2BYAX

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2byaX01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2byaX02
1QGFA 1EXFA 1KXAA 2ZC9H 2FX6A 1ELGA 2FYRA 5FX5A 4BAOB 3AAUA 3MU8A 1S81A 4ISHH 1GJDB 1WBGB 3C27B 1GI1A 3LT3A 1BZXE 2H5DA 1VITH 1JMOH 4Q7YA 1DITH 1O2LA 4WY3A 3P8OA 2EC9H 4X6MA 2FP7B 1D3PB 8GCHG 4D7GA 1KXDA 3FAOA 1PQ7A 5C5OA 3SORA 3W95A 2JH5D 3F9GA 3GCNA 3BTME 1BBRK 4TPIZ 4UFFH 4AB8A 1BRAA 2FTMA 1IQIA 3G01A 1LHFH 1EZQA 1Q2WA 1YCPK 5F8ZA 2UWLA 1O2HA 3ZVDA 2ZDKA 1QRZA 3HGNA 3TGJE 3GY6A 1W0YH 2A4QA 1Y3UA 3BTQE 1JRSA 1VITG 3KCGH 1GI9B 1TBRH 1DY8A 1ELDE 1SR5C 4Y10E 1L2EA 1DWDH 1IQGA 1O2VA 4HFPB 1DT2A 1BTYA 2WPIS 2G00A 1QR3E 1XUIA 2G52A 3SJOA 5A8YA 2Q6DA 3BTFE 1FONA 3VGCB 1QJ7B 1WTHD 2PKSB 3M5OA 4NGAH 3TGIE 4CHAB 1GBTA 2V3OH 3RXMA 1GVZA 1GL1A 1NFYA 5L2ZH 1FDPA 2V6NA 3BTGE 1GHBF 4ZHMU 3SQEE 1V2NT 4I8GA 3PMAB 3LC5A 2QCYA 1HCGA 2HRVA 2OC0A 1SGDE 2M5TA 4NFFA 2OLGA 1KDQA 1ZPBA 1ZSJA 5DO4H 3VB5A 3PTNA 4SGAE 3QN7A 2ZPQA 3I77A 5C1UA 3RMMH 1GI5A 1NZQH 2CHAB 2F9VA 1C5RA 5E0GA 1C2KA 3OYPA 2ZP0H 4BANB 1K1LA 1MAXA 2P16A 2TBSA 1GBBA 1NESE 1EX3A 3M7UA 3A8BA 1YCPM 1W13U 5C20A 1PFXC 1O37A 3KIDU 1RIWB 2ZI2H 1C4V2 3GDSA 4THNH 3RXBA 1EJNA 1D6RA 2F9UA 4YOGA 4AZ2B 1DANH 4BAHB 3TK5A 2R0KA 1ETRH 3M5MA 3DUXH 1SFQB 1ELTA 3BTWE 3SU4A 4ZKSU 3RXPA 2ZPSA 5FAHA 1QQUA 2BDBA 1WQVH 4QT8C 1UTPA 8LPRA 1PPGE 1IHTH 1TQ0B 1C2JA 1V2TT 1CT4E 3PO1B 2BQ7B 3QK1A 1EPTA 2ZQ1A 1UVUH 1TMUH 4ZHAA 4ABFA 5F8TA 1O2XA 4E7NA 2O9QA 1CVWH 2AGGX 1VGCC 3SQHE 1DSUA 3SU5A 4JZIA 2PSXA 5HMAA 3RXDA 2EI8A 1V2ST 1PJPA 1ZTKA 2FZZA 3RMOH 1O0DH 3S9BA 2BDCA 4YM9A 2SFAA 3HK6B 4CBNA 2BVRH 2A4RA 1F5LA 1GWAA 1O34A 2HLCA 4ZH8A 4TPYA 1FN8A 2P8OC 2FI3E 3RU4D 1Z8JB 1C1SA 1THRH 4IC6A 1FPHH 1MZAA 3A80A 3U9AH 5B6OA 4LXBH 2HALA 1CHOF 2D1JA 3FANA 1LO6A 1UHBB 1P3EA 3A86A 1UTMA 1O3GA 5K0HA 1IAUA 1AVWA 1GMDF 1P3CA 3KL6A 1K1IA 2SGQE 2G8TA 1FQ3A 4R8TB 1C1NA 1QRXA 1MBMA 2D2DA 4UONA 2BD5A 3GY3A 4XOJA 1BQYA 2VGCC 1TALA 2H5CA 4XBCA 1INCA 1PQ5A 2A31A 5E2PA 2F3CE 4B2AA 3NK8A 5JPMH 1A0HB 3JZ1B 2GMTB 2BLQA 5FBIA 1G37A 1GCDA 1YPEH 4Y8XA 2FX4A 1OPHB 2OC1A 1YKTA 2STAE 5DGJA 3TJUA 1GDNA 2RCEA 1O32A 4ZROA 3BIUH 1P2KA 4ABGA 1O2YA 5EPNA 1S85A 1ZHPA 1TX7A 1A3BH 4JZ1A 5F8XA 3ZZCA 1EUFA 4TWWA 1AY6H 1HJ9A 1NTPA 3BV9B 1G2MA 1GGDC 1H8IH 2BXTH 4GCHG 2EA3A 4X1SU 4DOQA 3CENA 1MUEB 3EQ0H 3VXFH 1HJAB 1QURH 1O3JA 2BD4A 3PB1E 3STIA 4A1XA 3L33A 2BD8A 2AEIH 3KQBA 3VXEH 2PR3A 2VH0A 1P01A 4ABEA 1RXPA 1FXYA 1P05A 4Y6DA 1BT7A 1MTWA 2Q1JA 3UPEA 4AN7A 1LTOA 1TB6H 2GZ9A 3MNSA 1C5XB 1BTHH 4CH8B 5L6NH 1LCYA 2ZPRA 1NM6A 4D7FA 1FIWA 1AO5A 4WXIA 4CREA 1O2UA 4DG4A 2VIVA 5A09A 1BTWA 2NU3E 4RN6A 4WF8A 1HXEH 3A84A 4HTCH 2UWOA 1XUFA 2AFQB 4GAWA 2VH6A 3GYLB 4D9QA 1SSXA 2FYQA 2ZCKP 2RA0A 2O8UA 3NCLA 2AERH 4JCNA 3M7TA 1JBUH 4K1SA 3MNCA 1BHXF 1J8AA 4Q2KA 3SU1A 1MKXH 5C5NA 1BMNH 1L1NA 1K1PA 1HAVA 1QB9A 4E7RG 1O2TA 3SV2H 2H9EH 2CF9H 3U8RH 3E90B 7GCHG 4MVNA 1IQJA 1GBKA 5EXLA 1HYLA 1K1JA 1QA0A 1C1TA 1MTVA 1WOFA 3PROA 1SPJA 3PLPA 2PW8H 3SUDA 2F83A 2Z3CA 4B1TA 2NU1E 4MPVA 1SGFA 1YYY1 1THSH 2FOFA 2A4GA 1P9SA 3MYWA 1AKSB 1XXFA 1P03A 1EJMA 1KXBA 1WUNH 5FPYA 4HI3A 3E1XB 1TA6A 2J4IA 1SGCA 3STJA 1S84A 4LZ1H 1ZSKA 3FZDA 1O5FH 2B5TB 2XBVA 3MU0A 1MAYA 1TPAE 1Y5BT 2XBWA 1UCYK 3R3GB 1ELAA 2QGRA 3SGAE 3K9XB 4FUCA 1P57B 2A2QH 1HGTH 1P2IA 2YNAA 1NFUA 2OQUA 1AUJA 1KYNA 3HATH 1P10A 4KTUA 4AORA 5BRRE 4JZEH 1T7CA 4NIWA 4YOJA 3GCHB 2XWBI 4MNYA 1PPEE 2OINA 3M35A 3MH5A 4O3UA 2V3HH 5DP9A 4OS4A 3MOCA 2F9OA 4TYDA 2J2UA 1A4WH 1PPCE 1V2UT 3A88A 1MD8A 3RP2A 1SQOA 3BTTE 1LVBA 3SN8A 6CHAC 1C5OH 2ILNA 1EAIA 5LPRA 3RC5A 1GI8B 3LDXH 3F1SB 3VB6A 1E37B 3QGNB 4FUBA 3BN9A 4ISNA 1ANDA 3ZV8A 2PGQB 4GHQA 1C1MA 2RA3A 3LGVA 3A7ZA 4RSPA 4MNWA 1GBCA 1AFQC 1CBWB 4X8TH 1UJ1A 2VB0A 3QX5H 2QAAA 2Z9LA 3SJ9A 2BYAX 3TU7H 1DLEA 2VWMA 1O3CA 1QNJA 2ZGCA 2AMDA 3QTOH 2CF8H 4GPGA 2FI4E 1XUKA 4K1TA 2KAIB 4NZQA 2PKAA 3GDUA 4NFEA 1C2FA 3SUGA 4IGDA 1DICA 1P2QA 1KXFA 1C5VA 4BTIB 3PMJA 1DWCH 5T6FA 3BEUA 1Z6JH 1MKXK 2PFEA 1GI4A 1C1VH 2H6MA 2WPHS 1O38A 3SJKA 2ZU2A 1HLTH 4X8UH 2BD9A 4INHA 1XUHA 3W94A 1ANCA 2FOMB 4X2VA 4DURA 1AUTC 1NN6A 2WV4A 1GBAA 1VJ9U 2BD7A 2K1QA 3T25A 3VB3A 1O2WA 5JBTA 2BLWA 1CGJE 2TIOA 3GCTF 2P3FH 1ETTH 1C2DA 2W5EA 1AVGH 1SGNE 2O8WA 4NA9H 1S83A 1FUJA 2JKHA 4IMZA 4UFDH 5HXFA 1A7SA 2ZFTA 1LPZB 5EU8A 2ZFSA 1P09A 2RDLA 2ZKSA 1J14A 4X8VH 3MWIU 5GCHG 1RFNA 3U8OH 1O5CB 3BTHE 2Z9KA 1XKAC 2VNTA 3NKKA 4CR5A 1WQSA 3M7QA 1T8NA 3DFLA 4MPXA 1ANBA 4UDWH 2C3SA 3BG8A 2QIQA 4IW4E 3URCA 3H5CB 3BSQA 4FUEA 1BRBE 1SI5H 4AYYB 3R0FA 2P94A 1HV7A 2C8XB 3RMLH 3LJOA 1BBRE 4AB9A 2A45B 1WAYB 5AFZH 2W3IA 1V6DA 2BOHB 1F7ZA 1FV9A 1O3KA 2A5AA 3A89A 1BCUH 2SGDE 1DXWA 2ANKH 5JB8S 1RTKA 3FP8E 1VJAU 1WTGH 2VJ1A 4FUJA 4IMQA 3SUEA 4ISLA 1QRWA 3A8AA 2WPJS 1UVTH 1A3EH 1DVAH 1C5ZB 1P8VC 1W11U 5FPSA 3ZVAA 3DA9B 6GCHF 1C1QA 4DY7B 1GHAG 2UUYA 3ATKA 1LKAA 1O31A 4JYTA 4FU8A 1FY3A 1TGBA 2G81E 3RXFA 2BD2A 3BG4B 5EQRA 2R9PA 2XBYA 4B76A 1CHOG 1W3CA 1O2PA 1NY22 3SNEA 1QTFA 3QTVH 4NIXA 2GTBA 1IOEA 2BHGA 2B7DH 1HIAB 3S0NA 1L0ZA 3Q3XA 1FAXA 5A0CA 3QZQA 4VGCC 2A1DB 3KGPA 3V0XA 2LNCA 2AIPA 1MMJN 4Y8ZA 1T32A 3SU3A 1FZZA 1O2MA 1GCTC 1B5GH 3RXJA 2B8OH 4MPUA 1P0SH 3AAVA 1QL9A 3M36A 4K69A 1Z7KA 3V7TA 3QO6A 4MQAA 1KXEA 3SJ8A 3RC6A 3GDVA 1RTFB 1Y3VA 1KSNA 1LHCH 3RLWH 1L4ZA 4PROA 1V2QT 3M3SA 1ZOMA 1DWEH 3M3TA 3UREA 5DP3A 4D9RA 1JRTA 3T29A 4O9VA 1C5PA 3A8DA 4R0IA 5E0HA 3L6PA 1TQ7B 4IN1A 1TGTA 1CQQA 3ESTA 5AFYH 8KME2 2A0QB 2XTTB 2ZCHP 4Y0ZE 1LQDB 1SHYA 4Z6AH 1FMGA 2BM2A 1TGNA 4INLA 1KLJH 1TWXB 3N7OA 2W7SA 3RLYH 7ESTE 1MTNC 1CA0C 2SGEE 3PV4A 1QQ4A 1ZTJA 1C5MD 2G5VA 1TGSZ 5JBBS 1ELEE 1GJ7B 4Q80A 4AFUA 1GL0E 2PUXB 3OX7U 2P8OB 2PTCE 2VIPA 4GLYA 4IN2A 4GVUA 5AHGH 2H2ZA 3AVZA 1GG6C 1WCZA 1QBVH 2WPMS 1XX9A 1O2KA 5JB9S 1W7GH 2VVCA 3ZZAA 2FI5E 1XUJA 1NS3A 1O2ZA 2A7HA 1DS2E 3B23B 3E0PB 2AGEX 2SNWA 5F6MA 4CRDA 2HOBA 3RXLA 1A0JA 4X6NA 2G5NA 3RXSA 3DT0H 2GCTB 2J34A 3LKWA 1CT0E 3ZYDA 1XKBC 2BQWB 2FWWA 1TOCB 3MU1A 1OS8A 4ABIA 3UOPA 1QL8A 1QB1A 4I33A 3RXKA 4AG2A 2IOTA 5LH8A 1GVKB 2OQ5A 1ANEA 2SGAA 5EPYA 1C1RA 4RKOB 4AFZA 1K2I1 2BX3A 3KQEA 1UTJA 1C2HA 1BTPA 3CS0A 3MNXA 3ZZ9A 1TRNA 4GHTA 3LOXA 1PQ8A 3F68H 3LGYA 3ATWA 1NRNH 1UK4A 3FP6E 4Y0YE 2R2WU 4ABDA 2GD4B 1OWDA 2STBE 1O3HA 4ABHA 1LHDH 1MTSA 1P2MA 3A87A 3KQCA 1C9PA 2A7JA 4O3TA 2WYJA 2FPZA 3ELAH 1PQAA 1GGDB 1O3EA 1C1WH 1MQ5A 5GDSH 1A5GH 1GBHA 1P2NA 2I6SA 1KXCA 4F4OC 1CO7E 1V2VT 1EATA 1TNIA 5DP6A 2GGVB 1T31A 3F9FA 4Q7XA 3MH4A 1KDQB 1SQAA 1YC0A 1ACBE 1ESAA 2ANWA 1A61H 1TYNA 3T28A 1H4WA 1EB1H 1ZHMA 1QY6A 1O2OA 2OXSA 3VGCC 4I8HA 2GCHG 1BITA 1DOJA 1CU1A 1VCQA 4ISIH 2A2XH 3EYDA 3B8JA 1L1GA 1GVLA 1W14U 1ZTLA 2HWLB 1NO9H 1BMMH 1G32B 1HAYB 1ESBA 2CXVA 3TH4H 3K6ZA 1O2JA 5CMXH 1P2JA 1NRPH 1O3PB 1GI7B 2CHAC 2Z6BD 5CHAB 3S7HB 5L30H 2TPIZ 1A0LA 5FBEA 2ZO3H 3A81A 1C4U2 3MO6A 1UCYH 3URDA 2Y7ZA 1QFKH 2GKVE 4XSKU 2R0LA 1SOZA 3I78A 5TCCA 1IQKA 3RXTA 1C1UH 1RIWC 3UWIA 2P3TB 1EPTB 3O8BA 5A8XA 3DFJA 3PMBB 1GHXH 1V2MT 2GT8A 2GV7A 4TWYA 2BY9X 3SNBA 4CRBA 3SO3A 1FIZA 1PPFE 1T4VH 1TRYA 2B0FA 2Z7FE 5A8ZA 3FFGA 1O5DH 2TGDA 1LVYA 2VU8E 4JK5A 3SV8A 1O39A 4K3JA 5LPFA 2HNTE 4WH8A 5EODA 1B0FA 3U98H 2DUCA 1VITF 1TNHA 5C1YA 1N8OB 3RU4E 3PO1C 1C5QA 3P8NA 2ZU3A 2J38A 3ZVGA 1OP2A 4JYVH 1AVXA 4I8JA 1EASA 1YPMH 1TIOA 2V35A 2J92A 4DW2U 3MTYA 4AYVB 2FDAA 1UTKA 1SLUB 1QB6A 3OY6U 2JETB 1EOLA 1NRSH 1ZR0A 4NWKA 3BIVH 3U1JB 2UWPA 1LDTT 1O5AB 2TRMA 1MKWH 2J9NA 2EI7A 3ZZ5A 2QV1A 1BTXA 3TJOA 2BLVA 2BQ6B 2Y5GA 2BZAA 1GDUA 1LKBA 3PWCA 1HBTH 2ZHFH 1YF4A 2C90B 4Y11E 1AI8H 3S69A 2G51A 1BDAA 1ELBA 3GCTG 5PTPA 5E8EH 4MG3A 2Z9IA 1BHXB 3RXIA 5GXPA 2GP9B 2FO9A 3SGBE 1F5RA 3MHWU 2Y5HA 1JIMA 1U6QA 4K60A 4ZMAH 2XWAA 4X8SH 1O5EH 3SNDA 1S82A 1Z1JA 3EA7A 1ZJKA 2TGAA 4YTAA 3MU5A 4U01A 1SC8U 3ZVEA 5DJ7A 4M7GA 1SGTA 2BXUH 3SHAH 5J4SA 3KNXA 5E0JA 3ZZ8A 1UO6A 1GMCG 1AFQB 5A0AE 1ZPZA 3ZZ7A 1AWHB 4ZXXH 4D76A 1AQ7A 1F0RA 3Q77A 4MLFB 1C2EA 1O30A 1PPHE 4AG1A 3VB7A 1Y5AT 3GISB 4BTTB 3S9CA 2IPHA 1GBJA 3KEEA 1OWHA 1SHHB 1ARCA 3RMNH 1BMAA 4ABJA 2QYIA 1OWEA 4JMYA 3LPRA 1AB9B 2ZHEH 1BOQA 4BOHA 2B9LA 4JZFH 2AGIX 3MFJA 2ZU4A 3Q00A 1SGQE 4KP0A 1YPHE 4FVDA 5EG4A 3E91A 1V2RT 2RG3A 2W7UA 2FOHA 4JYUH 4XBBA 3RU4T 1NT1A 2VINA 2ZCLP 1EAUA 2OTVA 1J17T 4H6SB 4CRGA 1VR1H 1QBNA 3TH2H 3MO9A 4A5TS 3M5LA 1YGCH 1ZSLA 1J16A 3IITA 1TGCA 1ORFA 4XBDA 2QXGA 2ZGJA 5GPIB 1BRCE 1LQEA 3U8TH 4CRAA 2FXRA 3Q76A 4XFQA 1WV7H 1HAVB 2P93A 1V2OT 2W26A 4O03A 3ZZBA 5JBAS 1O3FA 1A1RA 3HKJB 1BIOA 1GBMA 1RTLA 1O2NA 3SHCH 1CHGA 4K1EA 1V2JT 1ZRBA 1YM0A 2CMYA 1Y3WA 4LK4A 1VCWA 4I32A 1DE7H 1O2IA 4I8LA 1Z1IA 4UE7H 4J2YB 1ZMJA 3K2UA 2FS8A 3UQVA 4X1QU 1EKBB 3H7TA 3BF6H 2H9TH 1MKWK 1ELVA 2HNTF 2ZGHA 2ALVA 1BUIA 3TK9A 3JZ2B 4Y7BA 4IS5A 1AN1E 3RM0H 5JDUB 1HAOH 3SV9A 3M3VA 2R2MB 5GIBA 2XC0A 4FVBA 3UQOA 3E6PH 3LGWA 1FPCH 1PPBH 3T27A 4K8YA 4B73A 1MQ6A 1V2PT 1GI6A 3PM3A 1C5NH 4DIHH 1ABIH 1TAWA 4GCHF 3A8CA 3E0NB 2ZG0H 2BMGB 1GJBB 3RUOA 3QWCH 4KTSA 3E3TA 1C5UA 4FUHA 1Z6EA 2ZU1A 4DGJA 1IQLA 2ASUB 2LPRA 4X1RU 2BY8X 2R3UA 1BA8B 1K28D 5AF9H 4E05H 1GHBG 1UVOA 1YPKH 4UEHH 2BTCE 2FOGA 4WVPE 1D3DB 1P2OA 3EAJA 2ZU5A 4AX9H 3MMGA 4OS7A 3TITA 1HFDA 1A46H 3UNSA 2ANMH 4WJG2 2ULLA 3F6UH 4AFQA 5DP4A 5TJXA 2UUJB 4A7IB 1GI0A 2IJOB 1H9LB 1V2WT 1GBLA 3O8CA 1NFXA 1QBOA 3ENSB 4FXGH 4ZHLU 5CE1A 1C1OA 3P70B 4VGCB 1D3TB 3UIRA 3A83A 1LHEH 1VZQH 3F9HA 2C8WB 4BTUB 1FI8A 3LGTA 2G4UA 4A92A 3GCHC 1GCTB 3KHVA 4KELA 4O97A 1OOKB 2P95A 2D26C 1NC6A 1W2KH 4NSVA 3GY8A 2HNTC 3DHKH 2OC8A 3MO3A 5ETXA 2VVVA 4LZ4B 4F49A 9ESTA 4BXWA 1LPGB 4ZUHA 2P3UB 3A7WA 3M37A 1TBZH 7GCHF 4B2CA 4MPWA 2PKAB 1L4DA 1LVMA 1TOMH 1TONA 1KLTA 1O3DA 2QC2A 2ZGXH 3UR6A 2TGTA 1HRTH 2YNBA 1GI3A 3SNCA 1Y3XA 1O2GH 1QJ1B 1TPPA 2WPLS 1GBDA 1GHZA 3OSYA 4HGCA 4DT7B 2VWNA 1WU1A 3VEQB 5JBCS 1HJ8A 2XC4A 1IQEA 1GI2A 1JOUB 2ZHQH 3FP7E 2HPPH 2PWXA 3M5NA 2BB4A 1C9TA 2DE8A 3RXAA 3ATMA 1Z8IB 1S6FA 3H7OA 5F03A 4A1VA 1OX1A 3RXUA 1HDTH 3ZYEA 3RXQA 1YPJH 2SGPE 1GJ8B 3ZZ4A 1GG6B 4FUIA 2YOLA 4ESTE 1TMTH 1GJ9B 2ZWLH 1OWIA 4NCYA 1CSOE 3LIWA 1N1LA 4YZUA 3QLPH 4NA7A 1YPGH 4INKA 5FX6A 2Y81A 1XVMA 2EI6A 2FS9A 4YESB 1LHGH 3D65E 4NA8A 2XXLA 3ZZDA 1E36B 2R3YA 1GMDG 1BRUP 1CT2E 2BX4A 2QXHA 4YOIA 1EZXC 2BVXH 1GJ5H 4BAMB 2XNIA 4JZDH 2Y82A 3ZZ6A 1PPZA 3GCOA 1G3EA 4NIVA 3SU0A 2F9NA 1DSTA 4Y79A 4OS2A 1O2QA 1O5GH 4K2YA 2UUKB 4Y8YA 1YPLH 4ZKRU 3QGJA 1F0UA 1KY9A 1HXFH 2J95A 1FY4A 1YPHC 4MNVA 3SUFA 4B74A 1D9IA 5EW1H 2GVFA 3NXPA 3UTUH 1TNJA 3V13A 3UWJH 4AFSA 1TPOA 1QHRB 4WH6A 4B2BA 5DKMA 1O3MA 1MTUA 1SLXB 2Z94A 3UR9A 1LMWB 1W8BH 1DXPA 1HAHH 2GDEH 3FVFB 2AMQA 1VGCB 4ZKOU 5T3HA 3D49H 1PYTC 1XVOA 1BJUA 1SG8B 3K6YA 2PUQH 2GZ7A 2BY5X 3RM2H 5GJ4B 1AE5A 1FY1A 5FCRA 3E16B 3QUMP 1RD3B 1TA2A 2CN0H 2C4FH 1KTSB 2BY7X 3T62A 1RJXB 3ZV9A 1H8DH 1AHTH 2OBOA 2GZ8A 2ZIQH 2VIDA 2ZGBH 2A32A 3RDZA 2OP9A 1H9HE 2QN5T 4ZAEA 3CS7A 2OC7A 1GMHF 3NUMA 4OGYA 1O3BA 2FMJA 1OKXA 2PLXA 2VVUA 2TGPZ 1E34B 1D6WA 4UFGH 2XC5A 3TH3H 1C2GA 3BG4C 4ZXYH 5DP5A 1QA7A 2ZZUH 2GV6A 5A0BA 2GX4A 2AYWA 2ZTXA 1HAPH 4X6PA 1HNEE 1AZ8A 1DLKB 2O8TA 5DP8A 2FOBA 1C2LA 1UHBA 4X2XA 1T8OA 1EAXA 2VGCB 3VB4A 1E38B 1F0SA 1SGYE 1Y59T 3TIUA 2Y5FA 1DPOA 1CGHA 5GCHF 3E8LA 2ZDLA 3ODDA 3O8RA 1P04A 4IC5A 1NROH 1G36A 3LH3A 1TX6A 3RXVA 2QF0A 5EOKA 4AOQA 4DVAU 3EA8A 4Y71A 3LJJA 2ZFQH 3VPKA 2PTNA 3TJNA 4NG9H 1QCPA 2PV9B 4U2WA 1YLDA 5IDKA 4YT6H 1ZZZA 2ZDAH 3ATIA 3KQDA 2NU0E 3LC3A 3SU6A 3T26A 1A2CH 1M9UA 4H6TA 1SLVB 1BB0B 2PGBB 3SGQE 2W3KA 2CGAA 1C5TA 5EXNA 4E06H 4WMEA 2C93B 5E2OA 3QDZB 2VIWA 1G9IE 1SGPE 1NRQH 1XUGA 3SOSA 5IYTA 3VFEA 4MNXA 1GBIA 1Q31A 1AWFH 1MCVA 3SI3H 1K22H 3B9FH 3LU9B 1Z71A 2Y7XA 1YBWA 3ZVCA 2XW9A 1AMHA 2ESTE 2XYAA 2PKSC 5EGMA 1GHAF 3GICB 2EEKA 4CHAC 1SQTA 3PWBA 5I46H 2UUFB 1GJCB 2ODPA 2HPQH 1BTUA 2THFB 2O8MA 4RKJB 4FUGA 1AGJA 1TRMA 4UD9H 1IQFA 3LONA 3RXEA 3GY7A 3BEIB 1FY5A 2ZDVH 4BAQB 3F9EA 4MDSA 2BLOA 1GBFA 4LOYH 1Z8RA 4NZLA 3LGIA 3RXRA 1JWTA 1EP6A 1EOJA 1K1MA 1O2RA 1X7AC 2PHBA 1N6XA 2WINI 4I7YH 2GCTC 1XMNB 1GHWH 1W12U 1ZHRA 2BVSH 4CH2B 3S7KB 2CV3A 1A5IA 2VWOA 7KMEH 2H9HA 5FHTA 1TABE 3L3TA 5JYIA 4FU7A 2ALPA 2DE9A 2F9BH 1NRRH 2FIRH 3HKIB 8GCHF 4NWLA 1EB2A 5EQQA 3T2NA 1DM4B 1ELFA 2SNVA 3SBKA 1XM1A 2A7CA 3MH6A 3RC4A 1O3IA 1TFXA 2ZNKH 1C5WB 2BDGA 1SGFG 3PLKA 1TX8A 1GJ4H 2FM2A 3ODFA 1TE0A 3SV7A 1FNIA 4HZHA 1FAKH 4U32A 1IQNA 1B0EA 1WYKA 3AASA 1ESTA 1O3AA 1W0ZU 3TLOA 1J15A 4FUDA 3M61U 1SGEE 5EQSA 1DUAA 2BZ6H 2FODA 5T6GA 3TNTA 5C3NA 1G30B 3P8FA 4WXVA 1VCPA 4OGXA 2Y6TA 4XDEA 1UCYE 1AKSA 3HPTB 5L2YH 1MCTA 5G4BA 1BTZA 4H42U 3U1IB 4NSYA 1GJ6A 1F5KU 2AH4X 2A5KA 2WYGA 2Z9GA 4YT7H 1HPGA 1OWKA 2PSYA 3KN2A 3PTBA 1UTQA 2BOKA 1QJ6B 3PYHA 5LPEA 1SGRE 3SJIA 2FOCA 1O33A 1DWBH 1UTOA 4B71A 1V2LT 2JH6D 6ESTA 3GOVB 1E35B 1W10U 2ANYA 3IWMA 6CHAB 3EE0B 2P59A 1PYTD 4DJZB 1K21H 2ZTYA 4ZKNU 1S5SA 3SU2A 3O8DA 1ZGVA 2A4OA 2QXJA 1UVSH 4FU9A 1DX5M 4FUFA 3V12A 3K65B 5FPTA 1RS0A 3GYMA 1SVPA 1DDJA 4X2WA 1AIXH 5CHAC 1W7XH 2HGTH 5DG6A 4DCDA 1H9IE 3MI4A 1ELCA 4IBLH 2GMTC 1BMLA 4WWYA 1ETSH 2HVXA 1V2KT 3A85A 2XBXA 4H4FA 1RGQA 3Q3YA 1G2LA 1Z8GA 1ID5H 5HM2A 1P02A 2QA9E 3TNSA 1MU8B 4ISOA 1GPZA 4SGBE 1SLWB 2WUBA 1S0QA 1EPTC 2OCVB 3AW0A 1IQHA 3TGKE 4X6OA 1SFIA 3SV6A 4UFEH 1AFEH 1MBQA 3ZZ3A 1FN6A 2ZDNA 6LPRA 4NIYA 1IHSH 2FEQH 1UTNA 4KTCA 2ZEBA 3LH1A 1KIGH 3A7YA 2C8YB 1ZPCA 1OP8A 1TLDA 1OSSA 3BTKE 1JXPA 3BEFB 1EP5A 1O35A 1IQMA 1ZRKA 1HAXB 4WMDA 1C1PA 4X2YA 4BAKB 9LPRA 1J9CH 5J4QA 1N8OC 1HJAC 2KAIA 1D3QB 6GCHG 2Y80A 1OYTH 3UNRA 1KTTB 2ODQA 1AE8H 1EZSC 1XXDA 1SB1H 1ZJDA 5T6DA 2FOEA 2WPKS 5HYOA 3SI4H 4A1TA 2JETC 1FLEE 5EW2H 2ZDMA 1SBWA 2GCHF 4TY7A 1OXGA 4OS1A 2ZHDA 2D8WA 3HK3B 3BTEE 5EXMA 4ABAA 5C67A 1P12E 2JH0D 1MZDA 4K5ZA 3HGPA 4TY6A 1SL3A 5HGGA 1G3BA 2GT7A 1EQ9A 1WSSH 1QL7A 4X1NU 1ZMLA 5ABWA 3ZVBA 3DD2H 3TJVA 4U30A 4YLUA 4Q7ZA 1G3CA 3EGKH 1OYQA 1TPSA 4X1PU 1TNLA 5I25A 1ARBA 3GY4A 1MH0A 3GY5A 1YLCA 2VWLA 1C2IA 1HAIH 2ZFRH 3RXGA 2AIQA 3MNBA 2VIQA 3AW1A 2AS9A 3IG6B 1GDQA 3P17H 3PLBA 3A82A 3PMHB 7LPRA 2ZFFH 2AMPA 3UOUA 1P9UA 1FY8E 1DY9A 4MTBA 1K1NA 1LPKB 3MH7A 2F91A 3UNQA 1YP9A 2BY6X 3A7VA 1D4PB 1F0TA 5DK1A 1ABJH 3TVJB 1C2MA 3EDXB 4YO9A 1O5BB 4ASHA 3QZRA 4I8KA 3P8GA 1NPMA 2QF3A 1ZYOA 2Q6FA 1G3DA 1ZLRA 1JIRA 2Z3DA 3V3MA 3SNAA 5HM9A 4CR9A 2Q6GA 1KLIH 2WV5A 1V3XA 3UY9A 1OP0A 2ZA5A 2ZF0H 4Z0KA 1ZGIA 5ESBA 1HAZB 1UTLM 2G55A 2NWNA 2XRCA 3CP7A 4OS5A 1AB9C 1CA8B 4BNRA 3RXOA 2ODYB 1TNKA 2CJIA 1C5YB 1QIXB 4KGAA 4WMFA 2FLBH 2XCFA 3NWUA 1AU8A 1S0RA 3FZZA 5SGAE 2FLRH 4B75A 2NU4E 2FOAA 1EAWA 5LGOA 1GMHG 4AGJA 2ZECA 2SGFE 2ZTZA 4D8NA 5A2MH 1BBRH 1F2SE 2ZQ2A 4BXSA 1A5HA 5C1XA 3T5FH 2WUCA 1YCPH 1C4Y2 1SMFE 3BTDE 1SOTA 3WY8A 4J1YA 1EJAA 1T4UH 2FTLE 3ZVFA 4ABBA 3P6ZB 3UFAA 1FJSA 1UVPA 1TNGA 1CE5A 1LVOA 5H4IB 2NU2E 5DP7A 1UK3A 1MU6B 3A7XA 1HIAA 2J94A 2OUAA 4I31A 1S6HA 3UUZA 3SZNA 3GY2A 4OS6A 1DUEA 1AZZA 1HB0B 2A5IA 3EA9A 1C5SA 3RXCA 4CRFA 2OD3B 1GHVH 1OWJA 4Y76A 3SW2B 3NZIA 1GBEA 3TK6A 1HAGE 3C1KA 1UK2A 5TCAA 1GMCF 1MD7A 3S9AA 3P95A 1CBWC 2ZFPH 1EZUC 1Q3XA 3U69H 2BDYA 4KKDA 2GDDA 4JK6A 5GWZA 2QY0B 2XCNA 3D62A 1O36A 1DFPA 3ATLA 2BD3A 3OTJE 2C8ZB 1MTNB 1CA0B 3RXHA 1E0FD 2V0BA 5FXLA 2IN2A 2O8LA 1Y3YA 4DIIH 1HUTH 1NFWA 1F92A 3OY5U 3Q3KA 1BJVA 3P92A 1H1BA 2VIOA 4K8BA 4A6LA 2H1UA 1O3LA 1SGIB 5K7RA 2BDIA 3NPSA 1NU9A 1ZMNA 4CBOA 1O3NA 8ESTE 2I6QA 5FCKA 5ESTE 1GHYH 3I29A 4Y7AA 4GUXA 3TPIZ 4CRCA 1Y8TA 3KF2A 1K1OA 2Z9JA 3OU0A 1O2SA 3D23A 4GSOA 1T8LA 1T8MA 1NU7B 1UMAH 4AGKA 1O3OA 4X0WU 1N6YA 4XE4A 2FESH 1K9OE 5AVDA 1AD8H 1GJAB 1Y5UT 3ITIA 1THPB 2BDHA 4YLQH 5BPEA 1L1JA 5DPAA 1P11E 1TMBH 1C5LH 3A7TA 3MU4A 2BDAA 1P06A 2Z3EA 2F9PA 2G4TA 2ZHWH 1RRKA 3LGUA 1CGIE 1TBQH 5C2ZA 2QXIA 1B7XB 2OBQA
chains in the Genus database with same CATH superfamily
1QGFA 1EXFA 1KXAA 2ZC9H 2FX6A 1ELGA 4OM9A 2FYRA 5FX5A 4BAOB 3AAUA 3MU8A 1S81A 4ISHH 1GJDB 1WBGB 3C27B 1GI1A 3LT3A 1BZXE 2H5DA 1VITH 1JMOH 4Q7YA 1DITH 1O2LA 4WY3A 3P8OA 2EC9H 4X6MA 2FP7B 1D3PB 8GCHG 4D7GA 1KXDA 3FAOA 1PQ7A 5C5OA 3SORA 2M2AA 3W95A 2JH5D 3F9GA 3GCNA 3BTME 1BBRK 4TPIZ 4UFFH 4AB8A 1BRAA 2FTMA 1IQIA 3G01A 1LHFH 1EZQA 1Q2WA 1YCPK 5F8ZA 2UWLA 1O2HA 3ZVDA 2ZDKA 1QRZA 3HGNA 3TGJE 3GY6A 1W0YH 2A4QA 1Y3UA 3BTQE 1JRSA 1VITG 3KCGH 1GI9B 1TBRH 1DY8A 1ELDE 1SR5C 4Y10E 1L2EA 1DWDH 1IQGA 1O2VA 4HFPB 1DT2A 1BTYA 2WPIS 2G00A 1QR3E 1XUIA 2G52A 3SJOA 5A8YA 2Q6DA 3BTFE 3OE7D 1FONA 3VGCB 1QJ7B 1WTHD 2PKSB 3M5OA 3PV5A 4NGAH 3TGIE 4CHAB 1GBTA 2V3OH 3RXMA 1GVZA 1GL1A 1NFYA 5L2ZH 1FDPA 2V6NA 3BTGE 1GHBF 4ZHMU 3SQEE 1V2NT 4I8GA 3PMAB 3LC5A 2QCYA 1HCGA 2HRVA 2OC0A 1SGDE 2M5TA 4NFFA 2OLGA 1KDQA 1ZPBA 1ZSJA 5DO4H 3VB5A 5HKKD 3PTNA 4SGAE 3QN7A 2ZPQA 3I77A 5C1UA 3RMMH 1GI5A 1NZQH 4B6EA 2CHAB 2F9VA 1C5RA 5E0GA 1C2KA 3OYPA 2ZP0H 3FOAA 4BANB 1K1LA 3KQ5A 1MAXA 2P16A 2TBSA 3OEHD 1GBBA 1NESE 1EX3A 3M7UA 3A8BA 1YCPM 1W13U 5C20A 1PFXC 1O37A 3KIDU 4HG6A 1RIWB 1SQRA 2ZI2H 1C4V2 3GDSA 4THNH 3RXBA 1EJNA 1D6RA 2F9UA 4YOGA 4AZ2B 1DANH 4BAHB 3TK5A 3WW7A 2R0KA 1ETRH 3M5MA 3DUXH 1SFQB 1ELTA 3BTWE 3SU4A 4ZKSU 3RXPA 3MQKC 2ZPSA 5FAHA 3DSGA 1QQUA 2BDBA 1WQVH 4QT8C 1UTPA 8LPRA 1PPGE 1IHTH 1TQ0B 1C2JA 2L6OA 1V2TT 1CT4E 3PO1B 2BQ7B 3QK1A 1EPTA 2ZQ1A 1UVUH 1TMUH 4ZHAA 4ABFA 5F8TA 1O2XA 4E7NA 2O9QA 1CVWH 2AGGX 1VGCC 3SQHE 1DSUA 3SU5A 4JZIA 2PSXA 5HMAA 3RXDA 2EI8A 1V2ST 1PJPA 1ZTKA 2FZZA 3RMOH 1O0DH 3S9BA 2BDCA 4YM9A 2SFAA 3HK6B 4CBNA 2BVRH 2A4RA 1F5LA 1GWAA 1O34A 2HLCA 4ZH8A 4TPYA 1FN8A 2P8OC 2FI3E 3RU4D 1Z8JB 1C1SA 1THRH 4IC6A 1FPHH 1MZAA 3A80A 3U9AH 5B6OA 4LXBH 2HALA 1CHOF 2D1JA 3FANA 1LO6A 1UHBB 1P3EA 3A86A 1UTMA 1O3GA 1H8HD 5K0HA 1IAUA 1AVWA 1GMDF 1P3CA 3KL6A 1K1IA 2SGQE 2G8TA 1FQ3A 4R8TB 1C1NA 1QRXA 1MBMA 2WV9A 2D2DA 4UONA 5C0TA 2BD5A 3GY3A 3F0PA 4XOJA 2KCPA 1BQYA 2VGCC 1TALA 2H5CA 4XBCA 1INCA 1PQ5A 2A31A 3FN8A 2F3CE 5E2PA 4B2AA 3NK8A 5JPMH 1A0HB 3JZ1B 2GMTB 2BLQA 5FBIA 1G37A 1GCDA 1YPEH 4Y8XA 2FX4A 1OPHB 2OC1A 1YKTA 2STAE 5DGJA 3TJUA 1GDNA 2RCEA 1O32A 4ZROA 3BIUH 1P2KA 4ABGA 1O2YA 2YMSC 5EPNA 1S85A 1ZHPA 1VKYA 1TX7A 1A3BH 4JZ1A 5F8XA 3ZZCA 1EUFA 4TWWA 1AY6H 1HJ9A 1NTPA 3BV9B 1G2MA 1GGDC 1H8IH 2BXTH 4GCHG 2EA3A 4X1SU 4DOQA 3CENA 1MUEB 3EQ0H 3VXFH 1HJAB 1QURH 4FETA 1O3JA 2BD4A 3PB1E 3STIA 4A1XA 3L33A 2BD8A 2AEIH 3KQBA 3VXEH 2PR3A 2VH0A 1P01A 4ABEA 1RXPA 1FXYA 1P05A 4Y6DA 1BT7A 1MTWA 2Q1JA 3UPEA 4AN7A 1LTOA 1TB6H 2GZ9A 3MNSA 1C5XB 1BTHH 4CH8B 2L74A 5L6NH 1LCYA 4RT1A 2ZPRA 1NM6A 4D7FA 1FIWA 1AO5A 4WXIA 4CREA 1O2UA 4DG4A 2VIVA 5A09A 1BTWA 2NU3E 4RN6A 4WF8A 1HXEH 3A84A 4HTCH 4ACAA 2UWOA 1XUFA 2AFQB 4GAWA 2VH6A 3GYLB 4D9QA 2PP6A 1SSXA 2FYQA 2ZCKP 2RA0A 2O8UA 3NCLA 5B6LA 2AERH 2XOKD 4JCNA 3M7TA 1JBUH 4K1SA 3MNCA 1BHXF 1J8AA 4Q2KA 3SU1A 1MKXH 5C5NA 1BMNH 1L1NA 1K1PA 1HAVA 1QB9A 4E7RG 1O2TA 3SV2H 2H9EH 2CF9H 3U8RH 3E90B 7GCHG 4MVNA 1IQJA 1GBKA 5EXLA 1HYLA 1K1JA 1QA0A 3VG8A 1C1TA 1MTVA 1WOFA 3PROA 1SPJA 3PLPA 2PW8H 3SUDA 2F83A 2K0QA 2WHXA 2Z3CA 4B1TA 2EQNA 2NU1E 4MPVA 1SGFA 1YYY1 1THSH 2FOFA 3F2HA 2A4GA 1P9SA 3MYWA 1AKSB 1XXFA 1P03A 2KX4A 1EJMA 1KXBA 1WUNH 5FPYA 4HI3A 3E1XB 1TA6A 2KZ4A 2J4IA 1SGCA 3STJA 1S84A 4LZ1H 1ZSKA 3FZDA 4P02A 1O5FH 2B5TB 2XBVA 3MU0A 1MAYA 1TPAE 1Y5BT 2XBWA 1UCYK 3R3GB 1ELAA 2QGRA 3SGAE 3K9XB 4FUCA 1P57B 2A2QH 1HGTH 1P2IA 2YNAA 1NFUA 2OQUA 1AUJA 1KYNA 2HVYB 3HATH 1P10A 4KTUA 4AORA 5BRRE 4JZEH 1T7CA 4NIWA 4YOJA 3GCHB 2XWBI 4MNYA 1PPEE 2OINA 3M35A 3MH5A 4O3UA 2V3HH 5DP9A 4OS4A 3MOCA 2F9OA 4TYDA 2J2UA 1A4WH 1PPCE 1V2UT 3A88A 1MD8A 3RP2A 1SQOA 3BTTE 1LVBA 3SN8A 6CHAC 1C5OH 2ILNA 1EAIA 2KCYA 5LPRA 3RC5A 1GI8B 3LDXH 3F1SB 3VB6A 1E37B 3QGNB 4FUBA 3BN9A 4ISNA 1ANDA 3ZV8A 2PGQB 4GHQA 1C1MA 1EFRD 2RA3A 3LGVA 3A7ZA 4RSPA 4MNWA 1GBCA 1AFQC 1CBWB 4X8TH 1UJ1A 2VB0A 1NBMD 3QX5H 2QAAA 4I86A 2Z9LA 3SJ9A 1H8ED 2BYAX 3TU7H 1DLEA 2VWMA 1O3CA 1QNJA 2ZGCA 2JIZD 2AMDA 3QTOH 2CF8H 4GPGA 2FI4E 1XUKA 4K1TA 2KAIB 4NZQA 2PKAA 3GDUA 4NFEA 1C2FA 3SUGA 4IGDA 1DICA 1P2QA 1KXFA 1C5VA 4BTIB 3PMJA 1DWCH 5T6FA 3BEUA 1Z6JH 1MKXK 2GJGA 2PFEA 1GI4A 1C1VH 2H6MA 2WPHS 1O38A 3SJKA 2J97A 2ZU2A 1HLTH 4X8UH 2BD9A 2J98A 4INHA 1XUHA 3W94A 1ANCA 2FOMB 4X2VA 4DURA 1AUTC 1MABB 1NN6A 3W1EA 2WV4A 1GBAA 1VJ9U 2BD7A 2K1QA 1YY3A 3T25A 3VB3A 1O2WA 5JBTA 2BLWA 1CGJE 2TIOA 3GCTF 2P3FH 2KFWA 1ETTH 1C2DA 2W5EA 1AVGH 1SGNE 2O8WA 4NA9H 2W6ID 1S83A 1FUJA 2JKHA 4IMZA 4UFDH 5HXFA 2YMSD 1A7SA 2ZFTA 1LPZB 5EU8A 2ZFSA 1P09A 2RDLA 2ZKSA 1J14A 4X8VH 3MWIU 5GCHG 1RFNA 3U8OH 1O5CB 3GS9A 3BTHE 2Z9KA 1XKAC 2VNTA 3NKKA 4CR5A 1WQSA 3M7QA 1T8NA 3DFLA 4MPXA 1ANBA 4UDWH 2C3SA 3BG8A 2QIQA 4IW4E 3URCA 3H5CB 4F48B 3BSQA 4FUEA 1BRBE 1SI5H 4AYYB 3R0FA 2P94A 1HV7A 2C8XB 3RMLH 3LJOA 1BBRE 4AB9A 2A45B 3WWBA 1WAYB 5AFZH 2W3IA 1V6DA 2BOHB 1F7ZA 1FV9A 1O3KA 2A5AA 3A89A 1BCUH 2SGDE 1DXWA 2ANKH 5F53A 5JB8S 5EJ1A 1RTKA 3FP8E 1VJAU 1WTGH 2QE7D 2VJ1A 4FUJA 4IMQA 3SUEA 4ISLA 1QRWA 3A8AA 2WPJS 1UVTH 1A3EH 1DVAH 1C5ZB 1P8VC 1W11U 5FPSA 3ZVAA 3DA9B 6GCHF 1C1QA 4DY7B 1GHAG 2UUYA 5KECA 3ATKA 1LKAA 1O31A 4JYTA 4FU8A 1FY3A 1TGBA 2G81E 3F2FA 3RXFA 2BD2A 2HLDD 3BG4B 5EQRA 2R9PA 2XBYA 4B76A 1CHOG 3N99A 1W3CA 3NRLA 1O2PA 1NY22 3SNEA 1QTFA 3QTVH 4NIXA 2GTBA 1IOEA 2BHGA 2B7DH 1HIAB 3S0NA 1L0ZA 3Q3XA 1FAXA 5A0CA 3QZQA 4VGCC 1COWD 2A1DB 3KGPA 3V0XA 2LNCA 2AIPA 4ASUD 1MMJN 4Y8ZA 1T32A 3SU3A 1FZZA 1O2MA 4FOUC 1GCTC 1B5GH 3RXJA 2B8OH 4MPUA 1P0SH 3AAVA 1QL9A 3M36A 4K69A 5GNDA 1Z7KA 3V7TA 3QO6A 4MQAA 1KXEA 3SJ8A 3RC6A 3GDVA 1RTFB 1Y3VA 1KSNA 1LHCH 3RLWH 1L4ZA 4PROA 1V2QT 3M3SA 1ZOMA 1DWEH 3M3TA 3UREA 5DP3A 4D9RA 1JRTA 3T29A 4O9VA 1C5PA 3A8DA 4R0IA 5E0HA 3SYJA 3L6PA 1TQ7B 4IN1A 1TGTA 1CQQA 3ESTA 5AFYH 8KME2 2A0QB 2XTTB 2ZCHP 4Y0ZE 1LQDB 1SHYA 4Z6AH 1FMGA 2BM2A 3OTPA 1TGNA 4INLA 1KLJH 1TWXB 3N7OA 2W7SA 3RLYH 2F43B 7ESTE 1MTNC 1CA0C 2SGEE 3PV4A 1QQ4A 1ZTJA 1C5MD 2G5VA 1TGSZ 5JBBS 1ELEE 1GJ7B 4Q80A 4AFUA 1GL0E 2PUXB 3OX7U 2P8OB 2PTCE 5DN6D 2VIPA 4GLYA 4IN2A 4GVUA 5AHGH 2H2ZA 3AVZA 1GG6C 1WCZA 1QBVH 2WPMS 1XX9A 1O2KA 5JB9S 1W7GH 2VVCA 3ZZAA 2FI5E 2XNDD 1XUJA 1NS3A 1O2ZA 2A7HA 1DS2E 3B23B 3E0PB 2AGEX 2SNWA 5F6MA 4CRDA 2HOBA 3RXLA 1A0JA 2JDID 4X6NA 2G5NA 3RXSA 3DT0H 2GCTB 2J34A 3LKWA 1CT0E 3ZYDA 1XKBC 2BQWB 2CK3D 2FWWA 1TOCB 3MU1A 1OS8A 4ABIA 3UOPA 1QL8A 1QB1A 4I33A 3RXKA 4AG2A 4XD7D 2IOTA 5LH8A 1GVKB 2OQ5A 1ANEA 2SGAA 5EPYA 1C1RA 4RKOB 4AFZA 1K2I1 5KGOA 2BX3A 3KQEA 1UTJA 1C2HA 1BTPA 1SKYE 3CS0A 3MNXA 3ZZ9A 1TRNA 4GHTA 3LOXA 1PQ8A 3F68H 3LGYA 3ATWA 1NRNH 1UK4A 3FP6E 4Y0YE 2R2WU 2YMSB 4ABDA 1UW7A 2GD4B 1OWDA 2STBE 1O3HA 4ABHA 1LHDH 1MTSA 1P2MA 3A87A 3KQCA 1C9PA 2A7JA 4O3TA 2V3MA 2WYJA 2FPZA 3ELAH 1PQAA 1GGDB 1O3EA 1C1WH 1MQ5A 5GDSH 1A5GH 1GBHA 1P2NA 3KYGA 2I6SA 1KXCA 4F4OC 1CO7E 1V2VT 4ZCNA 1EATA 1TNIA 5DP6A 2GGVB 1T31A 3F9FA 4Q7XA 3EE7A 3MH4A 1KDQB 1SQAA 1YC0A 1KMHB 1ACBE 1ESAA 2ANWA 1A61H 1TYNA 3DSPA 3T28A 1H4WA 1EB1H 1ZHMA 1QY6A 1O2OA 2OXSA 3VGCC 3KYFA 4I8HA 2GCHG 1BITA 1DOJA 1CU1A 1VCQA 4ISIH 2A2XH 3EYDA 3B8JA 3ZIAD 1L1GA 1GVLA 1W14U 1ZTLA 2HWLB 1NO9H 1BMMH 1G32B 1HAYB 1ESBA 5HIYA 2CXVA 3TH4H 3K6ZA 1O2JA 5CMXH 1P2JA 1NRPH 1O3PB 1GI7B 2CHAC 2Z6BD 4DT4A 5CHAB 3S7HB 5L30H 2TPIZ 1A0LA 5FBEA 2ZO3H 3A81A 1C4U2 3AK5A 3MO6A 1UCYH 3URDA 2Y7ZA 1QFKH 2GKVE 4XSKU 2R0LA 1SOZA 3I78A 5TCCA 1IQKA 3RXTA 1C1UH 1RIWC 3UWIA 2P3TB 1EPTB 3O8BA 5A8XA 2WPDD 3DFJA 3PMBB 1GHXH 3DSOA 1V2MT 2GT8A 2GV7A 4TWYA 2BY9X 3SNBA 4CRBA 3SO3A 1FIZA 2QF4A 1PPFE 1T4VH 1TRYA 2B0FA 2Z7FE 5A8ZA 3FFGA 1O5DH 2TGDA 1LVYA 2VU8E 4JK5A 3SV8A 1O39A 4K3JA 5LPFA 3PRBA 2HNTE 4WH8A 5EODA 1B0FA 3U98H 2DUCA 1VITF 1TNHA 5C1YA 1N8OB 2RDEA 3PO1C 3RU4E 1C5QA 3P8NA 2ZU3A 2J38A 3ZVGA 1OP2A 4JYVH 1AVXA 4I8JA 1EASA 4F55A 5C17A 1YPMH 1TIOA 2V35A 2J92A 4DW2U 3MTYA 4AYVB 2FDAA 1UTKA 1SLUB 1QB6A 3OY6U 2JETB 1EOLA 1NRSH 1ZR0A 4NWKA 3BIVH 3PV2A 2UWPA 3U1JB 1LDTT 1O5AB 2TRMA 1MKWH 2J9NA 2EI7A 3ZZ5A 1OHHD 2QV1A 1BTXA 3TJOA 1BMFD 2BLVA 2BQ6B 2Y5GA 2BZAA 4M9FA 1GDUA 1LKBA 3PWCA 1HBTH 2ZHFH 1YF4A 2C90B 4Y11E 1AI8H 3S69A 2G51A 1BDAA 1ELBA 3GCTG 5PTPA 5E8EH 4MG3A 2Z9IA 1BHXB 3RXIA 5GXPA 2GP9B 2FO9A 3SGBE 4Z1MD 4RI0A 1F5RA 3MHWU 2Y5HA 1FX0B 1JIMA 1U6QA 2J5UA 4K60A 4ZMAH 2XWAA 4X8SH 1O5EH 3SNDA 1S82A 1Z1JA 3EA7A 1ZJKA 2TGAA 4YTAA 3MU5A 4U01A 1SC8U 3ZVEA 5DJ7A 4M7GA 1SGTA 2BXUH 3SHAH 5J4SA 3KNXA 5E0JA 3ZZ8A 1UO6A 1GMCG 1AFQB 5A0AE 1ZPZA 3ZZ7A 1AWHB 4ZXXH 4D76A 1AQ7A 1F0RA 3Q77A 4MLFB 1C2EA 1O30A 1PPHE 4AG1A 3VB7A 3U28C 1Y5AT 3GISB 4BTTB 3S9CA 2IPHA 1GBJA 3KEEA 1OWHA 1SHHB 1ARCA 3RMNH 1BMAA 4ABJA 2QYIA 1OWEA 4JMYA 3LPRA 1AB9B 2ZHEH 1BOQA 1S6LA 4BOHA 2B9LA 4JZFH 2AGIX 3MFJA 2ZU4A 3Q00A 1SGQE 4KP0A 1YPHE 4FVDA 5EG4A 3E91A 1V2RT 2RG3A 2W7UA 2FOHA 4JYUH 4XBBA 3RU4T 1NT1A 2VINA 2ZCLP 1EAUA 2OTVA 1J17T 2AHME 4H6SB 4CRGA 1VR1H 1QBNA 3TH2H 3MO9A 4A5TS 3M5LA 1YGCH 1ZSLA 4P00A 1J16A 3IITA 1TGCA 3FO8D 1ORFA 4XBDA 2QXGA 2ZGJA 5GPIB 1BRCE 1LQEA 3U8TH 4CRAA 2FXRA 3Q76A 4XFQA 1WV7H 1HAVB 2P93A 1V2OT 2W26A 4O03A 3ZZBA 5JBAS 1O3FA 1A1RA 3HKJB 1BIOA 1GBMA 1RTLA 1O2NA 3SHCH 1CHGA 4K1EA 1V2JT 1ZRBA 1YM0A 2CMYA 1Y3WA 4LK4A 1VCWA 4I32A 1DE7H 1O2IA 4I8LA 1Z1IA 4UE7H 4J2YB 1ZMJA 3K2UA 2FS8A 3UQVA 4X1QU 1EKBB 3H7TA 3BF6H 2H9TH 1MKWK 1ELVA 2HNTF 2ZGHA 2ALVA 1BUIA 3TK9A 3JZ2B 4Y7BA 4IS5A 1AN1E 3RM0H 5JDUB 1HAOH 3SV9A 3M3VA 2R2MB 5GIBA 2XC0A 4FVBA 3UQOA 3E6PH 3LGWA 1FPCH 1PPBH 3T27A 4K8YA 4B73A 1MQ6A 1V2PT 1GI6A 3F2GA 4YXWD 3UB0A 3PM3A 1C5NH 4DIHH 1ABIH 1TAWA 4GCHF 3A8CA 3E0NB 2ZG0H 2BMGB 1GJBB 3RUOA 3QWCH 4KTSA 1E79D 3E3TA 1C5UA 4FUHA 1Z6EA 2ZU1A 4DGJA 1IQLA 2ASUB 2LPRA 4X1RU 2BY8X 2R3UA 1BA8B 1K28D 5AF9H 4E05H 2WSSD 1GHBG 1UVOA 1YPKH 4UEHH 2BTCE 2FOGA 4WVPE 1D3DB 1P2OA 3EAJA 2ZU5A 4AX9H 3MMGA 4OS7A 3TITA 1HFDA 1A46H 3UNSA 2VBCA 2ANMH 4WJG2 2ULLA 3F6UH 4AFQA 5DP4A 5TJXA 1WDIA 2UUJB 4A7IB 1GI0A 2IJOB 1H9LB 5C94A 5CDFE 1V2WT 1GBLA 3O8CA 1NFXA 1QBOA 3ENSB 4FXGH 1YLNA 4ZHLU 1C1OA 5CE1A 3P70B 5IK2D 4VGCB 1D3TB 3UIRA 3A83A 1LHEH 1VZQH 3F9HA 2C8WB 4BTUB 1FI8A 3LGTA 2G4UA 4A92A 3GCHC 1GCTB 3KHVA 4KELA 4O97A 1OOKB 2P95A 2D26C 1NC6A 1W2KH 4NSVA 3GY8A 2HNTC 3DHKH 2OC8A 3MO3A 5ETXA 2VVVA 4LZ4B 4F49A 9ESTA 4BXWA 1LPGB 4ZUHA 2P3UB 3A7WA 3M37A 1TBZH 7GCHF 4B2CA 4MPWA 2PKAB 1L4DA 1LVMA 1TOMH 1TONA 1KLTA 1O3DA 2QC2A 2ZGXH 3UR6A 2TGTA 1HRTH 2YNBA 1GI3A 3SNCA 1Y3XA 1O2GH 1QJ1B 1TPPA 2WPLS 1GBDA 1GHZA 3OSYA 4HGCA 4DT7B 2VWNA 4AC9A 1WU1A 3VEQB 5JBCS 1HJ8A 2J98B 1IQEA 1GI2A 2XC4A 1JOUB 2ZHQH 3FP7E 2HPPH 2PWXA 2LP6A 3M5NA 2BB4A 1C9TA 2DE8A 5T1VA 3RXAA 3ATMA 1Z8IB 1S6FA 3H7OA 5F03A 4A1VA 1OX1A 3RXUA 1HDTH 3ZYEA 4TSFD 3RXQA 1YPJH 2SGPE 1GJ8B 1WXRA 3ZZ4A 1GG6B 4FUIA 2YOLA 4ESTE 1TMTH 1GJ9B 2ZWLH 1OWIA 4NCYA 1CSOE 3LIWA 1N1LA 4YZUA 3QLPH 4NA7A 1YPGH 4INKA 5FX6A 2Y81A 1XVMA 2EI6A 2FS9A 4YESB 1LHGH 3D65E 4NA8A 2XXLA 3ZZDA 1E36B 2R3YA 1GMDG 1BRUP 1CT2E 2BX4A 2QXHA 4YOIA 1EZXC 2BVXH 1GJ5H 4BAMB 2XNIA 4JZDH 2Y82A 3ZZ6A 1PPZA 3GCOA 1G3EA 4NIVA 3SU0A 2F9NA 1DSTA 4Y79A 4OS2A 1O2QA 1O5GH 4K2YA 2UUKB 3F3BA 3SZEA 4Y8YA 1YPLH 4ZKRU 3QGJA 1F0UA 1KY9A 1HXFH 2J95A 1FY4A 1YPHC 4MNVA 3SUFA 4B74A 1D9IA 5EW1H 2GVFA 3NXPA 3UTUH 1TNJA 3V13A 3UWJH 4AFSA 3OAAD 1TPOA 1QHRB 4WH6A 4B2BA 5DKMA 1O3MA 1MTUA 1SLXB 2Z94A 3UR9A 4B6FA 1LMWB 1W8BH 1DXPA 1HAHH 2GDEH 3FVFB 2AMQA 1VGCB 4ZKOU 5T3HA 3D49H 1PYTC 1XVOA 1BJUA 1SG8B 3K6YA 2PUQH 2GZ7A 2BY5X 3RM2H 5GJ4B 1AE5A 1FY1A 5FCRA 3E16B 3QUMP 1RD3B 1TA2A 2CN0H 2JJ2D 2C4FH 1KTSB 2BY7X 3T62A 1RJXB 3ZV9A 1H8DH 1AHTH 2OBOA 2GZ8A 2ZIQH 2VIDA 2ZGBH 2A32A 3RDZA 2OP9A 1H9HE 2QN5T 4ZAEA 3H09A 3CS7A 2OC7A 1GMHF 3NUMA 4OGYA 1O3BA 2FMJA 1OKXA 2PLXA 2VVUA 2TGPZ 1E34B 2KCAA 1D6WA 4UFGH 2XC5A 3TH3H 1C2GA 3BG4C 4ZXYH 5DP5A 1QA7A 2ZZUH 2GV6A 5A0BA 2GX4A 2AYWA 2ZTXA 1HAPH 4X6PA 1HNEE 1AZ8A 1DLKB 5C0UA 2O8TA 5DP8A 2FOBA 1C2LA 1UHBA 4X2XA 1T8OA 1EAXA 2VGCB 3VB4A 1E38B 1F0SA 1SGYE 1Y59T 3TIUA 2Y5FA 1DPOA 1CGHA 5GCHF 3E8LA 2ZDLA 3ODDA 3O8RA 1P04A 4IC5A 1NROH 1G36A 3LH3A 1TX6A 3RXVA 2QF0A 5EOKA 4AOQA 4DVAU 3EA8A 4Y71A 3LJJA 2ZFQH 3VPKA 2PTNA 3TJNA 4NG9H 1QCPA 1E1RD 2PV9B 4U2WA 1YLDA 5IDKA 4YT6H 1ZZZA 2WZQA 2ZDAH 2OK5A 3ATIA 3KQDA 2NU0E 3LC3A 3SU6A 3T26A 1A2CH 1M9UA 4H6TA 1SLVB 1BB0B 2PGBB 5DSFA 3SGQE 2W3KA 2CGAA 1C5TA 5EXNA 4E06H 4WMEA 2C93B 5E2OA 4ACBA 3QDZB 2VIWA 2IPQX 1G9IE 1SGPE 1NRQH 1XUGA 3SOSA 5IYTA 3VFEA 4MNXA 4XRNA 1GBIA 1Q31A 3N7DA 1AWFH 1MCVA 3SI3H 2W6JD 1K22H 3PRDA 3B9FH 3LU9B 1QZ8A 1Z71A 2Y7XA 1YBWA 3ZVCA 2XW9A 1AMHA 2ESTE 2XYAA 2PKSC 5EGMA 1GHAF 3GICB 2EEKA 4CHAC 1SQTA 3PWBA 5I46H 2UUFB 1GJCB 2ODPA 5CHBA 2HPQH 1BTUA 2THFB 2O8MA 4RKJB 4FUGA 1AGJA 1TRMA 4UD9H 1IQFA 3LONA 3RXEA 3GY7A 3BEIB 1FY5A 2ZDVH 4BAQB 3F9EA 4MDSA 2BLOA 3CNRA 1GBFA 4LOYH 1Z8RA 4NZLA 3LGIA 3RXRA 1JWTA 1EP6A 1EOJA 1K1MA 1O2RA 1X7AC 2PHBA 1N6XA 2WINI 4I7YH 2GCTC 1XMNB 1GHWH 1W12U 1ZHRA 2BVSH 4CH2B 3S7KB 2CV3A 1A5IA 2VWOA 7KMEH 2H9HA 5FHTA 1TABE 3L3TA 5JYIA 1W0JD 2ALPA 4FU7A 5FL7D 2DE9A 5HIZA 2F9BH 1NRRH 2FIRH 3HKIB 8GCHF 4NWLA 1EB2A 2LELA 5EQQA 3T2NA 1DM4B 1ELFA 2SNVA 3SBKA 1XM1A 2A7CA 3MH6A 3RC4A 1O3IA 1TFXA 2ZNKH 1C5WB 2BDGA 1SGFG 2QF5A 3PLKA 1TX8A 1GJ4H 2FM2A 3ODFA 2KCOA 1TE0A 3SV7A 1FNIA 4HZHA 1FAKH 4U32A 1IQNA 1B0EA 1WYKA 4Q4LA 3AASA 1ESTA 1O3AA 1W0ZU 3TLOA 1J15A 4FUDA 3M61U 1SGEE 5EQSA 1DUAA 2BZ6H 2FODA 1E1QD 5T6GA 3TNTA 5C3NA 5EJZA 1G30B 3P8FA 4WXVA 1VCPA 4TT3D 4OGXA 2Y6TA 4XDEA 1UCYE 1AKSA 3HPTB 5L2YH 1MCTA 5G4BA 1BTZA 4H42U 3U1IB 4NSYA 1GJ6A 1F5KU 2AH4X 2A5KA 2WYGA 2Z9GA 4YT7H 1HPGA 1OWKA 2PSYA 3KN2A 3PTBA 1UTQA 2BOKA 1QJ6B 3PYHA 5LPEA 1SGRE 3SJIA 2FOCA 1O33A 1DWBH 1UTOA 4B71A 1V2LT 2JH6D 6ESTA 3GOVB 1E35B 1W10U 2ANYA 3IWMA 6CHAB 3EE0B 2P59A 1PYTD 4DJZB 1K21H 2ZTYA 4ZKNU 1S5SA 3SU2A 3O8DA 1ZGVA 2A4OA 2QXJA 1UVSH 4FU9A 2K8IA 1DX5M 4FUFA 3V12A 3K65B 5FPTA 5KEDA 1RS0A 3GYMA 1SVPA 1DDJA 2KR7A 3DCLA 1AIXH 4X2WA 5CHAC 1W7XH 2HGTH 5DG6A 4DCDA 1H9IE 3MI4A 1ELCA 4IBLH 2GMTC 1BMLA 4WWYA 1ETSH 2HVXA 1V2KT 3A85A 2XBXA 4H4FA 1RGQA 3Q3YA 1G2LA 1Z8GA 1ID5H 5HM2A 1P02A 2QA9E 3TNSA 1MU8B 4ISOA 1GPZA 4SGBE 1SLWB 2WUBA 1S0QA 1EPTC 2OCVB 3AW0A 1IQHA 3TGKE 4X6OA 3FKSD 1SFIA 3SV6A 4UFEH 1AFEH 1MBQA 3ZZ3A 1FN6A 2ZDNA 6LPRA 4NIYA 1IHSH 2FEQH 1UTNA 4KTCA 2ZEBA 3LH1A 1KIGH 1W0KD 2V7QD 3A7YA 2C8YB 1ZPCA 1OP8A 1TLDA 1OSSA 3BTKE 1JXPA 3BEFB 1EP5A 1O35A 1IQMA 1ZRKA 1HAXB 4WMDA 1C1PA 4X2YA 4BAKB 9LPRA 1J9CH 5J4QA 1N8OC 1HJAC 2KAIA 1D3QB 6GCHG 2Y80A 1OYTH 3UNRA 1KTTB 2ODQA 1AE8H 1EZSC 1XXDA 1SB1H 1ZJDA 5T6DA 2FOEA 2WPKS 5HYOA 3SI4H 4A1TA 2JETC 1FLEE 5EW2H 2ZDMA 1SBWA 2GCHF 4TY7A 1OXGA 4OS1A 2ZHDA 2D8WA 3HK3B 3BTEE 5EXMA 4ABAA 5C67A 1P12E 2JH0D 1MZDA 4K5ZA 3HGPA 4TY6A 1SL3A 5HGGA 1G3BA 2GT7A 1EQ9A 1WSSH 1QL7A 2IJD1 4X1NU 1ZMLA 5ABWA 3ZVBA 3DD2H 3TJVA 3F0OA 4U30A 4YLUA 4Q7ZA 1G3CA 2F4LA 3EGKH 1OYQA 1TPSA 4X1PU 1TNLA 5I25A 1ARBA 3GY4A 1MH0A 3GY5A 1YLCA 2VWLA 1C2IA 1HAIH 2ZFRH 3RXGA 2AIQA 3MNBA 2VIQA 3AW1A 2AS9A 3IG6B 1GDQA 3P17H 3PLBA 3A82A 3PMHB 7LPRA 5EIYA 2ZFFH 2AMPA 2EY4C 3UOUA 1P9UA 1FY8E 1DY9A 4MTBA 1K1NA 1LPKB 3MH7A 2F91A 3UNQA 1YP9A 2BY6X 3A7VA 1D4PB 1F0TA 5DK1A 2KM0A 1ABJH 3OEED 1C2MA 3EDXB 3TVJB 4YO9A 1O5BB 4ASHA 3QZRA 4I8KA 3P8GA 1NPMA 2QF3A 1ZYOA 2Q6FA 1G3DA 1ZLRA 1JIRA 2Z3DA 3V3MA 3SNAA 5HM9A 4Q63A 4CR9A 2Q6GA 1KLIH 2WV5A 1V3XA 3UY9A 1OP0A 2ZA5A 2ZF0H 4Z0KA 1ZGIA 5ESBA 1HAZB 1UTLM 2G55A 2NWNA 2XRCA 3OFND 2RFKC 3CP7A 4OS5A 1AB9C 1CA8B 4BNRA 3RXOA 2JJ1D 2ODYB 1TNKA 2CJIA 1C5YB 1QIXB 4KGAA 4WMFA 2FLBH 2XCFA 3NWUA 1AU8A 1S0RA 3FZZA 5SGAE 2FLRH 4B75A 2NU4E 2FOAA 1EAWA 5LGOA 1GMHG 4AGJA 2ZECA 2SGFE 2ZTZA 4D8NA 5A2MH 1BBRH 1F2SE 2ZQ2A 4RT0A 4BXSA 1A5HA 5C1XA 3T5FH 2WUCA 1YCPH 1C4Y2 1SMFE 3BTDE 1SOTA 3WY8A 4J1YA 3UAIC 1EJAA 1T4UH 2FTLE 3ZVFA 4ABBA 3P6ZB 3UFAA 1FJSA 1UVPA 1TNGA 1CE5A 1LVOA 1NBME 5H4IB 1YWUA 2NU2E 1UK3A 5DP7A 1MU6B 3A7XA 1HIAA 2J94A 2OUAA 4I31A 1S6HA 3UUZA 3SZNA 3GY2A 4OS6A 1DUEA 1AZZA 1HB0B 2A5IA 3EA9A 1C5SA 3RXCA 4CRFA 3N7EA 2OD3B 1GHVH 1OWJA 4Y76A 3SW2B 3NZIA 1GBEA 3TK6A 1HAGE 3C1KA 1UK2A 5TCAA 1GMCF 1MD7A 3S9AA 3P95A 1CBWC 2ZFPH 1EZUC 1Q3XA 3U69H 2BDYA 4KKDA 2GDDA 4JK6A 5GWZA 2QY0B 2XCNA 3D62A 1O36A 1DFPA 3ATLA 2BD3A 3OTJE 2C8ZB 1MTNB 1CA0B 3RXHA 1E0FD 2V0BA 5FXLA 2IN2A 2O8LA 1Y3YA 4DIIH 1HUTH 1NFWA 1F92A 3OY5U 3Q3KA 1BJVA 3P92A 1H1BA 2VIOA 4K8BA 4A6LA 2H1UA 1O3LA 1SGIB 5K7RA 1K0HA 2BDIA 3NPSA 1NU9A 1ZMNA 4CBOA 1O3NA 8ESTE 2I6QA 5FCKA 5ESTE 1GHYH 3I29A 4Y7AA 4GUXA 3TPIZ 4CRCA 1Y8TA 3KF2A 1K1OA 2Z9JA 3OU0A 1O2SA 3D23A 4GSOA 3WWFA 1T8LA 1T8MA 1NU7B 1UMAH 4AGKA 1O3OA 4X0WU 1N6YA 4XE4A 2FESH 1K9OE 5AVDA 1AD8H 1GJAB 1Y5UT 3ITIA 1THPB 2BDHA 5EJLA 4YLQH 5BPEA 1L1JA 5DPAA 1P11E 1TMBH 1C5LH 3A7TA 3MU4A 2BDAA 1P06A 2Z3EA 2F9PA 2G4TA 2ZHWH 1RRKA 3LGUA 1CGIE 1TBQH 5C2ZA 2QXIA 1B7XB 2OBQA
chains in the Genus database with same CATH topology
1QGFA 1EXFA 1KXAA 2ZC9H 2FX6A 1ELGA 2FYRA 5FX5A 4BAOB 3AAUA 3MU8A 1S81A 4ISHH 1GJDB 1WBGB 3C27B 1GI1A 3LT3A 1BZXE 2H5DA 1VITH 1JMOH 4Q7YA 1DITH 1O2LA 4WY3A 3P8OA 2EC9H 4X6MA 2FP7B 1D3PB 8GCHG 4D7GA 1KXDA 3FAOA 1PQ7A 5C5OA 3SORA 3W95A 2JH5D 3F9GA 3GCNA 3BTME 1BBRK 4TPIZ 4UFFH 4AB8A 1BRAA 2FTMA 1IQIA 3G01A 1LHFH 1EZQA 1Q2WA 1YCPK 5F8ZA 2UWLA 1O2HA 3ZVDA 2ZDKA 1QRZA 3HGNA 3TGJE 3GY6A 1W0YH 2A4QA 1Y3UA 3BTQE 1JRSA 1VITG 3KCGH 1GI9B 1TBRH 1DY8A 1ELDE 1SR5C 4Y10E 1L2EA 1DWDH 1IQGA 1O2VA 4HFPB 1DT2A 1BTYA 2WPIS 2G00A 1QR3E 1XUIA 2G52A 3SJOA 5A8YA 2Q6DA 3BTFE 1FONA 3VGCB 1QJ7B 1WTHD 2PKSB 3M5OA 4NGAH 3TGIE 4CHAB 1GBTA 2V3OH 3RXMA 1GVZA 1GL1A 1NFYA 5L2ZH 1FDPA 2V6NA 3BTGE 1GHBF 4ZHMU 3SQEE 1V2NT 4I8GA 3PMAB 3LC5A 2QCYA 1HCGA 2HRVA 2OC0A 1SGDE 2M5TA 4NFFA 2OLGA 1KDQA 1ZPBA 1ZSJA 5DO4H 3VB5A 3PTNA 4SGAE 3QN7A 2ZPQA 3I77A 5C1UA 3RMMH 1GI5A 1NZQH 2CHAB 2F9VA 1C5RA 5E0GA 1C2KA 3OYPA 2ZP0H 4BANB 1K1LA 1MAXA 2P16A 2TBSA 1GBBA 1NESE 1EX3A 3M7UA 3A8BA 1YCPM 1W13U 5C20A 1PFXC 1O37A 3KIDU 1RIWB 2ZI2H 1C4V2 3GDSA 4THNH 3RXBA 1EJNA 1D6RA 2F9UA 4YOGA 4AZ2B 1DANH 4BAHB 3TK5A 2R0KA 1ETRH 3M5MA 3DUXH 1SFQB 1ELTA 3BTWE 3SU4A 4ZKSU 3RXPA 2ZPSA 5FAHA 1QQUA 2BDBA 1WQVH 4QT8C 1UTPA 8LPRA 1PPGE 1IHTH 1TQ0B 1C2JA 1V2TT 1CT4E 3PO1B 2BQ7B 3QK1A 1EPTA 2ZQ1A 1UVUH 1TMUH 4ZHAA 4ABFA 5F8TA 1O2XA 4E7NA 2O9QA 1CVWH 2AGGX 1VGCC 3SQHE 1DSUA 3SU5A 4JZIA 2PSXA 5HMAA 3RXDA 2EI8A 1V2ST 1PJPA 1ZTKA 2FZZA 3RMOH 1O0DH 3S9BA 2BDCA 4YM9A 2SFAA 3HK6B 4CBNA 2BVRH 2A4RA 1F5LA 1GWAA 1O34A 2HLCA 4ZH8A 4TPYA 1FN8A 2P8OC 2FI3E 3RU4D 1Z8JB 1C1SA 1THRH 4IC6A 1FPHH 1MZAA 3A80A 3U9AH 5B6OA 4LXBH 2HALA 1CHOF 2D1JA 3FANA 1LO6A 1UHBB 1P3EA 3A86A 1UTMA 1O3GA 5K0HA 1IAUA 1AVWA 1GMDF 1P3CA 3KL6A 1K1IA 2SGQE 2G8TA 1FQ3A 4R8TB 1C1NA 1QRXA 1MBMA 2D2DA 4UONA 2BD5A 3GY3A 4XOJA 1BQYA 2VGCC 1TALA 2H5CA 4XBCA 1INCA 1PQ5A 2A31A 5E2PA 2F3CE 4B2AA 3NK8A 5JPMH 1A0HB 3JZ1B 2GMTB 2BLQA 5FBIA 1G37A 1GCDA 1YPEH 4Y8XA 2FX4A 1OPHB 2OC1A 1YKTA 2STAE 5DGJA 3TJUA 1GDNA 2RCEA 1O32A 4ZROA 3BIUH 1P2KA 4ABGA 1O2YA 5EPNA 1S85A 1ZHPA 1TX7A 1A3BH 4JZ1A 5F8XA 3ZZCA 1EUFA 4TWWA 1AY6H 1HJ9A 1NTPA 3BV9B 1G2MA 1GGDC 1H8IH 2BXTH 4GCHG 2EA3A 4X1SU 4DOQA 3CENA 1MUEB 3EQ0H 3VXFH 1HJAB 1QURH 1O3JA 2BD4A 3PB1E 3STIA 4A1XA 3L33A 2BD8A 2AEIH 3KQBA 3VXEH 2PR3A 2VH0A 1P01A 4ABEA 1RXPA 1FXYA 1P05A 4Y6DA 1BT7A 1MTWA 2Q1JA 3UPEA 4AN7A 1LTOA 1TB6H 2GZ9A 3MNSA 1C5XB 1BTHH 4CH8B 5L6NH 1LCYA 2ZPRA 1NM6A 4D7FA 1FIWA 1AO5A 4WXIA 4CREA 1O2UA 4DG4A 2VIVA 5A09A 1BTWA 2NU3E 4RN6A 4WF8A 1HXEH 3A84A 4HTCH 2UWOA 1XUFA 2AFQB 4GAWA 2VH6A 3GYLB 4D9QA 1SSXA 2FYQA 2ZCKP 2RA0A 2O8UA 3NCLA 2AERH 4JCNA 3M7TA 1JBUH 4K1SA 3MNCA 1BHXF 1J8AA 4Q2KA 3SU1A 1MKXH 5C5NA 1BMNH 1L1NA 1K1PA 1HAVA 1QB9A 4E7RG 1O2TA 3SV2H 2H9EH 2CF9H 3U8RH 3E90B 7GCHG 4MVNA 1IQJA 1GBKA 5EXLA 1HYLA 1K1JA 1QA0A 1C1TA 1MTVA 1WOFA 3PROA 1SPJA 3PLPA 2PW8H 3SUDA 2F83A 2Z3CA 4B1TA 2NU1E 4MPVA 1SGFA 1YYY1 1THSH 2FOFA 2A4GA 1P9SA 3MYWA 1AKSB 1XXFA 1P03A 1EJMA 1KXBA 1WUNH 5FPYA 4HI3A 3E1XB 1TA6A 2J4IA 1SGCA 3STJA 1S84A 4LZ1H 1ZSKA 3FZDA 1O5FH 2B5TB 2XBVA 3MU0A 1MAYA 1TPAE 1Y5BT 2XBWA 1UCYK 3R3GB 1ELAA 2QGRA 3SGAE 3K9XB 4FUCA 1P57B 2A2QH 1HGTH 1P2IA 2YNAA 1NFUA 2OQUA 1AUJA 1KYNA 3HATH 1P10A 4KTUA 4AORA 5BRRE 4JZEH 1T7CA 4NIWA 4YOJA 3GCHB 2XWBI 4MNYA 1PPEE 2OINA 3M35A 3MH5A 4O3UA 2V3HH 5DP9A 4OS4A 3MOCA 2F9OA 4TYDA 2J2UA 1A4WH 1PPCE 1V2UT 3A88A 1MD8A 3RP2A 1SQOA 3BTTE 1LVBA 3SN8A 6CHAC 1C5OH 2ILNA 1EAIA 5LPRA 3RC5A 1GI8B 3LDXH 3F1SB 3VB6A 1E37B 3QGNB 4FUBA 3BN9A 4ISNA 1ANDA 3ZV8A 2PGQB 4GHQA 1C1MA 2RA3A 3LGVA 3A7ZA 4RSPA 4MNWA 1GBCA 1AFQC 1CBWB 4X8TH 1UJ1A 2VB0A 3QX5H 2QAAA 2Z9LA 3SJ9A 2BYAX 3TU7H 1DLEA 2VWMA 1O3CA 1QNJA 2ZGCA 2AMDA 3QTOH 2CF8H 4GPGA 2FI4E 1XUKA 4K1TA 2KAIB 4NZQA 2PKAA 3GDUA 4NFEA 1C2FA 3SUGA 4IGDA 1DICA 1P2QA 1KXFA 1C5VA 4BTIB 3PMJA 1DWCH 5T6FA 3BEUA 1Z6JH 1MKXK 2PFEA 1GI4A 1C1VH 2H6MA 2WPHS 1O38A 3SJKA 2ZU2A 1HLTH 4X8UH 2BD9A 4INHA 1XUHA 3W94A 1ANCA 2FOMB 4X2VA 4DURA 1AUTC 1NN6A 2WV4A 1GBAA 1VJ9U 2BD7A 2K1QA 3T25A 3VB3A 1O2WA 5JBTA 2BLWA 1CGJE 2TIOA 3GCTF 2P3FH 1ETTH 1C2DA 2W5EA 1AVGH 1SGNE 2O8WA 4NA9H 1S83A 1FUJA 2JKHA 4IMZA 4UFDH 5HXFA 1A7SA 2ZFTA 1LPZB 5EU8A 2ZFSA 1P09A 2RDLA 2ZKSA 1J14A 4X8VH 3MWIU 5GCHG 1RFNA 3U8OH 1O5CB 3BTHE 2Z9KA 1XKAC 2VNTA 3NKKA 4CR5A 1WQSA 3M7QA 1T8NA 3DFLA 4MPXA 1ANBA 4UDWH 2C3SA 3BG8A 2QIQA 4IW4E 3URCA 3H5CB 3BSQA 4FUEA 1BRBE 1SI5H 4AYYB 3R0FA 2P94A 1HV7A 2C8XB 3RMLH 3LJOA 1BBRE 4AB9A 2A45B 1WAYB 5AFZH 2W3IA 1V6DA 2BOHB 1F7ZA 1FV9A 1O3KA 2A5AA 3A89A 1BCUH 2SGDE 1DXWA 2ANKH 5JB8S 1RTKA 3FP8E 1VJAU 1WTGH 2VJ1A 4FUJA 4IMQA 3SUEA 4ISLA 1QRWA 3A8AA 2WPJS 1UVTH 1A3EH 1DVAH 1C5ZB 1P8VC 1W11U 5FPSA 3ZVAA 3DA9B 6GCHF 1C1QA 4DY7B 1GHAG 2UUYA 3ATKA 1LKAA 1O31A 4JYTA 4FU8A 1FY3A 1TGBA 2G81E 3RXFA 2BD2A 3BG4B 5EQRA 2R9PA 2XBYA 4B76A 1CHOG 1W3CA 1O2PA 1NY22 3SNEA 1QTFA 3QTVH 4NIXA 2GTBA 1IOEA 2BHGA 2B7DH 1HIAB 3S0NA 1L0ZA 3Q3XA 1FAXA 5A0CA 3QZQA 4VGCC 2A1DB 3KGPA 3V0XA 2LNCA 2AIPA 1MMJN 4Y8ZA 1T32A 3SU3A 1FZZA 1O2MA 1GCTC 1B5GH 3RXJA 2B8OH 4MPUA 1P0SH 3AAVA 1QL9A 3M36A 4K69A 1Z7KA 3V7TA 3QO6A 4MQAA 1KXEA 3SJ8A 3RC6A 3GDVA 1RTFB 1Y3VA 1KSNA 1LHCH 3RLWH 1L4ZA 4PROA 1V2QT 3M3SA 1ZOMA 1DWEH 3M3TA 3UREA 5DP3A 4D9RA 1JRTA 3T29A 4O9VA 1C5PA 3A8DA 4R0IA 5E0HA 3L6PA 1TQ7B 4IN1A 1TGTA 1CQQA 3ESTA 5AFYH 8KME2 2A0QB 2XTTB 2ZCHP 4Y0ZE 1LQDB 1SHYA 4Z6AH 1FMGA 2BM2A 1TGNA 4INLA 1KLJH 1TWXB 3N7OA 2W7SA 3RLYH 7ESTE 1MTNC 1CA0C 2SGEE 3PV4A 1QQ4A 1ZTJA 1C5MD 2G5VA 1TGSZ 5JBBS 1ELEE 1GJ7B 4Q80A 4AFUA 1GL0E 2PUXB 3OX7U 2P8OB 2PTCE 2VIPA 4GLYA 4IN2A 4GVUA 5AHGH 2H2ZA 3AVZA 1GG6C 1WCZA 1QBVH 2WPMS 1XX9A 1O2KA 5JB9S 1W7GH 2VVCA 3ZZAA 2FI5E 1XUJA 1NS3A 1O2ZA 2A7HA 1DS2E 3B23B 3E0PB 2AGEX 2SNWA 5F6MA 4CRDA 2HOBA 3RXLA 1A0JA 4X6NA 2G5NA 3RXSA 3DT0H 2GCTB 2J34A 3LKWA 1CT0E 3ZYDA 1XKBC 2BQWB 2FWWA 1TOCB 3MU1A 1OS8A 4ABIA 3UOPA 1QL8A 1QB1A 4I33A 3RXKA 4AG2A 2IOTA 5LH8A 1GVKB 2OQ5A 1ANEA 2SGAA 5EPYA 1C1RA 4RKOB 4AFZA 1K2I1 2BX3A 3KQEA 1UTJA 1C2HA 1BTPA 3CS0A 3MNXA 3ZZ9A 1TRNA 4GHTA 3LOXA 1PQ8A 3F68H 3LGYA 3ATWA 1NRNH 1UK4A 3FP6E 4Y0YE 2R2WU 4ABDA 2GD4B 1OWDA 2STBE 1O3HA 4ABHA 1LHDH 1MTSA 1P2MA 3A87A 3KQCA 1C9PA 2A7JA 4O3TA 2WYJA 2FPZA 3ELAH 1PQAA 1GGDB 1O3EA 1C1WH 1MQ5A 5GDSH 1A5GH 1GBHA 1P2NA 2I6SA 1KXCA 4F4OC 1CO7E 1V2VT 1EATA 1TNIA 5DP6A 2GGVB 1T31A 3F9FA 4Q7XA 3MH4A 1KDQB 1SQAA 1YC0A 1ACBE 1ESAA 2ANWA 1A61H 1TYNA 3T28A 1H4WA 1EB1H 1ZHMA 1QY6A 1O2OA 2OXSA 3VGCC 4I8HA 2GCHG 1BITA 1DOJA 1CU1A 1VCQA 4ISIH 2A2XH 3EYDA 3B8JA 1L1GA 1GVLA 1W14U 1ZTLA 2HWLB 1NO9H 1BMMH 1G32B 1HAYB 1ESBA 2CXVA 3TH4H 3K6ZA 1O2JA 5CMXH 1P2JA 1NRPH 1O3PB 1GI7B 2CHAC 2Z6BD 5CHAB 3S7HB 5L30H 2TPIZ 1A0LA 5FBEA 2ZO3H 3A81A 1C4U2 3MO6A 1UCYH 3URDA 2Y7ZA 1QFKH 2GKVE 4XSKU 2R0LA 1SOZA 3I78A 5TCCA 1IQKA 3RXTA 1C1UH 1RIWC 3UWIA 2P3TB 1EPTB 3O8BA 5A8XA 3DFJA 3PMBB 1GHXH 1V2MT 2GT8A 2GV7A 4TWYA 2BY9X 3SNBA 4CRBA 3SO3A 1FIZA 1PPFE 1T4VH 1TRYA 2B0FA 2Z7FE 5A8ZA 3FFGA 1O5DH 2TGDA 1LVYA 2VU8E 4JK5A 3SV8A 1O39A 4K3JA 5LPFA 2HNTE 4WH8A 5EODA 1B0FA 3U98H 2DUCA 1VITF 1TNHA 5C1YA 1N8OB 3RU4E 3PO1C 1C5QA 3P8NA 2ZU3A 2J38A 3ZVGA 1OP2A 4JYVH 1AVXA 4I8JA 1EASA 1YPMH 1TIOA 2V35A 2J92A 4DW2U 3MTYA 4AYVB 2FDAA 1UTKA 1SLUB 1QB6A 3OY6U 2JETB 1EOLA 1NRSH 1ZR0A 4NWKA 3BIVH 3U1JB 2UWPA 1LDTT 1O5AB 2TRMA 1MKWH 2J9NA 2EI7A 3ZZ5A 2QV1A 1BTXA 3TJOA 2BLVA 2BQ6B 2Y5GA 2BZAA 1GDUA 1LKBA 3PWCA 1HBTH 2ZHFH 1YF4A 2C90B 4Y11E 1AI8H 3S69A 2G51A 1BDAA 1ELBA 3GCTG 5PTPA 5E8EH 4MG3A 2Z9IA 1BHXB 3RXIA 5GXPA 2GP9B 2FO9A 3SGBE 1F5RA 3MHWU 2Y5HA 1JIMA 1U6QA 4K60A 4ZMAH 2XWAA 4X8SH 1O5EH 3SNDA 1S82A 1Z1JA 3EA7A 1ZJKA 2TGAA 4YTAA 3MU5A 4U01A 1SC8U 3ZVEA 5DJ7A 4M7GA 1SGTA 2BXUH 3SHAH 5J4SA 3KNXA 5E0JA 3ZZ8A 1UO6A 1GMCG 1AFQB 5A0AE 1ZPZA 3ZZ7A 1AWHB 4ZXXH 4D76A 1AQ7A 1F0RA 3Q77A 4MLFB 1C2EA 1O30A 1PPHE 4AG1A 3VB7A 1Y5AT 3GISB 4BTTB 3S9CA 2IPHA 1GBJA 3KEEA 1OWHA 1SHHB 1ARCA 3RMNH 1BMAA 4ABJA 2QYIA 1OWEA 4JMYA 3LPRA