3QK1A

Crystal structure of enterokinase-like trypsin variant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
224
structure length
224
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNKRRKNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Towards a restriction proteinase: construction of a self-activating enzyme.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 54
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3qk1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3qk1A02
1MTWA 3LIWA 1TPOA 4AGJA 1NESE 2HPPH 3VGCC 1THRH 3ENSB 1KIGH 3QTVH 4GHTA 5C3NA 1T8OA 3SGQE 3TNTA 2FOGA 1UTOA 4J1YA 2ZDVH 2ZCKP 1ZPBA 3RXMA 2HNTF 4Y11E 1QL8A 2DE9A 4VGCC 1TPSA 3T27A 4RSPA 2FPZA 1TGTA 2FOCA 1PQAA 1T8MA 5DP7A 1C5LH 1GJ4H 2TGAA 3DD2H 2XBXA 2OC0A 2CGAA 1ZRKA 4AOQA 3FZZA 2ZIQH 1BTWA 3PV4A 1UMAH 4YOJA 3O8CA 3PYHA 4TWYA 1KDQA 3PLBA 3M37A 3BTWE 3LU9B 1AUJA 3AAVA 5LPFA 1FMGA 1C4Y2 1TLDA 2P16A 2G5VA 4CH2B 1TQ7B 2B7DH 3GCHB 1YPEH 4X1NU 4B2CA 1A0JA 1G2LA 2ZP0H 4I7YH 1O2RA 2G8TA 3E6PH 3RXIA 2ZQ1A 4GAWA 4JK6A 4A6LA 3ZVFA 4OS5A 1F92A 1SL3A 4YM9A 1N1LA 3LONA 3GY7A 3QZRA 2A4RA 3E1XB 2R0LA 1FN6A 1HAIH 1O3AA 2BLVA 1WTHD 2VNTA 2H9TH 1Y5BT 4ISOA 5HXFA 2AGEX 5DPAA 3HK3B 2P3UB 3U1IB 3PTBA 3BTTE 3VB7A 1VGCB 1J15A 4UEHH 1K9OE 1FY4A 3EE0B 3RXHA 2VGCB 3S0NA 2HGTH 3VB6A 1FPHH 1N6YA 1DWBH 4X1SU 1V2MT 1V6DA 4X2YA 1QJ1B 3QWCH 5HM9A 5J4SA 5J4QA 3K2UA 2RCEA 1VJAU 2FODA 2QIQA 1EB2A 1V2UT 3FP8E 3LGVA 1RTKA 3E8LA 4KTSA 2EEKA 6GCHF 1INCA 3UOPA 3E91A 3A7XA 3TK5A 1TA6A 1V2LT 3S7KB 1TBQH 4KKDA 5EPNA 2V3HH 3KEEA 1TRNA 3UWJH 2AEIH 5FPTA 3KF2A 1GHZA 3NPSA 4X8TH 2OTVA 1BIOA 1ELBA 3RM0H 3A8AA 3L6PA 4MDSA 5DP5A 1UVTH 1DX5M 1V2ST 4OS6A 3SV2H 1WCZA 1O3KA 2ZHWH 3OY5U 3RXEA 2VWNA 1HFDA 1GI7B 2PSYA 2IOTA 5TCCA 5ESTE 5FPYA 5CHAC 3ZZ3A 2UWOA 1IQJA 1CBWB 2RA3A 1ZJKA 4O9VA 2BMGB 1NC6A 1LPKB 2ZU5A 5C1UA 3RXRA 4OGXA 2YNBA 1Y8TA 1GJ5H 4JK5A 4DCDA 1Z6JH 1AUTC 1V2VT 1E0FD 2A5AA 2BLWA 5L30H 2VWOA 4NA8A 1FZZA 2ZFFH 4ABJA 3QDZB 7GCHG 5CHAB 1P2IA 4IMZA 4YLUA 2FLRH 4IW4E 4OS4A 1PJPA 2ZQ2A 1FXYA 1AZ8A 1EJAA 1YCPK 4Y76A 2W7SA 1V2RT 4LK4A 1MTSA 4E05H 2ZG0H 1DVAH 1N8OC 4AN7A 2Z9KA 1ELEE 2GMTB 3RDZA 1OWHA 3SU3A 3BN9A 3E90B 3F6UH 1SFQB 4A1VA 3A7YA 1TAWA 1WQSA 5F03A 1MQ5A 2ODYB 1ZPZA 1QA0A 3FVFB 3MU1A 4Y0YE 2W26A 1EAWA 3MH5A 3F68H 1UHBA 5GDSH 3SJ8A 2ZF0H 5FAHA 1N8OB 3F9GA 3MNBA 6CHAC 3BF6H 1FUJA 4HI3A 2ZGCA 2AIQA 1QCPA 1BRUP 4ZMAH 3TK9A 2SGDE 4AB9A 3T29A 5A0CA 1HB0B 1P04A 1EJNA 3DT0H 3KQEA 4FXGH 3RXSA 1HAVA 1W11U 1GBMA 1LKAA 1AWHB 1LQEA 1ORFA 1P9SA 6CHAB 1QBOA 2SFAA 1C5RA 4X2VA 1OP2A 3BEUA 4JYVH 1Z1JA 1CA0B 4AFUA 2ZDKA 1DOJA 1QURH 2ZU3A 2OCVB 1QB9A 5A09A 2P8OC 1O3JA 3OSYA 1A46H 1ARBA 3U8TH 1ZYOA 1ZTLA 1C2EA 1UJ1A 2R2MB 1V2KT 1IAUA 3R0FA 1GBJA 1C5NH 3A8DA 3SJKA 3ZZDA 2ZDNA 3MWIU 3AAUA 4F49A 1D3DB 2VB0A 2BLOA 2HNTC 1KXCA 1C9PA 3TGKE 2Z9GA 1E38B 3TITA 1Y5UT 1NM6A 1KXEA 1XKBC 1NU9A 2AMDA 3ODFA 1UK2A 1MKWK 1UCYK 2F3CE 1EASA 3SQEE 3TH3H 3UR9A 1UHBB 1ABJH 1TPAE 3E0NB 4XBBA 1HDTH 1C1QA 2UWPA 1QBVH 2PSXA 3PMJA 1DUAA 3EA9A 1O3GA 1BTYA 3NXPA 2GV7A 3GCOA 3QLPH 1VZQH 1TPPA 1GHVH 1O3NA 2XNIA 5E0JA 1C1PA 3SJOA 1SGEE 5ETXA 4CRGA 1SLXB 2BD2A 3RXBA 1IQKA 4X1QU 4GVUA 4Y8ZA 3RXKA 1Z8RA 1MKXK 3LGTA 3FFGA 2D26C 1SGCA 1ELFA 1TGSZ 1ZZZA 2Z6BD 2FP7B 1S81A 1XM1A 1OOKB 2JETC 3FZDA 1P2QA 4XFQA 2CHAC 2QCYA 2VH6A 2ANMH 1UVOA 1HJ8A 1GHAG 2PV9B 1NFXA 4CR9A 1GHBF 3KN2A 5FCRA 4JCNA 4O3UA 1O2JA 1O5EH 3UFAA 3EAJA 1MH0A 3MH6A 3MFJA 1L4DA 5LPRA 1G9IE 1GG6B 1JIMA 5HMAA 2BDCA 1QL9A 3VEQB 2OC1A 1SI5H 2F83A 2Z3EA 2K1QA 3A87A 1Z71A 1O3DA 1TNLA 5DKMA 1GBHA 1MBMA 1NPMA 2P95A 1XUGA 3EA7A 1C2MA 2GZ9A 1V2NT 4K8BA 3VXFH 3GY8A 2QY0B 4JYTA 2XBVA 1LVMA 2JH0D 1EOLA 1HJ9A 1P3EA 4MNWA 4NA9H 3SU0A 5B6OA 3UTUH 3RXGA 1A3BH 3ZVAA 5E0GA 5DP3A 2I6QA 3LPRA 4OS1A 1KLJH 3GCTG 2J92A 2AFQB 1GI2A 1BMMH 3QO6A 4MPUA 2OUAA 3ZZBA 1O36A 5C67A 4CRDA 1JIRA 2F9UA 2J38A 1TNKA 1WBGB 1ZPCA 1UTMA 3SNBA 4UONA 4NIVA 1YPKH 5TJXA 1Z7KA 3P8FA 2FLBH 1ELCA 1G2MA 3UQOA 2P93A 3LH3A 1DSUA 1V3XA 1YPGH 2CXVA 3SHAH 2ZFRH 3TPIZ 5IDKA 1OP8A 1QQ4A 2FX6A 3AW1A 3MU4A 5E0HA 1Y59T 5JYIA 4NCYA 1G3BA 2ZECA 1C2IA 1MD7A 1A5HA 1O2IA 3PTNA 1FNIA 3GDUA 4Y8XA 1O3OA 4JYUH 4UFEH 2EA3A 3SW2B 3ZZ6A 5EG4A 1AHTH 1A5GH 4A1TA 4YLQH 1O5AB 3BG8A 1HAXB 1C1MA 1PFXC 1BTHH 2WV4A 3CP7A 1RTLA 2F9NA 2I6SA 1QFKH 5GIBA 5JBBS 2ZCHP 4Z6AH 1G37A 4Y0ZE 1W7XH 1LPGB 1KYNA 1AIXH 1Y3VA 4DOQA 1VCQA 2XBWA 2QF0A 2THFB 5CMXH 2Y6TA 3ZVEA 3PLPA 2QXGA 2JH6D 1O2UA 1MZDA 3AVZA 1O3LA 4GHQA 1LHDH 2FOMB 3HPTB 2A31A 3GY5A 1PYTC 1IOEA 2XYAA 1WUNH 5F8XA 3U8OH 1W10U 3Q3YA 5EW2H 4U01A 1XUKA 2ZGHA 3MU8A 5G4BA 4B71A 4GCHG 1AO5A 1QRXA 2BDAA 5LGOA 2P59A 3TJUA 4ZKSU 1EOJA 2XC0A 8GCHF 4BNRA 1FN8A 2A7JA 3SGBE 4CRBA 1VITG 1FDPA 2HVXA 1YPHE 4Z0KA 1GHXH 2D1JA 1C2DA 1ZLRA 1NY22 3RMMH 1A1RA 2BX4A 4K3JA 3RC4A 3GY4A 3PM3A 5T3HA 3LC5A 2STBE 1F0UA 1GL0E 3FP7E 1LHGH 1UTPA 4CRCA 1K22H 3B23B 5A8XA 1NO9H 2W3KA 3RXJA 3M5MA 1C1UH 4I32A 1QR3E 3TJNA 2ZPQA 1O3BA 1S6HA 1SGNE 3M3SA 4MNYA 1YPJH 2OINA 2VIPA 4CRFA 2Z3CA 3A89A 3NCLA 2UUYA 3QGNB 1D4PB 1GBCA 1XUIA 3UR6A 4AFZA 2PGQB 1NRRH 1NFYA 1U6QA 1GBKA 2GCTB 4K5ZA 2ZU4A 1UCYE 4O97A 2G51A 1QGFA 2BD4A 1C9TA 4AG2A 1PYTD 1W0YH 3SQHE 4FU7A 3Q3KA 1SG8B 2Z9JA 1Z8JB 1BRBE 3KL6A 3ELAH 4LOYH 3C27B 3RLWH 1CGJE 2VVUA 2TIOA 2SGQE 1NS3A 1PQ5A 3GY3A 2ESTE 2WINI 3GYLB 1BBRK 2WUBA 5T6DA 1IQFA 1DWCH 3MU5A 5DK1A 5EW1H 1HIAA 1TNHA 3K6ZA 4TPYA 1FQ3A 2XXLA 1CE5A 1WTGH 4WH8A 1O3FA 1T7CA 5ESBA 1FAXA 1BCUH 2SGEE 1SOTA 1O2XA 1CGHA 1EP5A 3A80A 1TNGA 1P3CA 4ZHMU 2ZGJA 1ZHRA 1A3EH 3GY2A 3ZVCA 1CU1A 5T6GA 1Z8GA 3SGAE 1EPTB 1H9HE 4TY7A 4LZ1H 1C2JA 4Q7YA 4FUIA 2GDDA 2WPIS 1GVZA 2FOHA 1LQDB 2DUCA 3W95A 2WPHS 3MNSA 4AZ2B 2BD7A 2ANKH 4U2WA 4ISLA 5T6FA 2UUFB 3KQCA 2GVFA 2W7UA 3VB4A 9ESTA 3F9EA 3BTQE 1O3HA 3RXDA 3NWUA 2EI6A 4BXWA 4GLYA 1EJMA 3A84A 4B2AA 1KTTB 2HWLB 1DSTA 1UO6A 1SC8U 3U9AH 5JPMH 1BHXB 3GCHC 3IWMA 2C4FH 2GP9B 3SHCH 1AQ7A 3DA9B 2BXUH 1D3PB 3M5LA 1PPHE 5EQRA 1PPBH 2ZHQH 1JXPA 1IHTH 4AFSA 1GJ9B 1TMUH 4X0WU 9LPRA 1OSSA 2OQ5A 5JBAS 4X6NA 2Z9IA 2F9BH 1HAYB 2FI4E 5GWZA 1O2WA 1O2TA 3ATLA 1XMNB 1G3EA 4ABHA 1GI3A 3PMBB 4E06H 2ANWA 1TRYA 1QJ6B 1MD8A 1VGCC 4CHAC 2VWLA 1MMJN 4U30A 1T32A 2C8ZB 2VGCC 3A8BA 2AMPA 1SHHB 1LCYA 4RKJB 2M5TA 2O8TA 1K1NA 3A7VA 1WYKA 1UCYH 1SGTA 4CHAB 2WYJA 2B0FA 1UK4A 2ZGXH 1BJUA 2FI5E 2ZU2A 1AB9B 3SV7A 1F0SA 2FM2A 2Y7XA 1LHCH 7KMEH 4ZXYH 4UFDH 1CHOG 3RU4D 2QN5T 3MO3A 4ABDA 1RS0A 1XX9A 4BXSA 5EXLA 3RP2A 2ZDMA 1YCPM 3BTFE 1KDQB 2ASUB 3HKIB 4OS2A 4X6MA 4WJG2 1TX6A 1AN1E 1UVPA 2GZ7A 3S7HB 1MKXH 4JZEH 4A1XA 4DT7B 4U32A 3Q00A 1P8VC 5GCHG 1SQOA 1O3MA 2P3FH 2XC4A 4ZAEA 1AZZA 2C8YB 2GDEH 4FUHA 1YKTA 2GCHG 4DG4A 3UREA 1TNJA 1DWDH 2QAAA 2PFEA 1EB1H 1CBWC 2H2ZA 1SVPA 4JMYA 4MVNA 4WH6A 5C20A 1JRTA 2PKAA 1EKBB 3KGPA 1BMLA 2ZHEH 5K7RA 2D2DA 1HAGE 4UE7H 1SQAA 1YP9A 4BTIB 1C2KA 2AS9A 3TJVA 1C2GA 3SI4H 2G4TA 1SFIA 3A8CA 3M7QA 1O2MA 2GV6A 4FUDA 4AGKA 5LPEA 1P05A 4IN2A 2BYAX 2OD3B 3RUOA 4DW2U 2BDHA 3RXAA 1ZSKA 1TMBH 4FVBA 4Y7AA 4BTUB 1CHGA 1SQTA 2SGFE 3SBKA 1F0TA 2GMTC 5C2ZA 1EAXA 2B8OH 3FAOA 5JDUB 1GDNA 1DY8A 2F9OA 4Q7ZA 5PTPA 2J34A 2Y82A 1O2NA 2G55A 1O5DH 1GI4A 2D8WA 1XKAC 3D23A 3TLOA 2FOEA 4FU9A 1O34A 1H9LB 1Y3UA 3GICB 4Y71A 1GBEA 5IYTA 1TWXB 1QRWA 5DP6A 1Y5AT 1O2YA 1HBTH 2V0BA 1B0FA 3E16B 1P0SH 3ODDA 3LOXA 3U69H 2FYQA 1ZHMA 3K6YA 2Q6DA 3T5FH 1BB0B 3K65B 4D9RA 2ZO3H 2J94A 2O8MA 2PKAB 2A5IA 1J17T 2V3OH 3ZV8A 1BTZA 3HK6B 3F1SB 4RKOB 1C5VA 2QA9E 2SGAA 1Q31A 2BD5A 1SGQE 1FY8E 3L33A 4INKA 3MNCA 2XTTB 1W0ZU 2WPMS 4D7GA 1O2PA 1C5XB 2BY6X 1GBFA 2VVVA 2KAIA 3QX5H 2Q6GA 2Y7ZA 1LHFH 3EYDA 5A8YA 6LPRA 1SGFG 3SORA 2BOKA 1AE5A 1C5ZB 1CA0C 4DGJA 1ARCA 1BMAA 4BAQB 3ZZ7A 5FX6A 1O2LA 1H8IH 2PLXA 3AASA 1O37A 1LVOA 4KP0A 1P10A 1S82A 1RIWB 3ZV9A 2AGGX 5FPSA 4I31A 2BQWB 1THPB 4SGBE 3T25A 1GMDG 1HXFH 3BEFB 3GOVB 3RU4E 4AORA 3PROA 1O39A 4YZUA 1O3PB 1OXGA 2Q1JA 1ZJDA 3A86A 1DLKB 1ZRBA 1SR5C 1Q2WA 1AKSA 2NU0E 1EAIA 1ZHPA 3ATWA 4THNH 4GPGA 5L2ZH 1EZXC 3BIUH 1YPHC 1FY5A 3UUZA 4YO9A 1GDUA 1TMTH 1OP0A 1SSXA 3V12A 1CGIE 6GCHG 1O2QA 5AVDA 4GUXA 2WPLS 1S83A 5C1YA 4CH8B 2FTMA 1Z8IB 2SNWA 1O2OA 2G5NA 3SUFA 1AMHA 3EGKH 3RMLH 1P02A 1S85A 1J9CH 2ZFSA 4KTCA 3TU7H 1QB6A 3PWCA 2PW8H 1MU8B 2KAIB 1FIZA 3HATH 3UIRA 1GGDB 2A4QA 4O3TA 4TPIZ 3V7TA 5EXMA 4KGAA 2NU4E 4D7FA 3LGYA 3UQVA 1OX1A 2BM2A 2A32A 2BHGA 2VJ1A 1ACBE 5EODA 1ELTA 1GCTB 1C1OA 3B8JA 1GJAB 1HAVB 1D6WA 2R9PA 1CT2E 4ISHH 4NSYA 1GVLA 3VB3A 5FCKA 3NUMA 4K1SA 1GJCB 2FMJA 3MI4A 1J14A 4I8JA 3SJ9A 4YTAA 1HRTH 4BANB 1F0RA 1P57B 2FYRA 2J2UA 4FUGA 1GG6C 1OPHB 3D49H 3BTEE 4D76A 1T31A 3ZZ9A 4BTTB 1PPCE 1H8DH 1BHXF 4FVDA 4I8HA 1FLEE 1CVWH 1GBDA 1MCVA 1AKSB 3RXTA 1VITF 8KME2 2XBYA 5F8ZA 1NRNH 2BD9A 3H7OA 1GVKB 1TRMA 2F9VA 1XVMA 3QK1A 1K2I1 3VFEA 3ZZAA 3O8BA 4IS5A 3URDA 1MU6B 3UOUA 1CA8B 7LPRA 4Q2KA 2PR3A 3M5NA 1KTSB 1V2QT 1ZR0A 4X1RU 3SU5A 4ISIH 1LVBA 2QXJA 2Y5HA 5F6MA 1BTUA 3I78A 1TABE 1SBWA 1DWEH 1A0LA 1J16A 1VITH 4WMEA 1BDAA 4XOJA 2Z7FE 1AGJA 4TWWA 4JZFH 1MBQA 1O3IA 1F5LA 2FZZA 3LGIA 3SUDA 1ANBA 1TFXA 1WAYB 1EATA 1OWKA 1NRPH 5AFZH 2Z9LA 4NSVA 3E3TA 1ANCA 4I8GA 3C1KA 2AMQA 2GT8A 1OWEA 3F9FA 1OYQA 1LO6A 2J95A 2V35A 3OY6U 1ANDA 3LGUA 5EPYA 3V0XA 4NZLA 4BOHA 1FPCH 2C8XB 1THSH 1L1NA 1ESTA 4OS7A 2B5TB 2OQUA 2VH0A 3ATIA 7ESTE 4JZIA 3RC5A 3D65E 2R0KA 3ZZCA 4X8UH 2CF9H 1P09A 2FWWA 1PPZA 5TCAA 3BTGE 2OC8A 4WMDA 1WU1A 2V6NA 1YM0A 3RMNH 3LJOA 1F5RA 2SGPE 1FY3A 4FUEA 4R8TB 2J4IA 2ZHDA 2ZWLH 2VIDA 2BDIA 3GDVA 1TYNA 3MU0A 1EP6A 3RXVA 3QUMP 4MTBA 2ZHFH 2AH4X 1GMCF 4BAHB 2ODPA 3T62A 3MYWA 1O5CB 1MAYA 2ZKSA 3M61U 3MH7A 5DG6A 3V13A 4AB8A 2BDGA 1T8NA 1UVUH 1K1PA 1GMHG 1TE0A 1RD3B 2GX4A 1BTPA 3TK6A 3BTHE 1SGIB 1KSNA 4ZH8A 5L2YH 1BRAA 1AI8H 4H6SB 1YLDA 2BQ6B 4NGAH 2HRVA 1A7SA 4ZHAA 1F2SE 3RU4T 2OP9A 1O2GH 2LNCA 2Y5FA 5EXNA 3LC3A 3SNDA 1C5TA 3Q77A 1W7GH 2OXSA 4MPVA 2QC2A 5C5OA 2HALA 4F4OC 5F8TA 1SOZA 5E8EH 2P94A 4XSKU 1CSOE 3MMGA 5GJ4B 4IMQA 3EDXB 3KQBA 5LH8A 1BQYA 2BVRH 2GCTC 3N7OA 4M7GA 5AHGH 1LHEH 1TIOA 3LDXH 4FU8A 2R2WU 1LKBA 3A85A 3DFLA 4Y7BA 1ZMJA 1DFPA 3KQDA 1QL7A 3TVJB 4TY6A 5FHTA 1GHBG 2PKSB 1C5OH 3UWIA 2OBOA 4RN6A 1DM4B 1MTNC 1PPGE 1V2JT 4SGAE 2ZFTA 1OWDA 1HV7A 1TX7A 2BY5X 2IJOB 2A5KA 3FANA 3TH4H 1TBRH 1E36B 2GKVE 2PGBB 3LGWA 3Q3XA 2YOLA 3SV9A 1O32A 3P8OA 2BVSH 3IG6B 3STIA 2BB4A 2XRCA 1DUEA 1MAXA 1MTNB 1UTLM 2ALVA 4ABAA 3BG4B 4CREA 3TGIE 1A5IA 3SU4A 2FEQH 4E7NA 2OLGA 3NK8A 2VIWA 1UTQA 1OYTH 5DP8A 2HLCA 2BDBA 2P3TB 1P2JA 3MO9A 4MNVA 1QA7A 4HGCA 1EPTC 3ZZ4A 1E37B 1HAZB 2VIOA 3SV8A 4HFPB 1P2OA 4K8YA 3RXCA 1O38A 1SLUB 4I8LA 3RC6A 2A7CA 1AVWA 2UUKB 4ASHA 2ZTZA 2XW9A 3OU0A 3A83A 1FAKH 3TNSA 3TGJE 1DANH 1C1VH 3Q76A 4ZROA 3WY8A 2GCHF 1QHRB 1YCPH 1K1IA 1ZMLA 3GY6A 5E2OA 1WV7H 2PTCE 1RJXB 5EOKA 1V2WT 4X6OA 1QBNA 4YT6H 1RGQA 1ZGVA 1AFQB 1KXBA 2GTBA 1C5YB 1ZGIA 2BLQA 2TRMA 2VIVA 4KTUA 1QRZA 3OX7U 3KCGH 4ABEA 8LPRA 1EZQA 1S0RA 1YF4A 1GCDA 3M35A 3SU6A 1K21H 3S69A 5C1XA 2SNVA 1HJAB 2W3IA 1RXPA 4UFFH 1GI1A 2BY7X 4A5TS 1CQQA 3M36A 4DY7B 4NFEA 1ETRH 1QIXB 1NRQH 1SPJA 4B75A 4B73A 1RTFB 3UNRA 1HXEH 3MO6A 7GCHF 1CT0E 1HIAB 1C1TA 1ELAA 2QXIA 5JBTA 5DP9A 2ZEBA 3P8NA 2BY9X 3NKKA 4XDEA 1YYY1 1T8LA 1VCPA 1Q3XA 1JMOH 1W13U 3P6ZB 1BMNH 2GZ8A 1O2HA 2VVCA 1EUFA 1ELDE 3AW0A 2ZZUH 2ZGBH 8GCHG 2FDAA 3SJIA 1PQ8A 3VGCB 1HLTH 3U8RH 2YNAA 3M3VA 4BAMB 2WPKS 3R3GB 4ZKRU 4A7IB 3EA8A 1DXWA 1ZSJA 3SO3A 4CRAA 1K1LA 1BA8B 2G81E 1XXFA 2OC7A 2H5CA 4VGCB 4XE4A 4AYVB 3PLKA 4MPXA 1HUTH 1S6FA 1SGRE 1DS2E 4Y10E 3T26A 1D9IA 4X1PU 1AB9C 1ID5H 4I8KA 5CE1A 4OGYA 2A4GA 2QGRA 1C1RA 2STAE 1SB1H 2ZFPH 2AGIX 4ZKNU 2PHBA 2O8WA 1GJ8B 1S0QA 5ABWA 1MKWH 1GBAA 1P11E 2R3UA 3KIDU 4NG9H 4QT8C 1DE7H 3VB5A 1C5UA 1L4ZA 4LXBH 1O5GH 2VU8E 2ZTXA 4B76A 3S9AA 2F9PA 1C1WH 1UK3A 1TBZH 1W8BH 3L3TA 1VR1H 4BAOB 4Y6DA 5BPEA 2XCFA 1GMDF 1NRSH 2BDYA 3ITIA 2C90B 3SUEA 1FV9A 3G01A 1A4WH 4JZDH 1TALA 3HGPA 2R3YA 1YC0A 1IQLA 3NZIA 1QQUA 8ESTE 3RMOH 1G3CA 1TA2A 3RXFA 1KLTA 1NU7B 4WXIA 4YESB 3GISB 3F9HA 3SU2A 2H5DA 2QXHA 2OBQA 1MCTA 3FP6E 1HNEE 1UVSH 2EC9H 1WSSH 1G36A 3HGNA 5EQSA 4WY3A 1GI6A 2H9HA 4AX9H 4FUCA 2NU2E 1DDJA 3MNXA 1HYLA 1GJ7B 2ULLA 3P95A 3A88A 3MOCA 2GT7A 3BIVH 3B9FH 3A82A 4R0IA 2J9NA 1CO7E 1H9IE 4UFGH 3A7ZA 3SOSA 1O5FH 3KNXA 3P17H 2EI7A 1FJSA 3SU1A 1GBBA 1GDQA 3CENA 1AWFH 1ZMNA 2W5EA 3U1JB 2ALPA 3SNEA 1GI9B 1GWAA 1YLCA 1A0HB 3PMHB 2TGTA 2JH5D 3O8DA 3SI3H 1AU8A 2FS9A 4B2BA 1O30A 1JRSA 1P06A 4NIWA 1OS8A 1BBRE 3O8RA 1ESAA 1QTFA 1GBIA 2NU3E 1W2KH 3H7TA 3HKJB 1GHAF 2A0QB 3KHVA 2ZNKH 3JZ1B 4ABBA 4J2YB 4I33A 1P2MA 1IQGA 2RA0A 1JWTA 5FBIA 1DICA 1DT2A 4WMFA 3GDSA 2C3SA 2PUQH 2TGPZ 2Z3DA 2XWAA 1BUIA 1DLEA 1QNJA 4ZXXH 3QTOH 1T4UH 1JBUH 1RIWC 4WXVA 1UTNA 1ELVA 1GBTA 4DIIH 1Y3YA 2XWBI 4ABIA 2RDLA 1BTXA 1H4WA 2BQ7B 2O9QA 2FS8A 3P8GA 3ZZ5A 1LPZB 2CN0H 4WVPE 3M3TA 3GCTF 4XBCA 1G30B 4DIHH 1C5WB 1ELGA 4FUBA 5BRRE 4INHA 3LH1A 3I29A 4ZKOU 2FOBA 4NWLA 5C5NA 1AVXA 4B1TA 3SV6A 4FUJA 2ILNA 4MPWA 4IC6A 2WYGA 2GD4B 1FI8A 1M9UA 1IHSH 2QV1A 3VXEH 2BTCE 2H1UA 2WUCA 1P03A 4MG3A 1IQHA 1DXPA 3BSQA 3DUXH 3ZVDA 4ESTE 1C5SA 2Y5GA 5HYOA 4CBNA 1GGDC 1SGYE 2O8UA 5K0HA 1XXDA 2A7HA 2ZU1A 1EZUC 1V2OT 1UTKA 5L6NH 1LTOA 1C1SA 1GPZA 1SGDE 2CMYA 1CT4E 3M7UA 4CBOA 5FXLA 1FIWA 2ZDAH 3STJA 5HM2A 2A2XH 5JB8S 2UUJB 1GCTC 4H6TA 1HAOH 1KY9A 3GCNA 1LMWB 1ABIH 2ANYA 1SGFA 3UY9A 1B0EA 1UTJA 3RXQA 4HTCH 4Y79A 3T2NA 2B9LA 2DE8A 1P12E 2PWXA 1YGCH 5H4IB 1DITH 1PPFE 1ANEA 1YPLH 2ZPSA 1BOQA 5DP4A 3RXLA 3MH4A 2BY8X 2ZC9H 2P8OB 4X8SH 3EQ0H 2C8WB 2G4UA 1GMHF 1Z6EA 2ZPRA 2XC5A 2PTNA 1NFUA 2JKHA 1O2ZA 3JZ2B 4BAKB 1F7ZA 2ZDLA 4GCHF 1YPMH 3QGJA 5HGGA 3ZVBA 4Q80A 1XUFA 2FO9A 1C2FA 1GJ6A 1C5PA 1OWJA 1ZSLA 2BD8A 2FTLE 3RM2H 5FBEA 5FX5A 3A81A 4CR5A 4IC5A 1P01A 1BBRH 2QYIA 2BOHB 4X6PA 3CS7A 2VIQA 4K60A 5DO4H 2AYWA 2IN2A 2HPQH 1RFNA 2BD3A 4ABGA 1O3EA 4H42U 2ZI2H 2G52A 1L1GA 2ZA5A 3H5CB 4NWKA 1AD8H 1G3DA 2FIRH 1NZQH 2PUXB 4NIXA 5DJ7A 3SNCA 2FXRA 4ISNA 4WWYA 3BTKE 1P2KA 5A0BA 1C2LA 2CJIA 1TOCB 2BZ6H 4IN1A 1O0DH 1BITA 2CV3A 1MQ6A 2UWLA 1W14U 3CS0A 1GHYH 4NIYA 5EGMA 2JETB 3A7TA 1AE8H 1ZOMA 4ZUHA 3IITA 2CHAB 3P92A 2O8LA 4Y8YA 1K1MA 1MZAA 2HOBA 2TPIZ 1DPOA 3LJJA 4XBDA 4NFFA 3BEIB 1MTVA 1TGNA 4X2XA 1IQEA 4MQAA 1BT7A 3TH2H 1W12U 3GYMA 2Y81A 4H4FA 1EAUA 3V3MA 1O2SA 1TX8A 2VWMA 2BXTH 2NWNA 3UPEA 1LDTT 4K1TA 1HPGA 1O3CA 1FY1A 5A8ZA 1K1OA 1NTPA 1TB6H 1GJDB 3M7TA 3UNSA 1NROH 1GBLA 3ATMA 4MLFB 3QN7A 5I46H 3QZQA 2C93B 1O35A 2LPRA 1EXFA 3W94A 1MTUA 2ZCLP 3ZZ8A 1KXAA 1HCGA 4MNXA 5E2PA 4Q7XA 1EQ9A 1OKXA 2IPHA 1GJBB 1NT1A 3TIUA 1O33A 1ZTJA 1YBWA 2QF3A 1L0ZA 1FONA 1XUJA 2XCNA 4YOIA 3OTJE 3S9BA 1C5MD 1GL1A 1O2VA 1ETTH 1EX3A 1KXFA 2FI3E 4E7RG 2H9EH 4X2WA 4YT7H 4AYYB 2EI8A 1C4U2 1B5GH 4LZ4B 1A2CH 1H1BA 1GI0A 4NA7A 5A0AE 3SN8A 2FESH 1ETSH 1GHWH 1GI5A 3ZVGA 4B74A 1P2NA 1TGCA 1K1JA 1D3QB 4O03A 4HZHA 2WV5A 1XVOA 3BTME 3RLYH 1OWIA 3S9CA 2Q6FA 1GI8B 2VINA 4UDWH 3SNAA 3E0PB 1QY6A 3TJOA 2PKSC 1V2PT 3M5OA 5I25A 3PB1E 2GGVB 1WOFA 1TONA 1IQNA 4D9QA 1T4VH 1ESBA 1MUEB 1O2KA 5JBCS 4DURA 3SZNA 3A7WA 1HAPH 2WPJS 1SGPE 3SUGA 3ZYDA 4AFQA 3URCA 5SGAE 3PO1C 1AY6H 1X7AC 2HNTE 1HAHH 3MTYA 1BJVA 1Z1IA 2AERH 4INLA 1IQMA 3BG4C 1F5KU 2TGDA 2NU1E 3U98H 2A4OA 1VJ9U 1HGTH 4IBLH 2H6MA 1C1NA 1P9UA 1EPTA 1O31A 1XUHA 3LT3A 1KLIH 2AIPA 3RXUA 1K28D 3PO1B 1DY9A 3RXOA 1B7XB 4PROA 2F91A 1SLVB 1RRKA 2BZAA 5AF9H 1EZSC 5JB9S 6ESTA 3UNQA 1NFWA 5A2MH 1SLWB 2FOAA 5DGJA 2A2QH 2TBSA 3OYPA 1CHOF 4KELA 1E34B 1C4V2 1S84A 4TYDA 3T28A 4ABFA 2BVXH 1E35B 1TOMH 4YOGA 1BZXE 3LKWA 1AFEH 3MHWU 5GPIB 1N6XA 1QB1A 3PWBA 1AVGH 1J8AA 1QJ7B 1Y3WA 5AFYH 1AFQC 2RG3A 5GCHF 1PQ7A 1JOUB 2Z94A 3VPKA 1SHYA 4UD9H 2BX3A 2FOFA 1NN6A 1IQIA 1C5QA 3BV9B 1C2HA 2ZFQH 4JZ1A 1TQ0B 1G32B 1VCWA 3D62A 4AG1A 3ZYEA 4NZQA 1HJAC 2ODQA 4GSOA 5GXPA 2Y80A 4X8VH 1D6RA 1PPEE 1O5BB 1BRCE 4DJZB 4A92A 4WF8A 1KXDA 1D3TB 2ZTYA 3K9XB 1ZTKA 4ZHLU 1Y3XA 2FX4A 1LVYA 3ATKA 5EQQA 1TNIA 3I77A 4DVAU 1W3CA 3BTDE 4K69A 1V2TT 1SMFE 4K2YA 4D8NA 2G00A 2A1DB 3PMAB 4K1EA 4FUFA 2A45B 1A61H 5EU8A 3DFJA 1L2EA 3RXPA 3DHKH 1L1JA 1WQVH 2CF8H 1TGBA 1GMCG 1S5SA 3P70B 4IGDA 3ESTA
chains in the Genus database with same CATH superfamily
1MTWA 3LIWA 1TPOA 3CNRA 4AGJA 1NESE 2HPPH 3VGCC 1THRH 3ENSB 1KIGH 3QTVH 4GHTA 5C3NA 1T8OA 3SGQE 3TNTA 2FOGA 1UTOA 4J1YA 2ZDVH 2ZCKP 1ZPBA 3RXMA 2HNTF 4Y11E 1QL8A 2DE9A 1COWD 4VGCC 1TPSA 3T27A 4RSPA 2FPZA 1TGTA 2FOCA 1PQAA 1T8MA 5DP7A 1C5LH 1GJ4H 2TGAA 3DD2H 2XBXA 2OC0A 1OHHD 2CGAA 1ZRKA 4AOQA 3FZZA 2ZIQH 2V7QD 3PRDA 1BTWA 3PV4A 1UMAH 4YOJA 3O8CA 3PYHA 4TWYA 1KDQA 3PLBA 3M37A 3BTWE 3LU9B 1AUJA 3AAVA 5LPFA 1FMGA 1C4Y2 1TLDA 2P16A 2G5VA 4CH2B 1TQ7B 2B7DH 3GCHB 1YPEH 4X1NU 4B2CA 1A0JA 1G2LA 2ZP0H 4I7YH 1O2RA 3WW7A 1NBME 2G8TA 3E6PH 3RXIA 2ZQ1A 4GAWA 4JK6A 4A6LA 3ZVFA 4OS5A 1F92A 1SL3A 4YM9A 1N1LA 3LONA 3GY7A 3QZRA 2YMSB 2A4RA 3E1XB 2R0LA 1FN6A 1HAIH 1SQRA 1O3AA 2BLVA 1WTHD 2VNTA 2XNDD 2H9TH 1Y5BT 4ISOA 5HXFA 2AGEX 5DPAA 3HK3B 2P3UB 1YWUA 3PTBA 3U1IB 3BTTE 3VB7A 1VGCB 1J15A 2KFWA 4UEHH 1K9OE 1FY4A 3EE0B 3RXHA 2VGCB 3S0NA 2HGTH 3VB6A 1FPHH 1N6YA 2EQNA 1DWBH 4X1SU 1V2MT 1V6DA 4X2YA 1QJ1B 3QWCH 5HM9A 5J4SA 2YMSD 5J4QA 3K2UA 2RCEA 1VJAU 2FODA 2QIQA 1EB2A 1V2UT 3FP8E 3LGVA 1RTKA 3E8LA 4KTSA 2EEKA 6GCHF 1INCA 3UOPA 3E91A 3A7XA 3TK5A 1TA6A 1V2LT 3S7KB 1TBQH 4KKDA 5EPNA 2V3HH 3KEEA 1TRNA 3UWJH 2AEIH 5FPTA 3KF2A 1GHZA 3NPSA 4X8TH 2OTVA 1BIOA 1ELBA 3RM0H 3A8AA 3L6PA 4MDSA 5DP5A 1UVTH 1DX5M 1V2ST 4OS6A 3SV2H 5C17A 1WCZA 1O3KA 2ZHWH 3OY5U 3RXEA 2VWNA 1HFDA 1GI7B 2PSYA 2IOTA 5TCCA 2F43B 5ESTE 5FPYA 5CHAC 3ZZ3A 2UWOA 1IQJA 1CBWB 2RA3A 1ZJKA 4O9VA 2BMGB 1NC6A 1LPKB 2ZU5A 5C1UA 3RXRA 4OGXA 2YNBA 1Y8TA 1GJ5H 4JK5A 4DCDA 1Z6JH 1AUTC 1V2VT 1E0FD 2A5AA 2BLWA 5L30H 2VWOA 4NA8A 1FZZA 2ZFFH 4ABJA 3QDZB 7GCHG 5CHAB 1P2IA 4IMZA 4YLUA 2FLRH 4IW4E 4OS4A 1PJPA 2ZQ2A 1FXYA 1AZ8A 1EJAA 1YCPK 4Y76A 2W7SA 1V2RT 4LK4A 1MTSA 4E05H 5EIYA 2ZG0H 1DVAH 1N8OC 4AN7A 2Z9KA 1ELEE 2GMTB 3RDZA 1OWHA 3SU3A 3BN9A 3E90B 3F6UH 1SFQB 4A1VA 3A7YA 1TAWA 1WQSA 5F03A 1MQ5A 2ODYB 1ZPZA 1QA0A 3FVFB 3MU1A 4Y0YE 2W26A 1EAWA 3MH5A 3F68H 1UHBA 5GDSH 3SJ8A 2ZF0H 5FAHA 1N8OB 4Z1MD 3F9GA 3MNBA 6CHAC 3BF6H 1FUJA 4HI3A 2ZGCA 2AIQA 1QCPA 3VG8A 1BRUP 4ZMAH 3TK9A 2SGDE 4AB9A 3T29A 5A0CA 1HB0B 1P04A 1EJNA 3DT0H 3KQEA 4FXGH 3RXSA 1HAVA 1W11U 1GBMA 1LKAA 1AWHB 1LQEA 1ORFA 1P9SA 6CHAB 1QBOA 2SFAA 1C5RA 4X2VA 1OP2A 3BEUA 4JYVH 1Z1JA 1CA0B 4AFUA 2ZDKA 1DOJA 1QURH 2ZU3A 2OCVB 1QB9A 5A09A 2P8OC 1O3JA 3OSYA 1A46H 1ARBA 4XRNA 3U8TH 1ZYOA 1ZTLA 1C2EA 1UJ1A 2R2MB 1V2KT 1IAUA 3R0FA 1GBJA 1C5NH 3A8DA 1E1RD 3SJKA 3ZZDA 2ZDNA 3MWIU 3AAUA 4F49A 1D3DB 2VB0A 2BLOA 2HNTC 1KXCA 1C9PA 3TGKE 2Z9GA 1E38B 3TITA 1Y5UT 1NM6A 1KXEA 1XKBC 1NU9A 2AMDA 3ODFA 1UK2A 1MKWK 1UCYK 2F3CE 1EASA 3SQEE 3TH3H 3UR9A 1UHBB 1ABJH 1TPAE 3E0NB 4XBBA 1HDTH 2WZQA 1C1QA 2UWPA 1QBVH 2PSXA 3PMJA 1DUAA 2K8IA 3EA9A 1O3GA 1BTYA 3NXPA 2GV7A 3GCOA 3QLPH 1VZQH 4P00A 1TPPA 1GHVH 1O3NA 2XNIA 5E0JA 1C1PA 3SJOA 1SGEE 5ETXA 4CRGA 3SYJA 1SLXB 2BD2A 3RXBA 1IQKA 4X1QU 4GVUA 4Y8ZA 3RXKA 1Z8RA 1MKXK 3LGTA 3FFGA 2D26C 1SGCA 3H09A 1ELFA 1TGSZ 1ZZZA 2Z6BD 2FP7B 1S81A 1XM1A 1OOKB 2JETC 3PRBA 3FZDA 1P2QA 4XFQA 2CHAC 2QCYA 2VH6A 3OAAD 2ANMH 1UVOA 1HJ8A 1GHAG 2PV9B 1NFXA 4CR9A 1GHBF 3KN2A 5FCRA 4JCNA 4O3UA 1O2JA 1O5EH 3UFAA 3EAJA 1MH0A 3MH6A 3MFJA 1L4DA 5LPRA 1G9IE 3F2GA 1GG6B 1JIMA 5HMAA 2BDCA 1QL9A 3VEQB 2OC1A 1SI5H 2F83A 2Z3EA 2K1QA 3A87A 1Z71A 1O3DA 1TNLA 5DKMA 1GBHA 1MBMA 1NPMA 2P95A 1XUGA 3EA7A 1C2MA 2GZ9A 1V2NT 4K8BA 3VXFH 3GY8A 2QY0B 4JYTA 2XBVA 1LVMA 2JH0D 1EOLA 1HJ9A 1P3EA 4MNWA 4NA9H 3SU0A 5B6OA 3UTUH 3RXGA 1A3BH 3ZVAA 5E0GA 5DP3A 2I6QA 3LPRA 4OS1A 1KLJH 3GCTG 2J92A 2AFQB 1GI2A 5IK2D 1BMMH 3QO6A 4MPUA 2OUAA 3ZZBA 1O36A 5C67A 4CRDA 1JIRA 2F9UA 2J38A 1TNKA 1WBGB 1ZPCA 1UTMA 3SNBA 4UONA 4NIVA 1YPKH 5TJXA 2L6OA 1Z7KA 3P8FA 3WWFA 5DN6D 2FLBH 1ELCA 1G2MA 3UQOA 2P93A 3LH3A 1DSUA 1V3XA 1YPGH 4XD7D 2CXVA 3SHAH 2ZFRH 3TPIZ 5IDKA 1OP8A 1QQ4A 2FX6A 3AW1A 3MU4A 5E0HA 1Y59T 5JYIA 4NCYA 3F0OA 1G3BA 2ZECA 1C2IA 1MD7A 1A5HA 1O2IA 3PTNA 1FNIA 3GDUA 4Y8XA 1O3OA 4JYUH 4UFEH 2EA3A 3SW2B 3ZZ6A 5EG4A 3UB0A 1AHTH 1A5GH 4A1TA 4YLQH 1O5AB 3BG8A 1HAXB 1C1MA 1PFXC 1BTHH 2WV4A 2EY4C 3CP7A 1RTLA 2F9NA 2I6SA 1QFKH 5GIBA 5JBBS 2ZCHP 4Z6AH 1G37A 4Y0ZE 1W7XH 1LPGB 1KYNA 1AIXH 1Y3VA 4DOQA 1VCQA 2XBWA 2QF0A 2THFB 5CMXH 2Y6TA 3ZVEA 3PLPA 2QXGA 2JH6D 1O2UA 1MZDA 3AVZA 1O3LA 4GHQA 1LHDH 2FOMB 3HPTB 2A31A 3GY5A 1PYTC 1IOEA 2XYAA 1WUNH 5F8XA 3U8OH 1W10U 3Q3YA 5EW2H 2OK5A 4U01A 1XUKA 2ZGHA 3MU8A 5G4BA 4B71A 4GCHG 1AO5A 1QRXA 2BDAA 5LGOA 2P59A 3TJUA 4ZKSU 1EOJA 2XC0A 8GCHF 4BNRA 1FN8A 2A7JA 3SGBE 4CRBA 1VITG 1FDPA 2JDID 2HVXA 1YPHE 4Z0KA 1GHXH 2D1JA 1C2DA 1ZLRA 1NY22 3RMMH 1A1RA 2BX4A 4K3JA 3RC4A 3GY4A 3PM3A 5T3HA 3LC5A 2STBE 1F0UA 1GL0E 1NBMD 1LHGH 1UTPA 3FP7E 4CRCA 1K22H 3B23B 5A8XA 1NO9H 2W3KA 2QE7D 3RXJA 3M5MA 1C1UH 4I32A 1QR3E 3TJNA 2ZPQA 1O3BA 1S6HA 1SGNE 3M3SA 4MNYA 1YPJH 2OINA 2VIPA 4CRFA 2Z3CA 3A89A 3NCLA 2UUYA 3QGNB 1D4PB 1GBCA 1XUIA 3UR6A 4AFZA 2PGQB 1NRRH 1NFYA 1U6QA 1GBKA 2GCTB 4K5ZA 2ZU4A 1UCYE 4O97A 2G51A 1QGFA 2BD4A 1C9TA 4AG2A 1PYTD 1W0YH 2QF4A 3SQHE 4FU7A 3Q3KA 1SG8B 2Z9JA 1Z8JB 1BRBE 3KL6A 3ELAH 4LOYH 3GS9A 3C27B 3RLWH 1CGJE 2VVUA 2TIOA 2SGQE 1NS3A 1PQ5A 3GY3A 2ESTE 3PV5A 2WINI 3GYLB 1BBRK 2WUBA 5T6DA 1IQFA 1DWCH 3MU5A 5DK1A 5EW1H 1HIAA 1TNHA 3K6ZA 4TPYA 1FQ3A 2XXLA 1CE5A 1WTGH 4WH8A 1O3FA 1T7CA 5ESBA 1FAXA 1BCUH 2SGEE 1SOTA 1O2XA 1CGHA 1EP5A 3A80A 1TNGA 1P3CA 4ZHMU 2ZGJA 1ZHRA 4Q4LA 1A3EH 3GY2A 3ZVCA 5KEDA 1CU1A 5T6GA 1Z8GA 3SGAE 1EPTB 1H9HE 4TY7A 4LZ1H 1C2JA 4Q7YA 4FUIA 2GDDA 2WPIS 1GVZA 2FOHA 1LQDB 2DUCA 3W95A 2WPHS 3MNSA 4AZ2B 2BD7A 2ANKH 4U2WA 4ISLA 5T6FA 2UUFB 3KQCA 2GVFA 2W7UA 3VB4A 9ESTA 3F9EA 2KM0A 1O3HA 3BTQE 3RXDA 3NWUA 2EI6A 4BXWA 4GLYA 1EJMA 3A84A 4B2AA 1KTTB 2HWLB 1DSTA 1UO6A 1SC8U 3U9AH 5JPMH 1BHXB 2KCAA 3GCHC 3IWMA 2C4FH 2GP9B 3SHCH 1AQ7A 3DA9B 2BXUH 1D3PB 3M5LA 1PPHE 5EQRA 1PPBH 1E1QD 2ZHQH 1JXPA 1IHTH 1SKYE 4AFSA 1GJ9B 1TMUH 4X0WU 9LPRA 2YMSC 1OSSA 2OQ5A 5JBAS 4X6NA 2Z9IA 2F9BH 1HAYB 2FI4E 5GWZA 1O2WA 1O2TA 2JIZD 3ATLA 5EJZA 1XMNB 1G3EA 4ABHA 1GI3A 3PMBB 4E06H 2ANWA 1TRYA 2CK3D 1QJ6B 1MD8A 1VGCC 4CHAC 2VWLA 1MMJN 4U30A 1T32A 2C8ZB 2VGCC 3A8BA 2AMPA 3DSGA 1SHHB 1LCYA 4RKJB 2WPDD 2M5TA 2O8TA 1K1NA 3A7VA 2KCYA 1WYKA 1UCYH 1BMFD 1SGTA 4CHAB 4RT1A 2WYJA 2B0FA 1UK4A 2ZGXH 1BJUA 2FI5E 2ZU2A 3F3BA 1AB9B 3SV7A 4TT3D 1F0SA 2FM2A 2Y7XA 1LHCH 7KMEH 4ZXYH 4UFDH 1CHOG 3RU4D 2QN5T 5HIZA 3MO3A 4ABDA 1RS0A 1XX9A 4BXSA 5EXLA 3RP2A 2ZDMA 1YCPM 3BTFE 1KDQB 2ASUB 3HKIB 4OS2A 4X6MA 4WJG2 1TX6A 1AN1E 1UVPA 2GZ7A 3S7HB 1MKXH 4JZEH 4A1XA 4DT7B 4U32A 3Q00A 1P8VC 5GCHG 1SQOA 1O3MA 2P3FH 2XC4A 1QZ8A 1AZZA 4ZAEA 2C8YB 2GDEH 4FUHA 1YKTA 2GCHG 4DG4A 2HVYB 3UREA 1TNJA 1DWDH 2QAAA 2PFEA 1EB1H 1CBWC 2H2ZA 1SVPA 4JMYA 4MVNA 4WH6A 5C20A 1JRTA 2PKAA 1EKBB 3KGPA 1BMLA 2ZHEH 5K7RA 2D2DA 1HAGE 4UE7H 1SQAA 1YP9A 4BTIB 1C2KA 2AS9A 3TJVA 1C2GA 3SI4H 2G4TA 1SFIA 3A8CA 3M7QA 2W6ID 1O2MA 3KQ5A 2GV6A 4FUDA 5GNDA 3FKSD 4AGKA 5LPEA 1WXRA 1P05A 4IN2A 2BYAX 2OD3B 3RUOA 4DW2U 2BDHA 3RXAA 1ZSKA 1TMBH 4FVBA 4Y7AA 4BTUB 1CHGA 1SQTA 2SGFE 3SBKA 1F0TA 2GMTC 5C2ZA 1EAXA 2B8OH 3FAOA 5JDUB 1GDNA 1DY8A 2F9OA 2JJ2D 4Q7ZA 5PTPA 2J34A 2Y82A 1O2NA 2G55A 1O5DH 1GI4A 2D8WA 1XKAC 3D23A 3TLOA 2FOEA 4FU9A 1O34A 1H9LB 1Y3UA 3GICB 4Y71A 1GBEA 5IYTA 1TWXB 1QRWA 5DP6A 1Y5AT 1O2YA 1HBTH 2V0BA 1B0FA 3DSOA 1MABB 3E16B 1P0SH 3ODDA 3LOXA 3U69H 2FYQA 1ZHMA 3KYFA 3K6YA 2Q6DA 3T5FH 1BB0B 3K65B 4D9RA 2ZO3H 2J94A 2O8MA 2PKAB 2A5IA 3F2FA 1J17T 2V3OH 3ZV8A 1BTZA 3HK6B 3F1SB 4RKOB 1W0KD 1YLNA 1C5VA 2QA9E 2SGAA 1Q31A 2BD5A 1SGQE 1FY8E 3L33A 4INKA 3MNCA 2XTTB 1W0ZU 2WPMS 4D7GA 1O2PA 1C5XB 2BY6X 1GBFA 2VVVA 2KAIA 3QX5H 2Q6GA 2Y7ZA 1LHFH 3EYDA 5A8YA 6LPRA 1SGFG 3SORA 2BOKA 1AE5A 1C5ZB 1CA0C 4DGJA 1ARCA 1BMAA 4BAQB 3ZZ7A 4Q63A 5FX6A 1O2LA 1H8IH 2PLXA 3AASA 1O37A 1LVOA 4KP0A 1P10A 5KGOA 1S82A 1RIWB 3ZV9A 2AGGX 4OM9A 5FPSA 4I31A 2BQWB 1THPB 4SGBE 3T25A 1GMDG 1HXFH 3BEFB 3GOVB 3RU4E 4AORA 3PROA 1O39A 3W1EA 4YZUA 4F48B 1O3PB 1OXGA 2WHXA 2Q1JA 5EJ1A 1ZJDA 3A86A 1DLKB 1ZRBA 1SR5C 1Q2WA 1AKSA 2NU0E 1EAIA 4ACBA 1ZHPA 3ATWA 4THNH 4GPGA 5L2ZH 1EZXC 3BIUH 3OTPA 1YPHC 1FY5A 3UUZA 4YO9A 1GDUA 1TMTH 1OP0A 1SSXA 3V12A 1CGIE 6GCHG 1O2QA 5AVDA 4GUXA 2WPLS 1S83A 5C1YA 4CH8B 2FTMA 1Z8IB 2SNWA 1O2OA 2G5NA 3SUFA 1AMHA 3EGKH 3RMLH 1P02A 1S85A 1J9CH 2ZFSA 4KTCA 3TU7H 3UAIC 1QB6A 3PWCA 4F55A 2PW8H 1MU8B 2KAIB 1FIZA 3HATH 3UIRA 5HIYA 1GGDB 2A4QA 4O3TA 4TPIZ 3V7TA 5EXMA 2GJGA 4KGAA 2NU4E 4D7FA 3LGYA 3UQVA 1OX1A 2BM2A 2A32A 2BHGA 2VJ1A 1ACBE 5EODA 1ELTA 1GCTB 1C1OA 3B8JA 1GJAB 1HAVB 1D6WA 2R9PA 1CT2E 4ISHH 4NSYA 1GVLA 3VB3A 5FCKA 3NUMA 1H8HD 4K1SA 1GJCB 2FMJA 3MI4A 1J14A 4I8JA 3SJ9A 4YTAA 1HRTH 4BANB 1F0RA 1P57B 2FYRA 2J2UA 4FUGA 1GG6C 1OPHB 3D49H 3BTEE 4D76A 1T31A 3ZZ9A 4BTTB 5F53A 1PPCE 1H8DH 1BHXF 4FVDA 4I8HA 1FLEE 3ZIAD 1CVWH 1GBDA 2KR7A 1MCVA 1AKSB 3RXTA 1VITF 8KME2 2XBYA 5F8ZA 1NRNH 2BD9A 3H7OA 1GVKB 1TRMA 2F9VA 1XVMA 3QK1A 1K2I1 3VFEA 3OEHD 3ZZAA 3O8BA 4IS5A 3URDA 1MU6B 3UOUA 1CA8B 7LPRA 4Q2KA 2PR3A 3M5NA 1KTSB 1V2QT 1ZR0A 4X1RU 3SU5A 4ISIH 1LVBA 1KMHB 2QXJA 2Y5HA 5F6MA 1BTUA 3I78A 4ACAA 1TABE 1SBWA 1DWEH 1A0LA 1J16A 1VITH 4WMEA 1BDAA 4XOJA 2Z7FE 1AGJA 3N99A 4TSFD 4TWWA 4JZFH 1MBQA 1O3IA 1F5LA 4P02A 2FZZA 3LGIA 3SUDA 1ANBA 1TFXA 1WAYB 1EATA 1OWKA 1NRPH 5AFZH 2Z9LA 4NSVA 3E3TA 1ANCA 4I8GA 1VKYA 3C1KA 4B6FA 1E79D 2AMQA 2GT8A 1OWEA 3F9FA 1OYQA 1LO6A 2J95A 2V35A 3OY6U 1ANDA 3LGUA 5EPYA 3V0XA 4NZLA 4BOHA 2KZ4A 4FETA 1FPCH 2VBCA 2C8XB 1THSH 1L1NA 1ESTA 4OS7A 2B5TB 2OQUA 2VH0A 3ATIA 7ESTE 4JZIA 3RC5A 3D65E 2R0KA 3ZZCA 4X8UH 3WWBA 2CF9H 1P09A 2FWWA 3NRLA 1PPZA 3PV2A 5TCAA 3BTGE 2OC8A 4WMDA 1WU1A 2V6NA 1YM0A 3RMNH 3LJOA 1F5RA 2SGPE 1FY3A 4FUEA 4R8TB 2J4IA 2ZHDA 5HKKD 2ZWLH 2VIDA 2BDIA 3GDVA 1TYNA 3MU0A 1EP6A 3RXVA 3QUMP 4MTBA 2ZHFH 2AH4X 3OFND 1GMCF 4BAHB 2ODPA 3DSPA 3T62A 4AC9A 3MYWA 1O5CB 1MAYA 3OE7D 2ZKSA 3M61U 3MH7A 5DG6A 1EFRD 3V13A 4AB8A 2BDGA 1T8NA 1UVUH 1K1PA 1GMHG 1TE0A 1RD3B 2GX4A 1BTPA 3TK6A 1H8ED 3BTHE 1SGIB 1KSNA 4ZH8A 5L2YH 1BRAA 1AI8H 4H6SB 1YLDA 2BQ6B 4NGAH 2HRVA 1A7SA 4ZHAA 1F2SE 3RU4T 2OP9A 1O2GH 2LNCA 2Y5FA 5EXNA 3LC3A 3SNDA 1C5TA 3Q77A 1W7GH 2OXSA 4MPVA 2QC2A 5C5OA 2HALA 3OEED 4F4OC 5F8TA 1SOZA 5E8EH 2P94A 4XSKU 1CSOE 3MMGA 5GJ4B 4IMQA 3EDXB 3KQBA 5LH8A 1BQYA 2BVRH 2GCTC 3N7OA 4M7GA 5AHGH 1LHEH 1TIOA 3LDXH 4FU8A 2R2WU 1LKBA 3A85A 3DFLA 4Y7BA 1ZMJA 1DFPA 3KQDA 1QL7A 3TVJB 4TY6A 5FHTA 1GHBG 2PKSB 1C5OH 3UWIA 2OBOA 4RN6A 1DM4B 1MTNC 1PPGE 1V2JT 4SGAE 2JJ1D 3MQKC 2LELA 2ZFTA 1OWDA 1HV7A 1TX7A 2BY5X 2IJOB 2A5KA 3FANA 3TH4H 1TBRH 5T1VA 1E36B 2GKVE 2PGBB 3LGWA 3Q3XA 2YOLA 3SV9A 1O32A 3P8OA 2BVSH 3IG6B 3STIA 2BB4A 2XRCA 1DUEA 1MAXA 1MTNB 1UTLM 2ALVA 4ABAA 3BG4B 4CREA 3TGIE 1A5IA 3SU4A 2FEQH 4E7NA 2OLGA 3NK8A 2VIWA 1UTQA 1OYTH 5DP8A 2HLCA 2BDBA 2P3TB 1P2JA 3MO9A 4MNVA 1QA7A 4HGCA 1EPTC 3ZZ4A 1E37B 1HAZB 2VIOA 3SV8A 4HFPB 4RT0A 1P2OA 2KCOA 4K8YA 3RXCA 1O38A 1WDIA 1SLUB 4I8LA 3RC6A 2A7CA 1AVWA 2UUKB 4ASHA 2ZTZA 2XW9A 3OU0A 3A83A 1FAKH 3TNSA 3TGJE 3FOAA 1DANH 1C1VH 3Q76A 4ZROA 3WY8A 2GCHF 1QHRB 1YCPH 1K1IA 1ZMLA 2V3MA 2WV9A 3GY6A 5E2OA 3DCLA 1WV7H 2PTCE 1RJXB 5EOKA 1V2WT 4X6OA 1QBNA 4YT6H 1RGQA 1ZGVA 1AFQB 1KXBA 2GTBA 1C5YB 1ZGIA 2BLQA 4ASUD 2TRMA 2VIVA 4KTUA 1QRZA 3OX7U 3KCGH 4ABEA 8LPRA 1EZQA 1S0RA 1YF4A 1GCDA 3M35A 3SU6A 1K21H 3S69A 5C1XA 2SNVA 1HJAB 2W3IA 1RXPA 4UFFH 1GI1A 2BY7X 4A5TS 1CQQA 3M36A 4DY7B 4NFEA 1ETRH 1QIXB 1NRQH 1SPJA 4B75A 4B73A 1RTFB 3UNRA 1HXEH 3MO6A 7GCHF 1CT0E 3FN8A 1HIAB 1C1TA 1ELAA 2QXIA 5JBTA 5DP9A 2ZEBA 3P8NA 2BY9X 3NKKA 4XDEA 1YYY1 1T8LA 1VCPA 1Q3XA 1JMOH 1W13U 3P6ZB 1BMNH 3N7EA 2GZ8A 1O2HA 2VVCA 1EUFA 1ELDE 3AW0A 2ZZUH 2ZGBH 8GCHG 2FDAA 3SJIA 1PQ8A 3VGCB 1HLTH 3U8RH 2YNAA 3M3VA 4BAMB 2WPKS 3R3GB 4ZKRU 4A7IB 3EA8A 1DXWA 1ZSJA 3F2HA 4RI0A 3SO3A 1K1LA 4CRAA 1BA8B 2G81E 1XXFA 2OC7A 2H5CA 4VGCB 4XE4A 4AYVB 3PLKA 4MPXA 1HUTH 1S6FA 1SGRE 1DS2E 4Y10E 3T26A 1D9IA 4X1PU 1AB9C 1ID5H 4I8KA 3N7DA 5CE1A 4OGYA 2A4GA 2QGRA 1C1RA 1FX0B 1SB1H 2STAE 2AGIX 2ZFPH 4ZKNU 2PHBA 2O8WA 1GJ8B 2J5UA 1S0QA 5ABWA 1MKWH 1GBAA 1P11E 2R3UA 3KIDU 4NG9H 4QT8C 1DE7H 3VB5A 2J97A 1C5UA 1L4ZA 4LXBH 1O5GH 2VU8E 2ZTXA 4B76A 3S9AA 2F9PA 2RDEA 1C1WH 1UK3A 1TBZH 1W8BH 3L3TA 1VR1H 4BAOB 4Y6DA 5BPEA 2XCFA 1GMDF 1NRSH 2BDYA 3ITIA 2C90B 3SUEA 1FV9A 3G01A 1A4WH 4JZDH 1TALA 3HGPA 2R3YA 1YC0A 1IQLA 3NZIA 1QQUA 8ESTE 3RMOH 1G3CA 1TA2A 3RXFA 1KLTA 1NU7B 4WXIA 4YESB 3GISB 3F9HA 3SU2A 2H5DA 2QXHA 1MCTA 2OBQA 3FP6E 1HNEE 1UVSH 2EC9H 1WSSH 1G36A 3HGNA 5EQSA 4WY3A 3F0PA 1GI6A 2H9HA 4AX9H 4FUCA 2NU2E 1DDJA 3MNXA 1HYLA 1GJ7B 2ULLA 3P95A 3A88A 3MOCA 2GT7A 3BIVH 3B9FH 3A82A 4R0IA 2J9NA 1CO7E 1H9IE 4UFGH 3A7ZA 3SOSA 1O5FH 3KNXA 3P17H 2EI7A 1FJSA 3SU1A 1GBBA 1GDQA 3CENA 4M9FA 2L74A 1AWFH 1ZMNA 2W5EA 2WSSD 3U1JB 2ALPA 3SNEA 1GI9B 1GWAA 1YLCA 1A0HB 3PMHB 2TGTA 2JH5D 3O8DA 3SI3H 1AU8A 3SZEA 2FS9A 4B2BA 1O30A 1JRSA 1P06A 4NIWA 1OS8A 1BBRE 3O8RA 1ESAA 1QTFA 1GBIA 2NU3E 2IPQX 4DT4A 1W2KH 3H7TA 3HKJB 1GHAF 2A0QB 3KHVA 2ZNKH 3JZ1B 4ABBA 4J2YB 4I33A 1P2MA 2RFKC 1IQGA 2RA0A 1JWTA 5FBIA 1DICA 1DT2A 4WMFA 3GDSA 2C3SA 2PUQH 2TGPZ 2Z3DA 2XWAA 1BUIA 1DLEA 1QNJA 4ZXXH 3QTOH 1T4UH 1JBUH 1RIWC 4WXVA 1UTNA 1ELVA 1GBTA 4DIIH 1Y3YA 2XWBI 4ABIA 2RDLA 1BTXA 3AK5A 1H4WA 2BQ7B 2O9QA 5CDFE 2FS8A 3P8GA 3ZZ5A 1LPZB 2CN0H 4WVPE 3M3TA 5FL7D 3GCTF 4XBCA 1G30B 4DIHH 1C5WB 1ELGA 3FO8D 4FUBA 5BRRE 4INHA 5KECA 3LH1A 3I29A 4ZKOU 2FOBA 4NWLA 5C5NA 1AVXA 4B1TA 3SV6A 4FUJA 2ILNA 4MPWA 4IC6A 2WYGA 2GD4B 1FI8A 1M9UA 1IHSH 2QV1A 3VXEH 4FOUC 2BTCE 2H1UA 2WUCA 1P03A 4MG3A 1IQHA 1DXPA 3BSQA 3DUXH 3ZVDA 4ESTE 1K0HA 1C5SA 2Y5GA 5HYOA 4CBNA 1GGDC 1SGYE 2O8UA 5K0HA 1XXDA 2A7HA 2ZU1A 1EZUC 1V2OT 1UTKA 5L6NH 1LTOA 1C1SA 1GPZA 1SGDE 2CMYA 1CT4E 2QF5A 3EE7A 3M7UA 4CBOA 5FXLA 1FIWA 2ZDAH 3STJA 5HM2A 2A2XH 5JB8S 2UUJB 1GCTC 4H6TA 1HAOH 5C94A 1KY9A 3GCNA 1LMWB 1ABIH 2ANYA 1SGFA 3UY9A 1B0EA 1UTJA 3RXQA 4HTCH 4Y79A 3T2NA 2B9LA 2DE8A 1P12E 2K0QA 2PWXA 1YGCH 5H4IB 1DITH 1PPFE 1ANEA 1YPLH 2ZPSA 1BOQA 5DP4A 3RXLA 3MH4A 2BY8X 2ZC9H 2P8OB 4X8SH 1YY3A 3EQ0H 2C8WB 2G4UA 1GMHF 1Z6EA 2ZPRA 2XC5A 2PTNA 1NFUA 2JKHA 1O2ZA 3JZ2B 4BAKB 1F7ZA 2ZDLA 4GCHF 1YPMH 3QGJA 5HGGA 3ZVBA 4Q80A 1XUFA 2FO9A 1C2FA 1GJ6A 1C5PA 1OWJA 1ZSLA 2BD8A 2FTLE 3RM2H 5FBEA 5FX5A 3A81A 4CR5A 4IC5A 1P01A 1BBRH 2QYIA 2BOHB 4X6PA 3CS7A 2VIQA 4K60A 5DO4H 2AYWA 2IN2A 2HPQH 1RFNA 2BD3A 4ABGA 1O3EA 4H42U 2ZI2H 2G52A 1L1GA 2ZA5A 2HLDD 3H5CB 4NWKA 1AD8H 1G3DA 2FIRH 1NZQH 2PUXB 4NIXA 5DJ7A 3SNCA 2FXRA 4ISNA 4WWYA 3BTKE 1P2KA 5A0BA 1C2LA 2CJIA 1TOCB 2BZ6H 4IN1A 1O0DH 1BITA 2CV3A 1MQ6A 2UWLA 1W14U 2W6JD 1GHYH 3CS0A 4NIYA 5EGMA 2JETB 3A7TA 1AE8H 1ZOMA 4ZUHA 3IITA 2CHAB 3P92A 2O8LA 4Y8YA 1K1MA 1MZAA 2HOBA 2TPIZ 1DPOA 3LJJA 4XBDA 4NFFA 3BEIB 1MTVA 1TGNA 4X2XA 1IQEA 4MQAA 1BT7A 3TH2H 1W12U 3GYMA 2Y81A 4H4FA 1EAUA 3V3MA 1O2SA 1TX8A 2VWMA 2BXTH 2NWNA 3UPEA 1LDTT 4K1TA 1HPGA 1O3CA 1FY1A 5DSFA 5A8ZA 1K1OA 1NTPA 1TB6H 5EJLA 1GJDB 3M7TA 3UNSA 1NROH 1GBLA 3ATMA 4MLFB 3QN7A 5I46H 3QZQA 2C93B 1UW7A 2XOKD 1O35A 2LPRA 1EXFA 2IJD1 3W94A 1MTUA 2ZCLP 3ZZ8A 1KXAA 1HCGA 2KX4A 4MNXA 5E2PA 4Q7XA 1EQ9A 1OKXA 2IPHA 1GJBB 1NT1A 3TIUA 1O33A 1ZTJA 1YBWA 2QF3A 1L0ZA 1FONA 5CHBA 1XUJA 2XCNA 4YOIA 3OTJE 3S9BA 1C5MD 1GL1A 1O2VA 1ETTH 1EX3A 1KXFA 2FI3E 4E7RG 2J98A 2H9EH 4X2WA 4YT7H 4AYYB 4ZCNA 2EI8A 4YXWD 1C4U2 1B5GH 2PP6A 4LZ4B 1A2CH 1H1BA 1GI0A 4NA7A 5A0AE 3SN8A 2FESH 4I86A 1ETSH 1GHWH 1GI5A 3ZVGA 4B74A 1P2NA 1TGCA 1K1JA 4B6EA 1D3QB 4O03A 4HZHA 2WV5A 1XVOA 3BTME 3RLYH 1OWIA 3S9CA 2Q6FA 1GI8B 2VINA 4UDWH 3SNAA 3E0PB 1QY6A 3TJOA 2PKSC 1V2PT 3M5OA 5I25A 3U28C 3PB1E 2GGVB 1WOFA 1TONA 1IQNA 3KYGA 4D9QA 1T4VH 1ESBA 1MUEB 1O2KA 5JBCS 4DURA 3SZNA 2AHME 2F4LA 3A7WA 1HAPH 2WPJS 1SGPE 3SUGA 3ZYDA 4AFQA 3URCA 5B6LA 5SGAE 3PO1C 5C0TA 2M2AA 1AY6H 1X7AC 2HNTE 1HAHH 3MTYA 1BJVA 1Z1IA 2AERH 4INLA 1IQMA 3BG4C 1F5KU 2TGDA 2NU1E 3U98H 2A4OA 1VJ9U 1HGTH 4IBLH 2H6MA 2J98B 1C1NA 1P9UA 1EPTA 1O31A 1XUHA 3LT3A 1KLIH 2AIPA 3RXUA 1K28D 3PO1B 1DY9A 3RXOA 1B7XB 4PROA 2F91A 1SLVB 1RRKA 2BZAA 5AF9H 1EZSC 5JB9S 6ESTA 3UNQA 1NFWA 5A2MH 1SLWB 2FOAA 5DGJA 2A2QH 2TBSA 3OYPA 1CHOF 4KELA 1E34B 1C4V2 1S84A 4TYDA 3T28A 4ABFA 2BVXH 1E35B 1TOMH 4YOGA 1BZXE 3LKWA 1AFEH 3MHWU 5GPIB 1N6XA 2KCPA 1QB1A 3PWBA 5C0UA 1AVGH 1J8AA 1QJ7B 1S6LA 1Y3WA 1AFQC 5AFYH 2RG3A 5GCHF 1PQ7A 1JOUB 2Z94A 3VPKA 1SHYA 4UD9H 2BX3A 2FOFA 1NN6A 1IQIA 1C5QA 3BV9B 1C2HA 2ZFQH 4JZ1A 1TQ0B 1W0JD 1G32B 1VCWA 3D62A 4AG1A 3ZYEA 4HG6A 4NZQA 1HJAC 2ODQA 4GSOA 5GXPA 2Y80A 4X8VH 1D6RA 1PPEE 1O5BB 1BRCE 4DJZB 4A92A 4WF8A 1KXDA 1D3TB 2ZTYA 3K9XB 1ZTKA 4ZHLU 1Y3XA 2FX4A 1LVYA 3ATKA 5EQQA 1TNIA 3I77A 4DVAU 1W3CA 3BTDE 4K69A 1V2TT 2LP6A 1SMFE 4K2YA 4D8NA 2G00A 2A1DB 3PMAB 4K1EA 4FUFA 2A45B 1A61H 5EU8A 3DFJA 1L2EA 3RXPA 3DHKH 1L1JA 1WQVH 2CF8H 1TGBA 1GMCG 1S5SA 3P70B 4IGDA 3ESTA
chains in the Genus database with same CATH topology
1MTWA 3LIWA 1TPOA 4AGJA 1NESE 2HPPH 3VGCC 1THRH 3ENSB 1KIGH 3QTVH 4GHTA 5C3NA 1T8OA 3SGQE 3TNTA 2FOGA 1UTOA 4J1YA 2ZDVH 2ZCKP 1ZPBA 3RXMA 2HNTF 4Y11E 1QL8A 2DE9A 4VGCC 1TPSA 3T27A 4RSPA 2FPZA 1TGTA 2FOCA 1PQAA 1T8MA 5DP7A 1C5LH 1GJ4H 2TGAA 3DD2H 2XBXA 2OC0A 2CGAA 1ZRKA 4AOQA 3FZZA 2ZIQH 1BTWA 3PV4A 1UMAH 4YOJA 3O8CA 3PYHA 4TWYA 1KDQA 3PLBA 3M37A 3BTWE 3LU9B 1AUJA 3AAVA 5LPFA 1FMGA 1C4Y2 1TLDA 2P16A 2G5VA 4CH2B 1TQ7B 2B7DH 3GCHB 1YPEH 4X1NU 4B2CA 1A0JA 1G2LA 2ZP0H 4I7YH 1O2RA 2G8TA 3E6PH 3RXIA 2ZQ1A 4GAWA 4JK6A 4A6LA 3ZVFA 4OS5A 1F92A 1SL3A 4YM9A 1N1LA 3LONA 3GY7A 3QZRA 2A4RA 3E1XB 2R0LA 1FN6A 1HAIH 1O3AA 2BLVA 1WTHD 2VNTA 2H9TH 1Y5BT 4ISOA 5HXFA 2AGEX 5DPAA 3HK3B 2P3UB 3U1IB 3PTBA 3BTTE 3VB7A 1VGCB 1J15A 4UEHH 1K9OE 1FY4A 3EE0B 3RXHA 2VGCB 3S0NA 2HGTH 3VB6A 1FPHH 1N6YA 1DWBH 4X1SU 1V2MT 1V6DA 4X2YA 1QJ1B 3QWCH 5HM9A 5J4SA 5J4QA 3K2UA 2RCEA 1VJAU 2FODA 2QIQA 1EB2A 1V2UT 3FP8E 3LGVA 1RTKA 3E8LA 4KTSA 2EEKA 6GCHF 1INCA 3UOPA 3E91A 3A7XA 3TK5A 1TA6A 1V2LT 3S7KB 1TBQH 4KKDA 5EPNA 2V3HH 3KEEA 1TRNA 3UWJH 2AEIH 5FPTA 3KF2A 1GHZA 3NPSA 4X8TH 2OTVA 1BIOA 1ELBA 3RM0H 3A8AA 3L6PA 4MDSA 5DP5A 1UVTH 1DX5M 1V2ST 4OS6A 3SV2H 1WCZA 1O3KA 2ZHWH 3OY5U 3RXEA 2VWNA 1HFDA 1GI7B 2PSYA 2IOTA 5TCCA 5ESTE 5FPYA 5CHAC 3ZZ3A 2UWOA 1IQJA 1CBWB 2RA3A 1ZJKA 4O9VA 2BMGB 1NC6A 1LPKB 2ZU5A 5C1UA 3RXRA 4OGXA 2YNBA 1Y8TA 1GJ5H 4JK5A 4DCDA 1Z6JH 1AUTC 1V2VT 1E0FD 2A5AA 2BLWA 5L30H 2VWOA 4NA8A 1FZZA 2ZFFH 4ABJA 3QDZB 7GCHG 5CHAB 1P2IA 4IMZA 4YLUA 2FLRH 4IW4E 4OS4A 1PJPA 2ZQ2A 1FXYA 1AZ8A 1EJAA 1YCPK 4Y76A 2W7SA 1V2RT 4LK4A 1MTSA 4E05H 2ZG0H 1DVAH 1N8OC 4AN7A 2Z9KA 1ELEE 2GMTB 3RDZA 1OWHA 3SU3A 3BN9A 3E90B 3F6UH 1SFQB 4A1VA 3A7YA 1TAWA 1WQSA 5F03A 1MQ5A 2ODYB 1ZPZA 1QA0A 3FVFB 3MU1A 4Y0YE 2W26A 1EAWA 3MH5A 3F68H 1UHBA 5GDSH 3SJ8A 2ZF0H 5FAHA 1N8OB 3F9GA 3MNBA 6CHAC 3BF6H 1FUJA 4HI3A 2ZGCA 2AIQA 1QCPA 1BRUP 4ZMAH 3TK9A 2SGDE 4AB9A 3T29A 5A0CA 1HB0B 1P04A 1EJNA 3DT0H 3KQEA 4FXGH 3RXSA 1HAVA 1W11U 1GBMA 1LKAA 1AWHB 1LQEA 1ORFA 1P9SA 6CHAB 1QBOA 2SFAA 1C5RA 4X2VA 1OP2A 3BEUA 4JYVH 1Z1JA 1CA0B 4AFUA 2ZDKA 1DOJA 1QURH 2ZU3A 2OCVB 1QB9A 5A09A 2P8OC 1O3JA 3OSYA 1A46H 1ARBA 3U8TH 1ZYOA 1ZTLA 1C2EA 1UJ1A 2R2MB 1V2KT 1IAUA 3R0FA 1GBJA 1C5NH 3A8DA 3SJKA 3ZZDA 2ZDNA 3MWIU 3AAUA 4F49A 1D3DB 2VB0A 2BLOA 2HNTC 1KXCA 1C9PA 3TGKE 2Z9GA 1E38B 3TITA 1Y5UT 1NM6A 1KXEA 1XKBC 1NU9A 2AMDA 3ODFA 1UK2A 1MKWK 1UCYK 2F3CE 1EASA 3SQEE 3TH3H 3UR9A 1UHBB 1ABJH 1TPAE 3E0NB 4XBBA 1HDTH 1C1QA 2UWPA 1QBVH 2PSXA 3PMJA 1DUAA 3EA9A 1O3GA 1BTYA 3NXPA 2GV7A 3GCOA 3QLPH 1VZQH 1TPPA 1GHVH 1O3NA 2XNIA 5E0JA 1C1PA 3SJOA 1SGEE 5ETXA 4CRGA 1SLXB 2BD2A 3RXBA 1IQKA 4X1QU 4GVUA 4Y8ZA 3RXKA 1Z8RA 1MKXK 3LGTA 3FFGA 2D26C 1SGCA 1ELFA 1TGSZ 1ZZZA 2Z6BD 2FP7B 1S81A 1XM1A 1OOKB 2JETC 3FZDA 1P2QA 4XFQA 2CHAC 2QCYA 2VH6A 2ANMH 1UVOA 1HJ8A 1GHAG 2PV9B 1NFXA 4CR9A 1GHBF 3KN2A 5FCRA 4JCNA 4O3UA 1O2JA 1O5EH 3UFAA 3EAJA 1MH0A 3MH6A 3MFJA 1L4DA 5LPRA 1G9IE 1GG6B 1JIMA 5HMAA 2BDCA 1QL9A 3VEQB 2OC1A 1SI5H 2F83A 2Z3EA 2K1QA 3A87A 1Z71A 1O3DA 1TNLA 5DKMA 1GBHA 1MBMA 1NPMA 2P95A 1XUGA 3EA7A 1C2MA 2GZ9A 1V2NT 4K8BA 3VXFH 3GY8A 2QY0B 4JYTA 2XBVA 1LVMA 2JH0D 1EOLA 1HJ9A 1P3EA 4MNWA 4NA9H 3SU0A 5B6OA 3UTUH 3RXGA 1A3BH 3ZVAA 5E0GA 5DP3A 2I6QA 3LPRA 4OS1A 1KLJH 3GCTG 2J92A 2AFQB 1GI2A 1BMMH 3QO6A 4MPUA 2OUAA 3ZZBA 1O36A 5C67A 4CRDA 1JIRA 2F9UA 2J38A 1TNKA 1WBGB 1ZPCA 1UTMA 3SNBA 4UONA 4NIVA 1YPKH 5TJXA 1Z7KA 3P8FA 2FLBH 1ELCA 1G2MA 3UQOA 2P93A 3LH3A 1DSUA 1V3XA 1YPGH 2CXVA 3SHAH 2ZFRH 3TPIZ 5IDKA 1OP8A 1QQ4A 2FX6A 3AW1A 3MU4A 5E0HA 1Y59T 5JYIA 4NCYA 1G3BA 2ZECA 1C2IA 1MD7A 1A5HA 1O2IA 3PTNA 1FNIA 3GDUA 4Y8XA 1O3OA 4JYUH 4UFEH 2EA3A 3SW2B 3ZZ6A 5EG4A 1AHTH 1A5GH 4A1TA 4YLQH 1O5AB 3BG8A 1HAXB 1C1MA 1PFXC 1BTHH 2WV4A 3CP7A 1RTLA 2F9NA 2I6SA 1QFKH 5GIBA 5JBBS 2ZCHP 4Z6AH 1G37A 4Y0ZE 1W7XH 1LPGB 1KYNA 1AIXH 1Y3VA 4DOQA 1VCQA 2XBWA 2QF0A 2THFB 5CMXH 2Y6TA 3ZVEA 3PLPA 2QXGA 2JH6D 1O2UA 1MZDA 3AVZA 1O3LA 4GHQA 1LHDH 2FOMB 3HPTB 2A31A 3GY5A 1PYTC 1IOEA 2XYAA 1WUNH 5F8XA 3U8OH 1W10U 3Q3YA 5EW2H 4U01A 1XUKA 2ZGHA 3MU8A 5G4BA 4B71A 4GCHG 1AO5A 1QRXA 2BDAA 5LGOA 2P59A 3TJUA 4ZKSU 1EOJA 2XC0A 8GCHF 4BNRA 1FN8A 2A7JA 3SGBE 4CRBA 1VITG 1FDPA 2HVXA 1YPHE 4Z0KA 1GHXH 2D1JA 1C2DA 1ZLRA 1NY22 3RMMH 1A1RA 2BX4A 4K3JA 3RC4A 3GY4A 3PM3A 5T3HA 3LC5A 2STBE 1F0UA 1GL0E 3FP7E 1LHGH 1UTPA 4CRCA 1K22H 3B23B 5A8XA 1NO9H 2W3KA 3RXJA 3M5MA 1C1UH 4I32A 1QR3E 3TJNA 2ZPQA 1O3BA 1S6HA 1SGNE 3M3SA 4MNYA 1YPJH 2OINA 2VIPA 4CRFA 2Z3CA 3A89A 3NCLA 2UUYA 3QGNB 1D4PB 1GBCA 1XUIA 3UR6A 4AFZA 2PGQB 1NRRH 1NFYA 1U6QA 1GBKA 2GCTB 4K5ZA 2ZU4A 1UCYE 4O97A 2G51A 1QGFA 2BD4A 1C9TA 4AG2A 1PYTD 1W0YH 3SQHE 4FU7A 3Q3KA 1SG8B 2Z9JA 1Z8JB 1BRBE 3KL6A 3ELAH 4LOYH 3C27B 3RLWH 1CGJE 2VVUA 2TIOA 2SGQE 1NS3A 1PQ5A 3GY3A 2ESTE 2WINI 3GYLB 1BBRK 2WUBA 5T6DA 1IQFA 1DWCH 3MU5A 5DK1A 5EW1H 1HIAA 1TNHA 3K6ZA 4TPYA 1FQ3A 2XXLA 1CE5A 1WTGH 4WH8A 1O3FA 1T7CA 5ESBA 1FAXA 1BCUH 2SGEE 1SOTA 1O2XA 1CGHA 1EP5A 3A80A 1TNGA 1P3CA 4ZHMU 2ZGJA 1ZHRA 1A3EH 3GY2A 3ZVCA 1CU1A 5T6GA 1Z8GA 3SGAE 1EPTB 1H9HE 4TY7A 4LZ1H 1C2JA 4Q7YA 4FUIA 2GDDA 2WPIS 1GVZA 2FOHA 1LQDB 2DUCA 3W95A 2WPHS 3MNSA 4AZ2B 2BD7A 2ANKH 4U2WA 4ISLA 5T6FA 2UUFB 3KQCA 2GVFA 2W7UA 3VB4A 9ESTA 3F9EA 3BTQE 1O3HA 3RXDA 3NWUA 2EI6A 4BXWA 4GLYA 1EJMA 3A84A 4B2AA 1KTTB 2HWLB 1DSTA 1UO6A 1SC8U 3U9AH 5JPMH 1BHXB 3GCHC 3IWMA 2C4FH 2GP9B 3SHCH 1AQ7A 3DA9B 2BXUH 1D3PB 3M5LA 1PPHE 5EQRA 1PPBH 2ZHQH 1JXPA 1IHTH 4AFSA 1GJ9B 1TMUH 4X0WU 9LPRA 1OSSA 2OQ5A 5JBAS 4X6NA 2Z9IA 2F9BH 1HAYB 2FI4E 5GWZA 1O2WA 1O2TA 3ATLA 1XMNB 1G3EA 4ABHA 1GI3A 3PMBB 4E06H 2ANWA 1TRYA 1QJ6B 1MD8A 1VGCC 4CHAC 2VWLA 1MMJN 4U30A 1T32A 2C8ZB 2VGCC 3A8BA 2AMPA 1SHHB 1LCYA 4RKJB 2M5TA 2O8TA 1K1NA 3A7VA 1WYKA 1UCYH 1SGTA 4CHAB 2WYJA 2B0FA 1UK4A 2ZGXH 1BJUA 2FI5E 2ZU2A 1AB9B 3SV7A 1F0SA 2FM2A 2Y7XA 1LHCH 7KMEH 4ZXYH 4UFDH 1CHOG 3RU4D 2QN5T 3MO3A 4ABDA 1RS0A 1XX9A 4BXSA 5EXLA 3RP2A 2ZDMA 1YCPM 3BTFE 1KDQB 2ASUB 3HKIB 4OS2A 4X6MA 4WJG2 1TX6A 1AN1E 1UVPA 2GZ7A 3S7HB 1MKXH 4JZEH 4A1XA 4DT7B 4U32A 3Q00A 1P8VC 5GCHG 1SQOA 1O3MA 2P3FH 2XC4A 4ZAEA 1AZZA 2C8YB 2GDEH 4FUHA 1YKTA 2GCHG 4DG4A 3UREA 1TNJA 1DWDH 2QAAA 2PFEA 1EB1H 1CBWC 2H2ZA 1SVPA 4JMYA 4MVNA 4WH6A 5C20A 1JRTA 2PKAA 1EKBB 3KGPA 1BMLA 2ZHEH 5K7RA 2D2DA 1HAGE 4UE7H 1SQAA 1YP9A 4BTIB 1C2KA 2AS9A 3TJVA 1C2GA 3SI4H 2G4TA 1SFIA 3A8CA 3M7QA 1O2MA 2GV6A 4FUDA 4AGKA 5LPEA 1P05A 4IN2A 2BYAX 2OD3B 3RUOA 4DW2U 2BDHA 3RXAA 1ZSKA 1TMBH 4FVBA 4Y7AA 4BTUB 1CHGA 1SQTA 2SGFE 3SBKA 1F0TA 2GMTC 5C2ZA 1EAXA 2B8OH 3FAOA 5JDUB 1GDNA 1DY8A 2F9OA 4Q7ZA 5PTPA 2J34A 2Y82A 1O2NA 2G55A 1O5DH 1GI4A 2D8WA 1XKAC 3D23A 3TLOA 2FOEA 4FU9A 1O34A 1H9LB 1Y3UA 3GICB 4Y71A 1GBEA 5IYTA 1TWXB 1QRWA 5DP6A 1Y5AT 1O2YA 1HBTH 2V0BA 1B0FA 3E16B 1P0SH 3ODDA 3LOXA 3U69H 2FYQA 1ZHMA 3K6YA 2Q6DA 3T5FH 1BB0B 3K65B 4D9RA 2ZO3H 2J94A 2O8MA 2PKAB 2A5IA 1J17T 2V3OH 3ZV8A 1BTZA 3HK6B 3F1SB 4RKOB 1C5VA 2QA9E 2SGAA 1Q31A 2BD5A 1SGQE 1FY8E 3L33A 4INKA 3MNCA 2XTTB 1W0ZU 2WPMS 4D7GA 1O2PA 1C5XB 2BY6X 1GBFA 2VVVA 2KAIA 3QX5H 2Q6GA 2Y7ZA 1LHFH 3EYDA 5A8YA 6LPRA 1SGFG 3SORA 2BOKA 1AE5A 1C5ZB 1CA0C 4DGJA 1ARCA 1BMAA 4BAQB 3ZZ7A 5FX6A 1O2LA 1H8IH 2PLXA 3AASA 1O37A 1LVOA 4KP0A 1P10A 1S82A 1RIWB 3ZV9A 2AGGX 5FPSA 4I31A 2BQWB 1THPB 4SGBE 3T25A 1GMDG 1HXFH 3BEFB 3GOVB 3RU4E 4AORA 3PROA 1O39A 4YZUA 1O3PB 1OXGA 2Q1JA 1ZJDA 3A86A 1DLKB 1ZRBA 1SR5C 1Q2WA 1AKSA 2NU0E 1EAIA 1ZHPA 3ATWA 4THNH 4GPGA 5L2ZH 1EZXC 3BIUH 1YPHC 1FY5A 3UUZA 4YO9A 1GDUA 1TMTH 1OP0A 1SSXA 3V12A 1CGIE 6GCHG 1O2QA 5AVDA 4GUXA 2WPLS 1S83A 5C1YA 4CH8B 2FTMA 1Z8IB 2SNWA 1O2OA 2G5NA 3SUFA 1AMHA 3EGKH 3RMLH 1P02A 1S85A 1J9CH 2ZFSA 4KTCA 3TU7H 1QB6A 3PWCA 2PW8H 1MU8B 2KAIB 1FIZA 3HATH 3UIRA 1GGDB 2A4QA 4O3TA 4TPIZ 3V7TA 5EXMA 4KGAA 2NU4E 4D7FA 3LGYA 3UQVA 1OX1A 2BM2A 2A32A 2BHGA 2VJ1A 1ACBE 5EODA 1ELTA 1GCTB 1C1OA 3B8JA 1GJAB 1HAVB 1D6WA 2R9PA 1CT2E 4ISHH 4NSYA 1GVLA 3VB3A 5FCKA