3BTGE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
total genus 53
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btgE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btgE02
1K1PA 4OGYA 2V3HH 2ZPRA 1TALA 1DXWA 1WYKA 2PKAA 3MH4A 3RMOH 1ANDA 3TVJB 1PPHE 1XVOA 2O8UA 4B73A 8GCHF 1O2PA 3VB7A 2RA0A 4TY6A 1YPJH 1W0YH 3F9HA 1GMCF 1HAPH 1CA0B 1DPOA 1YCPH 3GCHC 1C5MD 1ZRKA 3E90B 2RCEA 2Y5HA 3BTKE 4YO9A 4YZUA 5JBBS 5GCHF 1Z8JB 2BY8X 2ZECA 1PPFE 2GCTB 2ZDNA 3UWIA 3I77A 2ANMH 4FUFA 1TPAE 4WMDA 4JYUH 2BD8A 2DUCA 2VIPA 4XFQA 4ZMAH 3M3SA 5A0AE 2O8LA 3P95A 1OP0A 1QNJA 2ZU5A 3KQEA 3M7TA 1NRRH 1CHOF 4Y11E 4TWYA 4K2YA 1O2IA 4J1YA 1BTXA 4X8TH 1EPTA 3UY9A 3H7TA 4U30A 3MYWA 1SGDE 1ELCA 2BQ6B 3P17H 1C4U2 5HMAA 1S83A 3BTGE 1O3JA 1MCTA 1V2RT 1HAHH 1FN6A 4KTSA 2FYQA 1GBHA 1HAVB 3MWIU 3SQEE 4UFDH 1DICA 2OC1A 5T3HA 4ABFA 1AB9B 1TX8A 4FVBA 1N8OC 3B23B 1GMDF 3ATMA 1QA0A 1EB2A 1BJUA 2BXUH 1INCA 5ABWA 3SU6A 3LGIA 2O8WA 1KY9A 1O37A 3RXQA 1DX5M 5HGGA 1DWEH 4D7GA 1MZAA 1P05A 1GMHG 2ZTYA 1DSTA 1T4VH 1FN8A 1OYQA 3GDSA 2Y7XA 5FPYA 3A8BA 1RTKA 2SGQE 1G30B 2QGRA 5C2ZA 1FJSA 5ESTE 1KXCA 5HXFA 1HNEE 3BTFE 1D6RA 1ZTKA 1AQ7A 1ZOMA 2BDHA 1YLDA 1TMBH 1SGPE 1AUTC 3RXUA 4TPYA 1GI2A 1JMOH 2QF3A 4Y8YA 5E0JA 3V0XA 2G00A 1GGDB 1V2MT 1KLJH 2W3KA 1N1LA 1OPHB 3EQ0H 4X1RU 2ANYA 2PFEA 1MBMA 3UFAA 4FU7A 2SGPE 3BTDE 1FIZA 2GV7A 3SV2H 5L2ZH 3F68H 1D3PB 1EAXA 3ATWA 2BD9A 1CVWH 1O5FH 4FUGA 4CRCA 2WUCA 1QA7A 5AF9H 3GCTF 2PGBB 1KDQA 4CRDA 5FX5A 1ZMJA 2D1JA 2BDAA 4U2WA 3A87A 3P8FA 3Q3KA 1C5WB 1V2PT 1Y5BT 2FOHA 3ZV8A 4DW2U 2GV6A 3L6PA 4NGAH 3ZZ6A 4HZHA 5J4SA 3GY4A 1GBDA 1O36A 2ANKH 3U8RH 1QCPA 4ZXYH 1FY4A 2AERH 1GVZA 5EXMA 1GBBA 3P92A 4AFUA 2PW8H 3F9EA 2P95A 1TE0A 5FCRA 3V13A 1PFXC 3ZZ9A 3K6YA 2CV3A 1UVTH 3LC5A 1DWDH 2V0BA 2VGCB 3AAVA 1A5HA 3UNQA 4FUBA 2EI6A 4X2XA 3FVFB 1BQYA 3NXPA 2TGAA 1C2MA 4NWKA 3S69A 4XDEA 2AIPA 3K9XB 3JZ2B 5C1XA 5BRRE 1DSUA 1XKAC 1UK4A 2VVCA 4XE4A 1XUFA 4B2CA 1QIXB 3VB5A 1XUJA 1S6FA 1G32B 3FP6E 1F0SA 3RXTA 1JIRA 1P02A 3OU0A 2OP9A 1AE8H 1LHEH 4NA9H 1TOMH 3TGJE 1AVXA 3RXBA 3ATIA 1UCYK 2OCVB 2FTLE 1Y3VA 3F9GA 1SOTA 1AKSB 1EUFA 1SVPA 1SGFG 6ESTA 3SU1A 1HIAA 2GCHF 2UUFB 3OX7U 1Z7KA 4Q2KA 1UTJA 2SGEE 1GPZA 3UNSA 1V2VT 1VGCB 3T28A 3AASA 1V2ST 1BBRE 3LGVA 3M5LA 4FUEA 2ANWA 5EQSA 5T6FA 2FS9A 2O9QA 2TPIZ 3MFJA 1TX6A 1LHGH 2GDDA 2Q1JA 5F8ZA 4A6LA 1AWHB 3ENSB 2FTMA 4B71A 1GVKB 1IQIA 4X1NU 4DIIH 3DFLA 1GBLA 3A7ZA 3MO3A 1G2LA 3TPIZ 4DURA 1DUAA 1UHBB 1TPSA 2HALA 1FI8A 2RA3A 2Y80A 5E0HA 4JYTA 4X8VH 3TNTA 1OWHA 2JH0D 4IN1A 1MQ5A 2EI8A 1KIGH 3Q3XA 3V7TA 2STAE 6CHAC 4WMFA 2AEIH 1CHGA 3QWCH 4MTBA 4NZLA 2VIDA 5C3NA 1EZQA 1V2QT 3BG4C 3CENA 4AFSA 2R9PA 4B76A 1QB1A 3R0FA 2YNAA 1F5RA 4CR5A 3PROA 3G01A 2XYAA 2ZFQH 4MPVA 3QTOH 1BRCE 5C1YA 3P70B 1SBWA 1O3KA 4WXIA 1TMTH 4R0IA 3UREA 1PQ5A 1O2HA 3SUDA 3UIRA 4BTIB 3M5NA 5A2MH 1WBGB 2UUJB 4I33A 4CREA 2OTVA 2J34A 2ZO3H 1O5BB 3BF6H 1P9UA 4X2VA 3URDA 3QLPH 2W7UA 2ODPA 1O34A 1BTWA 7GCHF 4DIHH 3HK3B 4TYDA 2DE9A 3PLPA 3IG6B 1BRAA 2BZAA 1GHAG 1OP2A 1QL9A 4UFFH 4F49A 1AO5A 1F0RA 4FU9A 1YLCA 2GT7A 3FP8E 1BIOA 1YPLH 1GJ8B 4AG2A 4D9QA 1LVMA 1O2OA 2BOKA 2TGTA 1G9IE 1AMHA 3TJNA 2KAIA 1OXGA 1TQ0B 5EOKA 5HM2A 1NFUA 2J2UA 1W2KH 1CA0C 4ZKOU 3MNCA 3M61U 2FM2A 4Z6AH 1C1TA 1RS0A 1YF4A 2H2ZA 2Q6FA 4DGJA 1NM6A 5E2PA 3GCOA 1A46H 3BG8A 1PPZA 3T62A 2GCTC 1A0JA 3Q00A 4CRFA 1NFXA 1GJ6A 2XBYA 1OKXA 2GDEH 1GDNA 8GCHG 1C1UH 3ZYEA 5FBIA 1DVAH 3LJOA 1GMCG 1L0ZA 4D76A 3GISB 1FAKH 1HBTH 3RXPA 1GI6A 5C1UA 3QGJA 2BTCE 2H6MA 3ODDA 4WMEA 1HB0B 2A7JA 5GCHG 1B0EA 1O2WA 1SGFA 4UDWH 1Z1IA 1O2LA 1ZMNA 1C2KA 4Q7YA 1TNKA 1GJ5H 1EOJA 1UK3A 5DP6A 1SGCA 5L2YH 1TGBA 1ZYOA 1GI8B 2ZGCA 1BB0B 1E37B 2A7HA 2HNTC 2ODYB 3DUXH 1CHOG 3URCA 4NCYA 1AB9C 2W5EA 4IS5A 4BXSA 1V2NT 5CMXH 1O32A 3SJ9A 2OUAA 5EODA 1M9UA 1QFKH 3E0PB 8ESTE 1K22H 1NPMA 2QF0A 1ZHPA 1O3HA 1SMFE 2QAAA 1J14A 1T4UH 3RM2H 1VR1H 2R2WU 1O3LA 2FI4E 1GMDG 1O3EA 2WUBA 3LJJA 3MU8A 4DG4A 3KF2A 1U6QA 3PTNA 1WAYB 4LK4A 3RXIA 1K1JA 1AVGH 7LPRA 2FESH 1O2KA 4J2YB 1GGDC 4I8LA 3UQVA 1ZSKA 2V3OH 3QK1A 1T31A 2BB4A 3L33A 1CE5A 1CO7E 3WY8A 1BBRH 1NU9A 1LVBA 5LPEA 1TGNA 1C5ZB 1ZR0A 2VWNA 2ASUB 1BT7A 1W7GH 2FLBH 1FONA 1BHXF 4O3UA 3NPSA 3SJOA 3TJOA 3KQCA 3LT3A 2BXTH 4LXBH 5FCKA 1A7SA 3BSQA 4Q7ZA 1TPOA 1SI5H 1MTVA 2Z9LA 2ZQ1A 5JBAS 2ZG0H 1NRSH 3Q76A 2FOAA 1K1MA 1Z8RA 1ZTJA 1IQGA 3RXFA 1VJAU 2K1QA 5E0GA 4JCNA 3MOCA 4UE7H 3FFGA 4RSPA 3GCTG 1LCYA 1G37A 1SGRE 4Y76A 3BV9B 1O3MA 1YGCH 1OX1A 2GKVE 4ZHAA 2F9PA 2VIOA 1GHZA 1C5UA 1FDPA 1QQUA 2ZDKA 1ETRH 5B6OA 4I32A 2FPZA 3ZZCA 3A81A 5A09A 2VGCC 4AOQA 4CHAB 3RXHA 5JB9S 3RLWH 2FIRH 4IBLH 1P3CA 2G4UA 3ELAH 2A4OA 2WPIS 1K1OA 5DP4A 4GAWA 2G52A 3SNDA 3R3GB 2ZIQH 1NRNH 2C8YB 3RXRA 1K28D 1KLTA 3MH7A 1A3EH 3HPTB 4GHTA 3O8RA 1ANEA 4UONA 2AMDA 2ZFRH 2VJ1A 3E8LA 1CT4E 4RKOB 4I8JA 3OSYA 2ZF0H 2SNVA 3KQBA 1AWFH 2UUYA 2Y5FA 2QXJA 2B9LA 1LTOA 8KME2 2VWMA 2BVSH 5AHGH 1LHDH 3T5FH 1VGCC 1YPHE 3UR6A 5L30H 1C2DA 1ZHMA 1TLDA 3H5CB 3SV6A 1BRBE 1O5CB 1MD8A 1TPPA 3DFJA 3AVZA 1YPEH 1TNHA 1G2MA 2PSYA 1ANBA 3PWBA 1F0TA 4WH6A 4CRGA 2XRCA 2C8ZB 2GCHG 5A0CA 2GT8A 1MKWK 1ACBE 3A89A 3MO9A 4E06H 2SGAA 4ZKNU 4YLUA 1XX9A 1C2IA 3PWCA 1H8IH 5LPRA 1NRQH 4YESB 1C5OH 4JMYA 2HPPH 4ZH8A 2QXIA 2XBXA 3ESTA 1T8LA 1QL7A 2G81E 6CHAB 2ILNA 3F9FA 3SHAH 4NIYA 1BTYA 1C9TA 4Y6DA 4X2WA 2NWNA 3HGNA 7KMEH 1VCQA 4YOJA 3SU3A 1O2NA 1TNLA 2PUQH 1PQ7A 2NU0E 1TOCB 3L3TA 2ZU3A 5JB8S 1Y5AT 4SGAE 4E7NA 1F2SE 2Y5GA 2G5NA 1DUEA 1Y59T 4NWLA 3S9CA 4NSVA 1GCTB 1MUEB 3SUGA 1UVUH 4I31A 1L4DA 4FUCA 4ZKSU 2WPKS 3A80A 2FLRH 2GMTB 1S6HA 1YYY1 2PTCE 1H8DH 1HJAB 3RMMH 3S9BA 1A61H 1HXFH 1C4Y2 1ABJH 1SB1H 3MMGA 1ELFA 1GI3A 1C1VH 2LNCA 2NU4E 1UTQA 3P6ZB 4ZXXH 2VVUA 1C1QA 3O8DA 1AE5A 1HAXB 1ZGVA 5CHAB 1VCPA 3RC5A 3TJVA 1MTUA 1MKXH 3PV4A 3SZNA 4FU8A 2ZPQA 1TMUH 1O39A 5I46H 2OBOA 2FYRA 1UTNA 7GCHG 3VEQB 1AN1E 2ZGJA 3QGNB 1AUJA 2QXHA 3U1JB 1TBRH 3FZDA 3Q3YA 3V3MA 1TONA 3GCNA 1GJAB 1EX3A 3VFEA 2XCFA 1Y3WA 3UPEA 1ARCA 1SL3A 1EATA 2Z94A 3U8TH 1E38B 3M7QA 4IC5A 4ABIA 4ISOA 3S7KB 1C5RA 3A8CA 3KHVA 2M5TA 4FUHA 1KTSB 1SQOA 1RRKA 5GPIB 1TGCA 1O2VA 1DLEA 1V2KT 3QUMP 2HNTF 1ZTLA 3SNBA 2GZ8A 3KCGH 1BTPA 2F9NA 1IQNA 1L2EA 3RXJA 2GGVB 3KQDA 1EP6A 1FY3A 3GICB 4NFEA 1ZSJA 3DA9B 4WWYA 1O31A 1NC6A 2HWLB 2ZU2A 2TGPZ 5DK1A 1CGIE 2HGTH 3LGWA 3BTHE 1C2EA 1ARBA 1IAUA 1Q2WA 4LOYH 4BTUB 2QC2A 7ESTE 1GBFA 1K2I1 4H4FA 1THSH 4XBDA 1OS8A 1NY22 3F6UH 5C5OA 1IQJA 1EQ9A 1NN6A 1SGTA 3LIWA 3TIUA 5AVDA 3BEUA 1DXPA 3SQHE 1UTPA 4A7IB 2QXGA 3RXKA 2FO9A 3SO3A 1MU6B 2G5VA 3SOSA 1SPJA 4Y8ZA 5C20A 1L1GA 1O2SA 1C1SA 2XC5A 3ATKA 1O0DH 1FY5A 5AFZH 2D26C 1C1MA 1P03A 4AB8A 2ZU1A 1MAYA 2F9UA 3ZVGA 3ZZ4A 4YT6H 2O8TA 4K60A 2BVXH 5LGOA 1NU7B 2ZA5A 3D62A 4O3TA 1GJDB 1GHBF 3GY5A 1ETTH 1GBMA 1MTSA 1S5SA 1YBWA 1MKXK 2PKAB 4ABBA 3SV9A 2FZZA 2FOBA 4DY7B 1NT1A 2PLXA 3DD2H 2G55A 1NS3A 1ELGA 1YCPK 2ZWLH 1LHFH 3D23A 3S0NA 2BD5A 1SLWB 1T8NA 1EZSC 1XXDA 2BZ6H 5F8XA 2ZDAH 4GVUA 1F0UA 2ZFTA 3PYHA 2FP7B 4DOQA 2XTTB 2FOGA 4FUIA 3SUEA 1WCZA 2P16A 1FLEE 1GI9B 3A84A 2F83A 4CHAC 1QRXA 1V2TT 2ZCKP 1IQLA 5TJXA 2CN0H 4CRAA 1GCDA 1FUJA 1O3OA 5G4BA 4ZUHA 1GWAA 2BLOA 4YTAA 3SHCH 5TCAA 3QTVH 2ESTE 1S0QA 4X8SH 3KEEA 4THNH 5F6MA 2R0LA 4AORA 1EPTB 1LDTT 1P2KA 1Z8GA 1BTZA 2XCNA 1EJAA 1P3EA 3GY8A 4MPUA 1GI7B 1LHCH 1S82A 1HAGE 3ITIA 4JK6A 1Z6JH 1K9OE 2PR3A 4D7FA 2C4FH 2BVRH 1Y5UT 5EPNA 2HLCA 3JZ1B 4OS4A 1A5GH 3NWUA 2AH4X 2JH6D 1L1JA 1O2QA 1ABIH 3LKWA 3PLKA 4ZAEA 3RXVA 4CH2B 4ESTE 3MNSA 5CE1A 1QB6A 3SJKA 1XUIA 1GHWH 1VITF 3A7WA 1W11U 6LPRA 1AVWA 1GI0A 3OY5U 2Z3DA 2XBVA 3UNRA 3LOXA 1XUHA 1V6DA 1FY8E 3M5OA 4ABDA 1BJVA 4X1SU 3QX5H 2A1DB 1TX7A 2IN2A 2HVXA 3NUMA 4Y0ZE 3RXEA 4RN6A 1AY6H 1ID5H 3CS7A 2BDCA 1EP5A 1WU1A 1O38A 1MCVA 2BDIA 2BD3A 3M3VA 1O2JA 2F9VA 3NKKA 2BM2A 2OXSA 2UWLA 1DT2A 1E36B 1BRUP 5A8XA 3TGIE 1NFWA 1P57B 1W12U 3LGUA 3RMLH 1C1OA 1KDQB 4MPXA 1K21H 1LVYA 5SGAE 4R8TB 1SG8B 2XWBI 2AFQB 1SLVB 3UOUA 1W13U 1GCTC 5ESBA 3U9AH 1PYTD 1GDUA 1EKBB 3ZV9A 1O2XA 3RU4D 2GMTC 3LONA 1B5GH 3ZZ5A 1P10A 5DGJA 1BDAA 2PWXA 1HJAC 5DG6A 2R2MB 5DKMA 1TB6H 4INKA 1ZPCA 1AHTH 2IOTA 1A5IA 1LPGB 3P8OA 1EZXC 1YC0A 3ODFA 2PKSB 1DOJA 5CHAC 3TLOA 5IYTA 2ZDLA 1QURH 3RU4E 1RGQA 1QTFA 1C5SA 1O3DA 1A4WH 1B0FA 6GCHF 2OC0A 2PSXA 4NFFA 1GL0E 4HTCH 1B7XB 3UTUH 1OWDA 1D3QB 3HATH 3TNSA 2ZFFH 2A5KA 2Z9KA 5FHTA 3KNXA 2QCYA 1XUKA 3RXGA 4AZ2B 4JZFH 2SGDE 1GI4A 2AS9A 1Q31A 1HIAB 3M7UA 3STJA 3CP7A 1UVOA 2BOHB 1F92A 3RDZA 2H9HA 1NESE 2V35A 1GBEA 1TBQH 4TWWA 3KL6A 1MQ6A 4IW4E 3AAUA 3K65B 4M7GA 3U98H 1JRTA 1BMNH 5JBTA 1S0RA 4H6SB 1P0SH 2AGIX 1O3AA 3C1KA 2BLWA 1Y3XA 1LPKB 1THPB 5TCCA 3CS0A 2CF8H 2A7CA 3BEIB 2ZKSA 3PMHB 2ZHWH 1T32A 1MU8B 1OOKB 3ZZDA 1QJ6B 4D9RA 1G36A 1FIWA 4JZEH 1S81A 2AMPA 2ZGXH 2A5IA 3BTEE 2H9TH 2TIOA 4GHQA 1YPGH 2FDAA 2VB0A 2ZHDA 1RTFB 1T8OA 2Y7ZA 3MU1A 4BANB 4I8GA 1F7ZA 4B2BA 3GDUA 2Y82A 1KSNA 5IDKA 1F5KU 1DWCH 2ZI2H 8LPRA 1VJ9U 5GWZA 2EC9H 3UWJH 3MO6A 4ABEA 4MG3A 2FOMB 1LKAA 1HFDA 1ZMLA 1C5LH 2PUXB 1GJ7B 3LDXH 1P12E 2Z9GA 1EAIA 2B0FA 1O2UA 4IC6A 4WXVA 3FZZA 4INLA 1SFIA 2BY6X 3ZZBA 4A1VA 4H6TA 1DWBH 1YCPM 4Q7XA 2THFB 2ODQA 3KGPA 1O3NA 1HJ8A 1GBCA 2WV5A 3D49H 1G3CA 3MH5A 4Y0YE 1YPHC 1V2OT 1EOLA 4A5TS 1O35A 1HAIH 1UVPA 1EAWA 2OC8A 1C5QA 1GBKA 3HGPA 4MNYA 1NFYA 1QJ7B 3STIA 3PB1E 5DPAA 3RMNH 1H4WA 1UCYE 3PMJA 1P2IA 1VCWA 2OQ5A 2KAIB 1GHBG 1RXPA 1CU1A 5DP9A 1O2RA 2Z9IA 4VGCB 1DDJA 3TITA 2CXVA 3A8DA 4Y8XA 2C8WB 4CR9A 1Z1JA 1DS2E 1Z8IB 2UUKB 3ZVAA 1DM4B 2FOEA 4CBNA 2Z6BD 1P06A 1UK2A 4GUXA 5JDUB 2ALVA 1DANH 4BNRA 2DE8A 1MTWA 4D8NA 4AFZA 1RTLA 1Y8TA 2R3UA 5EU8A 2P8OB 3ZVFA 1XUGA 3A7VA 1OWIA 1EPTC 3SNEA 2FI5E 2Q6DA 5H4IB 4A1XA 5T6DA 3W94A 2PTNA 4AN7A 1CT2E 2NU1E 1DY8A 2OC7A 3UR9A 2HRVA 5HM9A 1TWXB 1QQ4A 5DP7A 4YOGA 1C5TA 1TGSZ 2A4QA 5EW2H 1J8AA 2ZFSA 4YT7H 3MU4A 1WTGH 5A8ZA 1QBNA 3LGTA 2H1UA 2WPMS 1O5GH 1AI8H 4BAMB 1HAVA 2BX3A 5FPSA 4IGDA 1W8BH 3M3TA 2AIQA 1D9IA 3E91A 2QIQA 2CF9H 1ZLRA 2EA3A 1PPCE 2J4IA 1WQSA 1J9CH 1BBRK 3MNBA 1VITG 4AG1A 1C9PA 2EEKA 3EA7A 4X6MA 2VIQA 3T26A 1OWEA 4OS5A 5FPTA 2BMGB 9ESTA 5I25A 3T25A 2QA9E 1KXEA 2XNIA 3E16B 1Z6EA 1IQHA 2B7DH 3A8AA 1W3CA 2VVVA 4NZQA 4X1QU 2A31A 5K0HA 1T7CA 2ZTXA 1SGIB 5JYIA 1SGEE 4UFGH 1EZUC 1MBQA 3LC3A 3SUFA 4BOHA 2RG3A 3MNXA 5EG4A 1V2UT 2Y81A 1BMLA 2BD4A 3DT0H 2B8OH 1TNIA 2QY0B 3RC6A 1GBIA 1O3CA 3TGKE 1TBZH 2A4RA 1AGJA 3SV7A 3TH3H 5DP8A 3TK6A 2UWPA 3OYPA 1EXFA 1TNGA 1WOFA 2ZCHP 2BQ7B 4NIXA 1IQEA 3RXAA 2PKSC 5E8EH 2STBE 4FUDA 3LH3A 2BLQA 4MPWA 4LZ1H 3GY2A 3O8BA 2NU2E 3PTBA 2ZGBH 2FODA 5A0BA 1BTHH 1SHHB 1ZPBA 3MHWU 5E2OA 1C5YB 2ZDVH 4O03A 1QL8A 1GBJA 4X1PU 4INHA 1BZXE 4KTCA 1GHVH 2I6SA 1ZSLA 3LU9B 1FPHH 4K8YA 5JBCS 1NTPA 2SFAA 6GCHG 3U69H 1DE7H 3RUOA 1CT0E 1ZPZA 1P04A 4H42U 1ORFA 2WYJA 1LQEA 4XSKU 5GXPA 4ABHA 1MMJN 2P94A 1FZZA 1GBTA 3KN2A 3LGYA 1A0LA 5DP3A 3M37A 3SU4A 4BXWA 2XC4A 1AD8H 1A3BH 3PM3A 1AFQB 4CRBA 1AKSA 1YKTA 5C5NA 1CA8B 4YLQH 4CH8B 2WPHS 2BDBA 2R0KA 1O3GA 1GJ9B 3T29A 1BITA 1NO9H 1TQ7B 1UCYH 2CHAB 1HJ9A 5FBEA 2XBWA 4B74A 4GPGA 1YM0A 4I8HA 2W7SA 3SW2B 1CBWB 3UQOA 1CGJE 4YM9A 2QV1A 4WY3A 1HGTH 4AB9A 1UTKA 3E6PH 4ZKRU 3LH1A 3SGQE 1ELTA 3KIDU 1PPEE 3A86A 2A4GA 2P3TB 4WH8A 5EPYA 5LPFA 2VWOA 1O5DH 1BMAA 1QRZA 5PTPA 3A85A 2C3SA 1P2OA 1NRPH 1QB9A 4NIVA 1UHBA 3PO1B 1LQDB 3SU2A 4Y71A 4ZROA 2GVFA 3U1IB 1WTHD 1ANCA 3VXEH 1TNJA 3MU5A 2WV4A 3I29A 3MI4A 1ETSH 2F91A 1XKBC 3GY7A 1N6XA 1CQQA 4K3JA 2SGFE 1OWKA 2G51A 4GCHF 4CBOA 1QGFA 4PROA 1MZDA 2J92A 3RXCA 5AFYH 3ZVEA 1TRNA 1YPKH 3K2UA 1C2LA 2BD2A 3SBKA 3SGBE 1DITH 1C2GA 1HAZB 1RFNA 1TYNA 3A7TA 2A45B 2Z7FE 1GHXH 3I78A 3K6ZA 3N7OA 1XVMA 3BTQE 1W7XH 4Z0KA 3EA8A 2IPHA 1AIXH 1O2GH 1PQAA 2SNWA 1J16A 3SJIA 4ABGA 5K7RA 1O33A 1HDTH 2ZGHA 3ZZ8A 3RM0H 2BQWB 4MLFB 3SNAA 1P2JA 1TRYA 2Z9JA 2ZNKH 1TA2A 1SGQE 4U32A 3T2NA 3T27A 1SHYA 1TA6A 3BIUH 3BTTE 2H5CA 1E0FD 2F3CE 2R3YA 2GZ9A 3ZVDA 1SSXA 2ZEBA 1OP8A 1XMNB 3E3TA 1XXFA 3PMAB 5FXLA 4XOJA 1ELVA 1IHSH 4VGCC 1AU8A 4WF8A 1SGNE 2LPRA 3ATLA 1OYTH 1HAYB 2H5DA 3GY6A 1SOZA 2JKHA 3MU0A 1GHYH 4K8BA 2ZPSA 2Z3CA 1IQFA 1YPMH 1S84A 2FX6A 1NZQH 1KYNA 1C5XB 4HGCA 1IHTH 4AYVB 3MTYA 4WJG2 1UO6A 2P8OC 1E35B 1EB1H 1P9SA 2HPQH 3VB3A 1SR5C 1UTLM 4LZ4B 1FY1A 1HUTH 1ZRBA 1QRWA 2FI3E 4MVNA 4A1TA 1BA8B 1Y3UA 1GG6B 1QR3E 2BY5X 2TRMA 1ELDE 4NA7A 4BAQB 2BY7X 3SU5A 4MNWA 4AX9H 2ZHFH 1JXPA 4ABAA 1TAWA 1L1NA 5EQQA 1C2JA 1ESBA 4SGBE 3GOVB 4X0WU 2BLVA 1C1NA 1VITH 1BTUA 4JK5A 1ESAA 5GIBA 1C1WH 3M35A 2JETB 2FWWA 5F8TA 1PYTC 3QN7A 4X6NA 1JWTA 1HPGA 1RIWC 4OGXA 3Q77A 3PMBB 1UJ1A 3VGCB 1GDQA 1E34B 4K1EA 4I7YH 5EGMA 1VZQH 4JYVH 3A7YA 4B1TA 2PHBA 1C5PA 1H9LB 4JZIA 1JBUH 3RU4T 2ULLA 5EXLA 3ZZ3A 1TGTA 1A2CH 3FAOA 1Y3YA 2A2XH 4E05H 1O3BA 1C2HA 2XW9A 4F4OC 3EAJA 2H9EH 4X6OA 1KXBA 4ZHLU 1KTTB 5ETXA 3ZZ7A 1MTNB 2VH6A 1LO6A 1O30A 3RXLA 1ZJDA 4BAOB 1FAXA 4MQAA 1HV7A 1THRH 4AGJA 2A2QH 2C93B 2F9BH 3RLYH 1H9HE 2RDLA 2BYAX 3SI4H 2TBSA 3B9FH 4NA8A 2QN5T 5FX6A 1FMGA 2I6QA 1RD3B 4IMZA 1KLIH 2G4TA 5HYOA 1O2ZA 2BDYA 3GDVA 4B2AA 3OTJE 3UOPA 5DO4H 1RJXB 1GJ4H 2J38A 1D3DB 3QZQA 1DFPA 1GVLA 1LVOA 4NIWA 1D6WA 1XM1A 2FMJA 1S85A 5J4QA 4JZDH 1NROH 3HK6B 4NSYA 2FS8A 4KKDA 1C1PA 2W26A 5DP5A 3RXOA 5C67A 1O2YA 1C2FA 1WSSH 3GCHB 1TABE 2ZU4A 1AZ8A 2ZFPH 2ZHQH 1HLTH 1GJBB 1HCGA 1PQ8A 4ISIH 2P3UB 1TRMA 3P8NA 1QBVH 2W3IA 2TGDA 4GSOA 2ALPA 4ABJA 1PPBH 1JRSA 2YNBA 4ZHMU 4ASHA 3E1XB 3SGAE 1K1LA 1V2WT 3EGKH 1P8VC 3FP7E 1QY6A 9LPRA 2P93A 1W0ZU 1AFQC 2ZC9H 1HAOH 4FUJA 3BEFB 2PV9B 1SLUB 3SN8A 1EASA 3O8CA 1W14U 4AFQA 1GMHF 2YOLA 4Q80A 1MAXA 4FXGH 3F1SB 3S9AA 2CHAC 4X2YA 2ZHEH 1GI5A 1EJNA 3RP2A 3HKJB 3AW0A 4K1SA 5JPMH 1N8OB 2XXLA 3EYDA 4U01A 3TK5A 3VXFH 1N6YA 3GYLB 3ZVCA 2J94A 1CBWC 3BN9A 2VU8E 1G3EA 2CGAA 1IOEA 2VH0A 3ZVBA 3TH4H 2ZZUH 2BD7A 1HRTH 4E7RG 2ZTZA 1DY9A 1LMWB 2EI7A 3BTME 3RXMA 4DT7B 4TPIZ 3BIVH 1QJ1B 1UTOA 2F9OA 2JH5D 4UEHH 1LPZB 4QT8C 2A0QB 1AZZA 1OWJA 3RC4A 2BX4A 3TJUA 4DJZB 2ZQ2A 1SGYE 3S7HB 3A83A 1J15A 3C27B 1BCUH 2OQUA 3PO1C 1H1BA 1K1IA 3GY3A 1F5LA 1UTMA 1EAUA 1MKWH 3NK8A 1X7AC 3EE0B 2P3FH 1WUNH 1O2TA 1HXEH 4I8KA 2VIWA 4UFEH 3HKIB 2AMQA 3ZYDA 2HOBA 3LPRA 4BAKB 3M5MA 2G8TA 1P09A 5GJ4B 3NZIA 1O2MA 1O5EH 4K1TA 1OSSA 3B8JA 1IQKA 2Q6GA 1JOUB 1T8MA 1KXDA 3VB6A 3QO6A 4BTTB 4FVDA 4JZ1A 1AFEH 4MNXA 1ZHRA 2GTBA 1A0HB 2QYIA 1ELBA 1BMMH 5A8YA 3TK9A 2P59A 4K69A 3VPKA 1CGHA 1DLKB 2WINI 1ELEE 1FV9A 1PPGE 2BHGA 4K5ZA 5F03A 2HNTE 5L6NH 5BPEA 3SV8A 3PLBA 1SC8U 2C8XB 1BHXB 1QBOA 4GCHG 2AGEX 4Y7AA 1FXYA 5GDSH 3DHKH 4AGKA 3SJ8A 3TU7H 1GL1A 5T6GA 5EW1H 2AYWA 1ELAA 1JIMA 1J17T 4GLYA 2A32A 2A5AA 4NG9H 1C5VA 4OS6A 2V6NA 2WPJS 1FNIA 2J95A 1LKBA 1BOQA 4MDSA 3RXDA 1ZZZA 4UD9H 1GI1A 3V12A 2GP9B 3OY6U 1YP9A 1FPCH 2FXRA 2IJOB 4ISNA 4XBCA 4KTUA 2GX4A 1G3DA 3UUZA 4IMQA 4Y7BA 1CSOE 1ZGIA 2PGQB 3MH6A 4RKJB 1IQMA 3D65E 3TH2H 1H9IE 1P11E 2FX4A 3H7OA 4ISLA 1UVSH 1TFXA 3ZZAA 5LH8A 2Z3EA 3QZRA 1G3BA 3AW1A 3P8GA 1MH0A 1EJMA 3A88A 1Z71A 4TY7A 3IWMA 3W95A 5EXNA 1HYLA 4A92A 2UWOA 2ZCLP 4AYYB 1A1RA 1FQ3A 2GZ7A 2XWAA 1WV7H 2D8WA 1GG6C 4XBBA 1L4ZA 4MNVA 2CMYA 1SFQB 1PJPA 2WPLS 3EDXB 1QHRB 3FANA 2XC0A 2J9NA 1WQVH 1C4V2 2BY9X 3RXSA 2OINA 5FAHA 2B5TB 1C5NH 4HFPB 4OS7A 1SLXB 4WVPE 4OS2A 3BTWE 1V3XA 4IN2A 1RIWB 4YOIA 1ZJKA 2C90B 2OBQA 2WYGA 1D4PB 2JETC 1SQAA 3M36A 1W10U 4ISHH 1BUIA 1SQTA 2AGGX 2O8MA 3IITA 3VGCC 4DVAU 2VWLA 4X8UH 1C1RA 3QDZB 4Y79A 1O5AB 2VNTA 1GJCB 4KGAA 2ZDMA 4Y10E 3GYMA 3VB4A 4OS1A 3SNCA 4BAHB 4O97A 4KELA 3SORA 4B75A 1O3PB 1Q3XA 2Y6TA 1MD7A 3BG4B 3U8OH 2VIVA 1O3IA 3E0NB 2GD4B 1K1NA 2BDGA 4KP0A 5EQRA 3A82A 4HI3A 2D2DA 1KXAA 1P2NA 2OLGA 2CJIA 2OD3B 1GHAF 1ESTA 1V2JT 1P01A 1P2QA 5DJ7A 4DCDA 3SI3H 2NU3E 2ZP0H 1TIOA 1O3FA 1UMAH 1MTNC 1D3TB 2FEQH 3NCLA 1V2LT 2FOCA 4X6PA 3A7XA 2FOFA 2VINA 3SU0A 1KXFA 4O9VA 3EA9A 1P2MA 1GBAA
chains in the Genus database with same CATH superfamily
1K1PA 4OGYA 2V3HH 2ZPRA 1TALA 1DXWA 1WYKA 2PKAA 3MH4A 3RMOH 1ANDA 3TVJB 1PPHE 1XVOA 2O8UA 5C0TA 4B73A 8GCHF 1O2PA 3VB7A 2RA0A 4TY6A 1YPJH 1W0YH 3F9HA 4Q4LA 1GMCF 1BMFD 1HAPH 1CA0B 1DPOA 1YCPH 3SZEA 3GCHC 1C5MD 1ZRKA 3E90B 2RCEA 2Y5HA 3BTKE 4YO9A 4YZUA 5JBBS 1COWD 1Z8JB 2BY8X 2ZECA 5GCHF 1PPFE 2GCTB 2ZDNA 3UWIA 3I77A 2ANMH 4FUFA 1TPAE 4WMDA 4JYUH 2BD8A 2DUCA 2VIPA 4XFQA 4ZMAH 3M3SA 5A0AE 2O8LA 3P95A 1OP0A 1QNJA 4Z1MD 5DN6D 2ZU5A 3KQEA 3M7TA 1NRRH 1CHOF 5C0UA 4Y11E 4TWYA 4K2YA 1O2IA 4J1YA 1BTXA 2YMSB 4X8TH 1SKYE 1EPTA 3UY9A 3H7TA 4U30A 3MYWA 1SGDE 3OE7D 1ELCA 2BQ6B 3P17H 1C4U2 5HMAA 1S83A 3BTGE 1O3JA 1MCTA 1V2RT 1HAHH 1FN6A 4KTSA 2FYQA 1GBHA 1HAVB 3MWIU 3SQEE 4UFDH 1DICA 2OC1A 5T3HA 4ABFA 1AB9B 1TX8A 4FVBA 1N8OC 3B23B 1GMDF 3ATMA 1QA0A 3ZIAD 1EB2A 1BJUA 2BXUH 1INCA 5ABWA 3SU6A 3LGIA 2O8WA 1KY9A 1O37A 3RXQA 1DX5M 5HGGA 1DWEH 4D7GA 1MZAA 1P05A 1GMHG 2ZTYA 1DSTA 1T4VH 1FN8A 1OYQA 3GDSA 2Y7XA 3OEED 3OEHD 5FPYA 2K8IA 3A8BA 1RTKA 2SGQE 1G30B 2QGRA 5C2ZA 1FJSA 5ESTE 1KXCA 5HXFA 1HNEE 3BTFE 1D6RA 1ZTKA 3UAIC 1AQ7A 1ZOMA 2BDHA 1YLDA 1TMBH 1SGPE 1AUTC 3RXUA 4TPYA 1GI2A 1JMOH 2QF3A 4Y8YA 5E0JA 3V0XA 2G00A 1GGDB 1V2MT 1KLJH 2W3KA 3OAAD 1N1LA 1OPHB 3EQ0H 4X1RU 2ANYA 2PFEA 1MBMA 3UFAA 4FU7A 2SGPE 3BTDE 1FIZA 2GV7A 3SV2H 5L2ZH 3F68H 1D3PB 1EAXA 3ATWA 2BD9A 1CVWH 1O5FH 4FUGA 4CRCA 2WUCA 1QA7A 5AF9H 1NBMD 3GCTF 2PGBB 1KDQA 4CRDA 5FX5A 1ZMJA 2D1JA 2BDAA 4U2WA 3A87A 3P8FA 3Q3KA 1C5WB 1V2PT 1Y5BT 2FOHA 3ZV8A 4DW2U 2GV6A 3L6PA 4NGAH 3ZZ6A 4HZHA 5J4SA 3GY4A 1GBDA 1O36A 2ANKH 3U8RH 1QCPA 4ZXYH 2KZ4A 1FY4A 2AERH 1GVZA 5EXMA 1GBBA 3P92A 4AFUA 2PW8H 3F9EA 2P95A 1TE0A 5FCRA 3V13A 1PFXC 3ZZ9A 4XD7D 3K6YA 2CV3A 1UVTH 3LC5A 1DWDH 2V0BA 2VGCB 2WV9A 1A5HA 3AAVA 4FUBA 3UNQA 2EI6A 4X2XA 3FVFB 1BQYA 3NXPA 2TGAA 1C2MA 4NWKA 3S69A 4XDEA 1OHHD 2AIPA 3K9XB 3JZ2B 5C1XA 5BRRE 1DSUA 1XKAC 1UK4A 2VVCA 4XE4A 1XUFA 4B2CA 1QIXB 3VB5A 1XUJA 1S6FA 1G32B 3FP6E 1F0SA 3RXTA 1JIRA 1P02A 3OU0A 2OP9A 1AE8H 1LHEH 4NA9H 1TOMH 3TGJE 1AVXA 3RXBA 2W6ID 1UCYK 3ATIA 2OCVB 2FTLE 1Y3VA 3F9GA 1SOTA 1AKSB 1EUFA 1SVPA 1SGFG 6ESTA 3SU1A 1HIAA 2GCHF 2UUFB 3OX7U 1Z7KA 4Q2KA 1UTJA 2SGEE 1GPZA 3UNSA 4DT4A 1V2VT 1VGCB 3T28A 3AASA 1V2ST 1BBRE 3LGVA 3M5LA 4FUEA 2ANWA 5EQSA 5T6FA 2FS9A 2O9QA 2TPIZ 3MFJA 1TX6A 1LHGH 2GDDA 2Q1JA 5F8ZA 4A6LA 1AWHB 3ENSB 2FTMA 4B71A 1GVKB 1IQIA 4X1NU 4DIIH 5HIYA 3DFLA 1GBLA 2QF4A 3A7ZA 3MO3A 1G2LA 3TPIZ 4DURA 1DUAA 1UHBB 1WXRA 3F0OA 1TPSA 2F4LA 2HALA 1FI8A 4F48B 2RA3A 2Y80A 5E0HA 4JYTA 4X8VH 2K0QA 2LP6A 3TNTA 1OWHA 2JH0D 4IN1A 1MQ5A 2EI8A 1KIGH 3Q3XA 3V7TA 1YLNA 2STAE 6CHAC 4WMFA 2AEIH 1CHGA 3QWCH 4MTBA 4NZLA 2VIDA 5C3NA 1EZQA 1V2QT 3BG4C 3CENA 4AFSA 2R9PA 4B76A 1QB1A 3PRBA 3R0FA 2YNAA 1F5RA 4CR5A 3PROA 3G01A 2XYAA 2ZFQH 4MPVA 3QTOH 1BRCE 5C1YA 3P70B 1SBWA 1O3KA 4WXIA 1TMTH 4R0IA 3UREA 1PQ5A 1O2HA 3SUDA 3UIRA 4BTIB 3M5NA 5A2MH 1WBGB 2UUJB 4I33A 4CREA 2OTVA 2J34A 3DSGA 2ZO3H 1O5BB 3BF6H 1P9UA 4X2VA 3URDA 3QLPH 2W7UA 2ODPA 1O34A 1BTWA 7GCHF 4DIHH 3HK3B 4TYDA 2DE9A 3PLPA 3IG6B 1BRAA 2BZAA 1GHAG 1OP2A 1QL9A 4UFFH 4F49A 1AO5A 3PV5A 4FETA 1F0RA 4FU9A 1YLCA 2GT7A 3FP8E 1BIOA 1YPLH 2RDEA 1GJ8B 2PP6A 3NRLA 4AG2A 4D9QA 1LVMA 1O2OA 2BOKA 2TGTA 1G9IE 1AMHA 3TJNA 2KAIA 1OXGA 1TQ0B 5EOKA 5HM2A 1NFUA 2J2UA 1W2KH 1CA0C 4ZKOU 3MNCA 3M61U 2FM2A 4Z6AH 1C1TA 1RS0A 2L74A 1YF4A 2H2ZA 2Q6FA 4DGJA 1NM6A 5E2PA 3GCOA 1A46H 3BG8A 1PPZA 3T62A 2GCTC 1A0JA 3Q00A 4CRFA 1NFXA 1GJ6A 2XBYA 1OKXA 2GDEH 1GDNA 8GCHG 3WWFA 1C1UH 3ZYEA 5FBIA 1DVAH 3LJOA 1GMCG 1L0ZA 4D76A 3GISB 1FAKH 1HBTH 3RXPA 1GI6A 5C1UA 3QGJA 2BTCE 2H6MA 3ODDA 4WMEA 3W1EA 1HB0B 2A7JA 5GCHG 1B0EA 2YMSC 1O2WA 1SGFA 4UDWH 1Z1IA 1O2LA 1ZMNA 1C2KA 4Q7YA 1TNKA 1GJ5H 1EOJA 1UK3A 5DP6A 1SGCA 5L2YH 1TGBA 1ZYOA 1GI8B 2ZGCA 1BB0B 1E37B 2A7HA 2HNTC 2ODYB 3DUXH 1CHOG 3URCA 4NCYA 1AB9C 2W5EA 4IS5A 4BXSA 1V2NT 5CMXH 1O32A 3SJ9A 2OUAA 4P02A 5EODA 1M9UA 1QFKH 3E0PB 8ESTE 1K22H 1NPMA 2QF0A 1ZHPA 1S6LA 1O3HA 1SMFE 2QAAA 1J14A 1T4UH 3RM2H 1VR1H 2R2WU 1O3LA 2FI4E 1GMDG 1O3EA 2WUBA 3LJJA 3MU8A 4DG4A 3KF2A 1U6QA 1MABB 3PTNA 1WAYB 4LK4A 3RXIA 1K1JA 1AVGH 2L6OA 7LPRA 2FESH 1O2KA 4J2YB 1GGDC 4I8LA 3UQVA 1ZSKA 2V3OH 3QK1A 1T31A 2BB4A 3L33A 1CE5A 1CO7E 3WY8A 1BBRH 1NU9A 1LVBA 5LPEA 1TGNA 1C5ZB 1ZR0A 2VWNA 2ASUB 1BT7A 1W7GH 2FLBH 1FONA 1BHXF 4O3UA 3NPSA 3SJOA 3TJOA 3KQCA 3LT3A 2BXTH 4LXBH 5FCKA 1A7SA 3BSQA 2WPDD 4Q7ZA 1TPOA 1SI5H 1MTVA 2Z9LA 2ZQ1A 5JBAS 2ZG0H 1NRSH 3Q76A 2V7QD 2FOAA 1K1MA 1Z8RA 1EFRD 1ZTJA 1IQGA 3RXFA 1VJAU 2K1QA 5E0GA 4HG6A 4JCNA 3MOCA 4UE7H 3FFGA 3KYGA 4RSPA 3GCTG 1LCYA 1G37A 1SGRE 4Y76A 3BV9B 1O3MA 1YGCH 1OX1A 2GKVE 4ZHAA 2F9PA 2VIOA 1GHZA 1QZ8A 1C5UA 1FDPA 1QQUA 2ZDKA 1ETRH 5B6OA 4I32A 2FPZA 3ZZCA 3A81A 5A09A 2VGCC 4AOQA 4CHAB 3RXHA 5JB9S 3RLWH 2FIRH 4IBLH 1P3CA 2G4UA 3ELAH 2A4OA 2WPIS 1K1OA 5DP4A 4GAWA 2G52A 3SNDA 3R3GB 2ZIQH 1NRNH 2C8YB 3RXRA 1K28D 1KLTA 3MH7A 1A3EH 3HPTB 4GHTA 3O8RA 5EIYA 1ANEA 4UONA 2AMDA 2ZFRH 2VJ1A 3E8LA 1CT4E 4RKOB 4I8JA 3OSYA 2ZF0H 2SNVA 3KQBA 1AWFH 3AK5A 2UUYA 2Y5FA 2QXJA 2B9LA 1LTOA 8KME2 4TT3D 2KM0A 4RT1A 2VWMA 2BVSH 5AHGH 1LHDH 3T5FH 1VGCC 1YPHE 3UR6A 5L30H 1C2DA 1ZHMA 1TLDA 3H5CB 3SV6A 1BRBE 1O5CB 1MD8A 1TPPA 3DFJA 3F0PA 3AVZA 1YPEH 1TNHA 1G2MA 2PSYA 1ANBA 3PWBA 1F0TA 4WH6A 4CRGA 2XRCA 2C8ZB 2GCHG 5A0CA 2GT8A 1MKWK 1ACBE 3A89A 3MO9A 4E06H 2SGAA 4ZKNU 4YLUA 1XX9A 1C2IA 3PWCA 1H8IH 5LPRA 1NRQH 4YESB 1C5OH 4JMYA 2HPPH 4ZH8A 2QXIA 2XBXA 3FN8A 3ESTA 2IJD1 1T8LA 1QL7A 2G81E 6CHAB 2ILNA 3F9FA 3SHAH 4NIYA 1BTYA 1C9TA 4Y6DA 4X2WA 2NWNA 3HGNA 7KMEH 1VCQA 3PV2A 4YOJA 3SU3A 1O2NA 1TNLA 2PUQH 1PQ7A 1W0JD 2NU0E 1TOCB 3L3TA 2ZU3A 5JB8S 1Y5AT 4SGAE 4E7NA 1F2SE 2Y5GA 2G5NA 3OFND 1DUEA 1Y59T 4NWLA 3S9CA 2JJ1D 4NSVA 1GCTB 1MUEB 3SUGA 1UVUH 4I31A 1L4DA 2M2AA 4FUCA 4ZKSU 2WPKS 3A80A 2FLRH 2GMTB 5EJZA 1S6HA 1YYY1 2PTCE 1H8DH 3N99A 1HJAB 3RMMH 3S9BA 2CK3D 1A61H 1HXFH 1C4Y2 1ABJH 1SB1H 3MMGA 1ELFA 1GI3A 1C1VH 2LNCA 2NU4E 1UTQA 3P6ZB 4ZXXH 2VVUA 1C1QA 3O8DA 1AE5A 1HAXB 1ZGVA 4RT0A 5CHAB 1VCPA 3RC5A 2J5UA 3TJVA 1MTUA 1MKXH 3PV4A 3SZNA 4FU8A 2ZPQA 1TMUH 1O39A 5I46H 2OBOA 2FYRA 1UTNA 7GCHG 3VEQB 1AN1E 2ZGJA 3QGNB 1AUJA 2QXHA 3U1JB 1TBRH 3FZDA 3Q3YA 3FKSD 3V3MA 1TONA 3GCNA 1GJAB 1EX3A 3VFEA 2XCFA 1Y3WA 3UPEA 1ARCA 1SL3A 1EATA 2Z94A 3U8TH 1E38B 3M7QA 4IC5A 4ABIA 4ISOA 3S7KB 1C5RA 3A8CA 3KHVA 2M5TA 4FUHA 1KTSB 1SQOA 1RRKA 5GPIB 1TGCA 1O2VA 1DLEA 1V2KT 3QUMP 2HNTF 1K0HA 1ZTLA 3SNBA 2GZ8A 3KCGH 1BTPA 2F9NA 1IQNA 1L2EA 3RXJA 2GGVB 4AC9A 3KQDA 1EP6A 1FY3A 5KEDA 3GICB 4NFEA 1ZSJA 3DA9B 4WWYA 1O31A 1NC6A 2HWLB 2ZU2A 2TGPZ 5DK1A 1CGIE 3GS9A 2HGTH 3LGWA 2J98A 3BTHE 1C2EA 1ARBA 1IAUA 1Q2WA 4LOYH 4BTUB 2QC2A 7ESTE 1GBFA 1K2I1 1H8HD 4H4FA 1THSH 4XBDA 1OS8A 1NY22 3F6UH 5C5OA 1IQJA 1EQ9A 1NN6A 1SGTA 3LIWA 3FOAA 3TIUA 5AVDA 3BEUA 1DXPA 3SQHE 1UTPA 4A7IB 2QXGA 3RXKA 2FO9A 3SO3A 1MU6B 2LELA 2G5VA 3SOSA 1SPJA 4Y8ZA 5C20A 1L1GA 1O2SA 1C1SA 2XC5A 3ATKA 1O0DH 3U28C 1FY5A 5AFZH 3F3BA 2D26C 1C1MA 1P03A 4AB8A 2ZU1A 1MAYA 2F9UA 3ZVGA 3ZZ4A 4YT6H 2O8TA 4K60A 2BVXH 5LGOA 1NU7B 2ZA5A 3D62A 4O3TA 1GJDB 1GHBF 3GY5A 1ETTH 1GBMA 1MTSA 1S5SA 1YBWA 1MKXK 2PKAB 4ABBA 3SV9A 2FZZA 2FOBA 4DY7B 1NT1A 2PLXA 5CHBA 3DD2H 2G55A 1NS3A 1ELGA 1YCPK 2ZWLH 1LHFH 3D23A 3S0NA 2BD5A 1SLWB 1T8NA 1EZSC 1XXDA 2BZ6H 5F8XA 2ZDAH 4GVUA 1F0UA 2ZFTA 3PYHA 2FP7B 4DOQA 2XTTB 2FOGA 4FUIA 3SUEA 1WCZA 2P16A 1FLEE 1GI9B 3A84A 2F83A 4CHAC 1QRXA 1V2TT 2ZCKP 1IQLA 5TJXA 2CN0H 4CRAA 1GCDA 1FUJA 1O3OA 5G4BA 4ZUHA 1GWAA 2BLOA 4YTAA 3SHCH 5TCAA 3QTVH 2ESTE 1S0QA 4X8SH 3KEEA 4THNH 5F6MA 2R0LA 4RI0A 1EPTB 1LDTT 1P2KA 1Z8GA 1BTZA 4AORA 2XCNA 1EJAA 1P3EA 3GY8A 4MPUA 1GI7B 1LHCH 1S82A 1HAGE 3ITIA 4JK6A 1Z6JH 1K9OE 2PR3A 4D7FA 2C4FH 2BVRH 1Y5UT 5EPNA 1YY3A 2HLCA 3JZ1B 4OS4A 1A5GH 3NWUA 2AH4X 2JH6D 1L1JA 1O2QA 5C17A 1ABIH 3LKWA 3PLKA 4ZAEA 3RXVA 4CH2B 4ESTE 3MNSA 5CE1A 1QB6A 3SJKA 1XUIA 1GHWH 1VITF 3A7WA 1W11U 6LPRA 1AVWA 1GI0A 3OY5U 2Z3DA 2XBVA 3UNRA 3LOXA 1XUHA 1V6DA 1FY8E 3M5OA 4ABDA 1BJVA 4X1SU 1W0KD 3QX5H 2A1DB 1TX7A 2IN2A 2HVXA 3NUMA 4Y0ZE 3RXEA 4RN6A 1AY6H 1ID5H 3CS7A 2BDCA 1EP5A 1WU1A 3H09A 1O38A 1MCVA 2BDIA 2BD3A 3M3VA 3KYFA 1O2JA 2F9VA 3NKKA 2BM2A 2OXSA 2UWLA 1DT2A 1E36B 1BRUP 5A8XA 3TGIE 1NFWA 1P57B 1W12U 3LGUA 3DSPA 3RMLH 1C1OA 1KDQB 4MPXA 1K21H 1LVYA 5SGAE 4R8TB 1SG8B 2XWBI 2AFQB 1SLVB 3UOUA 1W13U 1GCTC 5ESBA 3U9AH 1PYTD 1GDUA 2WHXA 1EKBB 3ZV9A 1O2XA 3RU4D 2GMTC 3LONA 1B5GH 3ZZ5A 1P10A 5DGJA 1BDAA 2PWXA 1HJAC 5DG6A 2R2MB 5DKMA 1TB6H 4INKA 1ZPCA 1AHTH 4TSFD 2IOTA 2WSSD 1A5IA 1LPGB 3P8OA 1EZXC 1YC0A 3ODFA 2PKSB 1DOJA 5CHAC 5GNDA 3TLOA 5IYTA 2ZDLA 1QURH 3RU4E 1RGQA 1QTFA 1C5SA 1O3DA 1A4WH 1B0FA 6GCHF 2JJ2D 2OC0A 2PSXA 4NFFA 1GL0E 4HTCH 2KR7A 1B7XB 3UTUH 1OWDA 1D3QB 3HATH 3TNSA 2ZFFH 2A5KA 2Z9KA 5FHTA 2WZQA 3KNXA 4M9FA 2QCYA 1XUKA 3RXGA 4AZ2B 4JZFH 2SGDE 1GI4A 2AS9A 1Q31A 1HIAB 3M7UA 3STJA 3CP7A 2XOKD 2XNDD 1UVOA 2BOHB 1F92A 3RDZA 2H9HA 1NESE 2V35A 1GBEA 1TBQH 4TWWA 3KL6A 1MQ6A 4IW4E 3AAUA 3K65B 4M7GA 3U98H 1JRTA 1BMNH 5JBTA 1S0RA 4H6SB 1P0SH 2AGIX 1O3AA 3C1KA 2BLWA 1Y3XA 1LPKB 1THPB 5TCCA 3CS0A 2CF8H 2A7CA 3BEIB 2KFWA 3FO8D 2ZKSA 3PMHB 2ZHWH 1T32A 1MU8B 1OOKB 3ZZDA 1QJ6B 4D9RA 1G36A 1FIWA 1WDIA 4JZEH 1S81A 2AMPA 2ZGXH 2A5IA 3BTEE 2H9TH 2TIOA 4GHQA 1YPGH 2FDAA 2VB0A 2ZHDA 4OM9A 1RTFB 1T8OA 2Y7ZA 3MU1A 4BANB 4I8GA 3OTPA 5CDFE 1F7ZA 4B2BA 3GDUA 2Y82A 4B6EA 3UB0A 1KSNA 2EY4C 5IDKA 1F5KU 1DWCH 2ZI2H 8LPRA 1VJ9U 5GWZA 2EC9H 3UWJH 3MO6A 4ABEA 4MG3A 2FOMB 1LKAA 1HFDA 1ZMLA 1C5LH 2PUXB 1GJ7B 3LDXH 1P12E 2Z9GA 1EAIA 1H8ED 2B0FA 1O2UA 4IC6A 4WXVA 3FZZA 4INLA 1SFIA 2BY6X 3ZZBA 3DSOA 4A1VA 4H6TA 1DWBH 1YCPM 4Q7XA 2THFB 4B6FA 2ODQA 3KGPA 1O3NA 1HJ8A 1GBCA 2WV5A 3D49H 1G3CA 3MH5A 4Y0YE 1YPHC 1V2OT 1EOLA 4A5TS 1O35A 1HAIH 1UVPA 1EAWA 2OC8A 1C5QA 1GBKA 3HGPA 4MNYA 1NFYA 1QJ7B 3DCLA 3STIA 3PB1E 1KMHB 4FOUC 5DPAA 3RMNH 1H4WA 1UCYE 3PMJA 1P2IA 1VCWA 2OQ5A 2KAIB 1GHBG 1RXPA 1CU1A 5DP9A 1O2RA 2Z9IA 4VGCB 1DDJA 3TITA 2CXVA 3A8DA 4Y8XA 2C8WB 4CR9A 1Z1JA 1DS2E 1Z8IB 2UUKB 3ZVAA 1DM4B 2FOEA 4CBNA 2Z6BD 1P06A 1UK2A 4GUXA 5JDUB 5T1VA 2ALVA 1DANH 4BNRA 2DE8A 1MTWA 4D8NA 4AFZA 1RTLA 1Y8TA 2R3UA 5EU8A 2P8OB 3ZVFA 1XUGA 3A7VA 1OWIA 1EPTC 3SNEA 2FI5E 2Q6DA 5H4IB 4A1XA 1UW7A 5T6DA 3KQ5A 3W94A 2PTNA 4AN7A 1CT2E 2NU1E 1DY8A 2OC7A 3UR9A 2HRVA 5HM9A 1TWXB 1QQ4A 5DP7A 4YOGA 1C5TA 1TGSZ 2A4QA 5EW2H 1J8AA 2ZFSA 4YT7H 3MU4A 1WTGH 5A8ZA 1QBNA 3LGTA 2H1UA 2WPMS 1O5GH 1AI8H 4BAMB 1HAVA 2BX3A 2OK5A 5FPSA 4IGDA 1W8BH 3M3TA 2AIQA 1D9IA 3E91A 2QIQA 2CF9H 1ZLRA 2EA3A 1PPCE 2J4IA 4ACBA 1WQSA 1J9CH 1BBRK 1E1RD 3MNBA 1VITG 4AG1A 1C9PA 2EEKA 3EA7A 4X6MA 2VIQA 3T26A 1OWEA 4OS5A 5FPTA 2BMGB 9ESTA 5I25A 3T25A 2QA9E 1KXEA 2XNIA 3E16B 1Z6EA 1IQHA 2B7DH 3A8AA 1W3CA 2EQNA 2VVVA 4NZQA 4X1QU 2A31A 5K0HA 1T7CA 2ZTXA 1SGIB 5JYIA 1SGEE 4UFGH 1EZUC 1MBQA 3LC3A 5DSFA 3SUFA 4BOHA 2RG3A 3MNXA 5EG4A 1V2UT 2Y81A 1BMLA 2BD4A 3DT0H 2B8OH 1TNIA 2QY0B 3RC6A 1GBIA 1O3CA 3TGKE 1TBZH 2A4RA 1AGJA 3SV7A 3TH3H 5DP8A 3TK6A 2UWPA 3CNRA 3OYPA 1EXFA 1TNGA 2AHME 1WOFA 2ZCHP 2BQ7B 4NIXA 1IQEA 1YWUA 2JIZD 3RXAA 2PKSC 5E8EH 2STBE 4FUDA 3LH3A 2BLQA 4MPWA 3N7DA 4LZ1H 3GY2A 3O8BA 2NU2E 3PTBA 2ZGBH 2FODA 5A0BA 1BTHH 1SHHB 1ZPBA 3MHWU 5E2OA 1C5YB 2ZDVH 4O03A 1QL8A 1GBJA 4Q63A 4X1PU 4INHA 1BZXE 4KTCA 1GHVH 2I6SA 1ZSLA 3LU9B 1FPHH 4K8YA 3F2HA 5JBCS 1NTPA 2SFAA 1E79D 6GCHG 3U69H 1DE7H 3RUOA 1CT0E 1ZPZA 1P04A 4H42U 1ORFA 2WYJA 1LQEA 4XSKU 5GXPA 4ABHA 1MMJN 2P94A 1FZZA 1GBTA 3KN2A 5EJLA 3LGYA 1A0LA 5DP3A 3F2FA 3M37A 3SU4A 4BXWA 2XC4A 1AD8H 1A3BH 3PM3A 1AFQB 4CRBA 1AKSA 1YKTA 5C5NA 1CA8B 3WWBA 4YLQH 1E1QD 4CH8B 2WPHS 2BDBA 2R0KA 1O3GA 1GJ9B 3T29A 1BITA 1NO9H 1TQ7B 1UCYH 2CHAB 1HJ9A 5FBEA 2XBWA 4B74A 4GPGA 1YM0A 4I8HA 2W7SA 3SW2B 1CBWB 3UQOA 1CGJE 4YM9A 2QV1A 4WY3A 1HGTH 4AB9A 1UTKA 3E6PH 4ZKRU 3LH1A 3SGQE 1ELTA 3KIDU 2KCAA 1PPEE 3A86A 2A4GA 2P3TB 4WH8A 5EPYA 5LPFA 2VWOA 1O5DH 1BMAA 1QRZA 5PTPA 3A85A 2C3SA 1P2OA 1NRPH 1QB9A 4NIVA 1UHBA 3PO1B 1LQDB 3SU2A 4YXWD 4Y71A 4ZROA 2GVFA 3U1IB 1WTHD 1ANCA 3VXEH 1TNJA 3MU5A 2WV4A 3I29A 3MI4A 1ETSH 2F91A 1XKBC 3GY7A 1N6XA 1CQQA 4K3JA 2SGFE 1OWKA 2G51A 5KGOA 4GCHF 4CBOA 1QGFA 4PROA 1MZDA 2J92A 3RXCA 5AFYH 3ZVEA 1TRNA 1YPKH 3K2UA 1C2LA 2BD2A 3SBKA 3SGBE 1DITH 1C2GA 1HAZB 1RFNA 1TYNA 3A7TA 2A45B 2Z7FE 1GHXH 3I78A 3K6ZA 3N7OA 1XVMA 3BTQE 1W7XH 4Z0KA 5EJ1A 3EA8A 2IPHA 1AIXH 1O2GH 1PQAA 2SNWA 1J16A 3SJIA 4ABGA 5K7RA 1O33A 1HDTH 2ZGHA 3ZZ8A 3RM0H 3EE7A 2BQWB 4MLFB 3SNAA 1P2JA 1TRYA 2Z9JA 2ZNKH 1TA2A 1SGQE 4U32A 3T2NA 3T27A 1SHYA 1TA6A 3BIUH 3BTTE 2H5CA 1E0FD 1NBME 2F3CE 2R3YA 2GZ9A 3ZVDA 1SSXA 2ZEBA 1OP8A 1XMNB 3E3TA 1XXFA 3PMAB 5FXLA 4XOJA 1ELVA 1IHSH 4VGCC 1AU8A 4WF8A 2KX4A 2VBCA 1SGNE 1VKYA 2LPRA 3ATLA 1OYTH 1HAYB 2H5DA 3GY6A 1SOZA 2JKHA 3MU0A 1GHYH 4K8BA 2ZPSA 2Z3CA 1IQFA 1YPMH 1S84A 2FX6A 4F55A 1NZQH 1KYNA 1C5XB 4HGCA 1IHTH 5HKKD 4AYVB 3MTYA 4WJG2 1UO6A 2P8OC 1E35B 1EB1H 1P9SA 2HPQH 3VB3A 1SR5C 1UTLM 4LZ4B 1FY1A 1HUTH 1ZRBA 1QRWA 2FI3E 4MVNA 4A1TA 1BA8B 1Y3UA 1GG6B 2GJGA 1QR3E 2BY5X 2TRMA 1ELDE 4NA7A 4BAQB 2HVYB 2BY7X 3SU5A 4MNWA 4AX9H 2ZHFH 1JXPA 4ABAA 1TAWA 2J98B 1L1NA 5EQQA 1C2JA 1ESBA 4SGBE 3GOVB 4X0WU 2BLVA 1C1NA 1VITH 1BTUA 4JK5A 1ESAA 5GIBA 1C1WH 3M35A 2JETB 2FWWA 5F8TA 1PYTC 3QN7A 4X6NA 1JWTA 1HPGA 1RIWC 4OGXA 3Q77A 3PMBB 1UJ1A 3VGCB 1GDQA 1E34B 4K1EA 4I7YH 4I86A 5EGMA 1VZQH 2J97A 4JYVH 3A7YA 4B1TA 2PHBA 1C5PA 1H9LB 4JZIA 1JBUH 3RU4T 2ULLA 4ASUD 5EXLA 4P00A 3ZZ3A 1TGTA 1A2CH 3FAOA 1Y3YA 2A2XH 4E05H 1O3BA 1C2HA 2XW9A 4F4OC 3EAJA 2H9EH 4X6OA 2KCYA 1KXBA 4ZHLU 5IK2D 1KTTB 5ETXA 3ZZ7A 1MTNB 2VH6A 1LO6A 1O30A 3RXLA 1ZJDA 4BAOB 1FAXA 4MQAA 1HV7A 1THRH 4AGJA 2A2QH 2C93B 2F9BH 3RLYH 1H9HE 2RDLA 2BYAX 3SI4H 2TBSA 3B9FH 4NA8A 2QN5T 5FX6A 1FMGA 2I6QA 1RD3B 3F2GA 4IMZA 1KLIH 2G4TA 5HYOA 1O2ZA 2BDYA 3GDVA 4B2AA 3OTJE 3UOPA 5DO4H 1RJXB 1GJ4H 2J38A 1D3DB 3QZQA 1DFPA 1GVLA 1LVOA 2HLDD 4NIWA 1D6WA 1XM1A 2FMJA 1S85A 5J4QA 4JZDH 1NROH 3HK6B 4NSYA 2FS8A 4KKDA 1C1PA 5C94A 2W26A 5DP5A 3RXOA 5C67A 1O2YA 1C2FA 1WSSH 3GCHB 1TABE 2ZU4A 1AZ8A 2ZFPH 2ZHQH 3N7EA 1HLTH 1GJBB 2F43B 1HCGA 1PQ8A 4ISIH 2P3UB 1TRMA 3P8NA 1QBVH 2W3IA 4XRNA 2TGDA 4GSOA 2ALPA 4ABJA 1PPBH 1JRSA 2YNBA 4ZHMU 4ASHA 3E1XB 3SGAE 1K1LA 1V2WT 3EGKH 1P8VC 3FP7E 1QY6A 9LPRA 2P93A 1W0ZU 1AFQC 2ZC9H 1HAOH 4FUJA 3BEFB 2PV9B 1SLUB 3SN8A 1EASA 3O8CA 1W14U 4AFQA 1GMHF 2YOLA 4Q80A 1MAXA 4FXGH 3MQKC 3F1SB 3S9AA 2CHAC 4X2YA 2ZHEH 1GI5A 1EJNA 3RP2A 3HKJB 3AW0A 4K1SA 5JPMH 1N8OB 2XXLA 3EYDA 4U01A 3TK5A 3VXFH 3WW7A 1N6YA 3GYLB 3ZVCA 2J94A 1CBWC 3BN9A 2VU8E 1G3EA 2CGAA 1IOEA 2VH0A 3ZVBA 3TH4H 2ZZUH 2BD7A 1HRTH 4E7RG 2ZTZA 1DY9A 1LMWB 2EI7A 3BTME 3RXMA 4DT7B 4TPIZ 3BIVH 1QJ1B 1UTOA 2F9OA 2JH5D 4UEHH 1LPZB 4QT8C 2A0QB 1AZZA 1OWJA 3RC4A 2BX4A 3TJUA 4DJZB 2ZQ2A 1SGYE 2YMSD 5HIZA 3S7HB 3A83A 1J15A 3C27B 1BCUH 2OQUA 3PO1C 1H1BA 1K1IA 3GY3A 1F5LA 1UTMA 1EAUA 1MKWH 3NK8A 1X7AC 3EE0B 2P3FH 1WUNH 1O2TA 1HXEH 3PRDA 4I8KA 2VIWA 4UFEH 3HKIB 2AMQA 3ZYDA 2HOBA 3LPRA 4BAKB 3M5MA 2G8TA 1P09A 5GJ4B 3NZIA 1O2MA 1O5EH 4K1TA 1OSSA 3B8JA 1IQKA 2Q6GA 1JOUB 1T8MA 1KXDA 3VB6A 3QO6A 4BTTB 4FVDA 2V3MA 5B6LA 4JZ1A 1AFEH 4MNXA 1ZHRA 2GTBA 1A0HB 2QYIA 2RFKC 1ELBA 1BMMH 5F53A 5A8YA 1FX0B 3TK9A 1SQRA 2P59A 4K69A 3VPKA 1CGHA 1DLKB 2WINI 1ELEE 1FV9A 1PPGE 2BHGA 4K5ZA 5F03A 2HNTE 5L6NH 5BPEA 3SV8A 3PLBA 1SC8U 2C8XB 1BHXB 1QBOA 4GCHG 2AGEX 4Y7AA 1FXYA 5GDSH 3DHKH 4AGKA 3SJ8A 3TU7H 1GL1A 5T6GA 2IPQX 5EW1H 2AYWA 1ELAA 1JIMA 1J17T 4GLYA 2A32A 2A5AA 4NG9H 1C5VA 4OS6A 2V6NA 2WPJS 1FNIA 2J95A 1LKBA 1BOQA 5KECA 4MDSA 3RXDA 1ZZZA 4UD9H 1GI1A 3V12A 2GP9B 3OY6U 1YP9A 1FPCH 2FXRA 2IJOB 4ISNA 2KCPA 4XBCA 4ZCNA 4KTUA 2GX4A 1G3DA 3UUZA 2KCOA 4IMQA 4Y7BA 1CSOE 1ZGIA 2PGQB 3MH6A 4RKJB 1IQMA 3D65E 3TH2H 1H9IE 1P11E 2FX4A 3H7OA 4ISLA 1UVSH 2QF5A 1TFXA 3ZZAA 5LH8A 2Z3EA 3QZRA 1G3BA 3AW1A 3P8GA 1MH0A 1EJMA 3A88A 1Z71A 4TY7A 3IWMA 3W95A 5EXNA 5FL7D 1HYLA 4A92A 2UWOA 2ZCLP 4AYYB 1A1RA 1FQ3A 2GZ7A 2XWAA 1WV7H 2D8WA 1GG6C 4XBBA 1L4ZA 4MNVA 2CMYA 1SFQB 1PJPA 2WPLS 3EDXB 2JDID 1QHRB 3FANA 2XC0A 2J9NA 1WQVH 1C4V2 2BY9X 3RXSA 2OINA 5FAHA 2B5TB 3SYJA 1C5NH 4HFPB 3VG8A 4OS7A 1SLXB 4WVPE 4OS2A 3BTWE 1V3XA 4IN2A 1RIWB 4YOIA 1ZJKA 2C90B 2OBQA 2WYGA 1D4PB 2JETC 1SQAA 3M36A 1W10U 4ISHH 1BUIA 1SQTA 2AGGX 2O8MA 3IITA 3VGCC 4DVAU 2VWLA 4X8UH 1C1RA 3QDZB 4Y79A 1O5AB 2VNTA 1GJCB 4KGAA 2ZDMA 4Y10E 3GYMA 3VB4A 4OS1A 3SNCA 4BAHB 4O97A 4KELA 3SORA 4B75A 1O3PB 1Q3XA 2Y6TA 1MD7A 3BG4B 3U8OH 2VIVA 1O3IA 3E0NB 2GD4B 1K1NA 2BDGA 4KP0A 5EQRA 3A82A 4HI3A 2D2DA 1KXAA 1P2NA 2OLGA 2W6JD 2CJIA 2OD3B 1GHAF 1ESTA 1V2JT 1P01A 1P2QA 5DJ7A 4DCDA 3SI3H 2NU3E 2ZP0H 1TIOA 1O3FA 1UMAH 1MTNC 1D3TB 2FEQH 2QE7D 3NCLA 1V2LT 2FOCA 4X6PA 3A7XA 2FOFA 2VINA 3SU0A 1KXFA 4O9VA 3EA9A 4ACAA 1P2MA 1GBAA
chains in the Genus database with same CATH topology
1K1PA 4OGYA 2V3HH 2ZPRA 1TALA 1DXWA 1WYKA 2PKAA 3MH4A 3RMOH 1ANDA 3TVJB 1PPHE 1XVOA 2O8UA 4B73A 8GCHF 1O2PA 3VB7A 2RA0A 4TY6A 1YPJH 1W0YH 3F9HA 1GMCF 1HAPH 1CA0B 1DPOA 1YCPH 3GCHC 1C5MD 1ZRKA 3E90B 2RCEA 2Y5HA 3BTKE 4YO9A 4YZUA 5JBBS 5GCHF 1Z8JB 2BY8X 2ZECA 1PPFE 2GCTB 2ZDNA 3UWIA 3I77A 2ANMH 4FUFA 1TPAE 4WMDA 4JYUH 2BD8A 2DUCA 2VIPA 4XFQA 4ZMAH 3M3SA 5A0AE 2O8LA 3P95A 1OP0A 1QNJA 2ZU5A 3KQEA 3M7TA 1NRRH 1CHOF 4Y11E 4TWYA 4K2YA 1O2IA 4J1YA 1BTXA 4X8TH 1EPTA 3UY9A 3H7TA 4U30A 3MYWA 1SGDE 1ELCA 2BQ6B 3P17H 1C4U2 5HMAA 1S83A 3BTGE 1O3JA 1MCTA 1V2RT 1HAHH 1FN6A 4KTSA 2FYQA 1GBHA 1HAVB 3MWIU 3SQEE 4UFDH 1DICA 2OC1A 5T3HA 4ABFA 1AB9B 1TX8A 4FVBA 1N8OC 3B23B 1GMDF 3ATMA 1QA0A 1EB2A 1BJUA 2BXUH 1INCA 5ABWA 3SU6A 3LGIA 2O8WA 1KY9A 1O37A 3RXQA 1DX5M 5HGGA 1DWEH 4D7GA 1MZAA 1P05A 1GMHG 2ZTYA 1DSTA 1T4VH 1FN8A 1OYQA 3GDSA 2Y7XA 5FPYA 3A8BA 1RTKA 2SGQE 1G30B 2QGRA 5C2ZA 1FJSA 5ESTE 1KXCA 5HXFA 1HNEE 3BTFE 1D6RA 1ZTKA 1AQ7A 1ZOMA 2BDHA 1YLDA 1TMBH 1SGPE 1AUTC 3RXUA 4TPYA 1GI2A 1JMOH 2QF3A 4Y8YA 5E0JA 3V0XA 2G00A 1GGDB 1V2MT 1KLJH 2W3KA 1N1LA 1OPHB 3EQ0H 4X1RU 2ANYA 2PFEA 1MBMA 3UFAA 4FU7A 2SGPE 3BTDE 1FIZA 2GV7A 3SV2H 5L2ZH 3F68H 1D3PB 1EAXA 3ATWA 2BD9A 1CVWH 1O5FH 4FUGA 4CRCA 2WUCA 1QA7A 5AF9H 3GCTF 2PGBB 1KDQA 4CRDA 5FX5A 1ZMJA 2D1JA 2BDAA 4U2WA 3A87A 3P8FA 3Q3KA 1C5WB 1V2PT 1Y5BT 2FOHA 3ZV8A 4DW2U 2GV6A 3L6PA 4NGAH 3ZZ6A 4HZHA 5J4SA 3GY4A 1GBDA 1O36A 2ANKH 3U8RH 1QCPA 4ZXYH 1FY4A 2AERH 1GVZA 5EXMA 1GBBA 3P92A 4AFUA 2PW8H 3F9EA 2P95A 1TE0A 5FCRA 3V13A 1PFXC 3ZZ9A 3K6YA 2CV3A 1UVTH 3LC5A 1DWDH 2V0BA 2VGCB 3AAVA 1A5HA 3UNQA 4FUBA 2EI6A 4X2XA 3FVFB 1BQYA 3NXPA 2TGAA 1C2MA 4NWKA 3S69A 4XDEA 2AIPA 3K9XB 3JZ2B 5C1XA 5BRRE 1DSUA 1XKAC 1UK4A 2VVCA 4XE4A 1XUFA 4B2CA 1QIXB 3VB5A 1XUJA 1S6FA 1G32B 3FP6E 1F0SA 3RXTA 1JIRA 1P02A 3OU0A 2OP9A 1AE8H 1LHEH 4NA9H 1TOMH 3TGJE 1AVXA 3RXBA 3ATIA 1UCYK 2OCVB 2FTLE 1Y3VA 3F9GA 1SOTA 1AKSB 1EUFA 1SVPA 1SGFG 6ESTA 3SU1A 1HIAA 2GCHF 2UUFB 3OX7U 1Z7KA 4Q2KA 1UTJA 2SGEE 1GPZA 3UNSA 1V2VT 1VGCB 3T28A 3AASA 1V2ST 1BBRE 3LGVA 3M5LA 4FUEA 2ANWA 5EQSA 5T6FA 2FS9A 2O9QA 2TPIZ 3MFJA 1TX6A 1LHGH 2GDDA 2Q1JA 5F8ZA 4A6LA 1AWHB 3ENSB 2FTMA 4B71A 1GVKB 1IQIA 4X1NU 4DIIH 3DFLA 1GBLA 3A7ZA 3MO3A 1G2LA 3TPIZ 4DURA 1DUAA 1UHBB 1TPSA 2HALA 1FI8A 2RA3A 2Y80A 5E0HA 4JYTA 4X8VH 3TNTA 1OWHA 2JH0D 4IN1A 1MQ5A 2EI8A 1KIGH 3Q3XA 3V7TA 2STAE 6CHAC 4WMFA 2AEIH 1CHGA 3QWCH 4MTBA 4NZLA 2VIDA 5C3NA 1EZQA 1V2QT 3BG4C 3CENA 4AFSA 2R9PA 4B76A 1QB1A 3R0FA 2YNAA 1F5RA 4CR5A 3PROA 3G01A 2XYAA 2ZFQH 4MPVA 3QTOH 1BRCE 5C1YA 3P70B 1SBWA 1O3KA 4WXIA 1TMTH 4R0IA 3UREA 1PQ5A 1O2HA 3SUDA 3UIRA 4BTIB 3M5NA 5A2MH 1WBGB 2UUJB 4I33A 4CREA 2OTVA 2J34A 2ZO3H 1O5BB 3BF6H 1P9UA 4X2VA 3URDA 3QLPH 2W7UA 2ODPA 1O34A 1BTWA 7GCHF 4DIHH 3HK3B 4TYDA 2DE9A 3PLPA 3IG6B 1BRAA 2BZAA 1GHAG 1OP2A 1QL9A 4UFFH 4F49A 1AO5A 1F0RA 4FU9A 1YLCA 2GT7A 3FP8E 1BIOA 1YPLH 1GJ8B 4AG2A 4D9QA 1LVMA 1O2OA 2BOKA 2TGTA 1G9IE 1AMHA 3TJNA 2KAIA 1OXGA 1TQ0B 5EOKA 5HM2A 1NFUA 2J2UA 1W2KH 1CA0C 4ZKOU 3MNCA 3M61U 2FM2A 4Z6AH 1C1TA 1RS0A 1YF4A 2H2ZA 2Q6FA 4DGJA 1NM6A 5E2PA 3GCOA 1A46H 3BG8A 1PPZA 3T62A 2GCTC 1A0JA 3Q00A 4CRFA 1NFXA 1GJ6A 2XBYA 1OKXA 2GDEH 1GDNA 8GCHG 1C1UH 3ZYEA 5FBIA 1DVAH 3LJOA 1GMCG 1L0ZA 4D76A 3GISB 1FAKH 1HBTH 3RXPA 1GI6A 5C1UA 3QGJA 2BTCE 2H6MA 3ODDA 4WMEA 1HB0B 2A7JA 5GCHG 1B0EA 1O2WA 1SGFA 4UDWH 1Z1IA 1O2LA 1ZMNA 1C2KA 4Q7YA 1TNKA 1GJ5H 1EOJA 1UK3A 5DP6A 1SGCA 5L2YH 1TGBA 1ZYOA 1GI8B 2ZGCA 1BB0B 1E37B 2A7HA 2HNTC 2ODYB 3DUXH 1CHOG 3URCA 4NCYA 1AB9C 2W5EA 4IS5A 4BXSA 1V2NT 5CMXH 1O32A 3SJ9A 2OUAA 5EODA 1M9UA 1QFKH 3E0PB 8ESTE 1K22H 1NPMA 2QF0A 1ZHPA 1O3HA 1SMFE 2QAAA 1J14A 1T4UH 3RM2H 1VR1H 2R2WU 1O3LA 2FI4E 1GMDG 1O3EA 2WUBA 3LJJA 3MU8A 4DG4A 3KF2A 1U6QA 3PTNA 1WAYB 4LK4A 3RXIA 1K1JA 1AVGH 7LPRA 2FESH 1O2KA 4J2YB 1GGDC 4I8LA 3UQVA 1ZSKA 2V3OH 3QK1A 1T31A 2BB4A 3L33A 1CE5A 1CO7E 3WY8A 1BBRH 1NU9A 1LVBA 5LPEA 1TGNA 1C5ZB 1ZR0A 2VWNA 2ASUB 1BT7A 1W7GH 2FLBH 1FONA 1BHXF 4O3UA 3NPSA 3SJOA 3TJOA 3KQCA 3LT3A 2BXTH 4LXBH 5FCKA 1A7SA 3BSQA 4Q7ZA 1TPOA 1SI5H 1MTVA 2Z9LA 2ZQ1A 5JBAS 2ZG0H 1NRSH 3Q76A 2FOAA 1K1MA 1Z8RA 1ZTJA 1IQGA 3RXFA 1VJAU 2K1QA 5E0GA 4JCNA 3MOCA 4UE7H 3FFGA 4RSPA 3GCTG 1LCYA 1G37A 1SGRE 4Y76A 3BV9B 1O3MA 1YGCH 1OX1A 2GKVE 4ZHAA 2F9PA 2VIOA 1GHZA 1C5UA 1FDPA 1QQUA 2ZDKA 1ETRH 5B6OA 4I32A 2FPZA 3ZZCA 3A81A 5A09A 2VGCC 4AOQA 4CHAB 3RXHA 5JB9S 3RLWH 2FIRH 4IBLH 1P3CA 2G4UA 3ELAH 2A4OA 2WPIS 1K1OA 5DP4A 4GAWA 2G52A 3SNDA 3R3GB 2ZIQH 1NRNH 2C8YB 3RXRA 1K28D 1KLTA 3MH7A 1A3EH 3HPTB 4GHTA 3O8RA 1ANEA 4UONA 2AMDA 2ZFRH 2VJ1A 3E8LA 1CT4E 4RKOB 4I8JA 3OSYA 2ZF0H 2SNVA 3KQBA 1AWFH 2UUYA 2Y5FA 2QXJA 2B9LA 1LTOA 8KME2 2VWMA 2BVSH 5AHGH 1LHDH 3T5FH 1VGCC 1YPHE 3UR6A 5L30H 1C2DA 1ZHMA 1TLDA 3H5CB 3SV6A 1BRBE 1O5CB 1MD8A 1TPPA 3DFJA 3AVZA 1YPEH 1TNHA 1G2MA 2PSYA 1ANBA 3PWBA 1F0TA 4WH6A 4CRGA 2XRCA 2C8ZB 2GCHG 5A0CA 2GT8A 1MKWK 1ACBE 3A89A 3MO9A 4E06H 2SGAA 4ZKNU 4YLUA 1XX9A 1C2IA 3PWCA 1H8IH 5LPRA 1NRQH 4YESB 1C5OH 4JMYA 2HPPH 4ZH8A 2QXIA 2XBXA 3ESTA 1T8LA 1QL7A 2G81E 6CHAB 2ILNA 3F9FA 3SHAH 4NIYA 1BTYA 1C9TA 4Y6DA 4X2WA 2NWNA 3HGNA 7KMEH 1VCQA 4YOJA 3SU3A 1O2NA 1TNLA 2PUQH 1PQ7A 2NU0E 1TOCB 3L3TA 2ZU3A 5JB8S 1Y5AT 4SGAE 4E7NA 1F2SE 2Y5GA 2G5NA 1DUEA 1Y59T 4NWLA 3S9CA 4NSVA 1GCTB 1MUEB 3SUGA 1UVUH 4I31A 1L4DA 4FUCA 4ZKSU 2WPKS 3A80A 2FLRH 2GMTB 1S6HA 1YYY1 2PTCE 1H8DH 1HJAB 3RMMH 3S9BA 1A61H 1HXFH 1C4Y2 1ABJH 1SB1H 3MMGA 1ELFA 1GI3A 1C1VH 2LNCA 2NU4E 1UTQA 3P6ZB 4ZXXH 2VVUA 1C1QA 3O8DA 1AE5A 1HAXB 1ZGVA 5CHAB 1VCPA 3RC5A 3TJVA 1MTUA 1MKXH 3PV4A 3SZNA 4FU8A 2ZPQA 1TMUH 1O39A 5I46H 2OBOA 2FYRA 1UTNA 7GCHG 3VEQB 1AN1E 2ZGJA 3QGNB 1AUJA 2QXHA 3U1JB 1TBRH 3FZDA 3Q3YA 3V3MA 1TONA 3GCNA 1GJAB 1EX3A 3VFEA 2XCFA 1Y3WA 3UPEA 1ARCA 1SL3A 1EATA 2Z94A 3U8TH 1E38B 3M7QA 4IC5A 4ABIA 4ISOA 3S7KB 1C5RA 3A8CA 3KHVA 2M5TA 4FUHA 1KTSB 1SQOA 1RRKA 5GPIB 1TGCA 1O2VA 1DLEA 1V2KT 3QUMP 2HNTF 1ZTLA 3SNBA 2GZ8A 3KCGH 1BTPA 2F9NA 1IQNA 1L2EA 3RXJA 2GGVB 3KQDA 1EP6A 1FY3A 3GICB 4NFEA 1ZSJA 3DA9B 4WWYA 1O31A 1NC6A 2HWLB 2ZU2A 2TGPZ 5DK1A 1CGIE 2HGTH 3LGWA 3BTHE 1C2EA 1ARBA 1IAUA 1Q2WA 4LOYH 4BTUB 2QC2A 7ESTE 1GBFA 1K2I1 4H4FA 1THSH 4XBDA 1OS8A 1NY22 3F6UH 5C5OA 1IQJA 1EQ9A 1NN6A 1SGTA 3LIWA 3TIUA 5AVDA 3BEUA 1DXPA 3SQHE 1UTPA 4A7IB 2QXGA 3RXKA 2FO9A 3SO3A 1MU6B 2G5VA 3SOSA 1SPJA 4Y8ZA 5C20A 1L1GA 1O2SA 1C1SA 2XC5A 3ATKA 1O0DH 1FY5A 5AFZH 2D26C 1C1MA 1P03A 4AB8A 2ZU1A 1MAYA 2F9UA 3ZVGA 3ZZ4A 4YT6H 2O8TA 4K60A 2BVXH 5LGOA 1NU7B 2ZA5A 3D62A 4O3TA 1GJDB 1GHBF 3GY5A 1ETTH 1GBMA 1MTSA 1S5SA 1YBWA 1MKXK 2PKAB 4ABBA 3SV9A 2FZZA 2FOBA 4DY7B 1NT1A 2PLXA 3DD2H 2G55A 1NS3A 1ELGA 1YCPK 2ZWLH 1LHFH 3D23A 3S0NA 2BD5A 1SLWB 1T8NA 1EZSC 1XXDA 2BZ6H 5F8XA 2ZDAH 4GVUA 1F0UA 2ZFTA 3PYHA 2FP7B 4DOQA 2XTTB 2FOGA 4FUIA 3SUEA 1WCZA 2P16A 1FLEE 1GI9B 3A84A 2F83A 4CHAC 1QRXA 1V2TT 2ZCKP 1IQLA 5TJXA 2CN0H 4CRAA 1GCDA 1FUJA 1O3OA 5G4BA 4ZUHA 1GWAA 2BLOA 4YTAA 3SHCH 5TCAA 3QTVH 2ESTE 1S0QA 4X8SH 3KEEA 4THNH 5F6MA 2R0LA 4AORA 1EPTB 1LDTT 1P2KA 1Z8GA 1BTZA 2XCNA 1EJAA 1P3EA 3GY8A 4MPUA 1GI7B 1LHCH 1S82A 1HAGE 3ITIA 4JK6A 1Z6JH 1K9OE 2PR3A 4D7FA 2C4FH 2BVRH 1Y5UT 5EPNA 2HLCA 3JZ1B 4OS4A 1A5GH 3NWUA 2AH4X 2JH6D 1L1JA 1O2QA 1ABIH 3LKWA 3PLKA 4ZAEA 3RXVA 4CH2B 4ESTE 3MNSA 5CE1A 1QB6A 3SJKA 1XUIA 1GHWH 1VITF 3A7WA 1W11U 6LPRA 1AVWA 1GI0A 3OY5U 2Z3DA 2XBVA 3UNRA 3LOXA 1XUHA 1V6DA 1FY8E 3M5OA 4ABDA 1BJVA 4X1SU 3QX5H 2A1DB 1TX7A 2IN2A 2HVXA 3NUMA 4Y0ZE 3RXEA 4RN6A 1AY6H 1ID5H 3CS7A 2BDCA 1EP5A 1WU1A 1O38A 1MCVA 2BDIA 2BD3A 3M3VA 1O2JA 2F9VA 3NKKA 2BM2A 2OXSA 2UWLA 1DT2A 1E36B 1BRUP 5A8XA 3TGIE 1NFWA 1P57B 1W12U 3LGUA 3RMLH 1C1OA 1KDQB 4MPXA 1K21H 1LVYA 5SGAE 4R8TB 1SG8B 2XWBI 2AFQB 1SLVB 3UOUA 1W13U 1GCTC 5ESBA 3U9AH 1PYTD 1GDUA 1EKBB 3ZV9A 1O2XA 3RU4D 2GMTC 3LONA 1B5GH 3ZZ5A 1P10A 5DGJA 1BDAA 2PWXA 1HJAC 5DG6A 2R2MB 5DKMA 1TB6H 4INKA 1ZPCA 1AHTH 2IOTA 1A5IA 1LPGB 3P8OA