3BTGE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
total genus 53
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btgE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btgE02
2TGAA 2ZDKA 7GCHF 1JIMA 1C5SA 1QRXA 1YPGH 3E1XB 1NT1A 1AY6H 1EAWA 1KXCA 2WV4A 3KQBA 3QZQA 1C2GA 3ESTA 4AFQA 2ZO3H 1TRNA 3BIVH 4I31A 1AU8A 1BTWA 1JWTA 3LGVA 2ZEBA 1RJXB 1RTFB 3VPKA 4TPIZ 1GMDF 2BY6X 1X7AC 4I8LA 2EI7A 3SHAH 1A5IA 3P8FA 4NIYA 1HXEH 4TY6A 1ZJKA 2FYRA 2Y7XA 3GICB 1P2JA 3K65B 4ABBA 4FUHA 3AAUA 3FP8E 3T62A 1LMWB 1C5QA 2F83A 1EJNA 3MTYA 1RTKA 3SORA 1DM4B 2CHAB 2VGCB 2ZDLA 5CHAC 1GJ4H 2FOAA 3SNBA 1E37B 1YPHC 4NZQA 3VEQB 3MH5A 3B8JA 4R0IA 2PKAB 1NROH 3Q3YA 5E0HA 3RC6A 1TNGA 2CMYA 3GCOA 1NRNH 2P8OB 2ZTYA 2PSYA 4WY3A 5JB8S 3HKIB 3HPTB 3Q77A 4NZLA 4F49A 2SFAA 1QFKH 3STJA 3RLYH 4BOHA 1V2MT 1THRH 1GHBG 1GI2A 2Z3CA 1DX5M 2UWPA 4RKJB 1SGRE 1G30B 4BTTB 2Z9GA 3H7OA 3MNXA 1ELTA 3MU0A 3ZZ8A 4CRGA 1HAYB 3RC4A 3K6YA 2BD9A 1CQQA 1J16A 3PYHA 1BMMH 3PTBA 3ATKA 3MNCA 4O97A 1ARBA 2OQUA 1ANBA 1GGDC 4ZAEA 3D65E 1TOCB 2XCFA 1ABIH 1WCZA 1C2HA 4ABHA 2BTCE 5G4BA 1GHVH 3PV4A 1TNHA 1W2KH 3VGCC 1RIWC 3RXIA 4Q7XA 3QGNB 4AZ2B 2FOMB 1S0QA 4IC6A 3Q3XA 1KXDA 1MZAA 2BOHB 2G52A 3B9FH 3EDXB 1ZHRA 3P8NA 3V3MA 2AIQA 3RLWH 1TPPA 3RXTA 1CT0E 2QF3A 2XBVA 2ZDVH 3GDUA 1KXFA 2Z3EA 3LOXA 4D8NA 8ESTE 1YBWA 7KMEH 1ELBA 1BQYA 1F0SA 1GCTB 1MH0A 1LPGB 3UPEA 7LPRA 1AB9B 4ZHLU 1GI8B 1ZMNA 2BD4A 2VIPA 3GYLB 5J4QA 1CO7E 3RDZA 5JB9S 1IAUA 1UVSH 1OP0A 3ZVFA 4UFGH 5DP6A 1IHTH 4NA8A 1SGTA 1DWBH 1O31A 4A1VA 3ENSB 1NFWA 2GMTB 1O33A 3LGWA 4JZDH 4Q7YA 1LO6A 3F6UH 6ESTA 1SLVB 2B8OH 1YCPH 5ESBA 4F4OC 1N8OC 2OQ5A 2FOCA 1A2CH 1NS3A 1Z8JB 5HM9A 2BOKA 1DUAA 2C8YB 4XFQA 2PTNA 1O37A 1C4U2 1QURH 2EC9H 1CHOF 1N6XA 3PMHB 1VCPA 4O3TA 1H4WA 1TONA 4X8SH 1AVWA 1UK4A 3FZZA 4AFSA 1BIOA 3PM3A 4IN1A 4K8YA 3SZNA 5E0GA 4X8VH 4NWKA 2PUXB 2XYAA 4CBOA 4U32A 1O2RA 1QBOA 5T6DA 1HAVB 4RSPA 8GCHF 1O5DH 1C5PA 3S7KB 1HAVA 2XC4A 1P01A 3ODDA 3U8OH 3BN9A 2DE8A 1AI8H 2OC7A 4B76A 5JBBS 1CT4E 2WPIS 4OS5A 2XBYA 4CRBA 1C2LA 2F9PA 2XBXA 4ZUHA 2BLOA 2F9UA 1FZZA 1O3DA 2OUAA 2V6NA 3M61U 1QHRB 4MQAA 3SU1A 4Y6DA 4AOQA 5JBCS 5C67A 1HGTH 1O2XA 3RXUA 1GG6B 3DD2H 4BAKB 1G3DA 3QDZB 1D3TB 1EAIA 2AYWA 2W3KA 1NRRH 3T26A 3SJOA 2YNAA 2F9VA 4JYVH 2V3HH 5EODA 1DSUA 2AIPA 3QK1A 1B0EA 2P95A 5T3HA 1YKTA 1IQMA 1P2QA 2TGDA 5FPSA 4NGAH 1QQUA 1AWHB 4NSYA 1GHAG 3SBKA 3R3GB 1A7SA 1O0DH 3A7TA 5HYOA 2QC2A 1GMDG 2I6SA 1S81A 4E06H 4CH8B 3BTME 1KSNA 3AVZA 2BD2A 4ISOA 4B73A 1RIWB 4K2YA 1SGDE 2A4OA 1OSSA 1WV7H 4B74A 3DHKH 4MNYA 2CN0H 5GPIB 3M5NA 3SJKA 1Y3UA 1FV9A 1LPKB 4SGAE 4K1TA 5HGGA 1JOUB 7GCHG 1NU9A 2M5TA 3FANA 1O2NA 4FUEA 3ATWA 1W3CA 1GI5A 1SHHB 3DFLA 1TA6A 5E2PA 3GDSA 2J9NA 1FMGA 5DK1A 5A8ZA 2ZHDA 2AMQA 1FY5A 3A7VA 1D3PB 1PQ5A 4UONA 3RXRA 3GCTF 4AYYB 2TIOA 2GDEH 1F0RA 3CENA 4YOGA 2TPIZ 1AQ7A 1ZMJA 4AFUA 1QIXB 3E8LA 1TOMH 4I8HA 3A83A 3M7QA 1WBGB 4DURA 4YOJA 2I6QA 1GWAA 3AAVA 1CT2E 2OLGA 2GCHG 1IQGA 1N8OB 3SUDA 2C3SA 4LZ1H 3SGQE 1WUNH 2UUJB 1GBMA 1OS8A 1ZHMA 4X6NA 3U8RH 1MTUA 3BTQE 2JH5D 4HTCH 3EA8A 4K60A 3BV9B 2Z7FE 3SHCH 2O8LA 4AN7A 2ZGJA 1G36A 1SMFE 4J2YB 4ZKSU 2XW9A 1CA8B 3MU4A 1GDUA 1NESE 1P12E 1EAXA 1BRAA 2BQWB 1KXAA 1V2WT 4GPGA 1F5LA 3MNSA 4GHQA 2NU2E 1XXFA 3HKJB 2F3CE 4A1TA 1CA0C 1FNIA 1BTYA 3SUGA 2V35A 2HGTH 1L1GA 2WUCA 3UIRA 5DP9A 1KDQA 1A46H 3FVFB 3RXGA 4BANB 4JK6A 3TJVA 1P9UA 1QGFA 2C8XB 4BXWA 1H9IE 2OCVB 3JZ1B 4MG3A 1OP8A 5FAHA 2Y7ZA 1UCYE 1AIXH 1F7ZA 4Q7ZA 5E8EH 4ISIH 1V2JT 3F9GA 2LNCA 4AORA 3M3SA 3GY8A 1O3IA 2UWLA 1XXDA 2GX4A 2R3UA 1T32A 4INLA 1AGJA 2ZU4A 3MH4A 1O3AA 2JETC 4MVNA 2XWAA 1AD8H 1TPOA 1Y3WA 1BTXA 3PB1E 1BOQA 1TB6H 1BT7A 1EOLA 3NWUA 2XRCA 1ELCA 2P3UB 5DPAA 1QB1A 3MOCA 1EJMA 2ZDNA 2BVXH 4XBCA 1DWEH 2B0FA 1UMAH 4FUDA 2FI3E 3I78A 4B2CA 2NU4E 1EASA 1QCPA 2FOBA 3EYDA 1GJCB 1MZDA 4B2BA 1C4Y2 2BD3A 3NXPA 2QGRA 1NFYA 1HXFH 3TK5A 5EQQA 2Y6TA 3TNSA 5L2ZH 3GDVA 1O5CB 6LPRA 1VGCB 4THNH 1PYTD 5F8XA 2GV7A 1GMCF 1GBLA 2O9QA 1GBTA 5FPTA 1MD7A 2QA9E 2VWNA 5CE1A 1PQAA 1AFQB 2BXUH 1ETTH 2JKHA 2C8ZB 3UWJH 2GCTC 4WMDA 3SV8A 5I46H 1O2JA 1ZGVA 3RU4E 3RMOH 1ELGA 2A2QH 5EGMA 4NIVA 3KEEA 4Z6AH 1TMTH 1FN6A 2TBSA 3QN7A 1P2MA 3EA7A 4H6TA 4MPVA 4YT7H 5A0AE 3TIUA 1C2EA 1NN6A 2ZHWH 3SUFA 3ZYEA 1VITH 1FY1A 2VIQA 1K1PA 1LTOA 1TGNA 4DG4A 2PW8H 1QR3E 1PPEE 3U98H 2A31A 5HMAA 4LZ4B 1SFQB 2R0KA 3TH3H 1T8NA 1TGSZ 1SBWA 4TYDA 1P57B 2PR3A 1DFPA 3VB7A 1CBWB 1QB6A 4AGJA 1S6HA 1LHGH 1N6YA 4IC5A 2BDCA 1NZQH 4UDWH 3UTUH 4X0WU 2P59A 1GBKA 1P06A 1Z1JA 2QN5T 4ZHMU 3D49H 1FQ3A 1Z6JH 1HLTH 4IGDA 1BUIA 1C2KA 1HJ9A 2JH6D 3P8OA 2J38A 1VITF 2Q6FA 4X1QU 2Q6GA 4LK4A 1DICA 2Y82A 3RXQA 3RUOA 7ESTE 4CREA 1UCYK 4NA9H 4X8TH 4K5ZA 2ZFRH 1BMLA 1V2ST 2SGAA 3ZZDA 3BTEE 2A32A 1OP2A 4ZHAA 4Y76A 1EZXC 4UD9H 4WMFA 2FS9A 2A45B 2BVRH 3HK3B 5L6NH 3GCHB 1ANDA 1XKAC 2HVXA 1QTFA 3TITA 1RS0A 1V2UT 5EXLA 2O8TA 1G2LA 2AMDA 1OWHA 3AASA 3EGKH 4IMQA 2BVSH 1F0TA 3URCA 1QRWA 1H8IH 2DUCA 3LGYA 2ZFQH 2BYAX 5EW2H 1TALA 3UFAA 2DE9A 2BY9X 2ZFTA 3T5FH 5FHTA 1KTTB 1KY9A 1UTNA 3RXKA 5L30H 2VIDA 2ZCLP 1TQ7B 1A1RA 1RRKA 3PMJA 2FTMA 1U6QA 1JRSA 2BDAA 1KLIH 3RXHA 1AB9C 1VZQH 1ID5H 1ZHPA 2WPJS 3ZZ9A 2EI6A 3GOVB 3D23A 1ZTKA 4Y0ZE 5B6OA 4H4FA 5H4IB 1FY3A 1W11U 1GHXH 1O2VA 3LJJA 4IN2A 2W7SA 1BBRK 1L4ZA 1V2OT 1A0JA 1EOJA 2QF0A 3TK6A 1K1OA 1MAYA 1O38A 3P8GA 2Z94A 3V0XA 1HNEE 2ZHEH 3RXEA 2D8WA 3OYPA 1C5WB 3LGUA 3M3TA 3CP7A 3SUEA 1PJPA 1VR1H 1OPHB 3SU2A 2A0QB 2VNTA 5AHGH 2G5VA 1V3XA 1UVUH 2O8UA 4GAWA 5AF9H 1OYQA 1YGCH 5A09A 2SGEE 3OY5U 4ZMAH 1FY8E 1HPGA 4LOYH 3BG4C 2HNTF 2HNTE 3RXAA 3SJ9A 1O35A 3RM0H 4I8JA 2BZ6H 1GI9B 5C5OA 1C5YB 3RXOA 2BY5X 1LHDH 2OXSA 3A87A 4CRFA 3KQEA 2BX4A 1CHOG 1LKBA 1NM6A 1O3BA 4ZKRU 1CGHA 3ZVDA 1OWJA 2RA3A 1BRUP 1EXFA 1TBQH 1SVPA 3DUXH 1UVOA 3E16B 4NWLA 2PLXA 4DCDA 1LHFH 1QY6A 3RXDA 5GCHF 1EZUC 1TA2A 1CBWC 1SQOA 2Y80A 2ZDMA 2PUQH 3O8DA 1AVGH 5EQRA 3S69A 3ZZCA 1PPGE 3TGKE 3AW1A 4HI3A 1TFXA 5FBIA 3L3TA 2NU0E 1GJAB 1BB0B 2GP9B 5A8XA 5A0CA 1T4UH 2R0LA 2OBOA 3RXMA 1BCUH 1P11E 1LQEA 5HM2A 1TGTA 2ZCKP 3GY4A 1W7GH 2BZAA 3OX7U 1UVTH 3GCTG 3ZYDA 2VVCA 3RXFA 1O2OA 4BAOB 1TBRH 1EP6A 4BTUB 1YLCA 3C27B 2IN2A 3T2NA 1O2TA 3E0PB 4MTBA 1DS2E 1WQVH 2Y5HA 3BG8A 3TU7H 2YNBA 1GL1A 1W0ZU 4BNRA 2AEIH 1PPFE 2Z6BD 3PLPA 4FU9A 2VINA 4R8TB 1AZ8A 1P03A 4WVPE 2ZG0H 4ABJA 2XCNA 3V13A 1KLTA 1TX8A 1D9IA 1O3MA 4A92A 1O5EH 1P2KA 2VWOA 1ZRKA 1BJUA 3UR9A 1C1OA 5DP3A 4DW2U 5JBTA 2VWLA 2OINA 1G3CA 1GMCG 3BSQA 2W5EA 1SFIA 4X8UH 1G9IE 1GBBA 3HGNA 1Q2WA 2BLWA 1TPAE 3SNAA 1WAYB 1TABE 1H9LB 5AFZH 3ZZ7A 1C1MA 3E91A 1LVBA 3P6ZB 4OS1A 1O39A 4Y8XA 1JMOH 2BDHA 1S83A 1FUJA 4OS4A 3VXFH 1WU1A 1J8AA 2Y81A 3T27A 1ZSJA 2D1JA 2P3FH 1SOTA 1MKWH 4Y8ZA 1YPMH 3GY7A 4MPWA 2R3YA 2BXTH 1UK3A 1DLEA 4UFFH 1ZSKA 1C1WH 1C5RA 1XX9A 2WPHS 9LPRA 2GZ9A 2VIVA 3S7HB 1EPTB 3OY6U 2ZHQH 2FX6A 4FUFA 5E0JA 1BA8B 1IQLA 5EPYA 4YO9A 2Z9JA 1C9TA 3IG6B 1J9CH 4VGCC 3QLPH 1C5ZB 2Y5FA 1E34B 1FIWA 2ZU1A 1MQ5A 3BG4B 3RU4T 2B7DH 1O3CA 4NG9H 1W14U 1EATA 1OYTH 3MU1A 1QA7A 3QGJA 2XTTB 2RDLA 1UTOA 3E3TA 2BDGA 3SV7A 3QZRA 2IJOB 2RCEA 3A80A 1NTPA 3KNXA 3R0FA 4GHTA 2J92A 3T29A 1D3DB 2QYIA 2UUFB 4JYUH 1BMNH 5I25A 2O8MA 2H6MA 3A85A 5BPEA 3RXSA 2A7HA 4INHA 1BHXF 2FTLE 4YOIA 2WPKS 1TPSA 4U01A 3FFGA 4HZHA 4FUBA 1F0UA 3NUMA 2XWBI 3SO3A 4B1TA 2GV6A 2XC5A 1GI1A 3L33A 1BMAA 3K9XB 6GCHG 1AUTC 2B9LA 1L1NA 4D76A 3F9FA 5FBEA 2FI4E 3C1KA 3GYMA 1C1UH 3UNSA 1GHYH 2W26A 1SR5C 1CVWH 1YPJH 4HFPB 1HAIH 2F91A 2GMTC 5FX5A 1BTZA 1HIAA 3LC5A 2C4FH 2Z9KA 4DOQA 1DDJA 5A2MH 2ZU2A 5CMXH 4I8KA 4XBBA 1GJ6A 3SU6A 2CXVA 4Z0KA 1A3EH 1C2MA 4DY7B 3LONA 3SU5A 3PMAB 1KLJH 4I8GA 1C5NH 2AS9A 5T6FA 3ZVAA 1VGCC 5LPFA 4KGAA 2ZQ1A 3UUZA 1ZZZA 2GVFA 1SGPE 4CHAC 3UNRA 2FM2A 3RXPA 1L2EA 1TBZH 3SW2B 3UOUA 2EEKA 3SNEA 1EB2A 2ALVA 1AFQC 1SGFG 3RXCA 2GGVB 2WINI 3M7TA 4MPXA 1BRBE 2FZZA 1UTQA 2Z3DA 1XVOA 1YPLH 3UY9A 3LDXH 1A3BH 1MTSA 3HATH 5IYTA 3MMGA 2XBWA 2NU1E 4OGYA 3ZZBA 2H5DA 2W7UA 1YLDA 2AGGX 3MU5A 1Q31A 1HJ8A 1O30A 3PMBB 4TPYA 4Q80A 1Y5BT 2ZI2H 5DP7A 3GY3A 1MBQA 2FOEA 3ZVBA 1Z7KA 1P09A 1S6FA 1C5LH 4GUXA 2KAIA 1XVMA 1GBIA 5TCAA 1KYNA 2FLRH 2O8WA 1Z6EA 3A88A 3LIWA 4UEHH 2G51A 1L1JA 3ZVEA 3A7ZA 3PO1B 1TIOA 2BD5A 4D9RA 4NIXA 3QWCH 4D7FA 3LU9B 2YOLA 2HPPH 4AX9H 3KHVA 4MNVA 4I7YH 5LPEA 5EG4A 3Q00A 1UTKA 1CU1A 1EPTC 5AVDA 1ETSH 1O2SA 2BLVA 1RXPA 4INKA 2WYGA 1WYKA 2BY8X 3T28A 3QUMP 2ANWA 3F9EA 1MTWA 1XUHA 3TVJB 4MDSA 1HRTH 3BEUA 1NY22 1BTHH 3NZIA 2BB4A 2EI8A 5K7RA 1VJ9U 1GVLA 2BHGA 1WSSH 2F9BH 3M37A 1TNKA 4NCYA 4YESB 2ZP0H 4Y8YA 1EZQA 4BAMB 3RP2A 5FPYA 4DJZB 2H2ZA 4IMZA 1XUJA 1O3OA 2AFQB 3RU4D 1DPOA 1P3EA 1ELEE 3LGIA 3M5LA 1A0LA 3KN2A 1DE7H 1W10U 3RMLH 1GCDA 2QCYA 1PPHE 2WPLS 1T4VH 1WOFA 1ZSLA 1ETRH 3KF2A 4QT8C 4DIIH 1Y8TA 1N1LA 1SG8B 3BF6H 2BD8A 2QIQA 1V6DA 3A7YA 1GMHG 3U9AH 2SGQE 1DITH 1V2KT 3SI3H 1Z8IB 1Y3YA 1FIZA 4JZ1A 1C1SA 2FS8A 3P95A 2QY0B 2PGBB 2VB0A 4B2AA 1JIRA 2VIWA 1O2YA 1ZYOA 3SQEE 3P70B 3VB6A 1SC8U 1ESBA 4BXSA 1EB1H 1XUIA 2J2UA 5EOKA 4OS7A 5LPRA 2A4GA 1YC0A 1OXGA 3UWIA 1K1IA 1EKBB 3LJOA 1FAXA 2SNWA 1MTVA 1GVKB 1TAWA 2G4TA 4YT6H 1HDTH 3DA9B 4BAHB 1SOZA 3LPRA 5JYIA 4ABFA 2THFB 1IQNA 5DG6A 3TJNA 4NIWA 3BEIB 2FWWA 1ESAA 5EPNA 3ELAH 1DSTA 4CRCA 1RD3B 4FUIA 1ABJH 4K8BA 1K2I1 3ATMA 1K22H 3LT3A 4Y79A 3F9HA 1BDAA 1H9HE 2FX4A 4DGJA 1ELDE 1VITG 2XXLA 3ITIA 6CHAC 3ZZ5A 2ZQ2A 1P8VC 1PPCE 1EP5A 3GY2A 5JBAS 2Z9LA 2IPHA 4FUGA 1YPKH 3U69H 1HAOH 4X1SU 1V2RT 2ZNKH 1O36A 1ZJDA 4X1RU 1HB0B 1MAXA 1OX1A 5F6MA 1YCPM 1KIGH 5EW1H 1ARCA 2STAE 1DUEA 1GHBF 3PO1C 1RGQA 3RM2H 1QL9A 2GTBA 1ZTLA 5FCKA 2ODPA 1EQ9A 2GT7A 5E2OA 2RG3A 1O5AB 1D3QB 4GCHG 3MWIU 2G4UA 1SGIB 3ZV8A 5HXFA 1H8DH 1C5MD 1O3FA 3VB3A 3I29A 5GDSH 1O2ZA 3LH3A 1K1NA 1SQAA 2UUYA 2A4RA 1GMHF 1TE0A 2KAIB 3LKWA 4MNXA 1UK2A 1O2QA 1D6RA 3BTFE 2FDAA 1B0FA 2HWLB 3HGPA 1PPBH 2FYQA 3ZV9A 2H1UA 3GCNA 2BDIA 3S9BA 3NK8A 1TMBH 5AFYH 5GXPA 4BTIB 5L2YH 3VXEH 4CBNA 2OBQA 3M7UA 4X2WA 1FXYA 1MBMA 5GIBA 5T6GA 1KTSB 4X2VA 1A5HA 1UTPA 2ZKSA 5FXLA 1RFNA 2VH0A 2ZGHA 3PWBA 3BEFB 1Y5AT 4ZXXH 1FLEE 2SGFE 4SGBE 1GVZA 3A7WA 4AB8A 1G37A 4K3JA 1O3PB 1V2PT 5DO4H 4O9VA 1SSXA 1WTGH 3U1JB 3M3VA 1A61H 1C5OH 1HBTH 1BRCE 1ACBE 2BLQA 4FXGH 5GWZA 1SLXB 3SV9A 1TRYA 1JRTA 3JZ2B 1W0YH 1GBFA 1JBUH 1FJSA 5CHAB 1IHSH 4XBDA 1P9SA 4I32A 3RXLA 1TLDA 2ZF0H 3NKKA 5A8YA 2VJ1A 4WH8A 1INCA 3D62A 1UTLM 1C4V2 4LXBH 2AH4X 4CH2B 1SL3A 1OOKB 1GI4A 2B5TB 4WXIA 3TNTA 4AYVB 1HJAB 4JZEH 1CE5A 2ESTE 2CJIA 1LHCH 1DOJA 3RXBA 1B7XB 1HCGA 4NSVA 2VVVA 2HOBA 2LPRA 1Z8GA 3SU0A 4DIHH 2OTVA 1L4DA 2R2MB 4JK5A 1DVAH 4KKDA 4YZUA 2ZGBH 4IW4E 4TY7A 3VB4A 1DY8A 1SPJA 4WXVA 1VJAU 3H7TA 2AERH 3VB5A 5TCCA 2Q1JA 1FI8A 1DY9A 3E6PH 3PWCA 2RA0A 2BMGB 1V2QT 4X6MA 1GJBB 1TYNA 1YCPK 1EJAA 4AG1A 3UQVA 1YF4A 5EXMA 1C1RA 2XNIA 3SNCA 4XE4A 4Y71A 1O2WA 4GLYA 1V2VT 3MYWA 5ESTE 6CHAB 1A4WH 1AO5A 4WF8A 2G55A 2FOFA 3TJUA 4A7IB 1SQTA 3PLBA 4NFEA 4YLQH 4JCNA 4H42U 5FCRA 3A8AA 3KL6A 1AN1E 1GJDB 1GBJA 1EZSC 1AKSB 4D7GA 1GI3A 5C3NA 1C1NA 4CRAA 2G8TA 1DLKB 3OU0A 1DXPA 1GCTC 4KTSA 4JYTA 2H9TH 4ISNA 3Q76A 2VVUA 4AB9A 5BRRE 1O2KA 4TWYA 1BBRE 1UJ1A 3UNQA 1K1MA 4NFFA 5F03A 2P3TB 2GCHF 5JPMH 2F9NA 1MKXH 1UCYH 1TNIA 1DWCH 1TGCA 1C1PA 1UHBB 3SU4A 3O8BA 1O3EA 1ZRBA 4E7NA 3UOPA 1AKSA 1UO6A 2JH0D 4KP0A 1LPZB 2FLBH 2ZPSA 2Z9IA 4CRDA 1PQ7A 2SNVA 3ZZ6A 5GJ4B 2PV9B 3E0NB 1AE5A 3H5CB 1HYLA 4FUCA 2VIOA 2A4QA 3M5MA 2D2DA 4O03A 4H6SB 1AUJA 4FVDA 4Y0YE 1P3CA 2C93B 3O8CA 3FP7E 1B5GH 4PROA 1HAGE 3UREA 4ISHH 1ZR0A 2ZTXA 1C5XB 1AZZA 5DP4A 1SGCA 4K1EA 9ESTA 1O3JA 3BIUH 1HFDA 3G01A 3SGBE 4ABDA 1QL8A 4ZKOU 1D4PB 2ODYB 1EAUA 1XUFA 1O2LA 2FEQH 2H5CA 1NPMA 2FI5E 4YLUA 1G3EA 1CA0B 4RKOB 2ANYA 5EU8A 1NRSH 2BM2A 1EUFA 3GY6A 1TGBA 1IQJA 1G2MA 4OS2A 2J34A 1CHGA 1MMJN 3URDA 1O3GA 1PFXC 1LVYA 1C1TA 1P2NA 2AGIX 2ZPRA 3F1SB 3QO6A 1Z1IA 1HAZB 4O3UA 2R2WU 4JZFH 1TQ0B 1LCYA 4GSOA 2VH6A 1RTLA 1K1JA 3MI4A 4KTCA 1IOEA 1NU7B 3SNDA 1LHEH 3DFJA 4GCHF 1UHBA 4UE7H 1UTJA 1NRQH 2XC0A 1V2NT 2STBE 1GG6C 1HJAC 1SB1H 1XKBC 3BTKE 1C2JA 1J17T 5DGJA 1AWFH 3L6PA 2CV3A 4Q2KA 3PTNA 3OTJE 1Q3XA 1QB9A 2V0BA 3KQCA 1V2LT 2HLCA 1GBHA 3SV2H 3MHWU 8GCHG 1O2PA 4ABIA 1DXWA 4FU8A 1P02A 4WMEA 1C2FA 1J15A 3RMMH 3ATLA 1O3NA 2ZZUH 3BTGE 4ABAA 4X2XA 2F9OA 2OC0A 1VCWA 1S84A 2QAAA 3IITA 1XMNB 4YM9A 4WH6A 4HGCA 2OC8A 3MO9A 1GI7B 1CGJE 5C20A 1GBEA 1O2HA 1T8MA 4IBLH 3CS0A 3W94A 2HRVA 4K1SA 1HAPH 2HNTC 1O5BB 1QBNA 1O3KA 4X1PU 2ZHFH 5LH8A 1FPHH 3MO6A 3SOSA 4FVBA 2CHAC 4RN6A 1MCVA 4ISLA 2OP9A 1OWIA 1O5GH 2Q6DA 3A82A 1TMUH 2ANMH 2SGPE 1DANH 1BJVA 2ZWLH 1W7XH 2NU3E 3PROA 1L0ZA 1MUEB 2GKVE 2P93A 4Y7BA 3T25A 3ZZAA 1O3HA 2P8OC 3MH6A 4XSKU 2Y5GA 4XDEA 1K1LA 1O2IA 4X6OA 5F8TA 3B23B 1K28D 1GHZA 4X1NU 4MPUA 2BX3A 5EXNA 2AMPA 1FONA 3A86A 5GCHG 2ZFFH 3TGJE 1S85A 2J95A 3I77A 1XM1A 1BITA 2BD7A 3RXJA 1Y5UT 3K2UA 2BQ7B 3KIDU 2ZECA 1S0RA 1TRMA 3SGAE 4D9QA 2ODQA 4B71A 6GCHF 3IWMA 2ZFSA 2GT8A 3ZVGA 1PYTC 3DT0H 1NRPH 3U8TH 1IQFA 1GBCA 1HIAB 1Y3VA 2G00A 1ELFA 2QXGA 5C1UA 4TWWA 1MTNC 1OWKA 1O2GH 3S9AA 4UFDH 1KXEA 1E38B 3N7OA 4A5TS 4CR5A 1GI0A 4X2YA 2WPMS 3O8RA 1GPZA 1NC6A 1SLUB 1Z71A 1WQSA 1BTUA 2TGPZ 4OGXA 3A81A 1Y59T 2FESH 2ZGCA 3LC3A 4FUJA 2HPQH 1Y3XA 1QRZA 1G32B 1SGQE 3TLOA 1IQEA 4ZH8A 2C8WB 2HALA 2VWMA 5FX6A 4WWYA 1ZPBA 1ZPZA 3TH2H 1AE8H 1K9OE 1ESTA 2TGTA 1GHAF 5PTPA 3GCHC 1O3LA 1ANCA 2ANKH 2QXJA 1C5TA 3A8CA 1ZMLA 3S0NA 1H1BA 2JETB 2NWNA 2PFEA 3SU3A 3P17H 1QA0A 3A89A 2BQ6B 2ZCHP 5ETXA 4DVAU 1T8LA 5JDUB 1A5GH 3GISB 3CS7A 2H9HA 1PPZA 3KCGH 4DT7B 1F2SE 2A2XH 4Y11E 1ELAA 3V12A 1FN8A 1E35B 1UVPA 3A8DA 1GHWH 1FY4A 1NFUA 2A5KA 1TNLA 1GI6A 1T31A 1W12U 1YM0A 3LH1A 1C2DA 3M35A 1P05A 2A5AA 2WUBA 3Q3KA 4ZXYH 1O32A 1ANEA 4BAQB 1C5UA 1GJ8B 4K69A 1IQKA 1MQ6A 3TGIE 1SGFA 1ZGIA 4CHAB 4AGKA 2QXHA 1HAXB 3FAOA 1AMHA 4Y7AA 3M5OA 5DP5A 4X6PA 2GCTB 1D6WA 2PTCE 2ZU3A 1P04A 1MKWK 2FPZA 1AVXA 4MNWA 3TJOA 1TNJA 3MNBA 5ABWA 3GY5A 1ZTJA 3QX5H 3S9CA 1ZOMA 1BBRH 1FAKH 5C2ZA 4OS6A 4XOJA 3SN8A 3KQDA 1CGIE 2D26C 3AW0A 2R9PA 3MO3A 3U1IB 2BDYA 3RMNH 3OSYA 3RC5A 5SGAE 2A1DB 3P92A 3QTOH 3ATIA 1S82A 1GDNA 1F92A 3F68H 2ZGXH 1YPHE 1DWDH 1W13U 1MU6B 1T8OA 2A7CA 3E90B 4Y10E 1SLWB 2K1QA 1QJ7B 1MD8A 2ULLA 4WJG2 1SI5H 2EA3A 3SJIA 5K0HA 1C9PA 3A7XA 1HUTH 5TJXA 2UUKB 5DJ7A 3SJ8A 1HV7A 3TH4H 2FP7B 4AFZA 1GBDA 2H9EH 2PKSC 2FIRH 1P0SH 1W8BH 4U30A 2FXRA 1V2TT 3NPSA 4CR9A 2TRMA 1XUGA 1VCQA 3WY8A 1QJ6B 1GL0E 1LVMA 4UFEH 8LPRA 3MH7A 1MTNB 4AG2A 1P10A 1C1QA 2ZFPH 2PWXA 3EAJA 1LVOA 1PQ8A 3SV6A 1EPTA 2FOGA 1TX6A 3K6ZA 4IS5A 2ZPQA 3MFJA 5DKMA 2QXIA 1J14A 3TPIZ 2FODA 1FPCH 4E7RG 1LKAA 2AGEX 1BHXB 1NO9H 3NCLA 3UR6A 1Z8RA 3A8BA 1EX3A 3EE0B 5EQSA 1THPB 2WYJA 4M7GA 1GDQA 2J4IA 1S5SA 3EQ0H 2WV5A 1DT2A 1FDPA 3SI4H 5C5NA 1MKXK 3ZVCA 2GZ8A 1C5VA 3BTHE 3STIA 4ABGA 1E0FD 1O34A 1G3BA 2BDBA 2SGDE 2ZIQH 3M36A 5J4SA 1AHTH 2P16A 1SGNE 2A7JA 1CSOE 1C2IA 2ZDAH 3BTTE 2VGCC 2J94A 1YPEH 2FOHA 2FO9A 1SHYA 2GZ7A 4JZIA 3KGPA 2IOTA 4YTAA 1NFXA 1A0HB 1GBAA 2OD3B 2PGQB 2GD4B 4B75A 1QQ4A 4U2WA 2ASUB 3UQOA 8KME2 2ZC9H 4I33A 5IDKA 1LDTT 1ELVA 2G81E 4A6LA 2ALPA 1P2OA 2UWOA 4NA7A 1TWXB 1THSH 3PLKA 3W95A 1F5RA 3ZZ4A 2FMJA 4E05H 2ZTZA 1KXBA 1QBVH 1HAHH 1ZPCA 3ZZ3A 3TK9A 3BTDE 4ZROA 4ESTE 3BTWE 3VFEA 2PKAA 5F8ZA 1SGEE 2CGAA 2GDDA 1IQIA 2V3OH 1QNJA 1GGDB 4ABEA 1P2IA 3RXVA 4ZKNU 1JXPA 3SQHE 1TX7A 1OWEA 1GJ5H 1XUKA 2PSXA 4VGCB 3VGCB 2CF8H 1ORFA 1OWDA 3FP6E 4KTUA 1T7CA 1BTPA 2C90B 2PHBA 3FZDA 2QV1A 3LGTA 1SGYE 2P94A 4JMYA 4A1XA 5C1XA 1YYY1 1OKXA 2VU8E 5DP8A 4MLFB 2G5NA 1MU8B 4ASHA 3V7TA 1K21H 3QTVH 5A0BA 1IQHA 3HK6B 5C1YA 1C1VH 1KDQB 1QJ1B 4J1YA 1WTHD 1F5KU 1ZLRA 2ILNA 1BZXE 1GJ9B 2A5IA 2W3IA 1E36B 1M9UA 3EA9A 4GVUA 2PKSB 1UTMA 2CF9H 4FU7A 1O2MA 2ZU5A 1QL7A 1GJ7B 1O5FH 2BY7X 3A84A 2ZA5A 3MU8A 5LGOA 1LQDB 3ODFA 1O2UA 1MCTA 2OC1A 4KELA 1AFEH 1YP9A
chains in the Genus database with same CATH superfamily
2TGAA 2ZDKA 7GCHF 1JIMA 1C5SA 1QRXA 1YPGH 3E1XB 1NT1A 1AY6H 1EAWA 1KXCA 2WV4A 3KQBA 3QZQA 1C2GA 3ESTA 4AFQA 2ZO3H 1TRNA 3BIVH 4I31A 1BMFD 1AU8A 1BTWA 1JWTA 3LGVA 2ZEBA 1RJXB 1RTFB 3VPKA 4TPIZ 4B6FA 1GMDF 2BY6X 1X7AC 4I8LA 2EI7A 3SHAH 5KEDA 1A5IA 3P8FA 4NIYA 1HXEH 4TY6A 1ZJKA 2FYRA 2Y7XA 3GICB 1P2JA 3K65B 4ABBA 4FUHA 3AAUA 3FP8E 4YXWD 3T62A 1LMWB 1C5QA 2F83A 1EJNA 3MTYA 1RTKA 2J5UA 1DM4B 2CHAB 3SORA 2YMSC 2VGCB 2ZDLA 5CHAC 5C0TA 1GJ4H 2FOAA 3SNBA 1E37B 1YPHC 4NZQA 3VEQB 3MH5A 3B8JA 4R0IA 2PKAB 1NROH 3Q3YA 5E0HA 3RC6A 1TNGA 2CMYA 3GCOA 1NRNH 2P8OB 2ZTYA 2PSYA 4WY3A 5JB8S 3HKIB 3HPTB 3Q77A 4NZLA 4F55A 4F49A 2SFAA 1QFKH 3STJA 3RLYH 4BOHA 1V2MT 1THRH 1GHBG 1GI2A 2Z3CA 1DX5M 2UWPA 4RKJB 1SGRE 1G30B 4BTTB 2Z9GA 3H7OA 3MNXA 1ELTA 3MU0A 3ZZ8A 4CRGA 1HAYB 3RC4A 3K6YA 2BD9A 1CQQA 1J16A 3PYHA 1BMMH 3PTBA 3ATKA 3MNCA 4O97A 1ARBA 5HIYA 4ZCNA 2OQUA 1ANBA 1GGDC 4ZAEA 3D65E 1TOCB 2XCFA 1ABIH 1WCZA 1C2HA 4ABHA 2BTCE 5G4BA 1GHVH 3PV4A 1TNHA 1W2KH 2QF4A 3VGCC 1RIWC 3RXIA 4Q7XA 3QGNB 4AZ2B 4F48B 2FOMB 4Q63A 1S0QA 4IC6A 1E1QD 3Q3XA 1KXDA 1MZAA 2BOHB 2G52A 3B9FH 3EDXB 1ZHRA 3P8NA 3V3MA 2AIQA 3RLWH 1TPPA 3RXTA 1CT0E 2QF3A 2XBVA 2ZDVH 3GDUA 1KXFA 2Z3EA 3LOXA 4D8NA 8ESTE 1YBWA 7KMEH 1ELBA 1BQYA 1F0SA 1GCTB 2EQNA 1MH0A 1LPGB 3UPEA 7LPRA 1AB9B 4ZHLU 1GI8B 1ZMNA 2BD4A 2VIPA 3GYLB 2WV9A 5J4QA 1CO7E 3RDZA 5JB9S 1IAUA 1UVSH 1OP0A 3ZVFA 4UFGH 5DP6A 1IHTH 4NA8A 1SGTA 1DWBH 1O31A 4A1VA 3ENSB 1NFWA 2GMTB 1O33A 3LGWA 4JZDH 4Q7YA 1LO6A 3F6UH 6ESTA 4XRNA 1SLVB 2B8OH 1YCPH 5ESBA 4F4OC 1N8OC 2OQ5A 2FOCA 1A2CH 1NS3A 1Z8JB 5HM9A 2BOKA 1DUAA 2C8YB 4XFQA 1H8HD 2PTNA 3DSOA 1O37A 1C4U2 1QURH 3CNRA 2EC9H 1CHOF 1N6XA 3PMHB 1VCPA 4O3TA 1H4WA 1TONA 3FN8A 4X8SH 1AVWA 2L6OA 1UK4A 3FZZA 3PV2A 1BIOA 4AFSA 3PM3A 4IN1A 4K8YA 3SZNA 5E0GA 4X8VH 4NWKA 2PUXB 5HIZA 2XYAA 4CBOA 4U32A 1O2RA 1QBOA 5T6DA 1HAVB 4RSPA 8GCHF 1O5DH 1C5PA 3S7KB 1HAVA 2XC4A 1P01A 3ODDA 3U8OH 3BN9A 2DE8A 1AI8H 2OC7A 4B76A 5JBBS 2IJD1 1CT4E 2WPIS 4OS5A 2XBYA 4CRBA 1C2LA 2F9PA 2XBXA 2V7QD 4ZUHA 2BLOA 2F9UA 1FZZA 1O3DA 2OUAA 2V6NA 3M61U 1QHRB 4MQAA 3SU1A 4Y6DA 4AOQA 5JBCS 5C67A 1HGTH 1O2XA 3RXUA 1GG6B 3DD2H 4BAKB 1G3DA 3QDZB 1D3TB 1EAIA 2AYWA 2W3KA 1NRRH 3T26A 3SJOA 2YNAA 2F9VA 4JYVH 2V3HH 5EODA 2VBCA 1DSUA 2AIPA 3QK1A 1B0EA 2P95A 5T3HA 2XNDD 1YKTA 1IQMA 1P2QA 2TGDA 5IK2D 5FPSA 4NGAH 1QQUA 1AWHB 4NSYA 5F53A 1GHAG 3SBKA 3R3GB 5EJ1A 1A7SA 1O0DH 3A7TA 5HYOA 2QC2A 1KMHB 1GMDG 2I6SA 1S81A 4E06H 4CH8B 3BTME 1KSNA 3AVZA 2BD2A 4ISOA 4B73A 1RIWB 4K2YA 1SGDE 2A4OA 1OSSA 1WV7H 4B74A 3DHKH 4MNYA 2CN0H 2KFWA 5GPIB 3M5NA 3SJKA 1Y3UA 1FV9A 1LPKB 4SGAE 3DSGA 4K1TA 5HGGA 1JOUB 7GCHG 1NU9A 2M5TA 3FANA 1O2NA 4FUEA 3ATWA 1W3CA 1GI5A 1SHHB 3DFLA 1TA6A 5E2PA 3GDSA 4RI0A 2J9NA 3F2FA 1FMGA 5DK1A 5A8ZA 2ZHDA 2AMQA 1FY5A 3A7VA 1D3PB 1PQ5A 4UONA 3RXRA 3GCTF 4AYYB 2TIOA 2GDEH 1F0RA 3CENA 2LELA 2TPIZ 1AQ7A 4YOGA 1ZMJA 4AFUA 1QIXB 2JDID 3E8LA 1TOMH 4I8HA 2WHXA 3A83A 3M7QA 1WBGB 4DURA 3UB0A 4YOJA 2I6QA 1GWAA 3AAVA 1CT2E 2OLGA 2GCHG 1IQGA 1N8OB 1QZ8A 3SUDA 2C3SA 4LZ1H 3SGQE 1WUNH 2UUJB 1GBMA 1OS8A 5T1VA 1ZHMA 4X6NA 3U8RH 1MTUA 3BTQE 2JH5D 4HTCH 3EA8A 4K60A 3BV9B 2Z7FE 3SHCH 2O8LA 4AN7A 2ZGJA 1G36A 1SMFE 4J2YB 4ZKSU 2XW9A 1CA8B 3MU4A 1GDUA 1NESE 1P12E 1EAXA 1BRAA 2BQWB 1KXAA 4TT3D 1V2WT 4GPGA 1F5LA 3MNSA 4GHQA 2NU2E 1XXFA 3H09A 3HKJB 2F3CE 4A1TA 1CA0C 1FNIA 1BTYA 3SUGA 2V35A 2HGTH 1L1GA 2WUCA 3UIRA 5DP9A 1KDQA 1A46H 3FVFB 3RXGA 4BANB 1S6LA 4JK6A 3TJVA 1P9UA 1QGFA 2C8XB 4BXWA 1H9IE 2EY4C 2OCVB 1NBMD 3JZ1B 1OP8A 4MG3A 5FAHA 2Y7ZA 1UCYE 1AIXH 1F7ZA 4Q7ZA 5E8EH 4ISIH 1V2JT 3F9GA 2LNCA 4AORA 3M3SA 3GY8A 1O3IA 2UWLA 1XXDA 2GX4A 2R3UA 1T32A 4INLA 1AGJA 2ZU4A 3MH4A 1O3AA 2JETC 4MVNA 2XWAA 1AD8H 1TPOA 1Y3WA 1BTXA 3PB1E 1BOQA 1TB6H 1BT7A 1EOLA 3NWUA 2XRCA 1ELCA 2P3UB 5DPAA 1QB1A 3MOCA 1EJMA 2ZDNA 2BVXH 4XBCA 1DWEH 2B0FA 1UMAH 4FUDA 2FI3E 3I78A 4B2CA 2NU4E 1EASA 1QCPA 2FOBA 3EYDA 1GJCB 1MZDA 2WZQA 4B2BA 1C4Y2 2BD3A 3NXPA 2QGRA 1NFYA 1HXFH 3TK5A 5EQQA 2Y6TA 3TNSA 5L2ZH 3GDVA 1O5CB 6LPRA 1VGCB 4THNH 1PYTD 5F8XA 2GV7A 1GMCF 1GBLA 2O9QA 1GBTA 5FPTA 2KCYA 1MD7A 2QA9E 2VWNA 5CE1A 1PQAA 1AFQB 3N7EA 5EIYA 2BXUH 2JJ1D 1ETTH 2JKHA 2C8ZB 3UWJH 2GCTC 4Z1MD 4WMDA 3SV8A 5I46H 1O2JA 1ZGVA 3RU4E 3OE7D 3GS9A 3RMOH 1ELGA 2A2QH 5EGMA 4NIVA 3KEEA 4Z6AH 1TMTH 1FN6A 2TBSA 3QN7A 1P2MA 3EA7A 4H6TA 4MPVA 4YT7H 5A0AE 3TIUA 1C2EA 1NN6A 2HLDD 2ZHWH 3SUFA 3ZYEA 1VITH 1FY1A 2VIQA 1K1PA 1LTOA 1TGNA 4DG4A 2PW8H 1QR3E 1PPEE 3U98H 2A31A 5HMAA 4LZ4B 1SFQB 2R0KA 2YMSB 3TH3H 1T8NA 1TGSZ 3WW7A 1SBWA 4TYDA 1P57B 2PR3A 1DFPA 3VB7A 1CBWB 1QB6A 4AGJA 1S6HA 1LHGH 1N6YA 4IC5A 2BDCA 1NZQH 4UDWH 3UTUH 4X0WU 2P59A 2W6ID 1FX0B 1GBKA 1P06A 1Z1JA 2QN5T 4ZHMU 3D49H 1FQ3A 1Z6JH 1HLTH 4IGDA 2RFKC 1BUIA 1C2KA 1HJ9A 2JH6D 3P8OA 2J38A 5HKKD 1VITF 2Q6FA 2KCPA 4X1QU 2Q6GA 4LK4A 1DICA 2Y82A 3RXQA 3RUOA 7ESTE 4CREA 1UCYK 4NA9H 4X8TH 4K5ZA 2ZFRH 4FETA 1BMLA 1WXRA 1V2ST 2F43B 2SGAA 3ZZDA 3BTEE 2A32A 1OP2A 4ZHAA 4Y76A 1EZXC 4UD9H 4WMFA 2FS9A 2A45B 2BVRH 3HK3B 5L6NH 3GCHB 1ANDA 1XKAC 2HVXA 1QTFA 3TITA 1RS0A 1V2UT 4XD7D 5EXLA 2O8TA 1G2LA 2AMDA 1OWHA 3AASA 3EGKH 4IMQA 2BVSH 1F0TA 3URCA 1QRWA 1H8IH 2DUCA 3LGYA 2ZFQH 2BYAX 5EW2H 1TALA 3UFAA 2DE9A 2BY9X 2ZFTA 3T5FH 5FHTA 1KTTB 1KY9A 1UTNA 3RXKA 5L30H 2VIDA 2ZCLP 1TQ7B 1A1RA 1RRKA 3PMJA 2FTMA 1U6QA 1JRSA 2BDAA 1KLIH 3RXHA 1AB9C 1VZQH 1ID5H 1ZHPA 2WPJS 3ZZ9A 2EI6A 3GOVB 3D23A 1ZTKA 4Y0ZE 2LP6A 5B6OA 4H4FA 5H4IB 2WPDD 1FY3A 1W11U 4DT4A 1GHXH 1O2VA 3LJJA 4IN2A 2W7SA 1BBRK 1L4ZA 1V2OT 1A0JA 1EOJA 2QF0A 3TK6A 1K1OA 1MAYA 1O38A 3P8GA 2Z94A 3V0XA 1HNEE 2ZHEH 3RXEA 2D8WA 3OYPA 3ZIAD 1C5WB 3LGUA 3M3TA 3CP7A 3SUEA 1PJPA 1VR1H 1OPHB 3SU2A 2A0QB 2VNTA 5AHGH 2G5VA 1V3XA 1UVUH 2O8UA 4GAWA 5AF9H 1OYQA 1YGCH 5A09A 2SGEE 3OY5U 4ZMAH 1FY8E 1HPGA 4LOYH 3BG4C 2HNTF 2HNTE 3RXAA 3SJ9A 1O35A 3RM0H 4I8JA 2BZ6H 1GI9B 5C5OA 1C5YB 3RXOA 2BY5X 1LHDH 2OXSA 3A87A 2OK5A 4CRFA 3KQEA 2BX4A 1CHOG 3NRLA 1LKBA 1NM6A 1O3BA 4ZKRU 1CGHA 3ZVDA 5KECA 1OWJA 2RA3A 1BRUP 1EXFA 1TBQH 1SVPA 3DUXH 1UVOA 3E16B 4NWLA 2PLXA 4DCDA 1LHFH 1QY6A 3RXDA 5GCHF 1EZUC 1TA2A 3WWBA 1CBWC 1SQOA 2Y80A 2ZDMA 2PUQH 3O8DA 1AVGH 5EQRA 3S69A 3ZZCA 1PPGE 3TGKE 3AW1A 4HI3A 1TFXA 5FBIA 3L3TA 2NU0E 1GJAB 1BB0B 2GP9B 5A8XA 5A0CA 1T4UH 2R0LA 2OBOA 3RXMA 2GJGA 1BCUH 1P11E 1LQEA 5HM2A 1TGTA 2ZCKP 3GY4A 1W7GH 2BZAA 3OX7U 1UVTH 3GCTG 3ZYDA 2VVCA 3RXFA 1O2OA 4BAOB 1TBRH 1EP6A 4BTUB 1YLCA 3C27B 2IN2A 3T2NA 1O2TA 3E0PB 4MTBA 1DS2E 1WQVH 2Y5HA 3BG8A 3TU7H 2YNBA 1GL1A 1W0ZU 4BNRA 2AEIH 1PPFE 2Z6BD 3PLPA 4FU9A 2VINA 4R8TB 4ASUD 1AZ8A 1P03A 4WVPE 2ZG0H 4ABJA 2XCNA 3V13A 1KLTA 1TX8A 1D9IA 1O3MA 4A92A 1O5EH 1P2KA 2VWOA 1ZRKA 1BJUA 3UR9A 1C1OA 5DP3A 4DW2U 5JBTA 2VWLA 2OINA 1G3CA 1GMCG 3BSQA 2W5EA 1SFIA 4X8UH 1G9IE 1GBBA 3HGNA 1Q2WA 2BLWA 1TPAE 3SNAA 1WAYB 1TABE 1H9LB 5AFZH 3ZZ7A 1C1MA 3E91A 1LVBA 3P6ZB 4OS1A 1O39A 4Y8XA 1JMOH 2BDHA 1S83A 1FUJA 4OS4A 3VXFH 1WU1A 1J8AA 2Y81A 3T27A 1ZSJA 2D1JA 2P3FH 1SOTA 1MKWH 4Y8ZA 1YPMH 3GY7A 4MPWA 2R3YA 2BXTH 1UK3A 3UAIC 1DLEA 4UFFH 1ZSKA 1C1WH 1C5RA 1XX9A 2WPHS 9LPRA 2GZ9A 2VIVA 3S7HB 1EPTB 3OY6U 2ZHQH 2FX6A 3F2HA 4FUFA 5E0JA 5C0UA 1BA8B 1IQLA 5EPYA 4YO9A 2Z9JA 1C9TA 3IG6B 1J9CH 4VGCC 3QLPH 1C5ZB 2Y5FA 1E34B 1FIWA 2ZU1A 3AK5A 1MQ5A 3BG4B 2KZ4A 3RU4T 2B7DH 1O3CA 4NG9H 1W14U 1EATA 1OYTH 3MU1A 1QA7A 3QGJA 2XTTB 2RDLA 1UTOA 3E3TA 2BDGA 3SV7A 3QZRA 2IJOB 2RCEA 3A80A 1NTPA 3KNXA 3R0FA 4GHTA 2J92A 3T29A 1D3DB 2QYIA 2UUFB 4JYUH 1BMNH 5I25A 2O8MA 2H6MA 3A85A 5BPEA 3RXSA 2A7HA 4INHA 1BHXF 2FTLE 4YOIA 2WPKS 1TPSA 4U01A 3FFGA 4Q4LA 4HZHA 4FUBA 1F0UA 3NUMA 2XWBI 3SO3A 4B1TA 2GV6A 2XC5A 1GI1A 3L33A 1BMAA 3K9XB 6GCHG 1AUTC 2B9LA 1L1NA 4D76A 3F9FA 5FBEA 2FI4E 3C1KA 3GYMA 1C1UH 3UNSA 1GHYH 2W26A 1SR5C 1CVWH 1YPJH 4HFPB 1HAIH 2F91A 2GMTC 5FX5A 1BTZA 1HIAA 3LC5A 2C4FH 2Z9KA 4DOQA 1DDJA 5A2MH 2ZU2A 2WSSD 5CMXH 4I8KA 4XBBA 1GJ6A 3SU6A 2CXVA 4Z0KA 1A3EH 1C2MA 4DY7B 3LONA 3SU5A 3PMAB 4P02A 1KLJH 4I8GA 1C5NH 2AS9A 5T6FA 2J98A 3ZVAA 3DCLA 1VGCC 5LPFA 4KGAA 2ZQ1A 3UUZA 1ZZZA 2GVFA 1SGPE 4CHAC 3UNRA 2FM2A 3RXPA 1L2EA 1TBZH 3SW2B 3UOUA 2EEKA 3SNEA 1EB2A 2ALVA 1AFQC 2PP6A 1SGFG 3RXCA 2GGVB 2WINI 3M7TA 4MPXA 1BRBE 2FZZA 1UTQA 2Z3DA 1XVOA 2KM0A 1YPLH 3UY9A 3LDXH 1A3BH 1MTSA 3HATH 5IYTA 3MMGA 2XBWA 2NU1E 4OGYA 3ZZBA 2H5DA 2W7UA 1YLDA 2AGGX 3MU5A 1Q31A 1HJ8A 1O30A 3PMBB 4TPYA 4Q80A 1Y5BT 2ZI2H 5DP7A 3GY3A 1MBQA 2FOEA 1SQRA 3ZVBA 1Z7KA 1P09A 1S6FA 1C5LH 4GUXA 2KAIA 1XVMA 1GBIA 5TCAA 1KYNA 2FLRH 2O8WA 1Z6EA 3A88A 3LIWA 4UEHH 2G51A 2L74A 1L1JA 3ZVEA 3A7ZA 3PO1B 1TIOA 2BD5A 4D9RA 4NIXA 3QWCH 4D7FA 3LU9B 2YOLA 2HPPH 4AX9H 3KHVA 4MNVA 4I7YH 5LPEA 5EG4A 3Q00A 1UTKA 1CU1A 1EPTC 5AVDA 2YMSD 1ETSH 1O2SA 2BLVA 1RXPA 4INKA 2WYGA 1WYKA 3N99A 2BY8X 3T28A 3QUMP 2ANWA 3F9EA 1MTWA 1XUHA 3TVJB 4MDSA 1HRTH 2AHME 2K0QA 2XOKD 3BEUA 1NY22 1BTHH 3WWFA 2J98B 3NZIA 2BB4A 2EI8A 5K7RA 1VJ9U 1GVLA 2BHGA 1WSSH 2F9BH 3M37A 1TNKA 4NCYA 4YESB 2ZP0H 4Y8YA 1EZQA 4BAMB 3RP2A 5FPYA 4DJZB 2H2ZA 4IMZA 1XUJA 1O3OA 2AFQB 3RU4D 1DPOA 1P3EA 1ELEE 3LGIA 3M5LA 1A0LA 2KR7A 3KN2A 1YWUA 1DE7H 1W10U 3RMLH 1YY3A 1GCDA 2QCYA 1PPHE 2WPLS 1T4VH 1WOFA 1ZSLA 4B6EA 1ETRH 3KF2A 2KCAA 4QT8C 5FL7D 4DIIH 1Y8TA 1N1LA 1SG8B 3BF6H 2BD8A 2QIQA 1V6DA 3A7YA 1GMHG 3U9AH 2SGQE 1DITH 1V2KT 3SI3H 1Z8IB 1Y3YA 1FIZA 4JZ1A 1C1SA 2FS8A 3P95A 2QY0B 2PGBB 2VB0A 4B2AA 1JIRA 2VIWA 1O2YA 1ZYOA 3SQEE 3P70B 3VB6A 1SC8U 1ESBA 4BXSA 1EB1H 1XUIA 2J2UA 5EOKA 4OS7A 5LPRA 2A4GA 1YC0A 1OXGA 3UWIA 1K1IA 1EKBB 3LJOA 1FAXA 2SNWA 1MTVA 1GVKB 1TAWA 3PRDA 2G4TA 4YT6H 1HDTH 3DA9B 4BAHB 1SOZA 3LPRA 5JYIA 4ABFA 2THFB 1IQNA 5DG6A 3TJNA 4NIWA 3BEIB 2FWWA 1ESAA 5EPNA 3ELAH 3N7DA 1DSTA 4CRCA 1RD3B 4FUIA 1ABJH 4K8BA 1K2I1 3ATMA 1K22H 3LT3A 4Y79A 3F9HA 1BDAA 1H9HE 2FX4A 4DGJA 1ELDE 1VITG 1COWD 2XXLA 1SKYE 3ITIA 6CHAC 3ZZ5A 2ZQ2A 1P8VC 1PPCE 1EP5A 3GY2A 5JBAS 2RDEA 2Z9LA 2IPHA 4FUGA 1YPKH 3U69H 1HAOH 4X1SU 1V2RT 2ZNKH 1O36A 1ZJDA 5EJZA 3KYGA 4X1RU 1HB0B 1MAXA 1OX1A 5F6MA 1YCPM 1KIGH 5EW1H 1ARCA 2STAE 1DUEA 1GHBF 3PO1C 1RGQA 3RM2H 1QL9A 2GTBA 1ZTLA 5FCKA 2ODPA 1EQ9A 2GT7A 5E2OA 2RG3A 1O5AB 1D3QB 4GCHG 3FOAA 2G4UA 1SGIB 3MWIU 3ZV8A 5HXFA 1H8DH 1C5MD 1O3FA 3VB3A 3I29A 5GDSH 1O2ZA 3LH3A 1K1NA 1SQAA 2UUYA 2A4RA 1GMHF 3F0PA 1TE0A 5B6LA 2KAIB 3LKWA 4MNXA 1UK2A 1O2QA 1D6RA 3BTFE 2FDAA 1B0FA 1H8ED 5KGOA 2HWLB 3HGPA 1PPBH 2FYQA 3ZV9A 2H1UA 3GCNA 2BDIA 3OTPA 3S9BA 3NK8A 1TMBH 5AFYH 5GXPA 4BTIB 5L2YH 3VXEH 4CBNA 2OBQA 3M7UA 4X2WA 1FXYA 1MBMA 5GIBA 5T6GA 1KTSB 2IPQX 4X2VA 1A5HA 1UTPA 2ZKSA 5FXLA 1RFNA 2VH0A 2ZGHA 3PWBA 2QF5A 3BEFB 1Y5AT 2JIZD 4ZXXH 1FLEE 2SGFE 4SGBE 1GVZA 3A7WA 4AB8A 1G37A 4K3JA 1O3PB 1V2PT 5DO4H 4O9VA 1SSXA 5EJLA 1WTGH 3U1JB 3M3VA 1A61H 1C5OH 1HBTH 1BRCE 1ACBE 2BLQA 5C94A 4FXGH 3VG8A 4I86A 5GWZA 1SLXB 3SV9A 1TRYA 1JRTA 3JZ2B 1W0YH 1GBFA 1JBUH 1FJSA 5CHAB 1IHSH 4XBDA 1P9SA 4I32A 3RXLA 1TLDA 2ZF0H 3NKKA 5A8YA 2VJ1A 1VKYA 4WH8A 1INCA 3D62A 1UTLM 1C4V2 4LXBH 2AH4X 1W0JD 4CH2B 1SL3A 1OOKB 1GI4A 2B5TB 4WXIA 3TNTA 4AYVB 1HJAB 4RT1A 4HG6A 4JZEH 1CE5A 2ESTE 2CJIA 1LHCH 1DOJA 2KX4A 1B7XB 3RXBA 1HCGA 4NSVA 2VVVA 2HOBA 2LPRA 1Z8GA 4TSFD 3SU0A 4DIHH 2OTVA 1L4DA 2R2MB 4JK5A 1DVAH 4KKDA 4YZUA 2ZGBH 3OAAD 4IW4E 4TY7A 1YLNA 3VB4A 1DY8A 1SPJA 4WXVA 1VJAU 3H7TA 2AERH 3VB5A 5TCCA 2Q1JA 1FI8A 1DY9A 3E6PH 3PWCA 2RA0A 2BMGB 1V2QT 4X6MA 1GJBB 1TYNA 1YCPK 1EJAA 4AG1A 3UQVA 1K0HA 1YF4A 5EXMA 1C1RA 2XNIA 3SNCA 4XE4A 4Y71A 1O2WA 4GLYA 1V2VT 3MYWA 5ESTE 6CHAB 1A4WH 1AO5A 3PV5A 3OEED 4WF8A 2G55A 2FOFA 3TJUA 4A7IB 1SQTA 3PLBA 2V3MA 4NFEA 4YLQH 4JCNA 4H42U 5FCRA 3A8AA 3KL6A 1AN1E 1GJDB 1GBJA 1EZSC 1AKSB 4D7GA 1GI3A 5C3NA 1C1NA 4CRAA 2G8TA 1DLKB 3OU0A 1DXPA 1GCTC 4KTSA 4JYTA 2H9TH 4ISNA 1W0KD 3Q76A 2VVUA 4AB9A 5BRRE 1O2KA 4TWYA 1BBRE 1UJ1A 3UNQA 1K1MA 4NFFA 5F03A 2P3TB 2GCHF 5JPMH 2F9NA 1MKXH 3KQ5A 1UCYH 1TNIA 1DWCH 1TGCA 1C1PA 1UHBB 3SU4A 3O8BA 1O3EA 1ZRBA 4E7NA 3UOPA 1AKSA 1UO6A 2JH0D 4KP0A 1LPZB 2FLBH 2ZPSA 2Z9IA 4CRDA 1PQ7A 2SNVA 3ZZ6A 5GJ4B 2PV9B 3E0NB 1AE5A 3H5CB 1HYLA 4FUCA 2VIOA 4M9FA 2A4QA 3M5MA 2D2DA 4O03A 4H6SB 1AUJA 4AC9A 4FVDA 4ACAA 4Y0YE 1P3CA 2C93B 3O8CA 3FP7E 1B5GH 4PROA 1HAGE 3UREA 4ISHH 1ZR0A 2ZTXA 1C5XB 1AZZA 5DP4A 1SGCA 4K1EA 9ESTA 1O3JA 3BIUH 1HFDA 3G01A 3SGBE 4ABDA 1QL8A 4ZKOU 1D4PB 2ODYB 1EAUA 1XUFA 1O2LA 2FEQH 2H5CA 1NPMA 2FI5E 4YLUA 1G3EA 1CA0B 4RKOB 2ANYA 5EU8A 1NRSH 2BM2A 1EUFA 3GY6A 1TGBA 1IQJA 1G2MA 4OS2A 2J34A 1CHGA 1MMJN 3URDA 4ACBA 1O3GA 5CDFE 1PFXC 3W1EA 1LVYA 1C1TA 1P2NA 2AGIX 2ZPRA 3F1SB 3QO6A 1Z1IA 1HAZB 4O3UA 2R2WU 4JZFH 1TQ0B 1LCYA 4GSOA 2VH6A 1RTLA 1K1JA 3MI4A 4KTCA 1IOEA 1NU7B 3SNDA 1LHEH 3DFJA 4GCHF 1UHBA 4UE7H 1UTJA 1NRQH 2XC0A 1V2NT 2STBE 1GG6C 1HJAC 1SB1H 1XKBC 3BTKE 1C2JA 1J17T 3PRBA 5DGJA 1AWFH 3L6PA 2CV3A 4Q2KA 3PTNA 3OTJE 1Q3XA 5GNDA 1QB9A 2V0BA 3KQCA 1V2LT 2HLCA 1GBHA 3SV2H 3MHWU 8GCHG 1O2PA 4ABIA 1DXWA 4FU8A 1P02A 4WMEA 1C2FA 1J15A 4RT0A 3RMMH 3ATLA 1O3NA 2ZZUH 3BTGE 4ABAA 4X2XA 2F9OA 2OC0A 1VCWA 3OEHD 1S84A 2QAAA 3IITA 1XMNB 4YM9A 4WH6A 4HGCA 2OC8A 3MO9A 1GI7B 1CGJE 5C20A 1GBEA 1O2HA 1T8MA 4IBLH 3CS0A 3W94A 2HRVA 4K1SA 1HAPH 2HNTC 1O5BB 1QBNA 1O3KA 4X1PU 2ZHFH 3KYFA 5LH8A 1FPHH 3MO6A 3SOSA 4FVBA 2CHAC 4RN6A 1MCVA 4ISLA 2OP9A 1OWIA 1O5GH 2Q6DA 3A82A 1TMUH 2ANMH 1UW7A 2SGPE 1DANH 1BJVA 2ZWLH 1W7XH 2NU3E 3PROA 1L0ZA 1MUEB 2GKVE 2P93A 4Y7BA 3T25A 3ZZAA 1O3HA 2P8OC 3MH6A 4XSKU 2Y5GA 4XDEA 1K1LA 1O2IA 4X6OA 5F8TA 3B23B 1K28D 1GHZA 1OHHD 1MABB 4X1NU 4MPUA 2BX3A 5EXNA 2AMPA 1FONA 3A86A 5GCHG 2ZFFH 3TGJE 1S85A 2J95A 3I77A 1XM1A 1BITA 2BD7A 3RXJA 1Y5UT 3K2UA 2BQ7B 3KIDU 2ZECA 1S0RA 1TRMA 3SGAE 4D9QA 2ODQA 4B71A 6GCHF 3IWMA 2ZFSA 2M2AA 2GT8A 3ZVGA 1PYTC 3DT0H 1NRPH 3U8TH 1IQFA 1GBCA 1HIAB 1Y3VA 2G00A 1ELFA 2QXGA 3OFND 5C1UA 3F2GA 4TWWA 1MTNC 1OWKA 1O2GH 3S9AA 4UFDH 1KXEA 1E38B 3N7OA 4A5TS 4CR5A 1GI0A 4X2YA 2WPMS 3O8RA 1GPZA 1NC6A 1SLUB 1Z71A 1WQSA 3FKSD 1BTUA 2TGPZ 4OGXA 3A81A 1Y59T 2FESH 2ZGCA 3LC3A 3SYJA 4FUJA 2HPQH 2JJ2D 1Y3XA 1QRZA 1G32B 1SGQE 3TLOA 1IQEA 4ZH8A 2C8WB 2W6JD 2HALA 2VWMA 5FX6A 4WWYA 1ZPBA 1ZPZA 3TH2H 1AE8H 1K9OE 1ESTA 2TGTA 1GHAF 5PTPA 3GCHC 1O3LA 1ANCA 2ANKH 2QXJA 1C5TA 3A8CA 1ZMLA 3S0NA 1H1BA 2JETB 2NWNA 1E79D 2PFEA 3SU3A 3P17H 1QA0A 3A89A 1NBME 2BQ6B 2ZCHP 5ETXA 4DVAU 1T8LA 5JDUB 1A5GH 3GISB 3CS7A 2H9HA 1PPZA 3KCGH 4DT7B 1F2SE 2A2XH 4Y11E 1ELAA 3V12A 1FN8A 1E35B 1UVPA 5C17A 3A8DA 1GHWH 1FY4A 1NFUA 2A5KA 1TNLA 1GI6A 1T31A 1W12U 1YM0A 3LH1A 1C2DA 3M35A 1P05A 2A5AA 2WUBA 3Q3KA 4ZXYH 1O32A 1ANEA 5DN6D 4BAQB 1C5UA 1GJ8B 4K69A 1IQKA 1MQ6A 3TGIE 1SGFA 1ZGIA 4CHAB 3F0OA 4AGKA 2QXHA 1HAXB 3FAOA 1AMHA 4Y7AA 3M5OA 5DP5A 4X6PA 2GCTB 1D6WA 2PTCE 2ZU3A 5CHBA 1P04A 1MKWK 2FPZA 1AVXA 4MNWA 3TJOA 1TNJA 3MNBA 5ABWA 3GY5A 1ZTJA 3QX5H 3S9CA 1ZOMA 1BBRH 1FAKH 5C2ZA 4OS6A 4XOJA 3SN8A 3KQDA 1CGIE 2D26C 3AW0A 4FOUC 2R9PA 3MO3A 3U1IB 2BDYA 2F4LA 3RMNH 3OSYA 3RC5A 5SGAE 2A1DB 3P92A 3QTOH 3ATIA 1S82A 1GDNA 1F92A 3F68H 2ZGXH 1YPHE 1DWDH 1W13U 1MU6B 1T8OA 2A7CA 3E90B 4Y10E 1SLWB 2K1QA 3EE7A 1QJ7B 2QE7D 1MD8A 2ULLA 1EFRD 1SI5H 4WJG2 2EA3A 3SJIA 5K0HA 1C9PA 3A7XA 1HUTH 5TJXA 2UUKB 5DJ7A 3SJ8A 1HV7A 3TH4H 2FP7B 4AFZA 1GBDA 2H9EH 2PKSC 2FIRH 1P0SH 1W8BH 4OM9A 4U30A 2FXRA 1V2TT 3NPSA 4CR9A 2TRMA 1XUGA 1VCQA 3WY8A 1QJ6B 1GL0E 3F3BA 1LVMA 4UFEH 8LPRA 3MH7A 1MTNB 4AG2A 1P10A 1C1QA 2ZFPH 2PWXA 2CK3D 3EAJA 1LVOA 1PQ8A 3SV6A 1EPTA 2FOGA 1TX6A 3K6ZA 4IS5A 2ZPQA 3MFJA 5DKMA 2QXIA 1J14A 2HVYB 3TPIZ 2FODA 1FPCH 4E7RG 1LKAA 2AGEX 1BHXB 3SZEA 1NO9H 3NCLA 3UR6A 1Z8RA 3A8BA 1EX3A 3EE0B 5EQSA 1THPB 2WYJA 4M7GA 1GDQA 3MQKC 2J4IA 1S5SA 3EQ0H 2WV5A 1DT2A 1FDPA 3SI4H 5C5NA 1MKXK 2KCOA 3ZVCA 2GZ8A 1C5VA 3BTHE 3STIA 4ABGA 1E0FD 1O34A 1G3BA 2BDBA 2SGDE 2J97A 2ZIQH 3M36A 5J4SA 1AHTH 2P16A 1SGNE 2A7JA 1CSOE 1C2IA 2ZDAH 3BTTE 2VGCC 2K8IA 2J94A 1YPEH 2FOHA 2FO9A 1SHYA 2GZ7A 4JZIA 3KGPA 2IOTA 4YTAA 1NFXA 1A0HB 1GBAA 2OD3B 2PGQB 2GD4B 4B75A 1QQ4A 4U2WA 2ASUB 3UQOA 8KME2 2ZC9H 4I33A 5IDKA 1LDTT 1ELVA 2G81E 4A6LA 1E1RD 2ALPA 1P2OA 2UWOA 4NA7A 1TWXB 1THSH 3PLKA 3W95A 1F5RA 3ZZ4A 2FMJA 4E05H 2ZTZA 1KXBA 3U28C 1QBVH 1HAHH 1ZPCA 3ZZ3A 3TK9A 3BTDE 4ZROA 4ESTE 3BTWE 3VFEA 2PKAA 5F8ZA 1SGEE 2CGAA 3DSPA 2GDDA 1IQIA 2V3OH 1QNJA 1GGDB 4ABEA 1P2IA 3RXVA 4ZKNU 1JXPA 3SQHE 1TX7A 1OWEA 1GJ5H 1XUKA 2PSXA 4VGCB 3VGCB 2CF8H 1ORFA 1OWDA 3FP6E 4KTUA 1T7CA 1BTPA 2C90B 2PHBA 3FZDA 2QV1A 3LGTA 1SGYE 2P94A 4JMYA 4A1XA 5C1XA 1YYY1 1OKXA 2VU8E 1WDIA 4P00A 5DP8A 4MLFB 5DSFA 2G5NA 1MU8B 4ASHA 3V7TA 1K21H 3QTVH 5A0BA 1IQHA 3HK6B 5C1YA 1C1VH 1KDQB 1QJ1B 4J1YA 1WTHD 1F5KU 1ZLRA 2ILNA 1BZXE 1GJ9B 2A5IA 1E36B 1M9UA 2W3IA 3EA9A 4GVUA 2PKSB 1UTMA 2CF9H 4FU7A 1O2MA 2ZU5A 1QL7A 1GJ7B 1O5FH 2BY7X 3A84A 2ZA5A 3MU8A 5LGOA 1LQDB 3FO8D 3ODFA 1O2UA 1MCTA 2OC1A 4KELA 1AFEH 1YP9A
chains in the Genus database with same CATH topology
2TGAA 2ZDKA 7GCHF 1JIMA 1C5SA 1QRXA 1YPGH 3E1XB 1NT1A 1AY6H 1EAWA 1KXCA 2WV4A 3KQBA 3QZQA 1C2GA 3ESTA 4AFQA 2ZO3H 1TRNA 3BIVH 4I31A 1AU8A 1BTWA 1JWTA 3LGVA 2ZEBA 1RJXB 1RTFB 3VPKA 4TPIZ 1GMDF 2BY6X 1X7AC 4I8LA 2EI7A 3SHAH 1A5IA 3P8FA 4NIYA 1HXEH 4TY6A 1ZJKA 2FYRA 2Y7XA 3GICB 1P2JA 3K65B 4ABBA 4FUHA 3AAUA 3FP8E 3T62A 1LMWB 1C5QA 2F83A 1EJNA 3MTYA 1RTKA 3SORA 1DM4B 2CHAB 2VGCB 2ZDLA 5CHAC 1GJ4H 2FOAA 3SNBA 1E37B 1YPHC 4NZQA 3VEQB 3MH5A 3B8JA 4R0IA 2PKAB 1NROH 3Q3YA 5E0HA 3RC6A 1TNGA 2CMYA 3GCOA 1NRNH 2P8OB 2ZTYA 2PSYA 4WY3A 5JB8S 3HKIB 3HPTB 3Q77A 4NZLA 4F49A 2SFAA 1QFKH 3STJA 3RLYH 4BOHA 1V2MT 1THRH 1GHBG 1GI2A 2Z3CA 1DX5M 2UWPA 4RKJB 1SGRE 1G30B 4BTTB 2Z9GA 3H7OA 3MNXA 1ELTA 3MU0A 3ZZ8A 4CRGA 1HAYB 3RC4A 3K6YA 2BD9A 1CQQA 1J16A 3PYHA 1BMMH 3PTBA 3ATKA 3MNCA 4O97A 1ARBA 2OQUA 1ANBA 1GGDC 4ZAEA 3D65E 1TOCB 2XCFA 1ABIH 1WCZA 1C2HA 4ABHA 2BTCE 5G4BA 1GHVH 3PV4A 1TNHA 1W2KH 3VGCC 1RIWC 3RXIA 4Q7XA 3QGNB 4AZ2B 2FOMB 1S0QA 4IC6A 3Q3XA 1KXDA 1MZAA 2BOHB 2G52A 3B9FH 3EDXB 1ZHRA 3P8NA 3V3MA 2AIQA 3RLWH 1TPPA 3RXTA 1CT0E 2QF3A 2XBVA 2ZDVH 3GDUA 1KXFA 2Z3EA 3LOXA 4D8NA 8ESTE 1YBWA 7KMEH 1ELBA 1BQYA 1F0SA 1GCTB 1MH0A 1LPGB 3UPEA 7LPRA 1AB9B 4ZHLU 1GI8B 1ZMNA 2BD4A 2VIPA 3GYLB 5J4QA 1CO7E 3RDZA 5JB9S 1IAUA 1UVSH 1OP0A 3ZVFA 4UFGH 5DP6A 1IHTH 4NA8A 1SGTA 1DWBH 1O31A 4A1VA 3ENSB 1NFWA 2GMTB 1O33A 3LGWA 4JZDH 4Q7YA 1LO6A 3F6UH 6ESTA 1SLVB 2B8OH 1YCPH 5ESBA 4F4OC 1N8OC 2OQ5A 2FOCA 1A2CH 1NS3A 1Z8JB 5HM9A 2BOKA 1DUAA 2C8YB 4XFQA 2PTNA 1O37A 1C4U2 1QURH 2EC9H 1CHOF 1N6XA 3PMHB 1VCPA 4O3TA 1H4WA 1TONA 4X8SH 1AVWA 1UK4A 3FZZA 4AFSA 1BIOA 3PM3A 4IN1A 4K8YA 3SZNA 5E0GA 4X8VH 4NWKA 2PUXB 2XYAA 4CBOA 4U32A 1O2RA 1QBOA 5T6DA 1HAVB 4RSPA 8GCHF 1O5DH 1C5PA 3S7KB 1HAVA 2XC4A 1P01A 3ODDA 3U8OH 3BN9A 2DE8A 1AI8H 2OC7A 4B76A 5JBBS 1CT4E 2WPIS 4OS5A 2XBYA 4CRBA 1C2LA 2F9PA 2XBXA 4ZUHA 2BLOA 2F9UA 1FZZA 1O3DA 2OUAA 2V6NA 3M61U 1QHRB 4MQAA 3SU1A 4Y6DA 4AOQA 5JBCS 5C67A 1HGTH 1O2XA 3RXUA 1GG6B 3DD2H 4BAKB 1G3DA 3QDZB 1D3TB 1EAIA 2AYWA 2W3KA 1NRRH 3T26A 3SJOA 2YNAA 2F9VA 4JYVH 2V3HH 5EODA 1DSUA 2AIPA 3QK1A 1B0EA 2P95A 5T3HA 1YKTA 1IQMA 1P2QA 2TGDA 5FPSA 4NGAH 1QQUA 1AWHB 4NSYA 1GHAG 3SBKA 3R3GB 1A7SA 1O0DH 3A7TA 5HYOA 2QC2A 1GMDG 2I6SA 1S81A 4E06H 4CH8B 3BTME 1KSNA 3AVZA 2BD2A 4ISOA 4B73A 1RIWB 4K2YA 1SGDE 2A4OA 1OSSA 1WV7H 4B74A 3DHKH 4MNYA 2CN0H 5GPIB 3M5NA 3SJKA 1Y3UA 1FV9A 1LPKB 4SGAE 4K1TA 5HGGA 1JOUB 7GCHG 1NU9A 2M5TA 3FANA 1O2NA 4FUEA 3ATWA 1W3CA 1GI5A 1SHHB 3DFLA 1TA6A 5E2PA 3GDSA 2J9NA 1FMGA 5DK1A 5A8ZA 2ZHDA 2AMQA 1FY5A 3A7VA 1D3PB 1PQ5A 4UONA 3RXRA 3GCTF 4AYYB 2TIOA 2GDEH 1F0RA 3CENA 4YOGA 2TPIZ 1AQ7A 1ZMJA 4AFUA 1QIXB 3E8LA 1TOMH 4I8HA 3A83A 3M7QA 1WBGB 4DURA 4YOJA 2I6QA 1GWAA 3AAVA 1CT2E 2OLGA 2GCHG 1IQGA 1N8OB 3SUDA 2C3SA 4LZ1H 3SGQE 1WUNH 2UUJB 1GBMA 1OS8A 1ZHMA 4X6NA 3U8RH 1MTUA 3BTQE 2JH5D 4HTCH 3EA8A 4K60A 3BV9B 2Z7FE 3SHCH 2O8LA 4AN7A 2ZGJA 1G36A 1SMFE 4J2YB 4ZKSU 2XW9A 1CA8B 3MU4A 1GDUA 1NESE 1P12E 1EAXA 1BRAA 2BQWB 1KXAA 1V2WT 4GPGA 1F5LA 3MNSA 4GHQA 2NU2E 1XXFA 3HKJB 2F3CE 4A1TA 1CA0C 1FNIA 1BTYA 3SUGA 2V35A 2HGTH 1L1GA 2WUCA 3UIRA 5DP9A 1KDQA 1A46H 3FVFB 3RXGA 4BANB 4JK6A 3TJVA 1P9UA 1QGFA 2C8XB 4BXWA 1H9IE 2OCVB 3JZ1B 4MG3A 1OP8A 5FAHA 2Y7ZA 1UCYE 1AIXH 1F7ZA 4Q7ZA 5E8EH 4ISIH 1V2JT 3F9GA 2LNCA 4AORA 3M3SA 3GY8A 1O3IA 2UWLA 1XXDA 2GX4A 2R3UA 1T32A 4INLA 1AGJA 2ZU4A 3MH4A 1O3AA 2JETC 4MVNA 2XWAA 1AD8H 1TPOA 1Y3WA 1BTXA 3PB1E 1BOQA 1TB6H 1BT7A 1EOLA 3NWUA 2XRCA 1ELCA 2P3UB 5DPAA 1QB1A 3MOCA 1EJMA 2ZDNA 2BVXH 4XBCA 1DWEH 2B0FA 1UMAH 4FUDA 2FI3E 3I78A 4B2CA 2NU4E 1EASA 1QCPA 2FOBA 3EYDA 1GJCB 1MZDA 4B2BA 1C4Y2 2BD3A 3NXPA 2QGRA 1NFYA 1HXFH 3TK5A 5EQQA 2Y6TA 3TNSA 5L2ZH 3GDVA 1O5CB 6LPRA 1VGCB 4THNH 1PYTD 5F8XA 2GV7A 1GMCF 1GBLA 2O9QA 1GBTA 5FPTA 1MD7A 2QA9E 2VWNA 5CE1A 1PQAA 1AFQB 2BXUH 1ETTH 2JKHA 2C8ZB 3UWJH 2GCTC 4WMDA 3SV8A 5I46H 1O2JA 1ZGVA 3RU4E 3RMOH 1ELGA 2A2QH 5EGMA 4NIVA 3KEEA 4Z6AH 1TMTH 1FN6A 2TBSA 3QN7A 1P2MA 3EA7A 4H6TA 4MPVA 4YT7H 5A0AE 3TIUA 1C2EA 1NN6A 2ZHWH 3SUFA 3ZYEA 1VITH 1FY1A 2VIQA 1K1PA 1LTOA 1TGNA 4DG4A 2PW8H 1QR3E 1PPEE 3U98H 2A31A 5HMAA 4LZ4B 1SFQB 2R0KA 3TH3H 1T8NA 1TGSZ 1SBWA 4TYDA 1P57B 2PR3A 1DFPA 3VB7A 1CBWB 1QB6A 4AGJA 1S6HA 1LHGH 1N6YA 4IC5A 2BDCA 1NZQH 4UDWH 3UTUH 4X0WU 2P59A 1GBKA 1P06A 1Z1JA 2QN5T 4ZHMU 3D49H 1FQ3A 1Z6JH 1HLTH 4IGDA 1BUIA 1C2KA 1HJ9A 2JH6D 3P8OA 2J38A 1VITF 2Q6FA 4X1QU 2Q6GA 4LK4A 1DICA 2Y82A 3RXQA 3RUOA 7ESTE 4CREA 1UCYK 4NA9H 4X8TH 4K5ZA 2ZFRH 1BMLA 1V2ST 2SGAA 3ZZDA 3BTEE 2A32A 1OP2A 4ZHAA 4Y76A 1EZXC 4UD9H 4WMFA 2FS9A 2A45B 2BVRH 3HK3B 5L6NH 3GCHB 1ANDA 1XKAC 2HVXA 1QTFA 3TITA 1RS0A 1V2UT 5EXLA 2O8TA 1G2LA 2AMDA 1OWHA 3AASA 3EGKH 4IMQA 2BVSH 1F0TA 3URCA 1QRWA 1H8IH 2DUCA 3LGYA 2ZFQH 2BYAX 5EW2H 1TALA 3UFAA 2DE9A 2BY9X 2ZFTA 3T5FH 5FHTA 1KTTB 1KY9A 1UTNA 3RXKA 5L30H 2VIDA 2ZCLP 1TQ7B 1A1RA 1RRKA 3PMJA 2FTMA 1U6QA 1JRSA 2BDAA 1KLIH 3RXHA 1AB9C 1VZQH 1ID5H 1ZHPA 2WPJS 3ZZ9A 2EI6A 3GOVB 3D23A 1ZTKA 4Y0ZE 5B6OA 4H4FA 5H4IB 1FY3A 1W11U 1GHXH 1O2VA 3LJJA 4IN2A 2W7SA 1BBRK 1L4ZA 1V2OT 1A0JA 1EOJA 2QF0A 3TK6A 1K1OA 1MAYA 1O38A 3P8GA 2Z94A 3V0XA 1HNEE 2ZHEH 3RXEA 2D8WA 3OYPA 1C5WB 3LGUA 3M3TA 3CP7A 3SUEA 1PJPA 1VR1H 1OPHB 3SU2A 2A0QB 2VNTA 5AHGH 2G5VA 1V3XA 1UVUH 2O8UA 4GAWA 5AF9H 1OYQA 1YGCH 5A09A 2SGEE 3OY5U 4ZMAH 1FY8E 1HPGA 4LOYH 3BG4C 2HNTF 2HNTE 3RXAA 3SJ9A 1O35A 3RM0H 4I8JA 2BZ6H 1GI9B 5C5OA 1C5YB 3RXOA 2BY5X 1LHDH 2OXSA 3A87A 4CRFA 3KQEA 2BX4A 1CHOG 1LKBA 1NM6A 1O3BA 4ZKRU 1CGHA 3ZVDA 1OWJA 2RA3A 1BRUP 1EXFA 1TBQH 1SVPA 3DUXH 1UVOA 3E16B 4NWLA 2PLXA 4DCDA 1LHFH 1QY6A 3RXDA 5GCHF 1EZUC 1TA2A 1CBWC 1SQOA 2Y80A 2ZDMA 2PUQH 3O8DA 1AVGH 5EQRA 3S69A 3ZZCA 1PPGE 3TGKE 3AW1A 4HI3A 1TFXA 5FBIA 3L3TA 2NU0E 1GJAB 1BB0B 2GP9B 5A8XA 5A0CA 1T4UH 2R0LA 2OBOA 3RXMA 1BCUH 1P11E 1LQEA 5HM2A 1TGTA 2ZCKP 3GY4A 1W7GH 2BZAA 3OX7U 1UVTH 3GCTG 3ZYDA 2VVCA 3RXFA 1O2OA 4BAOB 1TBRH 1EP6A 4BTUB 1YLCA 3C27B 2IN2A 3T2NA 1O2TA 3E0PB 4MTBA 1DS2E 1WQVH 2Y5HA 3BG8A 3TU7H 2YNBA 1GL1A 1W0ZU 4BNRA 2AEIH 1PPFE 2Z6BD 3PLPA 4FU9A 2VINA 4R8TB 1AZ8A 1P03A 4WVPE 2ZG0H 4ABJA 2XCNA 3V13A 1KLTA 1TX8A 1D9IA 1O3MA 4A92A 1O5EH 1P2KA 2VWOA 1ZRKA 1BJUA 3UR9A 1C1OA 5DP3A 4DW2U 5JBTA 2VWLA 2OINA 1G3CA 1GMCG 3BSQA 2W5EA 1SFIA 4X8UH 1G9IE 1GBBA 3HGNA 1Q2WA 2BLWA 1TPAE 3SNAA 1WAYB 1TABE 1H9LB 5AFZH 3ZZ7A 1C1MA 3E91A 1LVBA 3P6ZB 4OS1A 1O39A 4Y8XA 1JMOH 2BDHA 1S83A 1FUJA 4OS4A 3VXFH 1WU1A 1J8AA 2Y81A 3T27A 1ZSJA 2D1JA 2P3FH 1SOTA 1MKWH 4Y8ZA 1YPMH 3GY7A 4MPWA 2R3YA 2BXTH 1UK3A 1DLEA 4UFFH 1ZSKA 1C1WH 1C5RA 1XX9A 2WPHS 9LPRA 2GZ9A 2VIVA 3S7HB 1EPTB 3OY6U 2ZHQH 2FX6A 4FUFA 5E0JA 1BA8B 1IQLA 5EPYA 4YO9A 2Z9JA 1C9TA 3IG6B 1J9CH 4VGCC 3QLPH 1C5ZB 2Y5FA 1E34B 1FIWA 2ZU1A 1MQ5A 3BG4B 3RU4T 2B7DH 1O3CA 4NG9H 1W14U 1EATA 1OYTH 3MU1A 1QA7A 3QGJA 2XTTB 2RDLA 1UTOA 3E3TA 2BDGA 3SV7A 3QZRA 2IJOB 2RCEA 3A80A 1NTPA 3KNXA 3R0FA 4GHTA 2J92A 3T29A 1D3DB 2QYIA 2UUFB 4JYUH 1BMNH 5I25A 2O8MA 2H6MA 3A85A 5BPEA 3RXSA 2A7HA 4INHA 1BHXF 2FTLE 4YOIA 2WPKS 1TPSA 4U01A 3FFGA 4HZHA 4FUBA 1F0UA 3NUMA 2XWBI 3SO3A 4B1TA 2GV6A 2XC5A 1GI1A 3L33A 1BMAA 3K9XB 6GCHG 1AUTC 2B9LA 1L1NA 4D76A 3F9FA 5FBEA 2FI4E 3C1KA 3GYMA 1C1UH 3UNSA 1GHYH 2W26A 1SR5C 1CVWH 1YPJH 4HFPB 1HAIH 2F91A 2GMTC 5FX5A 1BTZA 1HIAA 3LC5A 2C4FH 2Z9KA 4DOQA 1DDJA 5A2MH 2ZU2A 5CMXH 4I8KA 4XBBA 1GJ6A 3SU6A 2CXVA 4Z0KA 1A3EH 1C2MA 4DY7B 3LONA 3SU5A 3PMAB 1KLJH 4I8GA 1C5NH 2AS9A 5T6FA 3ZVAA 1VGCC 5LPFA 4KGAA 2ZQ1A 3UUZA 1ZZZA 2GVFA 1SGPE 4CHAC 3UNRA 2FM2A 3RXPA 1L2EA 1TBZH 3SW2B 3UOUA 2EEKA 3SNEA 1EB2A 2ALVA 1AFQC 1SGFG 3RXCA 2GGVB 2WINI 3M7TA 4MPXA 1BRBE 2FZZA 1UTQA 2Z3DA 1XVOA 1YPLH 3UY9A 3LDXH 1A3BH 1MTSA 3HATH 5IYTA 3MMGA 2XBWA 2NU1E 4OGYA 3ZZBA 2H5DA 2W7UA 1YLDA 2AGGX 3MU5A 1Q31A 1HJ8A 1O30A 3PMBB 4TPYA 4Q80A 1Y5BT 2ZI2H 5DP7A 3GY3A 1MBQA 2FOEA 3ZVBA 1Z7KA 1P09A 1S6FA 1C5LH 4GUXA 2KAIA 1XVMA 1GBIA 5TCAA 1KYNA 2FLRH 2O8WA 1Z6EA 3A88A 3LIW