2BYAX

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2byaX01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2byaX02
1C1RA 2GGVB 3NWUA 1MMJN 1ANBA 2ZIQH 1A3BH 1QL7A 5G4BA 4INKA 3A7ZA 1C5WB 4FUFA 3BTFE 8GCHG 1VJAU 5T6DA 1GBAA 1C1PA 1CU1A 3FZZA 1AQ7A 3S0NA 3MU5A 3SN8A 2NU0E 1LQEA 5GDSH 1C5LH 3AW1A 8LPRA 4NCYA 3RMNH 3PMJA 5K0HA 1OX1A 4YOIA 3JZ1B 1EPTB 3T27A 1ZJKA 3UIRA 1WOFA 1E35B 1CA8B 2H9HA 1TGSZ 5E2PA 1SFIA 4X8TH 1EZXC 1Z7KA 4Y7BA 4NA8A 2FOAA 4ZKSU 4Y0YE 1B7XB 4CREA 2XC0A 2C90B 3LH1A 1K1JA 1PYTC 4DW2U 2VWOA 4OS6A 3RP2A 4ABGA 2ZHWH 2VGCB 3A82A 1BMNH 1FAXA 1S85A 1QGFA 3DFLA 4K8YA 1SR5C 2A7CA 2GTBA 2AIQA 2HGTH 1WAYB 1HCGA 2EI6A 1EKBB 2F9PA 3VB6A 3MO9A 1QQUA 2FI5E 2QCYA 2FI4E 2THFB 4D9RA 1P10A 1AD8H 2P95A 3TJOA 1DFPA 1C5ZB 2O9QA 1UK3A 1SGDE 1UVSH 3SGBE 1LHEH 1GJCB 3SU1A 5DP5A 3N7OA 3M7TA 4WMFA 2OXSA 3AASA 1GPZA 1YPGH 3L3TA 4R0IA 1IQLA 4ZHAA 2Q1JA 4X6MA 1ELEE 1EPTC 1KLIH 2BDAA 1Y3YA 3PMAB 1Q31A 2BD9A 1HXEH 4I8GA 1VCQA 1RS0A 5T3HA 1GJ7B 1FAKH 1AHTH 2BZAA 2J4IA 3TK5A 5LPEA 4D9QA 4B2CA 2O8TA 1NC6A 1KTTB 2HPQH 1AVWA 2ZFSA 2QA9E 4RSPA 2J34A 2PTCE 4FUBA 3QK1A 4SGBE 3RM0H 2F3CE 3RXIA 4NFFA 2FP7B 4J2YB 2VGCC 2NU3E 3SGAE 4BTTB 1P2IA 5EG4A 2BLWA 5BRRE 4HFPB 5DP8A 1EATA 3TIUA 1GMHG 3RXJA 3FP7E 3PMHB 3KHVA 4ABDA 3SBKA 4BAOB 3M5OA 2VVCA 2OTVA 2OD3B 1QL9A 1PQ8A 3ZVDA 2Y5HA 6CHAB 1EPTA 1GDNA 1RTLA 2R9PA 2GDEH 4KGAA 2ZHEH 3ZZCA 3GCHC 4ZHLU 2Z3EA 2FS9A 2O8MA 5HYOA 1DY9A 1DANH 1THRH 4H6TA 1O5BB 3CS7A 3TH2H 1GI3A 4Q7XA 5JBAS 3GCTG 1RFNA 3SU6A 4RN6A 2RDLA 1HJAB 3NKKA 3VGCB 1A4WH 1SGPE 2QXGA 4XBDA 4FUHA 2LPRA 1QJ7B 4HZHA 2A5IA 1MKWH 2BXUH 4YOJA 1LKAA 1QCPA 1O32A 1OYQA 4WWYA 2ZA5A 1S0RA 1L4DA 2ZZUH 1L1JA 2BZ6H 1BMAA 1LKBA 1THPB 1O38A 1FONA 1YPKH 3MNCA 1LQDB 1NRNH 1HAIH 4F49A 5FXLA 2BYAX 1PPGE 1THSH 1GI6A 2P94A 5L30H 1FIWA 1P09A 1O3HA 1ZGVA 4JYVH 4OS1A 2TPIZ 3PTNA 1EJMA 3SQHE 3GISB 1ZGIA 2M5TA 3KF2A 4X6OA 3A86A 6CHAC 4OS2A 3QTOH 1DSTA 2EI7A 1IOEA 1DUEA 2ZCKP 3RXOA 1TGCA 2W3KA 1TFXA 3GY5A 3P95A 1B0FA 5EGMA 2ZGJA 1G37A 1NPMA 1HJAC 1EZSC 3VGCC 1HAZB 1SOZA 1O3JA 3ZVEA 1V2PT 2SGQE 4DGJA 1K21H 1F0UA 4ZKOU 1FNIA 3QX5H 2AERH 2VVUA 1A0JA 1KXBA 1K2I1 2B8OH 4I7YH 1A5GH 2V35A 1T31A 4E7RG 7ESTE 3K65B 2Y82A 2XNIA 1OWEA 2H2ZA 2P3UB 1EJNA 1FN6A 1VGCC 4Y8YA 2Y81A 2A4OA 5CHAB 1XUHA 1JRSA 5CMXH 1UVPA 2H9TH 2VIOA 3LDXH 4D7GA 3A8CA 3V0XA 2W7UA 2ANKH 1QY6A 2H9EH 1EB2A 3ZVCA 3SJOA 2G5VA 1N6YA 2ZF0H 3LJJA 4AB9A 1DWEH 1D4PB 1NFUA 4ZH8A 1GJBB 3BF6H 2AMQA 3OX7U 3BTKE 1C1QA 4Y79A 1O5EH 1GHZA 1PPFE 1UTNA 3MMGA 1JIRA 1Z8RA 4JK6A 4NGAH 4X0WU 1TX8A 4MNYA 1N1LA 1AKSB 2OP9A 5C2ZA 1BTPA 1HGTH 4MPUA 3LGIA 1XKAC 2VH0A 1LVOA 3F9EA 4GVUA 5F8TA 2BQ6B 3HGNA 1EP5A 1FI8A 2G55A 4ZAEA 1HRTH 1C5QA 1SHYA 2JH5D 3EA9A 4JYUH 1GVKB 1ARBA 2XW9A 2BLVA 1ZLRA 4FUDA 4FUJA 1O35A 2ZDAH 5AFYH 3U9AH 5CHAC 1W10U 3K9XB 1IQGA 4H4FA 1SGNE 2FEQH 1QRWA 4K5ZA 3M3VA 4YZUA 3MH5A 2BY5X 3LIWA 1Y5BT 3PWCA 1CE5A 3A7XA 4XDEA 1HV7A 1NU9A 1SQOA 2BD3A 2PUXB 1MCTA 3I78A 2GCTB 1MQ5A 5L2ZH 2BTCE 3A87A 2RG3A 3OTJE 1HAVB 1SGQE 4CHAB 4ABFA 3E91A 2C8YB 1BOQA 2FTLE 2BDYA 5GWZA 3KCGH 3S9CA 2QXHA 3MO6A 3L33A 1O3OA 4MTBA 1TX6A 1MZDA 1ANCA 3ZZDA 6GCHG 1YPMH 1O3FA 1WTHD 2F9VA 4HGCA 4DCDA 5JPMH 2CGAA 2RCEA 2Y7XA 2AMPA 2FOBA 2KAIB 2ZTZA 3A7YA 1D9IA 4FVDA 2ZC9H 5FX6A 4E05H 2FLRH 3MFJA 1DXPA 3SHCH 1TNHA 1UTJA 1NESE 5C1UA 2PGQB 2P3FH 4K1EA 1LDTT 1SVPA 2ODQA 1ZPBA 1JXPA 3SHAH 2NU4E 4UDWH 1C1MA 1LHFH 2AYWA 3B23B 3FP6E 2WPJS 5DP9A 1P04A 1WQSA 3A8DA 1UCYE 2ZNKH 2ANWA 2OLGA 1O2WA 1A7SA 2GT7A 5SGAE 4I8JA 1AKSA 4IBLH 1O37A 2P16A 2SGDE 1O2RA 2W5EA 3RXUA 2G51A 4CHAC 3RXQA 4INLA 4NSVA 1RIWB 1P2JA 2HOBA 2O8UA 2XBVA 4A92A 1KSNA 5TJXA 2AGEX 1HB0B 3AAUA 4I33A 1NFYA 4X1PU 1H1BA 7GCHG 2STBE 1A2CH 3BTME 1ZYOA 1MTUA 1VCWA 4ASHA 1TOMH 5B6OA 1XUIA 2BY6X 2ZP0H 1BB0B 4D8NA 1S84A 1KLJH 3TGKE 1G3CA 1MU6B 1ELDE 2G4TA 3MOCA 1DE7H 3NZIA 1C1OA 1V2VT 3T2NA 2PSYA 2JETB 2ANYA 2XYAA 1HAVA 2O8WA 4RKJB 4MNXA 4FU7A 1GBHA 3OU0A 3DA9B 2GCHF 1A0HB 1BJUA 5E2OA 2OC1A 4X8SH 3SNDA 2ULLA 1WU1A 2AMDA 1E38B 2UUFB 4WH6A 2Z9JA 5L6NH 3WY8A 3G01A 3VB7A 7LPRA 1ZJDA 3PROA 3QGNB 4JYTA 2GMTB 1GMDF 3H7TA 3TLOA 5JB9S 1C1SA 1S5SA 2A5KA 2BX3A 5F8ZA 1TONA 3MHWU 1K22H 3BEFB 2EI8A 4I32A 4DT7B 2FWWA 4Y7AA 3E6PH 2FDAA 3KQBA 1KDQA 4CBOA 1WUNH 1GGDC 4UFFH 4NIWA 1HXFH 3STJA 3MNBA 1L2EA 2FX6A 2Z3DA 4CBNA 2GX4A 1KY9A 2A7HA 1A0LA 3SU4A 1QIXB 4GSOA 1P06A 4KTCA 1O3GA 2ZHFH 3ZVAA 3T29A 4KTUA 1W0YH 1WQVH 2JETC 2PTNA 3S7HB 5IYTA 1D6RA 1P03A 2ZG0H 4B2AA 4IN2A 4RKOB 1Y5AT 1GI1A 2GVFA 1U6QA 1MTVA 2BD5A 4TPIZ 3KNXA 2ESTE 3U1JB 3IG6B 1SSXA 4FVBA 4BNRA 3LGWA 3GYLB 1HAOH 3SNAA 1C2IA 1NFXA 1G2MA 2XCFA 2ZKSA 5H4IB 3I29A 4ISNA 3M7UA 3M5LA 5DG6A 2H1UA 3UREA 1UTMA 2A32A 3RUOA 3RXBA 3SJ9A 3KQEA 2CHAB 1EAIA 2HALA 4X1QU 4GAWA 2P8OB 3RXKA 3LGVA 1UCYH 2TIOA 3LU9B 2C4FH 4WXIA 1C2JA 3M3SA 5C67A 3B8JA 1OXGA 1TNKA 1BHXF 2UWLA 3ZZAA 4O9VA 3TH3H 5IDKA 1HJ9A 3RDZA 1C1NA 1T32A 1Y3VA 5FBEA 1G3BA 3VEQB 3O8RA 3OY6U 1C4V2 3ZYEA 1AFQB 3MU8A 3ZZ8A 5T6GA 3ODFA 1YLCA 4U30A 4NA7A 1TMUH 1C5MD 1O3AA 3KEEA 1JRTA 5TCCA 2OCVB 3NK8A 4IN1A 5EXNA 2BDIA 1C5PA 2TBSA 3QDZB 1NO9H 1ARCA 5EPNA 2B9LA 2OBOA 1K1MA 1MQ6A 2UUYA 2TGTA 4WF8A 1X7AC 1OSSA 1GBBA 1CT4E 4FUIA 4O3UA 3F68H 2BD2A 1YF4A 5JBBS 1UO6A 3E1XB 2A5AA 3SV2H 1C9TA 2CHAC 2SNVA 4AG1A 3JZ2B 4UFDH 2P8OC 1AY6H 2VJ1A 1GCDA 3B9FH 4GLYA 1C4U2 5C1XA 1TWXB 4NIVA 1CQQA 4B73A 4JZIA 1O5AB 3SJIA 1AUJA 1LPZB 3RC4A 1G2LA 1Y5UT 3A88A 1G30B 3PLBA 1YPJH 1DWDH 1AI8H 1KLTA 1AFQC 2D26C 4INHA 1RD3B 2J2UA 3TK9A 3BG8A 1CBWC 3DHKH 1CT2E 3KL6A 1W13U 1T7CA 1ZR0A 3RXPA 1EOLA 2BDCA 1Q3XA 4AGJA 2ZDVH 2ODYB 1QTFA 1GBJA 2Y5FA 1TA6A 1MH0A 4KKDA 1HAYB 3E0PB 1BRBE 4MPXA 1VZQH 3F9FA 2OC8A 2I6SA 1TGTA 2Z7FE 2ZFTA 1C4Y2 1ZMNA 1ANDA 2AGGX 1GI9B 1UTOA 3F9HA 3RLYH 1P2OA 2QAAA 4TY7A 2PWXA 2ZQ1A 2XBWA 2C8WB 2Z9LA 3UWIA 2HWLB 1CHOF 1D3QB 1IHSH 1G3DA 5FPYA 2OBQA 3SW2B 3GY4A 4X2VA 3TH4H 1XM1A 3OYPA 1NFWA 4AFUA 3BG4B 2CF8H 1W14U 1NM6A 1ZHMA 3SV6A 1EQ9A 1P2NA 1OS8A 1UTQA 2P93A 4GHTA 4MQAA 1O3LA 1ZMJA 5E0JA 1EP6A 2BOHB 3MU0A 1O2PA 3QLPH 1GVZA 2CMYA 2VINA 1O3IA 1GJ8B 1LVYA 4F4OC 2GV7A 2ZECA 4ZXXH 2V6NA 3P8FA 2TRMA 4O3TA 1QRXA 4Q7ZA 1TB6H 4AX9H 1IQFA 1C5TA 4ABJA 1MUEB 1C5OH 4BAMB 3V12A 1S82A 3T26A 3SQEE 5J4QA 4ISIH 5GXPA 1BQYA 1DY8A 1UTKA 1YCPH 1HPGA 4X2XA 2VH6A 1O33A 3EE0B 3S7KB 4YT7H 2PW8H 1Z71A 4TY6A 4MLFB 1GHVH 3PO1B 1QB9A 1ZSLA 3GY3A 1B0EA 1FDPA 2OINA 4U32A 3SU3A 5FHTA 3SNBA 1FJSA 3ZVBA 1QR3E 2ZDLA 3RXVA 1WTGH 1SLXB 3SV7A 1LHGH 2BOKA 5DJ7A 1F5RA 1C5YB 1FPCH 2FOMB 2G4UA 3BG4C 3SUDA 3S9AA 2CV3A 1BITA 4E06H 1GBCA 3BTTE 3EGKH 1SOTA 3UQVA 3TVJB 4ZKRU 1QA0A 4XE4A 3RXGA 1O3PB 1TGNA 4X6PA 2F83A 3C27B 1ETRH 1YGCH 1K1IA 2HNTE 1O34A 3O8CA 1MD8A 5BPEA 1ELVA 3UY9A 1Z1JA 1P11E 1G36A 3A8BA 1FY8E 1A5IA 1CSOE 3RC6A 5HM9A 2Y7ZA 4JZDH 3LKWA 2H6MA 1PJPA 1O3NA 2HPPH 4WJG2 2FESH 2WV4A 4MNWA 3T5FH 1P2QA 2PSXA 3PO1C 5GIBA 4XSKU 4YT6H 4ISLA 4UFEH 2ZTYA 3QGJA 3K6YA 4MNVA 1ZSKA 4VGCB 2BD4A 1OKXA 3RM2H 1ELFA 4BAHB 1GCTB 1VCPA 1O30A 2GT8A 2AFQB 3F9GA 3ZZ3A 1V2NT 3Q3YA 3BTHE 1BRUP 1BDAA 5JBTA 3BTDE 1RTKA 1KXFA 1ZTJA 1OPHB 1YPLH 2YNAA 3U69H 1FUJA 4WVPE 1T8MA 4FU8A 3I77A 1ORFA 1BBRE 5AVDA 4TWYA 2O8LA 3LGTA 4WXVA 2XTTB 1AWHB 3UR9A 2WV5A 1GI0A 4BANB 1E36B 5DP7A 1TX7A 1BTHH 5GPIB 3MH4A 2AS9A 1FY5A 1C2GA 2ZGBH 1V2UT 3SV8A 1CHGA 4Y6DA 1GJ4H 1TPAE 1O2MA 1AVXA 3SI4H 4UEHH 1BJVA 1C2KA 5LPFA 1UK4A 4B2BA 1T4VH 4A1TA 3RXMA 5K7RA 3QWCH 1W7XH 3SI3H 1AUTC 2GZ9A 1T8OA 2C93B 4VGCC 2H5CA 1PQAA 3UPEA 1MKXH 5EQQA 2GP9B 1NRPH 2ALVA 2ILNA 1IQEA 1HBTH 3RC5A 1BTWA 1QHRB 1C2MA 1XKBC 3P6ZB 1CVWH 1NRQH 3Q3KA 4B1TA 1TMTH 4DY7B 1Q2WA 1E0FD 2Z9KA 3RMLH 1TNJA 1XUKA 1AMHA 1DT2A 1MAYA 1HDTH 1NRSH 1OP2A 5A2MH 3M7QA 2NU2E 5AFZH 1SLUB 1M9UA 1ELBA 5ESTE 5FPTA 1MZAA 2QC2A 2ZTXA 4CRAA 2EEKA 1SHHB 1XVMA 4UD9H 3E8LA 2EA3A 3IITA 1ZMLA 6ESTA 2NWNA 1GMCF 1O5DH 1C9PA 4H42U 1V3XA 1Z6EA 1C2HA 3SU0A 2Z9IA 1ELAA 1RJXB 2Z94A 4GHQA 5JBCS 4AYYB 1QFKH 4YLQH 1TPPA 2ZFFH 1FXYA 4OGYA 2ZDNA 4IMQA 1O2HA 4BAKB 2QF0A 1V6DA 2OC0A 3TNTA 5DK1A 1DDJA 2FPZA 2GCHG 4TWWA 3M5MA 1F0SA 2BM2A 1O36A 1SL3A 2P3TB 4B76A 3MNSA 3LJOA 3PM3A 2ALPA 1W7GH 2WPKS 4JK5A 1GMDG 4A1VA 5LGOA 2BDHA 3P92A 4HTCH 1O31A 1OYTH 1VITF 3STIA 3UNSA 1TBRH 3RU4D 1IHTH 1BCUH 1WYKA 4O03A 5DP4A 3RLWH 1BBRH 1MKWK 1GL0E 2ZGXH 3EA8A 2ODPA 1TNGA 1F2SE 1GBKA 2VB0A 3SUFA 3V7TA 3TITA 4GUXA 5I46H 5DO4H 1W0ZU 3ZZ4A 1TPOA 1G32B 1MBQA 3BTQE 3SNEA 1DWCH 1KYNA 2IN2A 1ZHPA 2BQ7B 4NZQA 1P05A 2ZGCA 3SV9A 3H7OA 2PKSB 1ID5H 2OC7A 4BAQB 1HNEE 1WCZA 2FLBH 1O2VA 3P8NA 3RU4E 1JOUB 2J94A 1TQ7B 1SGTA 3ESTA 3O8BA 2GCTC 1O5GH 1A1RA 2ANMH 2CF9H 2OQ5A 2QXJA 1LPKB 1QJ1B 1J8AA 1W11U 1W2KH 2Q6FA 2TGAA 2Y6TA 1O3EA 1T8NA 1EAXA 3HGPA 1S0QA 3MU1A 3GY6A 1YBWA 5GCHF 5HM2A 2A4QA 1TYNA 3SZNA 1L0ZA 2GD4B 3BSQA 1ELCA 3IWMA 1P3CA 3SGQE 1F5LA 4A6LA 1TRMA 1NN6A 2NU1E 1AO5A 4M7GA 4A5TS 4AZ2B 2V3OH 3URCA 1S83A 3QUMP 3O8DA 1EZUC 2LNCA 3GCNA 4AFZA 1C5SA 1DUAA 3ZZ7A 1C2FA 1QJ6B 4SGAE 1BT7A 3S9BA 4AGKA 1UTLM 1K9OE 4WMDA 3RMOH 4Z6AH 1ABJH 3GICB 3BTWE 1O2SA 1SQTA 2PKSC 2CN0H 2J38A 1AVGH 4K8BA 2GV6A 2PKAB 1SGEE 1ZHRA 3MI4A 1RTFB 5C1YA 3U8RH 1PQ5A 1O3MA 4WMEA 3U1IB 1HAHH 1A61H 1NZQH 2KAIA 5FCRA 3UR6A 1EOJA 1FN8A 2Q6DA 3A83A 2ZDKA 1J9CH 4NIXA 1IQJA 1P57B 3A7WA 2ZI2H 4BOHA 2FS8A 2R0KA 1TABE 4ABBA 4DJZB 2A1DB 3DFJA 5LPRA 1EUFA 1RIWC 3ATKA 4K1SA 3UNQA 1SPJA 3TPIZ 1Y3UA 1W12U 1GI8B 1BIOA 3A80A 1O2UA 1DS2E 2ZPRA 4MG3A 1FV9A 1RXPA 2FOGA 3A7VA 2QXIA 4D7FA 3LONA 1P8VC 1KXAA 2FZZA 3P70B 1LTOA 1KXDA 2OUAA 3BV9B 3SOSA 3ZV9A 4FXGH 1ETTH 1XX9A 1P12E 3U98H 1MU8B 4IW4E 4LOYH 2OQUA 4JZ1A 3W95A 1Y59T 4X1RU 4PROA 1P9SA 3TJVA 4I8HA 3E3TA 4FUEA 3ATMA 3FANA 2BD8A 1QBOA 3EA7A 2D1JA 1P2KA 3HPTB 3ZZ9A 1FZZA 2ZPSA 1NTPA 1ZTLA 4JZEH 5C5OA 2GMTC 3A7TA 1W8BH 1V2QT 2IPHA 3SUGA 3D49H 4MPVA 5J4SA 1SGFG 1NS3A 2WYGA 1F0RA 4NSYA 1ANEA 2BLQA 1TBZH 1PPCE 2VWMA 1TMBH 5F6MA 1K1NA 1O5FH 2ZFRH 4Y76A 3R3GB 1YP9A 2A7JA 2QGRA 3QO6A 3RXEA 1CHOG 3T28A 1C5NH 3H5CB 1BBRK 1OP0A 1DX5M 1T8LA 1O0DH 5EPYA 5EODA 2PKAA 2VVVA 2SGEE 3ZZ6A 4A1XA 4OS7A 1GBFA 4GCHF 1ZZZA 3OY5U 3PYHA 2FOEA 1BA8B 3URDA 1TNLA 1NT1A 1TBQH 1GBLA 2XC5A 1QRZA 1QL8A 2Y80A 2ZQ2A 1D6WA 2A45B 1FQ3A 4DOQA 1LPGB 4WY3A 1LMWB 1MTNB 2FOFA 7KMEH 1DPOA 4NWKA 5A8ZA 1YPEH 1GBDA 5HMAA 5FCKA 2HNTC 3LGYA 1OWDA 3LPRA 5EW1H 3A81A 1V2MT 1JBUH 1DXWA 2FX4A 1WSSH 3FFGA 1QB6A 3RXAA 2V3HH 4UE7H 3K6ZA 3M5NA 1TQ0B 1DICA 1H8IH 4Y11E 2DE8A 4K1TA 5CE1A 3FAOA 3U8TH 4QT8C 1HJ8A 2ZCLP 2TGPZ 5F8XA 9ESTA 4UONA 1IQMA 1GHBF 1O2GH 1Y3WA 2XBXA 4KTSA 3ENSB 4X8UH 1SLVB 1UVOA 1GBEA 1ESAA 2BVRH 1O2JA 2PLXA 4IS5A 2BY7X 1MCVA 1HAGE 4YO9A 3HKJB 1BRAA 2ZEBA 4CRGA 3ZZ5A 3TGJE 2FIRH 4FUCA 3OSYA 2C8XB 1AWFH 4I31A 3D62A 1GVLA 2Q6GA 4AG2A 2IJOB 2ZU5A 4H6SB 1DVAH 1C1UH 1MTNC 1KIGH 4KELA 2FO9A 4E7NA 2VU8E 1EB1H 1H8DH 2ZWLH 3D65E 1CGJE 4LZ1H 1N8OB 1Z8IB 1P2MA 3QZRA 3VB5A 1S6HA 3BEIB 3GY7A 2SGFE 3KN2A 2QN5T 3M61U 4IGDA 3LC5A 1C1TA 5FPSA 1C5XB 5C3NA 3SJ8A 1YLDA 1G3EA 1V2OT 3NUMA 5T6FA 4MPWA 3CENA 2VNTA 1V2KT 2V0BA 4WH8A 2FOCA 2G52A 3DT0H 3BN9A 5DKMA 3E0NB 3ITIA 5A0BA 1H4WA 1QA7A 1TPSA 1GBIA 3VB3A 1C2LA 4DIIH 3F1SB 3HATH 5ESBA 1AGJA 3RXDA 1GI7B 3T25A 1BZXE 1QBVH 4K2YA 1CA0B 1CGHA 1GHAF 2J92A 2J95A 1IAUA 1O3KA 2GDDA 3GCOA 1BMMH 4Q80A 1QNJA 3GCHB 3MH6A 1MTSA 1LCYA 2BQWB 4Y8XA 3TU7H 1XUFA 2F9UA 4THNH 2DE9A 3FVFB 2Z9GA 2H5DA 1JWTA 1AU8A 1S6FA 2FM2A 1XUGA 4IC5A 2HRVA 1EASA 1N8OC 2PUQH 5AHGH 1YKTA 3ODDA 2AGIX 4GPGA 1BHXB 4CH8B 1T4UH 1YCPM 1HUTH 1TGBA 4HI3A 2A4RA 5DP6A 1UCYK 1KXEA 4NFEA 3GYMA 3DD2H 1O3CA 4DURA 3HKIB 4B75A 4BTUB 3P8GA 2ZFQH 1V2RT 3DUXH 2XCNA 2F91A 2BXTH 1B5GH 1C2DA 1SQAA 5GJ4B 1F5KU 3PB1E 1TOCB 1YPHE 1SMFE 4XBBA 4ISHH 4YOGA 4ABIA 1NU7B 1BRCE 1CA0C 2XWBI 3BIVH 1C1VH 1FPHH 8GCHF 1GDUA 2D8WA 1TE0A 2VIDA 1GG6B 2ZDMA 3LT3A 3C1KA 2A4GA 1A46H 1BTZA 1GHWH 1SBWA 3KQCA 5E0HA 3GDVA 4TYDA 1GMCG 1SC8U 1EJAA 1PQ7A 1LHCH 5DGJA 4AORA 1XMNB 1C2EA 4B74A 1MAXA 1PFXC 2QV1A 4X2WA 3SORA 1UMAH 1O3DA 2B0FA 4ISOA 3MNXA 2B5TB 1TRYA 1D3DB 2HLCA 4FU9A 4Y0ZE 1V2LT 4K3JA 1DWBH 4KP0A 3V3MA 1DM4B 4DG4A 2STAE 1IQHA 2ZU3A 1F0TA 3BTEE 1ETSH 1P9UA 1PYTD 3PV4A 1VGCB 2R2WU 4OGXA 3VFEA 1QQ4A 3LC3A 2WPHS 2TGDA 1D3TB 2GZ7A 1LVBA 4I8KA 1Z6JH 2I6QA 2BDGA 5HXFA 2ZHQH 1E34B 3BIUH 3V13A 4X2YA 4CRFA 4X1NU 1GG6C 1XUJA 1VITG 3EQ0H 1QBNA 2SFAA 1L4ZA 5EOKA 2VIPA 2CXVA 2FXRA 4XOJA 1P02A 3UOPA 1SG8B 4IC6A 3P8OA 1DSUA 1BTYA 2UUJB 4YESB 3SNCA 3GDUA 5DPAA 2AH4X 2A0QB 1JMOH 2IOTA 5PTPA 2ZCHP 3F6UH 3VB4A 1SGRE 3EDXB 5EXMA 1FIZA 1GCTC 1LVMA 3E90B 2G81E 1TAWA 3FP8E 3Q76A 3A84A 3ZV8A 5A0AE 3MO3A 1GMHF 3ZYDA 5A8YA 2W26A 4NWLA 4LK4A 3ZZBA 2BY8X 1TRNA 1EXFA 3RXSA 1BTXA 1C5VA 1EX3A 2CJIA 2PV9B 1O2XA 1TA2A 3LOXA 1CT0E 1Z8JB 2ZU2A 4ABHA 1GDQA 3ZVFA 2XWAA 1K1LA 1O2YA 5AF9H 4ZHMU 1L1NA 2D2DA 5E0GA 2BMGB 5GCHG 3SJKA 4UFGH 3UOUA 1MD7A 2ZHDA 2BX4A 2R3YA 3PWBA 3GCTF 3Q00A 4A7IB 1UVUH 3RXLA 1YCPK 4ABAA 2EC9H 3UUZA 4LZ4B 5ABWA 1WBGB 5C20A 5EXLA 1GL1A 2QY0B 2FYRA 1VITH 1SI5H 2J9NA 4K69A 5LH8A 3E16B 2ZU4A 4J1YA 5EU8A 1O2IA 2QYIA 2GKVE 4LXBH 1O3BA 4JMYA 3BTGE 3A8AA 1IQNA 3FZDA 4XBCA 1GBTA 1PPZA 2YOLA 1SGCA 1SGFA 2WYJA 1GJ9B 3W94A 4YLUA 4ABEA 1P3EA 1INCA 4X8VH 1ABIH 2G5NA 1K1OA 3MTYA 2K1QA 1YC0A 1EAUA 1AFEH 1IQIA 1O2OA 4Q7YA 1ZOMA 3L6PA 2FTMA 3LGUA 2FI3E 4AB8A 2VIWA 1JIMA 3VXFH 1GI2A 3VPKA 4AYVB 3UNRA 1V2WT 2HVXA 1MTWA 1O2QA 1K1PA 1BUIA 2HNTF 1O2LA 1FY3A 3TJNA 4BTIB 1VJ9U 3GY2A 5C5NA 1K28D 1RGQA 1C1WH 2W7SA 3MWIU 2G8TA 3KQDA 4Y10E 2A2XH 4CR5A 3M37A 3RXCA 1AE5A 1C5UA 1H9HE 3GOVB 2FODA 1YM0A 3GY8A 1FY4A 3RXFA 3AW0A 3KGPA 8ESTE 3RU4T 1ELGA 1W3CA 3M36A 5JYIA 1NROH 2F9NA 2VIQA 3A89A 2BHGA 4NA9H 4ZXYH 2F9BH 1GJ5H 5L2YH 2SGAA 2PFEA 1KDQB 1MBMA 2JKHA 4YTAA 1OP8A 3AAVA 4ZMAH 4NZLA 1AN1E 3UTUH 3UFAA 4CR9A 4AN7A 1KTSB 3GDSA 2ZFPH 2AIPA 4R8TB 4NIYA 1P0SH 3TGIE 2P59A 1SFQB 1TALA 1PPEE 1Z1IA 1O39A 5I25A 1BMLA 1XVOA 1GWAA 3TJUA 3RMMH 2WINI 1F92A 2WPMS 1CGIE 1DOJA 4AFQA 1A3EH 2GZ8A 1GJ6A 4I8LA 5JB8S 1DLEA 4X6NA 3P17H 2W3IA 2VIVA 1H9IE 1NRRH 3SO3A 3VXEH 2ZGHA 1J16A 4YM9A 4ZROA 3TNSA 1FY1A 1GGDB 5A09A 4GCHG 3RXRA 2R3UA 1GJAB 2G00A 1OWJA 3SUEA 2B7DH 2ZO3H 2WUBA 5F03A 1BTUA 1MKXK 3U8OH 3ATLA 1A5HA 3UWJH 3TK6A 2SGPE 1PPHE 5FAHA 2QIQA 4IMZA 4U01A 4MDSA 1UHBB 1RRKA 3AVZA 4O97A 1C5RA 3EYDA 1ZPCA 1QB1A 2RA3A 1AB9B 1HIAB 2FMJA 3D23A 4JCNA 2A31A 1J14A 2ZU1A 4FUGA 2UWOA 9LPRA 2XC4A 3KIDU 3NXPA 3CP7A 3EAJA 6LPRA 1DITH 2BB4A 4U2WA 1HYLA 1SGYE 1TNIA 5EQSA 3HK6B 1ZRKA 1ZSJA 3NCLA 5DP3A 1OOKB 1EZQA 1UJ1A 4MVNA 1ESBA 4BXSA 1GHBG 2XBYA 4ZUHA 2WPIS 1HLTH 1LHDH 2Z3CA 2PHBA 4TPYA 6GCHF 1ELTA 3MU4A 4Z0KA 2WPLS 4CRDA 1SLWB 3M3TA 4ZKNU 2BD7A 2F9OA 1CO7E 3PMBB 3ELAH 1VR1H 2FYQA 2SNWA 2Z6BD 3K2UA 1N6XA 2PGBB 4JZFH 1UTPA 1HAXB 2AEIH 1HAPH 1IQKA 2JH6D 4BXWA 5FX5A 5HGGA 8KME2 1FMGA 2UWPA 3UQOA 2VWNA 2JH0D 4B71A 3T62A 3PLPA 4ESTE 2R2MB 1AZ8A 1DLKB 1SGIB 4CRCA 1AB9C 1O2NA 1GJDB 1OWIA 1GHYH 5A8XA 1Y3XA 4NG9H 2ASUB 1AZZA 1ESTA 3R0FA 2XXLA 1TLDA 4DVAU 3ATWA 5EQRA 3ATIA 1F7ZA 1H9LB 1ZTKA 3S69A 3QTVH 4XFQA 1TIOA 3SU5A 4CH2B 4Y71A 4K60A 1UVTH 1QURH 1SB1H 1UK2A 1ZRBA 1V2JT 4CRBA 1UHBA 7GCHF 4D76A 2A2QH 3RXTA 5JDUB 5FBIA 3ZVGA 3Q3XA 3PLKA 1HIAA 1V2ST 4OS5A 3M35A 1P01A 4OS4A 2Y5GA 1PPBH 1GHAG 1O2ZA 2C3SA 2YNBA 1ACBE 3QN7A 4DIHH 1GBMA 1YPHC 2BY9X 1KXCA 1L1GA 3MH7A 1AE8H 1EAWA 2PR3A 2QF3A 1CBWB 4AOQA 1V2TT 1Y8TA 3Q77A 4X1SU 1NY22 3QZQA 1AIXH 1D3PB 4Y8ZA 1OWKA 1YYY1 1E37B 1HFDA 5EW2H 1WV7H 1O2TA 1O5CB 1G9IE 1XXDA 2BDBA 2BLOA 1GHXH 1LO6A 1GI4A 1ZPZA 2DUCA 3SU2A 1J17T 2VWLA 4Q2KA 5A0CA 2UUKB 3CS0A 1O2KA 2RA0A 3BEUA 5E8EH 1XXFA 1J15A 5TCAA 2BVSH 3MYWA 1Z8GA 1OWHA 4AFSA 2BVXH 3A85A 3HK3B 2C8ZB 2ZPQA 1FLEE 3RXHA 2R0LA 2FOHA 5ETXA 3NPSA 3LH3A 2WUCA 1GI5A 2XRCA 3PTBA 1S81A
chains in the Genus database with same CATH superfamily
1C1RA 2GGVB 3NWUA 1MMJN 1ANBA 2ZIQH 1A3BH 1QL7A 5G4BA 4INKA 3A7ZA 1C5WB 4FUFA 3BTFE 8GCHG 1VJAU 5T6DA 1GBAA 1C1PA 1CU1A 3FZZA 1AQ7A 3S0NA 3MU5A 3SN8A 2NU0E 1LQEA 5GDSH 1C5LH 3AW1A 2V3MA 8LPRA 4NCYA 3RMNH 3PMJA 5K0HA 1OX1A 4YOIA 3JZ1B 1EPTB 3T27A 1ZJKA 3UIRA 1WOFA 1E35B 1CA8B 2H9HA 1TGSZ 5E2PA 1SFIA 4X8TH 3OEED 1EZXC 1Z7KA 4Y7BA 4NA8A 2FOAA 4ZKSU 4Y0YE 1B7XB 4CREA 2XC0A 2C90B 1OHHD 3LH1A 1K1JA 1PYTC 4DW2U 2VWOA 4OS6A 3RP2A 4ABGA 5KECA 2ZHWH 3PV2A 2VGCB 3A82A 1BMNH 1YWUA 3F3BA 1FAXA 1S85A 1QGFA 5DSFA 3DFLA 4K8YA 1SR5C 2A7CA 2GTBA 2AIQA 2HGTH 1WAYB 1HCGA 2EI6A 1EKBB 2RDEA 2F9PA 3VB6A 3MO9A 1QQUA 2FI5E 2QCYA 2FI4E 2THFB 4D9RA 1P10A 1AD8H 2P95A 3TJOA 1DFPA 1WDIA 1C5ZB 2O9QA 1UK3A 3F0OA 1SGDE 1UVSH 3SGBE 1LHEH 1GJCB 3SU1A 2W6ID 5DP5A 3N7OA 3M7TA 4WMFA 2OXSA 3AASA 1GPZA 1YPGH 3L3TA 4R0IA 2L6OA 1IQLA 4ZHAA 2Q1JA 4X6MA 1ELEE 1EPTC 1KLIH 2BDAA 1Y3YA 3PMAB 1Q31A 2BD9A 3U28C 1HXEH 4I8GA 1VCQA 5FL7D 1RS0A 5T3HA 1E1QD 1FAKH 1AHTH 1GJ7B 2BZAA 2J4IA 3TK5A 5LPEA 4D9QA 4B2CA 2O8TA 1NC6A 1KTTB 2HPQH 1AVWA 2ZFSA 2QA9E 4RSPA 2KCOA 2J34A 2PTCE 4FUBA 3QK1A 4SGBE 3RM0H 2F3CE 3RXIA 4NFFA 2FP7B 4J2YB 2WHXA 2VGCC 2NU3E 3SGAE 4BTTB 1P2IA 5EG4A 2K8IA 2BLWA 5BRRE 4HFPB 5DP8A 1EATA 3TIUA 1GMHG 3RXJA 3FP7E 3PMHB 3KHVA 4ABDA 3SBKA 4BAOB 3M5OA 2VVCA 4RI0A 2OTVA 5CDFE 2OD3B 1QL9A 1PQ8A 3ZVDA 2Y5HA 6CHAB 1EPTA 1GDNA 1RTLA 2R9PA 2GDEH 4KGAA 2ZHEH 3ZZCA 3GCHC 4ZHLU 2Z3EA 2FS9A 2O8MA 5HYOA 1DY9A 1DANH 1THRH 4H6TA 1O5BB 3CS7A 3TH2H 1GI3A 4Q7XA 5JBAS 3GCTG 1RFNA 3SU6A 4OM9A 4RN6A 2RDLA 1HJAB 3NKKA 3VGCB 1A4WH 2W6JD 5C0TA 1SGPE 2QXGA 4XBDA 4FUHA 2LPRA 1QJ7B 4HZHA 2A5IA 1MKWH 2BXUH 4YOJA 1LKAA 1QCPA 1O32A 1OYQA 4WWYA 4B6FA 2ZA5A 1S0RA 1L4DA 2ZZUH 3FOAA 1L1JA 2BZ6H 1BMAA 1LKBA 1THPB 1O38A 1FONA 1YPKH 3MNCA 1H8HD 1LQDB 1NRNH 1HAIH 4F49A 5FXLA 2BYAX 1PPGE 1THSH 5KGOA 1GI6A 2P94A 5L30H 1FIWA 1P09A 1O3HA 1ZGVA 4JYVH 4OS1A 2TPIZ 3PTNA 1E79D 1EJMA 3SQHE 3GISB 1ZGIA 2M5TA 3KF2A 4X6OA 3A86A 6CHAC 2QE7D 4OS2A 3QTOH 1DSTA 2EI7A 1IOEA 1DUEA 2ZCKP 3RXOA 1TGCA 2W3KA 1TFXA 3GY5A 3P95A 2OK5A 1B0FA 5EGMA 2ZGJA 1G37A 1NPMA 1HJAC 1EZSC 3VGCC 1HAZB 1SOZA 1NBMD 1O3JA 3ZVEA 1V2PT 2SGQE 4DGJA 1K21H 1F0UA 4ZKOU 5EJ1A 1FNIA 3QX5H 2AERH 2VVUA 1A0JA 1KXBA 1K2I1 2B8OH 1WXRA 4I7YH 1A5GH 2V35A 1T31A 4E7RG 7ESTE 3K65B 2Y82A 2XNIA 1OWEA 2H2ZA 2P3UB 1EJNA 1FN6A 1VGCC 4Y8YA 2Y81A 2A4OA 5CHAB 1XUHA 1MABB 1JRSA 5CMXH 1UVPA 2H9TH 2XOKD 2VIOA 3LDXH 4D7GA 3A8CA 3V0XA 2W7UA 2ANKH 2KCPA 1QY6A 2H9EH 1EB2A 3ZVCA 3SJOA 1NBME 2G5VA 1N6YA 2ZF0H 3LJJA 4AB9A 1DWEH 1D4PB 1NFUA 4ZH8A 1GJBB 3BF6H 2AMQA 3OX7U 3BTKE 1C1QA 4Y79A 1O5EH 1GHZA 1PPFE 1UTNA 3MMGA 1JIRA 1Z8RA 1E1RD 4JK6A 4NGAH 4X0WU 1TX8A 4MNYA 1N1LA 1AKSB 2OP9A 5C2ZA 1BTPA 1HGTH 4MPUA 3LGIA 1XKAC 2VH0A 1LVOA 3F9EA 4GVUA 5F8TA 2BQ6B 3HGNA 1EP5A 1FI8A 2G55A 4ZAEA 1HRTH 1C5QA 1SHYA 2JH5D 3EA9A 4JYUH 2LP6A 1GVKB 1ARBA 2XW9A 2BLVA 4Q63A 3ZIAD 1ZLRA 4FUDA 4FUJA 1O35A 2ZDAH 5AFYH 3U9AH 5CHAC 1W10U 3K9XB 1IQGA 3OEHD 4H4FA 1SGNE 2FEQH 1QRWA 4K5ZA 3M3VA 4YZUA 3MH5A 2WZQA 2BY5X 3LIWA 1Y5BT 3PWCA 1CE5A 3A7XA 4XDEA 1HV7A 1NU9A 1SQOA 2BD3A 2PUXB 1MCTA 3I78A 2GCTB 1MQ5A 5L2ZH 2BTCE 3A87A 2RG3A 3OTJE 1HAVB 4AC9A 1SGQE 4CHAB 4ABFA 3E91A 2C8YB 1BOQA 2FTLE 2BDYA 5GWZA 3KCGH 3S9CA 2QXHA 3MO6A 4XRNA 3L33A 1O3OA 4MTBA 1TX6A 1MZDA 1ANCA 3ZZDA 6GCHG 1YPMH 1O3FA 1WTHD 2F9VA 4HGCA 4DCDA 5JPMH 2CGAA 2RCEA 2Y7XA 2AMPA 2FOBA 2KAIB 2ZTZA 3A7YA 1D9IA 4FVDA 2ZC9H 5FX6A 4E05H 2FLRH 3MFJA 1DXPA 3SHCH 3NRLA 1TNHA 1UTJA 1NESE 3N7DA 5C1UA 2PGQB 2P3FH 4K1EA 1LDTT 1SVPA 2ODQA 1ZPBA 1JXPA 3SHAH 2NU4E 4UDWH 1C1MA 3WWBA 2QF4A 1LHFH 2AYWA 3B23B 3FP6E 2WPJS 5DP9A 1P04A 1WQSA 3A8DA 1UCYE 2ZNKH 2ANWA 2OLGA 1O2WA 1A7SA 2GT7A 5SGAE 4I8JA 1AKSA 4IBLH 1O37A 2P16A 5EJLA 2SGDE 1O2RA 2W5EA 3RXUA 2G51A 4CHAC 3RXQA 4INLA 4NSVA 1RIWB 1P2JA 2HOBA 2O8UA 2XBVA 5EJZA 4A92A 1KSNA 5TJXA 2AGEX 1HB0B 3AAUA 4I33A 1NFYA 4X1PU 1H1BA 7GCHG 2STBE 1A2CH 3BTME 1ZYOA 1MTUA 1VCWA 4ASHA 1TOMH 5B6OA 5C94A 1XUIA 2BY6X 2ZP0H 1BB0B 4D8NA 1S84A 1KLJH 3TGKE 1G3CA 1MU6B 1ELDE 2G4TA 3MOCA 1DE7H 3NZIA 1C1OA 1V2VT 3T2NA 2PSYA 2JETB 2ANYA 2XYAA 1HAVA 2O8WA 4RKJB 4MNXA 4FU7A 1GBHA 3OU0A 3DA9B 2GCHF 1A0HB 1BJUA 5E2OA 2OC1A 4X8SH 3SNDA 2ULLA 1WU1A 2AMDA 3PRDA 1E38B 2UUFB 4WH6A 2Z9JA 5L6NH 3WY8A 3G01A 3VB7A 7LPRA 1ZJDA 2KR7A 3PROA 3QGNB 4JYTA 2GMTB 1GMDF 3H7TA 3TLOA 2GJGA 5JB9S 1C1SA 1S5SA 2A5KA 2BX3A 2KFWA 5F8ZA 1TONA 3MHWU 1K22H 3BEFB 2EI8A 4I32A 4DT7B 2FWWA 4Y7AA 3E6PH 2FDAA 3KQBA 1KDQA 4CBOA 1WUNH 1GGDC 4UFFH 4NIWA 1HXFH 3STJA 3MNBA 1COWD 1L2EA 2FX6A 2Z3DA 4CBNA 2GX4A 1KY9A 2A7HA 1A0LA 3SU4A 1QIXB 4GSOA 1P06A 4KTCA 1O3GA 2ZHFH 3ZVAA 3T29A 2HVYB 4KTUA 1W0YH 1WQVH 2JETC 2PTNA 3S7HB 5IYTA 1EFRD 1D6RA 1P03A 2ZG0H 4B2AA 4IN2A 4RKOB 1Y5AT 1GI1A 2GVFA 1U6QA 1MTVA 2BD5A 4TPIZ 3KNXA 2ESTE 3U1JB 3IG6B 1SSXA 4TSFD 4FVBA 4BNRA 3LGWA 2WV9A 3GYLB 1HAOH 3SNAA 1C2IA 1NFXA 1G2MA 2XCFA 2ZKSA 5H4IB 3I29A 4ISNA 3M7UA 3M5LA 5DG6A 2H1UA 3UREA 1UTMA 2A32A 3RUOA 3RXBA 3SJ9A 3KQEA 2CHAB 1EAIA 2HALA 4X1QU 4GAWA 2P8OB 3RXKA 3LGVA 4RT0A 1UCYH 2TIOA 3LU9B 2C4FH 4WXIA 1C2JA 3M3SA 5C67A 3B8JA 1OXGA 1TNKA 1BHXF 2UWLA 3ZZAA 4O9VA 3TH3H 5IDKA 1HJ9A 3RDZA 1C1NA 1T32A 1Y3VA 5FBEA 1G3BA 3VEQB 3O8RA 3OY6U 1C4V2 3ZYEA 1AFQB 4P02A 3MU8A 3ZZ8A 5T6GA 3ODFA 1YLCA 4FETA 4U30A 4NA7A 1TMUH 1C5MD 1O3AA 3KEEA 1JRTA 5TCCA 2OCVB 3NK8A 4IN1A 5EXNA 2BDIA 1C5PA 2TBSA 3QDZB 1NO9H 1ARCA 5EPNA 2B9LA 2OBOA 1K1MA 1MQ6A 2UUYA 2TGTA 4WF8A 1X7AC 1OSSA 3UAIC 1GBBA 1CT4E 4FUIA 4O3UA 3F68H 2BD2A 1YF4A 5JBBS 1UO6A 3E1XB 2A5AA 3SV2H 1C9TA 2CHAC 2SNVA 4AG1A 3JZ2B 4UFDH 2P8OC 1AY6H 2VJ1A 4Z1MD 5HIYA 2LELA 1GCDA 3B9FH 4GLYA 1C4U2 3DSGA 1TWXB 5C1XA 4NIVA 1CQQA 4B73A 4JZIA 1O5AB 3SJIA 1AUJA 1LPZB 3RC4A 1G2LA 1Y5UT 2VBCA 3A88A 1G30B 3PLBA 1YPJH 1DWDH 1AI8H 1KLTA 1AFQC 2D26C 4INHA 1RD3B 2J2UA 3F2FA 3TK9A 3BG8A 1CBWC 3DHKH 1CT2E 3KL6A 1W13U 1T7CA 1UW7A 1ZR0A 3RXPA 1EOLA 2BDCA 1Q3XA 4AGJA 2ZDVH 2ODYB 1QTFA 5T1VA 1GBJA 2Y5FA 1TA6A 1MH0A 1FX0B 4KKDA 1HAYB 3E0PB 1BRBE 4MPXA 1VZQH 3F9FA 2J98B 2OC8A 2I6SA 1TGTA 2Z7FE 2ZFTA 1C4Y2 1ZMNA 1ANDA 2AGGX 1GI9B 1UTOA 1K0HA 3F9HA 3RLYH 1P2OA 2JJ1D 2QAAA 4TY7A 2PWXA 2ZQ1A 2XBWA 2C8WB 2Z9LA 3UWIA 2HWLB 1CHOF 1D3QB 1IHSH 1G3DA 5FPYA 2OBQA 3SW2B 3GY4A 4X2VA 3TH4H 1XM1A 3OYPA 1NFWA 4AFUA 3BG4B 2CF8H 1W14U 1NM6A 1ZHMA 4B6EA 1EQ9A 3SV6A 1P2NA 1OS8A 1UTQA 2P93A 4GHTA 4MQAA 1O3LA 1ZMJA 5E0JA 1EP6A 2BOHB 3MU0A 1O2PA 3QLPH 2AHME 1GVZA 2CMYA 2VINA 1O3IA 1GJ8B 1LVYA 4F4OC 2GV7A 2ZECA 4ZXXH 2V6NA 3P8FA 2TRMA 4O3TA 1QRXA 4Q7ZA 1TB6H 4AX9H 1IQFA 1C5TA 2EQNA 4ABJA 1MUEB 1C5OH 4BAMB 3V12A 1S82A 3T26A 2KX4A 3SQEE 5J4QA 4ISIH 5GXPA 1BQYA 1DY8A 1UTKA 1YCPH 1HPGA 4X2XA 2VH6A 1O33A 3EE0B 3S7KB 4YT7H 2PW8H 1Z71A 4TY6A 4MLFB 1GHVH 3PO1B 1QB9A 1ZSLA 3GY3A 1B0EA 1FDPA 2OINA 4U32A 3SU3A 5FHTA 3SNBA 1FJSA 3ZVBA 1QR3E 2ZDLA 3RXVA 1WTGH 1SLXB 3SV7A 1LHGH 2BOKA 5DJ7A 1F5RA 1C5YB 1FPCH 2FOMB 2G4UA 3BG4C 3SUDA 3S9AA 2CV3A 1BITA 4E06H 1GBCA 3BTTE 3EGKH 1SOTA 3UQVA 4HG6A 3TVJB 4ZKRU 1QA0A 4XE4A 3RXGA 1O3PB 1TGNA 4X6PA 2F83A 3C27B 1ETRH 1YGCH 1K1IA 2HNTE 1O34A 3O8CA 1MD8A 5BPEA 1ELVA 3UY9A 1Z1JA 1P11E 1G36A 3A8BA 1FY8E 1A5IA 1CSOE 3RC6A 5HM9A 2Y7ZA 4JZDH 3LKWA 2H6MA 1PJPA 5IK2D 1O3NA 2HPPH 4WJG2 2FESH 3W1EA 2WV4A 4MNWA 3T5FH 1P2QA 2PSXA 3PO1C 5GIBA 4XSKU 4YT6H 4ISLA 4UFEH 2ZTYA 3QGJA 3K6YA 4MNVA 1ZSKA 4VGCB 2BD4A 1OKXA 3RM2H 1ELFA 4BAHB 1GCTB 1VCPA 1O30A 2GT8A 2AFQB 3F9GA 3ZZ3A 1V2NT 3Q3YA 3BTHE 1BRUP 1BDAA 5JBTA 3BTDE 1RTKA 1KXFA 1ZTJA 1OPHB 1YPLH 2YNAA 3U69H 1FUJA 4WVPE 1T8MA 5GNDA 4FU8A 3I77A 1ORFA 1BBRE 5AVDA 4TWYA 2O8LA 3LGTA 4WXVA 2XTTB 5F53A 1AWHB 3UR9A 2WV5A 1GI0A 4BANB 1E36B 5DP7A 1TX7A 1BTHH 5GPIB 3MH4A 3FN8A 2AS9A 1FY5A 1C2GA 2PP6A 2ZGBH 3DCLA 1V2UT 3SV8A 1CHGA 4Y6DA 1GJ4H 1TPAE 1O2MA 1AVXA 3SI4H 4UEHH 1BJVA 3FKSD 1C2KA 5LPFA 1UK4A 4B2BA 1T4VH 4A1TA 3RXMA 5K7RA 3QWCH 1W7XH 3SI3H 1AUTC 2GZ9A 1T8OA 2C93B 4VGCC 2H5CA 1PQAA 3UPEA 1MKXH 5EQQA 2GP9B 1NRPH 2ALVA 5KEDA 2ILNA 1IQEA 1HBTH 3RC5A 1BTWA 1QHRB 1C2MA 1XKBC 3PV5A 3P6ZB 1CVWH 1NRQH 3Q3KA 4B1TA 1TMTH 4DY7B 1Q2WA 1E0FD 2Z9KA 3RMLH 1TNJA 1XUKA 1AMHA 1DT2A 1MAYA 1HDTH 1NRSH 1OP2A 3OAAD 5A2MH 3M7QA 2NU2E 5AFZH 1SLUB 1M9UA 1ELBA 5ESTE 5FPTA 1MZAA 2QC2A 2ZTXA 4CRAA 2EEKA 1SHHB 1XVMA 4UD9H 3E8LA 2EA3A 3IITA 1ZMLA 6ESTA 2NWNA 1GMCF 1O5DH 1C9PA 1KMHB 1V3XA 1Z6EA 4H42U 1C2HA 3SU0A 2Z9IA 1ELAA 1RJXB 2Z94A 4ACAA 4GHQA 5JBCS 4AYYB 1QFKH 4YLQH 2HLDD 1TPPA 2ZFFH 1FXYA 4OGYA 2ZDNA 4IMQA 1O2HA 4BAKB 2QF0A 1V6DA 2OC0A 3TNTA 5DK1A 1DDJA 2FPZA 2GCHG 4TWWA 3M5MA 1F0SA 2BM2A 2M2AA 1O36A 2QF5A 1SL3A 2P3TB 4B76A 3MNSA 3LJOA 3PM3A 2ALPA 1W7GH 2WPKS 3GS9A 4JK5A 1GMDG 4A1VA 5LGOA 2BDHA 3P92A 4HTCH 1O31A 4ACBA 1OYTH 1VITF 3STIA 3UNSA 1TBRH 3RU4D 1IHTH 1BCUH 1WYKA 4O03A 5DP4A 3RLWH 1BBRH 1MKWK 1GL0E 2ZGXH 3EA8A 2ODPA 1TNGA 1F2SE 1GBKA 2VB0A 3SUFA 3V7TA 3TITA 4GUXA 5I46H 5DO4H 1W0ZU 3ZZ4A 1TPOA 1G32B 1MBQA 3BTQE 3SNEA 1DWCH 1KYNA 2IN2A 1ZHPA 2BQ7B 4NZQA 1P05A 2YMSB 2ZGCA 3SV9A 3H7OA 2PKSB 1ID5H 2OC7A 4BAQB 1HNEE 1WCZA 2FLBH 3WWFA 1O2VA 3P8NA 3RU4E 1JOUB 2J94A 4FOUC 1TQ7B 1SGTA 3ESTA 3O8BA 2GCTC 1O5GH 1A1RA 2ANMH 2CF9H 2OQ5A 2QXJA 1LPKB 1QJ1B 1J8AA 1W11U 1W2KH 2Q6FA 2TGAA 2Y6TA 1O3EA 1T8NA 1EAXA 3HGPA 1S0QA 3MU1A 3GY6A 1YBWA 5GCHF 5HM2A 2A4QA 1TYNA 3SZNA 1L0ZA 2GD4B 3BSQA 1ELCA 3IWMA 1P3CA 3SGQE 1F5LA 4A6LA 1TRMA 1NN6A 2NU1E 1AO5A 4M7GA 4A5TS 4AZ2B 2V3OH 3URCA 1S83A 3QUMP 3O8DA 1EZUC 2LNCA 3GCNA 4AFZA 1C5SA 1DUAA 2L74A 3ZZ7A 1C2FA 1QJ6B 4SGAE 1BT7A 3S9BA 4AGKA 1UTLM 3KYFA 1K9OE 4WMDA 3RMOH 4Z6AH 2J5UA 1ABJH 3GICB 3BTWE 1O2SA 1SQTA 2PKSC 2CN0H 1YLNA 2J38A 1AVGH 4K8BA 2GV6A 2PKAB 1SGEE 1ZHRA 3MI4A 1RTFB 5C1YA 3U8RH 1PQ5A 1O3MA 4WMEA 3U1IB 1HAHH 1A61H 1NZQH 2KAIA 5FCRA 3UR6A 1EOJA 1FN8A 3PRBA 2Q6DA 3A83A 2ZDKA 1J9CH 4NIXA 1IQJA 1P57B 3A7WA 2ZI2H 4BOHA 4RT1A 2FS8A 2R0KA 1TABE 4ABBA 4DJZB 2A1DB 3DFJA 5LPRA 1EUFA 1RIWC 3ATKA 4K1SA 3KYGA 3UNQA 1SPJA 3TPIZ 1Y3UA 1W12U 1GI8B 1BIOA 3A80A 1O2UA 1DS2E 2ZPRA 4MG3A 1FV9A 1RXPA 2FOGA 3A7VA 2K0QA 2QXIA 4D7FA 3LONA 1P8VC 1KXAA 2IPQX 2FZZA 3P70B 1LTOA 1KXDA 2OUAA 3BV9B 3SOSA 3ZV9A 4FXGH 1ETTH 1XX9A 1P12E 3U98H 1MU8B 4IW4E 4LOYH 2OQUA 4JZ1A 3W95A 1Y59T 4X1RU 4PROA 1P9SA 3TJVA 4I8HA 3E3TA 4FUEA 3ATMA 3FANA 2BD8A 1QBOA 3EA7A 2D1JA 1P2KA 3HPTB 3ZZ9A 1FZZA 2ZPSA 1NTPA 1ZTLA 4JZEH 3VG8A 5C5OA 2GMTC 3A7TA 1W8BH 1V2QT 2IPHA 3SUGA 3D49H 4MPVA 5J4SA 1SGFG 1NS3A 2WYGA 1F0RA 4NSYA 1ANEA 2BLQA 1TBZH 1PPCE 2VWMA 1TMBH 5F6MA 1K1NA 1O5FH 2ZFRH 4Y76A 3R3GB 1YP9A 2IJD1 2A7JA 2QGRA 3QO6A 3RXEA 1CHOG 3T28A 1C5NH 3H5CB 1BBRK 1OP0A 1DX5M 1T8LA 1O0DH 5EPYA 5EODA 2KM0A 2PKAA 2VVVA 2SGEE 3ZZ6A 4A1XA 4OS7A 1GBFA 4GCHF 1ZZZA 3OY5U 3PYHA 2FOEA 1BA8B 3URDA 1TNLA 1NT1A 1TBQH 1GBLA 2XC5A 1QRZA 1QL8A 2Y80A 2ZQ2A 1D6WA 2A45B 1FQ3A 4DOQA 1LPGB 4WY3A 1LMWB 1MTNB 2FOFA 7KMEH 2JIZD 1DPOA 4NWKA 5A8ZA 2YMSD 1YPEH 1GBDA 5HMAA 5FCKA 2HNTC 3LGYA 1OWDA 3LPRA 5EW1H 3A81A 1V2MT 1JBUH 1DXWA 2FX4A 1WSSH 3FFGA 1QB6A 3RXAA 3WW7A 2V3HH 4UE7H 3K6ZA 3M5NA 1TQ0B 1DICA 1H8IH 4Y11E 2DE8A 4K1TA 5CE1A 3FAOA 3U8TH 4QT8C 1HJ8A 2ZCLP 2TGPZ 5F8XA 9ESTA 4UONA 1IQMA 1GHBF 1O2GH 1Y3WA 2XBXA 4KTSA 3ENSB 4X8UH 1SLVB 1UVOA 1GBEA 1ESAA 2BVRH 1O2JA 2PLXA 4IS5A 2BY7X 1MCVA 3OE7D 1HAGE 4YO9A 3HKJB 1BRAA 2ZEBA 4CRGA 3ZZ5A 3TGJE 2FIRH 4FUCA 3EE7A 3OSYA 2C8XB 1AWFH 4I31A 3D62A 1GVLA 2Q6GA 1H8ED 4AG2A 2IJOB 2ZU5A 4H6SB 1DVAH 1C1UH 1MTNC 1KIGH 4KELA 1BMFD 2FO9A 4E7NA 2VU8E 1EB1H 1H8DH 2ZWLH 1W0KD 1CGJE 3D65E 4LZ1H 1N8OB 1Z8IB 1P2MA 3QZRA 3VB5A 1S6HA 3BEIB 3GY7A 2SGFE 3KN2A 2QN5T 3M61U 4IGDA 3LC5A 1C1TA 5FPSA 1C5XB 5C3NA 3AK5A 3SJ8A 1YLDA 4XD7D 1G3EA 1V2OT 3NUMA 5T6FA 4MPWA 3CENA 2VNTA 1V2KT 2V0BA 4WH8A 5DN6D 2FOCA 2G52A 3DT0H 3BN9A 5DKMA 3E0NB 3ITIA 5A0BA 1H4WA 1QA7A 1TPSA 1GBIA 3VB3A 1C2LA 4DIIH 3F1SB 3HATH 5ESBA 3UB0A 1AGJA 3RXDA 1GI7B 3T25A 1BZXE 1QBVH 4K2YA 1CA0B 1CGHA 1GHAF 2J92A 2J95A 1IAUA 1O3KA 2GDDA 3GCOA 1BMMH 4Q80A 1QNJA 3GCHB 3MH6A 1YY3A 1MTSA 1LCYA 2BQWB 4Y8XA 5C17A 3TU7H 1XUFA 2F9UA 4THNH 2DE9A 3FVFB 2Z9GA 2H5DA 1JWTA 1AU8A 1S6FA 2FM2A 1XUGA 4IC5A 2HRVA 1EASA 1N8OC 2PUQH 5AHGH 1YKTA 3ODDA 2JJ2D 2AGIX 4GPGA 1BHXB 4CH8B 2WPDD 1T4UH 1YCPM 1HUTH 3OFND 1TGBA 4HI3A 2A4RA 5DP6A 1UCYK 1KXEA 4NFEA 3GYMA 3DD2H 1O3CA 4DURA 3HKIB 4B75A 4BTUB 3P8GA 2ZFQH 1V2RT 3DUXH 2XCNA 2F91A 2BXTH 1B5GH 1C2DA 1SQAA 5GJ4B 1F5KU 2J98A 1TOCB 1YPHE 3PB1E 1SMFE 4XBBA 4ISHH 4YOGA 4ABIA 1NU7B 1BRCE 1CA0C 2XWBI 3BIVH 1C1VH 1FPHH 8GCHF 1GDUA 2D8WA 4TT3D 1TE0A 2VIDA 1GG6B 2ZDMA 5EIYA 3LT3A 3C1KA 2A4GA 1A46H 1BTZA 1GHWH 1SBWA 4P00A 3KQCA 5E0HA 3GDVA 4TYDA 1GMCG 1SC8U 1EJAA 1PQ7A 1LHCH 5DGJA 4AORA 1XMNB 1C2EA 3OTPA 4B74A 1MAXA 1PFXC 2QV1A 4X2WA 3SORA 1UMAH 1O3DA 2B0FA 4ISOA 3MNXA 2B5TB 1TRYA 1D3DB 2HLCA 4FU9A 4Y0ZE 1V2LT 4K3JA 1DWBH 4KP0A 3V3MA 1DM4B 4DG4A 2STAE 1IQHA 2ZU3A 1F0TA 3BTEE 4F48B 1ETSH 1P9UA 1PYTD 3PV4A 1VGCB 2R2WU 4OGXA 3VFEA 1QQ4A 3LC3A 2WPHS 2TGDA 1D3TB 2GZ7A 1LVBA 4I8KA 1Z6JH 2I6QA 3N7EA 2BDGA 5HXFA 2ZHQH 1E34B 3BIUH 3V13A 4X2YA 4CRFA 4X1NU 1GG6C 1XUJA 1VITG 3EQ0H 1QBNA 2SFAA 1L4ZA 3N99A 2VIPA 5EOKA 2CXVA 4ZCNA 2FXRA 4XOJA 2KZ4A 1P02A 3UOPA 1SG8B 4IC6A 3P8OA 1DSUA 1BTYA 2UUJB 4YESB 3SNCA 3GDUA 3H09A 2AH4X 5DPAA 2A0QB 1JMOH 2IOTA 5PTPA 2ZCHP 3F6UH 3VB4A 1SGRE 3EDXB 5EXMA 1FIZA 1GCTC 3F0PA 1LVMA 3E90B 2G81E 1TAWA 3FP8E 3Q76A 3A84A 3ZV8A 5A0AE 3MO3A 1GMHF 3ZYDA 5A8YA 2W26A 2RFKC 4NWLA 4LK4A 4YXWD 3ZZBA 2BY8X 1TRNA 1EXFA 3RXSA 1BTXA 1C5VA 1EX3A 2CJIA 2PV9B 1O2XA 1TA2A 3LOXA 1CT0E 3DSPA 1Z8JB 2ZU2A 4ABHA 1GDQA 3ZVFA 2XWAA 5C0UA 1K1LA 1O2YA 5AF9H 4ZHMU 3F2HA 1L1NA 2D2DA 5E0GA 2BMGB 5GCHG 3SJKA 4UFGH 3UOUA 1MD7A 2ZHDA 2BX4A 2R3YA 3PWBA 3GCTF 3Q00A 1SQRA 5CHBA 5HKKD 4A7IB 1UVUH 3RXLA 1YCPK 4ABAA 2EC9H 3UUZA 4LZ4B 5ABWA 1WBGB 5C20A 1SKYE 1GL1A 2QY0B 2FYRA 5EXLA 1VITH 1SI5H 2J9NA 4K69A 5LH8A 3E16B 2ZU4A 4J1YA 5EU8A 1O2IA 2QYIA 2GKVE 4LXBH 2KCAA 1O3BA 4JMYA 3BTGE 3A8AA 1IQNA 3FZDA 4XBCA 1GBTA 1PPZA 2YOLA 1SGCA 1SGFA 2WYJA 1GJ9B 3W94A 4YLUA 4DT4A 3SZEA 4ABEA 1P3EA 1INCA 4X8VH 1ABIH 2G5NA 1K1OA 3MTYA 2K1QA 1YC0A 1EAUA 1AFEH 1IQIA 1O2OA 4Q7YA 1ZOMA 3L6PA 2FTMA 3LGUA 2FI3E 4AB8A 2VIWA 1JIMA 3VXFH 4I86A 1GI2A 3VPKA 4AYVB 3UNRA 3MQKC 1V2WT 2HVXA 1MTWA 1O2QA 1K1PA 1BUIA 2HNTF 1O2LA 1FY3A 3TJNA 4BTIB 1VJ9U 3GY2A 5C5NA 1K28D 1RGQA 1C1WH 2W7SA 3MWIU 2G8TA 3KQDA 4Y10E 2A2XH 4CR5A 3M37A 3RXCA 1AE5A 1C5UA 1H9HE 3GOVB 2FODA 1YM0A 3GY8A 1FY4A 3RXFA 3AW0A 2F43B 3KGPA 8ESTE 3RU4T 1ELGA 1W3CA 3M36A 5JYIA 1NROH 2F9NA 2VIQA 3A89A 2BHGA 4NA9H 4ZXYH 2F9BH 1GJ5H 5L2YH 2SGAA 2PFEA 1KDQB 1MBMA 2JKHA 4YTAA 1OP8A 3AAVA 4ZMAH 4NZLA 1AN1E 3UTUH 3UFAA 4CR9A 4AN7A 1KTSB 3GDSA 2F4LA 2ZFPH 2AIPA 4R8TB 4NIYA 1P0SH 3TGIE 2P59A 1SFQB 1TALA 1PPEE 1Z1IA 1O39A 5I25A 1BMLA 2WSSD 1XVOA 4Q4LA 1GWAA 3TJUA 3RMMH 2WINI 1F92A 2WPMS 1CGIE 1DOJA 4AFQA 1A3EH 3DSOA 2GZ8A 1GJ6A 4I8LA 5JB8S 1DLEA 4X6NA 3P17H 2W3IA 2VIVA 1H9IE 1NRRH 3SO3A 3VXEH 2ZGHA 1J16A 4F55A 4YM9A 4ZROA 1W0JD 1FY1A 1GGDB 2JDID 3TNSA 5A09A 4GCHG 3RXRA 2R3UA 1GJAB 2G00A 1OWJA 3SUEA 2B7DH 2YMSC 2ZO3H 2WUBA 5F03A 1BTUA 1MKXK 3U8OH 3ATLA 1A5HA 3UWJH 3TK6A 2SGPE 1PPHE 5FAHA 2QIQA 4IMZA 4U01A 4MDSA 1UHBB 1RRKA 3AVZA 4O97A 1C5RA 3EYDA 1ZPCA 1QB1A 2RA3A 1AB9B 1HIAB 2FMJA 3D23A 4JCNA 2A31A 1J14A 2ZU1A 4FUGA 2UWOA 9LPRA 2XC4A 3KIDU 3NXPA 3CP7A 3EAJA 2J97A 3SYJA 6LPRA 1DITH 2BB4A 4U2WA 1HYLA 1SGYE 1TNIA 5EQSA 1S6LA 3HK6B 1ZRKA 1ZSJA 3NCLA 5DP3A 1OOKB 1EZQA 1UJ1A 4MVNA 1ESBA 4BXSA 1GHBG 2XBYA 4ZUHA 2WPIS 1HLTH 1LHDH 2Z3CA 2PHBA 4TPYA 6GCHF 4M9FA 1ELTA 3MU4A 4Z0KA 2WPLS 4CRDA 1SLWB 3M3TA 4ZKNU 2BD7A 2F9OA 1CO7E 2V7QD 3PMBB 3ELAH 1VR1H 2FYQA 2SNWA 2Z6BD 3K2UA 1N6XA 2PGBB 4JZFH 1UTPA 1HAXB 2AEIH 2XNDD 1HAPH 1IQKA 2JH6D 4BXWA 5FX5A 5HGGA 8KME2 1FMGA 2UWPA 3UQOA 2VWNA 2JH0D 5B6LA 4B71A 3T62A 3PLPA 4ESTE 2R2MB 1AZ8A 1DLKB 1SGIB 4CRCA 1AB9C 1O2NA 2EY4C 1GJDB 1OWIA 1GHYH 3F2GA 5A8XA 1Y3XA 4NG9H 2ASUB 1AZZA 1ESTA 3CNRA 3R0FA 2XXLA 2CK3D 1TLDA 4DVAU 3ATWA 3FO8D 5EQRA 3ATIA 1F7ZA 1H9LB 1ZTKA 3S69A 3QTVH 4XFQA 1TIOA 3SU5A 4CH2B 4Y71A 4K60A 1UVTH 1QURH 1SB1H 1UK2A 1ZRBA 1V2JT 4CRBA 1UHBA 7GCHF 4D76A 2A2QH 3RXTA 5JDUB 5FBIA 3ZVGA 3Q3XA 3PLKA 1HIAA 1V2ST 4OS5A 3M35A 1P01A 4OS4A 2Y5GA 1PPBH 1GHAG 1O2ZA 2C3SA 2YNBA 1ACBE 3QN7A 4DIHH 1GBMA 1YPHC 2BY9X 1KXCA 1L1GA 3MH7A 1AE8H 1EAWA 2PR3A 2QF3A 3KQ5A 1QZ8A 1CBWB 4AOQA 1V2TT 1Y8TA 3Q77A 4X1SU 1NY22 3QZQA 1AIXH 1D3PB 4Y8ZA 2KCYA 1OWKA 5HIZA 1YYY1 1E37B 1HFDA 5EW2H 1WV7H 1O2TA 1O5CB 1G9IE 1XXDA 2BDBA 2BLOA 1GHXH 1LO6A 1GI4A 1ZPZA 2DUCA 3SU2A 1J17T 2VWLA 4Q2KA 4ASUD 5A0CA 2UUKB 3CS0A 1O2KA 2RA0A 3BEUA 5E8EH 1XXFA 1J15A 5TCAA 1VKYA 2BVSH 3MYWA 1Z8GA 1OWHA 4AFSA 2BVXH 3A85A 3HK3B 2C8ZB 2ZPQA 1FLEE 3RXHA 2R0LA 2FOHA 5ETXA 3NPSA 3LH3A 2WUCA 1GI5A 2XRCA 3PTBA 1S81A
chains in the Genus database with same CATH topology
1C1RA 2GGVB 3NWUA 1MMJN 1ANBA 2ZIQH 1A3BH 1QL7A 5G4BA 4INKA 3A7ZA 1C5WB 4FUFA 3BTFE 8GCHG 1VJAU 5T6DA 1GBAA 1C1PA 1CU1A 3FZZA 1AQ7A 3S0NA 3MU5A 3SN8A 2NU0E 1LQEA 5GDSH 1C5LH 3AW1A 8LPRA 4NCYA 3RMNH 3PMJA 5K0HA 1OX1A 4YOIA 3JZ1B 1EPTB 3T27A 1ZJKA 3UIRA 1WOFA 1E35B 1CA8B 2H9HA 1TGSZ 5E2PA 1SFIA 4X8TH 1EZXC 1Z7KA 4Y7BA 4NA8A 2FOAA 4ZKSU 4Y0YE 1B7XB 4CREA 2XC0A 2C90B 3LH1A 1K1JA 1PYTC 4DW2U 2VWOA 4OS6A 3RP2A 4ABGA 2ZHWH 2VGCB 3A82A 1BMNH 1FAXA 1S85A 1QGFA 3DFLA 4K8YA 1SR5C 2A7CA 2GTBA 2AIQA 2HGTH 1WAYB 1HCGA 2EI6A 1EKBB 2F9PA 3VB6A 3MO9A 1QQUA 2FI5E 2QCYA 2FI4E 2THFB 4D9RA 1P10A 1AD8H 2P95A 3TJOA 1DFPA 1C5ZB 2O9QA 1UK3A 1SGDE 1UVSH 3SGBE 1LHEH 1GJCB 3SU1A 5DP5A 3N7OA 3M7TA 4WMFA 2OXSA 3AASA 1GPZA 1YPGH 3L3TA 4R0IA 1IQLA 4ZHAA 2Q1JA 4X6MA 1ELEE 1EPTC 1KLIH 2BDAA 1Y3YA 3PMAB 1Q31A 2BD9A 1HXEH 4I8GA 1VCQA 1RS0A 5T3HA 1GJ7B 1FAKH 1AHTH 2BZAA 2J4IA 3TK5A 5LPEA 4D9QA 4B2CA 2O8TA 1NC6A 1KTTB 2HPQH 1AVWA 2ZFSA 2QA9E 4RSPA 2J34A 2PTCE 4FUBA 3QK1A 4SGBE 3RM0H 2F3CE 3RXIA 4NFFA 2FP7B 4J2YB 2VGCC 2NU3E 3SGAE 4BTTB 1P2IA 5EG4A 2BLWA 5BRRE 4HFPB 5DP8A 1EATA 3TIUA 1GMHG 3RXJA 3FP7E 3PMHB 3KHVA 4ABDA 3SBKA 4BAOB 3M5OA 2VVCA 2OTVA 2OD3B 1QL9A 1PQ8A 3ZVDA 2Y5HA 6CHAB 1EPTA 1GDNA 1RTLA 2R9PA 2GDEH 4KGAA 2ZHEH 3ZZCA 3GCHC 4ZHLU 2Z3EA 2FS9A 2O8MA 5HYOA 1DY9A 1DANH 1THRH 4H6TA 1O5BB 3CS7A 3TH2H 1GI3A 4Q7XA 5JBAS 3GCTG 1RFNA 3SU6A 4RN6A 2RDLA 1HJAB 3NKKA 3VGCB 1A4WH 1SGPE 2QXGA 4XBDA 4FUHA 2LPRA 1QJ7B 4HZHA 2A5IA 1MKWH 2BXUH 4YOJA 1LKAA 1QCPA 1O32A 1OYQA 4WWYA 2ZA5A 1S0RA 1L4DA 2ZZUH 1L1JA 2BZ6H 1BMAA 1LKBA 1THPB 1O38A 1FONA 1YPKH 3MNCA 1LQDB 1NRNH 1HAIH 4F49A 5FXLA 2BYAX 1PPGE 1THSH 1GI6A 2P94A 5L30H 1FIWA 1P09A 1O3HA 1ZGVA 4JYVH 4OS1A 2TPIZ 3PTNA 1EJMA 3SQHE 3GISB 1ZGIA 2M5TA 3KF2A 4X6OA 3A86A 6CHAC 4OS2A 3QTOH 1DSTA 2EI7A 1IOEA 1DUEA 2ZCKP 3RXOA 1TGCA 2W3KA 1TFXA 3GY5A 3P95A 1B0FA 5EGMA 2ZGJA 1G37A 1NPMA 1HJAC 1EZSC 3VGCC 1HAZB 1SOZA 1O3JA 3ZVEA 1V2PT 2SGQE 4DGJA 1K21H 1F0UA 4ZKOU 1FNIA 3QX5H 2AERH 2VVUA 1A0JA 1KXBA 1K2I1 2B8OH 4I7YH 1A5GH 2V35A 1T31A 4E7RG 7ESTE 3K65B 2Y82A 2XNIA 1OWEA 2H2ZA 2P3UB 1EJNA 1FN6A 1VGCC 4Y8YA 2Y81A 2A4OA 5CHAB 1XUHA 1JRSA 5CMXH 1UVPA 2H9TH 2VIOA 3LDXH 4D7GA 3A8CA 3V0XA 2W7UA 2ANKH 1QY6A 2H9EH 1EB2A 3ZVCA 3SJOA 2G5VA 1N6YA 2ZF0H 3LJJA 4AB9A 1DWEH 1D4PB 1NFUA 4ZH8A 1GJBB 3BF6H 2AMQA 3OX7U 3BTKE 1C1QA 4Y79A 1O5EH 1GHZA 1PPFE 1UTNA 3MMGA 1JIRA 1Z8RA 4JK6A 4NGAH 4X0WU 1TX8A 4MNYA 1N1LA 1AKSB 2OP9A 5C2ZA 1BTPA 1HGTH 4MPUA 3LGIA 1XKAC 2VH0A 1LVOA 3F9EA 4GVUA 5F8TA 2BQ6B 3HGNA 1EP5A 1FI8A 2G55A 4ZAEA 1HRTH 1C5QA 1SHYA 2JH5D 3EA9A 4JYUH 1GVKB 1ARBA 2XW9A 2BLVA 1ZLRA 4FUDA 4FUJA 1O35A 2ZDAH 5AFYH 3U9AH 5CHAC 1W10U 3K9XB 1IQGA 4H4FA 1SGNE 2FEQH 1QRWA 4K5ZA 3M3VA 4YZUA 3MH5A 2BY5X 3LIWA 1Y5BT 3PWCA 1CE5A 3A7XA 4XDEA 1HV7A 1NU9A 1SQOA 2BD3A 2PUXB 1MCTA 3I78A 2GCTB 1MQ5A 5L2ZH 2BTCE 3A87A 2RG3A 3OTJE 1HAVB 1SGQE 4CHAB 4ABFA 3E91A 2C8YB 1BOQA 2FTLE 2BDYA 5GWZA 3KCGH 3S9CA 2QXHA 3MO6A 3L33A 1O3OA 4MTBA 1TX6A 1MZDA 1ANCA 3ZZDA 6GCHG 1YPMH 1O3FA 1WTHD 2F9VA 4HGCA 4DCDA 5JPMH 2CGAA 2RCEA 2Y7XA 2AMPA 2FOBA 2KAIB 2ZTZA 3A7YA 1D9IA 4FVDA 2ZC9H 5FX6A 4E05H 2FLRH 3MFJA 1DXPA 3SHCH 1TNHA 1UTJA 1NESE 5C1UA 2PGQB 2P3FH 4K1EA 1LDTT 1SVPA 2ODQA 1ZPBA 1JXPA 3SHAH 2NU4E 4UDWH 1C1MA 1LHFH 2AYWA 3B23B 3FP6E 2WPJS 5DP9A 1P04A 1WQSA 3A8DA 1UCYE 2ZNKH 2ANWA 2OLGA 1O2WA 1A7SA 2GT7A 5SGAE 4I8JA 1AKSA 4IBLH 1O37A 2P16A 2SGDE 1O2RA 2W5EA 3RXUA 2G51A 4CHAC 3RXQA 4INLA 4NSVA 1RIWB 1P2JA 2HOBA 2O8UA 2XBVA 4A92A 1KSNA 5TJXA 2AGEX 1HB0B 3AAUA 4I33A 1NFYA 4X1PU 1H1BA 7GCHG 2STBE 1A2CH 3BTME 1ZYOA 1MTUA 1VCWA 4ASHA 1TOMH 5B6OA 1XUIA 2BY6X 2ZP0H 1BB0B 4D8NA 1S84A 1KLJH 3TGKE 1G3CA 1MU6B 1ELDE 2G4TA 3MOCA 1DE7H 3NZIA 1C1OA 1V2VT 3T2NA 2PSYA 2JETB 2ANYA 2XYAA 1HAVA 2O8WA 4RKJB 4MNXA 4FU7A 1GBHA 3OU0A 3DA9B 2GCHF 1A0HB 1BJUA 5E2OA 2OC1A 4X8SH 3SNDA 2ULLA 1WU1A 2AMDA 1E38B 2UUFB 4WH6A 2Z9JA 5L6NH 3WY8A 3G01A 3VB7A 7LPRA 1ZJDA 3PROA 3QGNB 4JYTA 2GMTB 1GMDF 3H7TA 3TLOA 5JB9S 1C1SA 1S5SA 2A5KA 2BX3A 5F8ZA 1TONA 3MHWU 1K22H 3BEFB 2EI8A 4I32A 4DT7B 2FWWA 4Y7AA 3E6PH 2FDAA 3KQBA 1KDQA 4CBOA 1WUNH 1GGDC 4UFFH 4NIWA 1HXFH 3STJA 3MNBA 1L2EA 2FX6A 2Z3DA 4CBNA 2GX4A 1KY9A 2A7HA 1A0LA 3SU4A 1QIXB 4GSOA 1P06A 4KTCA 1O3GA 2ZHFH 3ZVAA 3T29A 4KTUA 1W0YH 1WQVH 2JETC 2PTNA 3S7HB 5IYTA 1D6RA 1P03A 2ZG0H 4B2AA 4IN2A 4RKOB 1Y5AT 1GI1A 2GVFA 1U6QA 1MTVA 2BD5A 4TPIZ 3KNXA 2ESTE 3U1JB 3IG6B 1SSXA 4FVBA 4BNRA 3LGWA 3GYLB 1HAOH 3SNAA 1C2IA 1NFXA 1G2MA 2XCFA 2ZKSA 5H4IB 3I29A 4ISNA 3M7UA 3M5LA 5DG6A 2H1UA 3UREA 1UTMA 2A32A 3RUOA 3RXBA 3SJ9A 3KQEA 2CHAB 1EAIA 2HALA 4X1QU 4GAWA 2P8OB 3RXKA 3LGVA 1UCYH 2TIOA 3LU9B 2C4FH 4WXIA 1C2JA 3M3SA 5C67A 3B8JA 1OXGA 1TNKA 1BHXF 2UWLA 3ZZAA 4O9VA 3TH3H 5IDKA 1HJ9A 3RDZA 1C1NA 1T32A 1Y3VA 5FBEA 1G3BA 3VEQB 3O8RA 3OY6U 1C4V2 3ZYEA 1AFQB 3MU8A 3ZZ8A 5T6GA 3ODFA 1YLCA 4U30A 4NA7A 1TMUH 1C5MD 1O3AA 3KEEA 1JRTA 5TCCA 2OCVB 3NK8A 4IN1A 5EXNA 2BDIA 1C5PA 2TBSA 3QDZB 1NO9H 1ARCA 5EPNA 2B9LA 2OBOA 1K1MA 1MQ6A 2UUYA 2TGTA 4WF8A 1X7AC 1OSSA 1GBBA 1CT4E 4FUIA 4O3UA 3F68H 2BD2A 1YF4A 5JBBS 1UO6A 3E1XB 2A5AA 3SV2H 1C9TA 2CHAC 2SNVA 4AG1A 3JZ2B 4UFDH 2P8OC 1AY6H 2VJ1A 1GCDA 3B9FH 4GLYA 1C4U2 5C1XA 1TWXB 4NIVA 1CQQA 4B73A 4JZIA 1O5AB 3SJIA 1AUJA 1LPZB 3RC4A 1G2LA 1Y5UT 3A88A 1G30B 3PLBA 1YPJH 1DWDH 1AI8H 1KLTA 1AFQC 2D26C 4INHA 1RD3B 2J2UA 3TK9A 3BG8A 1CBWC 3DHKH 1CT2E 3KL6A 1W13U 1T7CA 1ZR0A 3RXPA 1EOLA 2BDCA 1Q3XA 4AGJA 2ZDVH 2ODYB 1QTFA 1GBJA 2Y5FA 1TA6A 1MH0A 4KKDA 1HAYB 3E0PB 1BRBE 4MPXA 1VZQH 3F9FA 2OC8A 2I6SA 1TGTA 2Z7FE 2ZFTA 1C4Y2 1ZMNA 1ANDA 2AGGX 1GI9B 1UTOA 3F9HA 3RLYH 1P2OA 2QAAA 4TY7A 2PWXA 2ZQ1A 2XBWA 2C8WB 2Z9LA 3UWIA 2HWLB 1CHOF 1D3QB 1IHSH 1G3DA 5FPYA 2OBQA 3SW2B 3GY4A 4X2VA 3TH4H 1XM1A 3OYPA 1NFWA 4AFUA 3BG4B 2CF8H 1W14U 1NM6A 1ZHMA 3SV6A 1EQ9A 1P2NA 1OS8A 1UTQA 2P93A 4GHTA 4MQAA 1O3LA 1ZMJA 5E0JA 1EP6A 2BOHB 3MU0A 1O2PA 3QLPH 1GVZA 2CMYA 2VINA 1O3IA 1GJ8B 1LVYA 4F4OC 2GV7A 2ZECA 4ZXXH 2V6NA 3P8FA 2TRMA 4O3TA 1QRXA 4Q7ZA 1TB6H 4AX9H 1IQFA 1C5TA 4ABJA 1MUEB 1C5OH 4BAMB 3V12A 1S82A 3T26A 3SQEE 5J4QA 4ISIH 5GXPA 1BQYA 1DY8A 1UTKA 1YCPH 1HPGA 4X2XA 2VH6A 1O33A 3EE0B 3S7KB 4YT7H 2PW8H 1Z71A 4TY6A 4MLFB 1GHVH 3PO1B 1QB9A 1ZSLA 3GY3A 1B0EA 1FDPA 2OINA 4U32A 3SU3A 5FHTA 3SNBA 1FJSA 3ZVBA 1QR3E 2ZDLA 3RXVA 1WTGH 1SLXB 3SV7A 1LHGH 2BOKA 5DJ7A 1F5RA 1C5YB 1FPCH 2FOMB 2G4UA 3BG4C 3SUDA 3S9AA 2CV3A 1BITA 4E06H 1GBCA 3BTTE 3EGKH 1SOTA 3UQVA 3TVJB 4ZKRU 1QA0A 4XE4A 3RXGA 1O3PB 1TGNA 4X6PA 2F83A 3C27B 1ETRH 1YGCH 1K1IA 2HNTE 1O34A 3O8CA 1MD8A 5BPEA 1ELVA 3UY9A 1Z1JA 1P11E 1G36A 3A8BA 1FY8E 1A5IA 1CSOE 3RC6A 5HM9A 2Y7ZA 4JZDH 3LKWA 2H6MA 1PJPA 1O3NA 2HPPH 4WJG2 2FESH 2WV4A 4MNWA 3T5FH 1P2QA 2PSXA 3PO1C 5GIBA 4XSKU 4YT6H 4ISLA 4UFEH 2ZTYA 3QGJA 3K6YA 4MNVA 1ZSKA 4VGCB 2BD4A 1OKXA 3RM2H 1ELFA 4BAHB 1GCTB 1VCPA 1O30A 2GT8A 2AFQB 3F9GA 3ZZ3A 1V2NT 3Q3YA 3BTHE 1BRUP 1BDAA 5JBTA 3BTDE 1RTKA 1KXFA 1ZTJA 1OPHB 1YPLH 2YNAA 3U69H 1FUJA 4WVPE 1T8MA 4FU8A 3I77A 1ORFA 1BBRE 5AVDA 4TWYA 2O8LA 3LGTA 4WXVA 2XTTB 1AWHB 3UR9A 2WV5A 1GI0A 4BANB 1E36B 5DP7A 1TX7A 1BTHH 5GPIB 3MH4A 2AS9A 1FY5A 1C2GA 2ZGBH 1V2UT 3SV8A 1CHGA 4Y6DA 1GJ4H 1TPAE 1O2MA 1AVXA 3SI4H 4UEHH 1BJVA 1C2KA 5LPFA 1UK4A 4B2BA 1T4VH 4A1TA 3RXMA 5K7RA 3QWCH 1W7XH 3SI3H 1AUTC 2GZ9A 1T8OA 2C93B 4VGCC 2H5CA 1PQAA 3UPEA 1MKXH 5EQQA 2GP9B 1NRPH 2ALVA 2ILNA 1IQEA 1HBTH 3RC5A 1BTWA 1QHRB 1C2MA 1XKBC 3P6ZB 1CVWH 1NRQH 3Q3KA 4B1TA 1TMTH 4DY7B 1Q2WA 1E0FD 2Z9KA 3RMLH 1TNJA 1XUKA 1AMHA 1DT2A 1MAYA 1HDTH 1NRSH 1OP2A 5A2MH 3M7QA 2NU2E 5AFZH 1SLUB 1M9UA 1ELBA 5ESTE 5FPTA 1MZAA 2QC2A 2ZTXA 4CRAA 2EEKA 1SHHB 1XVMA 4UD9H 3E8LA 2EA3A 3IITA 1ZMLA 6ESTA 2NWNA 1GMCF 1O5DH 1C9PA 4H42U 1V3XA 1Z6EA 1C2HA 3SU0A 2Z9IA 1ELAA 1RJXB 2Z94A 4GHQA 5JBCS 4AYYB 1QFKH 4YLQH 1TPPA 2ZFFH 1FXYA 4OGYA 2ZDNA 4IMQA 1O2HA 4BAKB 2QF0A 1V6DA 2OC0A 3TNTA 5DK1A 1DDJA 2FPZA 2GCHG 4TWWA 3M5MA 1F0SA 2BM2A 1O36A 1SL3A