3BTGE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btgE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btgE02
1AVWA 3LT3A 3SZNA 4NGAH 2ZC9H 1O2UA 1HAXB 4WF8A 1PQ5A 1K1PA 5F8TA 3MNCA 3UQVA 2EI6A 2QN5T 3QGNB 2BD4A 2O8UA 1FDPA 1BJUA 4B74A 1KTSB 1UTQA 2FOFA 4H6TA 1YPHE 4R0IA 3JZ1B 3M5OA 1GWAA 4X2XA 3RU4T 1TMTH 5IDKA 5EOKA 1Z8GA 4HGCA 1QR3E 3SJ8A 4Q80A 2G55A 3SU1A 5DP6A 2HVXA 3M61U 1FMGA 1E36B 2HPPH 1MU8B 1SOZA 2XC5A 2V3HH 4E06H 1GHAG 2UWLA 3A8DA 3P17H 3ZZ7A 2ZU4A 1FY5A 3RMLH 3U8TH 5T6GA 1BMLA 1P2QA 4NIVA 3LGVA 4DY7B 1FXYA 2V3OH 1SQTA 4B73A 4X1QU 5DP8A 3F68H 1BOQA 1Z71A 2BD2A 4GVUA 3MO6A 4ZHAA 2H1UA 1QL8A 2VB0A 2BQWB 1NFYA 1GBFA 1EOJA 5AF9H 4NSVA 5GCHF 2RDLA 2ASUB 1T8OA 2PR3A 2G52A 4ZKRU 3D62A 3BTQE 1A3BH 1UCYK 2CF8H 1C4U2 2Y80A 1W12U 2BB4A 1IQJA 1W7XH 4KTCA 1L2EA 4UFDH 2JH0D 1H9LB 3S0NA 1TPSA 3U1JB 1NY22 1ZMNA 2BM2A 2F91A 3QGJA 3MWIU 1SGYE 3K6ZA 4BAOB 1EUFA 3SU6A 4ISNA 4NIWA 3ZZAA 1J9CH 2BTCE 1O2YA 1AGJA 1Y5AT 3E6PH 3RXBA 1LPZB 3MNSA 1GMHF 1ZTKA 2ANWA 1BBRH 2A5KA 3GCOA 3F9EA 1H8DH 1C9TA 1IQNA 3GY6A 1PQ7A 5E0GA 2ZHQH 3OSYA 1O32A 2JETB 5HXFA 1H8IH 5PTPA 1QBOA 4BOHA 6LPRA 3ZZ8A 3VFEA 3SHCH 2SGDE 2NWNA 5E2OA 1K21H 4WH6A 2ZFSA 1SOTA 2CHAC 5ESTE 5EQQA 2NU3E 4DOQA 4D7GA 4O3TA 2XBXA 1GVLA 1IQGA 2HNTC 1NRQH 5G4BA 4JYUH 1XM1A 5FBEA 1GBMA 1O35A 4NFFA 1NPMA 1XKAC 1D6RA 1MD8A 1C2KA 1DPOA 1YPGH 2ZGBH 1C2EA 3DFJA 1MTSA 4I8LA 5FXLA 1CVWH 4OGXA 1TRMA 2ZPSA 3A89A 4AG2A 1NTPA 3V3MA 4OS2A 1TMBH 1UTLM 3LGYA 3T27A 1KIGH 1SGCA 1JXPA 1QTFA 1SLXB 4NZQA 4WXVA 1TQ7B 1C2DA 2BOKA 2XC0A 2ZEBA 3CS0A 3VGCB 2B7DH 1F5RA 3M37A 1DUAA 2G8TA 1XUFA 3P92A 4OS6A 1DXWA 1Y3UA 2ZFPH 2PSXA 1XUKA 1HJAC 1QNJA 1MMJN 1NS3A 3SGAE 1HAVB 1ORFA 2ZU5A 4XBBA 3T2NA 4CHAB 4AYYB 1OWEA 1C5ZB 3GY2A 1CA0C 4K1SA 2VIQA 2W26A 2FXRA 1P2KA 2PUXB 1TX8A 2SGQE 1O2HA 1MTWA 4Q7YA 1KDQB 1QBVH 1NROH 1TBRH 2ODPA 3Q3KA 3RXFA 1GHXH 3RXRA 3A85A 3PTBA 4Q7ZA 3LJOA 1O5FH 1OOKB 1SQAA 2FLRH 4DT7B 3QWCH 2A0QB 1BHXB 2Q6FA 1BRCE 2PWXA 2H6MA 3SJ9A 4XBDA 1IQKA 2ZFFH 1DOJA 2RCEA 4IS5A 5EGMA 1W0YH 3BG8A 1G9IE 1PFXC 3UREA 1ESBA 2ZCHP 2BX4A 3ZZDA 1C5SA 2BDHA 2P8OB 1GJDB 3H5CB 1T8LA 1B0FA 3A88A 1FY1A 1C5QA 1C5YB 1O2TA 1UMAH 3SORA 1XUGA 1IHTH 1BTPA 2YNAA 1X7AC 1BTYA 2FEQH 2FZZA 2ZFRH 3GY5A 2IJOB 3OYPA 3BN9A 1PYTC 5HM9A 1SGRE 2OQ5A 3K65B 2BXUH 3RXUA 2J9NA 2XWBI 3PLPA 2VIOA 3RXAA 2SGPE 1C5NH 4AGKA 2B0FA 2Q6DA 3LOXA 2G81E 1ZJKA 1GI8B 2XBYA 3OY5U 1B0EA 4NA7A 4HI3A 2F9VA 3ZZ4A 1O30A 2ZU3A 4R8TB 3SJIA 4CRFA 1O33A 3A80A 1FN8A 1AB9C 1EZUC 3LC3A 2A31A 1ZJDA 1S81A 5F8ZA 1W8BH 1O2RA 1BB0B 1ZZZA 3KQEA 2A5AA 3DHKH 1P09A 3GDUA 2Y82A 1K28D 2KAIA 3KNXA 4OS7A 3ATMA 1P04A 2VWOA 3C1KA 2ZQ1A 1HB0B 1GMCG 1HAHH 1QURH 1S82A 1TNGA 3MI4A 6CHAB 3FZZA 1O3FA 4SGBE 4UD9H 5FX6A 1AN1E 1TA2A 1KXCA 1GBDA 1EB2A 1F2SE 2BVSH 1QA0A 4HTCH 3RXJA 4IMQA 4DIIH 5A09A 3GCNA 5A8YA 1IQMA 3T25A 1TIOA 2AIQA 3H7OA 2WUBA 3UFAA 2V6NA 2YNBA 3S7KB 3BTHE 4JK5A 4JZDH 2JH6D 2P59A 2A7JA 3A7YA 1OWIA 1TPAE 1BUIA 1LHGH 2GZ9A 1FY3A 1HV7A 1V2NT 1DITH 3GY7A 1ARCA 2B8OH 2Q1JA 1BDAA 2VGCB 2QF3A 1XX9A 3E0NB 1CHOG 1AUJA 1C1UH 2ZDNA 1OWHA 3GDVA 1O3DA 2Z94A 1AKSA 2FTMA 3GY4A 1RRKA 1E34B 1P3CA 1MBMA 2ANMH 4NIXA 1FONA 1JBUH 1XUJA 1NZQH 4YLQH 4F49A 4ESTE 3Q3YA 2ZGHA 2ZU1A 3HATH 3MU0A 2SNWA 4NSYA 1FI8A 2VWMA 1ABJH 1C1MA 1YPJH 2TGDA 1EZXC 1HYLA 4QT8C 5EXMA 1W10U 3SU4A 1IQFA 1OYQA 3C27B 3NK8A 1G2LA 1DWEH 3TH2H 2ZGJA 1P12E 3NPSA 1YM0A 3UOPA 1P06A 1F0SA 1P57B 4JMYA 2BYAX 1AWHB 1DXPA 3SV8A 1G2MA 1T31A 1IQEA 3EA8A 1QHRB 1XVOA 1GHVH 3A81A 3L33A 2H5CA 4ABFA 1GHYH 2GMTB 4FUEA 5DP5A 1QRXA 1GMDF 4K60A 2PHBA 2ANKH 3V13A 4KTUA 4CBNA 5T6FA 4WH8A 2F83A 4XFQA 1SFQB 3SU0A 2ANYA 4Y79A 2FOHA 2QXHA 1BQYA 1C1TA 1SVPA 4OS1A 5A0AE 5GPIB 1P0SH 1NRNH 1Y8TA 2BLWA 2BDIA 1BTXA 3UUZA 3VPKA 1CBWB 4O97A 1IQLA 1LKBA 1NRPH 4FVDA 4NCYA 1NU7B 4CRBA 3F1SB 1ZYOA 4I8HA 4CR9A 1VR1H 4K8BA 3QUMP 3RXGA 3M7UA 2AMQA 2PUQH 2AH4X 5LH8A 1V2LT 2XNIA 3UNSA 2AERH 4A92A 2A2QH 2GTBA 5LGOA 3RXEA 2R0KA 1EJAA 2BVRH 4MTBA 1HIAB 3NWUA 1A61H 1GJ7B 3L3TA 2KAIB 1BBRE 5DKMA 1M9UA 3URCA 3PV4A 1PPBH 4I7YH 3TJOA 3SBKA 3RXDA 1HLTH 3BTFE 1AE8H 4KTSA 1FPCH 1GI1A 2C8XB 1YYY1 1JWTA 4YTAA 1GL1A 1GHBF 1GCTB 7LPRA 2ZIQH 1TNJA 2GD4B 2ZCKP 1K1NA 1CE5A 3RXOA 1BTUA 1W14U 4UEHH 3PO1C 1EPTC 1SHHB 1O5EH 1EP5A 4DG4A 1SR5C 1YGCH 4J2YB 3S69A 3F9GA 2Z3CA 4Y8XA 1A4WH 2AS9A 4FU8A 4JZ1A 3AVZA 3QO6A 1O3OA 1VZQH 4A1XA 1KXEA 2H9EH 5FPYA 3Q76A 2FX6A 1GBEA 5JYIA 1JOUB 4X6OA 1C2GA 4GLYA 1UK3A 4IGDA 3M36A 3B8JA 2ZF0H 2FI4E 5EQRA 1EJMA 2EI7A 1C4Y2 1V2RT 1EZSC 1FAXA 3P8GA 1UK2A 5DP7A 1S6FA 3ZZ5A 1T7CA 1UO6A 2UUFB 1YPHC 1UTMA 2GCTC 2FTLE 4YLUA 2BDBA 1N8OB 3IWMA 2UUKB 3MU5A 1C1NA 4RKOB 4OGYA 4TY7A 1O5CB 1DFPA 3P8NA 3PMBB 1OWJA 3MHWU 4RN6A 1RFNA 3ZVBA 1JIMA 2HRVA 5JDUB 4AG1A 4VGCB 3PMAB 1O2GH 1ZGVA 1MQ6A 2BD8A 3RXPA 1Q2WA 1TONA 1BBRK 6GCHG 3UY9A 1ZHRA 4FVBA 4INLA 1FJSA 1MD7A 1ZRKA 3UIRA 3SW2B 1A5HA 5I46H 1GHAF 5EPYA 2ZFQH 2ZHEH 3KQBA 3ZVAA 4NZLA 5AFZH 4B76A 1TFXA 1D3DB 2C8ZB 4NG9H 1C1PA 3SHAH 2D8WA 1P02A 3GCHB 1GI4A 1VCWA 3HGPA 1LCYA 3MO9A 4TPIZ 3SV9A 2V0BA 4ZXXH 2TIOA 2IPHA 1GBLA 1P2NA 1MBQA 5L30H 3SV6A 1GBCA 1C2IA 1ZSJA 1Z8JB 5GWZA 4WJG2 2BLOA 4E05H 3SGBE 2SGEE 2QCYA 4A6LA 5E0JA 2ZG0H 1SHYA 1O2SA 1KTTB 2PLXA 2A4RA 1O5DH 1O2XA 3F6UH 1DLEA 2BMGB 2WPKS 3RC6A 2W5EA 4NFEA 3TJVA 1GI2A 5JBTA 1PPGE 2AGGX 2GT8A 2OXSA 1BHXF 3NZIA 1UVPA 3RU4D 4O9VA 5CE1A 4AZ2B 1EPTA 4BXWA 1O39A 1J8AA 3RXLA 3NCLA 1RD3B 3LIWA 2G4UA 1AI8H 1IQIA 4HZHA 4LXBH 4TWWA 1TNLA 1TMUH 1OWKA 2PFEA 1WSSH 2WUCA 2Z9LA 1PPFE 1GI5A 1IOEA 1N1LA 4Y11E 1O5BB 1NRSH 2BHGA 1SBWA 3VB7A 1VITG 1A1RA 2J4IA 2OBOA 2FPZA 3OTJE 1SLVB 4NA8A 1V2UT 1O3MA 3TNTA 4AYVB 2BZAA 1ELCA 2PKSB 1LHEH 1HXEH 2W7SA 2H9TH 1OP8A 1KXBA 1VCPA 1DS2E 1MTNC 4DGJA 1GHWH 9LPRA 4MG3A 1ELEE 5IYTA 1DVAH 3RMMH 4XE4A 5DP9A 3A8BA 2BLVA 1OKXA 1O34A 3AW0A 1Z1IA 1UTNA 3B9FH 2Y5FA 1AUTC 3ODDA 4CRCA 3A7VA 1TOCB 4KELA 3SNBA 3KEEA 1O0DH 4X6NA 1VGCC 1MAXA 3UR9A 1C2MA 1MKXH 2R3YA 3QX5H 2P3UB 1CQQA 4Y8YA 2GMTC 3UNQA 1B7XB 2G00A 1E35B 1F0TA 1FNIA 1HUTH 4FUJA 2WV4A 2F3CE 4B2BA 1O2LA 1Y59T 1P3EA 1KYNA 2P95A 2ZZUH 4X8VH 5GCHG 1GI7B 3BTME 1SG8B 2JKHA 2QXJA 1RS0A 1QA7A 1GI3A 1N6YA 4IBLH 5A8ZA 1K9OE 3E0PB 1FIWA 5C1YA 1C5RA 3TLOA 2Y7ZA 1F5LA 1LHDH 3SN8A 1MZAA 2ZDLA 5T3HA 4JZIA 1AE5A 2ZWLH 4BAMB 3SQEE 1TYNA 2PKAA 2RA0A 1E0FD 3A84A 4MDSA 1CBWC 5JPMH 1FN6A 3A7XA 1O3PB 1HAGE 2VH0A 2A4OA 1QJ6B 1GI9B 1RIWC 2AFQB 4ISIH 2BY9X 1YPMH 4AFSA 1FLEE 4U01A 3DFLA 1OX1A 2NU0E 1NRRH 1GMHG 4XOJA 4Y71A 2O8WA 3LONA 2ZGCA 2ZFTA 1SGEE 4FUIA 3S9AA 3M7QA 1WAYB 3SOSA 3M35A 4FXGH 1C5UA 2R2MB 1DY9A 2TRMA 1J17T 2UWPA 4UFGH 1GG6B 4JYTA 2O8TA 2LPRA 5GXPA 3SI4H 3AAUA 3GYMA 1Y5BT 2GCHG 3UQOA 2DUCA 2BX3A 2A45B 1PPCE 4AN7A 3HPTB 3PWBA 1HAOH 3U98H 1ETSH 2GV7A 4XBCA 4X2WA 5DO4H 1NT1A 1WQSA 2ZA5A 3ITIA 1ZRBA 2CN0H 2ALVA 4ZHMU 5CHAB 2OP9A 1J14A 1SGPE 2BY5X 1GJ8B 5ESBA 2A7CA 4B1TA 1MCTA 1YF4A 4CH8B 1C4V2 3M3VA 2VVVA 4X2VA 1T32A 5E2PA 3H7TA 3SNDA 3BG4B 3D23A 2O8MA 3F9FA 3I29A 1TGNA 1DWDH 3Q00A 3F9HA 1EZQA 3PLKA 1PPZA 2A5IA 3ZVGA 1ANEA 2THFB 3BV9B 1GJ6A 1RTFB 1A5GH 1TGCA 1CHGA 1GMCF 5C67A 4Y0YE 1K22H 4KP0A 1WQVH 3P8OA 2A4GA 1GI0A 3ZYEA 4MPUA 4Y7BA 2TBSA 2QC2A 1HXFH 1GGDB 1LTOA 1HGTH 1THRH 1AFQB 1TX6A 1TQ0B 1GL0E 5B6OA 2J34A 1O3KA 3SO3A 1T4UH 1EAIA 2VVCA 4VGCC 2HGTH 1W7GH 3TGIE 2FOBA 4MPVA 1TGTA 3SNAA 1Y3VA 4U30A 5BPEA 1YCPK 1EATA 5LPRA 1C9PA 1W11U 4O3UA 1DWCH 5A8XA 1CT4E 1F0UA 1CHOF 1SLWB 4IN2A 1QB9A 2H2ZA 2H5DA 4FUCA 4ZHLU 2OTVA 4CBOA 3P8FA 3TIUA 4H4FA 2VVUA 2FESH 3P6ZB 1OXGA 4MNWA 2VU8E 4CRAA 2ZTXA 2PTCE 1SQOA 4K3JA 4DCDA 1O3AA 1D3QB 4MNYA 1OSSA 1Z7KA 1C1RA 1HPGA 3AW1A 1EB1H 2A1DB 1OP2A 3MH7A 3SU2A 2QA9E 1IHSH 4LZ4B 1O37A 3IG6B 1V2PT 4YESB 1UVTH 4YO9A 4CRGA 1YBWA 1RJXB 1BRAA 4MQAA 4FUBA 1V2VT 2UUYA 1GI6A 4THNH 1LHCH 2D26C 4BNRA 3TGJE 5JBCS 4H6SB 2LNCA 4BANB 1FY8E 1H4WA 2BDCA 1D6WA 2STBE 1FV9A 3VB3A 4YM9A 2PSYA 5GIBA 1EAWA 1O2JA 1D3TB 2ZGXH 2AMDA 3RC5A 1DM4B 4A7IB 3LH1A 2NU1E 1C1QA 2BY6X 2FM2A 4WY3A 1SGTA 1EX3A 5TCCA 2FO9A 3RC4A 8GCHF 1ZSKA 3LC5A 1GJ5H 3PWCA 1TRNA 1XUIA 3KN2A 3RP2A 1MKWK 3GYLB 1TALA 3PLBA 4I8JA 5TCAA 2PGBB 1T4VH 4Z6AH 2PTNA 1UK4A 2BLQA 1HDTH 1TGBA 3LPRA 3TGKE 1F7ZA 1YP9A 2AGIX 3NXPA 4Y6DA 1CU1A 2HOBA 5EG4A 3A87A 1Q3XA 3E16B 1QJ1B 2JH5D 4IW4E 3RXQA 2ZTZA 3UR6A 1NM6A 3A8AA 5DJ7A 4K1TA 1SGIB 4Y10E 1HJ9A 2ZHWH 5C5OA 1DDJA 4GCHG 4ZROA 3HGNA 2ZQ2A 1ELVA 1TABE 1F5KU 1DANH 3TJNA 1A7SA 2J94A 1P2IA 3GCTG 2R0LA 4MNVA 1KXDA 3M3TA 2HPQH 4INKA 2XXLA 3E3TA 1BT7A 6ESTA 1P9UA 1AFEH 2VH6A 2FI3E 1C2LA 5C1UA 3M3SA 3TK6A 1U6QA 1LVMA 2UUJB 3BTKE 5E0HA 1HJ8A 4D7FA 3GISB 1YC0A 1ZPBA 3DT0H 2UWOA 1WV7H 1D9IA 7GCHG 4Y76A 4ZKNU 1S6HA 3TPIZ 1YCPH 1Y3XA 5L6NH 2D2DA 1IAUA 4IN1A 1AU8A 2F9BH 1P9SA 1JRTA 2CHAB 1YKTA 1HNEE 4ABIA 1O2NA 2JETC 2I6QA 3I77A 4DJZB 2OCVB 3RXKA 4DVAU 2IOTA 5AHGH 4IC5A 1FZZA 3FP7E 4UE7H 2QF0A 4Z0KA 1Z8RA 1O31A 1VJ9U 2OINA 3TVJB 4KKDA 4CRDA 3SU3A 1TPPA 1DT2A 1O5GH 1S85A 2FP7B 3BTTE 4AB8A 1AMHA 3SV7A 4DIHH 3TITA 1W2KH 3U8OH 5FCRA 4LK4A 3A7ZA 1O3GA 1J16A 1ZMLA 1EKBB 2ZP0H 4K69A 1V6DA 5FHTA 1GMDG 1S5SA 2FYQA 4YOJA 1KLIH 4ABBA 3M5LA 3MH5A 1V2QT 3GICB 4NWLA 3WY8A 4FU9A 1XVMA 1O3EA 1O38A 4AX9H 2XRCA 3U1IB 1CGHA 1HJAB 2HLCA 2RA3A 2OD3B 4ZH8A 3EGKH 1PPEE 3QLPH 4NWKA 2EC9H 3D49H 3SQHE 3SV2H 3VGCC 1CA0B 1ZPZA 1MUEB 4D9RA 1MTUA 2ZO3H 3OY6U 2J38A 1Y3YA 1XXFA 2M5TA 1N6XA 1UVSH 4RSPA 4I8GA 3ZZCA 4CHAC 1AZ8A 1FUJA 1MKWH 2XWAA 3DA9B 3ZVEA 1HFDA 2GZ7A 5H4IB 1HCGA 4RKJB 4UONA 2QAAA 1AKSB 4XDEA 3MNXA 3A7TA 6GCHF 4F4OC 1P2JA 1ESTA 2C93B 2Y7XA 4ABDA 1MZDA 2ZKSA 2GDEH 2WPIS 5EW2H 5C20A 1SB1H 2WINI 2Z9KA 2RG3A 3TNSA 3EAJA 1NN6A 2ODYB 3T29A 1LDTT 2XCNA 5DK1A 1J15A 3EE0B 2ZTYA 1WTGH 3LGTA 2ALPA 1G32B 1L4DA 2BDAA 3SNEA 1GHBG 3TK9A 3GY8A 2YOLA 1YPLH 4A1TA 5JB9S 3SUGA 2P8OC 1O3LA 2FLBH 3VEQB 2VWLA 1ABIH 3BG4C 2NU2E 2CMYA 4PROA 2BXTH 1YLDA 3OU0A 3LDXH 2OQUA 5FAHA 1KY9A 1H1BA 1YLCA 5EQSA 1V2WT 4E7RG 1MKXK 2GT7A 3RDZA 2FMJA 5AVDA 3URDA 1TRYA 1VJAU 1KXAA 4WXIA 1MQ5A 2GKVE 1ELGA 4WMFA 3W95A 1RGQA 2Y5HA 5DP4A 2Z9IA 1G3EA 1AB9B 1XXDA 3EYDA 2VIPA 1OYTH 1UCYE 2AYWA 3BTWE 1QJ7B 2ZDVH 1C1SA 1QCPA 2BQ7B 2IN2A 3LJJA 5ETXA 1LVYA 1XMNB 4B71A 3GY3A 1G3DA 1NFWA 3T5FH 5DPAA 4ZMAH 5A0BA 4KGAA 2D1JA 2DE9A 3T62A 1D3PB 4ABHA 1K1IA 5HM2A 1JIRA 5L2ZH 1TLDA 3SJOA 2DE8A 2ZI2H 4I32A 1VITF 2OLGA 4Y8ZA 2ILNA 3MNBA 2HWLB 3RUOA 4ISOA 3M5NA 4WWYA 6CHAC 2BD7A 2FOEA 2F9UA 3VXEH 7KMEH 5A0CA 1AQ7A 1CGJE 3RXSA 1NC6A 1LPKB 1TGSZ 1HBTH 1QQ4A 5LPEA 1O3BA 1DWBH 2QGRA 2XBWA 1CT2E 1EAXA 3O8RA 3VXFH 1KXFA 1HAVA 4BTIB 2QY0B 4YT6H 3PB1E 3SUDA 2Y6TA 1C5OH 4GPGA 2OC7A 4U32A 1O2MA 4B2AA 3TH3H 3FANA 1Q31A 3I78A 1BA8B 1FY4A 3FFGA 1HAPH 4ZXYH 1AO5A 1KDQA 3QK1A 3MYWA 1SI5H 1Z1JA 5DP3A 3FAOA 2VGCC 1A3EH 3KQDA 3E8LA 1QB1A 1SL3A 2CXVA 1O5AB 1WBGB 4X2YA 1THSH 3ZZBA 5HMAA 2W3KA 2WYGA 2R9PA 1LKAA 1XUHA 2FIRH 4D8NA 1D4PB 5FX5A 1UVOA 1E37B 3BSQA 1GDUA 1O2IA 1QBNA 3SUEA 1SC8U 4GHTA 3NUMA 3QN7A 4YZUA 3E1XB 1QRWA 1A0LA 2O8LA 7ESTE 1SMFE 3A86A 4MLFB 4M7GA 4X8SH 3ZVCA 1ELDE 3K9XB 4UFEH 5I25A 1F92A 1TA6A 3HKIB 5J4SA 1UTKA 3BIUH 3M5MA 3PTNA 4ZUHA 1WYKA 4U2WA 1QGFA 3S7HB 1DSTA 1HAZB 2Y5GA 1SGQE 2W3IA 3EDXB 2O9QA 2FI5E 1VCQA 1S0QA 1V2ST 2BDGA 2PW8H 3MTYA 1GJ4H 3VB6A 3O8CA 4IMZA 4BTUB 1L1JA 4CREA 3NKKA 1K2I1 1A2CH 1THPB 3RXMA 3ZZ9A 1QL9A 4MPXA 3LH3A 1EAUA 2AIPA 3RXVA 2R3UA 1LPGB 1S84A 1UHBA 4TWYA 2ULLA 1GBJA 1EASA 2R2WU 2TGAA 3ZV9A 2P3FH 1GJBB 4ZAEA 2C8YB 4ABAA 4BAHB 1GBHA 2CV3A 1WUNH 5HGGA 3LGUA 1Z6EA 2TGPZ 4ZKOU 3DUXH 1T8MA 2BD5A 3DD2H 3N7OA 1SSXA 1BMNH 3SUFA 4ASHA 1OP0A 1TB6H 3L6PA 3PM3A 5J4QA 3Q77A 4FUDA 4X1SU 2GCHF 2SGFE 4MPWA 2FS8A 4LOYH 2OUAA 3KGPA 4INHA 1BMAA 2V35A 1G3BA 3FP8E 1KSNA 1O2VA 1YPKH 4O03A 1MU6B 2ZDKA 1H9IE 4BXSA 3KQCA 4JZEH 2GZ8A 1P8VC 1NO9H 5L2YH 1A0HB 1ETRH 1V2OT 2XCFA 4CR5A 1GDQA 3W94A 1MCVA 3EQ0H 3LGWA 5JBBS 1BTWA 1AWFH 4A1VA 3BTDE 2FDAA 3ATWA 1TBQH 1Y5UT 3D65E 2ZDAH 2G5VA 2FX4A 1TWXB 3MFJA 4X8TH 5DGJA 1GBIA 3PO1B 1EPTB 1GCTC 1SGDE 1QFKH 1H9HE 2VJ1A 1BIOA 1SGFA 1WTHD 2G4TA 3MU4A 5F8XA 1O2KA 1ACBE 4B75A 1EJNA 1WU1A 1C1WH 3FP6E 1G36A 2OBQA 4TPYA 4FUGA 4IC6A 1P05A 4I31A 2FODA 3HK6B 3MU1A 4D9QA 5F6MA 2Y81A 4WVPE 2ZHFH 5E8EH 3K2UA 1C2JA 1G30B 4X1PU 3MU8A 1VITH 2HNTE 1EP6A 1KLTA 1ANBA 2J2UA 1AY6H 1SGFG 2GX4A 3QTOH 4GSOA 5C1XA 3S9BA 1UCYH 2BZ6H 2GVFA 4X1RU 4J1YA 3UTUH 3RM0H 1P11E 1QY6A 2GCTB 1HRTH 2XBVA 4AFQA 4K5ZA 1LO6A 1BMMH 1UVUH 1DY8A 3MH4A 5CMXH 3A7WA 2CJIA 5GDSH 3E91A 1YCPM 1P03A 2HNTF 3O8BA 1RTLA 5EW1H 1UTOA 4X6MA 3QDZB 2GP9B 1N8OC 4X6PA 2BVXH 3RLYH 1BJVA 5ABWA 1GBKA 2BQ6B 1GCDA 3PYHA 1ESAA 1EXFA 2QXGA 1DLKB 1WOFA 1ANCA 3BEIB 1QIXB 2XW9A 5EODA 1ELBA 4K2YA 1BRUP 3ESTA 2P16A 2SFAA 2FOCA 3KF2A 1B5GH 4DW2U 1RTKA 3AASA 3ATLA 3MOCA 4JCNA 2C90B 1O3IA 4I8KA 1UTPA 1C5TA 3BTEE 1P2MA 3V7TA 4UFFH 3ATKA 2A4QA 1C5VA 3CENA 1P2OA 5A2MH 2BDYA 4OS5A 1SFIA 1UHBB 4I33A 4XSKU 4ZKSU 3UPEA 4HFPB 4AFUA 1O3HA 3RXCA 3VB4A 4E7NA 3U9AH 3PROA 1P10A 1GVKB 1PQAA 2SNVA 3GOVB 1E38B 4LZ1H 1OPHB 2P93A 2VIVA 1LQDB 3PMHB 1ZSLA 1OS8A 2STAE 1C5MD 2FWWA 5C3NA 3ZYDA 3RXIA 1DE7H 4Q7XA 1ZGIA 3GCHC 1YPEH 2WPMS 2PKAB 1TE0A 1HIAA 4AOQA 2GDDA 3QZRA 2B9LA 1JMOH 1NESE 8LPRA 1DSUA 1ELTA 2Z3EA 2EEKA 1QQUA 2F9OA 3MH6A 3U8RH 1GBAA 4Q2KA 1ZHPA 3ENSB 1Z6JH 1OWDA 1O3NA 2WYJA 1K1OA 1L1GA 3G01A 3LKWA 5K0HA 1Z8IB 2FYRA 2P3TB 2J95A 4YT7H 4FUFA 3RMNH 9ESTA 1ZPCA 1PJPA 1SLUB 2WPHS 1AIXH 4GCHF 5TJXA 1K1JA 1ZOMA 8KME2 1FQ3A 1JRSA 1ZMJA 1NFUA 2VIDA 3FVFB 3GDSA 5EPNA 2WV5A 1FIZA 3RLWH 1ARBA 3GCTF 2C8WB 4X1NU 4NA9H 1LMWB 5EXLA 3KL6A 1UTJA 2WPJS 2F9NA 1DX5M 3MO3A 2G51A 2TGTA 5T6DA 2FOGA 3UWIA 2ZECA 2C4FH 3KCGH 1ID5H 4NIYA 1K1MA 1EQ9A 2Z3DA 3SJKA 3SU5A 2QIQA 4CH2B 3U69H 3BEUA 7GCHF 1FPHH 1O2PA 4FUHA 1GDNA 1L4ZA 1ZLRA 4D76A 5C2ZA 3BF6H 1GBBA 1V2JT 4TYDA 1C5LH 1MTNB 3ZVDA 1TNKA 1MTVA 2PKSC 2CF9H 4BTTB 1GHZA 3LU9B 1O2ZA 2NU4E 2TPIZ 2F9PA 1O2WA 1PYTD 2AGEX 1HAIH 2QXIA 3ODFA 3HK3B 2FS9A 2Z6BD 2ZCLP 3STIA 2B5TB 2GV6A 1GJAB 2VNTA 1QL7A 4AGJA 1V2TT 4ISHH 2EI8A 2OC1A 1VGCB 3BTGE 1P01A 3BIVH 4MNXA 1CA8B 1LQEA 5EXNA 3RXHA 3UOUA 2J92A 5FPSA 2A7HA 1NU9A 1C1OA 2GGVB 8GCHG 1AVXA 3ZZ3A 2Z9GA 1LVBA 2QYIA 3STJA 1RXPA 1SGNE 2Z7FE 3A8CA 1ZHMA 3CP7A 1PQ8A 2PV9B 1S83A 2FOMB 4Y0ZE 5HYOA 2ZNKH 1TAWA 4ABJA 1MH0A 3OX7U 4TY6A 5AFYH 4GHQA 4DURA 5JBAS 3CS7A 1ELAA 3M7TA 4JZFH 4K8YA 3KIDU 1KLJH 1T8NA 1UJ1A 3A82A 1G3CA 1ETTH 3E90B 3ZZ6A 1Y3WA 2XTTB 2WPLS 1C2FA 2ESTE 1BTHH 3Q3XA 3ZVFA 3UWJH 1RIWB 1AZZA 1QB6A 2OC0A 1TNIA 1C5XB 2Q6GA 1F0RA 1WCZA 4YOGA 1QRZA 3EA7A 1A46H 1S0RA 3MMGA 4JK6A 3T28A 3O8DA 1ZTLA 4AFZA 4AB9A 4JYVH 1MAYA 2BD9A 1DUEA 3P70B 3ATIA 1ELFA 1CGIE 2ODQA 1O2QA 1G37A 4GAWA 1W13U 2BY7X 4ISLA 3RMOH 4GUXA 1C2HA 4BAQB 1AVGH 3TH4H 3KHVA 1XKBC 1W0ZU 1DICA 2C3SA 4A5TS 2ZDMA 1ZTJA 1V3XA 3BEFB 2SGAA 1LHFH 2VIWA 1GG6C 1TPOA 4AORA 1CSOE 2BOHB 3S9CA 2XC4A 1O36A 4BAKB 5JB8S 2ZHDA 3QZQA 4ABEA 4X8UH 1TX7A 4H42U 1BCUH 1C5WB 1L1NA 2VINA 3TJUA 2HALA 3A83A 1V2MT 3SI3H 2PGQB 1K1LA 3LGIA 1O3JA 3IITA 1GVZA 1ANDA 1NFXA 5FCKA 1CO7E 1GBTA 1BTZA 1BZXE 3P95A 4FU7A 5LPFA 1A0JA 1IQHA 2FOAA 2QV1A 5CHAC 1GJCB 1LVOA 4K1EA 1W3CA 4MVNA 1PPHE 3B23B 1AHTH 1C1VH 3R0FA 1TOMH 5F03A 1EOLA 2ZU2A 5FBIA 1CT0E 2AEIH 3RXTA 5EU8A 3V0XA 2OC8A 4B2CA 4UDWH 1L0ZA 3EA9A 4X0WU 3SNCA 1V2KT 1TNHA 1ZR0A 2BD3A 2AMPA 2ZPRA 2ZPQA 1HAYB 1O3CA 4Y7AA 5K7RA 4YOIA 3JZ2B 5GJ4B 4ABGA 3UNRA 3K6YA 4WMDA 3PMJA 1BRBE 5SGAE 1TBZH 5FPTA 1O2OA 2A32A 1GJ9B 8ESTE 3TU7H 3RM2H 1GGDC 3QTVH 1INCA 3FZDA 3AAVA 4WMEA 3V12A 3ZV8A 1AFQC 2P94A 5BRRE 1AD8H 1GPZA 2Z9JA 4OS4A 2W7UA 2G5NA 3VB5A 1C5PA 1BITA 3SGQE 5DG6A 3T26A 2H9HA 2I6SA 2K1QA 3TK5A 2VWNA 3RU4E 1A5IA 4SGAE 2XYAA 2EA3A 3R3GB 1FAKH 3ELAH 3HKJB 1SPJA 2BY8X 2CGAA 5C5NA 2A2XH
chains in the Genus database with same CATH superfamily
1AVWA 3LT3A 3SZNA 4NGAH 2ZC9H 1O2UA 1HAXB 4WF8A 1PQ5A 1K1PA 5F8TA 3MNCA 3UQVA 2EI6A 2V7QD 2QN5T 3QGNB 2BD4A 2O8UA 1FDPA 1BJUA 4B74A 1KTSB 1UTQA 2FOFA 4H6TA 1YPHE 4R0IA 3JZ1B 3M5OA 1GWAA 4X2XA 3RU4T 1TMTH 5IDKA 5EOKA 3OEED 1Z8GA 4HGCA 1QR3E 3SJ8A 4Q80A 2G55A 3SU1A 5DP6A 2HVXA 3M61U 1FMGA 1E36B 2HPPH 1MU8B 1SOZA 2XC5A 2V3HH 4E06H 4XD7D 3KYFA 1GHAG 2UWLA 3A8DA 3P17H 3ZZ7A 2ZU4A 1FY5A 1VKYA 3RMLH 5CDFE 3U8TH 5T6GA 1BMLA 1P2QA 4NIVA 3LGVA 4DY7B 1FXYA 2V3OH 1SQTA 5HKKD 4B73A 4X1QU 4RI0A 5DP8A 3F68H 1BOQA 1Z71A 2BD2A 3OE7D 4GVUA 3MO6A 4ZHAA 2H1UA 1QL8A 2VB0A 2BQWB 1NFYA 1GBFA 1EOJA 5AF9H 4NSVA 5GCHF 2RDLA 2ASUB 1T8OA 2PR3A 2G52A 4ZKRU 3KYGA 3D62A 3BTQE 1A3BH 1UCYK 2CF8H 1C4U2 2Y80A 1W12U 2BB4A 1IQJA 1W7XH 4KTCA 1L2EA 4UFDH 2JH0D 1H9LB 3S0NA 1TPSA 3U1JB 1NY22 3OFND 1ZMNA 2HVYB 4F48B 2BM2A 2F91A 3QGJA 3MWIU 1SGYE 3K6ZA 4BAOB 1EUFA 3SU6A 4ISNA 4NIWA 3ZZAA 1J9CH 2BTCE 1O2YA 1AGJA 1Y5AT 3E6PH 3RXBA 1LPZB 3MNSA 1GMHF 1ZTKA 2ANWA 2J98A 1BBRH 2A5KA 3GCOA 3F9EA 1H8DH 1C9TA 1IQNA 3GY6A 1PQ7A 5E0GA 2ZHQH 3OSYA 1O32A 2JETB 5HXFA 1H8IH 5PTPA 1QBOA 4BOHA 6LPRA 3ZZ8A 3VFEA 3SHCH 2SGDE 2NWNA 5E2OA 1K21H 4WH6A 2ZFSA 1SOTA 2CHAC 5ESTE 5EQQA 2NU3E 4DOQA 4D7GA 4O3TA 2XBXA 1GVLA 1IQGA 2HNTC 1NRQH 5G4BA 4JYUH 1XM1A 5FBEA 5HIYA 1GBMA 1O35A 4NFFA 1NPMA 1XKAC 1D6RA 2YMSD 1MD8A 1C2KA 1DPOA 1YPGH 2ZGBH 1C2EA 3DFJA 1MTSA 4I8LA 5FXLA 1CVWH 4OGXA 1TRMA 2ZPSA 3A89A 3F2GA 4AG2A 1NTPA 3V3MA 4OS2A 1TMBH 1UTLM 3LGYA 3T27A 1KIGH 1SGCA 2CK3D 1JXPA 1QTFA 1SLXB 4NZQA 4WXVA 1TQ7B 1C2DA 2BOKA 2XC0A 2ZEBA 3CS0A 3VGCB 2B7DH 1F5RA 3M37A 1DUAA 2G8TA 1XUFA 3F2FA 3P92A 4OS6A 1DXWA 1Y3UA 2ZFPH 2PSXA 3SYJA 1XUKA 1HJAC 1QNJA 1MMJN 1NS3A 3SGAE 1HAVB 1ORFA 2ZU5A 4XBBA 3T2NA 4CHAB 4AYYB 1OWEA 1C5ZB 3GY2A 1CA0C 4K1SA 2VIQA 2W26A 3F2HA 2FXRA 4Z1MD 1P2KA 2PUXB 1TX8A 2SGQE 1O2HA 1MTWA 4Q7YA 1KDQB 4F55A 1QBVH 1NROH 1TBRH 2ODPA 3Q3KA 3RXFA 1GHXH 3RXRA 3A85A 3PTBA 4Q7ZA 3LJOA 1O5FH 1OOKB 1SQAA 2FLRH 4TT3D 4DT7B 3QWCH 2A0QB 3DCLA 1BHXB 2Q6FA 1BRCE 2PWXA 2H6MA 2QE7D 3SJ9A 4XBDA 1IQKA 2ZFFH 1DOJA 2KM0A 2RCEA 4IS5A 1WDIA 5EGMA 1W0YH 3BG8A 1G9IE 1PFXC 3UREA 1ESBA 2ZCHP 2BX4A 3ZZDA 1C5SA 2BDHA 2P8OB 1GJDB 3H5CB 1T8LA 1B0FA 3A88A 1FY1A 1C5QA 1C5YB 1O2TA 1UMAH 3SORA 1XUGA 4P02A 1IHTH 1BTPA 2YNAA 1X7AC 1BTYA 2FEQH 2FZZA 2ZFRH 3GY5A 2IJOB 3OYPA 3BN9A 1PYTC 5HM9A 1SGRE 2OQ5A 3K65B 2BXUH 3RXUA 2J9NA 2XWBI 3PLPA 2VIOA 3RXAA 2SGPE 2F4LA 1C5NH 4AGKA 2B0FA 2Q6DA 3LOXA 2G81E 1ZJKA 1GI8B 2KCPA 2XBYA 3OY5U 1SKYE 1B0EA 4NA7A 4ASUD 4HI3A 2F9VA 3ZZ4A 1O30A 2ZU3A 4R8TB 3SJIA 4CRFA 1O33A 3A80A 1FN8A 1AB9C 1EZUC 3LC3A 2A31A 1ZJDA 1S81A 2LP6A 5F8ZA 1W8BH 1O2RA 2KX4A 1BB0B 1ZZZA 3KQEA 2A5AA 3DHKH 1P09A 3GDUA 2Y82A 1K28D 2KAIA 3KNXA 3DSPA 4OS7A 3ATMA 1P04A 2VWOA 3C1KA 2ZQ1A 1HB0B 1GMCG 1HAHH 1QURH 1S82A 1TNGA 3MI4A 6CHAB 3FZZA 1O3FA 4SGBE 5T1VA 4UD9H 5FX6A 1AN1E 1TA2A 1KXCA 1GBDA 1EB2A 1F2SE 2BVSH 1QA0A 4HTCH 3RXJA 4IMQA 4DIIH 5A09A 3GCNA 5A8YA 1IQMA 3T25A 1TIOA 2AIQA 3H7OA 2WUBA 3UFAA 2V6NA 2YNBA 3FOAA 3S7KB 3BTHE 4JK5A 4JZDH 2JH6D 2P59A 2A7JA 3A7YA 1OWIA 1TPAE 2JJ1D 1BUIA 1LHGH 2GZ9A 1FY3A 1HV7A 1V2NT 1DITH 3GY7A 1ARCA 2B8OH 2Q1JA 1BDAA 2VGCB 2QF3A 1XX9A 3E0NB 1CHOG 5CHBA 1AUJA 4P00A 1C1UH 2ZDNA 1OWHA 3GDVA 1O3DA 2Z94A 1AKSA 2FTMA 3GY4A 1RRKA 1E34B 1P3CA 1MBMA 5B6LA 2ANMH 4NIXA 1FONA 1JBUH 1XUJA 1NZQH 4YLQH 4F49A 4ESTE 5EIYA 3F3BA 3Q3YA 2ZGHA 2ZU1A 3HATH 3MU0A 2SNWA 4NSYA 1FI8A 2VWMA 1ABJH 1C1MA 1YPJH 2TGDA 1EZXC 1HYLA 4QT8C 5EXMA 1W10U 3SU4A 1IQFA 1OYQA 3C27B 3NK8A 1G2LA 1DWEH 3TH2H 2ZGJA 1P12E 4DT4A 3NPSA 1YM0A 3UOPA 1P06A 1F0SA 1P57B 4JMYA 2BYAX 1AWHB 1DXPA 3SV8A 1G2MA 1T31A 1IQEA 3EA8A 1QHRB 1XVOA 1GHVH 3FN8A 3A81A 2AHME 3L33A 2H5CA 4ABFA 1GHYH 2GMTB 4FUEA 5DP5A 1QRXA 1GMDF 4K60A 2PHBA 1H8HD 2ANKH 3V13A 4KTUA 3PRBA 4CBNA 5T6FA 4WH8A 2F83A 4XFQA 1SFQB 3SU0A 2ANYA 4Y79A 2FOHA 2QXHA 1BQYA 1C1TA 1SVPA 4OS1A 5A0AE 5GPIB 1P0SH 1NRNH 1Y8TA 2BLWA 2BDIA 1BTXA 3UUZA 3VPKA 1CBWB 4O97A 1IQLA 1LKBA 1NRPH 4FVDA 4NCYA 5EJZA 1NU7B 4CRBA 3F1SB 1ZYOA 4I8HA 4CR9A 1VR1H 4K8BA 4AC9A 3QUMP 3RXGA 3M7UA 2AMQA 2PUQH 2AH4X 5LH8A 3NRLA 1V2LT 2XNIA 3UNSA 2AERH 4A92A 2A2QH 2GTBA 5LGOA 3RXEA 2R0KA 1EJAA 2BVRH 4MTBA 1HIAB 3NWUA 1A61H 1GJ7B 3L3TA 3W1EA 2KAIB 2K8IA 1BBRE 5DKMA 1M9UA 3URCA 3PV4A 1PPBH 4I7YH 3TJOA 3SBKA 3RXDA 1HLTH 3BTFE 1AE8H 4KTSA 1FPCH 1GI1A 5C0TA 2C8XB 1YYY1 1JWTA 4YTAA 1GL1A 1GHBF 1GCTB 1W0JD 7LPRA 2ZIQH 1TNJA 2GD4B 2ZCKP 1K1NA 1CE5A 3RXOA 1BTUA 1W14U 4UEHH 3PO1C 1EPTC 1SHHB 1O5EH 1EP5A 4DG4A 1SR5C 1YGCH 4J2YB 3S69A 3F9GA 2Z3CA 4Y8XA 1A4WH 2AS9A 4FU8A 4JZ1A 3AVZA 3QO6A 1O3OA 1VZQH 4A1XA 1KXEA 2H9EH 5FPYA 3Q76A 2FX6A 1GBEA 5JYIA 1JOUB 2GJGA 4X6OA 1C2GA 4GLYA 1UK3A 4IGDA 3M36A 3B8JA 2ZF0H 2FI4E 5EQRA 1EJMA 2EI7A 1C4Y2 1V2RT 1EZSC 1FAXA 3P8GA 2XOKD 1UK2A 5DP7A 1S6FA 3ZZ5A 1T7CA 3OAAD 2JDID 1UO6A 2UUFB 1YPHC 1UTMA 2GCTC 3FKSD 2FTLE 4YLUA 2BDBA 1N8OB 3IWMA 2UUKB 3MU5A 1C1NA 4RKOB 4OGYA 4TY7A 1O5CB 1DFPA 3P8NA 3PMBB 1OWJA 3MHWU 4RN6A 1RFNA 3ZVBA 1JIMA 2HRVA 5JDUB 4AG1A 4VGCB 3PMAB 1O2GH 1ZGVA 1MQ6A 3WWBA 2HLDD 2BD8A 3RXPA 1Q2WA 1YLNA 1TONA 1BBRK 6GCHG 3UY9A 1ZHRA 2QF5A 4FVBA 4INLA 1FJSA 1MD7A 1ZRKA 3UIRA 3SW2B 1A5HA 5I46H 1GHAF 5EPYA 2ZFQH 2ZHEH 3KQBA 3ZVAA 4NZLA 5AFZH 4B76A 1TFXA 1D3DB 2C8ZB 4NG9H 1C1PA 3SHAH 2D8WA 1P02A 3GCHB 1GI4A 1VCWA 3HGPA 1LCYA 3MO9A 4TPIZ 3SV9A 2V0BA 4ZXXH 2TIOA 2IPHA 1GBLA 1P2NA 3WW7A 1MBQA 5L30H 3SV6A 1GBCA 1C2IA 1ZSJA 1Z8JB 5GWZA 4WJG2 2BLOA 4E05H 3SGBE 2SGEE 2QCYA 4A6LA 5E0JA 2ZG0H 1SHYA 1O2SA 1KTTB 2PLXA 2A4RA 1O5DH 1O2XA 3F6UH 1DLEA 2YMSC 2BMGB 2WPKS 3RC6A 2W5EA 4NFEA 3TJVA 1GI2A 5JBTA 1PPGE 2AGGX 2GT8A 2OXSA 1BHXF 3NZIA 1UVPA 3RU4D 4O9VA 5CE1A 4AZ2B 1EPTA 4BXWA 1O39A 1J8AA 3RXLA 3NCLA 1RD3B 3LIWA 2G4UA 1AI8H 1IQIA 4HZHA 4LXBH 4TWWA 1TNLA 1TMUH 1OWKA 2PFEA 1WSSH 2WUCA 2Z9LA 1PPFE 3MQKC 1GI5A 1IOEA 1N1LA 4Y11E 1O5BB 1NRSH 2BHGA 1SBWA 3VB7A 1VITG 1A1RA 2J4IA 2OBOA 2FPZA 3OTJE 1SLVB 4NA8A 1V2UT 1O3MA 3TNTA 4AYVB 2BZAA 1ELCA 2PKSB 1LHEH 1HXEH 2W7SA 2H9TH 1OP8A 1KXBA 1VCPA 1DS2E 1MTNC 4DGJA 1GHWH 9LPRA 3UAIC 2OK5A 4MG3A 1ELEE 5IYTA 1DVAH 3RMMH 4XE4A 5DP9A 3A8BA 2BLVA 1OKXA 1O34A 3AW0A 1Z1IA 1UTNA 3B9FH 2Y5FA 1AUTC 3ODDA 4CRCA 3A7VA 1TOCB 4KELA 3SNBA 3KEEA 1O0DH 4X6NA 1VGCC 1MAXA 3UR9A 5KGOA 5GNDA 1C2MA 1MKXH 2R3YA 3QX5H 2P3UB 1CQQA 4Y8YA 2GMTC 3DSGA 3UNQA 1B7XB 2G00A 1E35B 1F0TA 1FNIA 1HUTH 4FUJA 2WV4A 2F3CE 4B2BA 1O2LA 1Y59T 1P3EA 1KYNA 2P95A 2ZZUH 4X8VH 5GCHG 1GI7B 2KCOA 3BTME 1SG8B 2JKHA 2QXJA 1RS0A 1QA7A 1GI3A 1N6YA 4IBLH 5A8ZA 1K9OE 3E0PB 1FIWA 5C1YA 1C5RA 3TLOA 2Y7ZA 1F5LA 1LHDH 3SN8A 1MZAA 2ZDLA 5T3HA 4JZIA 1AE5A 2ZWLH 4BAMB 3SQEE 1TYNA 2PKAA 2RA0A 1E0FD 3A84A 4MDSA 1CBWC 5JPMH 1FN6A 3A7XA 1O3PB 1HAGE 1E1QD 2VH0A 2A4OA 1QJ6B 1GI9B 1RIWC 2AFQB 4ISIH 2BY9X 1YPMH 4AFSA 1FLEE 4U01A 3DFLA 1OX1A 2NU0E 1NRRH 1GMHG 4XOJA 4Y71A 2O8WA 3LONA 2ZGCA 2ZFTA 1SGEE 4FUIA 3S9AA 3M7QA 1WAYB 3SOSA 3M35A 4FXGH 1C5UA 2R2MB 1DY9A 2TRMA 1J17T 2UWPA 4UFGH 1GG6B 4JYTA 2O8TA 2LPRA 5GXPA 3SI4H 3AAUA 3GYMA 1Y5BT 2GCHG 3UQOA 2DUCA 2BX3A 2A45B 1PPCE 4AN7A 3HPTB 3PWBA 1HAOH 3U98H 1ETSH 2GV7A 4XBCA 4X2WA 5DO4H 1NT1A 1WQSA 2ZA5A 3ITIA 1ZRBA 2CN0H 2JJ2D 2ALVA 4ZHMU 5CHAB 2OP9A 1J14A 1SGPE 2BY5X 1GJ8B 5ESBA 2A7CA 2J97A 4B1TA 1MCTA 1YF4A 4CH8B 1C4V2 3M3VA 1BMFD 2VVVA 4X2VA 1T32A 5E2PA 3H7TA 3SNDA 3BG4B 3D23A 2O8MA 3F9FA 3I29A 1TGNA 1DWDH 3Q00A 3F9HA 4RT0A 1EZQA 3PLKA 1PPZA 2A5IA 3ZVGA 1ANEA 2THFB 3BV9B 1GJ6A 1RTFB 1A5GH 1TGCA 1CHGA 1GMCF 5C67A 4Y0YE 1K22H 4KP0A 1WQVH 3P8OA 2A4GA 1GI0A 3ZYEA 4MPUA 4Y7BA 2TBSA 2QC2A 1HXFH 1GGDB 1H8ED 1LTOA 1HGTH 1THRH 2L74A 1AFQB 1TX6A 1TQ0B 1GL0E 5B6OA 2J34A 1O3KA 3SO3A 1T4UH 2J98B 1EAIA 2VVCA 4VGCC 2RFKC 2HGTH 1W7GH 3TGIE 2FOBA 4MPVA 1TGTA 3SNAA 1Y3VA 4U30A 5BPEA 1YCPK 1EATA 5LPRA 1C9PA 1W11U 4O3UA 1DWCH 5A8XA 1CT4E 1F0UA 1CHOF 1SLWB 4IN2A 1QB9A 2H2ZA 2H5DA 4FUCA 4ZHLU 2OTVA 4CBOA 3P8FA 3TIUA 5DSFA 2WHXA 4H4FA 2VVUA 2FESH 3P6ZB 1OXGA 4MNWA 2VU8E 4CRAA 2ZTXA 2PTCE 1SQOA 4K3JA 4DCDA 1O3AA 1D3QB 4MNYA 1OSSA 1Z7KA 1C1RA 1HPGA 4Q4LA 3AW1A 1EB1H 1YWUA 2A1DB 1OP2A 3MH7A 3SU2A 2QA9E 1IHSH 4LZ4B 1O37A 3IG6B 1V2PT 4YESB 5HIZA 1UVTH 4YO9A 4CRGA 1YBWA 1RJXB 1BRAA 4MQAA 4FUBA 1V2VT 2UUYA 1GI6A 4THNH 1LHCH 2D26C 4BNRA 3TGJE 5JBCS 4H6SB 2LNCA 4BANB 1FY8E 1H4WA 2BDCA 1D6WA 2STBE 1FV9A 3VB3A 4YM9A 2PSYA 5GIBA 1EAWA 1O2JA 1D3TB 2ZGXH 2AMDA 3RC5A 1DM4B 4A7IB 3LH1A 2NU1E 1C1QA 2BY6X 2FM2A 4WY3A 1SGTA 1EX3A 5TCCA 2FO9A 3RC4A 8GCHF 1ZSKA 3LC5A 1GJ5H 3PWCA 1TRNA 1XUIA 3KN2A 3RP2A 1MKWK 3GYLB 1TALA 3PLBA 4I8JA 5TCAA 2PGBB 1T4VH 4Z6AH 2PTNA 1UK4A 2BLQA 1HDTH 1TGBA 3LPRA 3TGKE 1F7ZA 1YP9A 2AGIX 3NXPA 4Y6DA 1CU1A 2HOBA 5EG4A 3A87A 1Q3XA 3E16B 1QJ1B 2JH5D 4IW4E 2M2AA 3RXQA 2ZTZA 3UR6A 1NM6A 3OTPA 1W0KD 3A8AA 5DJ7A 4K1TA 1SGIB 3DSOA 4Y10E 1HJ9A 2ZHWH 5C5OA 1DDJA 4GCHG 4ZROA 3HGNA 2ZQ2A 1ELVA 1TABE 1F5KU 1DANH 3TJNA 1A7SA 2J94A 1P2IA 3GCTG 2R0LA 4MNVA 1KXDA 3M3TA 2HPQH 4INKA 2XXLA 3E3TA 1BT7A 6ESTA 1P9UA 1AFEH 2VH6A 2FI3E 1C2LA 5C1UA 3M3SA 1SQRA 3TK6A 1U6QA 1LVMA 2UUJB 3BTKE 5E0HA 1HJ8A 4D7FA 3GISB 1YC0A 1ZPBA 3DT0H 2UWOA 1WV7H 1D9IA 7GCHG 4Y76A 4ZKNU 1S6HA 3TPIZ 1YCPH 1Y3XA 5L6NH 2D2DA 1IAUA 4IN1A 1AU8A 2F9BH 1P9SA 1JRTA 2CHAB 1YKTA 1HNEE 4ABIA 1O2NA 2JETC 2I6QA 3I77A 3F0PA 4DJZB 2OCVB 3RXKA 4DVAU 1K0HA 2IOTA 5AHGH 4IC5A 1FZZA 3FP7E 4UE7H 2QF0A 4Z0KA 1Z8RA 1O31A 2RDEA 1VJ9U 2OINA 3TVJB 4KKDA 4CRDA 3SU3A 1TPPA 1DT2A 1O5GH 1S85A 2FP7B 3BTTE 4AB8A 1AMHA 3SV7A 4DIHH 3TITA 1W2KH 3U8OH 5FCRA 4LK4A 3A7ZA 1O3GA 1J16A 1ZMLA 1EKBB 2ZP0H 4K69A 1V6DA 5FHTA 1GMDG 1S5SA 2FYQA 4YOJA 2V3MA 1KLIH 4ABBA 3M5LA 3MH5A 1V2QT 3GICB 4NWLA 3WY8A 4FU9A 1XVMA 1O3EA 1O38A 4AX9H 2XRCA 3U1IB 1CGHA 1HJAB 2HLCA 4HG6A 2RA3A 2OD3B 4ZH8A 3EGKH 1PPEE 3QLPH 4NWKA 2EC9H 3D49H 3SQHE 3SV2H 2F43B 3VGCC 1CA0B 1ZPZA 1MUEB 4D9RA 1MTUA 2ZO3H 3OY6U 2J38A 1Y3YA 1XXFA 2M5TA 1N6XA 1UVSH 4RSPA 4I8GA 3ZZCA 4CHAC 1AZ8A 1FUJA 1MKWH 2XWAA 2XNDD 3DA9B 3ZVEA 4ACBA 1HFDA 2GZ7A 2PP6A 1HCGA 4RKJB 5H4IB 4UONA 2QAAA 1AKSB 4XDEA 3MNXA 3A7TA 6GCHF 4F4OC 1P2JA 1ESTA 2C93B 2Y7XA 4ABDA 1MZDA 2ZKSA 2GDEH 2WPIS 5EW2H 5C20A 1SB1H 2WINI 5IK2D 2Z9KA 2KCYA 2RG3A 3TNSA 3EAJA 1NN6A 2ODYB 3T29A 1LDTT 2XCNA 5DK1A 1J15A 3EE0B 2ZTYA 1WTGH 3LGTA 2ALPA 1G32B 1L4DA 2BDAA 3SNEA 1GHBG 3TK9A 3GY8A 2YOLA 1YPLH 4TSFD 4A1TA 5JB9S 3SUGA 2P8OC 1O3LA 2FLBH 3VEQB 2VWLA 1ABIH 3BG4C 2NU2E 2CMYA 2IPQX 4PROA 2BXTH 5EJ1A 1YLDA 3OU0A 3LDXH 2OQUA 5FAHA 1KY9A 2KZ4A 1H1BA 1YLCA 5EQSA 4RT1A 1V2WT 1WXRA 4E7RG 1MKXK 2GT7A 3RDZA 2FMJA 5AVDA 3URDA 1TRYA 5C0UA 1VJAU 1KXAA 4WXIA 1MQ5A 2GKVE 1ELGA 4WMFA 3W95A 1RGQA 2Y5HA 5DP4A 2Z9IA 1G3EA 1AB9B 2WV9A 1XXDA 5KEDA 3EYDA 2VIPA 1OYTH 2EY4C 1UCYE 2AYWA 3BTWE 1QJ7B 2ZDVH 1C1SA 1QCPA 2BQ7B 2IN2A 3LJJA 2EQNA 5ETXA 1LVYA 1XMNB 4B71A 2VBCA 3GY3A 1G3DA 1NFWA 3T5FH 5DPAA 4ZMAH 5A0BA 3CNRA 4KGAA 2D1JA 2DE9A 3T62A 1D3PB 4ABHA 1K1IA 5HM2A 1JIRA 5L2ZH 3KQ5A 1TLDA 3SJOA 2DE8A 2ZI2H 4I32A 1VITF 2OLGA 4Y8ZA 2ILNA 3MNBA 2HWLB 3RUOA 4ISOA 1E79D 3M5NA 4WWYA 6CHAC 2BD7A 2FOEA 2F9UA 3VXEH 7KMEH 5A0CA 1AQ7A 1CGJE 2JIZD 3RXSA 1NC6A 1LPKB 1TGSZ 1HBTH 1QQ4A 5LPEA 1O3BA 1DWBH 2QGRA 2XBWA 1CT2E 1EAXA 3O8RA 3VXFH 1KXFA 1HAVA 4BTIB 2QY0B 4YT6H 3PB1E 3SUDA 2Y6TA 1C5OH 4GPGA 2OC7A 4U32A 1O2MA 4B2AA 3TH3H 3FANA 1Q31A 3I78A 3FO8D 1BA8B 1FY4A 3FFGA 1HAPH 4ZXYH 1AO5A 1KDQA 3QK1A 3MYWA 5C17A 1EFRD 1SI5H 1Z1JA 5DP3A 3FAOA 2WSSD 2VGCC 1A3EH 3KQDA 3E8LA 1QB1A 1SL3A 2CXVA 1O5AB 1WBGB 4FOUC 4X2YA 1THSH 3ZZBA 5HMAA 2W3KA 2WYGA 2R9PA 1LKAA 1XUHA 2FIRH 4D8NA 1D4PB 5FX5A 1UVOA 1E37B 3BSQA 1GDUA 1O2IA 1QBNA 3SUEA 1SC8U 4GHTA 3NUMA 3QN7A 4YZUA 3E1XB 1QRWA 1A0LA 4ZCNA 2O8LA 4M9FA 7ESTE 1SMFE 3A86A 4MLFB 4M7GA 4X8SH 3ZVCA 1ELDE 3K9XB 4UFEH 5I25A 3N7EA 1F92A 1TA6A 3HKIB 5J4SA 1UTKA 3BIUH 3M5MA 3PTNA 4ZUHA 1WYKA 4U2WA 1QGFA 3S7HB 1DSTA 1HAZB 2Y5GA 1SGQE 2W3IA 3EDXB 2O9QA 2FI5E 1VCQA 1S0QA 1V2ST 2BDGA 2PW8H 3MTYA 1GJ4H 3VB6A 3O8CA 3U28C 4IMZA 4BTUB 1L1JA 4CREA 3NKKA 1K2I1 1A2CH 1THPB 1KMHB 3RXMA 3ZZ9A 1QL9A 4MPXA 3LH3A 1EAUA 2AIPA 3RXVA 2R3UA 1LPGB 1S84A 1UHBA 4TWYA 2ULLA 1GBJA 1EASA 2R2WU 2TGAA 3ZV9A 2P3FH 1GJBB 4ZAEA 2C8YB 4ABAA 4BAHB 1GBHA 2CV3A 1WUNH 5HGGA 3LGUA 1Z6EA 2TGPZ 4ZKOU 3DUXH 1T8MA 2BD5A 3DD2H 3N7OA 1SSXA 1BMNH 3SUFA 4ASHA 1OP0A 1TB6H 3L6PA 3PM3A 5J4QA 3Q77A 4FUDA 4X1SU 2GCHF 2SGFE 4MPWA 2FS8A 4LOYH 2OUAA 3KGPA 4INHA 1BMAA 3PRDA 2V35A 2KR7A 1G3BA 3FP8E 1KSNA 1O2VA 1YPKH 4O03A 1MU6B 2ZDKA 1H9IE 4BXSA 3KQCA 4JZEH 2GZ8A 1P8VC 1NO9H 5L2YH 1A0HB 1ETRH 1V2OT 2XCFA 4CR5A 1GDQA 3W94A 1MCVA 3EQ0H 3LGWA 5JBBS 1BTWA 1AWFH 4B6FA 4A1VA 3BTDE 2FDAA 3ATWA 1TBQH 1Y5UT 3D65E 2ZDAH 2G5VA 2FX4A 1TWXB 3MFJA 4X8TH 5DGJA 1GBIA 3WWFA 3PO1B 1EPTB 1GCTC 1SGDE 1QFKH 1H9HE 2VJ1A 1BIOA 1SGFA 1WTHD 2G4TA 3MU4A 5F8XA 1O2KA 1ACBE 4B75A 1EJNA 1WU1A 1C1WH 3FP6E 1G36A 2OBQA 4TPYA 4FUGA 4IC6A 5EJLA 1P05A 4I31A 2FODA 3HK6B 1OHHD 3MU1A 4D9QA 5F6MA 2Y81A 4WVPE 2ZHFH 5E8EH 3K2UA 1C2JA 1G30B 4X1PU 3MU8A 1VITH 2HNTE 1EP6A 1KLTA 1ANBA 2J2UA 1AY6H 1SGFG 2GX4A 3QTOH 4GSOA 5C1XA 3S9BA 1UCYH 2BZ6H 2GVFA 4X1RU 4J1YA 3UTUH 5F53A 3RM0H 1P11E 1QY6A 2GCTB 1HRTH 2XBVA 4AFQA 4K5ZA 1LO6A 1BMMH 1UVUH 1DY8A 3MH4A 5CMXH 3A7WA 2CJIA 5GDSH 3E91A 1YCPM 1P03A 2HNTF 3O8BA 1RTLA 5EW1H 1UTOA 4X6MA 3QDZB 2GP9B 1N8OC 4X6PA 2BVXH 3RLYH 1BJVA 5ABWA 1GBKA 2BQ6B 1GCDA 3PYHA 1ESAA 1EXFA 2QXGA 1DLKB 1WOFA 1ANCA 3BEIB 1QIXB 2XW9A 5EODA 1ELBA 4K2YA 1BRUP 3ESTA 2P16A 3UB0A 2SFAA 3PV5A 2FOCA 3KF2A 1B5GH 4DW2U 1RTKA 3AASA 3ATLA 3MOCA 4JCNA 4OM9A 2C90B 1O3IA 4I8KA 1UTPA 1C5TA 3BTEE 1P2MA 3V7TA 4UFFH 3ATKA 2A4QA 1C5VA 1FX0B 3CENA 1P2OA 5A2MH 1E1RD 2BDYA 4OS5A 1SFIA 1UHBB 4I33A 4XSKU 4ZKSU 3UPEA 4HFPB 4AFUA 1O3HA 3RXCA 3VB4A 4E7NA 3U9AH 3PROA 1P10A 1GVKB 1PQAA 2SNVA 3GOVB 1E38B 4LZ1H 1OPHB 2P93A 2VIVA 1LQDB 3PMHB 1ZSLA 1COWD 1OS8A 2STAE 1C5MD 2FWWA 5C3NA 3ZYDA 2W6ID 1DE7H 3RXIA 4Q7XA 1ZGIA 3GCHC 1YPEH 2WPMS 2PKAB 3N7DA 1TE0A 1HIAA 3OEHD 4AOQA 2GDDA 3QZRA 2B9LA 1JMOH 1NESE 8LPRA 2YMSB 1DSUA 1ELTA 2Z3EA 2EEKA 1QQUA 2F9OA 3MH6A 3U8RH 1GBAA 4Q2KA 1ZHPA 3ENSB 1Z6JH 1OWDA 1O3NA 2WYJA 1K1OA 1L1GA 3G01A 3LKWA 5K0HA 2J5UA 1Z8IB 2FYRA 2P3TB 2J95A 4YT7H 4FUFA 3RMNH 9ESTA 1ZPCA 3F0OA 1PJPA 4YXWD 1SLUB 2WPHS 1AIXH 4GCHF 5TJXA 1K1JA 1ZOMA 8KME2 1FQ3A 1JRSA 1ZMJA 1NFUA 2VIDA 3FVFB 3GDSA 5EPNA 2WV5A 1FIZA 3RLWH 1ARBA 1S6LA 3GCTF 2C8WB 5KECA 4X1NU 4NA9H 1LMWB 5EXLA 1NBME 3KL6A 1UTJA 2WPJS 2F9NA 1DX5M 3MO3A 2G51A 2TGTA 5T6DA 2FOGA 3UWIA 2ZECA 2C4FH 3KCGH 1ID5H 1QZ8A 4NIYA 1K1MA 1EQ9A 2Z3DA 3SJKA 4B6EA 3SU5A 2QIQA 4CH2B 3U69H 3BEUA 7GCHF 1FPHH 1O2PA 4FUHA 2QF4A 1GDNA 2WPDD 1L4ZA 1ZLRA 4D76A 5C2ZA 3BF6H 1GBBA 1V2JT 4TYDA 1C5LH 1MTNB 3ZVDA 1TNKA 1MTVA 2PKSC 2CF9H 4BTTB 1GHZA 3LU9B 1O2ZA 2NU4E 2TPIZ 2F9PA 3SZEA 1O2WA 1PYTD 2AGEX 1HAIH 2QXIA 3ODFA 3HK3B 2FS9A 2Z6BD 2ZCLP 3STIA 2B5TB 2GV6A 1GJAB 2VNTA 1QL7A 4AGJA 1V2TT 4ISHH 2EI8A 1VGCB 2OC1A 3BTGE 1P01A 3BIVH 5FL7D 4MNXA 1NBMD 1CA8B 1LQEA 5EXNA 3RXHA 3UOUA 2J92A 5FPSA 2A7HA 1NU9A 1C1OA 2GGVB 8GCHG 1AVXA 3ZZ3A 2Z9GA 1LVBA 4XRNA 2QYIA 3STJA 1RXPA 1SGNE 2Z7FE 3A8CA 1ZHMA 3CP7A 1PQ8A 2PV9B 1S83A 2FOMB 4Y0ZE 5HYOA 2ZNKH 1TAWA 4ABJA 1MH0A 2IJD1 3OX7U 4TY6A 5AFYH 4GHQA 4DURA 5JBAS 5DN6D 3CS7A 1ELAA 3M7TA 1YY3A 4JZFH 3N99A 4K8YA 3KIDU 1KLJH 1T8NA 1UJ1A 3A82A 1G3CA 1ETTH 3E90B 3ZZ6A 1Y3WA 2XTTB 2WPLS 1C2FA 2ESTE 1BTHH 3Q3XA 3ZVFA 3UWJH 1RIWB 1AZZA 1QB6A 2OC0A 1TNIA 1C5XB 2Q6GA 2K0QA 1F0RA 1WCZA 4Q63A 1QRZA 3EA7A 1A46H 1S0RA 3MMGA 4JK6A 4YOGA 3T28A 3O8DA 1ZTLA 4AFZA 4AB9A 4JYVH 1MAYA 2BD9A 1DUEA 3P70B 3ATIA 1ELFA 1CGIE 2ODQA 1O2QA 1G37A 4GAWA 1W13U 3GS9A 2BY7X 2WZQA 2KFWA 4ISLA 3ZIAD 3RMOH 4GUXA 1C2HA 4BAQB 1AVGH 3TH4H 3KHVA 1XKBC 1W0ZU 1DICA 2C3SA 4A5TS 2ZDMA 5C94A 1ZTJA 1V3XA 3BEFB 2SGAA 1LHFH 2VIWA 1GG6C 1TPOA 4AORA 1CSOE 2BOHB 3S9CA 2XC4A 1O36A 4BAKB 5JB8S 2ZHDA 3QZQA 4ABEA 4X8UH 4ACAA 1TX7A 4H42U 1BCUH 1C5WB 1L1NA 2VINA 3TJUA 2HALA 3A83A 1V2MT 3SI3H 2PGQB 1K1LA 3LGIA 1O3JA 4I86A 3IITA 1GVZA 1ANDA 1NFXA 5FCKA 1CO7E 1GBTA 1BTZA 1BZXE 1UW7A 3P95A 4FU7A 5LPFA 1A0JA 1IQHA 2FOAA 2QV1A 5CHAC 2LELA 1GJCB 1LVOA 4K1EA 1W3CA 4MVNA 1PPHE 3B23B 1AHTH 1C1VH 3R0FA 1TOMH 5F03A 1EOLA 2ZU2A 5FBIA 1CT0E 2AEIH 3RXTA 5EU8A 3V0XA 2OC8A 4B2CA 4UDWH 3VG8A 1L0ZA 3EA9A 4X0WU 3SNCA 1V2KT 1TNHA 1ZR0A 2BD3A 2AMPA 2ZPRA 2ZPQA 1HAYB 1O3CA 4Y7AA 5K7RA 1MABB 4YOIA 3JZ2B 5GJ4B 4ABGA 3UNRA 3K6YA 4WMDA 3PMJA 1BRBE 4FETA 2L6OA 5SGAE 1TBZH 5FPTA 1O2OA 2A32A 1GJ9B 8ESTE 3H09A 3TU7H 3RM2H 1GGDC 3QTVH 3AK5A 1INCA 3FZDA 3AAVA 4WMEA 3PV2A 3V12A 3ZV8A 1AFQC 2P94A 5BRRE 1AD8H 1GPZA 2Z9JA 4OS4A 2W7UA 2G5NA 3VB5A 1C5PA 1BITA 3SGQE 5DG6A 3T26A 2H9HA 2I6SA 2K1QA 3TK5A 2VWNA 3RU4E 1A5IA 3EE7A 4SGAE 2XYAA 2EA3A 3R3GB 1FAKH 3ELAH 3HKJB 1SPJA 2KCAA 2BY8X 2CGAA 2W6JD 5C5NA 2A2XH
chains in the Genus database with same CATH topology
1AVWA 3LT3A 3SZNA 4NGAH 2ZC9H 1O2UA 1HAXB 4WF8A 1PQ5A 1K1PA 5F8TA 3MNCA 3UQVA 2EI6A 2QN5T 3QGNB 2BD4A 2O8UA 1FDPA 1BJUA 4B74A 1KTSB 1UTQA 2FOFA 4H6TA 1YPHE 4R0IA 3JZ1B 3M5OA 1GWAA 4X2XA 3RU4T 1TMTH 5IDKA 5EOKA 1Z8GA 4HGCA 1QR3E 3SJ8A 4Q80A 2G55A 3SU1A 5DP6A 2HVXA 3M61U 1FMGA 1E36B 2HPPH 1MU8B 1SOZA 2XC5A 2V3HH 4E06H 1GHAG 2UWLA 3A8DA 3P17H 3ZZ7A 2ZU4A 1FY5A 3RMLH 3U8TH 5T6GA 1BMLA 1P2QA 4NIVA 3LGVA 4DY7B 1FXYA 2V3OH 1SQTA 4B73A 4X1QU 5DP8A 3F68H 1BOQA 1Z71A 2BD2A 4GVUA 3MO6A 4ZHAA 2H1UA 1QL8A 2VB0A 2BQWB 1NFYA 1GBFA 1EOJA 5AF9H 4NSVA 5GCHF 2RDLA 2ASUB 1T8OA 2PR3A 2G52A 4ZKRU 3D62A 3BTQE 1A3BH 1UCYK 2CF8H 1C4U2 2Y80A 1W12U 2BB4A 1IQJA 1W7XH 4KTCA 1L2EA 4UFDH 2JH0D 1H9LB 3S0NA 1TPSA 3U1JB 1NY22 1ZMNA 2BM2A 2F91A 3QGJA 3MWIU 1SGYE 3K6ZA 4BAOB 1EUFA 3SU6A 4ISNA 4NIWA 3ZZAA 1J9CH 2BTCE 1O2YA 1AGJA 1Y5AT 3E6PH 3RXBA 1LPZB 3MNSA 1GMHF 1ZTKA 2ANWA 1BBRH 2A5KA 3GCOA 3F9EA 1H8DH 1C9TA 1IQNA 3GY6A 1PQ7A 5E0GA 2ZHQH 3OSYA 1O32A 2JETB 5HXFA 1H8IH 5PTPA 1QBOA 4BOHA 6LPRA 3ZZ8A 3VFEA 3SHCH 2SGDE 2NWNA 5E2OA 1K21H 4WH6A 2ZFSA 1SOTA 2CHAC 5ESTE 5EQQA 2NU3E 4DOQA 4D7GA 4O3TA 2XBXA 1GVLA 1IQGA 2HNTC 1NRQH 5G4BA 4JYUH 1XM1A 5FBEA 1GBMA 1O35A 4NFFA 1NPMA 1XKAC 1D6RA 1MD8A 1C2KA 1DPOA 1YPGH 2ZGBH 1C2EA 3DFJA 1MTSA 4I8LA 5FXLA 1CVWH 4OGXA 1TRMA 2ZPSA 3A89A 4AG2A 1NTPA 3V3MA 4OS2A 1TMBH 1UTLM 3LGYA 3T27A 1KIGH 1SGCA 1JXPA 1QTFA 1SLXB 4NZQA 4WXVA 1TQ7B 1C2DA 2BOKA 2XC0A 2ZEBA 3CS0A 3VGCB 2B7DH 1F5RA 3M37A 1DUAA 2G8TA 1XUFA 3P92A 4OS6A 1DXWA 1Y3UA 2ZFPH 2PSXA 1XUKA 1HJAC 1QNJA 1MMJN 1NS3A 3SGAE 1HAVB 1ORFA 2ZU5A 4XBBA 3T2NA 4CHAB 4AYYB 1OWEA 1C5ZB 3GY2A 1CA0C 4K1SA 2VIQA 2W26A 2FXRA 1P2KA 2PUXB 1TX8A 2SGQE 1O2HA 1MTWA 4Q7YA 1KDQB 1QBVH 1NROH 1TBRH 2ODPA 3Q3KA 3RXFA 1GHXH 3RXRA 3A85A 3PTBA 4Q7ZA 3LJOA 1O5FH 1OOKB 1SQAA 2FLRH 4DT7B 3QWCH 2A0QB 1BHXB 2Q6FA 1BRCE 2PWXA 2H6MA 3SJ9A 4XBDA 1IQKA 2ZFFH 1DOJA 2RCEA 4IS5A 5EGMA 1W0YH 3BG8A 1G9IE 1PFXC 3UREA 1ESBA 2ZCHP 2BX4A 3ZZDA 1C5SA 2BDHA 2P8OB 1GJDB 3H5CB 1T8LA 1B0FA 3A88A 1FY1A 1C5QA 1C5YB 1O2TA 1UMAH 3SORA 1XUGA 1IHTH 1BTPA 2YNAA 1X7AC 1BTYA 2FEQH 2FZZA 2ZFRH 3GY5A 2IJOB 3OYPA 3BN9A 1PYTC 5HM9A 1SGRE 2OQ5A 3K65B 2BXUH 3RXUA 2J9NA 2XWBI 3PLPA 2VIOA 3RXAA 2SGPE 1C5NH 4AGKA 2B0FA 2Q6DA 3LOXA 2G81E 1ZJKA 1GI8B 2XBYA 3OY5U 1B0EA 4NA7A 4HI3A 2F9VA 3ZZ4A 1O30A 2ZU3A 4R8TB 3SJIA 4CRFA 1O33A 3A80A 1FN8A 1AB9C 1EZUC 3LC3A 2A31A 1ZJDA 1S81A 5F8ZA 1W8BH 1O2RA 1BB0B 1ZZZA 3KQEA 2A5AA 3DHKH 1P09A 3GDUA 2Y82A 1K28D 2KAIA 3KNXA 4OS7A 3ATMA 1P04A 2VWOA 3C1KA 2ZQ1A 1HB0B 1GMCG 1HAHH 1QURH 1S82A 1TNGA 3MI4A 6CHAB 3FZZA 1O3FA 4SGBE 4UD9H 5FX6A 1AN1E 1TA2A 1KXCA 1GBDA 1EB2A 1F2SE 2BVSH 1QA0A 4HTCH 3RXJA 4IMQA 4DIIH 5A09A 3GCNA 5A8YA 1IQMA 3T25A 1TIOA 2AIQA 3H7OA 2WUBA 3UFAA 2V6NA 2YNBA 3S7KB 3BTHE 4JK5A 4JZDH 2JH6D 2P59A 2A7JA 3A7YA 1OWIA 1TPAE 1BUIA 1LHGH 2GZ9A 1FY3A 1HV7A 1V2NT 1DITH 3GY7A 1ARCA 2B8OH 2Q1JA 1BDAA 2VGCB 2QF3A 1XX9A 3E0NB 1CHOG 1AUJA 1C1UH 2ZDNA 1OWHA 3GDVA 1O3DA 2Z94A 1AKSA 2FTMA 3GY4A 1RRKA 1E34B 1P3CA 1MBMA 2ANMH 4NIXA 1FONA 1JBUH 1XUJA 1NZQH 4YLQH 4F49A 4ESTE 3Q3YA 2ZGHA 2ZU1A 3HATH 3MU0A 2SNWA 4NSYA 1FI8A 2VWMA 1ABJH 1C1MA 1YPJH 2TGDA 1EZXC 1HYLA 4QT8C 5EXMA 1W10U 3SU4A 1IQFA 1OYQA 3C27B 3NK8A 1G2LA 1DWEH 3TH2H 2ZGJA 1P12E 3NPSA 1YM0A 3UOPA 1P06A 1F0SA 1P57B 4JMYA 2BYAX 1AWHB 1DXPA 3SV8A 1G2MA 1T31A 1IQEA 3EA8A 1QHRB 1XVOA 1GHVH 3A81A 3L33A 2H5CA 4ABFA 1GHYH 2GMTB 4FUEA 5DP5A 1QRXA 1GMDF 4K60A 2PHBA 2ANKH 3V13A 4KTUA 4CBNA 5T6FA 4WH8A 2F83A 4XFQA 1SFQB 3SU0A 2ANYA 4Y79A 2FOHA 2QXHA 1BQYA 1C1TA 1SVPA 4OS1A 5A0AE 5GPIB 1P0SH 1NRNH 1Y8TA 2BLWA 2BDIA 1BTXA 3UUZA 3VPKA 1CBWB 4O97A 1IQLA 1LKBA 1NRPH 4FVDA 4NCYA 1NU7B 4CRBA 3F1SB 1ZYOA 4I8HA 4CR9A 1VR1H 4K8BA 3QUMP 3RXGA 3M7UA 2AMQA 2PUQH 2AH4X 5LH8A 1V2LT 2XNIA 3UNSA 2AERH 4A92A 2A2QH 2GTBA 5LGOA 3RXEA 2R0KA 1EJAA 2BVRH 4MTBA 1HIAB 3NWUA 1A61H 1GJ7B 3L3TA 2KAIB 1BBRE 5DKMA 1M9UA 3URCA 3PV4A 1PPBH 4I7YH 3TJOA 3SBKA 3RXDA 1HLTH 3BTFE 1AE8H 4KTSA 1FPCH 1GI1A 2C8XB 1YYY1 1JWTA 4YTAA 1GL1A 1GHBF 1GCTB 7LPRA 2ZIQH 1TNJA 2GD4B 2ZCKP 1K1NA 1CE5A 3RXOA 1BTUA 1W14U 4UEHH 3PO1C 1EPTC 1SHHB 1O5EH 1EP5A 4DG4A 1SR5C 1YGCH 4J2YB 3S69A 3F9GA 2Z3CA 4Y8XA 1A4WH 2AS9A 4FU8A 4JZ1A 3AVZA 3QO6A 1O3OA 1VZQH 4A1XA 1KXEA 2H9EH 5FPYA 3Q76A 2FX6A 1GBEA 5JYIA 1JOUB 4X6OA 1C2GA 4GLYA 1UK3A 4IGDA 3M36A 3B8JA 2ZF0H 2FI4E 5EQRA 1EJMA 2EI7A 1C4Y2 1V2RT 1EZSC 1FAXA 3P8GA 1UK2A 5DP7A 1S6FA 3ZZ5A 1T7CA 1UO6A 2UUFB 1YPHC 1UTMA 2GCTC 2FTLE 4YLUA 2BDBA 1N8OB 3IWMA 2UUKB 3MU5A 1C1NA 4RKOB 4OGYA 4TY7A 1O5CB 1DFPA 3P8NA 3PMBB 1OWJA 3MHWU 4RN6A 1RFNA 3ZVBA 1JIMA 2HRVA 5JDUB 4AG1A 4VGCB 3PMAB 1O2GH 1ZGVA 1MQ6A 2BD8A 3RXPA 1Q2WA 1TONA 1BBRK 6GCHG 3UY9A 1ZHRA 4FVBA 4INLA 1FJSA 1MD7A 1ZRKA 3UIRA 3SW2B 1A5HA 5I46H 1GHAF 5EPYA 2ZFQH 2ZHEH 3KQBA 3ZVAA 4NZLA 5AFZH 4B76A 1TFXA 1D3DB 2C8ZB 4NG9H 1C1PA 3SHAH 2D8WA 1P02A 3GCHB 1GI4A 1VCWA 3HGPA 1LCYA 3MO9A 4TPIZ 3SV9A 2V0BA 4ZXXH 2TIOA 2IPHA 1GBLA 1P2NA 1MBQA 5L30H 3SV6A 1GBCA 1C2IA 1ZSJA 1Z8JB 5GWZA 4WJG2 2BLOA 4E05H 3SGBE 2SGEE 2QCYA 4A6LA 5E0JA 2ZG0H 1SHYA 1O2SA 1KTTB 2PLXA 2A4RA 1O5DH 1O2XA 3F6UH 1DLEA 2BMGB 2WPKS 3RC6A 2W5EA 4NFEA 3TJVA 1GI2A 5JBTA 1PPGE 2AGGX 2GT8A 2OXSA 1BHXF 3NZIA 1UVPA 3RU4D 4O9VA 5CE1A 4AZ2B 1EPTA 4BXWA 1O39A 1J8AA 3RXLA 3NCLA 1RD3B 3LIWA 2G4UA 1AI8H 1IQIA 4HZHA 4LXBH 4TWWA 1TNLA 1TMUH 1OWKA 2PFEA 1WSSH 2WUCA 2Z9LA 1PPFE 1GI5A 1IOEA 1N1LA 4Y11E 1O5BB 1NRSH 2BHGA 1SBWA 3VB7A 1VITG 1A1RA 2J4IA 2OBOA 2FPZA 3OTJE 1SLVB 4NA8A 1V2UT 1O3MA 3TNTA 4AYVB 2BZAA 1ELCA 2PKSB 1LHEH 1HXEH 2W7SA 2H9TH 1OP8A 1KXBA 1VCPA 1DS2E 1MTNC 4DGJA 1GHWH 9LPRA 4MG3A 1ELEE 5IYTA 1DVAH 3RMMH 4XE4A 5DP9A 3A8BA 2BLVA 1OKXA 1O34A 3AW0A 1Z1IA 1UTNA 3B9FH 2Y5FA 1AUTC 3ODDA 4CRCA 3A7VA 1TOCB 4KELA 3SNBA 3KEEA 1O0DH 4X6NA 1VGCC 1MAXA 3UR9A 1C2MA 1MKXH 2R3YA 3QX5H 2P3UB 1CQQA 4Y8YA 2GMTC 3UNQA 1B7XB 2G00A 1E35B 1F0TA 1FNIA 1HUTH 4FUJA 2WV4A 2F3CE 4B2BA 1O2LA 1Y59T 1P3EA 1KYNA 2P95A 2ZZUH 4X8VH 5GCHG 1GI7B 3BTME 1SG8B 2JKHA 2QXJA 1RS0A 1QA7A 1GI3A 1N6YA 4IBLH 5A8ZA 1K9OE 3E0PB 1FIWA 5C1YA 1C5RA 3TLOA 2Y7ZA 1F5LA 1LHDH 3SN8A 1MZAA 2ZDLA 5T3HA 4JZIA 1AE5A 2ZWLH 4BAMB 3SQEE 1TYNA 2PKAA 2RA0A 1E0FD 3A84A 4MDSA 1CBWC 5JPMH 1FN6A 3A7XA 1O3PB 1HAGE 2VH0A 2A4OA 1QJ6B 1GI9B 1RIWC 2AFQB 4ISIH 2BY9X 1YPMH 4AFSA 1FLEE 4U01A 3DFLA 1OX1A 2NU0E 1NRRH 1GMHG 4XOJA 4Y71A 2O8WA 3LONA 2ZGCA 2ZFTA 1SGEE 4FUIA 3S9AA 3M7QA 1WAYB 3SOSA 3M35A 4FXGH 1C5UA 2R2MB 1DY9A 2TRMA 1J17T 2UWPA 4UFGH 1GG6B 4JYTA 2O8TA 2LPRA 5GXPA 3SI4H 3AAUA 3GYMA 1Y5BT 2GCHG 3UQOA 2DUCA 2BX3A 2A45B 1PPCE 4AN7A 3HPTB 3PWBA 1HAOH 3U98H 1ETSH 2GV7A 4XBCA 4X2WA 5DO4H 1NT1A 1WQSA 2ZA5A 3ITIA 1ZRBA 2CN0H 2ALVA 4ZHMU 5CHAB 2OP9A 1J14A 1SGPE 2BY5X 1GJ8B 5ESBA 2A7CA 4B1TA 1MCTA 1YF4A 4CH8B 1C4V2 3M3VA 2VVVA 4X2VA 1T32A 5E2PA 3H7TA 3SNDA 3BG4B 3D23A 2O8MA 3F9FA 3I29A 1TGNA 1DWDH 3Q00A 3F9HA 1EZQA 3PLKA 1PPZA 2A5IA 3ZVGA 1ANEA 2THFB 3BV9B 1GJ6A 1RTFB 1A5GH 1TGCA 1CHGA 1GMCF 5C67A 4Y0YE 1K22H 4KP0A 1WQVH 3P8OA 2A4GA 1GI0A 3ZYEA 4MPUA 4Y7BA 2TBSA 2QC2A 1HXFH 1GGDB 1LTOA 1HGTH 1THRH 1AFQB 1TX6A 1TQ0B 1GL0E 5B6OA 2J34A 1O3KA 3SO3A 1T4UH 1EAIA 2VVCA 4VGCC 2HGTH 1W7GH 3TGIE 2FOBA 4MPVA 1TGTA 3SNAA 1Y3VA 4U30A 5BPEA 1YCPK 1EATA 5LPRA 1C9PA 1W11U 4O3UA 1DWCH 5A8XA 1CT4E 1F0UA 1CHOF 1SLWB 4IN2A 1QB9A 2H2ZA 2H5DA 4FUCA 4ZHLU 2OTVA 4CBOA 3P8FA 3TIUA 4H4FA 2VVUA 2FESH 3P6ZB 1OXGA 4MNWA 2VU8E 4CRAA 2ZTXA 2PTCE 1SQOA 4K3JA 4DCDA 1O3AA 1D3QB 4MNYA 1OSSA 1Z7KA 1C1RA 1HPGA 3AW1A 1EB1H 2A1DB 1OP2A 3MH7A 3SU2A 2QA9E 1IHSH 4LZ4B 1O37A 3IG6B 1V2PT 4YESB 1UVTH 4YO9A 4CRGA 1YBWA 1RJXB 1BRAA 4MQAA 4FUBA 1V2VT 2UUYA 1GI6A 4THNH 1LHCH 2D26C 4BNRA 3TGJE 5JBCS 4H6SB 2LNCA 4BANB 1FY8E 1H4WA 2BDCA 1D6WA 2STBE 1FV9A 3VB3A 4YM9A 2PSYA 5GIBA 1EAWA 1O2JA 1D3TB 2ZGXH 2AMDA 3RC5A 1DM4B 4A7IB 3LH1A 2NU1E 1C1QA 2BY6X 2FM2A 4WY3A 1SGTA 1EX3A 5TCCA 2FO9A 3RC4A 8GCHF 1ZSKA 3LC5A 1GJ5H 3PWCA 1TRNA