2BYAX

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
molecule tags Hydrolase
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2byaX01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2byaX02
2XYAA 3RXIA 3U8TH 3SV6A 2P93A 4CRCA 1P57B 3F9EA 2A1DB 3KL6A 1GL1A 1VITF 1FIZA 1VITH 1Z6EA 2BY9X 1UHBA 2Y5GA 1GBAA 2ZDNA 4CRDA 1A0HB 4ABGA 4SGBE 4KTCA 2CGAA 1AVXA 3W95A 1ZHMA 2GV7A 3NKKA 3P8FA 4KTUA 4TYDA 1P02A 3DT0H 5C1XA 3A8BA 3G01A 3N7OA 2BQ7B 1RXPA 1V2UT 2ZU4A 1ZPZA 5L6NH 2F83A 1GJ5H 2UUYA 2OP9A 1O2TA 1AGJA 1FIWA 1UTJA 1BRBE 1DWBH 1C5MD 3T62A 4ZKRU 1BRCE 1ARBA 4MNWA 4INHA 1TYNA 1FI8A 1LHCH 7GCHG 2AS9A 4ZXYH 3F9FA 1NRQH 1GBIA 3FZDA 3KHVA 1BMMH 3A84A 4FUEA 4H4FA 4H42U 2Y5FA 2ZFSA 1Y59T 1T8LA 1XXFA 1O2LA 1C5SA 1Y5BT 1VGCB 1W0ZU 2GDDA 1GVKB 1O5BB 4I8HA 2BM2A 2GZ9A 2P3UB 3RXKA 1C2IA 1WUNH 3KIDU 2ZDMA 5ETXA 2VB0A 4XBDA 1ZOMA 1L1JA 3RXVA 2ZU2A 1CU1A 3LJJA 1B0EA 3RXQA 3VXEH 3FAOA 3SU1A 2QN5T 1HAVB 4F4OC 5CMXH 2LNCA 1AZ8A 3E1XB 1NM6A 1O39A 3E8LA 1RGQA 1XUJA 1Y5UT 3IWMA 1ELBA 4OS2A 1BMLA 1EAWA 2Q1JA 1CBWB 1LPGB 2PKAB 4I32A 2P3TB 2BQ6B 1EXFA 2V3HH 3SNAA 1ZHPA 3TGKE 2AERH 3BTME 3V12A 1NFXA 1A7SA 1PQ5A 1G3DA 2FX4A 3RXRA 3VFEA 4NA8A 1JIMA 2H9TH 3LH1A 2VU8E 1ZMLA 2FI4E 1O0DH 1TQ7B 4GSOA 2PUQH 2BD8A 3QO6A 1X7AC 3A7VA 3A85A 1GBFA 1TBRH 5CHAC 1YM0A 3FANA 4HFPB 5GIBA 1O2IA 3RM0H 3TK9A 4UD9H 2OQUA 3MNCA 1B7XB 2BYAX 1PPFE 4OS1A 1NU9A 4MNYA 2BQWB 2AMQA 1MTVA 2FXRA 1MKWK 1QB1A 4DJZB 2BD5A 1K22H 5FCRA 4Y79A 3LOXA 3ZYDA 2LPRA 4FXGH 1MU8B 1QRZA 1C1QA 3DD2H 4AGJA 1V6DA 3K2UA 3LPRA 2O9QA 1UVTH 3BEUA 1UTMA 1T7CA 3F9GA 4CRAA 2JETC 1W7XH 2OC0A 1IAUA 1TPPA 2F9UA 3GY8A 2P8OB 3TJUA 5JDUB 1INCA 3SHCH 3SU3A 3ESTA 1A5HA 3M3VA 1B5GH 2XBVA 1TRMA 1CQQA 2GMTC 4TPIZ 3RM2H 5C2ZA 2GP9B 2CHAC 3GYMA 1DICA 2AGIX 3L33A 3QGJA 2ZKSA 3SV7A 2PKSC 1GI3A 2C8YB 2G52A 4X6NA 1DOJA 1QJ7B 1MU6B 1GDUA 3OY5U 1MD8A 4MPXA 4ABFA 1SLVB 3PMAB 3RC6A 1FLEE 1KXDA 3RU4E 5T6DA 5LH8A 2JETB 2V35A 1C4V2 4WH6A 1C1OA 3ZZ7A 4FU9A 1OWDA 4NSYA 3MO9A 1DANH 2PSYA 1GHZA 2RG3A 1AY6H 3ZZ3A 3NK8A 2BZAA 4MDSA 4BAMB 4F49A 2XNIA 3BG4B 4A6LA 1WBGB 5DKMA 4Y7BA 5J4SA 4VGCC 1OPHB 4H6SB 4A7IB 1O2SA 1SFQB 5EODA 4K1EA 1QURH 3RXMA 4LK4A 1DWDH 2ZTZA 1GBCA 1SHHB 2QA9E 1TPSA 3PWCA 1FV9A 5ABWA 2VIDA 3CS0A 1O2ZA 1WCZA 4NA7A 4Y71A 1C2LA 3W94A 1EUFA 1MQ6A 3KQEA 2QYIA 9ESTA 1GMHF 4ASHA 2F9VA 1OS8A 1P03A 1HAGE 1H1BA 2CF8H 2BZ6H 1PFXC 1O3EA 5E0HA 3DFLA 1A5IA 2JH5D 5HM9A 5LPRA 1MAYA 3AAVA 1O3AA 1F5KU 2O8LA 1IHSH 2A5AA 1DE7H 3GCHC 1A61H 3ATMA 1DUAA 2XCNA 1V2MT 1AO5A 2AMDA 1BTPA 2Z3EA 3BF6H 5I46H 2CXVA 2QGRA 3LC5A 2CHAB 6LPRA 1S0RA 4ZKOU 5A0BA 5A8YA 5HGGA 4Y10E 4JZFH 3D62A 1RJXB 1YCPH 3AW0A 4UFFH 2SNWA 2BX3A 5DP4A 4FUGA 1NRSH 1CGIE 5C67A 3RMOH 1C9TA 3T25A 1K21H 1OYTH 4K2YA 1O3PB 2VWMA 2OUAA 1C1NA 3E0NB 2ZNKH 4X0WU 1SGFA 2FIRH 1RFNA 1AWFH 4TWWA 1E38B 1UVUH 2QXHA 2PFEA 1GHXH 2FWWA 1OWHA 2H1UA 2FOAA 1UCYH 3GY3A 2ZI2H 1AUTC 2XTTB 2GCHF 1WYKA 2VWLA 4ZMAH 2BDGA 4ISNA 2H9HA 3SU4A 2AH4X 1DT2A 3ZVGA 1PPCE 3U1IB 1QL9A 3BIVH 1HAOH 4U32A 3RXSA 2O8WA 2PV9B 4MTBA 1CA8B 2Y82A 1OXGA 1O3NA 1J14A 1QL8A 1V2ST 2Z3CA 1BIOA 1T32A 1HJ9A 2V6NA 1K28D 1CA0B 4KELA 3ZVBA 3ENSB 4YT6H 1BBRK 1QTFA 3OTJE 4YO9A 2Y7XA 4Z6AH 1O3OA 1C5TA 1AFEH 1BMAA 3AW1A 4BAOB 2Z3DA 4CR9A 2A7CA 2FOBA 4DT7B 1TRNA 2C3SA 1WAYB 9LPRA 1P3CA 1UJ1A 1EQ9A 3QTVH 2O8TA 1GPZA 1RD3B 2GT7A 3A7YA 1PQ8A 1BMNH 3M5OA 1C2MA 1TOMH 2P3FH 2STAE 4Y0YE 1MH0A 1TGTA 1YPHC 4ZHAA 3E90B 3Q3YA 1DPOA 2FOMB 3NPSA 5FPTA 4ABBA 1AB9C 1F5LA 2FODA 1XKBC 2HLCA 1RRKA 4NCYA 1TX7A 4YOGA 3E6PH 1TPAE 2AFQB 3S0NA 1NC6A 3A7XA 2ZCKP 5GXPA 3C27B 1O3BA 4WXVA 5JPMH 1O5EH 4BANB 2ZWLH 2ZDKA 2ZU1A 4KGAA 4NIVA 1ZSLA 3IITA 1HJAC 4HTCH 3T28A 4U2WA 2IJOB 3QK1A 4MG3A 2WPMS 2Z6BD 1BCUH 1KXFA 2VJ1A 1DY8A 2JKHA 1EKBB 1HV7A 1GJ6A 1UO6A 4IS5A 1NESE 4IN2A 2BDIA 2G5NA 3P70B 1VCQA 1MBMA 3S7HB 4ABEA 3FFGA 1GI7B 1SHYA 3ZVFA 4NZQA 1O2NA 2VIOA 3GCHB 2HPPH 1NFYA 5DP7A 1MZAA 2WYJA 1LCYA 4NG9H 3T5FH 4KKDA 2VIWA 2A32A 4MNVA 1BDAA 1G3BA 1QA7A 2UWLA 1EOJA 1XMNB 1O33A 2WV4A 3VGCC 2FEQH 5IYTA 2BY7X 1LHEH 2WPKS 4NIXA 2C4FH 2B0FA 3EDXB 1BT7A 5E8EH 1H4WA 1O2VA 2OC1A 1ANDA 4Y7AA 1IQLA 3KN2A 5E0JA 3ZZ9A 1TNKA 1EZUC 2GDEH 1EX3A 3I77A 1GJ9B 4CH8B 4INLA 1NPMA 3BTEE 1V2WT 4AYVB 5BRRE 2SGFE 1SGDE 1C5XB 1LVMA 1TGBA 1WV7H 3M37A 4IGDA 3M35A 1OWJA 1QRXA 1CA0C 1O2HA 3IG6B 1ID5H 2QY0B 3GY4A 1QGFA 2D26C 4ZUHA 1EPTA 4YESB 1LMWB 1D6WA 2BY5X 2GV6A 5DP8A 2PR3A 1DFPA 2VIPA 3TK6A 1C1RA 3I29A 1A0LA 2QF3A 2Z9GA 3PWBA 1KXBA 3EA9A 4WVPE 3ZVEA 1ZJDA 4TY7A 3MH7A 2WPHS 4FUHA 2AYWA 2I6SA 1TNLA 1GJAB 1JBUH 1JRTA 3M61U 4BNRA 1ZMNA 1HAIH 1IQGA 3K9XB 2A4RA 3URCA 1T31A 1Y5AT 1SB1H 4D9RA 1N8OC 1E0FD 1SGFG 3GCOA 1Y3UA 3SUEA 3LGTA 4MNXA 1LQDB 2G81E 4NSVA 3BTDE 4E7NA 3LJOA 5EQSA 2BDCA 1DSUA 1CSOE 2K1QA 3VB3A 4DOQA 5C1UA 5ESBA 1DITH 1PPBH 2G5VA 4JYTA 1NT1A 2PSXA 3PB1E 3PTBA 2VIQA 1ZSJA 1EB2A 1CHOF 3ZV8A 1TMTH 2UUFB 1XM1A 2NU1E 1DDJA 2FOFA 3UUZA 1P11E 1CHGA 2CJIA 1NRRH 1AVWA 2RCEA 2ZFPH 4DG4A 2ZGBH 1HLTH 1P12E 1IQNA 3UR6A 3M7TA 4DVAU 1XUKA 1L4ZA 2BXTH 5EG4A 2Z7FE 6CHAC 1ESBA 1FXYA 2PKSB 3ITIA 3KQDA 2O8MA 1ELCA 1ORFA 1KLIH 3UNQA 5JBCS 2C8ZB 1ZRBA 2BTCE 1O38A 3JZ2B 1GI4A 2D8WA 1SG8B 1LHDH 2UUJB 1HNEE 4J2YB 1BUIA 1XUHA 3RXBA 1VGCC 1HPGA 3H5CB 1GHBG 5A0CA 1IQKA 2ZHEH 1A3BH 1C2DA 1S85A 2HGTH 2P16A 3F6UH 1AU8A 1O2PA 2BDHA 3TJOA 3TLOA 1KXCA 2BD2A 1GWAA 1TB6H 1A1RA 2PKAA 4VGCB 1C4U2 1K1PA 3MFJA 2R3UA 3MU1A 2P59A 3ZZ4A 2QXGA 3SU2A 1L1NA 1C2HA 1Z8JB 4BXWA 2AIPA 4AZ2B 4BAHB 1V2KT 1P10A 4OGYA 2QF0A 1ZTJA 3K65B 2A7JA 2J4IA 3ZYEA 2OBQA 1YPGH 1HAYB 1J16A 1O2MA 1GL0E 3TNTA 4X1SU 1O36A 1HAHH 5H4IB 5GDSH 2Z9LA 5F03A 1H9LB 5B6OA 1C9PA 4CR5A 1FPHH 3GCTF 1ELAA 2HVXA 2W7SA 3FZZA 3V7TA 1XUGA 4FUBA 2H9EH 2GGVB 1GMHG 1P2OA 2A7HA 1SQOA 1MTNC 1GBLA 1THRH 1O2XA 2HNTF 4CHAB 1GGDC 1E36B 3CENA 1HXEH 1Z8GA 1MCVA 2F9NA 2WPIS 1JWTA 1SLWB 1CT0E 1OP0A 4AG1A 1YF4A 1ACBE 1PJPA 2ZC9H 5EXNA 1P9UA 2B5TB 1C5LH 1S84A 1P2IA 1P09A 4I8GA 3LT3A 1GJ7B 1KY9A 3SQHE 5IDKA 4ZHLU 1CVWH 3PROA 4NIWA 1AI8H 1KLJH 1KXAA 1TPOA 4I31A 2J92A 2SGQE 3T26A 3UR9A 5K0HA 2W26A 3M3SA 1C1WH 3C1KA 3SGQE 1TIOA 2ZQ2A 5A2MH 2I6QA 1YYY1 1S6FA 2STBE 3PO1C 1ETTH 1HAXB 1RIWB 1XUIA 5E2PA 1ESAA 1GBMA 1EPTC 2FPZA 3UFAA 4X6PA 3RXDA 1AZZA 2Z9JA 4MVNA 1SGTA 3RXEA 1YPLH 3L6PA 1WOFA 1Q3XA 1ZTKA 4CBOA 2GCTB 3EA7A 3LGWA 1QFKH 3U69H 4E05H 3B8JA 1GJ8B 1CT2E 1Q31A 5JB8S 1CBWC 3ATKA 1YPHE 2QC2A 2BMGB 4K8YA 1GCTC 1THPB 3UTUH 2SGEE 4FUCA 2BLQA 1AB9B 5T6GA 3A83A 4A1XA 1XVOA 4DIIH 2A0QB 3SJKA 4MLFB 2ZCHP 3A87A 2BX4A 8GCHG 5DO4H 1O2KA 1TBQH 2A5KA 1IQFA 1YPMH 2EC9H 3DA9B 1AKSA 3V13A 3BTHE 2F3CE 3P8GA 3QLPH 2FX6A 1L2EA 5E2OA 1NFWA 1BTUA 1Y8TA 8LPRA 2XRCA 1MTNB 3FP7E 2J9NA 4MQAA 2W7UA 1K1LA 2OC8A 3M7UA 1O2JA 4X8TH 2A2XH 2ANYA 8GCHF 2ODYB 2HNTC 1SFIA 4FUJA 5FAHA 2XWBI 3BV9B 1O32A 2Y6TA 1BTWA 1AQ7A 3ZZ5A 1FY3A 2R3YA 1FN6A 3F9HA 1FMGA 4AX9H 1UTKA 2W3IA 1QBNA 2XWAA 3E3TA 2FYRA 1K2I1 1NS3A 2ZG0H 4THNH 2FP7B 3K6ZA 1RTLA 1V2LT 2R2WU 3P6ZB 1ZR0A 5L2YH 1PPHE 3HK6B 1Z8IB 3M5MA 2ASUB 1O5GH 2ZFFH 2ZHDA 2CMYA 2FS8A 2F9BH 1C1VH 1ZGVA 1SQAA 4JZ1A 3RXOA 4B76A 2AEIH 1C5RA 5GJ4B 1KIGH 4K8BA 4B2BA 1C2FA 1O34A 1CHOG 1L0ZA 1IQMA 3KQCA 8KME2 3ZVCA 3OY6U 4AFQA 4AOQA 4Y76A 3KNXA 4B2AA 2BD4A 1GMDG 1QNJA 1O5CB 2WV5A 2RA3A 3NXPA 4RKOB 2ZPRA 2WUBA 1GBHA 1O5FH 2JH0D 2OC7A 2BB4A 3LGVA 2C90B 2OTVA 1GI8B 4Y8ZA 1AE5A 1ETSH 1P01A 1V2QT 1ESTA 1ZLRA 3LONA 1OOKB 2OLGA 3DHKH 1SOZA 2ZDAH 5EQQA 2VVCA 3NZIA 3RXPA 5EOKA 1QL7A 1IOEA 1CE5A 3AASA 1FAKH 2HPQH 1IQEA 3H7OA 3SV2H 3LKWA 1T8MA 2FOEA 2V3OH 1Y3VA 2WUCA 3SJOA 3B23B 5DP5A 1PYTD 3SUDA 1HJAB 1EJNA 3BG4C 1EAUA 3UOPA 1V3XA 3UIRA 1OSSA 4ABAA 1BJUA 3S9CA 2BLWA 1O2RA 3TGJE 4BOHA 1SL3A 4FU8A 4WJG2 1J9CH 4R8TB 4WMEA 1ZPBA 4XE4A 8ESTE 1TA2A 3ZZDA 4FU7A 4D7FA 4WXIA 4DGJA 1C5ZB 5E0GA 3FP8E 1GMDF 2EEKA 3MNSA 4ZAEA 4B2CA 3SV9A 1ANCA 2PUXB 3BSQA 3ODDA 1S0QA 4O97A 2D1JA 4K3JA 1UTPA 2GT8A 2GTBA 1FN8A 4IC5A 1YC0A 1MBQA 1T8NA 1O3FA 2R0KA 1K1OA 3GCNA 2EI8A 3Q76A 1IQJA 4DW2U 1HDTH 3GYLB 2VWNA 3BTKE 4WMFA 1JOUB 5F8XA 1SGYE 5JYIA 1UVSH 1TGSZ 3U8OH 2ZFQH 1GJCB 1FY5A 2CF9H 1WSSH 3PM3A 1GBTA 1GGDB 1LVOA 1BHXB 2ODPA 3A86A 2FTMA 3MTYA 1SGRE 1UVPA 4X6MA 2FMJA 3F68H 1ETRH 3D65E 1QB6A 1SR5C 1DM4B 3QWCH 7GCHF 1C5UA 1HFDA 5A0AE 3MMGA 1VJAU 1CGJE 3EA8A 5FHTA 3U1JB 4YZUA 1O3JA 1THSH 2FOHA 1SLUB 5DPAA 2PW8H 3QTOH 1C1TA 1TNJA 1TWXB 3FVFB 1JIRA 2EA3A 2OBOA 3A8CA 2PGBB 3VPKA 2XC4A 2AMPA 2QV1A 3VXFH 4GCHG 1M9UA 4IN1A 1ZRKA 4XSKU 4INKA 5A8ZA 1F92A 1N1LA 2NU0E 3GDVA 4AN7A 1N6YA 3ZV9A 5EXLA 1TMBH 4Q7XA 4HZHA 5FBIA 1DVAH 1O3CA 3MI4A 1C2GA 3E91A 1TGNA 3Q77A 4IMZA 2FDAA 1OYQA 1OWEA 2BVRH 1ZMJA 1MTWA 2BXUH 1MQ5A 2FYQA 2GMTB 2ZECA 3RXCA 4UFEH 2ZTYA 1TAWA 2BD9A 2G4UA 4I8JA 1P05A 2JH6D 3KF2A 3SHAH 1OP8A 3A88A 3RXJA 1GHBF 1VCWA 3CP7A 1EAIA 3S7KB 1W2KH 4M7GA 3HKJB 1D3PB 4E7RG 1DWCH 3CS7A 1UK4A 2A2QH 2VNTA 3EAJA 4UDWH 1TONA 1CGHA 4JK6A 1TABE 2Q6FA 4J1YA 3GY2A 5C5NA 4AFSA 1KTSB 3A7ZA 2Y81A 1ZSKA 2GCHG 1E34B 1J8AA 5AVDA 1MUEB 1BJVA 1K1MA 3MH4A 1P9SA 2ODQA 2PTCE 2VH0A 1FQ3A 5TJXA 1ELGA 2ZFTA 3UNRA 4CH2B 5JB9S 2NWNA 1F0TA 3LDXH 1V2VT 2OINA 1YPJH 2Z9IA 4CREA 3UWIA 4D76A 2QCYA 3QN7A 2ZGCA 3GCTG 4XOJA 4FVDA 1QQ4A 1ZYOA 3Q3XA 4GVUA 4CRBA 5HMAA 1PPEE 2BLOA 2HRVA 1YCPM 3BTFE 3LU9B 4JMYA 5EPYA 1NFUA 1VR1H 3GDSA 1YKTA 3SGBE 3UNSA 4B74A 1F2SE 3ZZBA 1V2RT 3RXUA 5K7RA 5JBAS 4KP0A 1ABIH 1GJBB 3M5NA 5DK1A 3KCGH 1HIAA 3BTGE 2XW9A 3T27A 3RP2A 4X2XA 4IW4E 2ZGJA 1OKXA 3M3TA 3TGIE 1UTLM 1E35B 1NN6A 3MU0A 1UK2A 5LPFA 2H6MA 1BBRE 5HM2A 5C3NA 4CHAC 1WU1A 2P94A 2TRMA 1TX8A 1W7GH 4H6TA 3M7QA 3O8BA 4YLQH 2IPHA 2ZCLP 1D6RA 1PYTC 3GDUA 4BTUB 3ZZCA 4NFEA 7KMEH 1HBTH 3HGNA 1XXDA 2ZU3A 4K60A 2VWOA 4CRFA 3QDZB 1F0RA 1GJ4H 2HOBA 3ZVDA 1SGPE 2BVSH 1QCPA 1DY9A 3T29A 1C5PA 5FCKA 1TQ0B 1G37A 1O30A 1ZJKA 2B8OH 2SGDE 1E37B 1DLEA 5AFZH 1AMHA 2W3KA 4AB8A 1SBWA 2BDBA 1C5YB 3VEQB 1P06A 2CN0H 1YPKH 4FUDA 1BTZA 4AFZA 1ZHRA 1EOLA 2NU2E 2ANMH 3P8NA 3UPEA 1GI6A 4KTSA 1T4VH 1GHVH 1EJMA 4LOYH 4AORA 5J4QA 1DUEA 3SO3A 3P92A 2J95A 4ABJA 5AF9H 1LKAA 2VINA 4D9QA 1DXPA 4YOIA 1F0SA 1SGEE 2RDLA 4Q7YA 4TWYA 7ESTE 1P8VC 1EZQA 1MKXK 2Y7ZA 1Z8RA 1S81A 2FZZA 1C5OH 2ZDLA 1FDPA 4X8UH 4ZXXH 4YOJA 1BTHH 2XXLA 1J15A 3DFJA 2WPLS 4WMDA 5JBTA 5TCAA 5C20A 5F8TA 4A5TS 2FS9A 1W13U 1GJDB 1G3EA 2F9OA 3SUFA 4PROA 3DUXH 1BRAA 3P95A 1QQUA 3OX7U 1QB9A 4LZ4B 5L2ZH 1W12U 2FO9A 1SI5H 1MKWH 1HJ8A 4GPGA 3MU8A 4GHTA 1Z1IA 1XUFA 3RU4T 1ZGIA 3KQBA 1LPZB 4R0IA 1GHAG 3GOVB 1HRTH 2QIQA 4Y8XA 5A8XA 1C5QA 1O2QA 1PQAA 5LPEA 3GY5A 1OWIA 3RUOA 1RTKA 1EASA 1UHBB 1V2PT 1P3EA 1CT4E 3ATIA 2GKVE 3F1SB 5BPEA 5C1YA 6GCHG 2ZTXA 3KEEA 4UFDH 1NZQH 1O5AB 1W14U 1YCPK 4TY6A 2AIQA 4D7GA 1GBBA 2HALA 1N8OB 1HAZB 1GBDA 1U6QA 1SQTA 3NWUA 4AGKA 3SJIA 3SORA 1P04A 2PWXA 5SGAE 1YLDA 3EQ0H 3SW2B 3T2NA 1XVMA 1QJ6B 5A09A 4JZEH 3SI3H 1KLTA 2YOLA 4HI3A 4RN6A 1DX5M 1O3LA 1HYLA 1O35A 2PGQB 3P17H 1O37A 1KYNA 4O3UA 1Z6JH 2SGAA 4Q7ZA 1FY1A 1GG6B 3Q00A 2TGPZ 1QBOA 3KGPA 1WQSA 5AHGH 3MYWA 2WPJS 2F9PA 1G2MA 4QT8C 4ZHMU 1KTTB 3RLYH 1L1GA 2TBSA 3ZZ8A 3SOSA 4SGAE 3PMJA 5GCHG 2C8XB 5I25A 1JRSA 2GZ7A 1NRPH 2P8OC 4XDEA 2ZGXH 1GMCG 1TMUH 5L30H 3TNSA 1Y3WA 3MU4A 3TITA 1A2CH 4WH8A 3BEFB 1A4WH 1V2OT 2PHBA 3LC3A 4O9VA 2BHGA 4ISIH 1C1SA 2TGAA 2XBXA 2BVXH 4ISHH 2VVUA 1F0UA 5DP3A 4FVBA 4GLYA 1J17T 5CHAB 4YTAA 5ESTE 4K69A 1GG6C 3SU5A 2GD4B 1LVYA 1H9IE 1UK3A 3S69A 5C5OA 1GHYH 2GX4A 1QY6A 1GCDA 2FTLE 3A7TA 3STIA 1NRNH 1HAPH 1EZXC 1DS2E 1UVOA 4OS7A 4JCNA 4AB9A 1BBRH 3MO6A 4YT7H 1LHGH 3URDA 2VGCB 2DUCA 1O3MA 4DIHH 2G51A 4NWKA 4B71A 2C93B 4XBCA 3RC5A 1QJ1B 3LIWA 3MWIU 4GHQA 1SOTA 4FUFA 5GPIB 5AFYH 4U30A 1BRUP 3MOCA 1HGTH 4JZDH 4BXSA 2R9PA 2ZEBA 4JYUH 1N6XA 1QIXB 4X1PU 1S83A 5DG6A 5FXLA 3RC4A 3SNDA 1TLDA 3PMHB 1NU7B 2YNAA 3V0XA 2ZU5A 2FOCA 3TH4H 1HUTH 4Q2KA 4ISLA 2OQ5A 4I8KA 1G2LA 2TPIZ 2ESTE 1Z71A 2IOTA 3QUMP 2A4QA 3A81A 1NY22 3RXHA 1ZPCA 3BTTE 1SVPA 2ZA5A 4Q80A 1UCYE 2SGPE 1Z7KA 1AD8H 1P2MA 3SGAE 2EI6A 4XFQA 1DXWA 1C2EA 2ZGHA 1UTNA 1O3GA 4X8VH 2J38A 2ULLA 4B75A 2ZPQA 1W8BH 1EJAA 3TJVA 3HPTB 2OD3B 4NIYA 1A0JA 1YLCA 3D23A 1WTHD 2H5CA 1V2TT 1KSNA 1Z1JA 4I8LA 3LGUA 2Q6GA 4WWYA 1RIWC 1UTOA 1QRWA 2ZP0H 1SGIB 1GBKA 2TGTA 3WY8A 1GBJA 1DLKB 2Y80A 2PTNA 4UFGH 7LPRA 3GY6A 5TCCA 1SGQE 3OU0A 2FM2A 4ISOA 4ZROA 4ABIA 1G32B 1G36A 2OCVB 4FUIA 3SJ9A 1AUJA 3EYDA 4I33A 1MTSA 4NGAH 2BDYA 1G3CA 2ZPSA 1AHTH 1TALA 4K1SA 1BHXF 2J94A 1MD7A 3UQVA 2A5IA 1HXFH 1W3CA 4OS4A 2FI3E 3TIUA 2QXIA 1V2JT 3NCLA 3I78A 4DURA 5T3HA 1FJSA 1LTOA 1GDNA 4MPVA 4CBNA 2THFB 3RXGA 2IN2A 3SN8A 2ZQ1A 4A1TA 1LO6A 1DWEH 5HYOA 2P95A 4YLUA 5DP9A 4AYYB 3H7TA 2J2UA 4DCDA 1VZQH 2Q6DA 2WINI 1EB1H 2ZHFH 1W0YH 2GVFA 3V3MA 3QZRA 1TRYA 1KDQA 2SFAA 3PLBA 2CV3A 2FESH 1O3HA 4X6OA 2EI7A 1WTGH 2QAAA 2BDAA 1OX1A 3QX5H 1PQ7A 1TNGA 3RXFA 3SU0A 4OGXA 1O2YA 2H2ZA 1GCTB 1O3KA 3A7WA 1Y3XA 1ELTA 2BY6X 4A92A 1O2UA 2G00A 3E0PB 5EU8A 3SNBA 1YBWA 5FPSA 1EP5A 4O03A 4GAWA 1C5WB 3VB4A 1TE0A 2DE8A 1S5SA 2V0BA 1W11U 4GUXA 2UUKB 3UWJH 2ZHWH 1FONA 2G4TA 4JK5A 3PYHA 3S9BA 1EPTB 1HB0B 2ZF0H 1ABJH 1O2WA 1D3QB 4LXBH 1L4DA 1TOCB 2WYGA 4OS5A 1GVLA 3SJ8A 1C4Y2 2G8TA 1SSXA 1RTFB 4IC6A 3TPIZ 1GHAF 4Y11E 4NWLA 1C1UH 1FPCH 3HK3B 2PLXA 2ZO3H 1GI1A 3Q3KA 1FAXA 2QXJA 1AVGH 2FI5E 4TPYA 2B7DH 1EATA 1FY8E 4NA9H 5FX5A 1BZXE 1P2NA 3PLKA 3UOUA 1GBEA 1G30B 1W10U 2VIVA 1WQVH 2R2MB 1P2KA 2DE9A 1D3DB 3ATWA 5FX6A 1K1JA 1AKSB 1K1IA 1TA6A 4E06H 1BOQA 2M5TA 2XBWA 3JZ1B 1ZTLA 4X1QU 3PTNA 4X2VA 3VB7A 4B1TA 1FY4A 3PLPA 3HKIB 5JBBS 3MHWU 2UWPA 1AIXH 1F5RA 1CO7E 4ESTE 1JMOH 2GZ8A 3A89A 3SZNA 2XCFA 1ARCA 4Y8YA 3SI4H 3SU6A 1BTYA 2C8WB 3RMMH 2J34A 1Y3YA 1SLXB 1TFXA 3RLWH 1D4PB 3R3GB 3MH5A 1EP6A 1RS0A 3TH2H 1A3EH 1JXPA 4JZIA 3MNXA 3E16B 4U01A 3D49H 1K1NA 4RKJB 5F6MA 3SQEE 3O8RA 1H9HE 3BTQE 1UMAH 1XX9A 1SC8U 2A45B 1DSTA 2HWLB 5EW1H 5FBEA 1O2GH 1GHWH 1NROH 1P0SH 4WF8A 4MPUA 1AE8H 4NZLA 4K1TA 1A46H 1ELFA 1C1MA 1GMCF 4IBLH 1GI9B 3TU7H 1BQYA 2AGGX 2Z94A 3RMNH 4UE7H 4RSPA 1IQHA 1TNHA 1FNIA 1LHFH 4HGCA 1MMJN 4K5ZA 3TK5A 3SBKA 5EPNA 3K6YA 1QBVH 3TVJB 2ZHQH 1K9OE 3HGPA 3UY9A 4Y0ZE 1KXEA 1VJ9U 2VVVA 4O3TA 3A8DA 3GISB 1HIAB 3MO3A 3O8CA 3U9AH 1VITG 4BTIB 2ZIQH 3S9AA 3VGCB 3ZVAA 4X2YA 5EXMA 3TH3H 2XBYA 1T8OA 2NU3E 3LGYA 1GVZA 1PPZA 3UQOA 2TIOA 3ELAH 4Z0KA 4BTTB 2ZZUH 4UONA 4YM9A 1NO9H 4DY7B 4ZKNU 4AFUA 1P2QA 1G9IE 3SNCA 1GDQA 2O8UA 2TGDA 1D9IA 4IMQA 2BLVA 6ESTA 1MAXA 4X8SH 1H8IH 3PMBB 5GCHF 1V2NT 1GI5A 1YGCH 2VH6A 1O5DH 2B9LA 1KDQB 2G55A 1FZZA 3VB5A 1TBZH 5T6FA 1O2OA 1UTQA 3EE0B 1ANEA 2ZDVH 1SPJA 2BD3A 4GCHF 2A4GA 1C1PA 2A4OA 1AFQC 1BITA 2H5DA 1LDTT 3OYPA 2ALPA 1ELDE 3BG8A 5FPYA 4I7YH 1AN1E 2ALVA 5CE1A 4JYVH 2Y5HA 4BAQB 1TNIA 1BTXA 3ODFA 3L3TA 1EZSC 1AWHB 1S6HA 3B9FH 3LGIA 3GICB 4NFFA 1MTUA 3OSYA 5DGJA 1LPKB 2VGCC 2BOKA 1GI0A 2RA0A 1EAXA 3P8OA 1SGNE 3FP6E 1LQEA 1VCPA 3MU5A 1LVBA 3EGKH 5F8ZA 2YNBA 3QGNB 3GY7A 4Y6DA 2D2DA 6GCHF 5PTPA 1MKXH 1SGCA 1HCGA 4ZKSU 1LKBA 2BOHB 3U8RH 1AFQB 1SMFE 1YPEH 4X1RU 3SUGA 2KAIA 5G4BA 1GI2A 1UCYK 3MNBA 1OP2A 3ZZAA 3RU4D 3BTWE 1T4UH 1IQIA 1ANBA 2ANWA 1QA0A 1O3DA 3U98H 3STJA 1ELEE 4ZH8A 1HAVA 5EW2H 1C5NH 4LZ1H 1ELVA 1A5GH 5EQRA 1OWKA 3HATH 2AGEX 4MPWA 1S82A 2FLBH 2FOGA 3NUMA 4CRGA 1O3IA 2OXSA 1QHRB 3AAUA 4ABDA 3QZQA 5GWZA 1TGCA 2ZFRH 3BIUH 4UEHH 5HXFA 1C5VA 2BD7A 1C2JA 1QR3E 2A31A 4D8NA 2ANKH 3PV4A 3BN9A 3M5LA 2F91A 3MH6A 1PPGE 2XC0A 3AVZA 3A82A 1FUJA 1TX6A 1Q2WA 1YP9A 3RXTA 2XC5A 3RXAA 1B0FA 3SNEA 2GCTC 5DJ7A 5LGOA 2ILNA 3ATLA 3LH3A 1ZZZA 1BB0B 5DP6A 3A80A 3O8DA 2SNVA 2FLRH 1MCTA 4XBBA 5EGMA 3R0FA 4A1VA 1F7ZA 1XKAC 4X2WA 2KAIB 1H8DH 2W5EA 3BEIB 3M36A 3RDZA 3VB6A 4ABHA 2R0LA 3A8AA 4OS6A 2NU4E 3PO1B 3RXLA 3TJNA 3UREA 2HNTE 2Z9KA 1D3TB 1MZDA 3SV8A 4WY3A 3RMLH 1NTPA 1O31A 1P2JA 2UWOA 4X1NU 3ZZ6A 6CHAB 4B73A 1IHTH 2BY8X 1C2KA 4BAKB 1BA8B 4AG2A
chains in the Genus database with same CATH superfamily
2XYAA 3RXIA 3U8TH 3SV6A 2P93A 3FKSD 4CRCA 1P57B 3F9EA 2A1DB 3KL6A 5DN6D 1GL1A 1VITF 1FIZA 1VITH 1Z6EA 2BY9X 1UHBA 2Y5GA 1GBAA 2ZDNA 4CRDA 1A0HB 4ABGA 4SGBE 4KTCA 2CGAA 3OTPA 1AVXA 3W95A 1ZHMA 2GV7A 3NKKA 3P8FA 4KTUA 4TYDA 1P02A 3DT0H 5C1XA 3A8BA 3G01A 3N7OA 2BQ7B 1RXPA 1V2UT 2ZU4A 1ZPZA 5L6NH 2F83A 1GJ5H 2UUYA 2OP9A 1O2TA 1AGJA 1FIWA 1UTJA 1BRBE 1DWBH 1C5MD 3T62A 4ZKRU 1BRCE 1ARBA 4MNWA 4INHA 1TYNA 1FI8A 1LHCH 7GCHG 2AS9A 4ZXYH 3F9FA 1NRQH 1GBIA 3FZDA 3KHVA 1BMMH 3A84A 4FUEA 4H4FA 4H42U 2Y5FA 2ZFSA 1Y59T 4FETA 1T8LA 1XXFA 1O2LA 1C5SA 1Y5BT 1VGCB 1W0ZU 2GDDA 1GVKB 1O5BB 4I8HA 2BM2A 2GZ9A 2P3UB 3RXKA 1C2IA 1WUNH 3KIDU 2ZDMA 5ETXA 2VB0A 4XBDA 1ZOMA 1L1JA 3RXVA 2ZU2A 2F4LA 1CU1A 3LJJA 1B0EA 3RXQA 3VXEH 3FAOA 3SU1A 2QN5T 1HAVB 4F4OC 4ACBA 2LNCA 5CMXH 5CDFE 1AZ8A 2EY4C 3E1XB 1NM6A 1O39A 3E8LA 1RGQA 1XUJA 1Y5UT 3IWMA 1ELBA 4OS2A 1BMLA 1EAWA 2Q1JA 1CBWB 3NRLA 1LPGB 2PKAB 4I32A 2P3TB 2BQ6B 1EXFA 2V3HH 3SNAA 1ZHPA 3TGKE 2AERH 3BTME 3V12A 1NFXA 1A7SA 1YWUA 1PQ5A 1G3DA 2FX4A 5EJ1A 4Q4LA 3RXRA 3VFEA 4NA8A 1JIMA 2H9TH 2KR7A 3LH1A 4P02A 4B6FA 2VU8E 1ZMLA 2FI4E 1O0DH 1TQ7B 4GSOA 2PUQH 2BD8A 3QO6A 1BMFD 1X7AC 3A7VA 3A85A 1GBFA 1TBRH 5CHAC 1YM0A 3FANA 4HFPB 5GIBA 1O2IA 3RM0H 3TK9A 4UD9H 2OQUA 1YY3A 3MNCA 4ASUD 1B7XB 2BYAX 1PPFE 4OS1A 4FOUC 1NU9A 4MNYA 2BQWB 2AMQA 1MTVA 2FXRA 1MKWK 1QB1A 4DJZB 2BD5A 1K22H 5FCRA 4Y79A 2KZ4A 3LOXA 3ZYDA 2LPRA 4FXGH 1MU8B 1QRZA 1C1QA 3DD2H 4AGJA 1V6DA 3K2UA 3LPRA 2O9QA 1UVTH 5C94A 3BEUA 1UTMA 1T7CA 3F9GA 4CRAA 2JETC 1W7XH 2OC0A 1IAUA 1TPPA 2F9UA 3GY8A 2P8OB 3TJUA 5JDUB 1INCA 3SHCH 3SU3A 2V7QD 3ESTA 1A5HA 3M3VA 1B5GH 2XBVA 1TRMA 1CQQA 2GMTC 4TPIZ 3RM2H 2KCYA 5C2ZA 2GP9B 2CHAC 3VG8A 3GYMA 1DICA 2AGIX 3L33A 1MABB 3QGJA 2ZKSA 3SV7A 2PKSC 1GI3A 2C8YB 2G52A 4X6NA 1DOJA 1QJ7B 1MU6B 1GDUA 3OY5U 1MD8A 4MPXA 4ABFA 1SLVB 3PMAB 3RC6A 1FLEE 1KXDA 3RU4E 5T6DA 5LH8A 2JETB 2V35A 1C4V2 4WH6A 1C1OA 3ZZ7A 4FU9A 1OWDA 4NSYA 3MO9A 1DANH 2PSYA 2KCPA 1GHZA 2RG3A 1AY6H 3H09A 3ZZ3A 3NK8A 2BZAA 4MDSA 4BAMB 4F49A 2XNIA 3BG4B 4A6LA 1WBGB 5DKMA 4Y7BA 5J4SA 4VGCC 1OPHB 4H6SB 4A7IB 1O2SA 1SFQB 5EODA 4K1EA 1QURH 3RXMA 4LK4A 1DWDH 2ZTZA 1GBCA 1SHHB 4YXWD 2QA9E 1TPSA 3PWCA 1FV9A 5ABWA 4M9FA 2VIDA 3CS0A 5HIZA 1O2ZA 1WCZA 4NA7A 4Y71A 1C2LA 3W94A 1EUFA 1MQ6A 3KQEA 2QYIA 9ESTA 1GMHF 4ASHA 5EIYA 2F9VA 1OS8A 1P03A 1HAGE 1H1BA 2CF8H 2BZ6H 1PFXC 2V3MA 1O3EA 5E0HA 2JIZD 1A5IA 2JH5D 2J98A 3DFLA 5HM9A 5LPRA 1MAYA 3AAVA 1O3AA 1F5KU 2O8LA 1IHSH 2A5AA 1DE7H 3GCHC 1A61H 3ATMA 1DUAA 2XCNA 1V2MT 1AO5A 2AMDA 1BTPA 2Z3EA 3BF6H 5I46H 2CXVA 2QGRA 3LC5A 2CHAB 6LPRA 1S0RA 4ZKOU 5A0BA 5A8YA 5HGGA 4Y10E 4JZFH 3D62A 1RJXB 1YCPH 3AW0A 4UFFH 2SNWA 2BX3A 5DP4A 4FUGA 1NRSH 1CGIE 5C67A 3RMOH 1C9TA 3T25A 1K21H 1OYTH 4K2YA 1O3PB 2VWMA 2OUAA 1C1NA 3E0NB 2ZNKH 4X0WU 1SGFA 2FIRH 1RFNA 1AWFH 4TWWA 1E38B 1UVUH 2QXHA 2PFEA 1GHXH 2FWWA 1OWHA 2H1UA 2FOAA 1UCYH 3GY3A 1E1RD 2ZI2H 1AUTC 2XTTB 2GCHF 1WYKA 2VWLA 4ZMAH 2BDGA 4ISNA 2H9HA 3SU4A 3PV5A 2AH4X 1DT2A 3ZVGA 1PPCE 3U1IB 1QL9A 3BIVH 1HAOH 2RDEA 4U32A 3RXSA 2O8WA 2PV9B 4MTBA 1CA8B 2Y82A 1OXGA 1O3NA 1J14A 1QL8A 1V2ST 2Z3CA 1BIOA 1T32A 1HJ9A 2V6NA 1K28D 1CA0B 4KELA 3ZVBA 3ENSB 4YT6H 1BBRK 1QTFA 3OTJE 4YO9A 2Y7XA 4Z6AH 1O3OA 1C5TA 1AFEH 1BMAA 3AW1A 2KFWA 4BAOB 2Z3DA 4CR9A 2A7CA 2FOBA 4DT7B 1TRNA 2C3SA 1WAYB 9LPRA 1P3CA 1UJ1A 1EQ9A 3QTVH 2O8TA 1GPZA 1RD3B 2GT7A 3A7YA 1PQ8A 1BMNH 3M5OA 1C2MA 1TOMH 2P3FH 2STAE 4P00A 4Y0YE 1MH0A 1TGTA 1YPHC 4ZHAA 3E90B 3Q3YA 1DPOA 2FOMB 3NPSA 5FPTA 4ABBA 1AB9C 1F5LA 2FODA 1XKBC 2HLCA 1RRKA 4NCYA 1TX7A 4YOGA 3E6PH 1TPAE 2AFQB 3S0NA 1NC6A 3A7XA 2ZCKP 5GXPA 3C27B 1O3BA 4WXVA 5JPMH 1O5EH 4BANB 2ZWLH 2ZDKA 2ZU1A 4OM9A 4KGAA 4NIVA 1ZSLA 3IITA 1HJAC 4HTCH 3T28A 4U2WA 2IJOB 3QK1A 3FN8A 4MG3A 2WPMS 2Z6BD 1BCUH 1KXFA 2VJ1A 1DY8A 2JKHA 1EKBB 1HV7A 4ACAA 1GJ6A 1UO6A 3F2HA 1NESE 4IS5A 4IN2A 2BDIA 2G5NA 3P70B 1VCQA 1MBMA 3S7HB 2HVYB 4ABEA 3FFGA 1GI7B 1SHYA 4I86A 3ZVFA 4NZQA 1O2NA 2VIOA 3GCHB 2HPPH 1NBME 1NFYA 5DP7A 1MZAA 2WYJA 1LCYA 4NG9H 3T5FH 4KKDA 2VIWA 2A32A 4MNVA 1BDAA 1G3BA 1QA7A 2UWLA 1EOJA 1XMNB 1O33A 2WV4A 3VGCC 2FEQH 5IYTA 2BY7X 1LHEH 2WPKS 4NIXA 2C4FH 2B0FA 3EDXB 1BT7A 5E8EH 1H4WA 1O2VA 2OC1A 1ANDA 4Y7AA 1IQLA 3KN2A 2J97A 5E0JA 3ZZ9A 1H8HD 1TNKA 1EZUC 2GDEH 1EX3A 3I77A 1GJ9B 4CH8B 4INLA 1NPMA 3BTEE 1V2WT 4AYVB 5BRRE 2SGFE 1SGDE 1C5XB 1LVMA 1TGBA 1WV7H 3M37A 4IGDA 3M35A 1OWJA 1QRXA 2WZQA 3F0OA 1CA0C 1O2HA 3IG6B 1ID5H 2QY0B 3GY4A 1QGFA 2D26C 4ZUHA 1EPTA 4YESB 1LMWB 1D6WA 2BY5X 2GV6A 5DP8A 2PR3A 1DFPA 2VIPA 3TK6A 1C1RA 3I29A 1A0LA 2QF3A 2Z9GA 3PWBA 1KXBA 3EA9A 4WVPE 3ZVEA 1ZJDA 4TY7A 3MH7A 2WPHS 4FUHA 2AYWA 2I6SA 1TNLA 1GJAB 1JBUH 1JRTA 3M61U 4BNRA 1ZMNA 4RT0A 1HAIH 1IQGA 3K9XB 2A4RA 3URCA 1T31A 1Y5AT 1SB1H 4D9RA 1N8OC 1E0FD 1SGFG 3GCOA 1Y3UA 3SUEA 3LGTA 4MNXA 1LQDB 2G81E 4NSVA 3BTDE 4E7NA 3LJOA 5EQSA 4XD7D 2BDCA 1DSUA 1CSOE 2K1QA 3VB3A 4DOQA 3SZEA 5C1UA 5ESBA 1DITH 1PPBH 2G5VA 4JYTA 1NT1A 2PSXA 3PB1E 3PTBA 2VIQA 1ZSJA 1EB2A 1CHOF 3ZV8A 2AHME 1TMTH 2UUFB 1XM1A 2L6OA 2NU1E 1DDJA 2FOFA 3UUZA 1P11E 1CHGA 2CJIA 1NRRH 1AVWA 2RCEA 2ZFPH 4DG4A 2ZGBH 1HLTH 1P12E 1IQNA 3UR6A 3M7TA 2W6JD 4DVAU 1XUKA 1L4ZA 2BXTH 5EG4A 2Z7FE 3KYFA 1ESBA 6CHAC 1FXYA 2PKSB 3ITIA 3KQDA 2O8MA 1ELCA 1ORFA 1KLIH 3UNQA 5JBCS 2C8ZB 1ZRBA 2BTCE 2YMSD 1O38A 3JZ2B 1GI4A 2D8WA 1SG8B 1LHDH 2UUJB 3GS9A 1HNEE 4J2YB 1BUIA 1XUHA 3RXBA 1VGCC 1HPGA 3H5CB 1GHBG 5A0CA 1IQKA 2ZHEH 1A3BH 1W0KD 1C2DA 1S85A 2HGTH 2P16A 3F6UH 1AU8A 1O2PA 2BDHA 3TJOA 3TLOA 1KXCA 2BD2A 1GWAA 1TB6H 2YMSC 1A1RA 2PKAA 4VGCB 1C4U2 1K1PA 3MFJA 2R3UA 3MU1A 2P59A 3ZZ4A 2QXGA 3SU2A 1L1NA 1C2HA 1Z8JB 4BXWA 2AIPA 4AZ2B 4BAHB 1V2KT 1P10A 4OGYA 2QF0A 1ZTJA 3K65B 2A7JA 2J4IA 3ZYEA 2OBQA 2WV9A 1YPGH 1HAYB 1J16A 1O2MA 1GL0E 3TNTA 4X1SU 1O36A 1HAHH 5H4IB 5DSFA 5GDSH 1WDIA 2Z9LA 5F03A 1H9LB 5B6OA 1C9PA 4CR5A 1FPHH 3GCTF 1ELAA 2HVXA 2W7SA 2HLDD 3FZZA 3V7TA 1XUGA 2K8IA 4FUBA 2H9EH 2GGVB 1GMHG 1P2OA 2A7HA 1SQOA 1MTNC 1GBLA 1THRH 1O2XA 2HNTF 4CHAB 1GGDC 1E36B 3CENA 1HXEH 1Z8GA 1MCVA 2F9NA 2WPIS 1JWTA 1SLWB 1CT0E 1OP0A 4AG1A 1YF4A 3PV2A 2JDID 1ACBE 1PJPA 2JJ1D 2ZC9H 5EXNA 1P9UA 2B5TB 1C5LH 1S84A 1NBMD 1P09A 1P2IA 4I8GA 3LT3A 1GJ7B 1KY9A 3SQHE 5IDKA 4TT3D 4ZHLU 1CVWH 3PROA 4NIWA 1AI8H 1KLJH 1KXAA 1TPOA 4I31A 2J92A 2SGQE 3T26A 3UR9A 5K0HA 2W26A 3M3SA 1C1WH 3C1KA 3SGQE 1TIOA 2ZQ2A 5A2MH 2I6QA 1YYY1 1S6FA 2STBE 3PO1C 1ETTH 1HAXB 1RIWB 2WPDD 1XUIA 5E2PA 1ESAA 1GBMA 1EPTC 2FPZA 3UFAA 4X6PA 3RXDA 1AZZA 2Z9JA 4MVNA 1SGTA 3RXEA 1YPLH 3L6PA 1WOFA 5IK2D 1Q3XA 1ZTKA 4CBOA 2GCTB 5T1VA 3EA7A 3LGWA 1QFKH 3U69H 4E05H 3B8JA 1GJ8B 1CT2E 1Q31A 5JB8S 1CBWC 3ATKA 1YPHE 2QC2A 2BMGB 3KYGA 4K8YA 1GCTC 1THPB 3UTUH 2SGEE 4FUCA 2BLQA 1AB9B 5T6GA 3A83A 4A1XA 1XVOA 4DIIH 2A0QB 3SJKA 4MLFB 2ZCHP 3A87A 2BX4A 8GCHG 5DO4H 1O2KA 2IJD1 2WHXA 1TBQH 2A5KA 1IQFA 1YPMH 2EC9H 3DA9B 1AKSA 4XRNA 3V13A 3F2GA 3BTHE 2F3CE 3P8GA 3QLPH 2FX6A 1L2EA 5E2OA 1NFWA 1BTUA 1Y8TA 8LPRA 2XRCA 1MTNB 3FP7E 2J9NA 4MQAA 2W7UA 1K1LA 2OC8A 3M7UA 1O2JA 4X8TH 2A2XH 2ANYA 8GCHF 2ODYB 2HNTC 1SFIA 4FUJA 5FAHA 2XWBI 3BV9B 1O32A 2Y6TA 1BTWA 1AQ7A 3ZZ5A 1FY3A 2R3YA 1FN6A 3F9HA 1FMGA 4AX9H 1UTKA 2W3IA 1QBNA 2XWAA 3E3TA 2FYRA 1K2I1 1NS3A 2ZG0H 4THNH 2FP7B 3K6ZA 1RTLA 1V2LT 2R2WU 3P6ZB 1ZR0A 5L2YH 1PPHE 3HK6B 1Z8IB 3M5MA 2ASUB 2QF4A 5HIYA 1O5GH 2ZFFH 2ZHDA 2CMYA 2FS8A 2F9BH 1C1VH 1ZGVA 1SQAA 2KX4A 4JZ1A 3RXOA 4B76A 2AEIH 1C5RA 5GJ4B 1KIGH 4K8BA 4B2BA 1C2FA 1O34A 1CHOG 1L0ZA 2OK5A 1IQMA 2XNDD 3KQCA 8KME2 3ZVCA 3OY6U 4AFQA 4AOQA 4Y76A 3KNXA 4B2AA 2BD4A 1GMDG 1QNJA 1O5CB 2WV5A 2RA3A 3NXPA 4RKOB 2ZPRA 1GBHA 2WUBA 1O5FH 2JH0D 2OC7A 2BB4A 3LGVA 2C90B 2OTVA 1GI8B 4Y8ZA 1AE5A 1ETSH 1P01A 1V2QT 1ESTA 1ZLRA 3LONA 1OOKB 2OLGA 3DHKH 1SOZA 2ZDAH 5EQQA 2VVCA 3NZIA 3RXPA 5EOKA 1QL7A 1IOEA 1CE5A 3AASA 1FAKH 2HPQH 1IQEA 3H7OA 3SV2H 3LKWA 1T8MA 2FOEA 2V3OH 1Y3VA 2WUCA 3SJOA 3B23B 5DP5A 1PYTD 2XOKD 5C17A 3SUDA 1HJAB 1EJNA 3BG4C 1EAUA 3UOPA 1V3XA 3UIRA 1OSSA 4ABAA 1BJUA 3S9CA 2BLWA 1O2RA 3TGJE 4BOHA 1SL3A 4FU8A 4WJG2 1J9CH 4R8TB 4WMEA 1ZPBA 4XE4A 8ESTE 1TA2A 3ZZDA 4FU7A 4D7FA 4WXIA 4DGJA 1C5ZB 5E0GA 3FP8E 1GMDF 5CHBA 2EEKA 3MNSA 3UB0A 4ZAEA 4B2CA 3SV9A 1ANCA 2PUXB 3BSQA 3ODDA 1S0QA 4O97A 2D1JA 4K3JA 1UTPA 2GT8A 2GTBA 1FN8A 4IC5A 1YC0A 5GNDA 1MBQA 1T8NA 1O3FA 2R0KA 1K1OA 3GCNA 2EI8A 3Q76A 1IQJA 4DW2U 1HDTH 3GYLB 2VWNA 3BTKE 4WMFA 1JOUB 5F8XA 2KCAA 1SGYE 5JYIA 1UVSH 1TGSZ 3U8OH 2ZFQH 1GJCB 1FY5A 2CF9H 1WSSH 3PM3A 1GBTA 1GGDB 1LVOA 1BHXB 2ODPA 3A86A 2FTMA 3MTYA 1SGRE 1UVPA 4X6MA 2FMJA 3F68H 1ETRH 3D65E 1QB6A 1SR5C 1DM4B 3QWCH 7GCHF 1C5UA 1HFDA 5A0AE 3MMGA 1VJAU 1CGJE 3EA8A 5FHTA 3U1JB 4YZUA 1O3JA 1THSH 2FOHA 1SLUB 5DPAA 2PW8H 3QTOH 1C1TA 2F43B 3FO8D 1TNJA 1TWXB 3FVFB 1JIRA 2EA3A 2OBOA 3A8CA 2PGBB 3VPKA 2XC4A 2AMPA 2QV1A 3VXFH 4GCHG 1M9UA 4IN1A 1ZRKA 4XSKU 1EFRD 4INKA 5A8ZA 1F92A 1N1LA 2NU0E 3GDVA 4AN7A 1N6YA 3ZV9A 5B6LA 5EXLA 1TMBH 4Q7XA 4HZHA 5FBIA 1DVAH 1K0HA 1O3CA 3MI4A 1C2GA 3E91A 1TGNA 5KGOA 3Q77A 4IMZA 2FDAA 1OYQA 1OWEA 2BVRH 1ZMJA 1MTWA 2BXUH 1MQ5A 2FYQA 2GMTB 2ZECA 3RXCA 4UFEH 2ZTYA 1TAWA 2BD9A 2G4UA 4I8JA 1P05A 2JH6D 3KF2A 3SHAH 1OP8A 3A88A 3RXJA 1GHBF 1VCWA 3CP7A 1EAIA 3S7KB 1W2KH 4M7GA 3HKJB 1D3PB 4RI0A 4E7RG 1DWCH 3CS7A 1UK4A 3DSPA 2A2QH 2VNTA 2JJ2D 3EAJA 4UDWH 1TONA 1CGHA 4JK6A 1TABE 2Q6FA 4J1YA 3GY2A 5C5NA 4AFSA 1KTSB 3A7ZA 3ZIAD 3OAAD 3F2FA 2Y81A 1ZSKA 2GCHG 1E34B 1J8AA 5AVDA 1MUEB 1BJVA 1K1MA 3MH4A 1P9SA 2ODQA 2PTCE 2VH0A 1FQ3A 5TJXA 1ELGA 2ZFTA 3UNRA 4CH2B 5JB9S 2NWNA 1F0TA 4B6EA 3LDXH 1V2VT 2OINA 1YPJH 2Z9IA 4CREA 3UWIA 4D76A 2QCYA 3QN7A 2ZGCA 3GCTG 4XOJA 4FVDA 2VBCA 1QQ4A 1ZYOA 3Q3XA 4GVUA 4CRBA 5HMAA 1PPEE 2BLOA 2HRVA 1YCPM 3BTFE 3LU9B 4JMYA 5EPYA 1NFUA 1VR1H 3GDSA 1YKTA 3SGBE 3UNSA 4B74A 1F2SE 3ZZBA 4F55A 1V2RT 3RXUA 5K7RA 5JBAS 4KP0A 1ABIH 1W0JD 1GJBB 5HKKD 3M5NA 5DK1A 3KCGH 1KMHB 1HIAA 3BTGE 2XW9A 3T27A 3RP2A 4X2XA 4IW4E 2ZGJA 1OKXA 3M3TA 3TGIE 1UTLM 1E35B 1NN6A 3MU0A 1UK2A 5LPFA 2H6MA 1BBRE 5HM2A 5C3NA 4CHAC 2QE7D 1WU1A 2P94A 2TRMA 1TX8A 1W7GH 4H6TA 3M7QA 3O8BA 4YLQH 2IPHA 2ZCLP 1D6RA 1PYTC 3GDUA 4BTUB 3ZZCA 4NFEA 7KMEH 1HBTH 3HGNA 1XXDA 2ZU3A 4K60A 2VWOA 4CRFA 3QDZB 1F0RA 1GJ4H 2HOBA 3ZVDA 1SGPE 2BVSH 1QCPA 1DY9A 3T29A 1C5PA 5FCKA 1TQ0B 1UW7A 1G37A 1O30A 1ZJKA 2B8OH 2SGDE 3PRDA 2LELA 1E37B 1DLEA 5AFZH 1AMHA 2W3KA 4AB8A 1SBWA 2BDBA 1C5YB 3VEQB 1P06A 3UAIC 2CN0H 1YPKH 3MQKC 4FUDA 1BTZA 4AFZA 1ZHRA 1EOLA 2NU2E 2ANMH 3P8NA 3UPEA 1GI6A 4KTSA 1T4VH 1GHVH 4ZCNA 1EJMA 4LOYH 4AORA 5J4QA 1DUEA 3SO3A 3P92A 2J95A 4ABJA 5AF9H 1S6LA 1LKAA 2VINA 4D9QA 1DXPA 4YOIA 1F0SA 1SGEE 2RDLA 4Q7YA 4TWYA 7ESTE 1P8VC 1EZQA 1MKXK 2Y7ZA 1Z8RA 1S81A 2FZZA 1C5OH 2ZDLA 1FDPA 4X8UH 4ZXXH 4YOJA 1BTHH 2XXLA 1J15A 3DFJA 2WPLS 4WMDA 5JBTA 5TCAA 5C20A 5F8TA 4A5TS 2FS9A 1W13U 1GJDB 1G3EA 2F9OA 3SUFA 4PROA 3DUXH 1BRAA 3P95A 1QQUA 3OX7U 1QB9A 4LZ4B 5L2ZH 1W12U 2FO9A 1SI5H 3OFND 4RT1A 1MKWH 1HJ8A 4GPGA 3MU8A 4GHTA 1Z1IA 1XUFA 3RU4T 1ZGIA 3KQBA 1LPZB 4R0IA 1GHAG 3GOVB 1HRTH 2QIQA 4Y8XA 5A8XA 1C5QA 1O2QA 1PQAA 5LPEA 3GY5A 1OWIA 3RUOA 1RTKA 1EASA 1UHBB 1V2PT 1P3EA 1CT4E 3ATIA 2GKVE 3F1SB 5BPEA 5C1YA 6GCHG 2ZTXA 3KEEA 4UFDH 1NZQH 1O5AB 1W14U 1YCPK 4TY6A 2AIQA 4D7GA 1GBBA 2HALA 1N8OB 1HAZB 1GBDA 1U6QA 1SQTA 3NWUA 4AGKA 3SJIA 2QF5A 3SORA 1P04A 2PWXA 5SGAE 1YLDA 3EQ0H 3SW2B 3T2NA 1XVMA 1QJ6B 5A09A 4JZEH 3SI3H 1KLTA 2YOLA 3CNRA 4HI3A 4RN6A 1DX5M 1O3LA 1HYLA 1O35A 2PGQB 3P17H 1O37A 1KYNA 4O3UA 1Z6JH 2SGAA 4Q7ZA 1FY1A 1GG6B 3Q00A 2TGPZ 1QBOA 3KGPA 1WQSA 5AHGH 3MYWA 2WPJS 2F9PA 1G2MA 4QT8C 4ZHMU 1KTTB 3RLYH 1L1GA 2TBSA 3ZZ8A 3SOSA 4SGAE 3PMJA 5GCHG 2C8XB 5I25A 1JRSA 2GZ7A 2WSSD 3OE7D 1NRPH 2P8OC 4XDEA 2ZGXH 1GMCG 1TMUH 5L30H 3TNSA 1Y3WA 3MU4A 3TITA 1A2CH 4WH8A 3BEFB 1A4WH 1V2OT 2PHBA 3LC3A 4O9VA 2BHGA 4ISIH 1C1SA 2TGAA 2L74A 2EQNA 2XBXA 2BVXH 4ISHH 2VVUA 1F0UA 5DP3A 4FVBA 4GLYA 1J17T 5CHAB 3FOAA 4YTAA 5ESTE 2GJGA 4K69A 1GG6C 3SU5A 2GD4B 1LVYA 1H9IE 5KECA 1UK3A 3S69A 5C5OA 1GHYH 2GX4A 1QY6A 1GCDA 2RFKC 2FTLE 3A7TA 3STIA 1NRNH 1HAPH 1EZXC 1DS2E 1UVOA 4OS7A 4JCNA 4AB9A 1BBRH 3MO6A 4YT7H 1LHGH 3URDA 2VGCB 1WXRA 2DUCA 1O3MA 4DIHH 2G51A 4NWKA 4B71A 2C93B 2J98B 4XBCA 3RC5A 1QJ1B 3LIWA 2LP6A 3MWIU 4GHQA 1SOTA 4FUFA 5GPIB 5AFYH 4U30A 1BRUP 3MOCA 1HGTH 4JZDH 4BXSA 2R9PA 2ZEBA 4JYUH 1N6XA 1QIXB 4X1PU 1S83A 5DG6A 5FXLA 3RC4A 3SNDA 1TLDA 3PMHB 1NU7B 2YNAA 3V0XA 2ZU5A 2FOCA 3TH4H 1HUTH 4Q2KA 4ISLA 1E79D 2OQ5A 4I8KA 1G2LA 2TPIZ 2ESTE 1Z71A 2IOTA 3QUMP 2A4QA 3A81A 1NY22 3RXHA 1ZPCA 3BTTE 5C0TA 1SVPA 2ZA5A 4Q80A 1UCYE 2SGPE 1Z7KA 1AD8H 1P2MA 3WWBA 3SGAE 3U28C 2EI6A 4XFQA 1DXWA 1C2EA 2ZGHA 1UTNA 1O3GA 4X8VH 2J38A 5EJZA 2ULLA 4B75A 2ZPQA 1W8BH 1EJAA 3TJVA 1OHHD 3HPTB 2OD3B 4NIYA 1A0JA 1YLCA 3D23A 1WTHD 1VKYA 2H5CA 1V2TT 1KSNA 1Z1JA 4I8LA 3LGUA 2Q6GA 4WWYA 1RIWC 1UTOA 1QRWA 2ZP0H 1SGIB 3N7DA 1GBKA 2TGTA 3WY8A 1GBJA 1DLKB 2Y80A 2PTNA 4UFGH 7LPRA 3GY6A 3PRBA 5TCCA 1SGQE 3OU0A 2FM2A 4ISOA 4ZROA 4ABIA 1G32B 3DCLA 1G36A 2OCVB 4FUIA 3SJ9A 1AUJA 3EYDA 4I33A 1MTSA 4NGAH 2BDYA 1G3CA 2KCOA 2ZPSA 1AHTH 4AC9A 4TSFD 1TALA 4K1SA 1BHXF 2J94A 1MD7A 3UQVA 2A5IA 1HXFH 1W3CA 4OS4A 2FI3E 3WWFA 4F48B 3TIUA 2KM0A 1V2JT 2QXIA 3NCLA 3I78A 4DURA 5T3HA 5KEDA 3F3BA 1FJSA 1LTOA 1E1QD 1GDNA 4MPVA 4CBNA 2THFB 3RXGA 2IN2A 3SN8A 2ZQ1A 4A1TA 1LO6A 1DWEH 5HYOA 2P95A 4YLUA 5DP9A 4AYYB 3H7TA 2J2UA 4DCDA 1VZQH 2Q6DA 2WINI 1EB1H 2ZHFH 1W0YH 2GVFA 3V3MA 3QZRA 1TRYA 1KDQA 2SFAA 3PLBA 2CV3A 2FESH 1O3HA 4X6OA 2EI7A 1WTGH 2QAAA 5EJLA 2BDAA 1OX1A 3QX5H 1PQ7A 1TNGA 3RXFA 3SU0A 4OGXA 1O2YA 2H2ZA 1GCTB 1O3KA 3A7WA 1Y3XA 1ELTA 2BY6X 4A92A 1O2UA 2G00A 3E0PB 5EU8A 3SNBA 1YBWA 5FPSA 1EP5A 4O03A 4GAWA 1C5WB 3VB4A 1TE0A 3AK5A 2DE8A 1S5SA 2V0BA 1W11U 4Z1MD 2J5UA 4GUXA 2UUKB 3UWJH 2ZHWH 1FONA 2G4TA 4JK5A 3PYHA 3S9BA 1EPTB 1HB0B 2ZF0H 1ABJH 1O2WA 1D3QB 4LXBH 1L4DA 1TOCB 2WYGA 4OS5A 1GVLA 3SJ8A 1C4Y2 1H8ED 2G8TA 1SSXA 1RTFB 4IC6A 3TPIZ 1GHAF 4Y11E 4NWLA 1C1UH 4Q63A 1FPCH 3HK3B 2PLXA 2ZO3H 1GI1A 3Q3KA 1FAXA 2QXJA 1AVGH 2FI5E 4TPYA 2B7DH 1EATA 1FY8E 4NA9H 5FX5A 1BZXE 1P2NA 3PLKA 3UOUA 1GBEA 1G30B 4DT4A 1W10U 3N99A 2VIVA 1WQVH 2R2MB 1P2KA 2DE9A 1D3DB 3ATWA 5FX6A 1K1JA 1AKSB 1K1IA 1TA6A 5C0UA 4E06H 1BOQA 2M5TA 2XBWA 3JZ1B 1ZTLA 3KQ5A 4X1QU 3PTNA 4X2VA 3VB7A 4B1TA 1FY4A 3PLPA 3HKIB 5JBBS 3MHWU 2UWPA 1SKYE 1AIXH 1F5RA 1CO7E 4ESTE 1JMOH 2GZ8A 3A89A 3SZNA 2XCFA 1ARCA 4Y8YA 3SI4H 3SU6A 1BTYA 2C8WB 3RMMH 2J34A 1Y3YA 1SLXB 1TFXA 3RLWH 1D4PB 3R3GB 3MH5A 1EP6A 1RS0A 3TH2H 1A3EH 1JXPA 4JZIA 3MNXA 3E16B 4U01A 3D49H 1K1NA 4RKJB 5F6MA 3SQEE 3O8RA 1H9HE 3BTQE 1UMAH 1XX9A 1SC8U 2A45B 1DSTA 2HWLB 5EW1H 5FBEA 1O2GH 1GHWH 1NROH 1P0SH 4WF8A 4MPUA 1AE8H 4NZLA 3WW7A 4K1TA 1A46H 1ELFA 1C1MA 1GMCF 4IBLH 1GI9B 3TU7H 1BQYA 2AGGX 2Z94A 3RMNH 4UE7H 5F53A 4RSPA 1IQHA 1TNHA 1FNIA 1LHFH 4HGCA 1MMJN 4K5ZA 3TK5A 3SBKA 5EPNA 3K6YA 1QBVH 3TVJB 2ZHQH 3DSGA 1K9OE 3HGPA 3UY9A 4Y0ZE 1KXEA 1VJ9U 2VVVA 4O3TA 3A8DA 3GISB 1HIAB 3MO3A 3O8CA 3U9AH 1VITG 4BTIB 2ZIQH 3S9AA 3VGCB 3ZVAA 4X2YA 5EXMA 3TH3H 2XBYA 1T8OA 2NU3E 3LGYA 1GVZA 1PPZA 3UQOA 2TIOA 3ELAH 4Z0KA 4BTTB 2ZZUH 4UONA 5FL7D 4YM9A 1NO9H 4DY7B 4ZKNU 4AFUA 1P2QA 1G9IE 3SNCA 1GDQA 2TGDA 2O8UA 1D9IA 4IMQA 2BLVA 6ESTA 1MAXA 3OEHD 4X8SH 1H8IH 3PMBB 5GCHF 1V2NT 1GI5A 1YGCH 2VH6A 1O5DH 2B9LA 1KDQB 2G55A 1FZZA 3VB5A 4HG6A 1TBZH 5T6FA 1O2OA 1UTQA 3EE0B 1ANEA 2ZDVH 1SPJA 2BD3A 4GCHF 2A4GA 1C1PA 2A4OA 1AFQC 1BITA 2H5DA 1LDTT 2IPQX 3OYPA 2ALPA 1ELDE 3BG8A 5FPYA 4I7YH 1AN1E 2ALVA 5CE1A 1QZ8A 4JYVH 2Y5HA 4BAQB 2CK3D 1TNIA 1BTXA 3ODFA 1YLNA 3L3TA 1EZSC 1AWHB 1S6HA 3B9FH 3LGIA 3GICB 4NFFA 1MTUA 3OSYA 5DGJA 1LPKB 2VGCC 2BOKA 1GI0A 2RA0A 1EAXA 3P8OA 1SGNE 3FP6E 1LQEA 1VCPA 3MU5A 1LVBA 3EGKH 5F8ZA 2YNBA 3QGNB 3GY7A 4Y6DA 2D2DA 6GCHF 5PTPA 1MKXH 1SGCA 1HCGA 4ZKSU 1LKBA 2BOHB 3U8RH 1AFQB 3W1EA 1SMFE 1YPEH 4X1RU 3SUGA 2KAIA 5G4BA 1GI2A 1UCYK 3MNBA 1OP2A 3SYJA 3ZZAA 3RU4D 3BTWE 1T4UH 1IQIA 1ANBA 1COWD 2ANWA 1QA0A 1O3DA 3U98H 3STJA 1ELEE 4ZH8A 3OEED 1HAVA 5EW2H 3EE7A 1C5NH 4LZ1H 1ELVA 1A5GH 5EQRA 1OWKA 3HATH 2AGEX 4MPWA 1S82A 2FLBH 2FOGA 3NUMA 4CRGA 1O3IA 2OXSA 1QHRB 3AAUA 4ABDA 3QZQA 5GWZA 1TGCA 2ZFRH 3BIUH 4UEHH 5HXFA 1C5VA 2BD7A 3N7EA 3DSOA 1C2JA 1QR3E 2A31A 2K0QA 4D8NA 2ANKH 3PV4A 3BN9A 3M5LA 2F91A 3MH6A 1PPGE 2XC0A 1FX0B 3AVZA 3A82A 1FUJA 1TX6A 1Q2WA 1YP9A 2YMSB 3RXTA 1SQRA 2XC5A 3RXAA 1B0FA 3SNEA 3F0PA 2GCTC 5DJ7A 5LGOA 2ILNA 3ATLA 3LH3A 1ZZZA 1BB0B 5DP6A 2W6ID 3A80A 3O8DA 2SNVA 2FLRH 1MCTA 4XBBA 5EGMA 3R0FA 4A1VA 1F7ZA 1XKAC 4X2WA 2KAIB 1H8DH 2W5EA 3BEIB 3M36A 3RDZA 3VB6A 4ABHA 2R0LA 3A8AA 4OS6A 2NU4E 3PO1B 3RXLA 3TJNA 3UREA 2HNTE 2Z9KA 1D3TB 1MZDA 3SV8A 4WY3A 3RMLH 1NTPA 1O31A 1P2JA 2M2AA 2UWOA 4X1NU 3ZZ6A 6CHAB 4B73A 1IHTH 2BY8X 1C2KA 4BAKB 1BA8B 2PP6A 4AG2A
chains in the Genus database with same CATH topology
2XYAA 3RXIA 3U8TH 3SV6A 2P93A 4CRCA 1P57B 3F9EA 2A1DB 3KL6A 1GL1A 1VITF 1FIZA 1VITH 1Z6EA 2BY9X 1UHBA 2Y5GA 1GBAA 2ZDNA 4CRDA 1A0HB 4ABGA 4SGBE 4KTCA 2CGAA 1AVXA 3W95A 1ZHMA 2GV7A 3NKKA 3P8FA 4KTUA 4TYDA 1P02A 3DT0H 5C1XA 3A8BA 3G01A 3N7OA 2BQ7B 1RXPA 1V2UT 2ZU4A 1ZPZA 5L6NH 2F83A 1GJ5H 2UUYA 2OP9A 1O2TA 1AGJA 1FIWA 1UTJA 1BRBE 1DWBH 1C5MD 3T62A 4ZKRU 1BRCE 1ARBA 4MNWA 4INHA 1TYNA 1FI8A 1LHCH 7GCHG 2AS9A 4ZXYH 3F9FA 1NRQH 1GBIA 3FZDA 3KHVA 1BMMH 3A84A 4FUEA 4H4FA 4H42U 2Y5FA 2ZFSA 1Y59T 1T8LA 1XXFA 1O2LA 1C5SA 1Y5BT 1VGCB 1W0ZU 2GDDA 1GVKB 1O5BB 4I8HA 2BM2A 2GZ9A 2P3UB 3RXKA 1C2IA 1WUNH 3KIDU 2ZDMA 5ETXA 2VB0A 4XBDA 1ZOMA 1L1JA 3RXVA 2ZU2A 1CU1A 3LJJA 1B0EA 3RXQA 3VXEH 3FAOA 3SU1A 2QN5T 1HAVB 4F4OC 5CMXH 2LNCA 1AZ8A 3E1XB 1NM6A 1O39A 3E8LA 1RGQA 1XUJA 1Y5UT 3IWMA 1ELBA 4OS2A 1BMLA 1EAWA 2Q1JA 1CBWB 1LPGB 2PKAB 4I32A 2P3TB 2BQ6B 1EXFA 2V3HH 3SNAA 1ZHPA 3TGKE 2AERH 3BTME 3V12A 1NFXA 1A7SA 1PQ5A 1G3DA 2FX4A 3RXRA 3VFEA 4NA8A 1JIMA 2H9TH 3LH1A 2VU8E 1ZMLA 2FI4E 1O0DH 1TQ7B 4GSOA 2PUQH 2BD8A 3QO6A 1X7AC 3A7VA 3A85A 1GBFA 1TBRH 5CHAC 1YM0A 3FANA 4HFPB 5GIBA 1O2IA 3RM0H 3TK9A 4UD9H 2OQUA 3MNCA 1B7XB 2BYAX 1PPFE 4OS1A 1NU9A 4MNYA 2BQWB 2AMQA 1MTVA 2FXRA 1MKWK 1QB1A 4DJZB 2BD5A 1K22H 5FCRA 4Y79A 3LOXA 3ZYDA 2LPRA 4FXGH 1MU8B 1QRZA 1C1QA 3DD2H 4AGJA 1V6DA 3K2UA 3LPRA 2O9QA 1UVTH 3BEUA 1UTMA 1T7CA 3F9GA 4CRAA 2JETC 1W7XH 2OC0A 1IAUA 1TPPA 2F9UA 3GY8A 2P8OB 3TJUA 5JDUB 1INCA 3SHCH 3SU3A 3ESTA 1A5HA 3M3VA 1B5GH 2XBVA 1TRMA 1CQQA 2GMTC 4TPIZ 3RM2H 5C2ZA 2GP9B 2CHAC 3GYMA 1DICA 2AGIX 3L33A 3QGJA 2ZKSA 3SV7A 2PKSC 1GI3A 2C8YB 2G52A 4X6NA 1DOJA 1QJ7B 1MU6B 1GDUA 3OY5U 1MD8A 4MPXA 4ABFA 1SLVB 3PMAB 3RC6A 1FLEE 1KXDA 3RU4E 5T6DA 5LH8A 2JETB 2V35A 1C4V2 4WH6A 1C1OA 3ZZ7A 4FU9A 1OWDA 4NSYA 3MO9A 1DANH 2PSYA 1GHZA 2RG3A 1AY6H 3ZZ3A 3NK8A 2BZAA 4MDSA 4BAMB 4F49A 2XNIA 3BG4B 4A6LA 1WBGB 5DKMA 4Y7BA 5J4SA 4VGCC 1OPHB 4H6SB 4A7IB 1O2SA 1SFQB 5EODA 4K1EA 1QURH 3RXMA 4LK4A 1DWDH 2ZTZA 1GBCA 1SHHB 2QA9E 1TPSA 3PWCA 1FV9A 5ABWA 2VIDA 3CS0A 1O2ZA 1WCZA 4NA7A 4Y71A 1C2LA 3W94A 1EUFA 1MQ6A 3KQEA 2QYIA 9ESTA 1GMHF 4ASHA 2F9VA 1OS8A 1P03A 1HAGE 1H1BA 2CF8H 2BZ6H 1PFXC 1O3EA 5E0HA 3DFLA 1A5IA 2JH5D 5HM9A 5LPRA 1MAYA 3AAVA 1O3AA 1F5KU 2O8LA 1IHSH 2A5AA 1DE7H 3GCHC 1A61H 3ATMA 1DUAA 2XCNA 1V2MT 1AO5A 2AMDA 1BTPA 2Z3EA 3BF6H 5I46H 2CXVA 2QGRA 3LC5A 2CHAB 6LPRA 1S0RA 4ZKOU 5A0BA 5A8YA 5HGGA 4Y10E 4JZFH 3D62A 1RJXB 1YCPH 3AW0A 4UFFH 2SNWA 2BX3A 5DP4A 4FUGA 1NRSH 1CGIE 5C67A 3RMOH 1C9TA 3T25A 1K21H 1OYTH 4K2YA 1O3PB 2VWMA 2OUAA 1C1NA 3E0NB 2ZNKH 4X0WU 1SGFA 2FIRH 1RFNA 1AWFH 4TWWA 1E38B 1UVUH 2QXHA 2PFEA 1GHXH 2FWWA 1OWHA 2H1UA 2FOAA 1UCYH 3GY3A 2ZI2H 1AUTC 2XTTB 2GCHF 1WYKA 2VWLA 4ZMAH 2BDGA 4ISNA 2H9HA 3SU4A 2AH4X 1DT2A 3ZVGA 1PPCE 3U1IB 1QL9A 3BIVH 1HAOH 4U32A 3RXSA 2O8WA 2PV9B 4MTBA 1CA8B 2Y82A 1OXGA 1O3NA 1J14A 1QL8A 1V2ST 2Z3CA 1BIOA 1T32A 1HJ9A 2V6NA 1K28D 1CA0B 4KELA 3ZVBA 3ENSB 4YT6H 1BBRK 1QTFA 3OTJE 4YO9A 2Y7XA 4Z6AH 1O3OA 1C5TA 1AFEH 1BMAA 3AW1A 4BAOB 2Z3DA 4CR9A 2A7CA 2FOBA 4DT7B 1TRNA 2C3SA 1WAYB 9LPRA 1P3CA 1UJ1A 1EQ9A 3QTVH 2O8TA 1GPZA 1RD3B 2GT7A 3A7YA 1PQ8A 1BMNH 3M5OA 1C2MA 1TOMH 2P3FH 2STAE 4Y0YE 1MH0A 1TGTA 1YPHC 4ZHAA 3E90B 3Q3YA 1DPOA 2FOMB 3NPSA 5FPTA 4ABBA 1AB9C 1F5LA 2FODA 1XKBC 2HLCA 1RRKA 4NCYA 1TX7A 4YOGA 3E6PH 1TPAE 2AFQB 3S0NA 1NC6A 3A7XA 2ZCKP 5GXPA 3C27B 1O3BA 4WXVA 5JPMH 1O5EH 4BANB 2ZWLH 2ZDKA 2ZU1A 4KGAA 4NIVA 1ZSLA 3IITA 1HJAC 4HTCH 3T28A 4U2WA 2IJOB 3QK1A 4MG3A 2WPMS 2Z6BD 1BCUH 1KXFA 2VJ1A 1DY8A 2JKHA 1EKBB 1HV7A 1GJ6A 1UO6A 4IS5A 1NESE 4IN2A 2BDIA 2G5NA 3P70B 1VCQA 1MBMA 3S7HB 4ABEA 3FFGA 1GI7B 1SHYA 3ZVFA 4NZQA 1O2NA 2VIOA 3GCHB 2HPPH 1NFYA 5DP7A 1MZAA 2WYJA 1LCYA 4NG9H 3T5FH 4KKDA 2VIWA 2A32A 4MNVA 1BDAA 1G3BA 1QA7A 2UWLA 1EOJA 1XMNB 1O33A 2WV4A 3VGCC 2FEQH 5IYTA 2BY7X 1LHEH 2WPKS 4NIXA 2C4FH 2B0FA 3EDXB 1BT7A 5E8EH 1H4WA 1O2VA 2OC1A 1ANDA 4Y7AA 1IQLA 3KN2A 5E0JA 3ZZ9A 1TNKA 1EZUC 2GDEH 1EX3A 3I77A 1GJ9B 4CH8B 4INLA 1NPMA 3BTEE 1V2WT 4AYVB 5BRRE 2SGFE 1SGDE 1C5XB 1LVMA 1TGBA 1WV7H 3M37A 4IGDA 3M35A 1OWJA 1QRXA 1CA0C 1O2HA 3IG6B 1ID5H 2QY0B 3GY4A 1QGFA 2D26C 4ZUHA 1EPTA 4YESB 1LMWB 1D6WA 2BY5X 2GV6A 5DP8A 2PR3A 1DFPA 2VIPA 3TK6A 1C1RA 3I29A 1A0LA 2QF3A 2Z9GA 3PWBA 1KXBA 3EA9A 4WVPE 3ZVEA 1ZJDA 4TY7A 3MH7A 2WPHS 4FUHA 2AYWA 2I6SA 1TNLA 1GJAB 1JBUH 1JRTA 3M61U 4BNRA 1ZMNA 1HAIH 1IQGA 3K9XB 2A4RA 3URCA 1T31A 1Y5AT 1SB1H 4D9RA 1N8OC 1E0FD 1SGFG 3GCOA 1Y3UA 3SUEA 3LGTA 4MNXA 1LQDB 2G81E 4NSVA 3BTDE 4E7NA 3LJOA 5EQSA 2BDCA 1DSUA 1CSOE 2K1QA 3VB3A 4DOQA 5C1UA 5ESBA 1DITH 1PPBH 2G5VA 4JYTA 1NT1A 2PSXA 3PB1E 3PTBA 2VIQA 1ZSJA 1EB2A 1CHOF 3ZV8A 1TMTH 2UUFB 1XM1A 2NU1E 1DDJA 2FOFA 3UUZA 1P11E 1CHGA 2CJIA 1NRRH 1AVWA 2RCEA 2ZFPH 4DG4A 2ZGBH 1HLTH 1P12E 1IQNA 3UR6A 3M7TA 4DVAU 1XUKA 1L4ZA 2BXTH 5EG4A 2Z7FE 6CHAC 1ESBA 1FXYA 2PKSB 3ITIA 3KQDA 2O8MA 1ELCA 1ORFA 1KLIH 3UNQA 5JBCS 2C8ZB 1ZRBA 2BTCE 1O38A 3JZ2B 1GI4A 2D8WA 1SG8B 1LHDH 2UUJB 1HNEE 4J2YB 1BUIA 1XUHA 3RXBA 1VGCC 1HPGA 3H5CB 1GHBG 5A0CA 1IQKA 2ZHEH 1A3BH 1C2DA 1S85A 2HGTH 2P16A 3F6UH 1AU8A 1O2PA 2BDHA 3TJOA 3TLOA 1KXCA 2BD2A 1GWAA 1TB6H 1A1RA 2PKAA 4VGCB 1C4U2 1K1PA 3MFJA 2R3UA 3MU1A 2P59A 3ZZ4A 2QXGA 3SU2A 1L1NA 1C2HA 1Z8JB 4BXWA 2AIPA 4AZ2B 4BAHB 1V2KT 1P10A 4OGYA 2QF0A 1ZTJA 3K65B 2A7JA 2J4IA 3ZYEA 2OBQA 1YPGH 1HAYB 1J16A 1O2MA 1GL0E 3TNTA 4X1SU 1O36A 1HAHH 5H4IB 5GDSH 2Z9LA 5F03A 1H9LB 5B6OA 1C9PA 4CR5A 1FPHH 3GCTF 1ELAA 2HVXA 2W7SA 3FZZA 3V7TA 1XUGA 4FUBA 2H9EH 2GGVB 1GMHG 1P2OA 2A7HA 1SQOA 1MTNC 1GBLA 1THRH 1O2XA 2HNTF 4CHAB 1GGDC 1E36B 3CENA 1HXEH 1Z8GA 1MCVA 2F9NA 2WPIS 1JWTA 1SLWB 1CT0E 1OP0A 4AG1A 1YF4A 1ACBE 1PJPA 2ZC9H 5EXNA 1P9UA 2B5TB 1C5LH 1S84A 1P2IA 1P09A 4I8GA 3LT3A 1GJ7B 1KY9A 3SQHE 5IDKA 4ZHLU 1CVWH 3PROA 4NIWA 1AI8H 1KLJH 1KXAA 1TPOA 4I31A 2J92A 2SGQE 3T26A 3UR9A 5K0HA 2W26A 3M3SA 1C1WH 3C1KA 3SGQE 1TIOA 2ZQ2A 5A2MH 2I6QA 1YYY1 1S6FA 2STBE 3PO1C 1ETTH 1HAXB 1RIWB 1XUIA 5E2PA 1ESAA 1GBMA 1EPTC 2FPZA 3UFAA 4X6PA 3RXDA 1AZZA 2Z9JA 4MVNA 1SGTA 3RXEA 1YPLH 3L6PA 1WOFA 1Q3XA 1ZTKA 4CBOA 2GCTB 3EA7A 3LGWA 1QFKH 3U69H 4E05H 3B8JA 1GJ8B 1CT2E 1Q31A 5JB8S 1CBWC 3ATKA 1YPHE 2QC2A 2BMGB 4K8YA 1GCTC 1THPB 3UTUH 2SGEE 4FUCA 2BLQA 1AB9B 5T6GA 3A83A 4A1XA 1XVOA 4DIIH 2A0QB 3SJKA 4MLFB 2ZCHP 3A87A 2BX4A 8GCHG 5DO4H 1O2KA 1TBQH 2A5KA 1IQFA 1YPMH 2EC9H 3DA9B 1AKSA 3V13A 3BTHE 2F3CE 3P8GA 3QLPH 2FX6A 1L2EA 5E2OA 1NFWA 1BTUA 1Y8TA 8LPRA 2XRCA 1MTNB 3FP7E 2J9NA 4MQAA 2W7UA 1K1LA 2OC8A 3M7UA 1O2JA 4X8TH 2A2XH 2ANYA 8GCHF 2ODYB 2HNTC 1SFIA 4FUJA 5FAHA 2XWBI 3BV9B 1O32A 2Y6TA 1BTWA 1AQ7A 3ZZ5A 1FY3A 2R3YA 1FN6A 3F9HA 1FMGA 4AX9H 1UTKA 2W3IA 1QBNA 2XWAA 3E3TA 2FYRA 1K2I1 1NS3A 2ZG0H 4THNH 2FP7B 3K6ZA 1RTLA 1V2LT 2R2WU 3P6ZB 1ZR0A 5L2YH 1PPHE 3HK6B 1Z8IB 3M5MA 2ASUB 1O5GH 2ZFFH 2ZHDA 2CMYA 2FS8A 2F9BH 1C1VH 1ZGVA 1SQAA 4JZ1A 3RXOA 4B76A 2AEIH 1C5RA 5GJ4B 1KIGH 4K8BA 4B2BA 1C2FA 1O34A 1CHOG 1L0ZA 1IQMA 3KQCA 8KME2 3ZVCA 3OY6U 4AFQA 4AOQA 4Y76A 3KNXA 4B2AA 2BD4A 1GMDG 1QNJA 1O5CB 2WV5A 2RA3A 3NXPA 4RKOB 2ZPRA 2WUBA 1GBHA 1O5FH 2JH0D 2OC7A 2BB4A 3LGVA 2C90B 2OTVA 1GI8B 4Y8ZA 1AE5A 1ETSH 1P01A 1V2QT 1ESTA 1ZLRA 3LONA 1OOKB 2OLGA 3DHKH 1SOZA 2ZDAH 5EQQA 2VVCA 3NZIA 3RXPA 5EOKA 1QL7A 1IOEA 1CE5A 3AASA 1FAKH 2HPQH 1IQEA 3H7OA 3SV2H 3LKWA 1T8MA 2FOEA 2V3OH 1Y3VA 2WUCA 3SJOA 3B23B 5DP5A 1PYTD 3SUDA 1HJAB 1EJNA 3BG4C 1EAUA 3UOPA 1V3XA 3UIRA 1OSSA 4ABAA 1BJUA 3S9CA 2BLWA 1O2RA 3TGJE 4BOHA 1SL3A 4FU8A 4WJG2 1J9CH 4R8TB 4WMEA 1ZPBA 4XE4A 8ESTE 1TA2A 3ZZDA 4FU7A 4D7FA 4WXIA 4DGJA 1C5ZB 5E0GA 3FP8E 1GMDF 2EEKA 3MNSA 4ZAEA 4B2CA 3SV9A 1ANCA 2PUXB 3BSQA 3ODDA 1S0QA 4O97A 2D1JA 4K3JA 1UTPA 2GT8A 2GTBA 1FN8A 4IC5A 1YC0A 1MBQA 1T8NA 1O3FA 2R0KA 1K1OA 3GCNA 2EI8A 3Q76A 1IQJA 4DW2U 1HDTH 3GYLB 2VWNA 3BTKE 4WMFA 1JOUB 5F8XA 1SGYE 5JYIA 1UVSH 1TGSZ 3U8OH 2ZFQH 1GJCB 1FY5A 2CF9H 1WSSH 3PM3A 1GBTA 1GGDB 1LVOA 1BHXB 2ODPA 3A86A 2FTMA 3MTYA 1SGRE 1UVPA