2NA 3AW0A 1TB6H 2ZU1A 4IMZA 5FXLA 3TH4H 1XUGA 1O2YA 4ABEA 1HAIH 1Q3XA 1ZGVA 2ZHEH 1P2OA 1GJ7B 1RTLA 3SGBE 1TABE 1T8OA 1C5ZB 3RUOA 1K2I1 3M5MA 3PTNA 1XUJA 2D2DA 5LPRA 5EGMA 2Z3EA 1NROH 2ZA5A 3SV6A 3AW1A 1NU9A 1LKAA 2AMPA 1Y3VA 3SNCA 2VVUA 1T31A 1HB0B 2PGQB 3ZZ8A 1JXPA 2QAAA 4A1VA 1V3XA 4WH8A 5DPAA 1S5SA 1C2EA 4BOHA 1AQ7A 1NRQH 1W14U 3MNCA 4INKA 4CR9A 1C9PA 4Y6DA 1C5TA 5I46H 1DLKB 5HMAA 2BY8X 2OP9A 4FVBA 3FP7E 1Y5UT 1Z6JH 3OTJE 1ZPZA 1IHTH 1O2UA 4Z6AH 2QXIA 3DT0H 1YPKH 1C5XB 4X0WU 4B73A 2STAE 3A80A 4FVDA 5IYTA 3ZZ5A 3SU3A 1HJ9A 1GG6B 1EX3A 1A0LA 2ZHQH 3RXDA 2PW8H 2PUXB 4FU8A 2QCYA 4A6LA 2TPIZ 1WCZA 4GHTA 3ZZ4A 3DFLA 4NFEA 5J4QA 1NY22 1L0ZA 3RU4T 1TGSZ 4JK5A 3RXSA 5A8YA 2GMTB 2KAIA 3SBKA 3QDZB 1TOMH 3M7UA 3KIDU 1DY8A 4E7RG 5AHGH 1O5GH 1OYQA 4R0IA 1BJUA 1UK4A 3V13A 1ID5H 3UY9A 3P8NA 1UMAH 5EXLA 2VIQA 1D9IA 5E0HA 1GDNA 1GDUA 1O3NA 1A1RA 5LGOA 3FVFB 1Z71A 3IWMA 4Q2KA 3UFAA 2H9TH 1GJ4H 3EDXB 4I33A 2BD4A 2BLOA 1TIOA 3A83A 2GCTB 2TGTA 8GCHF 5GWZA 3RC4A 4I8GA 1A5GH 1QQUA 1FN8A 3F9EA 1EOLA 2VIWA 5ETXA 4AN7A 1WQSA 3E16B 2AYWA 1C4V2 1J17T 1L1NA 1SLVB 3AASA 1GI3A 1ELAA 1AWHB 4ZKRU 2ZTZA 5DP9A 4ZXXH 6GCHF 2OINA 1G37A 2FTMA 2G51A 3TIUA 1JWTA 4CH2B 1HDTH 3S9AA 2XYAA 1L4DA 1EB2A 2F9NA 1D3DB 1XKAC 1Z1IA 3GYMA 3P6ZB 4D9QA 4X8TH 3SNDA 1C1OA 1XVMA 2XC4A 3NUMA 1IQHA 3ZVBA 2R9PA 1O2KA 1GMCG 1EUFA 1O3GA 4FU7A 2ZC9H 1RS0A 1GI5A 2UWPA 2G8TA 5PTPA 1C5OH 3SJKA 3SNBA 2O8LA 1K1IA 4Y8YA 1W0YH 2BX3A 1MU6B 3ODDA 1GL0E 1G3CA 2AIPA 2FX6A 3BV9B 3TNSA 1SOTA 2I6QA 3ELAH 1Q2WA 2W7SA 1C2LA 2FOCA 1UTQA 2DUCA 2QV1A 1Y59T 4MVNA 1KXBA 1V2QT 1EATA 4ZH8A 4YZUA 2ZGBH 5F8TA 1ZPBA 2VNTA 2HNTF 3N7OA 4BAOB 2XBWA 3BIUH 3K9XB 1MBQA 3TGJE 2A5AA 2GTBA 3VPKA 1J15A 1E37B 1HIAB 4BAKB 1CE5A 4OS1A 4H6TA 1G2LA 5FPTA 1H9HE 2QGRA 4JCNA 2FOBA 3Q76A 4DG4A 2O8UA 3RMNH 2ZFTA 2Q6DA 2WINI 1D3QB 1AWFH 1P02A 1IOEA 1P09A 1BB0B 1TX8A 1FONA 4HTCH 1GL1A 5FAHA 1JRSA 1QFKH 1YPGH 5JBCS 2UUFB 1QBOA 2ZPRA 4WH6A 1EJAA 1MKWH 1JRTA 3ZZ7A 2V3HH 3MWIU 2FODA 2EA3A 1YPJH 1GHAF 3ZVFA 1O3AA 1GHVH 4NSVA 3M7QA 4ABBA 1PQ7A 3MNBA 1AHTH 1SLUB 1MH0A 2VINA 1V2OT 1CHGA 2NU4E 3I29A 4X1NU 3HATH 2VIOA 4THNH 1LTOA 1TPAE 4ABHA 2YNBA 1SGEE 3MHWU 1ESAA 3T5FH 1O38A 1EAWA 2ZDVH 1V2JT 1V2PT 1F92A 2VVCA 1GJAB 1SLXB 5CE1A 1QQ4A 5HYOA 1QJ1B 4AGKA 2GV7A 2FOMB 2ZEBA 1D4PB 1TWXB 2G4TA 3UR9A 5CHAC 1HAOH 2FEQH 4ABGA 2O8MA 4Q80A 4XDEA 2BQ7B 1O34A 1QJ6B 1V2ST 1PPCE 3KQCA 2BD9A 1TNKA 5DJ7A 2VJ1A 1MUEB 2BDGA 3RM0H 1CSOE 1BDAA 4DOQA 1C5UA 5JYIA 3T62A 1EKBB 1ZJKA 2BY5X 3PLPA 1KY9A 4Y11E 2VVVA 4ZUHA 3MOCA 1ZHMA 2CF8H 6CHAC 1O33A 3LDXH 3PLBA 4GAWA 4KTSA 1DWEH 1FY4A 4B2BA 1NT1A 1S6FA 3SOSA 2FI3E 1SG8B 1VCWA 2ZKSA 1UTNA 1XMNB 3M3TA 2BLVA 1OYTH 1C2HA 1SC8U 2GZ8A 2ZTYA 2EEKA 1YPHE 4CHAC 2C3SA 1UTPA 3RC5A 4ZMAH 2PTNA 4X6OA 2FOHA 3GY8A 3ZYDA 1UK3A 1O2OA 2Y5FA 2VWNA 1NS3A 3EE0B 4JZIA 2F91A 1ZHRA 2F83A 3UOUA 4FUBA 2BOHB 4RKJB 1DT2A 2G5VA 2ZFSA 1QR3E 5A2MH 2XCNA 2GDDA 1GI1A 2A2XH 4YOIA 4IS5A 2BDHA 1E36B 1EZQA 4QT8C 2OC0A 2ZGHA 3BTDE 2GX4A 1LVOA 1YC0A 4NFFA 1SOZA 1S0RA 1C4U2 4OGYA 1THSH 2WPMS 1BIOA 1NN6A 3M7TA 1C5NH 2PV9B 1O5FH 5EQSA 4Y76A 3STIA 1GMCF 5E0JA 1WUNH 1NZQH 3Q00A 1A46H 1KXCA 4VGCC 1O35A 4FXGH 4B71A 2C4FH 3QGNB 1C1VH 3GY4A 3NK8A 1B7XB 2ZGXH 1GJ5H 2A4OA 1OXGA 1MCVA 1DXPA 1O2HA 3L3TA 4FUIA 1O36A 4MQAA 4Z0KA 1HAPH 3E0PB 1Y3YA 1EPTC 1VCQA 3SJ8A 2ANYA 1ABIH 2OBOA 2EI7A 1SBWA 2PKAB 4DVAU 3F9HA 2BD2A 4LZ1H 1EP5A 4WXIA 1OP2A 3KQBA 2PHBA 2J9NA 3VXEH 3MH6A 5CHAB 1V2LT 4PROA 3SJOA 1KTSB 1ELDE 1P06A 4Y8XA 1DX5M 1KXDA 2XTTB 3CS0A 5DP4A 5I25A 1OPHB 1ANBA 2JETC 2VB0A 2BZAA 3P8OA 4H6SB 4XFQA 1NFWA 3UPEA 2XBYA 4INLA 5C5OA 3RXIA 3LGTA 3HK3B 1N1LA 3SHAH 2OXSA 4GPGA 1GVLA 6CHAB 2J92A 1SGQE 1GBJA 1DWBH 1YLDA 1Z1JA 1FY5A 1GCTC 1AUTC 1K1NA 1ZSKA 1P05A 1OOKB 1RTFB 4CBOA 2YNAA 3UTUH 4BAQB 1P04A 1GBHA 2BVSH 3ZV9A 3F68H 4CHAB 1UCYK 2LNCA 2ZP0H 3FAOA 5EXMA 2XNIA 1E0FD 1W11U 3ZV8A 3Q3KA 1O2GH 7GCHF 1PYTD 3K65B 2EC9H 3TH3H 3RLYH 3M37A 5BRRE 1SGPE 1MKXK 2AGIX 2P8OC 4WMDA 1BUIA 1U6QA 6LPRA 1HYLA 3LU9B 4OS7A 3FP8E 1T4UH 1C5QA 3VGCC 3MO6A 5EXNA 3QTOH 1OWHA 1SL3A 1O3PB 2F9BH 3RMLH 1LDTT 4IBLH 1DXWA 2RCEA 3SUDA 1DLEA 3KEEA 1H4WA 4BTIB 2CV3A 4HFPB 3PROA 1CT2E 1FIWA 5JB8S 1ZSJA 4X8VH 4UONA 2AERH 4VGCB 4YT6H 1WQVH 2Q6GA 3BTKE 2BDAA 1KDQB 1O3KA 3GCOA 5LPFA 3LGUA 4E05H 4X6NA 3F1SB 3NCLA 3A7XA 1ZLRA 1O2SA 4XBBA 2HLCA 1OWEA 4F4OC 1EPTB 8GCHG 1IQFA 3LGVA 4UEHH 3RXTA 1UVPA 2F9UA 1GI8B 2ZG0H 2AS9A 5F03A 1V2VT 1HJAB 3U8TH 5A8XA 3TJNA 2UWOA 1S81A 3MH7A 2OD3B 3F6UH 1K22H 3PWCA 3TITA 2BYAX 1HUTH 1C1RA 3BN9A 3FZZA 4GVUA 4OS2A 3E3TA 1F5LA 1QRXA 2M5TA 1GHZA 4X1PU 3MO9A 6GCHG 4O97A 1GBTA 1QL9A 2JETB 4I8HA 2GGVB 1C5MD 3ENSB 1YBWA 1TYNA 5ABWA 1K9OE 2BDYA 1DDJA 4JMYA 3BEUA 5C1YA 3SGAE 2ZDAH 1T8MA 4Y7BA 1GVKB 3SV2H 1TX7A 4MPUA 1DUAA 3E1XB 1OKXA 3MH5A 1WTGH 4AB8A 1HAHH 1SHYA 2FDAA 3SUFA 5DP5A 3TK9A 1GCTB 3BG8A 1G32B 2BDCA 3HGNA 2NU2E 3BTQE 3O8DA 4DIIH 2C8XB 4Q7YA 3GY5A 1O0DH 1HXFH 4FUFA 5K0HA 1HAYB 1DITH 1EOJA 6ESTA 5TJXA 4TWYA 1HGTH 1LHGH 2ODYB 2SNWA 1VR1H 2Y80A 4IN2A 3TU7H 1SGFG 3F9FA 1LCYA 1O37A 1YCPM 2GCHF 4WY3A 3QLPH 4Q7XA 1D6WA 2Z9LA 3FANA 5C1XA 4LOYH 3EYDA 2P8OB 1P2QA 3NXPA 5EPNA 4NGAH 1O5BB 1C1SA 2BXTH 4I8JA 2SGFE 1IHSH 2CJIA 5FPSA 3MNSA 5ESBA 3VGCB 4IC6A 4MTBA 1GHAG 1HAGE 1TGNA 2HRVA 3TPIZ 1PQ8A 2FPZA 3HKIB 2ESTE 2AFQB 2H6MA 1M9UA 3C27B 3PO1C 2G55A 1V2MT 1TMTH 1TALA 3BTFE 1W3CA 2OCVB 1TRYA 1PPHE 4WF8A 2GZ9A 4WMFA 2VWOA 4RSPA 3NZIA 3TLOA 3GCNA 1NFUA 2F9VA 1C5YB 1G2MA 1P8VC 3PYHA 3QZQA 3SUGA 2VU8E 2H5CA 1CGJE 1G9IE 1SQOA 2WYGA 1MMJN 1NTPA 5TCAA 3UWJH 2Y7ZA 3SN8A 2W26A 3T26A 3U9AH 3KQEA 3VB5A 4UFFH 1OSSA 2BZ6H 2PWXA 4B2AA 3UQOA 3SO3A 1K1MA 1O3HA 1HIAA 1V6DA 2V6NA 5L2YH 1UO6A 1BTHH 4I8KA 1RD3B 4DW2U 1Y5AT 1MTVA 1V2KT 1TMBH 4NA8A 1UCYE 2TGDA 2DE8A 1GDQA 1UK2A 1O3JA 4JYUH 2PFEA 1HPGA 2P16A 2TGAA 3A8BA 5GPIB 1E38B 1GJCB 3TK5A 2GVFA 1E34B 1MTUA 1ZGIA 1DWCH 1P2IA 2ASUB 2ZECA 4ZROA 2QIQA 1YCPH 1L2EA 1LMWB 3GICB 4ZHAA 1FY8E 2ZCLP 4LK4A 3Q3XA 1FIZA 3PM3A 3MU8A 1BHXF 1WSSH 1BTXA 3F9GA 4MLFB 2BXUH 5H4IB 1EAXA 1YPMH 2BLQA 1GJBB 3ATWA 3SU4A 1ZYOA 5JBTA 2QF0A 4X8SH 1RGQA 3RXGA 1P03A 1QA7A 2GZ7A 2PLXA 1OP0A 3BEFB 2ZU4A 1C4Y2 3D65E 1Y3XA 1GBIA 3ATLA 5L30H 1CA0C 1G3BA 1UVTH 2ANKH 3BTWE 5EQRA 3AAVA 4I8LA 2ZIQH 1WV7H 2TIOA 1C2IA 3UQVA 3A85A 2ZFFH 3BG4C 3P17H 1BCUH 2O9QA 2XRCA 3MTYA 1N6YA 1EJNA 1TNHA 1YF4A 1YPEH 2RA0A 2V3OH 3RXCA 5JPMH 2OQUA 3LOXA 4NIXA 2FOEA 3PO1B 3MMGA 4MG3A 3RXEA 1ANCA 4U01A 2SGQE 4OS4A 1PQAA 3BTME 2BY6X 4ESTE 1K28D 1LHCH 1J14A 4X2VA 3NPSA 1BA8B 3UOPA 2P94A 2HALA 5TCCA 2XW9A 3IG6B 4ZKNU 4XBCA 3BTTE 3RXBA 1T4VH 3TVJB 3GDSA 1BTUA 1C1WH 4AG2A 3SV7A 1SGNE 3A8CA 3LC3A 1ARBA 1QBVH 1XUFA 1Z8GA 1A61H 5FPYA 1YM0A 1QL7A 3U69H 3A88A 3MI4A 1V2NT 4WJG2 1J8AA 2FMJA 3ZVGA 1WU1A 2C8YB 3ATMA 2UWLA 4TY6A 4YLUA 1FN6A 1LHEH 1AD8H 5J4SA 1O2TA 3W94A 1MQ5A 1AMHA 1TX6A 2BHGA 4X2YA 1ZR0A 3SV8A 4WXVA 1C5LH 3PMHB 1LPKB 3A89A 2AGEX 4AFUA 1P9UA 9LPRA 2G81E 1D6RA 4ISOA 1QGFA 2ZTXA 1TPPA 1SLWB 1ZMLA 3JZ2B 2A1DB 4JYVH 1IQMA 4NWKA 5IDKA 3LH1A 5EOKA 1LHDH 3H7OA 4U32A 4NCYA 3SNEA 1TA6A 5AFYH 4K3JA 3T27A 4Y8ZA 3T25A 1XM1A 2A4RA 2ANMH 2BDBA 3P8FA 1CA8B 1ZJDA 3KQDA 4YTAA 5GJ4B 1CHOG 1SGIB 3VFEA 2FOFA 2W7UA 3D23A 3UNQA 4DURA 1NRRH 3G01A 2WPKS 1ELFA 2QXGA 2OLGA 3M3VA 4FUEA 1UHBB 3RXRA 1ELTA 2P3UB 3JZ1B 7GCHG 1C2MA 3RXPA 1O5EH 5LPEA 2PKAA 5A8ZA 1NO9H 1BBRH 2XBXA 1V2TT 4K1SA 1QB1A 1O3EA 5DG6A 1ELVA 2OC7A 1FPCH 1F0UA 3OY6U 4DGJA 2ZI2H 4K8BA 5F8XA 3A81A 1CA0B 2FX4A 4NZQA 4XOJA 1GHXH 1ANDA 3V7TA 3ESTA 1S84A 3LT3A 4ISLA 4NA7A 3MU4A 3BG4B 2QN5T 4KGAA 4AZ2B 2DE9A 4IMQA 3KGPA 4K2YA 1GPZA 1N6XA 1Q31A 2J4IA 1ZZZA 3AAUA 2GV6A 4BAMB 1FQ3A 1TMUH 3RXMA 1YPHC 1AVWA 1O3BA 5EPYA 3TGIE 1P11E 1MTWA 2FIRH 1IQNA 1K1LA 2ZDMA 3MYWA 1NESE 5A0BA 1NRNH 3M36A 1SHHB 3OYPA 1MKWK 2BD7A 1GWAA 3RXLA 2FP7B 2JKHA 1W7XH 3GY6A 4FU9A 1ELGA 2AH4X 3T28A 1TRMA 1W13U 1F0TA 4NA9H 3LH3A 1C5WB 2J94A 4IC5A 3QO6A 1EB1H 2O8TA 1VITF 3T29A 5EU8A 1THRH 1ZTKA 1Z8IB 2UUJB 4X2WA 1O30A 3QUMP 1AVXA 2IPHA 2J38A 1UVUH 3UIRA 1OWKA 1AY6H 4JZ1A 3VB3A 1AKSB 2Z6BD 1ELEE 1P3EA 2NWNA 3SHCH 3SI3H 2R0LA 3SV9A 1K1OA 4NIYA 3PTBA 2WUBA 2GP9B 2H1UA 1GJ6A 3BIVH 1QBNA 2G52A 1MTSA 4JZEH 3STJA 1QY6A 2ULLA 3S9BA 3SW2B 3DHKH 1L4ZA 1YP9A 3SU1A 4CH8B 2VWMA 3MH4A 3RXUA 1GBMA 1QCPA 1C2FA 1K21H 1LVYA 3MU1A 1UTOA 2ALPA 3OY5U 3VB6A 4NIVA 1HJAC 1Z8JB 1EPTA 4YO9A 4YOGA 2GCHG 2OQ5A 1GI6A 4AGJA 1BRAA 3HKJB 4CREA 5JB9S 3EA9A 1BT7A 4INHA 1J16A 1Y3WA 4IW4E 1BITA 1GI2A 1V2WT 4O03A 3RMOH 3S69A 2R0KA 2QXJA 1FY3A 2B7DH 3NWUA 1KYNA 1BRBE 1OWIA 3UWIA 3V3MA 4DIHH 2W3IA 3A84A 2LPRA 1PPEE 1QB6A 2CF9H 4BTTB 1DANH 1Z7KA 5C20A 1NPMA 2GDEH 4CRAA 2A2QH 3Q77A 1X7AC 1DSTA 1HBTH 1PPZA 4ISNA 4NIWA 1AE5A 1UTLM 1P0SH 2EI6A 1O39A 3OX7U 1QRZA 1AFEH 3RXQA 1ZHPA 2STBE 1MZDA 1CHOF 4K8YA 2NU1E 3RMMH 1O3IA 1O5DH 4RKOB 2IN2A 3KF2A 3EA8A 2P59A 1P3CA 1SR5C 2I6SA 2ZCHP 3V12A 1TONA 5AFZH 1CBWC 4SGBE 5LH8A 2HGTH 1AZ8A 2WPHS 5FX6A 3ZZCA 2WV4A 4YOJA 1VJ9U 4A1XA 3H5CB 1UTJA 2ZZUH 1ANEA 1W8BH 3SJIA 1RFNA 1WAYB 1ACBE 2GT7A 2R2WU 1OWJA 1QHRB 2XWBI 1C2KA 5HXFA 1K1JA 3R3GB 1THPB 1JIRA 1GHWH 1C1NA 4KELA 3K6ZA 2FLBH 1KXEA 1C1UH 2GT8A 3RXJA 1ZRBA 2B5TB 1O2ZA 2ANWA 4GHQA 4Y0ZE 2XXLA 1P12E 1C5VA 1HAVB 3LGIA 1K1PA 2VGCC 1O5AB 3A87A 4GCHF 1ARCA 3QN7A 2VIVA 3KNXA 5C3NA 3ZZ9A 1A0HB 4Q7ZA 3GYLB 3ZZ3A 5JBAS 1DY9A 4XE4A 5G4BA 1NC6A 1GBDA 2VH6A 3O8BA 1GBCA 1TBZH 5B6OA 1HFDA 2QYIA 2BQ6B 3E6PH 2Q1JA 1B0EA 3E91A 2Z94A 3LGYA 1C2DA 3KL6A 4D8NA 2VIPA 1P57B 1P9SA 4OS5A 4JZFH 4U2WA 1BRUP 3UNRA 1P2MA 1FJSA 1EAIA 2H5DA 1ELBA 1RIWC 3LGWA 3RXKA 1FZZA 1MD7A 2WPLS 1A3EH 4DCDA 1EAUA 2A4QA 1C1PA 2C90B 3M5LA 4ISHH 5JBBS 2BQWB 2FOAA 1LVMA 1C5RA 1F5RA 4X1SU 3U1IB 1ZMJA 1AN1E 4J2YB 1LPZB 1FUJA 3LPRA 4K5ZA 1XUKA 1SFQB 4ZHMU 5DO4H 5GXPA 1OX1A 1O32A 1EP6A 4ZXYH 3RXFA 2J2UA 3RC6A 2BM2A 1TNJA 2AGGX 1DE7H 1ZSLA 2BOKA 1HAXB 1O2IA 3B23B 5E2OA 3EA7A 1HCGA 1O3MA 4AG1A 2AEIH 1AFQC 3E90B 2A32A 2Z3CA 1NRPH 1L1GA 2OUAA 1A5HA 3M5OA 5K7RA 4ZAEA 1F0RA 5GCHF 4BNRA 2JH6D 3Q3YA 3GCTF 1EZUC 3ZZ6A 2PSXA 2R3UA 1DS2E 1F0SA 3ZVDA 2XC0A 2A7JA 3U1JB 1TGBA 2HNTC 3SNAA 3SQHE 3LKWA 4X6MA 1CBWB 4ZHLU 1LPGB 1ELCA 2BB4A 1AU8A 1S82A 1BBRE 1O2RA 1IQGA 1BMNH 1T8LA 3QK1A 3V0XA 2G00A 3PMAB 4CBNA 4AFZA 1NU7B 1AGJA 2WYJA 2Y7XA 2B8OH 1GGDC 4KTCA 1F2SE 3R0FA 1LKBA 1HRTH 1DWDH 1MCTA 2Y81A 1S6HA 2ZPQA 4LZ4B 4E06H 5DP6A 5DP8A 2Y82A 4CRCA 1OS8A 1SQAA 4Y10E 1ZPCA 4B76A 2J95A 1EQ9A 3TJVA 1BTWA 1JOUB 2UUYA 2V0BA 1BTPA 1MBMA 2FOGA 2SFAA 4R8TB 1WYKA 2F9PA 2NU0E 1O2WA 2VGCB 4NSYA 4E7NA 1BQYA 3L33A 3A7TA 5A09A 2NU3E 1SPJA 2ZU3A 2ALVA 1CGHA 3SU0A 2SGAA 1PQ5A 4ABIA 2ZFPH 4XBDA 1XUIA 5JDUB 2V35A 1JIMA 1TBQH 1HLTH 3I78A 3A7VA 3D62A 1BHXB 2K1QA 4CRBA 3L6PA 1MQ6A 2FS9A 2FESH 2WV5A 1TPSA 2C93B 1BRCE 2D26C 5EG4A 5F8ZA 1ESBA 2Y6TA 3TGKE 3ODFA 1RIWB 3QZRA 1ESTA 3SUEA 5ESTE 4BAHB 3A8DA 2WPJS 3GY2A 5AVDA 4AFSA 1Z8RA 1D3TB 1KLIH
chains in the Genus database with same CATH superfamily
5EW1H 4AFQA 2FO9A 1N8OC 2AMDA 2IOTA 2BVXH 3S7KB 1O2JA 1GI0A 2ZFQH 2BD3A 3UAIC 1DVAH 1GI9B 1OWDA 3PV4A 4MDSA 3RXAA 4BXSA 1BMAA 1H8DH 1QURH 3E8LA 1TNGA 5DK1A 3S0NA 3O8CA 1MAXA 2P95A 1EZXC 3FFGA 1TQ7B 3HPTB 3ZZBA 3SORA 3FP6E 3LC5A 1SGYE 2BY7X 5E2PA 1IQEA 1SGDE 4X1QU 1A2CH 3ZVEA 2SGDE 2B0FA 3KCGH 4B6FA 1AFQB 1DFPA 2A45B 5L6NH 2Y5HA 2F9OA 1CT0E 1FY1A 1C1MA 2A0QB 3KYGA 2WV9A 3RP2A 5T3HA 3GISB 1VJAU 1UHBA 4D9RA 4FUCA 1GMHG 3A7YA 3P70B 2KR7A 2J97A 4MPWA 1A4WH 1GVZA 8ESTE 3ITIA 3BEIB 2ZQ1A 1G3EA 2A7HA 1VITG 2BD5A 5T6DA 5EJZA 3MO3A 2FTLE 1RTKA 3SQEE 2J98B 1O3LA 4TWWA 2PR3A 4MNYA 3CP7A 4UFDH 5FHTA 1GGDB 2JH0D 4HZHA 3TNTA 1TA2A 1Y5BT 3DA9B 2QY0B 1IQLA 2FI5E 1VZQH 4MNWA 1O2VA 4FUHA 3KN2A 3U98H 1L1JA 1P01A 2ZHDA 3CENA 1G30B 1G36A 4IN1A 5A0CA 1C5PA 1CO7E 2IJOB 1RXPA 2CHAC 3GDUA 2ZHFH 1XVOA 4UE7H 5E0GA 5FCKA 4OGXA 1KSNA 1ETRH 3AVZA 2QXHA 2SGEE 1HJ8A 1TRNA 3VEQB 3MU0A 3ZYEA 3M61U 2ILNA 5E8EH 2XNDD 4UFEH 4MNVA 1F7ZA 3P8GA 4MPXA 1GI7B 2ZNKH 2A5IA 2CN0H 1SMFE 3VB4A 1GHBF 3OFND 3UNSA 3MQKC 1QTFA 4AX9H 4K60A 3HK6B 4X8UH 1ETSH 2WPIS 4FUDA 2OTVA 3A82A 2H9EH 2PGBB 4B2CA 2XC5A 5F6MA 1O2MA 4ZKSU 1A3BH 1TNLA 2BMGB 1IQJA 1H9LB 3RXVA 3DD2H 1UVOA 1FPHH 7LPRA 1YCPK 2GD4B 3SU6A 3SU2A 1XKBC 1EJMA 3RXOA 1FV9A 1A7SA 4YLQH 1N8OB 3A86A 1WTHD 5EW2H 1FNIA 4MNXA 1SI5H 2FM2A 1YLCA 2BLWA 3U8RH 3PLKA 1AKSA 1YYY1 2KAIB 1TQ0B 2FXRA 3ZZDA 2FI4E 2JH5D 2A4GA 2ODQA 4DY7B 1TFXA 3QGJA 2TRMA 3GDVA 1H8IH 4TYDA 1CT4E 1FMGA 2HWLB 3NKKA 1UW7A 1GJDB 4YM9A 2BD8A 4K69A 3P92A 1LHFH 4TT3D 2ODPA 1EASA 2D1JA 2G4UA 2GKVE 3EQ0H 1BMLA 2ZO3H 1SSXA 1P2NA 5HGGA 1Y8TA 2W3KA 1GMDG 2Z7FE 4LXBH 1F5KU 2M2AA 1EXFA 3KQ5A 1FXYA 1YPLH 1MAYA 4ABAA 3S9CA 4AYVB 4A5TS 2TGPZ 3ZVAA 1PFXC 2WUCA 2H9HA 3K6YA 1W2KH 2Z3DA 1IQIA 3F2FA 3MFJA 4ASHA 1LVBA 3RDZA 1E35B 2UUKB 1C5SA 1AO5A 4Y7AA 2FWWA 2ZU2A 1MZAA 1NFYA 4FUJA 4Y0YE 5AF9H 3IITA 1LO6A 1ZTJA 4BANB 4YESB 3H7TA 2BTCE 4ISIH 3D49H 1TGTA 3P95A 3TJOA 1HAZB 2PKSC 2D8WA 3EAJA 1DUEA 3GCHC 4GCHG 3SJ9A 3OSYA 3HGPA 1ORFA 1AI8H 2CHAB 4B1TA 4TPIZ 4X6PA 4K1EA 1SB1H 2IPQX 2HPQH 3SI4H 5HIZA 3WY8A 2Q6FA 1NRSH 4KKDA 3M5NA 1YGCH 4F49A 1RRKA 3B8JA 1AB9C 1MU8B 3VXFH 2FYRA 2ZDNA 4ASUD 4JYTA 1QA0A 3FN8A 4XSKU 1GJ8B 1A0JA 2ZDKA 1NM6A 2ZGJA 1W0ZU 1GMHF 2Z9GA 1ETTH 3ZVCA 1J9CH 1CGIE 2FZZA 2KX4A 3W95A 1CQQA 4GSOA 1XXFA 3LONA 1NFXA 3B9FH 1TBRH 4I31A 1COWD 4CRGA 3S7HB 4FUGA 3DFJA 4F55A 2HVYB 1BTZA 5GIBA 2Z9JA 4Y79A 3PMJA 3UREA 3QWCH 1UTKA 2EI8A 1O2XA 3MNXA 4K1TA 1UCYH 2BVRH 1SGRE 2PTCE 3KHVA 4IGDA 3CNRA 4A1TA 2SGPE 3ZZAA 1AE8H 1BBRK 4RT0A 2G5NA 5L2ZH 2J34A 1HAVA 2OBQA 5GDSH 1SQTA 3BF6H 1D3PB 1KDQA 1MKXH 1SGTA 4X1RU 5GCHG 1WBGB 3GCTG 1S83A 3ATIA 2P3TB 1TLDA 2VH0A 1GBLA 3TH2H 4O9VA 3BTHE 1FI8A 2HOBA 1CU1A 1GHYH 2R3YA 4HI3A 4BXWA 1VGCC 2ZCKP 3TK6A 4YT7H 1T8NA 1O3CA 3O8RA 4TPYA 1GBEA 2C8ZB 8KME2 1KLTA 1H1BA 4ZKOU 1W10U 1QL8A 1ZMNA 1QB9A 1WOFA 5T6GA 1GI4A 1IAUA 3GY3A 1O2LA 1EFRD 2FS8A 3BTEE 1ABJH 1S85A 3URDA 1C1QA 1C1TA 1LQDB 2O8WA 2BY9X 1A5IA 1P2JA 5DGJA 1W7GH 4AYYB 4Z1MD 5HM9A 1XXDA 1PJPA 4J1YA 2R2MB 3C1KA 1WXRA 1BMMH 1ZRKA 1C9TA 4A92A 4KP0A 1KXAA 3GY7A 1TPOA 1SVPA 2CXVA 2OC1A 2BX4A 2PKSB 1VITH 3A7ZA 2YOLA 3GCHB 2F3CE 1QIXB 2TBSA 2ZFRH 3SGQE 2QC2A 1HNEE 3A8AA 1O5CB 4HGCA 5DKMA 2A5KA 3FZDA 4TY7A 1KXFA 1T32A 3PWBA 4NZLA 2SNVA 1BTYA 4CRDA 5DP7A 4M7GA 5CMXH 1S0QA 3OTPA 1AB9B 4U30A 3RU4D 9ESTA 4RN6A 1GMDF 4ABJA 1RJXB 5HM2A 1MTNC 1P2KA 1V2UT 4CRFA 1Y3UA 5FBEA 2ZHWH 7KMEH 2C8WB 2H2ZA 4WMEA 3N99A 3SZNA 1H9IE 1DPOA 2OC8A 1GCDA 1TNIA 2VIDA 1DOJA 5A0AE 1DICA 4YXWD 1YKTA 2P3FH 3TJUA 3GOVB 3PMBB 4UDWH 1E1QD 1B5GH 3UR6A 2PUQH 1TE0A 1IQKA 2ZF0H 4UD9H 2ZU5A 3A7WA 1JMOH 1O2QA 4TSFD 1XUHA 5EODA 1FLEE 2ZPSA 2Z9IA 1UVSH 2XWAA 4CR5A 1TGCA 1AUJA 1QRWA 3OU0A 1C2GA 2ZWLH 3K2UA 1W12U 3F2GA 2PSYA 1DSUA 4AOQA 5BPEA 1HXEH 3M3SA 7ESTE 4D76A 1T7CA 1UJ1A 3CS7A 3LIWA 1INCA 1SFIA 1FAKH 1KIGH 2BDIA 1FDPA 1PYTC 2HVXA 3FKSD 1Z6EA 1LQEA 1SGCA 3RU4E 2QE7D 3SU5A 4MPVA 3LJOA 2QA9E 2QF3A 3F0PA 4BTUB 1QNJA 1GBFA 1AIXH 1GJ9B 4KTUA 1VGCB 2THFB 4H4FA 1ZOMA 3MU5A 4RT1A 3KYFA 1AZZA 2ZGCA 1O31A 2A7CA 2RG3A 2P93A 4DT7B 2XBVA 1EZSC 1JBUH 1NBME 1TAWA 4JZDH 4OM9A 3EGKH 1VCPA 2ZQ2A 3RXHA 1TOCB 2CMYA 4DJZB 4GLYA 3UUZA 4ABDA 1PPFE 4NG9H 4AC9A 5C2ZA 5FCRA 1C2JA 1GG6C 1O3OA 3M35A 1GBAA 1KLJH 2V3MA 2Y5GA 5C17A 1QJ7B 1BOQA 3BSQA 3LJJA 5C5NA 3DSPA 5FX5A 4H42U 1O3FA 3DUXH 5T6FA 2F4LA 3I77A 2W5EA 2XCFA 4O3TA 2FYQA 3RLWH 2GMTC 1PPGE 2ZDLA 1O3DA 1BJVA 3URCA 2AIQA 4OS6A 2FLRH 8LPRA 5SGAE 4D7GA 1PPBH 1UTMA 2RDLA 4B74A 1AVGH 1BZXE 4X2XA 1XX9A 4UFGH 4GUXA 3QX5H 1ZTLA 4I7YH 5F53A 4AORA 2HPPH 3SYJA 5C67A 4AB9A 1GHBG 1P10A 4JK6A 1CVWH 3H09A 1OP8A 4SGAE 3ATKA 4D7FA 3BTGE 2VWLA 4B75A 1HV7A 2RA3A 3T2NA 4WWYA 2A31A 1G3DA 4A7IB 4NWLA 3E0NB 4I32A 3U8OH 1MTNB 2GCTC 3FOAA 4O3UA 4I86A 1V2RT 1O2PA 2WHXA 1BMFD 3PB1E 5EQQA 4ABFA 5EJ1A 2AMQA 4WVPE 1DM4B 1MD8A 2CGAA 1GBKA 3VB7A 3RM2H 5C1UA 5DP3A 5FBIA 1FAXA 2B9LA 3QTVH 4Y71A 1KTTB 2Z9KA 1GBBA 2HNTE 1SGFA 2J98A 1B0FA 1O2NA 3AW0A 1TB6H 2WSSD 2ZU1A 4IMZA 5FXLA 3TH4H 1XUGA 2KCOA 1O2YA 4ABEA 1HAIH 1Q3XA 1ZGVA 2ZHEH 1P2OA 1GJ7B 3UB0A 1RTLA 3SGBE 1TABE 4P00A 1T8OA 1C5ZB 3RUOA 1K2I1 3M5MA 3PTNA 1XUJA 2D2DA 5LPRA 5EGMA 2Z3EA 1NROH 2ZA5A 1QZ8A 3SV6A 3AW1A 1NU9A 1LKAA 2AMPA 1Y3VA 3SNCA 2VVUA 1T31A 1HB0B 2PGQB 3ZZ8A 1JXPA 2QAAA 4A1VA 1V3XA 2QF5A 4WH8A 5DPAA 1S5SA 1C2EA 4BOHA 1AQ7A 1NRQH 1W14U 3MNCA 4INKA 4CR9A 1C9PA 4Y6DA 1C5TA 5I46H 1DLKB 5HMAA 2BY8X 2OP9A 4FVBA 3FP7E 1Y5UT 1Z6JH 3OTJE 1ZPZA 1IHTH 4XD7D 1O2UA 3SZEA 4Z6AH 2QXIA 3DT0H 1YPKH 1C5XB 4X0WU 4B73A 2STAE 3A80A 4FVDA 5IYTA 3ZZ5A 3SU3A 1HJ9A 1GG6B 1EX3A 1A0LA 2ZHQH 3RXDA 2PW8H 2PUXB 4FU8A 2QCYA 4A6LA 2TPIZ 1WCZA 4GHTA 3ZZ4A 3DFLA 4NFEA 5J4QA 1NY22 1L0ZA 3RU4T 1TGSZ 4JK5A 3RXSA 5A8YA 2GMTB 2KAIA 3SBKA 3QDZB 1TOMH 3M7UA 3KIDU 1DY8A 3AK5A 4E7RG 5AHGH 1O5GH 1OYQA 4R0IA 2JDID 1BJUA 1UK4A 3V13A 1ID5H 3UY9A 3P8NA 1UMAH 5EXLA 2VIQA 1D9IA 5E0HA 1GDNA 1GDUA 1O3NA 1A1RA 5LGOA 3FVFB 1Z71A 3IWMA 4Q2KA 3UFAA 2H9TH 1GJ4H 3EDXB 4I33A 2BD4A 2BLOA 1TIOA 3A83A 2GCTB 2TGTA 8GCHF 5GWZA 3RC4A 4I8GA 1A5GH 1QQUA 1FN8A 3F9EA 1EOLA 2VIWA 5ETXA 3OEHD 4AN7A 1WQSA 3E16B 2AYWA 1C4V2 5GNDA 1J17T 1L1NA 1SLVB 4Q4LA 3PV2A 3AASA 1GI3A 2F43B 1ELAA 1AWHB 4ZKRU 2ZTZA 2AHME 5DP9A 4ZXXH 3DCLA 6GCHF 2OINA 1G37A 2FTMA 2G51A 3TIUA 1JWTA 5HKKD 4CH2B 1HDTH 3S9AA 2XYAA 1L4DA 1EB2A 2F9NA 1D3DB 1XKAC 1Z1IA 3GYMA 3P6ZB 2RDEA 4D9QA 4X8TH 3SNDA 1C1OA 1XVMA 2XC4A 3NUMA 1IQHA 3ZVBA 2R9PA 1O2KA 1GMCG 1EUFA 1O3GA 4FU7A 2ZC9H 1RS0A 1GI5A 2UWPA 2G8TA 5PTPA 1C5OH 3SJKA 3SNBA 2O8LA 1K1IA 4Y8YA 5CDFE 1W0YH 2BX3A 1MU6B 3ODDA 1GL0E 1G3CA 2AIPA 2FX6A 3BV9B 3TNSA 1SOTA 2I6QA 3ELAH 1Q2WA 2W7SA 1C2LA 2FOCA 1UTQA 2DUCA 2QV1A 1Y59T 4MVNA 1KXBA 1V2QT 1EATA 4ZH8A 4YZUA 2ZGBH 5F8TA 1ZPBA 2VNTA 2HNTF 3N7OA 4BAOB 2XBWA 3BIUH 3K9XB 1MBQA 3TGJE 2A5AA 2GTBA 3VPKA 1J15A 1E37B 1HIAB 4BAKB 1CE5A 4OS1A 4H6TA 1G2LA 5FPTA 1H9HE 2QGRA 4JCNA 2FOBA 3Q76A 4DG4A 2O8UA 3RMNH 2ZFTA 2Q6DA 2WINI 1D3QB 1AWFH 1P02A 1IOEA 1P09A 1BB0B 1TX8A 1FONA 4HTCH 1GL1A 5FAHA 1JRSA 1QFKH 1YPGH 5JBCS 2UUFB 1QBOA 2ZPRA 4WH6A 1EJAA 1MKWH 1JRTA 3ZZ7A 2V3HH 3MWIU 3DSOA 2FODA 2EA3A 1YPJH 1GHAF 3ZVFA 1O3AA 1GHVH 4NSVA 3M7QA 4ABBA 1PQ7A 3MNBA 1AHTH 1SLUB 1MH0A 2VINA 1V2OT 1CHGA 2NU4E 3I29A 4X1NU 3HATH 2VIOA 4THNH 1LTOA 1TPAE 4ABHA 2YNBA 1SGEE 3MHWU 1ESAA 4F48B 3T5FH 1O38A 1EAWA 2ZDVH 1V2JT 1V2PT 1F92A 2VVCA 1GJAB 1YWUA 1SLXB 5CE1A 1QQ4A 5HYOA 1QJ1B 4AGKA 2GV7A 2FOMB 2ZEBA 1D4PB 1TWXB 2G4TA 3UR9A 5CHAC 1HAOH 2FEQH 4ABGA 2O8MA 2KCYA 3PRDA 2HLDD 5IK2D 4Q80A 4XDEA 2BQ7B 1O34A 1QJ6B 1V2ST 1PPCE 3KQCA 2BD9A 1TNKA 5DJ7A 2VJ1A 1MUEB 2BDGA 3RM0H 1CSOE 1BDAA 4DOQA 1C5UA 5JYIA 3T62A 1EKBB 1ZJKA 2BY5X 3PLPA 1KY9A 4Y11E 2VVVA 5HIYA 4ZUHA 3MOCA 1ZHMA 5C0UA 2CF8H 6CHAC 1O33A 3LDXH 3PLBA 4GAWA 4KTSA 1DWEH 1FY4A 4B2BA 3DSGA 5EJLA 1NT1A 1S6FA 3SOSA 2FI3E 1SG8B 1VCWA 2ZKSA 1UTNA 1XMNB 3M3TA 2BLVA 1OYTH 1VKYA 1C2HA 1SC8U 2GZ8A 2ZTYA 2EEKA 1YPHE 4CHAC 2C3SA 1UTPA 3RC5A 4ZMAH 2PTNA 4X6OA 2FOHA 3GY8A 3ZYDA 1UK3A 1O2OA 2Y5FA 1SQRA 2VWNA 1NS3A 3EE0B 4JZIA 2F91A 1ZHRA 2F83A 3UOUA 4FUBA 2BOHB 4RKJB 1DT2A 2G5VA 2ZFSA 1QR3E 5A2MH 2XCNA 2GDDA 1GI1A 2A2XH 4YOIA 4IS5A 2BDHA 1E36B 1EZQA 4QT8C 2OC0A 2K8IA 2ZGHA 3BTDE 2GX4A 1LVOA 1YC0A 4NFFA 3WWFA 1SOZA 1S0RA 1C4U2 4OGYA 1THSH 2WPMS 4DT4A 5B6LA 1BIOA 5DN6D 1NN6A 3M7TA 1C5NH 2PV9B 2XOKD 1O5FH 4M9FA 5EQSA 4Y76A 3STIA 1GMCF 5E0JA 1WUNH 1NZQH 3Q00A 1A46H 1KXCA 4VGCC 1MABB 1O35A 4FXGH 4B71A 2C4FH 3QGNB 1C1VH 3GY4A 3NK8A 1B7XB 2ZGXH 1GJ5H 2A4OA 1OXGA 1MCVA 1DXPA 1O2HA 1YY3A 3L3TA 4FUIA 1O36A 4MQAA 4Z0KA 1HAPH 3E0PB 2L74A 1Y3YA 1EPTC 1VCQA 3SJ8A 2ANYA 1ABIH 2OBOA 2EI7A 1SBWA 2PKAB 4DVAU 3F9HA 2BD2A 1H8HD 4LZ1H 1EP5A 4WXIA 1OP2A 3KQBA 2PHBA 2J9NA 3VXEH 4XRNA 3MH6A 5CHAB 1V2LT 4PROA 3SJOA 1KTSB 1ELDE 1P06A 4Y8XA 1DX5M 1KXDA 2XTTB 3CS0A 5DP4A 5I25A 1OPHB 1ANBA 2JETC 2VB0A 2BZAA 3P8OA 5CHBA 4H6SB 4XFQA 1NFWA 3UPEA 2XBYA 4INLA 5C5OA 3RXIA 3LGTA 3HK3B 1N1LA 3SHAH 2OXSA 4GPGA 1GVLA 6CHAB 2J92A 1SGQE 1GBJA 1DWBH 1YLDA 1Z1JA 1FY5A 1GCTC 1AUTC 1K1NA 1ZSKA 1P05A 1OOKB 1RTFB 4CBOA 2LP6A 2YNAA 3UTUH 4BAQB 1P04A 1GBHA 2BVSH 3ZV9A 3F68H 4CHAB 1UCYK 2LNCA 2ZP0H 3FAOA 5EXMA 2XNIA 1E0FD 1W11U 3ZV8A 3Q3KA 1O2GH 7GCHF 1PYTD 3K65B 2EC9H 3TH3H 3RLYH 3M37A 5BRRE 1SGPE 1MKXK 2AGIX 2P8OC 3FO8D 4WMDA 1BUIA 3EE7A 1U6QA 1K0HA 6LPRA 1HYLA 3LU9B 4OS7A 3FP8E 1T4UH 1C5QA 3VGCC 3MO6A 5EXNA 3QTOH 1OWHA 1SL3A 1O3PB 2F9BH 2W6JD 3RMLH 1LDTT 4IBLH 1DXWA 2RCEA 3SUDA 1DLEA 3KEEA 1FX0B 1H4WA 2CV3A 4HFPB 3PROA 1CT2E 4BTIB 1FIWA 5JB8S 1ZSJA 4X8VH 4UONA 2AERH 4VGCB 4YT6H 1WQVH 2Q6GA 3BTKE 2BDAA 4Q63A 1KDQB 1O3KA 3GCOA 5LPFA 3LGUA 4E05H 4X6NA 3F1SB 3NCLA 3A7XA 1ZLRA 1O2SA 4ACAA 4XBBA 2HLCA 1OWEA 4RI0A 4F4OC 1EPTB 8GCHG 1IQFA 3LGVA 4UEHH 3RXTA 1UVPA 3F2HA 2F9UA 1GI8B 1WDIA 2ZG0H 2AS9A 5F03A 1V2VT 1HJAB 3U8TH 5A8XA 3TJNA 2UWOA 1S81A 3MH7A 2OD3B 3F6UH 1K22H 3PWCA 3TITA 2BYAX 1HUTH 1C1RA 3BN9A 3FZZA 4GVUA 4OS2A 3E3TA 1F5LA 1QRXA 2M5TA 1GHZA 4X1PU 3MO9A 6GCHG 4O97A 1GBTA 1QL9A 2JETB 4I8HA 2GGVB 1C5MD 3ENSB 1YBWA 1TYNA 5ABWA 1K9OE 2BDYA 1DDJA 4JMYA 3BEUA 5C1YA 3SGAE 2ZDAH 1T8MA 4Y7BA 1GVKB 3SV2H 1TX7A 4MPUA 1DUAA 3E1XB 1OKXA 3MH5A 1WTGH 4AB8A 1HAHH 1SHYA 2FDAA 3SUFA 5DP5A 3TK9A 1GCTB 3BG8A 1G32B 2BDCA 3HGNA 2NU2E 3BTQE 2QF4A 2RFKC 3O8DA 4DIIH 2C8XB 4Q7YA 3GY5A 3OEED 1O0DH 3PV5A 1HXFH 4FUFA 5K0HA 1HAYB 1DITH 1EOJA 6ESTA 5TJXA 4TWYA 1HGTH 1LHGH 1YLNA 2ODYB 1VR1H 2SNWA 2Y80A 3F0OA 4IN2A 1SGFG 3F9FA 1LCYA 3TU7H 1O37A 1YCPM 2GCHF 4WY3A 3QLPH 5T1VA 4Q7XA 2KM0A 1D6WA 2Z9LA 3FANA 5C1XA 4LOYH 1E1RD 3EYDA 3OAAD 2P8OB 1P2QA 3NXPA 5EPNA 4NGAH 1O5BB 1C1SA 2YMSC 2BXTH 4I8JA 2SGFE 2KCPA 1IHSH 2CJIA 5FPSA 3MNSA 5KEDA 5ESBA 3VGCB 4IC6A 4MTBA 1GHAG 1HAGE 1TGNA 2HRVA 3TPIZ 1PQ8A 2FPZA 3HKIB 2ESTE 2AFQB 2H6MA 1M9UA 3C27B 3PO1C 2G55A 1V2MT 1TMTH 1TALA 3BTFE 1W3CA 2OCVB 1TRYA 1PPHE 4WF8A 2GZ9A 4WMFA 2VWOA 4RSPA 3NZIA 3TLOA 3GCNA 1NFUA 2KCAA 2F9VA 1C5YB 1G2MA 1P8VC 3PYHA 3QZQA 3SUGA 2VU8E 2H5CA 1CGJE 1G9IE 1SQOA 2WYGA 1MMJN 1NTPA 5TCAA 3UWJH 2Y7ZA 3SN8A 2W26A 3T26A 5KECA 3U9AH 3KQEA 3VB5A 4UFFH 1OSSA 2BZ6H 2PWXA 4B2AA 3UQOA 3SO3A 1K1MA 1O3HA 1HIAA 1V6DA 2V6NA 5L2YH 1UO6A 1BTHH 1W0JD 4I8KA 1RD3B 4DW2U 1Y5AT 1MTVA 1V2KT 1TMBH 4NA8A 1UCYE 2TGDA 2DE8A 2GJGA 1GDQA 1UK2A 1O3JA 4JYUH 2PFEA 1HPGA 2P16A 2TGAA 3A8BA 2PP6A 5GPIB 1E38B 1GJCB 3TK5A 2GVFA 1E34B 2WZQA 1MTUA 1ZGIA 2V7QD 1DWCH 1P2IA 2ASUB 2EY4C 2KFWA 2ZECA 4ZROA 2QIQA 1YCPH 1L2EA 1LMWB 3GICB 4ZHAA 1FY8E 2ZCLP 4LK4A 3Q3XA 1FIZA 3PM3A 3MU8A 4HG6A 1BHXF 1WSSH 1BTXA 3F9GA 4MLFB 2BXUH 5H4IB 1EAXA 1YPMH 2BLQA 1GJBB 3ATWA 3SU4A 1ZYOA 4ZCNA 5JBTA 2QF0A 4X8SH 1RGQA 5KGOA 3RXGA 1P03A 1QA7A 2GZ7A 2PLXA 1OP0A 1H8ED 3BEFB 2ZU4A 1C4Y2 3D65E 3U28C 1Y3XA 1GBIA 3ATLA 3N7EA 5L30H 1CA0C 1G3BA 1UVTH 2ANKH 3BTWE 5EQRA 3AAVA 2YMSB 4I8LA 2CK3D 2ZIQH 1WV7H 2TIOA 1C2IA 3UQVA 3A85A 2ZFFH 3BG4C 3P17H 1BCUH 2O9QA 2XRCA 3MTYA 1N6YA 1EJNA 1TNHA 1YF4A 1YPEH 2RA0A 2V3OH 3RXCA 5JPMH 2OQUA 3LOXA 4NIXA 3OE7D 2FOEA 3PO1B 3MMGA 4MG3A 3RXEA 1ANCA 2IJD1 2SGQE 4U01A 4OS4A 1PQAA 3BTME 1S6LA 2BY6X 4ESTE 1K28D 1LHCH 1J14A 4X2VA 3NPSA 1BA8B 3UOPA 2P94A 2HALA 5TCCA 2XW9A 3IG6B 4ZKNU 4XBCA 3BTTE 3RXBA 1T4VH 3TVJB 3GDSA 1BTUA 1C1WH 4AG2A 3SV7A 1SGNE 3A8CA 3LC3A 1ARBA 1QBVH 1XUFA 1Z8GA 1A61H 5FPYA 1YM0A 1QL7A 3U69H 3A88A 3MI4A 1V2NT 4WJG2 1J8AA 2FMJA 3ZVGA 1WU1A 2C8YB 3ATMA 2UWLA 4TY6A 4YLUA 1FN6A 1LHEH 1AD8H 5J4SA 1O2TA 3W94A 1MQ5A 1AMHA 1TX6A 2BHGA 4X2YA 1ZR0A 3SV8A 4WXVA 1C5LH 5C94A 3PMHB 1LPKB 3A89A 2AGEX 4AFUA 1P9UA 9LPRA 2G81E 1D6RA 4ISOA 1QGFA 2ZTXA 1TPPA 1SLWB 1ZMLA 3JZ2B 2A1DB 4JYVH 1IQMA 4NWKA 5IDKA 3LH1A 5EOKA 1LHDH 3H7OA 4U32A 5EIYA 4NCYA 3SNEA 1TA6A 5AFYH 4K3JA 3T27A 4Y8ZA 3T25A 1XM1A 2A4RA 2ANMH 2BDBA 3P8FA 1CA8B 1ZJDA 3KQDA 4YTAA 5GJ4B 1CHOG 1SGIB 3VFEA 2FOFA 2W7UA 3D23A 3UNQA 2J5UA 4DURA 1NRRH 3G01A 2WPKS 4FOUC 1ELFA 2QXGA 2OLGA 3M3VA 4FUEA 1UHBB 3RXRA 1ELTA 2P3UB 3JZ1B 7GCHG 1C2MA 3RXPA 1O5EH 5LPEA 2PKAA 5A8ZA 1NO9H 1BBRH 2XBXA 1V2TT 4K1SA 1QB1A 1O3EA 5DG6A 1ELVA 2OC7A 1FPCH 1F0UA 3OY6U 4DGJA 2ZI2H 4K8BA 5F8XA 3A81A 1CA0B 2FX4A 4NZQA 4XOJA 1E79D 1GHXH 1ANDA 4P02A 3V7TA 3ESTA 1S84A 3LT3A 4ISLA 4NA7A 3MU4A 3BG4B 1OHHD 2QN5T 4KGAA 4AZ2B 2DE9A 4IMQA 3KGPA 4K2YA 1GPZA 1N6XA 1Q31A 2J4IA 1ZZZA 3AAUA 2GV6A 4BAMB 1FQ3A 1TMUH 2K0QA 1YPHC 3RXMA 1AVWA 1O3BA 5EPYA 3TGIE 1P11E 1MTWA 2FIRH 1IQNA 1K1LA 2ZDMA 3MYWA 1NESE 5A0BA 1NRNH 3M36A 1SHHB 3OYPA 1MKWK 2BD7A 1GWAA 3RXLA 2FP7B 2JKHA 1W7XH 3GY6A 4FU9A 1ELGA 2AH4X 3T28A 1TRMA 1W13U 1F0TA 4NA9H 3LH3A 1C5WB 2J94A 4IC5A 3QO6A 1EB1H 2O8TA 1VITF 3T29A 5EU8A 1THRH 1ZTKA 1Z8IB 2UUJB 4X2WA 1O30A 3QUMP 1AVXA 2IPHA 2J38A 1UVUH 3UIRA 1OWKA 1AY6H 4JZ1A 3VB3A 1AKSB 2Z6BD 1ELEE 1P3EA 2NWNA 3SHCH 3SI3H 2R0LA 3SV9A 1K1OA 4NIYA 2JJ1D 3PTBA 2WUBA 2GP9B 2H1UA 1GJ6A 3BIVH 5C0TA 1QBNA 2G52A 1MTSA 4JZEH 2KZ4A 3STJA 1QY6A 2ULLA 3S9BA 3SW2B 3DHKH 1L4ZA 1YP9A 3SU1A 3WW7A 4CH8B 2VWMA 2W6ID 3MH4A 3RXUA 3PRBA 1GBMA 1QCPA 1C2FA 1K21H 1LVYA 3MU1A 1UTOA 2ALPA 3OY5U 3VB6A 4NIVA 1HJAC 1Z8JB 1EPTA 4YO9A 3F3BA 4YOGA 2GCHG 2OK5A 2OQ5A 1GI6A 4AGJA 1BRAA 3HKJB 4CREA 5JB9S 3EA9A 1BT7A 4INHA 1J16A 1Y3WA 4IW4E 1BITA 1GI2A 1V2WT 4O03A 3RMOH 3S69A 2R0KA 2QXJA 1FY3A 2B7DH 3NWUA 1KYNA 1BRBE 1OWIA 3UWIA 3V3MA 2EQNA 4DIHH 2W3IA 3A84A 2LPRA 1PPEE 1QB6A 2CF9H 4BTTB 1DANH 1Z7KA 5C20A 1NPMA 2GDEH 4CRAA 2A2QH 3Q77A 1X7AC 1DSTA 1HBTH 1PPZA 4ISNA 4NIWA 1AE5A 1UTLM 1P0SH 2EI6A 1O39A 3OX7U 1QRZA 1AFEH 3RXQA 1ZHPA 2STBE 1MZDA 1CHOF 4K8YA 3WWBA 3W1EA 2NU1E 2JJ2D 1O3IA 1O5DH 4RKOB 3RMMH 2IN2A 3KF2A 3EA8A 2VBCA 2P59A 1P3CA 1SR5C 2I6SA 2ZCHP 3V12A 1TONA 5AFZH 1CBWC 4SGBE 5LH8A 2HGTH 1AZ8A 2WPHS 5FX6A 3ZZCA 2WV4A 4YOJA 1VJ9U 4A1XA 3H5CB 1UTJA 2ZZUH 1ANEA 1W8BH 3SJIA 1RFNA 1WAYB 1ACBE 2GT7A 2R2WU 1OWJA 1QHRB 4ACBA 2XWBI 1C2KA 5HXFA 1K1JA 3R3GB 1THPB 1JIRA 1NBMD 4B6EA 1GHWH 1C1NA 4KELA 3K6ZA 3NRLA 2FLBH 1KXEA 1C1UH 2GT8A 3RXJA 1ZRBA 4FETA 2B5TB 1O2ZA 2ANWA 4GHQA 4Y0ZE 2XXLA 1P12E 1C5VA 1HAVB 3LGIA 1K1PA 2VGCC 1O5AB 3A87A 4GCHF 1ARCA 3QN7A 2VIVA 3KNXA 5C3NA 3ZZ9A 1A0HB 4Q7ZA 3GYLB 3ZZ3A 5JBAS 1DY9A 4XE4A 5G4BA 1NC6A 1GBDA 2VH6A 3O8BA 1GBCA 1TBZH 5B6OA 1HFDA 1KMHB 2BQ6B 2QYIA 3E6PH 2Q1JA 1B0EA 3E91A 2Z94A 3LGYA 1C2DA 3KL6A 4D8NA 2VIPA 1P57B 1P9SA 4OS5A 4JZFH 4U2WA 1BRUP 3UNRA 1P2MA 1FJSA 1EAIA 2H5DA 1ELBA 1RIWC 3LGWA 3RXKA 1FZZA 1MD7A 2WPLS 1A3EH 4DCDA 1EAUA 2A4QA 1C1PA 2C90B 3M5LA 4ISHH 5JBBS 2BQWB 2FOAA 2WPDD 1LVMA 1C5RA 1F5RA 4X1SU 2LELA 3U1IB 3GS9A 3N7DA 1ZMJA 1AN1E 4J2YB 1LPZB 1FUJA 3LPRA 4K5ZA 1XUKA 1SFQB 4ZHMU 5DO4H 5GXPA 1OX1A 1O32A 1EP6A 4ZXYH 3RXFA 2J2UA 3RC6A 2BM2A 1TNJA 2AGGX 1DE7H 1ZSLA 2BOKA 1HAXB 1O2IA 2YMSD 3B23B 5E2OA 3EA7A 1HCGA 1O3MA 4AG1A 3ZIAD 1W0KD 2AEIH 1AFQC 3E90B 2A32A 2Z3CA 1NRPH 1L1GA 2OUAA 1A5HA 3M5OA 5K7RA 4ZAEA 1F0RA 5GCHF 4BNRA 2JH6D 3Q3YA 3GCTF 1EZUC 3ZZ6A 2PSXA 2R3UA 1DS2E 1F0SA 5DSFA 3ZVDA 2XC0A 2A7JA 3U1JB 1TGBA 2HNTC 3SNAA 3SQHE 3LKWA 4X6MA 1CBWB 4ZHLU 1LPGB 1ELCA 2BB4A 1AU8A 1S82A 1BBRE 1O2RA 1IQGA 1BMNH 1T8LA 3QK1A 3V0XA 2G00A 3PMAB 4CBNA 4AFZA 1NU7B 1AGJA 2WYJA 2Y7XA 2B8OH 1GGDC 4KTCA 2L6OA 1F2SE 3R0FA 1LKBA 1HRTH 3VG8A 1DWDH 1SKYE 1MCTA 2Y81A 1S6HA 2ZPQA 4LZ4B 4E06H 5DP6A 5DP8A 2Y82A 4CRCA 1OS8A 1SQAA 4Y10E 1ZPCA 4B76A 2J95A 1EQ9A 3TJVA 1BTWA 1JOUB 2UUYA 2V0BA 1BTPA 1MBMA 2FOGA 2SFAA 4R8TB 5FL7D 1WYKA 2F9PA 2NU0E 1O2WA 2VGCB 4NSYA 4E7NA 1BQYA 3L33A 3A7TA 5A09A 2NU3E 1SPJA 2ZU3A 2ALVA 1CGHA 3SU0A 2SGAA 1PQ5A 2JIZD 4ABIA 2ZFPH 4XBDA 1XUIA 5JDUB 2V35A 1JIMA 1TBQH 1HLTH 3I78A 3A7VA 3D62A 1BHXB 2K1QA 4CRBA 3L6PA 1MQ6A 2FS9A 2FESH 2WV5A 1TPSA 2C93B 1BRCE 2D26C 5EG4A 5F8ZA 1ESBA 2Y6TA 3TGKE 3ODFA 1RIWB 3QZRA 1ESTA 3SUEA 5ESTE 4BAHB 3A8DA 2WPJS 3GY2A 5AVDA 4AFSA 1Z8RA 1D3TB 1KLIH
chains in the Genus database with same CATH topology
5EW1H 4AFQA 2FO9A 1N8OC 2AMDA 2IOTA 2BVXH 3S7KB 1O2JA 1GI0A 2ZFQH 2BD3A 1DVAH 1GI9B 1OWDA 3PV4A 4MDSA 3RXAA 4BXSA 1BMAA 1H8DH 1QURH 3E8LA 1TNGA 5DK1A 3S0NA 3O8CA 1MAXA 2P95A 1EZXC 3FFGA 1TQ7B 3HPTB 3ZZBA 3SORA 3FP6E 3LC5A 1SGYE 2BY7X 5E2PA 1IQEA 1SGDE 4X1QU 1A2CH 3ZVEA 2SGDE 2B0FA 3KCGH 1AFQB 1DFPA 2A45B 5L6NH 2Y5HA 2F9OA 1CT0E 1FY1A 1C1MA 2A0QB 3RP2A 5T3HA 3GISB 1VJAU 1UHBA 4D9RA 4FUCA 1GMHG 3A7YA 3P70B 4MPWA 1A4WH 1GVZA 8ESTE 3ITIA 3BEIB 2ZQ1A 1G3EA 2A7HA 1VITG 2BD5A 5T6DA 3MO3A 2FTLE 1RTKA 3SQEE 1O3LA 4TWWA 2PR3A 4MNYA 3CP7A 4UFDH 5FHTA 1GGDB 2JH0D 4HZHA 3TNTA 1TA2A 1Y5BT 3DA9B 2QY0B 1IQLA 2FI5E 1VZQH 4MNWA 1O2VA 4FUHA 3KN2A 3U98H 1L1JA 1P01A 2ZHDA 3CENA 1G30B 1G36A 4IN1A 5A0CA 1C5PA 1CO7E 2IJOB 1RXPA 2CHAC 3GDUA 2ZHFH 1XVOA 4UE7H 5E0GA 5FCKA 4OGXA 1KSNA 1ETRH 3AVZA 2QXHA 2SGEE 1HJ8A 1TRNA 3VEQB 3MU0A 3ZYEA 3M61U 2ILNA 5E8EH 4UFEH 4MNVA 1F7ZA 3P8GA 4MPXA 1GI7B 2ZNKH 2A5IA 2CN0H 1SMFE 3VB4A 1GHBF 3UNSA 1QTFA 4AX9H 4K60A 3HK6B 4X8UH 1ETSH 2WPIS 4FUDA 2OTVA 3A82A 2H9EH 2PGBB 4B2CA 2XC5A 5F6MA 1O2MA 4ZKSU 1A3BH 1TNLA 2BMGB 1IQJA 1H9LB 3RXVA 3DD2H 1UVOA 1FPHH 7LPRA 1YCPK 2GD4B 3SU6A 3SU2A 1XKBC 1EJMA 3RXOA 1FV9A 1A7SA 4YLQH 1N8OB 3A86A 1WTHD 5EW2H 1FNIA 4MNXA 1SI5H 2FM2A 1YLCA 2BLWA 3U8RH 3PLKA 1AKSA 1YYY1 2KAIB 1TQ0B 2FXRA 3ZZDA 2FI4E 2JH5D 2A4GA 2ODQA 4DY7B 1TFXA 3QGJA 2TRMA 3GDVA 1H8IH 4TYDA 1CT4E 1FMGA 2HWLB 3NKKA 1GJDB 4YM9A 2BD8A 4K69A 3P92A 1LHFH 2ODPA 1EASA 2D1JA 2G4UA 2GKVE 3EQ0H 1BMLA 2ZO3H 1SSXA 1P2NA 5HGGA 1Y8TA 2W3KA 1GMDG 2Z7FE 4LXBH 1F5KU 1EXFA 1FXYA 1YPLH 1MAYA 4ABAA 3S9CA 4AYVB 4A5TS 2TGPZ 3ZVAA 1PFXC 2WUCA 2H9HA 3K6YA 1W2KH 2Z3DA 1IQIA 4ASHA 3MFJA 1LVBA 3RDZA 1E35B 2UUKB 1C5SA 1AO5A 4Y7AA 2FWWA 2ZU2A 1MZAA 1NFYA 4FUJA 4Y0YE 5AF9H 3IITA 1LO6A 1ZTJA 4BANB 4YESB 3H7TA 2BTCE 4ISIH 3D49H 1TGTA 3P95A 3TJOA 1HAZB 2PKSC 2D8WA 3EAJA 1DUEA 3GCHC 4GCHG 3SJ9A 3OSYA 3HGPA 1ORFA 1AI8H 2CHAB 4B1TA 4TPIZ 4X6PA 4K1EA 1SB1H 2HPQH 3SI4H 3WY8A 2Q6FA 1NRSH 4KKDA 3M5NA 1YGCH 4F49A 1RRKA 3B8JA 1AB9C 1MU8B 3VXFH 2FYRA 2ZDNA 4JYTA 1QA0A 4XSKU 1GJ8B 1A0JA 2ZDKA 1NM6A 2ZGJA 1W0ZU 1GMHF 2Z9GA 1ETTH 3ZVCA 1J9CH 1CGIE 2FZZA 3W95A 1CQQA 4GSOA 1XXFA 3LONA 1NFXA 3B9FH 1TBRH 4I31A 4CRGA 3S7HB 4FUGA 3DFJA 1BTZA 5GIBA 2Z9JA 4Y79A 3PMJA 3UREA 3QWCH 1UTKA 2EI8A 1O2XA 3MNXA 4K1TA 1UCYH 2BVRH 1SGRE 2PTCE 3KHVA 4IGDA 4A1TA 2SGPE 3ZZAA 1AE8H 1BBRK 2G5NA 5L2ZH 2J34A 1HAVA 2OBQA 5GDSH 1SQTA 3BF6H 1D3PB 1KDQA 1MKXH 1SGTA 4X1RU 5GCHG 1WBGB 3GCTG 1S83A 3ATIA 2P3TB 1TLDA 2VH0A 1GBLA 3TH2H 4O9VA 3BTHE 1FI8A 2HOBA 1CU1A 1GHYH 2R3YA 4HI3A 4BXWA 1VGCC 2ZCKP 3TK6A 4YT7H 1T8NA 1O3CA 3O8RA 4TPYA 1GBEA 2C8ZB 8KME2 1KLTA 1H1BA 4ZKOU 1W10U 1QL8A 1ZMNA 1QB9A 1WOFA 5T6GA 1GI4A 1IAUA 3GY3A 1O2LA 2FS8A 3BTEE 1ABJH 1S85A 3URDA 1C1QA 1C1TA 1LQDB 2O8WA 2BY9X 1A5IA 1P2JA 5DGJA 1W7GH 4AYYB 5HM9A 1XXDA 1PJPA 4J1YA 2R2MB 3C1KA 1BMMH 1ZRKA 1C9TA 4A92A 4KP0A 1KXAA 3GY7A 1TPOA 1SVPA 2CXVA 2OC1A 2BX4A 2PKSB 1VITH 3A7ZA 2YOLA 3GCHB 2F3CE 1QIXB 2TBSA 2ZFRH 3SGQE 2QC2A 1HNEE 3A8AA 1O5CB 4HGCA 5DKMA 2A5KA 3FZDA 4TY7A 1KXFA 1T32A 3PWBA 4NZLA 2SNVA 1BTYA 4CRDA 5DP7A 4M7GA 5CMXH 1S0QA 1AB9B 4U30A 3RU4D 9ESTA 4RN6A 1GMDF 4ABJA 1RJXB 5HM2A 1MTNC 1P2KA 1V2UT 4CRFA 1Y3UA 5FBEA 2ZHWH 7KMEH 2C8WB 2H2ZA 4WMEA 3SZNA 1H9IE 1DPOA 2OC8A 1GCDA 1TNIA 2VIDA 1DOJA 5A0AE 1DICA 1YKTA 2P3FH 3TJUA 3GOVB 3PMBB 4UDWH 1B5GH 3UR6A 2PUQH 1TE0A 1IQKA 2ZF0H 4UD9H 2ZU5A 3A7WA 1JMOH 1O2QA 5EODA 1XUHA 1FLEE 2ZPSA 2Z9IA 1UVSH 2XWAA 4CR5A 1TGCA 1AUJA 1QRWA 3OU0A 1C2GA 2ZWLH 3K2UA 1W12U 2PSYA 1DSUA 4AOQA 5BPEA 1HXEH 3M3SA 7ESTE 4D76A 1T7CA 1UJ1A 3CS7A 3LIWA 1INCA 1SFIA 1FAKH 1KIGH 2BDIA 1FDPA 1PYTC 2HVXA 1Z6EA 1LQEA 1SGCA 3RU4E 3SU5A 4MPVA 3LJOA 2QA9E 2QF3A 4BTUB 1QNJA 1GBFA 1AIXH 1GJ9B 4KTUA 1VGCB 2THFB 4H4FA 1ZOMA 3MU5A 1AZZA 2ZGCA 1O31A 2A7CA 2RG3A 2P93A 4DT7B 2XBVA 1EZSC 1JBUH 1TAWA 4JZDH 3EGKH 1VCPA 2ZQ2A 3RXHA 1TOCB 2CMYA 4DJZB 4GLYA 3UUZA 4ABDA 1PPFE 4NG9H 5C2ZA 5FCRA 1C2JA 1GG6C 1O3OA 3M35A 1GBAA 1KLJH 2Y5GA 1QJ7B 1BOQA 3BSQA 3LJJA 5C5NA 5FX5A 4H42U 1O3FA 3DUXH 5T6FA 3I77A 2W5EA 2XCFA 4O3TA 2FYQA 3RLWH 2GMTC 1PPGE 2ZDLA 1O3DA 1BJVA 3URCA 2AIQA 4OS6A 2FLRH 8LPRA 5SGAE 4D7GA 1PPBH 1UTMA 2RDLA 4B74A 1AVGH 1BZXE 4X2XA 1XX9A 4UFGH 4GUXA 3QX5H 1ZTLA 4I7YH 4AORA 2HPPH 5C67A 4AB9A 1GHBG 1P10A 4JK6A 1CVWH 1OP8A 4SGAE 3ATKA 4D7FA 3BTGE 2VWLA 4B75A 1HV7A 2RA3A 3T2NA 4WWYA 2A31A 1G3DA 4A7IB 4NWLA 3E0NB 4I32A 3U8OH 1MTNB 2GCTC 4O3UA 1V2RT 1O2PA 3PB1E 5EQQA 4ABFA 2AMQA 4WVPE 1DM4B 1MD8A 2CGAA 1GBKA 3VB7A 3RM2H 5C1UA 5DP3A 5FBIA 1FAXA 2B9LA 3QTVH 4Y71A 1KTTB 2Z9KA 1GBBA 2HNTE 1SGFA 1B0FA 1O2NA 3AW0A 1TB6H 2ZU1A 4IMZA 5FXLA 3TH4H 1XUGA 1O2YA 4ABEA 1HAIH 1Q3XA 1ZGVA 2ZHEH 1P2OA 1GJ7B 1RTLA 3SGBE 1TABE 1T8OA 1C5ZB 3RUOA 1K2I1 3M5MA 3PTNA 1XUJA 2D2DA 5LPRA 5EGMA 2Z3EA 1NROH 2ZA5A 3SV6A 3AW1A 1NU9A 1LKAA 2AMPA 1Y3VA 3SNCA 2VVUA 1T31A 1HB0B 2PGQB 3ZZ8A 1JXPA 2QAAA 4A1VA 1V3XA 4WH8A 5DPAA 1S5SA 1C2EA 4BOHA 1AQ7A 1NRQH 1W14U 3MNCA 4INKA 4CR9A 1C9PA 4Y6DA 1C5TA 5I46H 1DLKB 5HMAA 2BY8X 2OP9A 4FVBA 3FP7E 1Y5UT 1Z6JH 3OTJE 1ZPZA 1IHTH 1O2UA 4Z6AH 2QXIA 3DT0H 1YPKH 1C5XB 4X0WU 4B73A 2STAE 3A80A 4FVDA 5IYTA 3ZZ5A 3SU3A 1HJ9A 1GG6B 1EX3A 1A0LA 2ZHQH 3RXDA 2PW8H 2PUXB 4FU8A 2QCYA 4A6LA 2TPIZ 1WCZA 4GHTA 3ZZ4A 3DFLA 4NFEA 5J4QA 1NY22 1L0ZA 3RU4T 1TGSZ 4JK5A 3RXSA 5A8YA 2GMTB 2KAIA 3SBKA 3QDZB 1TOMH 3M7UA 3KIDU 1DY8A 4E7RG 5AHGH 1O5GH 1OYQA 4R0IA 1BJUA 1UK4A 3V13A 1ID5H 3UY9A 3P8NA 1UMAH 5EXLA 2VIQA 1D9IA 5E0HA 1GDNA 1GDUA 1O3NA 1A1RA 5LGOA 3FVFB 1Z71A 3IWMA 4Q2KA 3UFAA 2H9TH 1GJ4H 3EDXB 4I33A 2BD4A 2BLOA 1TIOA 3A83A 2GCTB 2TGTA 8GCHF 5GWZA 3RC4A 4I8GA 1A5GH 1QQUA 1FN8A 3F9EA 1EOLA 2VIWA 5ETXA 4AN7A 1WQSA 3E16B 2AYWA 1C4V2 1J17T 1L1NA 1SLVB 3AASA 1GI3A 1ELAA 1AWHB 4ZKRU 2ZTZA 5DP9A 4ZXXH 6GCHF 2OINA 1G37A 2FTMA 2G51A 3TIUA 1JWTA 4CH2B 1HDTH 3S9AA 2XYAA 1L4DA 1EB2A 2F9NA 1D3DB 1XKAC 1Z1IA 3GYMA 3P6ZB 4D9QA 4X8TH 3SNDA 1C1OA 1XVMA 2XC4A 3NUMA 1IQHA 3ZVBA 2R9PA 1O2KA 1GMCG 1EUFA 1O3GA 4FU7A 2ZC9H 1RS0A 1GI5A 2UWPA 2G8TA 5PTPA 1C5OH 3SJKA 3SNBA 2O8LA 1K1IA 4Y8YA 1W0YH 2BX3A 1MU6B 3ODDA 1GL0E 1G3CA 2AIPA 2FX6A 3BV9B 3TNSA 1SOTA 2I6QA 3ELAH 1Q2WA 2W7SA 1C2LA 2FOCA 1UTQA 2DUCA 2QV1A 1Y59T 4MVNA 1KXBA 1V2QT 1EATA 4ZH8A 4YZUA 2ZGBH 5F8TA 1ZPBA 2VNTA 2HNTF 3N7OA 4BAOB 2XBWA 3BIUH 3K9XB 1MBQA 3TGJE 2A5AA 2GTBA 3VPKA 1J15A 1E37B 1HIAB 4BAKB 1CE5A 4OS1A 4H6TA 1G2LA 5FPTA 1H9HE 2QGRA 4JCNA 2FOBA 3Q76A 4DG4A 2O8UA 3RMNH 2ZFTA 2Q6DA 2WINI 1D3QB 1AWFH 1P02A 1IOEA 1P09A 1BB0B 1TX8A 1FONA 4HTCH 1GL1A 5FAHA 1JRSA 1QFKH 1YPGH 5JBCS 2UUFB 1QBOA 2ZPRA 4WH6A 1EJAA 1MKWH 1JRTA 3ZZ7A 2V3HH 3MWIU 2FODA 2EA3A 1YPJH 1GHAF 3ZVFA 1O3AA 1GHVH 4NSVA 3M7QA 4ABBA 1PQ7A 3MNBA 1AHTH 1SLUB 1MH0A 2VINA 1V2OT 1CHGA 2NU4E 3I29A 4X1NU 3HATH 2VIOA 4THNH 1LTOA 1TPAE 4ABHA 2YNBA 1SGEE 3MHWU 1ESAA 3T5FH 1O38A 1EAWA 2ZDVH 1V2JT 1V2PT 1F92A 2VVCA 1GJAB 1SLXB 5CE1A 1QQ4A 5HYOA 1QJ1B 4AGKA 2GV7A 2FOMB 2ZEBA 1D4PB 1TWXB 2G4TA 3UR9A 5CHAC 1HAOH 2FEQH 4ABGA 2O8MA 4Q80A 4XDEA 2BQ7B 1O34A 1QJ6B 1V2ST 1PPCE 3KQCA 2BD9A 1TNKA 5DJ7A 2VJ1A 1MUEB 2BDGA 3RM0H 1CSOE 1BDAA 4DOQA 1C5UA 5JYIA 3T62A 1EKBB 1ZJKA 2BY5X 3PLPA 1KY9A 4Y11E 2VVVA 4ZUHA 3MOCA 1ZHMA 2CF8H 6CHAC 1O33A 3LDXH 3PLBA 4GAWA 4KTSA 1DWEH 1FY4A 4B2BA 1NT1A 1S6FA 3SOSA 2FI3E 1SG8B 1VCWA 2ZKSA 1UTNA 1XMNB 3M3TA 2BLVA 1OYTH 1C2HA 1SC8U 2GZ8A 2ZTYA 2EEKA 1YPHE 4CHAC 2C3SA 1UTPA 3RC5A 4ZMAH 2PTNA 4X6OA 2FOHA 3GY8A 3ZYDA 1UK3A 1O2OA 2Y5FA 2VWNA 1NS3A 3EE0B 4JZIA 2F91A 1ZHRA 2F83A 3UOUA 4FUBA 2BOHB 4RKJB 1DT2A 2G5VA 2ZFSA 1QR3E 5A2MH 2XCNA 2GDDA 1GI1A 2A2XH 4YOIA 4IS5A 2BDHA 1E36B 1EZQA 4QT8C 2OC0A 2ZGHA 3BTDE 2GX4A 1LVOA 1YC0A 4NFFA 1SOZA 1S0RA 1C4U2 4OGYA 1THSH 2WPMS 1BIOA 1NN6A 3M7TA 1C5NH 2PV9B 1O5FH 5EQSA 4Y76A 3STIA 1GMCF 5E0JA 1WUNH 1NZQH 3Q00A 1A46H 1KXCA 4VGCC 1O35A 4FXGH 4B71A 2C4FH 3QGNB 1C1VH 3GY4A 3NK8A 1B7XB 2ZGXH 1GJ5H 2A4OA 1OXGA 1MCVA 1DXPA 1O2HA 3L3TA