2BYAX

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2byaX01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2byaX02
1A5GH 4YESB 5LH8A 1CE5A 2FTLE 1FAKH 1J15A 4H6SB 1G3EA 3P8OA 4E05H 1P9UA 2VIQA 7ESTE 1P2NA 4ABFA 1EZSC 1F92A 1YKTA 1C2EA 1MAYA 3BTME 3LT3A 1GMDG 1VJ9U 4ZROA 4B1TA 1V3XA 4IMQA 1QL9A 5JDUB 1TPPA 1AE5A 1BRAA 1DX5M 3MWIU 3SV2H 1W14U 3ATLA 1LHEH 3ZVAA 1F0UA 5EG4A 2PGQB 1P06A 1WV7H 3SBKA 3SORA 3SHCH 1T7CA 3PROA 3AAVA 1RIWC 2A0QB 1MBMA 1O2YA 3RXJA 1TOMH 3FP7E 1EB2A 2FWWA 1G37A 2UWPA 1N6XA 2QAAA 3ATKA 3SU0A 1FLEE 1TRMA 8LPRA 2V6NA 1FN6A 3O8CA 1DE7H 1DM4B 1YLCA 3RC6A 4CHAC 3I78A 1TGBA 2BY8X 4X1RU 2NU0E 5K0HA 2Z9GA 4FUIA 4WJG2 3UNRA 2V3OH 1EATA 2BVXH 1O5BB 4X6PA 3FZDA 4R0IA 1T8OA 1QRXA 2ZHEH 2G5NA 1SSXA 1BQYA 3GCHB 1GI1A 1G2MA 2FEQH 1YC0A 4K8BA 1GGDC 2NWNA 1M9UA 2FYRA 2YNAA 1W3CA 2XBWA 1FY5A 4NFEA 1SOZA 5JPMH 2QC2A 2A5KA 1TNGA 3QDZB 2OXSA 1UTKA 3UR9A 1HV7A 1ZHMA 2G4TA 4LXBH 4Y7AA 1GDNA 4A1XA 4TPIZ 3T62A 1Y3XA 2TGPZ 3MNXA 4MPVA 2BDBA 2G81E 1P0SH 2FOAA 2TGTA 5TCAA 4ABBA 1DS2E 2VVUA 5T6DA 3RXFA 3GDSA 2G4UA 3FP8E 3K6YA 1GHAF 3CENA 3MU5A 1XX9A 6LPRA 3MFJA 2FODA 3I29A 3GOVB 2GDEH 1DXPA 1O2PA 1O3LA 1MTNB 1P3EA 1ZR0A 4FU7A 1SGFA 1HB0B 2PUQH 1IQJA 3A86A 3SUGA 1QL7A 2GV6A 3UFAA 1L2EA 1ZTLA 1O39A 1D3TB 3F1SB 2VIWA 3PMHB 4GHQA 4NIVA 5FBEA 4KELA 1RD3B 1AB9B 3RXRA 4ASHA 1QGFA 4B73A 4A1VA 2OC1A 3A80A 3KEEA 4Y8ZA 4BAMB 2EI7A 4Y79A 1W2KH 2ZU4A 1O3NA 3ZYEA 1VCPA 1S82A 2BD5A 1F5RA 1XXFA 2Z9LA 4DGJA 2BVRH 1C5LH 2TGAA 1GHAG 1KXBA 1P10A 3SQHE 4YT6H 3ZZCA 1BOQA 2J92A 3HGNA 5EXMA 2B0FA 2W3IA 5DP8A 1A7SA 1IHTH 1DWCH 1XUJA 4BOHA 1SBWA 1TPSA 3OX7U 1TABE 1WCZA 5C3NA 4Y8YA 1C5SA 1UJ1A 1WBGB 2VGCC 3F6UH 3LGYA 3TJVA 1DSUA 2D26C 2Y82A 1HYLA 2PSYA 3LGWA 5H4IB 1CVWH 2O8WA 4IS5A 2ALVA 4Q7YA 1XUFA 3M5LA 1H9LB 3RP2A 1WU1A 1T8NA 1ZPBA 1ZJKA 4D7FA 1H8DH 4Y76A 4UONA 4CRGA 2PHBA 8GCHF 9ESTA 3GYLB 4Q7XA 2XBXA 1O2MA 1BRCE 1GJCB 3ZVDA 2ZEBA 1HIAA 1V2JT 4IC6A 1GDQA 1O32A 1DVAH 2Q6GA 1OWJA 4NA8A 3SU5A 5DP3A 2W26A 1EJNA 1MH0A 2AGGX 2AGEX 4Y0ZE 3NPSA 1YPHC 2G51A 2PUXB 2CXVA 5AVDA 4WMFA 5JB9S 2BLQA 2GD4B 2ZU3A 2UWOA 2FMJA 4HZHA 1FJSA 1A1RA 4NWKA 1C5OH 3RXPA 1GJ4H 3ATWA 1FNIA 3SNBA 1Z6JH 4NIYA 1ELAA 1NFWA 3W94A 1AWHB 1O2UA 1DICA 3VXEH 3HGPA 2PV9B 8GCHG 1A5HA 1HXEH 1CHGA 2H9EH 3FP6E 2BVSH 1S85A 4YOIA 1UO6A 2B5TB 4CH2B 5HGGA 1ARCA 1DANH 1V2ST 3TIUA 2FOMB 1AFQB 3E0NB 5FCKA 3M7UA 2FS8A 1ZOMA 1ZPCA 1TFXA 1LPZB 3ZVFA 2H6MA 5GCHF 2A7CA 1SGTA 1H1BA 2BQ7B 2BB4A 3JZ1B 1GI0A 2ZTYA 1O2RA 1SLWB 1P01A 1C2KA 4HI3A 1GI5A 1A46H 1O3FA 2FOEA 3GY3A 1TRNA 3PMJA 3RLWH 1IHSH 4MPXA 4X8VH 3RXLA 3MU8A 2Y5HA 4DCDA 1AI8H 2ZECA 2DUCA 4U32A 1P8VC 2DE9A 4CRAA 1EOLA 4AN7A 1LVMA 4XBCA 5GXPA 4A1TA 1XUGA 1EJAA 3RMNH 2ZU2A 1JBUH 1VGCB 1HJ9A 1ELCA 2HNTF 1C2FA 5GCHG 3MO6A 1MMJN 4UD9H 1ELBA 1C1TA 1QA7A 3STIA 1GBMA 3EA8A 4JZDH 3UIRA 1W10U 2ANMH 1ABIH 2XBYA 4ZKSU 1QB6A 1TALA 1O3HA 1YPGH 4XBBA 3ZZ3A 1THPB 4AGJA 4HTCH 1FY1A 3K2UA 3M37A 1AO5A 1SB1H 1O2IA 2BTCE 4GUXA 4ABHA 1P2QA 2ZDKA 5F8TA 1UCYH 3A83A 1AVWA 5JBCS 2BMGB 5DG6A 1TGNA 1C9TA 2W7SA 1HAIH 1G3DA 1QQUA 1GJ7B 3BIVH 1OP8A 1FY4A 3PWBA 3L33A 4NWLA 4ESTE 1BBRH 2NU1E 2H5DA 1AUJA 2OBOA 1HLTH 4KGAA 5JBBS 1GBIA 1QJ7B 3GCHC 3NWUA 3ODDA 2ZWLH 1XVMA 3RMMH 1AWFH 3RC5A 3BTWE 1ZTJA 3A7YA 3JZ2B 2CN0H 1P03A 1OOKB 3U98H 4B2BA 2BDIA 2GV7A 1C2MA 2HPQH 4MNWA 4A5TS 4I31A 3H7TA 1EUFA 2GZ9A 1AUTC 2JKHA 1P2OA 4Z6AH 2ZGCA 5GPIB 3S9AA 1PYTD 3SU1A 5GIBA 2UUFB 2Z3EA 4WWYA 4K69A 1A0JA 1TX8A 5A0CA 1KSNA 4OGYA 4ZXYH 3A85A 3TK6A 2TRMA 1MTNC 1LHFH 3A7VA 4NCYA 1FIWA 4I8GA 5A8ZA 3LDXH 1TX7A 1EJMA 1ZGVA 2RDLA 3QTVH 4A7IB 1NU9A 1F0RA 2BDHA 1E36B 3O8RA 2RG3A 3BTFE 1AB9C 1ACBE 5J4QA 3F9GA 2OCVB 3SUFA 1GJ9B 2PKSB 3M5NA 1ESAA 1RTFB 4X8SH 1BRUP 3HATH 5T6FA 2D2DA 3N7OA 2HVXA 1HAOH 1GJ5H 3GICB 2B8OH 1OKXA 4YT7H 1AKSB 1QTFA 2XCFA 1KDQA 6CHAB 5ETXA 2PLXA 4YTAA 1HRTH 4YLQH 4K1EA 3VGCB 4AB8A 2OQUA 2XWBI 1W12U 4OS6A 1SGYE 3T28A 1K1NA 5LPRA 4K1TA 2ALPA 3ESTA 2QF0A 1BJUA 3DUXH 1TQ7B 3RXOA 1GCTB 3DFLA 3RXKA 3FANA 1QHRB 2PFEA 1HFDA 7KMEH 3SQEE 3QO6A 2SGQE 1V2TT 2QY0B 4Y8XA 2CV3A 3IG6B 3EGKH 3RMOH 1SFIA 4K60A 5EW1H 4OS2A 1Z6EA 4ZHAA 1C1QA 1A0HB 3NXPA 5AFZH 3SGQE 3HK3B 1OP0A 1ARBA 1O2ZA 4XOJA 1P12E 2HGTH 4TPYA 3PO1B 5EU8A 4UFDH 1Y5UT 1P09A 2WINI 4SGAE 1YCPH 1D6WA 2GKVE 1TGTA 1C5YB 1AKSA 3SJ9A 1W0ZU 2J95A 3TK5A 1AHTH 3D23A 4IW4E 4WH6A 1TNLA 1EPTB 1JIRA 2NU3E 2I6SA 2SNWA 4Q7ZA 3GY8A 1W7GH 1WAYB 2ZCKP 5E0JA 5HMAA 1PQAA 1GBHA 3SV9A 1FQ3A 1VZQH 2O8MA 3D65E 1OWHA 2F91A 3QWCH 3IITA 3P6ZB 2HPPH 2FI5E 2PWXA 3T25A 2Z3CA 3SNEA 1AIXH 4MVNA 1ELTA 5EQRA 2QXGA 3UQOA 3CS0A 2SGDE 1DLKB 3ELAH 1SHHB 2IJOB 4WXVA 2FTMA 2QXHA 2GT7A 2O8UA 4IGDA 2ANWA 2FOFA 5AF9H 3BTGE 1BT7A 1AFQC 2FI3E 2Z9JA 1O2VA 4NA9H 2V35A 3RMLH 1DWDH 2FLRH 1O2TA 1LQDB 2FOCA 4X8UH 1UTOA 5E2OA 2NU4E 1F7ZA 2QV1A 2Z9KA 1ZTKA 4TYDA 3LU9B 3ZV9A 4X1PU 4LOYH 1DY8A 1P9SA 3EQ0H 3QZRA 1GVKB 1HJ8A 4A92A 3LGVA 3SGBE 1SVPA 4ZHLU 2AYWA 3MO3A 2GCHF 4D9QA 2AMDA 2CMYA 5I46H 2G55A 1PQ8A 1T4UH 3ZZ6A 4B2CA 4DJZB 3SHAH 1CA8B 1WTGH 3S9CA 1J9CH 1O2XA 1GI2A 1C5VA 3SGAE 2VVCA 4FUJA 3PLPA 1OS8A 2ZDMA 4ABAA 4J2YB 1VGCC 1UVTH 3ZZ7A 2GVFA 1NZQH 3KNXA 3QZQA 2B9LA 1LHCH 4JYUH 1O2QA 4CRFA 2FPZA 3L3TA 3KF2A 2OUAA 1HAGE 2FX6A 5LGOA 1BMNH 1DSTA 1SGRE 4QT8C 1B7XB 1RS0A 3LGTA 1VJAU 2F9NA 2GZ8A 2XWAA 1O37A 2HRVA 3BTQE 1BITA 2GCHG 1GHBF 3VXFH 1O2WA 2A2XH 3SJKA 3PYHA 1DUAA 1MBQA 2XC0A 4CRBA 2ZCHP 5LPFA 1PJPA 3VFEA 3AW1A 1SQOA 4FUDA 4TY7A 1UMAH 2VWOA 3PV4A 2OLGA 3A8CA 1J8AA 1W0YH 1MU6B 1V2UT 2BD8A 1IQHA 2JH5D 5C20A 1GBFA 2HLCA 2ZNKH 2A31A 1SG8B 4BAKB 4Y0YE 1D9IA 2Y5GA 1K1PA 2ZGHA 1N8OB 5FX5A 4K8YA 3TK9A 3MHWU 5A0BA 1ELGA 4INLA 4DT7B 1HNEE 3VB6A 1GJAB 1TGCA 1YBWA 4VGCB 4X0WU 3KQCA 2IOTA 1OYTH 1Z1IA 1GHBG 1GPZA 1GWAA 4BANB 2OD3B 2A4GA 1NROH 1MCTA 2A2QH 1ELDE 2CF9H 2G00A 1Z8RA 4NZLA 1PPEE 1L4ZA 1LPGB 4H4FA 1J14A 4ISIH 4K3JA 1V2QT 1SQAA 1ZGIA 1S0RA 2BDCA 1A3EH 2BOKA 1NO9H 2LPRA 5EODA 2EC9H 3C1KA 1Z7KA 4ISHH 1BB0B 1NC6A 2ZQ2A 3BEFB 2AEIH 1G32B 3FFGA 1D3DB 1O36A 1GHWH 1KXFA 2VWLA 4F4OC 3UPEA 1C2JA 3PTNA 3SOSA 1EKBB 1O3OA 2PSXA 5C2ZA 1Z8IB 4AORA 2SNVA 3OTJE 1Y5AT 2ZFFH 3M7TA 4M7GA 1ABJH 1EZQA 3K9XB 2A5AA 3OYPA 1WYKA 2BY5X 2ESTE 5GJ4B 2AIPA 3Q00A 1ZSLA 1ZPZA 1PQ7A 3A84A 3O8BA 5DP6A 2XBVA 1S6HA 1C5MD 1O3EA 1YPHE 4NGAH 1UCYK 2PKSC 1SHYA 3ODFA 4MNVA 3TGKE 1KLIH 1HIAB 2VIOA 5K7RA 4TY6A 4A6LA 1EZUC 2WUBA 3SN8A 4F49A 3KN2A 1V2MT 1TA6A 2FYQA 1RJXB 1HXFH 3PM3A 5DP5A 3A88A 3OSYA 1H9HE 3ATIA 1XVOA 1EAIA 1C1UH 3Q3XA 3MH6A 1SLXB 2SGFE 5TCCA 4MPWA 1BBRK 1GI3A 3DA9B 2CJIA 4CREA 3VGCC 4I8LA 2A7JA 1P3CA 4GLYA 1MTUA 1NTPA 2R2MB 4BXSA 1F5KU 5L6NH 1CGHA 1UTLM 2VIDA 3V13A 4ABDA 5L2ZH 2Z7FE 1MD7A 1VR1H 2OTVA 4K5ZA 4OS5A 1UTNA 3O8DA 4UDWH 1GCTC 3K6ZA 1ZRKA 1CA0B 3BSQA 1T8MA 3B8JA 3BN9A 1C4V2 1C5TA 2A45B 3V7TA 4AX9H 1EB1H 4B2AA 1HAVB 2AMQA 1UTJA 1H8IH 1RFNA 3RDZA 3BEUA 4UE7H 3ZZDA 1ETTH 1GVZA 1U6QA 1T4VH 1S6FA 1KTSB 1KXCA 1CBWB 1Q31A 2XTTB 2P3UB 2G8TA 1AVXA 3PO1C 4ABEA 1K2I1 2WPIS 3RXCA 4CBOA 1EAXA 2FI4E 1E38B 1T31A 4IN2A 2OC7A 3RXGA 2ZFPH 1XKBC 3QUMP 1SGPE 4XDEA 4D7GA 1V2LT 2NU2E 3GY4A 3OY5U 1ANEA 1NFYA 4FUGA 2F9PA 1GHZA 4AYYB 1D3PB 1TRYA 2FIRH 3TJOA 1CO7E 1EPTC 1AMHA 1QBVH 5JBTA 1V2NT 7LPRA 1C1WH 4WMDA 3UWJH 1E34B 1VITH 5IYTA 1P04A 1P11E 3EAJA 2IPHA 3MTYA 4LZ1H 2HWLB 3ZZ5A 2ODQA 4AZ2B 1C1OA 4MDSA 2ZGXH 1Y3WA 1KLJH 2ZIQH 3EYDA 4OGXA 1YYY1 2ZP0H 1HAVA 2ZO3H 4WF8A 3FZZA 1NRPH 4RKJB 4JMYA 1UK3A 1C5QA 1O5DH 1QA0A 4E7NA 1A2CH 1BHXF 1V2WT 2QGRA 1GCDA 2ZKSA 1V2KT 2ZFRH 3TGIE 3SJIA 1UK4A 1WQVH 2BX4A 3NKKA 4RN6A 3TH2H 2UUYA 4RKOB 4B74A 1SGNE 4NZQA 3GY7A 2CHAC 3RM2H 2EI8A 4TWYA 4DIIH 3MH5A 2H9HA 2C93B 2Y81A 1ZSKA 1K22H 1AN1E 4GCHF 4X2YA 5GDSH 1ZMNA 3ZVBA 3NK8A 3UNSA 1NESE 2ZHWH 3A8AA 4X6MA 1TWXB 2R3YA 1XUKA 3QN7A 3VPKA 4AB9A 1XXDA 4Y6DA 1SI5H 2BDGA 1HAHH 1TGSZ 3RU4E 3EE0B 3AW0A 3QGJA 1BTPA 4KTCA 2BYAX 2EEKA 2Z9IA 4I8KA 2WPJS 2ZDLA 4WH8A 3P70B 2OP9A 1HGTH 4K2YA 2OQ5A 2VH0A 1C2IA 3LPRA 3QX5H 2PW8H 5G4BA 2JH0D 3E91A 2OC8A 3U8OH 1ETRH 4GCHG 2H1UA 2M5TA 1V6DA 2BZAA 2ODPA 2P59A 1AE8H 3V3MA 3BG8A 2XYAA 3RXEA 1WSSH 1O34A 1O3JA 3SV6A 2AGIX 1THSH 2ZC9H 3RXUA 2J34A 1KLTA 2R0LA 5GWZA 1HAXB 4AFQA 1HBTH 3RXTA 4DOQA 1Q2WA 4FVDA 1FXYA 4YZUA 4B76A 3MI4A 3ITIA 1ZJDA 4H6TA 2P94A 3B9FH 1C1SA 3BTDE 1TYNA 1QB1A 3TH4H 2RA3A 4AFUA 1DPOA 1PPZA 1Z8GA 3UWIA 1N8OC 1P2MA 2P3TB 1TBQH 5HXFA 1MAXA 5SGAE 1GBTA 1MD8A 4O3UA 1YP9A 2ANKH 1F0TA 1BTHH 1TB6H 2C8ZB 1G3BA 1DWBH 4VGCC 2H5CA 3KIDU 2UUJB 1AU8A 3QK1A 4BTTB 1OPHB 2BDYA 2QA9E 2BXUH 5EGMA 1GBCA 5EOKA 3QLPH 1O3AA 1GMCF 2Y7XA 1MZAA 1QJ1B 1KDQB 3MU4A 4ABIA 1F0SA 2VWMA 1TOCB 2OBQA 3SU3A 4B75A 4SGBE 1ZLRA 2G5VA 1P2KA 1OXGA 2ZGJA 4BAHB 1HDTH 2ODYB 3AVZA 8ESTE 3UR6A 3RLYH 3A82A 3BTKE 1FZZA 3E0PB 2AIQA 2GT8A 4YOGA 3TGJE 2D1JA 2Y5FA 3SI3H 1O5GH 5A8XA 2O8TA 2FXRA 1GBKA 1C1NA 1TX6A 5PTPA 3ZVGA 2A7HA 1FIZA 2VJ1A 3E8LA 4X1NU 5ESTE 3U8TH 1OWKA 1GI9B 2IN2A 4DY7B 3PMAB 1FN8A 4CRCA 1G3CA 1XUHA 2PTCE 1FPCH 5C5OA 1GMCG 1Z1JA 2Q6FA 2DE8A 1DT2A 3LONA 1GDUA 4JYTA 2J9NA 2PTNA 2R0KA 3MMGA 5T3HA 1A61H 2FM2A 1BZXE 2SGPE 2WV4A 4NFFA 1YPJH 1BTYA 1TAWA 1ESBA 1NRSH 1TMTH 1TNHA 2EA3A 1LKAA 1A4WH 4I8JA 3U8RH 1Y3UA 1ZHPA 2A4QA 1BMMH 3GYMA 4B71A 3BG4B 2C90B 5FX6A 3T2NA 2TGDA 4GPGA 2A1DB 2TBSA 1BUIA 1UVOA 3PMBB 1DFPA 5F03A 1CA0C 1KY9A 1UVPA 1S0QA 4TWWA 4BAOB 3TPIZ 1AY6H 3Q3YA 1TMUH 1DDJA 4IMZA 2GMTB 3M3TA 1MTSA 1IOEA 1J17T 1E37B 1G36A 1TLDA 3SV8A 3RXVA 1CBWC 3GDUA 1T32A 1CT2E 3MU1A 4DW2U 1O2JA 4CH8B 3UNQA 1CT0E 5A0AE 1SOTA 1QCPA 1C1PA 1B0EA 2BOHB 1O3PB 3ZV8A 2P8OB 1FV9A 3PB1E 1GMHF 1JXPA 2ZCLP 1D3QB 1QY6A 1SFQB 4X2XA 2RA0A 1VCWA 1ZRBA 1S84A 1OWIA 4Z0KA 3DT0H 4XFQA 1Q3XA 3HK6B 4ISOA 5EXLA 1TNKA 2ZFTA 2GCTB 3E90B 3EA9A 1BIOA 2QYIA 5AFYH 3UOPA 2BDAA 1FY8E 2J4IA 3RXMA 1FAXA 4NSYA 1IQLA 4YO9A 3RM0H 2BX3A 3A89A 3UY9A 5E0GA 1KTTB 3MYWA 4JZIA 1C2HA 1O31A 1BTXA 1SGDE 3ZYDA 1P02A 5JB8S 1MTWA 1GI6A 2BD2A 3MNBA 4O97A 4JZEH 1H4WA 1F2SE 1GMHG 1O38A 1MTVA 2ZFSA 1YGCH 1AVGH 1B5GH 3KQBA 2QCYA 2Z6BD 3H7OA 4ZUHA 3UQVA 2R2WU 2XC4A 1MU8B 2FX4A 3ZZ4A 1WOFA 4AOQA 3E1XB 3RXSA 3RXHA 1ESTA 2WPLS 1CU1A 3LIWA 4U2WA 1AQ7A 1NM6A 2BHGA 1A0LA 2EI6A 3MO9A 4I33A 4JZ1A 5L30H 2A4RA 3BEIB 2HNTC 5DK1A 1HCGA 1O2OA 3VB7A 5DKMA 2J38A 4IN1A 3GDVA 1OYQA 2ZTZA 1TPOA 5DO4H 3BTEE 1SGQE 3SZNA 1S83A 1Y3YA 5BRRE 2OC0A 1NPMA 1L1NA 1C2LA 5HYOA 1FDPA 2JETB 2F3CE 1GL0E 2FDAA 1F5LA 3BIUH 1ELFA 2ZGBH 4KP0A 1LHDH 1Z71A 3VB3A 2Z3DA 2STAE 1ZHRA 2VIPA 1LQEA 5E2PA 1O3BA 1GVLA 4AGKA 3A81A 4E7RG 1LVBA 1SQTA 3V0XA 2KAIB 1RTKA 1EASA 2GX4A 1KXAA 4INHA 5EXNA 1N1LA 3VB4A 1QIXB 1MKWH 5FPSA 2J2UA 1C9PA 5C1UA 5FAHA 2P93A 4FUCA 1Y5BT 1O5AB 1EAWA 1C1MA 1GBJA 1THRH 4ZKRU 1ZMJA 1YPKH 3F68H 1NS3A 5DP4A 1O30A 1QNJA 1SC8U 4CR5A 4KTSA 5JBAS 3ZZ9A 1ANCA 1PPCE 1C2GA 1L0ZA 1KYNA 2FP7B 1NN6A 4XBDA 1AZ8A 3Q77A 4XSKU 2WPMS 1O5FH 1EP6A 1OWEA 1EQ9A 1TIOA 1TNIA 5EQSA 4LZ4B 3TJNA 1DXWA 2ZHDA 1JRTA 2H2ZA 3P8GA 3TLOA 2BD9A 3PLKA 1IQKA 2BY9X 2BM2A 1L1GA 1YM0A 4IC5A 5CHAB 2KAIA 3S7HB 2SGEE 3U69H 4MNYA 2C4FH 3WY8A 1C5UA 3BV9B 3SU6A 1EZXC 2ZZUH 2XNIA 1LDTT 1NFUA 4Y71A 2XXLA 4GAWA 4UFGH 4D8NA 1KXEA 1LMWB 1D6RA 2THFB 3SO3A 1V2OT 1AD8H 3SNDA 3HKIB 2HOBA 1GG6B 3LKWA 5C1XA 2FOGA 5FXLA 3KQDA 2BLWA 3T5FH 1BMAA 2BQWB 2AMPA 3DHKH 5F8XA 1QRZA 3S0NA 2F9UA 1IQFA 2BD4A 1TQ0B 5A2MH 1NRRH 1O3GA 4WVPE 4ZKNU 3M35A 4X6NA 1UTMA 4X2WA 3RXBA 2ZPQA 4X8TH 4YOJA 1GBEA 4KTUA 1UTQA 3A7TA 2ZA5A 1C1RA 2VNTA 3UREA 4BXWA 7GCHF 4HGCA 1SLVB 2G52A 3GCNA 1SL3A 4MPUA 3Q76A 4ABJA 1FY3A 4OS7A 4BTUB 1SGFG 1MZDA 1DLEA 4MG3A 3ZZAA 1DUEA 4X1QU 2ZPRA 3LJJA 5IDKA 1ID5H 2W3KA 4CBNA 5ESBA 1IQGA 1N6YA 6CHAC 1GI8B 1JRSA 1K1LA 1MQ6A 1BTUA 2WUCA 1UVUH 3BG4C 2AH4X 2F9VA 1VITF 2LNCA 3GCOA 1FPHH 1K28D 3H5CB 1GHYH 3Q3KA 1MKXH 3GCTF 4Y10E 2VH6A 2BD3A 1NRQH 3PWCA 2B7DH 7GCHG 1AGJA 1BCUH 1CGJE 1PQ5A 1FONA 3RXDA 4BAQB 4YLUA 2BXTH 1P05A 2GMTC 1C5ZB 2O8LA 3LH3A 4GSOA 1HPGA 2XC5A 4JK5A 1HJAB 1OSSA 3SV7A 1G2LA 1O5CB 1ETSH 1PPGE 1NFXA 1GBLA 3K65B 2OINA 3SI4H 3F9FA 1YF4A 3TH3H 1LKBA 1EOJA 3RU4D 1ZZZA 2P8OC 2WPHS 1XUIA 4U01A 5DP9A 4MQAA 1VITG 3KQEA 2H9TH 3DD2H 4DURA 2ULLA 1ORFA 2VINA 3GCTG 1QBOA 2W7UA 3ATMA 4I8HA 5DJ7A 2GZ7A 1FMGA 1C5XB 1QBNA 2GCTC 5DGJA 2GTBA 2C8WB 3ZVEA 4OS1A 3T26A 1BDAA 3RXIA 2WYGA 1IQNA 1BHXB 3IWMA 3SU4A 1UHBB 1BRBE 3ZVCA 1K1IA 4I32A 3NCLA 3T29A 4FXGH 3EA7A 1IQEA 3UOUA 4JYVH 1FUJA 2GGVB 4FUBA 6GCHF 2C8XB 2ASUB 2ZDVH 1HUTH 4UFFH 3L6PA 4H42U 1C4U2 3B23B 1TE0A 1QURH 1OP2A 2Y6TA 1LO6A 4JZFH 2GP9B 1SR5C 2P3FH 2ZTXA 1QJ6B 3ZZBA 3TU7H 4O9VA 5B6OA 4THNH 3BTHE 3HPTB 3S69A 4D9RA 1WUNH 3F9HA 1RGQA 2FOHA 1GI4A 1CQQA 1G30B 1XM1A 3P95A 4OS4A 2AERH 1D4PB 3M5MA 1NRNH 1QRWA 1QFKH 4ZAEA 3U9AH 1DITH 2FZZA 1O2HA 1GI7B 1QQ4A 4INKA 3F9EA 1C5PA 4ZXXH 4JCNA 5A09A 2FS9A 6GCHG 3CS7A 1UHBA 2UUKB 1JIMA 2CF8H 1O5EH 2ANYA 2ZU1A 3LJOA 2PKAB 2BY6X 5CMXH 1V2RT 2JETC 2SFAA 2TIOA 3S7KB 2F9OA 1O3MA 1YCPK 4JK6A 3P17H 1W7XH 3AAUA 2AFQB 2PGBB 1MUEB 5F6MA 3FVFB 5A8YA 4ZHMU 3MNCA 1CGIE 5F8ZA 4XE4A 3LC5A 1RTLA 1Z8JB 2JH6D 1P57B 3RUOA 2FESH 4GVUA 4FU8A 4DVAU 1FI8A 4HFPB 2C3SA 2W5EA 1YPMH 1LVYA 3GY5A 2A5IA 4Q80A 2Y7ZA 3TITA 1SPJA 2O9QA 1GBBA 1YPLH 3U1IB 2R3UA 1RRKA 2XW9A 4ISLA 1EXFA 3KCGH 5E0HA 2YOLA 3STJA 1S5SA 1C5WB 3C27B 2UWLA 1TPAE 8KME2 4MLFB 4O3TA 1O0DH 4FU9A 3AASA 3HKJB 5L2YH 2YNBA 5DPAA 3KHVA 4NA7A 5AHGH 2ZDNA 2R9PA 2ZHQH 4NIXA 2PKAA 3SW2B 5EPYA 1RIWB 5C1YA 2ZU5A 4Q2KA 3P92A 3SUEA 1BTWA 2QXJA 4UEHH 4I7YH 4ABGA 1A5IA 1JOUB 1QL8A 3QTOH 3SNAA 4CHAB 3E6PH 4NIWA 3LGIA 2F83A 1INCA 4X1SU 3A7ZA 5FPYA 1Y3VA 1B0FA 3KGPA 4J1YA 1G9IE 1NY22 2I6QA 3OY6U 3P8NA 3A7WA 1K21H 1S81A 3SJ8A 3A7XA 5CHAC 9LPRA 1OWDA 2GDDA 2BZ6H 4AFSA 1GGDB 4DIHH 1O33A 2ZG0H 1CSOE 1XMNB 3TJUA 1LTOA 2VVVA 1YPEH 4UFEH 1C2DA 1JMOH 1GG6C 2ZFQH 4D76A 1PPHE 4R8TB 3EDXB 1P2JA 1HAZB 3M5OA 2WPKS 3PLBA 4ZMAH 1PPFE 5C67A 1HAYB 1C4Y2 4WMEA 4ZH8A 2TPIZ 3LGUA 3RC4A 5FBIA 1WTHD 2HALA 1BA8B 3TVJB 1GHXH 1L1JA 1O2KA 2AS9A 1PPBH 2BD7A 5I25A 3S9BA 5DP7A 1TBRH 1YCPM 2J94A 4LK4A 1Y59T 1QR3E 1GJBB 2CGAA 1MKWK 2A32A 2P16A 3VEQB 3G01A 2RCEA 1GJ8B 1XKAC 1IQMA 3D49H 1T8LA 1KXDA 4WXIA 2WYJA 1TMBH 2BQ6B 3UTUH 1UK2A 5JYIA 5BPEA 4IBLH 3RU4T 5C5NA 4AFZA 1JWTA 4K1SA 4CRDA 2BLOA 3SNCA 3A87A 3M61U 3RXQA 3MH4A 2ZDAH 2BLVA 1C5RA 1O3IA 3W95A 1GJDB 2Q6DA 3LOXA 1ELEE 1HAPH 1GL1A 1O35A 1IAUA 3I77A 3PTBA 4ISNA 1GHVH 2A4OA 4YM9A 5CE1A 1E35B 1GJ6A 1UCYE 2QXIA 1DOJA 4Y11E 1K9OE 1OX1A 3URCA 2D8WA 1ELVA 2QIQA 1SGCA 1Y8TA 1KIGH 1QB9A 2QF3A 5EPNA 1TBZH 2ZHFH 2BY7X 3M7QA 1A3BH 2K1QA 3CP7A 4X2VA 1MQ5A 1TONA 3D62A 1HJAC 3MU0A 1TA2A 3SUDA 2ZF0H 4FUEA 4RSPA 3R3GB 3T27A 2Y80A 3E3TA 1UVSH 1GBAA 1BBRE 1AFEH 1LVOA 1O3DA 3P8FA 5HM9A 2VGCB 1SGIB 3ZZ8A 1LCYA 2HNTE 1ZYOA 3NUMA 4BTIB 3MOCA 1EX3A 4MNXA 1YLDA 2WV5A 2XCNA 4FUFA 1J16A 3E16B 4NSVA 1X7AC 4Y7BA 2QN5T 1V2PT 1VCQA 3TNSA 2STBE 3MH7A 4E06H 2V0BA 2ILNA 3BTTE 1EP5A 1O2GH 1BTZA 4AG2A 1O3CA 3A8DA 4AYVB 1NU7B 4KKDA 3MNSA 1ZMLA 1CHOF 3BF6H 3M3SA 2XRCA 1V2VT 3NZIA 1BJVA 3M3VA 4X6OA 3OU0A 2F9BH 4FUHA 1W8BH 1TNJA 4DG4A 4PROA 6ESTA 2C8YB 3ENSB 2FLBH 1ANDA 1W11U 1RXPA 1GBDA 3LH1A 3V12A 3VB5A 1O2LA 2PR3A 1ANBA 5HM2A 4O03A 4GHTA 1WQSA 5T6GA 2FOBA 1DWEH 5LPEA 2ZPSA 1SMFE 1O3KA 2ZQ1A 1LPKB 2SGAA 3R0FA 1SGEE 1W13U 3QGNB 3GISB 3M36A 2ZI2H 1CHOG 1C1VH 1MKXK 1NT1A 1UTPA 1O2SA 5TJXA 1DY9A 1MCVA 5E8EH 3RXAA 2VB0A 1C5NH 5EQQA 2VIVA 1ZSJA 3SU2A 3A8BA 3LC3A 2V3HH 1LHGH 5J4SA 3SJOA 3URDA 3GY6A 2P95A 5FCRA 5ABWA 3FAOA 1E0FD 1H9IE 2CHAB 2FO9A 3DFJA 1K1OA 1GMDF 2VWNA 2Q1JA 3U1JB 4CR9A 1K1MA 2VU8E 1O2NA 1P2IA 4AG1A 1PFXC 4NG9H 5FPTA 1PYTC 4FVBA 1CT4E 3TNTA 3KL6A 1EPTA 4MTBA 1K1JA 4U30A 3UUZA 4BNRA 1L4DA 3GY2A 4ZKOU 1AZZA 4WY3A 5EW2H 2Z94A 1EAUA 1BMLA 1SLUB 5FHTA 1IQIA
chains in the Genus database with same CATH superfamily
1A5GH 4YESB 5LH8A 1CE5A 2FTLE 3DCLA 1FAKH 1J15A 4H6SB 1G3EA 3P8OA 4E05H 1P9UA 2VIQA 7ESTE 1P2NA 2JDID 4ABFA 1EZSC 1F92A 1YKTA 1C2EA 1MAYA 3BTME 3LT3A 1GMDG 1VJ9U 4ZROA 4B1TA 1V3XA 4IMQA 1QL9A 5JDUB 1TPPA 1AE5A 1BRAA 1DX5M 3MWIU 3SV2H 1W14U 3ATLA 1LHEH 3ZVAA 1F0UA 5EG4A 2PGQB 1P06A 1WV7H 3FN8A 3FKSD 3SBKA 3SORA 3SHCH 5EIYA 1T7CA 3PROA 3AAVA 1RIWC 2A0QB 1MBMA 1O2YA 3F0OA 3RXJA 1TOMH 1EFRD 3FP7E 1EB2A 2FWWA 1G37A 2UWPA 1N6XA 2QAAA 3ATKA 3SU0A 1FLEE 1TRMA 2V3MA 2V6NA 8LPRA 1FN6A 3O8CA 1DE7H 1DM4B 1YLCA 3RC6A 4CHAC 3I78A 1TGBA 2BY8X 4X1RU 2NU0E 5K0HA 2Z9GA 4FUIA 4WJG2 3UNRA 2V3OH 1EATA 2BVXH 1O5BB 4X6PA 3FZDA 4R0IA 1T8OA 1QRXA 2ZHEH 2G5NA 1SSXA 1BQYA 3GCHB 1GI1A 1G2MA 1NBME 2FEQH 1YC0A 4K8BA 1GGDC 2NWNA 1M9UA 2FYRA 2YNAA 1W3CA 2XBWA 1FY5A 4NFEA 1SOZA 5JPMH 3N7EA 2QC2A 2A5KA 1TNGA 3QDZB 2OXSA 1UTKA 3UR9A 1HV7A 1ZHMA 2G4TA 4LXBH 4Y7AA 1GDNA 4A1XA 4TPIZ 3T62A 1Y3XA 2TGPZ 3MNXA 4MPVA 1BMFD 2BDBA 2G81E 1P0SH 2FOAA 2TGTA 5TCAA 4ABBA 1DS2E 2VVUA 5T6DA 3RXFA 5C94A 3GDSA 2G4UA 3FP8E 3K6YA 1GHAF 3CENA 3MU5A 1XX9A 6LPRA 3MFJA 2FODA 3I29A 3GOVB 2GDEH 1DXPA 1O2PA 1O3LA 1MTNB 1P3EA 1ZR0A 3H09A 4FU7A 1SGFA 1HB0B 2PUQH 2QF5A 1IQJA 3A86A 3SUGA 1QL7A 2GV6A 2JIZD 3UFAA 5B6LA 1L2EA 1ZTLA 1O39A 1D3TB 3F1SB 2VIWA 3PMHB 4GHQA 4NIVA 5FBEA 4KELA 1RD3B 1AB9B 3RXRA 4ASHA 1QGFA 4B73A 4A1VA 2OC1A 3A80A 3KEEA 4Y8ZA 4BAMB 2EI7A 4Y79A 1W2KH 2ZU4A 1O3NA 3ZYEA 1VCPA 1S82A 2BD5A 1F5RA 1XXFA 2Z9LA 1SQRA 4DGJA 2BVRH 1C5LH 2TGAA 1GHAG 1KXBA 4AC9A 1P10A 3SQHE 4YT6H 3ZZCA 1BOQA 2J92A 3HGNA 5EXMA 2B0FA 2W3IA 5DP8A 1A7SA 1IHTH 3KYGA 1DWCH 1XUJA 4BOHA 1SBWA 1TPSA 3OX7U 1UW7A 1TABE 1WCZA 5C3NA 4Y8YA 1C5SA 1UJ1A 2KX4A 1WBGB 4B6FA 2F4LA 2VGCC 3F6UH 3LGYA 3TJVA 1DSUA 2D26C 2Y82A 1HYLA 2PSYA 3LGWA 5H4IB 1CVWH 2O8WA 4IS5A 2ALVA 3DSGA 4Q7YA 1XUFA 3M5LA 1H9LB 3RP2A 1WU1A 1T8NA 1ZPBA 1ZJKA 4D7FA 1H8DH 4Y76A 4UONA 4CRGA 2PHBA 8GCHF 9ESTA 3GYLB 4Q7XA 2XBXA 1O2MA 1BRCE 1GJCB 3ZVDA 2ZEBA 1HIAA 1V2JT 4IC6A 1GDQA 1O32A 1DVAH 2Q6GA 1OWJA 4NA8A 3SU5A 5DP3A 2W26A 1EJNA 1E1RD 1MH0A 2AGGX 2AGEX 4Y0ZE 3NPSA 1YPHC 2G51A 2PUXB 2CXVA 5AVDA 4WMFA 5JB9S 2BLQA 2GD4B 2ZU3A 2UWOA 2FMJA 4HZHA 1FJSA 2KM0A 1A1RA 4NWKA 1C5OH 3RXPA 1GJ4H 3ATWA 3NRLA 1FNIA 3SNBA 1Z6JH 4NIYA 1ELAA 1NFWA 2F43B 3W94A 1AWHB 1O2UA 1DICA 3VXEH 3HGPA 2PV9B 8GCHG 1A5HA 1HXEH 1CHGA 2H9EH 3FP6E 2BVSH 1S85A 4YOIA 1UO6A 2B5TB 4CH2B 5HGGA 1ARCA 1DANH 1V2ST 3TIUA 2FOMB 1AFQB 3N99A 3E0NB 5FCKA 3M7UA 2FS8A 1ZOMA 1ZPCA 1TFXA 4DT4A 2KCPA 1LPZB 3ZVFA 2H6MA 5GCHF 2A7CA 1SGTA 1H1BA 2BQ7B 2BB4A 3JZ1B 1GI0A 2ZTYA 1O2RA 1SLWB 1P01A 1W0JD 1C2KA 4HI3A 1GI5A 3DSOA 1A46H 1O3FA 2FOEA 3GY3A 1TRNA 3PMJA 3RLWH 1IHSH 4MPXA 4X8VH 3RXLA 3MU8A 2Y5HA 4DCDA 1AI8H 2ZECA 4RT1A 5DN6D 2DUCA 4U32A 3AK5A 1P8VC 2DE9A 4CRAA 1EOLA 1E1QD 4AN7A 1LVMA 4XBCA 5GXPA 4A1TA 1XUGA 1EJAA 3RMNH 2ZU2A 1JBUH 1VGCB 1HJ9A 1ELCA 2HNTF 1C2FA 5GCHG 3MO6A 1MMJN 4UD9H 1ELBA 1C1TA 1QA7A 3STIA 1GBMA 3EA8A 4JZDH 3UIRA 1W10U 2ANMH 1ABIH 2XBYA 4ZKSU 1QB6A 1TALA 1O3HA 1YPGH 4XBBA 3ZZ3A 1THPB 4AGJA 4HTCH 1FY1A 3K2UA 3M37A 1AO5A 1SB1H 1O2IA 2BTCE 4GUXA 4ABHA 1P2QA 2ZDKA 5F8TA 1UCYH 3A83A 1AVWA 5JBCS 2BMGB 5DG6A 1TGNA 2YMSD 1C9TA 2W7SA 1HAIH 1G3DA 1QQUA 1GJ7B 3UB0A 3BIVH 1OP8A 1FY4A 3PWBA 3L33A 4NWLA 4ESTE 1BBRH 2NU1E 2H5DA 1AUJA 2OBOA 1HLTH 4KGAA 5JBBS 1GBIA 1QJ7B 3GCHC 3NWUA 3ODDA 2ZWLH 1XVMA 3RMMH 1AWFH 3RC5A 3BTWE 1ZTJA 3A7YA 3JZ2B 2CN0H 1P03A 1OOKB 2J97A 3U98H 4B2BA 2BDIA 2GV7A 1S6LA 1C2MA 2HPQH 4MNWA 4A5TS 4I31A 3H7TA 1EUFA 2GZ9A 1AUTC 2JKHA 1P2OA 4Z6AH 2ZGCA 5GPIB 3S9AA 2JJ1D 1PYTD 3SU1A 5GIBA 2UUFB 2Z3EA 4WWYA 4K69A 1A0JA 1TX8A 5A0CA 1KSNA 4OGYA 4ZXYH 3A85A 3TK6A 2TRMA 1MTNC 1LHFH 3A7VA 3WWBA 4NCYA 1FIWA 4I8GA 2EY4C 5A8ZA 3LDXH 1TX7A 1EJMA 1ZGVA 2RDLA 3QTVH 4A7IB 1E79D 2RFKC 1NU9A 1F0RA 2BDHA 1E36B 3O8RA 2RG3A 3BTFE 1AB9C 1ACBE 5J4QA 3F9GA 2OCVB 3SUFA 1GJ9B 2PKSB 3M5NA 1ESAA 1RTFB 4X8SH 1BRUP 3HATH 5T6FA 2D2DA 3N7OA 2HVXA 1HAOH 1FX0B 1GJ5H 3GICB 2B8OH 1OKXA 4ASUD 4YT7H 1AKSB 1QTFA 2XCFA 1KDQA 6CHAB 5ETXA 2PLXA 4YTAA 1HRTH 4YLQH 4K1EA 3VGCB 4AB8A 2OQUA 2XWBI 1W12U 4OS6A 1SGYE 3T28A 3UAIC 1K1NA 5LPRA 4K1TA 2ALPA 3ESTA 2QF0A 1BJUA 3DUXH 1TQ7B 3RXOA 1GCTB 3DFLA 3RXKA 3FANA 4ACAA 1QHRB 2PFEA 1HFDA 7KMEH 3SQEE 3QO6A 2SGQE 1V2TT 2QY0B 4Y8XA 2CV3A 3IG6B 3EGKH 3RMOH 1SFIA 4K60A 5EW1H 4OS2A 1Z6EA 4ZHAA 1C1QA 1A0HB 3NXPA 5AFZH 1OHHD 3SGQE 3HK3B 1YWUA 1OP0A 1ARBA 1O2ZA 4XOJA 1P12E 2HGTH 4TPYA 3PO1B 5EU8A 4UFDH 1Y5UT 1P09A 2WINI 4SGAE 2OK5A 1YCPH 1D6WA 2GKVE 1TGTA 1C5YB 1AKSA 1VKYA 3SJ9A 1W0ZU 2J95A 3TK5A 1AHTH 3D23A 4IW4E 4WH6A 1TNLA 1EPTB 1JIRA 2I6SA 2NU3E 2SNWA 4HG6A 3GY8A 1W7GH 1WAYB 2ZCKP 4Q7ZA 5E0JA 5HMAA 1PQAA 3PV2A 1GBHA 3SV9A 1FQ3A 1VZQH 2O8MA 3D65E 1OWHA 2F91A 3QWCH 3IITA 3P6ZB 2HPPH 2FI5E 2PWXA 3T25A 2Z3CA 3SNEA 1AIXH 4MVNA 1ELTA 5EQRA 2KCYA 2QXGA 3UQOA 3CS0A 2SGDE 1DLKB 3ELAH 1SHHB 4I86A 2IJOB 4WXVA 2FTMA 2QXHA 2GT7A 2O8UA 4IGDA 2ANWA 2FOFA 5AF9H 3BTGE 2KFWA 1BT7A 1AFQC 2FI3E 2Z9JA 1O2VA 4NA9H 2V35A 3RMLH 1DWDH 2FLRH 1O2TA 1W0KD 1LQDB 2FOCA 4X8UH 1UTOA 5E2OA 2NU4E 1F7ZA 2QV1A 2Z9KA 1ZTKA 4TYDA 3LU9B 3ZV9A 2HVYB 4X1PU 4LOYH 1DY8A 2KZ4A 1P9SA 3EQ0H 3QZRA 1GVKB 1HJ8A 4A92A 3LGVA 3SGBE 1SVPA 4ZHLU 2AYWA 3MO3A 2GCHF 4D9QA 2AMDA 2CMYA 5I46H 2G55A 1PQ8A 1T4UH 3ZZ6A 4B2CA 4DJZB 3SHAH 1CA8B 1WTGH 5KGOA 3S9CA 1J9CH 1O2XA 1GI2A 1C5VA 3SGAE 2VVCA 4FUJA 3PLPA 1OS8A 2ZDMA 4ABAA 4J2YB 1VGCC 1UVTH 3ZZ7A 2GVFA 1NZQH 3KNXA 3QZQA 4YXWD 2B9LA 1LHCH 4JYUH 1O2QA 4CRFA 2FPZA 3L3TA 3KF2A 2OUAA 1HAGE 2FX6A 5LGOA 1BMNH 1DSTA 1SGRE 4QT8C 1B7XB 1RS0A 3LGTA 1VJAU 2F9NA 4OM9A 2GZ8A 2XWAA 1O37A 2HRVA 3BTQE 1BITA 2GCHG 1GHBF 3VXFH 1O2WA 2A2XH 3SJKA 3PYHA 1DUAA 1MBQA 2XC0A 4CRBA 2ZCHP 5LPFA 1PJPA 3VFEA 3AW1A 1SQOA 4FUDA 4TY7A 1UMAH 2VWOA 3PV4A 2OLGA 3A8CA 4XD7D 1J8AA 1W0YH 1MU6B 2QE7D 1V2UT 2BD8A 1IQHA 2JH5D 5C20A 1GBFA 2HLCA 2ZNKH 2A31A 1SG8B 4BAKB 4Y0YE 1D9IA 2Y5GA 2W6ID 1K1PA 2ZGHA 1N8OB 1COWD 5FX5A 4K8YA 3TK9A 3MHWU 5A0BA 1ELGA 4INLA 4DT7B 1HNEE 3VB6A 1GJAB 1TGCA 1YBWA 4VGCB 4X0WU 3KQCA 2IOTA 1OYTH 1Z1IA 1GHBG 1GPZA 1GWAA 4BANB 2OD3B 2A4GA 1NROH 1MCTA 2A2QH 1ELDE 2CF9H 2G00A 1Z8RA 4NZLA 1PPEE 1L4ZA 1LPGB 4H4FA 1J14A 4ISIH 4K3JA 1V2QT 1SQAA 1ZGIA 1S0RA 2BDCA 1A3EH 2BOKA 1NO9H 2LPRA 5EODA 2EC9H 3C1KA 1Z7KA 4ISHH 1BB0B 1NC6A 2ZQ2A 3BEFB 2AEIH 1G32B 3FFGA 3WWFA 1D3DB 1O36A 1GHWH 1KXFA 2VWLA 4F4OC 3UPEA 1C2JA 3PTNA 3SOSA 1EKBB 1O3OA 2PSXA 5C2ZA 1Z8IB 2J98A 4AORA 2SNVA 3OTJE 2CK3D 1Y5AT 2ZFFH 3M7TA 4M7GA 1ABJH 1EZQA 3K9XB 2A5AA 3OYPA 1WYKA 2BY5X 2ESTE 5GJ4B 2AIPA 3Q00A 1ZSLA 1ZPZA 1PQ7A 3A84A 3O8BA 5DP6A 2XBVA 1S6HA 1C5MD 1O3EA 1YPHE 4NGAH 1UCYK 2PKSC 2WHXA 1SHYA 3ODFA 4MNVA 3TGKE 1KLIH 1HIAB 2VIOA 5K7RA 4TY6A 4A6LA 1EZUC 2WUBA 3SN8A 4F49A 3KN2A 1V2MT 1TA6A 2FYQA 4F55A 1RJXB 1HXFH 3PM3A 5DP5A 3A88A 3OSYA 1H9HE 3ATIA 1XVOA 1EAIA 1C1UH 3Q3XA 3MH6A 1SLXB 2SGFE 5TCCA 4MPWA 1BBRK 1GI3A 3DA9B 2CJIA 4CREA 3VGCC 4I8LA 2A7JA 1P3CA 4GLYA 1MTUA 1NTPA 2R2MB 4BXSA 1F5KU 5L6NH 1CGHA 1UTLM 2VIDA 3V13A 4ABDA 5L2ZH 2Z7FE 1MD7A 1VR1H 2OTVA 2W6JD 4K5ZA 4OS5A 5F53A 1UTNA 3O8DA 5HKKD 4UDWH 1GCTC 3K6ZA 1ZRKA 1CA0B 3BSQA 1T8MA 2KCAA 3B8JA 3BN9A 1C4V2 1C5TA 2A45B 3V7TA 4AX9H 1EB1H 4B2AA 1HAVB 2AMQA 1UTJA 1H8IH 1RFNA 3RDZA 3BEUA 4UE7H 3ZZDA 1ETTH 1GVZA 1U6QA 1T4VH 1S6FA 1KTSB 1KXCA 1CBWB 1Q31A 4TSFD 2XTTB 2P3UB 2G8TA 1AVXA 2J5UA 3PO1C 4ABEA 1K2I1 2WPIS 3RXCA 4CBOA 1EAXA 2FI4E 1E38B 1T31A 4IN2A 2OC7A 3RXGA 2ZFPH 1XKBC 3QUMP 1SGPE 4XDEA 4D7GA 1V2LT 2NU2E 3GY4A 3OY5U 1ANEA 1NFYA 4FUGA 2F9PA 1GHZA 4AYYB 1D3PB 1TRYA 2FIRH 2V7QD 3TJOA 1CO7E 1EPTC 1AMHA 1QBVH 5JBTA 1V2NT 7LPRA 1C1WH 4WMDA 4RI0A 3UWJH 1E34B 1VITH 3F2GA 5IYTA 1P04A 1P11E 3GS9A 3EAJA 2IPHA 3MTYA 4LZ1H 2HWLB 3ZZ5A 2ODQA 4AZ2B 1C1OA 4MDSA 2ZGXH 1Y3WA 1KLJH 2ZIQH 3EYDA 4OGXA 1YYY1 2ZP0H 1HAVA 2ZO3H 4WF8A 3FZZA 1NRPH 4RKJB 4JMYA 1UK3A 5EJLA 1C5QA 2WPDD 1O5DH 1QA0A 4P00A 4E7NA 1A2CH 1WXRA 1BHXF 1V2WT 2QGRA 3SYJA 1GCDA 2ZKSA 1V2KT 2ZFRH 3TGIE 3SJIA 1UK4A 1WQVH 2BX4A 3NKKA 4RN6A 3TH2H 2UUYA 4RKOB 4B74A 1SGNE 4NZQA 3GY7A 4ZCNA 3OTPA 2CHAC 3RM2H 2EI8A 4TWYA 4DIIH 2EQNA 3MH5A 2H9HA 2C93B 2Y81A 1ZSKA 1K22H 1AN1E 4GCHF 4X2YA 5GDSH 1ZMNA 3ZVBA 3NK8A 3UNSA 1NESE 2VBCA 2ZHWH 3A8AA 4X6MA 1TWXB 2R3YA 1XUKA 3QN7A 2K8IA 3VPKA 4AB9A 2L74A 1XXDA 4Y6DA 1SI5H 2BDGA 1HAHH 1TGSZ 3RU4E 3EE0B 2RDEA 3AW0A 3QGJA 1BTPA 4KTCA 2LP6A 2BYAX 2EEKA 2Z9IA 4I8KA 2WPJS 2ZDLA 4WH8A 3P70B 2OP9A 1HGTH 2PP6A 5IK2D 4K2YA 2OQ5A 2VH0A 1C2IA 3LPRA 3QX5H 2PW8H 5G4BA 2JH0D 3E91A 2OC8A 3U8OH 1ETRH 3F2HA 4GCHG 2H1UA 2M5TA 1V6DA 2BZAA 2ODPA 2P59A 1AE8H 3V3MA 3BG8A 2XYAA 3RXEA 1WSSH 1O34A 1O3JA 3SV6A 2AGIX 1THSH 2ZC9H 3RXUA 2J34A 1KLTA 2R0LA 4P02A 5GWZA 1HAXB 4AFQA 1HBTH 3RXTA 4DOQA 1Q2WA 4FVDA 1FXYA 4YZUA 4B76A 3MI4A 3ITIA 1ZJDA 4H6TA 3KQ5A 5FL7D 2P94A 3B9FH 1C1SA 3BTDE 1TYNA 1QB1A 3TH4H 3PRBA 2RA3A 4AFUA 1DPOA 1PPZA 1Z8GA 3UWIA 1N8OC 1P2MA 2P3TB 1TBQH 5HXFA 1MAXA 5SGAE 1GBTA 1MD8A 4O3UA 1YP9A 2ANKH 1F0TA 1BTHH 5C0TA 1TB6H 2C8ZB 1G3BA 1DWBH 4VGCC 2H5CA 3KIDU 2UUJB 1AU8A 3QK1A 4BTTB 1OPHB 2BDYA 2QA9E 2BXUH 5EGMA 1GBCA 5EOKA 3QLPH 1O3AA 1GMCF 3F2FA 2Y7XA 1MZAA 1QJ1B 1KDQB 3MU4A 4ABIA 1F0SA 2VWMA 1TOCB 2OBQA 3SU3A 4B75A 4SGBE 1ZLRA 2G5VA 1P2KA 1OXGA 2ZGJA 4BAHB 1HDTH 2ODYB 3AVZA 8ESTE 3UR6A 3RLYH 3A82A 3BTKE 1FZZA 2GJGA 3E0PB 2AIQA 2GT8A 4YOGA 3TGJE 2D1JA 2Y5FA 3SI3H 1O5GH 5A8XA 2O8TA 2FXRA 1GBKA 1C1NA 1TX6A 5PTPA 3ZVGA 2A7HA 1FIZA 2VJ1A 3E8LA 4X1NU 5ESTE 3U8TH 1OWKA 3OEED 1GI9B 2IN2A 4DY7B 3PMAB 1FN8A 4CRCA 1G3CA 1XUHA 2PTCE 1FPCH 5C5OA 1GMCG 1Z1JA 2Q6FA 2DE8A 1DT2A 3LONA 5HIYA 1GDUA 4JYTA 2J9NA 2PTNA 2R0KA 3MMGA 5T3HA 1A61H 2FM2A 1BZXE 2KCOA 2WSSD 2SGPE 2WV4A 4NFFA 1YPJH 1BTYA 1TAWA 1ESBA 1NRSH 1TMTH 1TNHA 2EA3A 1LKAA 1A4WH 4I8JA 3U8RH 1Y3UA 1ZHPA 2A4QA 1BMMH 3GYMA 4B71A 3BG4B 2C90B 5FX6A 3T2NA 2TGDA 4GPGA 2A1DB 2TBSA 1BUIA 1UVOA 3PMBB 1DFPA 5F03A 1CA0C 1KY9A 1UVPA 1S0QA 4TWWA 4BAOB 3TPIZ 1AY6H 3Q3YA 1TMUH 1DDJA 4IMZA 3FO8D 2GMTB 3M3TA 1MTSA 1IOEA 1J17T 1E37B 1G36A 1TLDA 1SKYE 3SV8A 3RXVA 1CBWC 3GDUA 1T32A 1CT2E 3MU1A 4DW2U 1O2JA 3WW7A 4CH8B 3UNQA 1CT0E 5A0AE 1SOTA 1QCPA 1C1PA 1B0EA 2BOHB 2WZQA 1O3PB 3ZV8A 2P8OB 3EE7A 1FV9A 3PB1E 1GMHF 1JXPA 2ZCLP 1D3QB 1QY6A 1SFQB 4X2XA 2RA0A 1VCWA 1ZRBA 1S84A 1OWIA 4Z0KA 3DT0H 4XFQA 1Q3XA 3HK6B 4ISOA 5EXLA 1TNKA 2ZFTA 2GCTB 3E90B 3EA9A 1BIOA 2QYIA 5AFYH 3UOPA 2BDAA 1FY8E 2J4IA 3RXMA 1FAXA 4NSYA 1IQLA 4YO9A 3RM0H 2BX3A 3A89A 3UY9A 3F0PA 5E0GA 1KTTB 3MYWA 4JZIA 1C2HA 1O31A 1BTXA 1SGDE 3ZYDA 1P02A 5JB8S 1MTWA 1GI6A 2BD2A 5T1VA 3MNBA 4O97A 4JZEH 1H4WA 1F2SE 1GMHG 1O38A 1MTVA 2ZFSA 3OAAD 1YGCH 1AVGH 1B5GH 3KQBA 2QCYA 2Z6BD 3H7OA 4Q4LA 4ZUHA 3UQVA 2R2WU 1YLNA 2XC4A 1MU8B 2FX4A 3ZZ4A 1WOFA 4AOQA 3E1XB 3RXSA 3RXHA 1ESTA 2WPLS 1CU1A 3LIWA 3OFND 4U2WA 1AQ7A 1NM6A 2BHGA 1A0LA 2EI6A 3MO9A 4I33A 4JZ1A 5L30H 2A4RA 3BEIB 2HNTC 5DK1A 1HCGA 1O2OA 3VB7A 5DKMA 2J38A 4IN1A 3GDVA 1OYQA 2ZTZA 1TPOA 5DO4H 3BTEE 4FETA 1SGQE 3SZNA 1S83A 1Y3YA 5BRRE 2OC0A 1NPMA 1L1NA 1C2LA 5HYOA 1FDPA 2JETB 2F3CE 1GL0E 2FDAA 1F5LA 3BIUH 1ELFA 2ZGBH 4KP0A 1LHDH 1Z71A 3VB3A 2Z3DA 2STAE 4ACBA 1ZHRA 2VIPA 1LQEA 5E2PA 1O3BA 1GVLA 4AGKA 3A81A 4E7RG 1LVBA 1SQTA 3V0XA 4Z1MD 2KAIB 1RTKA 1EASA 2GX4A 1KXAA 4INHA 5EXNA 1N1LA 3VB4A 1QIXB 1MKWH 5FPSA 2J2UA 1C9PA 5C1UA 5FAHA 2P93A 4FUCA 1Y5BT 1O5AB 1EAWA 1C1MA 1GBJA 1THRH 4ZKRU 1ZMJA 1YPKH 3F68H 1NS3A 5DP4A 1O30A 1QNJA 1SC8U 4CR5A 4KTSA 5JBAS 3ZZ9A 1ANCA 2J98B 1PPCE 1C2GA 1L0ZA 1KYNA 2FP7B 4M9FA 1NN6A 4XBDA 1AZ8A 2IPQX 3Q77A 4XSKU 2WPMS 1O5FH 1EP6A 1OWEA 1EQ9A 1TIOA 1TNIA 5EQSA 4LZ4B 3TJNA 1DXWA 2ZHDA 1JRTA 2H2ZA 3P8GA 3TLOA 2BD9A 3PLKA 1IQKA 2BY9X 2BM2A 1L1GA 1YM0A 2L6OA 4IC5A 2KAIA 5CHAB 3S7HB 2SGEE 3U69H 4MNYA 2C4FH 3WY8A 1C5UA 3BV9B 3SU6A 2K0QA 1EZXC 2ZZUH 2XNIA 1LDTT 1NFUA 4Y71A 2XXLA 4GAWA 2XOKD 4UFGH 4D8NA 1KXEA 1LMWB 1D6RA 2THFB 5CHBA 3SO3A 1V2OT 1AD8H 3SNDA 3HKIB 2HOBA 1GG6B 3LKWA 5C1XA 2FOGA 5FXLA 3KQDA 2BLWA 3T5FH 1BMAA 2BQWB 2AMPA 3PV5A 3DHKH 3F3BA 5F8XA 1QRZA 2XNDD 3S0NA 2F9UA 1WDIA 1IQFA 2BD4A 1TQ0B 5A2MH 1NRRH 1O3GA 4WVPE 4ZKNU 3M35A 4X6NA 1UTMA 4X2WA 3RXBA 2ZPQA 4X8TH 4YOJA 1GBEA 4KTUA 1UTQA 3A7TA 2ZA5A 1C1RA 2VNTA 3UREA 4BXWA 7GCHF 4HGCA 1SLVB 2G52A 3GCNA 1SL3A 4MPUA 3Q76A 4ABJA 1FY3A 4OS7A 4BTUB 1SGFG 1MZDA 1DLEA 4MG3A 3ZZAA 1DUEA 4X1QU 2ZPRA 3LJJA 3PRDA 5IDKA 2KR7A 1ID5H 2W3KA 4CBNA 5ESBA 1IQGA 1N6YA 1MABB 6CHAC 1GI8B 1JRSA 1K1LA 1MQ6A 1BTUA 5CDFE 2WUCA 1UVUH 3BG4C 2AH4X 2F9VA 1VITF 2LNCA 3GCOA 1FPHH 1K28D 3CNRA 3H5CB 1GHYH 5EJZA 3Q3KA 2LELA 1MKXH 3GCTF 4Y10E 2VH6A 2BD3A 1NRQH 3PWCA 2B7DH 7GCHG 1AGJA 1BCUH 1CGJE 1PQ5A 2M2AA 1FONA 3RXDA 4BAQB 4YLUA 2BXTH 1P05A 2GMTC 1C5ZB 2O8LA 3LH3A 4GSOA 1HPGA 2XC5A 4JK5A 1HJAB 1OSSA 3SV7A 1G2LA 1O5CB 1ETSH 1PPGE 1NFXA 1GBLA 3K65B 2OINA 3SI4H 3F9FA 1YF4A 3TH3H 1LKBA 1EOJA 3RU4D 1ZZZA 2P8OC 2WPHS 3SZEA 1XUIA 4U01A 5DP9A 4MQAA 1VITG 3KQEA 2H9TH 3DD2H 4DURA 2ULLA 1ORFA 2VINA 3GCTG 1QBOA 2W7UA 3ATMA 4I8HA 5DJ7A 2GZ7A 4TT3D 1FMGA 1C5XB 1QBNA 2GCTC 5DGJA 2GTBA 2C8WB 3ZVEA 4OS1A 3T26A 1BDAA 3RXIA 2WYGA 1IQNA 1BHXB 3IWMA 3SU4A 1UHBB 1BRBE 3ZVCA 1K1IA 4I32A 3NCLA 3T29A 4FXGH 3EA7A 1IQEA 3UOUA 4JYVH 1FUJA 2GGVB 4FUBA 6GCHF 2C8XB 2ASUB 2ZDVH 2YMSB 1HUTH 4UFFH 3L6PA 4H42U 1C4U2 3B23B 1TE0A 1QURH 1OP2A 2Y6TA 1LO6A 4JZFH 2GP9B 1SR5C 2P3FH 1KMHB 1QJ6B 2ZTXA 3ZZBA 3TU7H 4O9VA 5B6OA 4THNH 3BTHE 3HPTB 3S69A 4D9RA 1WUNH 3F9HA 1RGQA 2FOHA 1GI4A 2IJD1 1CQQA 1G30B 1XM1A 3P95A 5EJ1A 4OS4A 2AERH 1D4PB 3M5MA 1NRNH 1QRWA 1QFKH 4ZAEA 3U9AH 1DITH 2FZZA 1O2HA 1GI7B 1QQ4A 3FOAA 4INKA 3F9EA 1C5PA 4ZXXH 4JCNA 5A09A 5DSFA 2FS9A 4FOUC 6GCHG 3CS7A 1UHBA 2UUKB 1JIMA 2CF8H 1O5EH 2ANYA 2ZU1A 3LJOA 2PKAB 2BY6X 5CMXH 3OE7D 1V2RT 2JETC 2SFAA 2TIOA 3S7KB 2F9OA 1O3MA 1YCPK 4JK6A 3P17H 1W7XH 3AAUA 2AFQB 2PGBB 1MUEB 5F6MA 3FVFB 5A8YA 4ZHMU 3MNCA 1CGIE 5F8ZA 4XE4A 3LC5A 1RTLA 1Z8JB 2JH6D 1P57B 3RUOA 3ZIAD 1QZ8A 2FESH 4GVUA 4FU8A 4DVAU 1FI8A 4HFPB 2C3SA 2W5EA 1YPMH 1LVYA 3GY5A 2A5IA 5KEDA 4Q80A 2Y7ZA 3TITA 1SPJA 2O9QA 5C17A 1GBBA 1YPLH 1YY3A 3U28C 3U1IB 2R3UA 3MQKC 1RRKA 2XW9A 4ISLA 1EXFA 3KCGH 5E0HA 2YOLA 3STJA 1S5SA 1C5WB 3C27B 2UWLA 1TPAE 8KME2 4MLFB 4O3TA 1O0DH 4FU9A 3AASA 3HKJB 5L2YH 2YNBA 5DPAA 3KHVA 4NA7A 5AHGH 2ZDNA 2R9PA 2ZHQH 4NIXA 2PKAA 3SW2B 5EPYA 1RIWB 5C1YA 2ZU5A 4Q2KA 3P92A 3SUEA 1BTWA 2QXJA 4UEHH 4I7YH 4ABGA 1A5IA 1JOUB 1QL8A 3QTOH 3SNAA 4CHAB 3E6PH 4NIWA 3LGIA 2F83A 1INCA 4X1SU 3A7ZA 5FPYA 1Y3VA 1B0FA 3KGPA 4J1YA 1G9IE 1NY22 2I6QA 3OY6U 3P8NA 3A7WA 1K21H 1S81A 3SJ8A 3A7XA 5CHAC 9LPRA 1OWDA 2GDDA 2BZ6H 4AFSA 1GGDB 4DIHH 1K0HA 1O33A 2ZG0H 1CSOE 1XMNB 3TJUA 1LTOA 2VVVA 1YPEH 4UFEH 1C2DA 1JMOH 1GG6C 2ZFQH 4D76A 1PPHE 4R8TB 3N7DA 3EDXB 1P2JA 1HAZB 3M5OA 2WPKS 3PLBA 4ZMAH 3OEHD 1PPFE 5C67A 1HAYB 1C4Y2 4WMEA 4ZH8A 2TPIZ 3LGUA 3RC4A 5FBIA 1WTHD 2HALA 1BA8B 3TVJB 1GHXH 1L1JA 1O2KA 2AS9A 1PPBH 2BD7A 5I25A 3S9BA 5DP7A 1TBRH 1YCPM 2J94A 4LK4A 1Y59T 1QR3E 1GJBB 2CGAA 1MKWK 2A32A 2P16A 3VEQB 3G01A 2RCEA 1GJ8B 1XKAC 1IQMA 3D49H 5C0UA 1T8LA 1KXDA 4WXIA 2WYJA 1TMBH 2BQ6B 3UTUH 1UK2A 5JYIA 5BPEA 4B6EA 4IBLH 3RU4T 5C5NA 4AFZA 1JWTA 4K1SA 4CRDA 2BLOA 5GNDA 3KYFA 2QF4A 3SNCA 3A87A 3M61U 3RXQA 3MH4A 2ZDAH 2BLVA 1C5RA 1O3IA 3W95A 1GJDB 2Q6DA 3LOXA 1ELEE 1HAPH 1GL1A 1O35A 1IAUA 3I77A 3PTBA 4ISNA 5HIZA 1GHVH 2A4OA 4YM9A 5CE1A 1E35B 1GJ6A 1UCYE 2QXIA 1DOJA 4Y11E 1K9OE 1OX1A 3URCA 2D8WA 1ELVA 2QIQA 1SGCA 1Y8TA 4Q63A 1KIGH 1QB9A 2QF3A 5EPNA 1TBZH 2ZHFH 2BY7X 3M7QA 1A3BH 2K1QA 3CP7A 4X2VA 1MQ5A 1TONA 3D62A 1HJAC 3MU0A 1TA2A 3SUDA 2ZF0H 4FUEA 4RSPA 3R3GB 3T27A 2Y80A 3E3TA 1UVSH 1GBAA 1BBRE 1AFEH 1LVOA 1O3DA 3P8FA 5HM9A 2VGCB 1SGIB 3ZZ8A 1LCYA 2HNTE 1ZYOA 3NUMA 4BTIB 3MOCA 1EX3A 4MNXA 1YLDA 2WV5A 2XCNA 4FUFA 1J16A 3E16B 4NSVA 2WV9A 1X7AC 4Y7BA 2QN5T 1V2PT 1VCQA 3TNSA 2STBE 3MH7A 4E06H 2V0BA 2ILNA 1H8HD 3BTTE 1EP5A 1O2GH 1BTZA 4AG2A 1O3CA 3A8DA 4AYVB 1NU7B 4KKDA 3MNSA 1ZMLA 1CHOF 3BF6H 3M3SA 2XRCA 1V2VT 3NZIA 1BJVA 3DSPA 4XRNA 3M3VA 4X6OA 5KECA 3OU0A 2F9BH 4FUHA 1W8BH 1TNJA 4DG4A 4PROA 6ESTA 2C8YB 3ENSB 2FLBH 1ANDA 1W11U 1RXPA 1GBDA 3LH1A 3V12A 3VB5A 1O2LA 2YMSC 2PR3A 1ANBA 5HM2A 4O03A 1H8ED 4GHTA 1WQSA 5T6GA 2FOBA 1DWEH 5LPEA 2ZPSA 1SMFE 1O3KA 2ZQ1A 1LPKB 2SGAA 3R0FA 1SGEE 1W13U 3QGNB 3GISB 3M36A 4RT0A 2ZI2H 1CHOG 1C1VH 1MKXK 1NT1A 1UTPA 2JJ2D 1O2SA 5TJXA 1DY9A 1MCVA 5E8EH 3RXAA 2VB0A 1C5NH 5EQQA 2VIVA 1ZSJA 3SU2A 3A8BA 2HLDD 3LC3A 2V3HH 1LHGH 5J4SA 3SJOA 3URDA 3GY6A 2P95A 5FCRA 5ABWA 2AHME 3FAOA 1E0FD 1H9IE 2CHAB 2FO9A 4F48B 3VG8A 3DFJA 1K1OA 1GMDF 1NBMD 2VWNA 2Q1JA 3U1JB 4CR9A 1K1MA 2VU8E 1O2NA 1P2IA 4AG1A 1PFXC 4NG9H 5FPTA 1PYTC 4FVBA 1CT4E 3W1EA 3TNTA 3KL6A 1EPTA 4MTBA 1K1JA 4U30A 3UUZA 4BNRA 1L4DA 3GY2A 4ZKOU 1AZZA 4WY3A 5EW2H 2Z94A 1EAUA 1BMLA 1SLUB 5FHTA 1IQIA
chains in the Genus database with same CATH topology
1A5GH 4YESB 5LH8A 1CE5A 2FTLE 1FAKH 1J15A 4H6SB 1G3EA 3P8OA 4E05H 1P9UA 2VIQA 7ESTE 1P2NA 4ABFA 1EZSC 1F92A 1YKTA 1C2EA 1MAYA 3BTME 3LT3A 1GMDG 1VJ9U 4ZROA 4B1TA 1V3XA 4IMQA 1QL9A 5JDUB 1TPPA 1AE5A 1BRAA 1DX5M 3MWIU 3SV2H 1W14U 3ATLA 1LHEH 3ZVAA 1F0UA 5EG4A 2PGQB 1P06A 1WV7H 3SBKA 3SORA 3SHCH 1T7CA 3PROA 3AAVA 1RIWC 2A0QB 1MBMA 1O2YA 3RXJA 1TOMH 3FP7E 1EB2A 2FWWA 1G37A 2UWPA 1N6XA 2QAAA 3ATKA 3SU0A 1FLEE 1TRMA 8LPRA 2V6NA 1FN6A 3O8CA 1DE7H 1DM4B 1YLCA 3RC6A 4CHAC 3I78A 1TGBA 2BY8X 4X1RU 2NU0E 5K0HA 2Z9GA 4FUIA 4WJG2 3UNRA 2V3OH 1EATA 2BVXH 1O5BB 4X6PA 3FZDA 4R0IA 1T8OA 1QRXA 2ZHEH 2G5NA 1SSXA 1BQYA 3GCHB 1GI1A 1G2MA 2FEQH 1YC0A 4K8BA 1GGDC 2NWNA 1M9UA 2FYRA 2YNAA 1W3CA 2XBWA 1FY5A 4NFEA 1SOZA 5JPMH 2QC2A 2A5KA 1TNGA 3QDZB 2OXSA 1UTKA 3UR9A 1HV7A 1ZHMA 2G4TA 4LXBH 4Y7AA 1GDNA 4A1XA 4TPIZ 3T62A 1Y3XA 2TGPZ 3MNXA 4MPVA 2BDBA 2G81E 1P0SH 2FOAA 2TGTA 5TCAA 4ABBA 1DS2E 2VVUA 5T6DA 3RXFA 3GDSA 2G4UA 3FP8E 3K6YA 1GHAF 3CENA 3MU5A 1XX9A 6LPRA 3MFJA 2FODA 3I29A 3GOVB 2GDEH 1DXPA 1O2PA 1O3LA 1MTNB 1P3EA 1ZR0A 4FU7A 1SGFA 1HB0B 2PUQH 1IQJA 3A86A 3SUGA 1QL7A 2GV6A 3UFAA 1L2EA 1ZTLA 1O39A 1D3TB 3F1SB 2VIWA 3PMHB 4GHQA 4NIVA 5FBEA 4KELA 1RD3B 1AB9B 3RXRA 4ASHA 1QGFA 4B73A 4A1VA 2OC1A 3A80A 3KEEA 4Y8ZA 4BAMB 2EI7A 4Y79A 1W2KH 2ZU4A 1O3NA 3ZYEA 1VCPA 1S82A 2BD5A 1F5RA 1XXFA 2Z9LA 4DGJA 2BVRH 1C5LH 2TGAA 1GHAG 1KXBA 1P10A 3SQHE 4YT6H 3ZZCA 1BOQA 2J92A 3HGNA 5EXMA 2B0FA 2W3IA 5DP8A 1A7SA 1IHTH 1DWCH 1XUJA 4BOHA 1SBWA 1TPSA 3OX7U 1TABE 1WCZA 5C3NA 4Y8YA 1C5SA 1UJ1A 1WBGB 2VGCC 3F6UH 3LGYA 3TJVA 1DSUA 2D26C 2Y82A 1HYLA 2PSYA 3LGWA 5H4IB 1CVWH 2O8WA 4IS5A 2ALVA 4Q7YA 1XUFA 3M5LA 1H9LB 3RP2A 1WU1A 1T8NA 1ZPBA 1ZJKA 4D7FA 1H8DH 4Y76A 4UONA 4CRGA 2PHBA 8GCHF 9ESTA 3GYLB 4Q7XA 2XBXA 1O2MA 1BRCE 1GJCB 3ZVDA 2ZEBA 1HIAA 1V2JT 4IC6A 1GDQA 1O32A 1DVAH 2Q6GA 1OWJA 4NA8A 3SU5A 5DP3A 2W26A 1EJNA 1MH0A 2AGGX 2AGEX 4Y0ZE 3NPSA 1YPHC 2G51A 2PUXB 2CXVA 5AVDA 4WMFA 5JB9S 2BLQA 2GD4B 2ZU3A 2UWOA 2FMJA 4HZHA 1FJSA 1A1RA 4NWKA 1C5OH 3RXPA 1GJ4H 3ATWA 1FNIA 3SNBA 1Z6JH 4NIYA 1ELAA 1NFWA 3W94A 1AWHB 1O2UA 1DICA 3VXEH 3HGPA 2PV9B 8GCHG 1A5HA 1HXEH 1CHGA 2H9EH 3FP6E 2BVSH 1S85A 4YOIA 1UO6A 2B5TB 4CH2B 5HGGA 1ARCA 1DANH 1V2ST 3TIUA 2FOMB 1AFQB 3E0NB 5FCKA 3M7UA 2FS8A 1ZOMA 1ZPCA 1TFXA 1LPZB 3ZVFA 2H6MA 5GCHF 2A7CA 1SGTA 1H1BA 2BQ7B 2BB4A 3JZ1B 1GI0A 2ZTYA 1O2RA 1SLWB 1P01A 1C2KA 4HI3A 1GI5A 1A46H 1O3FA 2FOEA 3GY3A 1TRNA 3PMJA 3RLWH 1IHSH 4MPXA 4X8VH 3RXLA 3MU8A 2Y5HA 4DCDA 1AI8H 2ZECA 2DUCA 4U32A 1P8VC 2DE9A 4CRAA 1EOLA 4AN7A 1LVMA 4XBCA 5GXPA 4A1TA 1XUGA 1EJAA 3RMNH 2ZU2A 1JBUH 1VGCB 1HJ9A 1ELCA 2HNTF 1C2FA 5GCHG 3MO6A 1MMJN 4UD9H 1ELBA 1C1TA 1QA7A 3STIA 1GBMA 3EA8A 4JZDH 3UIRA 1W10U 2ANMH 1ABIH 2XBYA 4ZKSU 1QB6A 1TALA 1O3HA 1YPGH 4XBBA 3ZZ3A 1THPB 4AGJA 4HTCH 1FY1A 3K2UA 3M37A 1AO5A 1SB1H 1O2IA 2BTCE 4GUXA 4ABHA 1P2QA 2ZDKA 5F8TA 1UCYH 3A83A 1AVWA 5JBCS 2BMGB 5DG6A 1TGNA 1C9TA 2W7SA 1HAIH 1G3DA 1QQUA 1GJ7B 3BIVH 1OP8A 1FY4A 3PWBA 3L33A 4NWLA 4ESTE 1BBRH 2NU1E 2H5DA 1AUJA 2OBOA 1HLTH 4KGAA 5JBBS 1GBIA 1QJ7B 3GCHC 3NWUA 3ODDA 2ZWLH 1XVMA 3RMMH 1AWFH 3RC5A 3BTWE 1ZTJA 3A7YA 3JZ2B 2CN0H 1P03A 1OOKB 3U98H 4B2BA 2BDIA 2GV7A 1C2MA 2HPQH 4MNWA 4A5TS 4I31A 3H7TA 1EUFA 2GZ9A 1AUTC 2JKHA 1P2OA 4Z6AH 2ZGCA 5GPIB 3S9AA 1PYTD 3SU1A 5GIBA 2UUFB 2Z3EA 4WWYA 4K69A 1A0JA 1TX8A 5A0CA 1KSNA 4OGYA 4ZXYH 3A85A 3TK6A 2TRMA 1MTNC 1LHFH 3A7VA 4NCYA 1FIWA 4I8GA 5A8ZA 3LDXH 1TX7A 1EJMA 1ZGVA 2RDLA 3QTVH 4A7IB 1NU9A 1F0RA 2BDHA 1E36B 3O8RA 2RG3A 3BTFE 1AB9C 1ACBE 5J4QA 3F9GA 2OCVB 3SUFA 1GJ9B 2PKSB 3M5NA 1ESAA 1RTFB 4X8SH 1BRUP 3HATH 5T6FA 2D2DA 3N7OA 2HVXA 1HAOH 1GJ5H 3GICB 2B8OH 1OKXA 4YT7H 1AKSB 1QTFA 2XCFA 1KDQA 6CHAB 5ETXA 2PLXA 4YTAA 1HRTH 4YLQH 4K1EA 3VGCB 4AB8A 2OQUA 2XWBI 1W12U 4OS6A 1SGYE 3T28A 1K1NA 5LPRA 4K1TA 2ALPA 3ESTA 2QF0A 1BJUA 3DUXH 1TQ7B 3RXOA 1GCTB 3DFLA 3RXKA 3FANA 1QHRB 2PFEA 1HFDA 7KMEH 3SQEE 3QO6A 2SGQE 1V2TT 2QY0B 4Y8XA 2CV3A 3IG6B 3EGKH 3RMOH 1SFIA 4K60A 5EW1H 4OS2A 1Z6EA 4ZHAA 1C1QA 1A0HB 3NXPA 5AFZH 3SGQE 3HK3B 1OP0A 1ARBA 1O2ZA 4XOJA 1P12E 2HGTH 4TPYA 3PO1B 5EU8A 4UFDH 1Y5UT 1P09A 2WINI 4SGAE 1YCPH 1D6WA 2GKVE 1TGTA 1C5YB 1AKSA 3SJ9A 1W0ZU 2J95A 3TK5A 1AHTH 3D23A 4IW4E 4WH6A 1TNLA 1EPTB 1JIRA 2NU3E 2I6SA 2SNWA 4Q7ZA 3GY8A 1W7GH 1WAYB 2ZCKP 5E0JA 5HMAA 1PQAA 1GBHA 3SV9A 1FQ3A 1VZQH 2O8MA 3D65E 1OWHA 2F91A 3QWCH 3IITA 3P6ZB 2HPPH 2FI5E 2PWXA 3T25A 2Z3CA 3SNEA 1AIXH 4MVNA 1ELTA 5EQRA 2QXGA 3UQOA 3CS0A 2SGDE 1DLKB 3ELAH 1SHHB 2IJOB 4WXVA 2FTMA 2QXHA 2GT7A 2O8UA 4IGDA 2ANWA 2FOFA 5AF9H 3BTGE 1BT7A 1AFQC 2FI3E 2Z9JA 1O2VA 4NA9H 2V35A 3RMLH 1DWDH 2FLRH 1O2TA 1LQDB 2FOCA 4X8UH 1UTOA 5E2OA 2NU4E 1F7ZA 2QV1A 2Z9KA 1ZTKA 4TYDA 3LU9B 3ZV9A 4X1PU 4LOYH 1DY8A 1P9SA 3EQ0H 3QZRA 1GVKB 1HJ8A 4A92A 3LGVA 3SGBE 1SVPA 4ZHLU 2AYWA 3MO3A 2GCHF 4D9QA 2AMDA 2CMYA 5I46H 2G55A 1PQ8A 1T4UH 3ZZ6A 4B2CA 4DJZB 3SHAH 1CA8B 1WTGH 3S9CA 1J9CH 1O2XA 1GI2A 1C5VA 3SGAE 2VVCA 4FUJA 3PLPA 1OS8A 2ZDMA 4ABAA 4J2YB 1VGCC 1UVTH 3ZZ7A 2GVFA 1NZQH 3KNXA 3QZQA 2B9LA 1LHCH 4JYUH 1O2QA 4CRFA 2FPZA 3L3TA 3KF2A 2OUAA 1HAGE 2FX6A 5LGOA 1BMNH 1DSTA 1SGRE 4QT8C 1B7XB 1RS0A 3LGTA 1VJAU 2F9NA 2GZ8A 2XWAA 1O37A 2HRVA 3BTQE 1BITA 2GCHG 1GHBF 3VXFH 1O2WA 2A2XH 3SJKA 3PYHA 1DUAA 1MBQA 2XC0A 4CRBA 2ZCHP 5LPFA 1PJPA 3VFEA 3AW1A 1SQOA 4FUDA 4TY7A 1UMAH 2VWOA 3PV4A 2OLGA 3A8CA 1J8AA 1W0YH 1MU6B 1V2UT 2BD8A 1IQHA 2JH5D 5C20A 1GBFA 2HLCA 2ZNKH 2A31A 1SG8B 4BAKB 4Y0YE 1D9IA 2Y5GA 1K1PA 2ZGHA 1N8OB 5FX5A 4K8YA 3TK9A 3MHWU 5A0BA 1ELGA 4INLA 4DT7B 1HNEE 3VB6A 1GJAB 1TGCA 1YBWA 4VGCB 4X0WU 3KQCA 2IOTA 1OYTH 1Z1IA 1GHBG 1GPZA 1GWAA 4BANB 2OD3B 2A4GA 1NROH 1MCTA 2A2QH 1ELDE 2CF9H 2G00A 1Z8RA 4NZLA 1PPEE 1L4ZA 1LPGB 4H4FA 1J14A 4ISIH 4K3JA 1V2QT 1SQAA 1ZGIA 1S0RA 2BDCA 1A3EH 2BOKA 1NO9H 2LPRA 5EODA 2EC9H 3C1KA 1Z7KA 4ISHH 1BB0B 1NC6A 2ZQ2A 3BEFB 2AEIH 1G32B 3FFGA 1D3DB 1O36A 1GHWH 1KXFA 2VWLA 4F4OC 3UPEA 1C2JA 3PTNA 3SOSA 1EKBB 1O3OA 2PSXA 5C2ZA 1Z8IB 4AORA 2SNVA 3OTJE 1Y5AT 2ZFFH 3M7TA 4M7GA 1ABJH 1EZQA 3K9XB 2A5AA 3OYPA 1WYKA 2BY5X 2ESTE 5GJ4B 2AIPA 3Q00A 1ZSLA 1ZPZA 1PQ7A 3A84A 3O8BA 5DP6A 2XBVA 1S6HA 1C5MD 1O3EA 1YPHE 4NGAH 1UCYK 2PKSC 1SHYA 3ODFA 4MNVA 3TGKE 1KLIH 1HIAB 2VIOA 5K7RA 4TY6A 4A6LA 1EZUC 2WUBA 3SN8A 4F49A 3KN2A 1V2MT 1TA6A 2FYQA 1RJXB 1HXFH 3PM3A 5DP5A 3A88A 3OSYA 1H9HE 3ATIA 1XVOA 1EAIA 1C1UH 3Q3XA 3MH6A 1SLXB 2SGFE 5TCCA 4MPWA 1BBRK 1GI3A 3DA9B 2CJIA 4CREA 3VGCC 4I8LA 2A7JA 1P3CA 4GLYA 1MTUA 1NTPA 2R2MB 4BXSA 1F5KU 5L6NH 1CGHA 1UTLM 2VIDA 3V13A 4ABDA 5L2ZH 2Z7FE 1MD7A 1VR1H 2OTVA 4K5ZA 4OS5A 1UTNA 3O8DA 4UDWH 1GCTC 3K6ZA 1ZRKA 1CA0B 3BSQA 1T8MA 3B8JA 3BN9A 1C4V2 1C5TA 2A45B 3V7TA 4AX9H 1EB1H 4B2AA 1HAVB 2AMQA 1UTJA 1H8IH 1RFNA 3RDZA 3BEUA 4UE7H 3ZZDA 1ETTH 1GVZA 1U6QA 1T4VH 1S6FA 1KTSB 1KXCA 1CBWB 1Q31A 2XTTB 2P3UB 2G8TA 1AVXA 3PO1C 4ABEA 1K2I1 2WPIS 3RXCA 4CBOA 1EAXA 2FI4E 1E38B 1T31A 4IN2A 2OC7A 3RXGA 2ZFPH 1XKBC 3QUMP 1SGPE 4XDEA 4D7GA 1V2LT 2NU2E 3GY4A 3OY5U 1ANEA 1NFYA 4FUGA 2F9PA 1GHZA 4AYYB 1D3PB 1TRYA 2FIRH 3TJOA 1CO7E 1EPTC 1AMHA 1QBVH 5JBTA 1V2NT 7LPRA 1C1WH 4WMDA 3UWJH 1E34B 1VITH 5IYTA 1P04A 1P11E 3EAJA 2IPHA 3MTYA 4LZ1H 2HWLB 3ZZ5A 2ODQA 4AZ2B 1C1OA 4MDSA 2ZGXH 1Y3WA 1KLJH 2ZIQH 3EYDA 4OGXA 1YYY1 2ZP0H 1HAVA 2ZO3H 4WF8A 3FZZA 1NRPH 4RKJB 4JMYA 1UK3A 1C5QA 1O5DH 1QA0A 4E7NA 1A2CH 1BHXF 1V2WT 2QGRA 1GCDA 2ZKSA 1V2KT 2ZFRH 3TGIE 3SJIA 1UK4A 1WQVH 2BX4A 3NKKA 4RN6A 3TH2H 2UUYA 4RKOB 4B74A 1SGNE 4NZQA 3GY7A 2CHAC 3RM2H 2EI8A 4TWYA 4DIIH 3MH5A 2H9HA 2C93B 2Y81A 1ZSKA 1K22H 1AN1E 4GCHF 4X2YA 5GDSH 1ZMNA 3ZVBA 3NK8A 3UNSA 1NESE 2ZHWH 3A8AA 4X6MA 1TWXB 2R3YA 1XUKA 3QN7A 3VPKA 4AB9A 1XXDA 4Y6DA 1SI5H 2BDGA 1HAHH 1TGSZ 3RU4E 3EE0B 3AW0A 3QGJA 1BTPA 4KTCA 2BYAX 2EEKA 2Z9IA 4I8KA 2WPJS 2ZDLA 4WH8A 3P70B 2OP9A 1HGTH 4K2YA 2OQ5A 2VH0A 1C2IA 3LPRA 3QX5H 2PW8H 5G4BA 2JH0D 3E91A 2OC8A 3U8OH 1ETRH 4GCHG 2H1UA 2M5TA 1V6DA 2BZAA 2ODPA 2P59A 1AE8H 3V3MA 3BG8A 2XYAA