3M7UA

Crystal structure of alpha-lytic protease sb1+2 r64a/e182q mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDAAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFQRLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lytic protease
molecule tags Hydrolase
source organism Lysobacter enzymogenes
publication title Quantifying protein unfolding cooperativity with acid sensitive probes: Interdomain salt bridge contributions to unfolding cooperativity are combined efficiently in alpha-Lytic Protease
rcsb
total genus 54
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7uA01
3ATIA 1SSXA 1HAOH 1PPFE 1Z8JB 3UOUA 3T25A 4VGCC 2TGDA 1QGFA 2GCHF 4X1PU 1C5PA 3V13A 1AY6H 2P3TB 1SGPE 4NA7A 3BTHE 1L1GA 1C5SA 3RXVA 4MLFB 1BT7A 1O2WA 1AWFH 2QXJA 1FI8A 2ZGCA 1CT2E 1WV7H 4VGCB 1H9IE 1UTKA 1P2NA 1W10U 3B9FH 3SUEA 2OQ5A 2PGBB 1IQNA 1V2KT 4AFQA 1ZHRA 1B0FA 1GBKA 7GCHG 4WVPE 3LONA 1ZSJA 3LC3A 3STJA 2ULLA 5G4BA 2A0QB 3CS0A 4AG2A 1O3AA 1LHDH 3M7QA 1C1QA 2B0FA 4WWYA 5LPRA 3A84A 1GHAG 1ABIH 2PKAA 4B73A 4JZDH 3MH6A 4LZ4B 2OTVA 1EASA 1D3DB 3H5CB 5HYOA 1C5UA 5AFZH 3PMJA 1C9TA 3PWCA 1A5IA 2FLBH 1CQQA 3GY6A 4UD9H 3OY6U 2GV6A 3RXHA 1GBDA 1V2RT 3PMAB 1B0EA 1GMCF 1ZTJA 1XXDA 1AB9C 2UUJB 3M3TA 3M61U 4ABFA 2GKVE 2WINI 1ANBA 3ELAH 3GCOA 4K1TA 3UWJH 2FESH 1YC0A 3TJVA 1GVZA 7ESTE 4U30A 1H1BA 1HB0B 4QT8C 1XUFA 5GJ4B 1XUJA 2BZ6H 2ZGJA 1AVXA 2TIOA 3C27B 1GVKB 2ZDMA 3RXAA 1UO6A 2ZQ2A 1LHEH 1UTQA 4NGAH 3SQEE 2ZC9H 1MU8B 3F9GA 1GI1A 3A89A 1NFXA 2VH0A 2D8WA 1PQ5A 3TNSA 3TGKE 1SGIB 2FTLE 2SGAA 1HNEE 1F5LA 5T6FA 4ZROA 4B2AA 1SGDE 1O2QA 4CHAC 2F9NA 1CT4E 2BVRH 1TGSZ 2Z9KA 1W8BH 2SGDE 1O2SA 1PYTC 2G51A 2QN5T 3OU0A 3ZYDA 5K0HA 3QGNB 3RXPA 2A32A 1GMCG 1ZPBA 1WAYB 1P09A 2GTBA 2BY6X 2G4TA 1NT1A 1PPZA 2HWLB 3EQ0H 3L6PA 3SNBA 3SUFA 3TGJE 1ETSH 2HVXA 2JH0D 4YESB 1BMMH 1JRTA 1A61H 1AFQB 4KTSA 2ZDKA 1BRAA 2RA3A 4K2YA 2GX4A 5DP9A 3RM0H 1O2NA 1C1PA 4A6LA 1O38A 1A0HB 4Y7AA 1CO7E 3TK5A 2BDIA 2PTCE 2O8LA 5ESBA 2R0KA 1T8NA 2P59A 2A5IA 1GI2A 3PWBA 1C2FA 1PJPA 1OWJA 2FI4E 3LGWA 1H8IH 1BRBE 3LU9B 1RJXB 1SQAA 2ANMH 2O8TA 2XWBI 3LGTA 1P57B 4IS5A 4INKA 1DT2A 1KSNA 1SBWA 1F92A 2ODQA 2P3UB 3M5OA 1CGJE 2EI6A 1IHTH 3ZVEA 1DWCH 4YM9A 1KYNA 1QQUA 5A8ZA 4KP0A 1MKXH 4A5TS 2CHAC 2GZ9A 1F5RA 3HATH 2TBSA 6CHAB 2FX4A 3SJ9A 1K21H 3KIDU 1UCYE 1BA8B 3D62A 4X2XA 3M7UA 1ZMNA 5ABWA 2R2WU 4BAHB 4Q7XA 5F6MA 1NRPH 3RMLH 1XUKA 5HMAA 1T8OA 2G52A 1TFXA 1WCZA 2BY8X 1ELGA 3GCNA 3H7TA 2THFB 1UTLM 1V2PT 5DPAA 4K3JA 4U2WA 1YBWA 4B2BA 5I25A 4UFDH 5LPFA 3VXEH 1HJAB 3Q3KA 3RXEA 4NIVA 1EZSC 2FO9A 3LDXH 1HXEH 1Z71A 1YP9A 1SPJA 3MH7A 4ZH8A 2PUQH 2BHGA 1C1WH 1NS3A 1GG6B 2C8YB 2BMGB 1UTMA 3SJIA 4DIIH 3A80A 4GVUA 4JZ1A 1HBTH 4IMZA 1NRSH 4PROA 4UFGH 1BTUA 3BV9B 3TVJB 2G8TA 2ZU3A 5E0GA 1ZZZA 2ZEBA 1MTSA 5FPTA 2FOEA 2WPJS 1IQJA 4UDWH 4YT6H 1GDQA 1YF4A 2K1QA 3GY7A 1ANDA 5PTPA 3RXGA 5EW1H 1NPMA 3MYWA 2ZKSA 2H5CA 2WV4A 3MU8A 4NSVA 2QCYA 2OC1A 4BAOB 1C5QA 4OGXA 3BG4B 3PROA 2Q6DA 1DLKB 1FAKH 2BDYA 2OXSA 1FJSA 2CN0H 2A2QH 1P2KA 1GHAF 4WJG2 2WUBA 1V2NT 1RRKA 4AFZA 4I8HA 3I77A 1AGJA 1V2ST 1P9UA 3QO6A 4INHA 4WH8A 1KDQB 4KTUA 1QB1A 3IITA 1JMOH 1MTVA 2Y5FA 4KGAA 4A1XA 3HKIB 3LOXA 4NA9H 2BB4A 1P06A 1LVOA 1H9LB 1HXFH 1T32A 3G01A 2XYAA 1E0FD 1KXAA 4HI3A 5HM9A 5E8EH 3TITA 3A87A 3RXMA 1P2IA 2A5KA 1INCA 3NCLA 4ZAEA 1XVMA 3TGIE 1XKBC 3R0FA 3E6PH 3GCHC 4ISHH 4MQAA 4B71A 2FOFA 2F3CE 4DOQA 9LPRA 2HGTH 4MNYA 4JYVH 1UVTH 1HAYB 5C1UA 3QZRA 4X6NA 1C2MA 1C5RA 3QWCH 1FQ3A 1OWEA 2FS9A 2Z94A 1MTUA 1W14U 1ID5H 3M5MA 4AB9A 3AW1A 1GDUA 2HRVA 1VITG 3JZ1B 4I31A 4CRCA 4ABGA 4AGJA 1XUIA 1ELAA 2ESTE 3RXSA 1KXEA 3RXOA 1QJ1B 1GJAB 2J95A 1PPHE 3URCA 4ISNA 5I46H 3FANA 4GHQA 2D2DA 1FY8E 3M3VA 3F1SB 1GCTB 3V7TA 3MH5A 1HAPH 1QL7A 4BOHA 3TJUA 3FZDA 1KLTA 3RDZA 1FMGA 1DWEH 4Z6AH 2D1JA 3SU0A 1HJAC 2BD7A 1O5GH 1W11U 1CE5A 1MKWH 1TPAE 1TNLA 3S9CA 1TAWA 1O3KA 3GYLB 2BLVA 3IG6B 2P93A 3A7TA 2GP9B 1O2GH 1TGBA 1O3FA 2B7DH 4K1EA 1O3HA 4OS6A 2LNCA 3SQHE 4TWYA 1O5BB 3KQEA 4MPVA 5C5OA 5HGGA 1LPZB 2HNTF 4NSYA 2I6SA 2KAIB 2CF8H 4MVNA 5EPYA 1DOJA 1CT0E 4E05H 1XKAC 3D23A 6CHAC 1LKAA 4Y71A 3RXTA 3VB7A 1RTLA 4MNVA 1E36B 2G00A 1HUTH 2JH6D 2W26A 1CGHA 4FXGH 1ELDE 1ORFA 3GY8A 3K65B 4NWLA 1CBWB 4IN2A 3QK1A 1BHXF 1NFWA 2WPHS 4GSOA 1AKSB 1DS2E 4AX9H 1BJVA 5EXNA 1J8AA 2H1UA 2VIVA 4X2WA 1F7ZA 1GMHG 1QB6A 3FVFB 3RXQA 3QZQA 1ZPZA 4JCNA 1P2JA 1KXDA 2G5NA 1YKTA 1KLIH 3SU5A 1TBRH 4D7FA 5L30H 2STAE 1O3EA 2C90B 4I8KA 1VGCC 2R3UA 1NFUA 3SU4A 2BD5A 4NZQA 1K22H 5FX5A 2FM2A 2GVFA 2WPKS 1O32A 4BAKB 5EU8A 3TH4H 4INLA 2ZCKP 2A31A 3UPEA 3PV4A 1SGNE 1RFNA 2AMPA 3PTNA 2XCNA 3MNSA 4O9VA 1EPTB 4YLQH 4X6PA 1AZZA 1EAUA 1LHFH 1O2XA 2TGAA 1SGEE 2VB0A 4DY7B 2HLCA 1GMDG 3HK3B 3RU4T 1EJNA 2QYIA 1EP5A 1KXBA 2ZU1A 2AEIH 2ANKH 2BM2A 3FZZA 4X6MA 1NRRH 1MBMA 1GJ8B 2FOCA 1MTNB 3STIA 1EOJA 3TPIZ 3RU4D 5A0AE 2F9VA 2FS8A 4CBNA 5FBEA 3GCTG 1BHXB 2XWAA 2ZU4A 1O5AB 7KMEH 5JBTA 5EQQA 1WTHD 3UIRA 4ZKOU 1C5MD 3E3TA 4X1NU 2WV5A 1IQLA 4GAWA 3ZZBA 2F91A 3OTJE 1K1IA 1AWHB 2J34A 2SGFE 1DVAH 5FCRA 1E37B 1A2CH 1UTOA 4WXIA 1BTYA 1P10A 2AGEX 1O31A 3V12A 4GCHG 5EODA 2QGRA 1C2JA 2CMYA 2BD9A 2FP7B 2UUFB 5TCAA 3GY5A 2OD3B 3SV2H 1IQIA 2A4GA 3NWUA 1ABJH 1MD7A 1G2MA 1GJ6A 1OPHB 1OWIA 1AD8H 3KHVA 1A3EH 3KF2A 1PQ8A 3LT3A 1Q31A 2FOAA 1ZPCA 3TNTA 1DXPA 1UVOA 2J92A 3IWMA 1QCPA 5LGOA 1GBLA 1Y5AT 1LCYA 4XDEA 3VXFH 2VIWA 1SGTA 1C5XB 1LVBA 3M37A 2BYAX 1DITH 3SHAH 5C2ZA 1A0LA 1IOEA 1ELFA 1ESTA 2NU4E 5DP6A 1K1LA 1OP2A 1TWXB 1MKXK 3Q3YA 1T4UH 1TRYA 3T29A 3KGPA 3TJOA 4CRFA 1MAXA 1Z1JA 3RXLA 1S84A 3QTOH 3HK6B 1NO9H 1QA0A 4LOYH 4A7IB 4GCHF 1UTJA 1ZJKA 4NIYA 5E2PA 3GYMA 8GCHG 2P16A 2O8MA 1DWDH 4FUIA 1CA8B 1CGIE 1H8DH 1F0RA 1OYQA 4NIWA 1TRNA 1KY9A 2OQUA 2ZHQH 1DY9A 1C2GA 2SNVA 1BOQA 1BB0B 2ZI2H 2DE8A 5FBIA 1D3PB 1TPSA 1LPGB 1O35A 3ZZ5A 3VPKA 4XSKU 4ABEA 3P8OA 3A7WA 2QXIA 3AAUA 1O33A 5FPYA 4AZ2B 2ZWLH 5LPEA 1GI3A 1UK3A 3MMGA 5A2MH 4FVBA 2G5VA 1DE7H 1SQOA 2FYQA 3SNCA 3ZVCA 1Y3VA 1P0SH 3L3TA 1TX8A 4BTTB 1GHBF 1GJ9B 4OS1A 1WTGH 1AE5A 1FXYA 3A83A 5DP4A 2Y5HA 4MPXA 3QN7A 2ZTXA 2GDEH 1TMTH 2ZO3H 4NWKA 3QLPH 3SJ8A 2HNTC 2J4IA 4ZUHA 2ZHDA 3D49H 4UFEH 4X1SU 3BIVH 1Y8TA 5FXLA 3ATMA 3GDVA 3K2UA 3F68H 1FIWA 2BXUH 4IGDA 1T8MA 3M3SA 5FHTA 5J4SA 1YPGH 1JIRA 2R2MB 2Z6BD 3T27A 3PMBB 3T26A 1KTTB 1MMJN 3RP2A 1HYLA 8ESTE 3NXPA 1EXFA 3GY2A 1P12E 4E06H 3BF6H 1GBEA 1S81A 4ESTE 2WYJA 7GCHF 1F5KU 1G3EA 4D7GA 3E90B 1ZGVA 3A8AA 4ZMAH 3Q00A 5BPEA 1EJMA 3QX5H 1N1LA 1ZJDA 3RLWH 1HAGE 1Z6JH 3UNQA 1TRMA 4H42U 1LPKB 2FODA 3O8BA 1VGCB 2SFAA 5EG4A 2OINA 1QQ4A 2XBXA 5F8ZA 1BBRE 1BZXE 1XUHA 1HCGA 3RXUA 1NFYA 3RXDA 1KIGH 2NU0E 1C1TA 1IQHA 2DE9A 4XFQA 3GICB 1GJ5H 1P01A 1RIWB 3QGJA 4A1VA 5JBBS 2QA9E 1TX6A 1HAVB 2Z7FE 3MU5A 1JIMA 4CREA 1LVMA 4ABIA 1GBCA 1G3CA 5L2ZH 4UONA 1XMNB 1YM0A 2ZTZA 1S6HA 1CBWC 4NG9H 2GZ8A 2XCFA 3A85A 1Y59T 1SOTA 4JK5A 3NK8A 4WMEA 1O30A 4X0WU 1O3NA 1OSSA 2P95A 4RKJB 1AVWA 2ZGXH 1BBRK 2A1DB 4YOIA 3BTTE 1KLJH 1O2OA 3A7ZA 3KNXA 2VIPA 1YGCH 3U69H 5EQRA 1TONA 2XXLA 2IN2A 1ZOMA 5DP5A 4K60A 2PKAB 1MUEB 1TOMH 1P05A 3K9XB 3VFEA 1YPKH 5C20A 2H9EH 3NPSA 4NCYA 5FX6A 1DUAA 1OKXA 1NU7B 2AMQA 3UFAA 2EI7A 4FUBA 2ASUB 1DX5M 1SGQE 4K8BA 1ZGIA 1N8OC 2FDAA 1OWHA 3MO9A 2BQ6B 1MCVA 2NU1E 2Y5GA 2AS9A 4JMYA 3S9BA 2QIQA 1GCTC 4TYDA 4ISIH 5DP3A 1A46H 4AGKA 3DA9B 4I8GA 4IC6A 1C1OA 3FP6E 1ZRBA 2UUYA 2ALVA 1GMHF 2ANWA 2ZQ1A 2Y6TA 3KN2A 3M5NA 2ZFFH 1AUTC 1SGFG 2F9BH 3PLPA 5EOKA 1MTNC 1JBUH 2XW9A 1MZAA 1SGFA 5E0HA 3BEIB 4D8NA 2BVXH 2BZAA 1TQ7B 3NZIA 1YPJH 3D65E 1XXFA 8GCHF 4X2YA 4Q80A 4MPUA 2G4UA 2HPPH 1C2DA 2FOGA 4AN7A 1GHYH 3KCGH 3ZYEA 1SHHB 1C2IA 1GI8B 1TBQH 2ALPA 2EC9H 3PM3A 3ATWA 1SGRE 1GGDB 2ZTYA 1O39A 1EPTC 2PR3A 4RN6A 1DFPA 3ITIA 5IDKA 2W3KA 4YZUA 4YLUA 3PYHA 2W7UA 3SV8A 2FWWA 2OBQA 3LJJA 3UREA 4ZHAA 2FOMB 2AGGX 1NM6A 1T31A 1TOCB 1O3IA 3ZV8A 1GHZA 2BXTH 1MQ5A 1S6FA 4UE7H 5B6OA 2PWXA 1NN6A 3S69A 2GMTB 3AW0A 1ZHPA 2J9NA 1HV7A 4DCDA 2EI8A 4LK4A 2FMJA 3DHKH 1VJ9U 5AVDA 2QC2A 4BTUB 1D6WA 2GDDA 1DDJA 2QXHA 4O3TA 3DFLA 1PQ7A 2ZHFH 1LHCH 1S5SA 4ABDA 3FAOA 5JYIA 1PPCE 4Y0YE 1V2LT 2CJIA 4OS5A 2BD2A 4HFPB 1DY8A 1L1NA 4X8VH 2FOHA 4X1RU 1J15A 2TPIZ 1V2JT 1GHXH 4U01A 2UWPA 2JH5D 2YOLA 1O2LA 1NRNH 1KDQA 2FIRH 2QXGA 1C2HA 2A4QA 1T4VH 4Q7ZA 1QR3E 5FPSA 5TCCA 3EA9A 1GG6C 2QAAA 1UHBB 3MTYA 1BTWA 3SNEA 3JZ2B 3SUGA 2A2XH 2BDGA 1F0TA 2VH6A 1UMAH 4ABAA 4ABBA 3TK9A 1EP6A 2WPIS 2H9HA 4ABHA 3MHWU 5A0CA 3FP8E 4FU8A 4WH6A 1O5FH 1C1UH 1PPGE 4BANB 1LDTT 1N6XA 2TRMA 2AGIX 3EAJA 3RXCA 4ASHA 1C4V2 1L2EA 1AMHA 2AYWA 1QY6A 3UR6A 2BVSH 1MU6B 1HIAB 3VB6A 1P2MA 5TJXA 1YPHC 1TB6H 5JB8S 3I29A 4UEHH 3RUOA 2VU8E 5T6GA 3SW2B 1MD8A 5A09A 1LQEA 5GXPA 4I33A 4NFFA 1BMNH 1C5LH 2FX6A 1L0ZA 1TIOA 3VB3A 5C3NA 3BTQE 1EZQA 3LGIA 3LJOA 4CRGA 1SVPA 2PTNA 1HAHH 3SJKA 1MH0A 4K69A 3U1IB 1TNJA 5JBAS 1ZRKA 1FNIA 4D76A 1MTWA 2BD4A 1RGQA 3O8RA 3EYDA 1YPMH 1AHTH 1KTSB 3B23B 5K7RA 1Z8IB 1GJCB 1CHOF 4H4FA 1HPGA 2GMTC 1QBVH 3ENSB 1E34B 2Q1JA 3KQBA 1C1SA 4TY6A 2CF9H 1K1NA 3RLYH 3UNSA 3ZZ6A 4AYYB 4IMQA 3MU1A 4DT7B 3RU4E 1TABE 1N6YA 3FP7E 3ZZ3A 5A8XA 3P70B 4DGJA 4A1TA 1UHBA 3RC6A 3ATKA 3U8TH 2C93B 5BRRE 1J17T 1RD3B 2R0LA 3B8JA 3Q76A 4ISOA 1EQ9A 1G32B 1TPPA 1G3DA 5F03A 1O2IA 2BDBA 2FI3E 6GCHG 3BG4C 1ZTLA 2FI5E 3ODDA 1THPB 1GGDC 1CA0C 1H9HE 1SL3A 1AFEH 1C9PA 3F9FA 4XBCA 2G81E 2ZGBH 5F8TA 1DUEA 1K2I1 1TNGA 1IQEA 4CHAB 1ANEA 1Y3XA 2A5AA 4FUCA 1GPZA 4NFEA 4OS7A 1P3EA 1JXPA 3HGPA 1AKSA 2Z3CA 1C2KA 2LPRA 2ZPQA 4DG4A 1Q3XA 2Y7ZA 5FAHA 1TALA 1YCPH 1O2MA 2PLXA 1NESE 1KXFA 1MKWK 2NU3E 2UUKB 1SHYA 4ZHLU 5C1XA 1OP0A 2ZHWH 1AE8H 4YOJA 2P8OC 2VIOA 3PLBA 3MH4A 2OC0A 4GLYA 4YTAA 1D9IA 3ZZ7A 1FLEE 3EDXB 3PTBA 1FZZA 6GCHF 1AB9B 3MNCA 1W7XH 2TGPZ 3PB1E 2ZDAH 1GI0A 5CHAC 2B9LA 1K1JA 1HAVA 2NU2E 1UJ1A 4FVDA 3ZV9A 1GI4A 1ZMJA 2M5TA 2FEQH 4BAMB 1VR1H 1C5WB 1ZTKA 5CMXH 2TGTA 1J14A 1W12U 1TMBH 4CBOA 1VJAU 1GI6A 2CGAA 4AOQA 1XM1A 3SV6A 1GHWH 2VNTA 5DKMA 4KKDA 3HGNA 1EAXA 3LH3A 5GWZA 1LMWB 4BXSA 1QBNA 1GHBG 1GBHA 2AFQB 1TA6A 2C4FH 3GY4A 1ELVA 2ANYA 2Z3EA 1SGYE 2RCEA 4X8UH 4YO9A 1P03A 1GDNA 3NKKA 3P8NA 1UTNA 1SOZA 2B5TB 2Q6FA 2CHAB 3TK6A 2ZDLA 2IOTA 5DK1A 4TWWA 1L4ZA 1FV9A 2CV3A 2VWOA 2IPHA 3A82A 4K1SA 3UQOA 4KTCA 3E16B 1SLVB 2VWLA 3HKJB 5DG6A 3UOPA 3A7XA 1QIXB 1B7XB 1SLWB 2D26C 2V35A 1V2VT 3SGBE 1GWAA 2QF3A 5E2OA 4SGAE 1AIXH 3SNAA 1Z8RA 3ZVGA 5EPNA 1BQYA 1GBFA 1X7AC 1RIWC 3UNRA 3M5LA 1ACBE 2GGVB 1UVSH 2ZP0H 2A45B 2BX4A 2OC7A 1ARCA 1QJ7B 4J2YB 2XTTB 7LPRA 4GHTA 3SOSA 3CS7A 1LVYA 3A81A 5EXMA 5GIBA 4YOGA 1EPTA 2YNAA 4Z0KA 4XE4A 2ZDNA 1VCWA 1YPEH 3SU6A 1DPOA 4FUDA 3BN9A 1GJDB 2AH4X 4R8TB 3RMOH 2UWLA 1AFQC 4CH2B 5C67A 1FAXA 3I78A 1TA2A 1VCPA 3MNBA 1NROH 2FZZA 2ZIQH 2H9TH 6ESTA 3N7OA 4Y79A 1O3DA 2ZFQH 3AAVA 4JYUH 4AYVB 4MG3A 3GOVB 5T3HA 2OLGA 5DJ7A 1HGTH 3SV9A 1AU8A 1QJ6B 1QFKH 4WMFA 1IQGA 1C1MA 1TPOA 4GUXA 1SC8U 8KME2 4CR5A 4CR9A 2GV7A 2Z9JA 5JPMH 2UWOA 1V2OT 1A0JA 4D9RA 4F49A 2VWMA 1CVWH 1GHVH 1QB9A 1O2ZA 3QUMP 3RMMH 2ZPSA 1D4PB 1TE0A 3RXBA 3OSYA 1WU1A 4B2CA 3T28A 1MBQA 4TPYA 4MPWA 1J16A 2BLOA 3MU4A 3MU0A 5T6DA 2BTCE 1VITH 3BTWE 1U6QA 3H7OA 3DT0H 2B8OH 4Y8ZA 4ZKSU 1BMAA 1G2LA 3C1KA 1YYY1 1QL9A 4R0IA 2VINA 1HLTH 2AIPA 1O2TA 2XNIA 2C8WB 5DP8A 1P8VC 1QA7A 2Y80A 1MCTA 1GI7B 2BY5X 1D3TB 3SJOA 1GMDF 5ESTE 3A7VA 3M36A 4HZHA 1Z1IA 1S83A 1AVGH 1A5HA 1AZ8A 1C5NH 1FY1A 3A8DA 1F2SE 3U8RH 1HAZB 1SFQB 5L2YH 1W13U 1O3JA 2ZCLP 1V3XA 1O3GA 2J94A 4I32A 3A86A 1ZSKA 4XOJA 3SV7A 1WQSA 3U8OH 1BMLA 1J9CH 4K8YA 1O2UA 4JZFH 3M35A 2A4OA 3U9AH 1QBOA 1MZDA 1UCYK 3E0NB 1L4DA 3T62A 3ATLA 5AFYH 5AF9H 3QDZB 3S7HB 4D9QA 1V2WT 2FYRA 2VGCB 4AG1A 1BIOA 1ZLRA 2ZECA 2ODPA 1F0SA 1A5GH 2F83A 1QNJA 3DFJA 2ZFPH 1ESBA 3ZZ9A 1ESAA 3BTEE 3TU7H 3S7KB 4LXBH 4ISLA 1O5CB 3ZVBA 4O3UA 4IW4E 2ZCHP 2SGPE 1TBZH 2G55A 1P04A 2OCVB 4FU7A 4BXWA 1AQ7A 4JYTA 1AN1E 2QY0B 3T5FH 2Y81A 1DICA 1WUNH 1TGTA 1THSH 3R3GB 3ODFA 1MQ6A 2O8WA 2AMDA 4CH8B 9ESTA 2OP9A 5A0BA 6LPRA 1TYNA 5C5NA 4Y8YA 1Z8GA 4XBBA 1JOUB 4HTCH 1W0ZU 4Y11E 3SGAE 1S85A 3SU3A 5JB9S 1XX9A 1LO6A 1AUJA 1C4U2 1K1PA 2A7JA 1LQDB 2ZA5A 3W95A 1ANCA 1NRQH 3O8DA 3GDSA 3SO3A 2R3YA 2ZPRA 5J4QA 3E0PB 1FN6A 1WOFA 2PKSC 1K1MA 1TX7A 4X8TH 1Y5UT 1PPEE 3ZVAA 2SGEE 4Q7YA 5CHAB 1QRZA 2OC8A 1SI5H 1ETRH 3VB4A 3RXIA 5DP7A 2PSXA 4FU9A 5CE1A 4HGCA 4MTBA 3MI4A 3RC4A 4FUEA 3K6YA 2NWNA 1UCYH 3P17H 3TLOA 2P8OB 1O5DH 2WPLS 2BLQA 1PYTD 2XBVA 3PO1B 3ZZ4A 1CHOG 1BTXA 4XBDA 4E7NA 2PW8H 3W94A 1ZMLA 4UFFH 4X6OA 4Y8XA 2Z9IA 1EB2A 3SI3H 3Q77A 1ZR0A 1GJ4H 1CU1A 1GI5A 5A8YA 1OYTH 3MWIU 3AVZA 4I7YH 4WF8A 3KEEA 3ZVDA 2BD8A 2ZDVH 3KQCA 4JZIA 2P94A 1A3BH 1IAUA 1CA0B 1C5VA 3VGCC 1QL8A 1C2LA 1AO5A 5H4IB 1Z6EA 3DUXH 1S82A 1V2QT 1V6DA 1HIAA 2H2ZA 1Y3YA 3GISB 1BJUA 3SI4H 5DGJA 3FFGA 3BTKE 2FLRH 1C1RA 5EGMA 2OUAA 4NIXA 3HPTB 2XBYA 4FUHA 2IJOB 4WXVA 1G3BA 1GL0E 1EJAA 1BRUP 3LPRA 1NTPA 1ZHMA 1O5EH 2JETB 2RG3A 1GBJA 2A7HA 3S9AA 5EXLA 1DSUA 2GCTC 2C8ZB 4FUFA 1F0UA 1TNHA 5HXFA 1NC6A 1O3BA 1HJ8A 4Q2KA 1O2RA 1BITA 1ZSLA 3ESTA 1UTPA 1WYKA 4RSPA 2VIDA 1FN8A 2WPMS 1DSTA 4I8JA 5FCKA 1Y5BT 1O2HA 1M9UA 2ZG0H 1A4WH 2EEKA 4ZHMU 1RS0A 3VEQB 2ZF0H 1YCPM 1FONA 4Y0ZE 2C8XB 1OXGA 2F9UA 4JZEH 1BTZA 4H6SB 1DWBH 4AFUA 3CP7A 1NZQH 3SU1A 1VCQA 1ELBA 2Q6GA 4Y6DA 1HFDA 5EQSA 1UK2A 4U32A 1ELCA 3SN8A 1UVPA 1EZUC 3A7YA 1EZXC 2BD3A 1G30B 4I8LA 1IQMA 2O8UA 2ZU2A 4E7RG 1NU9A 5IYTA 2F9OA 3SHCH 1BCUH 4ZXYH 1FPHH 1Y3UA 3U1JB 3OYPA 1UVUH 1YLCA 3BTDE 2Z3DA 1EKBB 4AFSA 1O2JA 1RXPA 3NUMA 3RM2H 1B5GH 5HM2A 4WY3A 1V2UT 1WBGB 1TNIA 3MO3A 2XBWA 1SFIA 4M7GA 1LHGH 1DM4B 2ZGHA 2FOBA 4X1QU 4ZKRU 1FPCH 1OP8A 4TPIZ 1THRH 2Z9LA 2VVVA 2WUCA 2WYGA 4SGBE 3VB5A 1UK4A 1C5ZB 2O9QA 3T2NA 1SGCA 4DURA 1JWTA 1W2KH 1XUGA 2QV1A 2ILNA 2DUCA 1EUFA 2JKHA 3BTME 3UY9A 1QHRB 4JK6A 1TGNA 1GI9B 1IQKA 3CENA 3ZZAA 1FUJA 5JBCS 2Y7XA 3SU2A 3F9HA 2YNBA 1V2TT 2HNTE 3V3MA 2EA3A 4ZXXH 1C2EA 3EA8A 1O36A 1SB1H 3MOCA 3OX7U 2H5DA 2VVUA 4Y10E 3S0NA 3GCHB 2BQWB 3P6ZB 4K5ZA 2GT7A 2ZZUH 2PUXB 3LC5A 1T7CA 1GCDA 4O97A 5EW2H 4O03A 1V2MT 1OWDA 3URDA 2BX3A 1ARBA 1C5YB 1QRWA 3RXFA 1FDPA 2XC0A 4AB8A 1K9OE 2BOHB 4IN1A 4YT7H 2H6MA 3BG8A 2V6NA 3MFJA 4IBLH 2GCTB 3A8BA 3UTUH 1SMFE 3P92A 2AERH 3TIUA 3BTGE 3LGVA 1FY4A 2ZNKH 4DW2U 1K28D 1P02A 1SR5C 3GCTF 3GY3A 2ZU5A 3LGUA 1P3CA 2CXVA 5F8XA 4ZKNU 2QF0A 3A8CA 3BTFE 2J2UA 1O3LA 1K1OA 2ZFSA 2BY7X 1DXWA 1P11E 3GDUA 4MDSA 1TNKA 1YLDA 4LZ1H 1O2KA 1RTKA 3UR9A 1O2PA 2A4RA 4FUGA 4B74A 1EB1H 2GD4B 2PHBA 4H6TA 2HALA 1EATA 4CRAA 3F6UH 1ELTA 1W0YH 4Y7BA 4BTIB 4A92A 1S0QA 1FIZA 1AI8H 1YPHE 2HOBA 3RXKA 1HAXB 5GDSH 1BTPA 1L1JA 1FY5A 2BDCA 3PO1C 3ZZ8A 1IQFA 1P2OA 2HPQH 1CHGA 2V3OH 3Q3XA 2VVCA 1EX3A 2BY9X 1ELEE 1HRTH 1E35B 1ZYOA 1HDTH 1XVOA 1H4WA 2STBE 1EAIA 3BSQA 1Z7KA 1OX1A 2FXRA 1C1VH 2BDAA 1N8OB 5LH8A 4J1YA 1OWKA 1WQVH 3ZVFA 3TH3H 1NY22 2PKSB 4FUJA 4DVAU 1SLUB 1OOKB 1BRCE 4WMDA 3L33A 2W7SA 1C5OH 5GPIB 1P9SA 4CRDA 4Y76A 3TH2H 2J38A 1A1RA 4GPGA 5E0JA 1RTFB 3MNXA 2RDLA 5JDUB 1C1NA 3UWIA 2W3IA 3SUDA 4MNWA 3KQDA 2BQ7B 2I6QA 2GZ7A 4IC5A 3SBKA 3P95A 2AIQA 1KXCA 1O2YA 4F4OC 1C5TA 5ETXA 1GBAA 2V3HH 1QURH 3EA7A 3SGQE 3BEUA 1OS8A 2R9PA 3RMNH 1Q2WA 4B1TA 4DIHH 4RKOB 1YPLH 1G36A 3EGKH 1S0RA 1QRXA 2F9PA 2XC5A 1PFXC 1FY3A 1SG8B 3M7TA 4MNXA 3BIUH 4NZLA 1TMUH 2BOKA 2BLWA 1BTHH 1O3OA 2Y82A 2ZFTA 1GVLA 1TGCA 2XRCA 3QTVH 1T8LA 2VGCC 3SNDA 4AORA 4CRBA 2JETC 3ZZDA 1GBMA 1GJ7B 2Z9GA 3AASA 3LGYA 1DLEA 3U98H 1E38B 1O34A 2SGQE 1ETTH 3RXRA 4BNRA 3UUZA 2W5EA 5L6NH 1O0DH 1TQ0B 3A88A 1LTOA 1D6RA 1GBBA 2P3FH 1G37A 2OBOA 1PPBH 3SZNA 3PMHB 1EAWA 1TLDA 2V0BA 3BEFB 4TY7A 1O2VA 5AHGH 4KELA 1CSOE 1W3CA 1BBRH 4X2VA 1O3PB 3F9EA 2ZFRH 5GCHG 1DANH 3LKWA 3E1XB 3E91A 3OY5U 2PSYA 3RC5A 4ABJA 4X8SH 3K6ZA 3VGCB 3V0XA 4NA8A 1JRSA 1A7SA 1W7GH 4DJZB 2VWNA 2C3SA 1O3MA 3E8LA 3RXJA 5SGAE 4THNH 1PQAA 5C1YA 3O8CA 3KL6A 1YCPK 1O3CA 1LKBA 3PLKA 1C4Y2 1BDAA 3ZZCA 1GBTA 2KAIA 1P2QA 1SQTA 2A7CA 2BDHA 4OGYA 1SLXB 1O37A 2GCHG 2RA0A 2PGQB 4OS4A 3TJNA 4B75A 3DD2H 1HAIH 3P8GA 1G9IE 2VJ1A 3MO6A 4B76A 1BUIA 2GT8A 1IHSH 4OS2A 3EE0B 2SNWA 1VZQH 2FPZA 2ZHEH 5GCHF 3LH1A 1GJBB 3SORA 2VIQA 3LIWA 4BAQB 1HJ9A 8LPRA 1VITF 1MAYA 1Y3WA 1GL1A 1GBIA 1WSSH 2PV9B 3UQVA 1D3QB 2XC4A 1EOLA 1QTFA 2PFEA 2ODYB 5DO4H 3WY8A 3P8FA 2FTMA
chains in the Genus database with same CATH superfamily
2J98A 3ATIA 1SSXA 1HAOH 1PPFE 1Z8JB 3UOUA 3T25A 4VGCC 2TGDA 1QGFA 2GCHF 4X1PU 1C5PA 3V13A 1AY6H 2P3TB 1SGPE 4NA7A 3BTHE 1L1GA 1C5SA 3RXVA 5C94A 4MLFB 1BT7A 1O2WA 1AWFH 2QXJA 1FI8A 2ZGCA 1CT2E 1WV7H 4VGCB 1H9IE 1UTKA 1P2NA 2W6JD 1W10U 3B9FH 3SUEA 2OQ5A 2PGBB 1IQNA 1V2KT 2KCYA 3PRBA 4AFQA 1ZHRA 1B0FA 1GBKA 7GCHG 4WVPE 3LONA 1ZSJA 3LC3A 3STJA 2ULLA 5G4BA 2A0QB 3CS0A 4HG6A 4AG2A 1O3AA 2PP6A 1LHDH 3M7QA 1C1QA 2B0FA 4WWYA 5LPRA 3A84A 1GHAG 1ABIH 2PKAA 4B73A 4JZDH 3MH6A 4LZ4B 2OTVA 1EASA 1D3DB 3H5CB 5HYOA 1C5UA 5AFZH 3F2FA 3PV2A 3PMJA 1C9TA 3PWCA 1A5IA 2FLBH 1CQQA 3GY6A 4UD9H 3OY6U 2GV6A 5GNDA 3RXHA 1GBDA 1V2RT 3PMAB 1B0EA 3FN8A 1GMCF 1ZTJA 1XXDA 1AB9C 2UUJB 3M3TA 3M61U 4ABFA 2GKVE 2WINI 1ANBA 3ELAH 3GCOA 4K1TA 3UWJH 5KGOA 2FESH 1YC0A 3TJVA 1GVZA 7ESTE 4U30A 1H1BA 1HB0B 4QT8C 1XUFA 5GJ4B 4F48B 1XUJA 2BZ6H 2ZGJA 1AVXA 2TIOA 3C27B 1GVKB 2ZDMA 3RXAA 1UO6A 2ZQ2A 1LHEH 1UTQA 4NGAH 3SQEE 2ZC9H 3OE7D 1MU8B 3F9GA 1GI1A 3A89A 1NFXA 2D8WA 2VH0A 1PQ5A 3TNSA 3TGKE 1SGIB 5C17A 2FTLE 2SGAA 1HNEE 1F5LA 5T6FA 4ZROA 4B2AA 1SGDE 1MABB 1O2QA 4CHAC 2F9NA 1CT4E 2BVRH 3F0OA 1TGSZ 2Z9KA 1W8BH 3W1EA 2SGDE 1O2SA 3F2HA 1PYTC 2G51A 2QN5T 3OU0A 3ZYDA 5K0HA 3QGNB 3RXPA 2A32A 1GMCG 3DCLA 1ZPBA 1WAYB 1P09A 2GTBA 2BY6X 2G4TA 1NT1A 1PPZA 2HWLB 3EQ0H 3L6PA 3SNBA 3SUFA 3TGJE 1ETSH 2HVXA 2JH0D 4YESB 1BMMH 5CHBA 1JRTA 1A61H 1AFQB 4KTSA 2ZDKA 1BRAA 2RA3A 4B6EA 4K2YA 2GX4A 5DP9A 3RM0H 1O2NA 1C1PA 4A6LA 1O38A 1A0HB 4Y7AA 1CO7E 3TK5A 2BDIA 2PTCE 2O8LA 5ESBA 2R0KA 1T8NA 2P59A 4OM9A 2A5IA 1GI2A 3PWBA 1C2FA 1PJPA 1OWJA 2FI4E 3LGWA 1H8IH 1BRBE 3LU9B 1RJXB 1SQAA 2ANMH 2O8TA 2XWBI 3LGTA 3OEHD 1P57B 4IS5A 4INKA 1DT2A 1KSNA 1SBWA 1F92A 2ODQA 2P3UB 3M5OA 3DSOA 1CGJE 2EI6A 1IHTH 3ZVEA 1DWCH 4YM9A 1KYNA 1QQUA 5A8ZA 4KP0A 1MKXH 4A5TS 2CHAC 2OK5A 2GZ9A 1F5RA 3HATH 2TBSA 6CHAB 2FX4A 3SJ9A 1K21H 3KIDU 1UCYE 1BA8B 3D62A 4X2XA 3M7UA 1ZMNA 5ABWA 2R2WU 4BAHB 4Q7XA 5F6MA 1NRPH 3RMLH 1XUKA 2WZQA 2AHME 5HMAA 1T8OA 2G52A 5T1VA 1TFXA 1WCZA 2BY8X 1ELGA 3GCNA 3H7TA 2THFB 1UTLM 1V2PT 5DPAA 4K3JA 3F3BA 1YBWA 4U2WA 4B2BA 5I25A 4UFDH 5LPFA 3VXEH 1HJAB 3Q3KA 3RXEA 4NIVA 1EZSC 2FO9A 3LDXH 1HXEH 1Z71A 1YP9A 1SPJA 3MH7A 4ZH8A 2PUQH 2BHGA 1C1WH 1NS3A 1NBMD 1GG6B 2C8YB 2BMGB 1UTMA 3SJIA 4DIIH 3A80A 4GVUA 4JZ1A 1HBTH 4IMZA 1NRSH 4PROA 4UFGH 1BTUA 3BV9B 3TVJB 2G8TA 2ZU3A 5E0GA 1ZZZA 2ZEBA 1MTSA 5FPTA 2FOEA 2WPJS 2KFWA 1IQJA 4UDWH 4YT6H 1GDQA 1YF4A 2K1QA 3GY7A 1ANDA 5PTPA 3RXGA 5EW1H 1NPMA 3MYWA 2ZKSA 2H5CA 2WV4A 3MU8A 4NSVA 2QCYA 2OC1A 4BAOB 1UW7A 1C5QA 4OGXA 2RFKC 3BG4B 3OAAD 3PROA 2Q6DA 1DLKB 1FAKH 2BDYA 2OXSA 1FJSA 2CN0H 3OTPA 2A2QH 1P2KA 1GHAF 4WJG2 2WUBA 1V2NT 1RRKA 4AFZA 4I8HA 3I77A 1AGJA 1V2ST 1P9UA 3QO6A 4INHA 4WH8A 1KDQB 4KTUA 1QB1A 3IITA 1JMOH 1MTVA 1EFRD 1KMHB 2Y5FA 4KGAA 4A1XA 3HKIB 3LOXA 4NA9H 2BB4A 1P06A 1LVOA 1H9LB 1HXFH 1T32A 3G01A 2XYAA 1E0FD 1KXAA 4HI3A 5HM9A 5E8EH 1W0JD 3TITA 3A87A 3RXMA 1P2IA 2A5KA 1INCA 3NCLA 4ZAEA 1XVMA 3TGIE 1FX0B 1XKBC 3R0FA 3E6PH 3GCHC 4ISHH 4MQAA 2JDID 4B71A 2FOFA 2F3CE 4DOQA 9LPRA 2HGTH 2HVYB 4MNYA 4JYVH 1UVTH 1HAYB 3FKSD 5C1UA 3QZRA 4X6NA 1C2MA 1C5RA 3QWCH 1FQ3A 1OWEA 2FS9A 2Z94A 1MTUA 1W14U 1ID5H 3M5MA 4AB9A 3AW1A 1GDUA 2HRVA 1VITG 3JZ1B 2HLDD 4I31A 4CRCA 4ABGA 4AGJA 1XUIA 1ELAA 2ESTE 3RXSA 1KXEA 3RXOA 1QJ1B 3FOAA 1GJAB 2J95A 1PPHE 3URCA 4ISNA 5I46H 3FANA 4GHQA 2D2DA 1FY8E 3M3VA 3F1SB 1GCTB 3N7EA 3V7TA 3MH5A 1HAPH 1QL7A 4BOHA 4XD7D 3TJUA 3FZDA 1KLTA 3RDZA 1FMGA 1DWEH 4Z6AH 2D1JA 3SU0A 1HJAC 2BD7A 1O5GH 1W11U 1CE5A 1MKWH 1TPAE 1TNLA 3S9CA 1TAWA 1O3KA 3GYLB 2BLVA 3IG6B 2P93A 3A7TA 2GP9B 1O2GH 1TGBA 1O3FA 2B7DH 4K1EA 1O3HA 4OS6A 2LNCA 3SQHE 4TWYA 1O5BB 3KQEA 4MPVA 5C5OA 5HGGA 1LPZB 2HNTF 4NSYA 2I6SA 2KAIB 2CF8H 4MVNA 5EPYA 1DOJA 1CT0E 4E05H 1XKAC 3D23A 6CHAC 1LKAA 4Y71A 3RXTA 3VB7A 2EQNA 1RTLA 4MNVA 1E36B 2G00A 1HUTH 2JH6D 2W26A 1CGHA 4FXGH 1ELDE 1ORFA 3GY8A 3K65B 4NWLA 2VBCA 1CBWB 4IN2A 3QK1A 1BHXF 1NFWA 1WXRA 2WPHS 4GSOA 1AKSB 1DS2E 4AX9H 1BJVA 5EXNA 1J8AA 2H1UA 2VIVA 4X2WA 1F7ZA 1GMHG 1QB6A 3FVFB 3RXQA 3QZQA 1ZPZA 4JCNA 1P2JA 1KXDA 2G5NA 1SQRA 1YKTA 1KLIH 3SU5A 1TBRH 4D7FA 5L30H 2STAE 1O3EA 2C90B 4I8KA 1VGCC 2R3UA 1NFUA 3SU4A 2BD5A 4NZQA 1K22H 5FX5A 2FM2A 2GVFA 2WPKS 1O32A 4BAKB 5EU8A 3TH4H 4INLA 2ZCKP 2A31A 3UPEA 3PV4A 1SGNE 1RFNA 2AMPA 3PTNA 2XCNA 3MNSA 4O9VA 1EPTB 5HIZA 2W6ID 4YLQH 4X6PA 1AZZA 1EAUA 1LHFH 1O2XA 2TGAA 1SGEE 1YLNA 2VB0A 4DY7B 2HLCA 1GMDG 3HK3B 3RU4T 1EJNA 2QYIA 2WHXA 1EP5A 1KXBA 2ZU1A 2AEIH 2ANKH 2BM2A 3FZZA 2KM0A 4X6MA 1NRRH 1MBMA 1GJ8B 2FOCA 1MTNB 3STIA 1EOJA 3TPIZ 3RU4D 5A0AE 3DSPA 2F9VA 2FS8A 4CBNA 3DSGA 5FBEA 3GCTG 4TSFD 1BHXB 2XWAA 2ZU4A 1O5AB 7KMEH 5JBTA 5EQQA 1WTHD 3UIRA 4ZKOU 1C5MD 3E3TA 4X1NU 2WV5A 1IQLA 4GAWA 3ZZBA 2F91A 3OTJE 1K1IA 1AWHB 2J34A 2SGFE 1DVAH 5FCRA 1E37B 1A2CH 1UTOA 4WXIA 1BTYA 1P10A 2AGEX 1O31A 3V12A 4GCHG 5EODA 3OFND 2QGRA 1C2JA 2CMYA 2BD9A 2FP7B 1VKYA 2UUFB 5TCAA 3GY5A 2OD3B 3SV2H 1IQIA 2A4GA 3NWUA 1ABJH 1MD7A 1G2MA 1GJ6A 4ACAA 1OPHB 1OWIA 1AD8H 1H8ED 3KHVA 1A3EH 3KF2A 1PQ8A 3LT3A 1Q31A 2FOAA 1ZPCA 3TNTA 1DXPA 1UVOA 2J92A 3IWMA 1QCPA 5LGOA 1GBLA 1Y5AT 1LCYA 3KYGA 4XDEA 3VXFH 1SGTA 2VIWA 1C5XB 1LVBA 3M37A 2BYAX 1DITH 3SHAH 5C2ZA 1A0LA 1IOEA 1ELFA 1ESTA 2NU4E 5EJ1A 5DP6A 1K1LA 1OP2A 1TWXB 1MKXK 3Q3YA 1T4UH 1TRYA 2J97A 3T29A 3KGPA 3TJOA 4CRFA 1MAXA 1Z1JA 3RXLA 1S84A 3QTOH 3HK6B 1NO9H 1QA0A 4LOYH 4A7IB 4GCHF 1UTJA 1ZJKA 4NIYA 5E2PA 3GYMA 8GCHG 2P16A 2O8MA 1DWDH 4P02A 1QZ8A 4FUIA 1CA8B 1CGIE 1H8DH 1F0RA 1OYQA 4NIWA 1TRNA 1KY9A 2WV9A 2OQUA 2ZHQH 1DY9A 1C2GA 2SNVA 1BOQA 1BB0B 2ZI2H 2DE8A 5FBIA 1D3PB 1TPSA 1LPGB 1O35A 3ZZ5A 3VPKA 4XSKU 4ABEA 3P8OA 2YMSD 2QXIA 3A7WA 1O33A 3AAUA 5FPYA 4AZ2B 2ZWLH 5LPEA 1GI3A 1UK3A 3MMGA 5A2MH 4FVBA 2G5VA 1DE7H 1SQOA 2FYQA 3SNCA 3ZVCA 1Y3VA 1P0SH 3L3TA 1TX8A 4BTTB 1GHBF 1GJ9B 4OS1A 1WTGH 1AE5A 1FXYA 2J98B 3A83A 5DP4A 3GS9A 2Y5HA 4MPXA 3QN7A 2ZTXA 2GDEH 1TMTH 2ZO3H 4NWKA 3QLPH 3SJ8A 2HNTC 2J4IA 3F0PA 4ZUHA 2ZHDA 3D49H 4UFEH 4X1SU 2XOKD 3BIVH 1Y8TA 5EJLA 5FXLA 3ATMA 3GDVA 3K2UA 3F68H 1FIWA 2BXUH 4IGDA 2CK3D 1T8MA 3M3SA 5FHTA 5J4SA 1YPGH 1JIRA 2R2MB 2Z6BD 3T27A 3PMBB 3T26A 1KTTB 1MMJN 3RP2A 1HYLA 8ESTE 3NXPA 1EXFA 3GY2A 1P12E 4E06H 3BF6H 1GBEA 1S81A 4ESTE 2WYJA 7GCHF 1F5KU 1G3EA 4D7GA 3E90B 1ZGVA 3A8AA 4ZMAH 3Q00A 5BPEA 1H8HD 1EJMA 3QX5H 1N1LA 1ZJDA 3RLWH 1HAGE 1W0KD 1Z6JH 3UNQA 1SKYE 1TRMA 4H42U 1LPKB 2FODA 3O8BA 1VGCB 2SFAA 5EG4A 2OINA 1QQ4A 2XBXA 5F8ZA 1BBRE 1BZXE 1XUHA 1HCGA 3RXUA 5DSFA 1NFYA 3RXDA 1KIGH 2NU0E 1C1TA 1IQHA 2DE9A 4XFQA 3GICB 1GJ5H 1P01A 2V7QD 1RIWB 3QGJA 4A1VA 2M2AA 5JBBS 2QA9E 1TX6A 1HAVB 2Z7FE 3MU5A 1JIMA 3UB0A 4CREA 1LVMA 4ABIA 1GBCA 1G3CA 5L2ZH 4UONA 1XMNB 1YM0A 2ZTZA 1S6HA 1CBWC 4NG9H 2GZ8A 2XCFA 3A85A 1Y59T 1SOTA 4JK5A 3NK8A 4WMEA 1O30A 4X0WU 1O3NA 1OSSA 2P95A 4RKJB 1AVWA 2ZGXH 1BBRK 2A1DB 4YOIA 3BTTE 1KLJH 1O2OA 3A7ZA 3KNXA 2VIPA 1YGCH 3U69H 5EQRA 1TONA 2XXLA 2IN2A 1ZOMA 3AK5A 5DP5A 4K60A 2PKAB 1MUEB 1TOMH 1P05A 3K9XB 3VFEA 1YPKH 5C20A 2H9EH 3NPSA 4NCYA 5FX6A 1DUAA 1OKXA 1NU7B 2AMQA 3UFAA 3F2GA 2EI7A 4FUBA 2ASUB 1DX5M 1SGQE 4K8BA 1ZGIA 1N8OC 2FDAA 1OWHA 3MO9A 2BQ6B 1MCVA 2NU1E 2Y5GA 2AS9A 4JMYA 3S9BA 2QIQA 1GCTC 4TYDA 4ISIH 5DP3A 1A46H 4AGKA 3DA9B 4I8GA 4IC6A 1C1OA 3FP6E 3NRLA 1ZRBA 2UUYA 2ALVA 1GMHF 2ANWA 2ZQ1A 2Y6TA 3KN2A 3M5NA 2ZFFH 1AUTC 1SGFG 2F9BH 3PLPA 5EOKA 1MTNC 1JBUH 2XW9A 1MZAA 1SGFA 5E0HA 3BEIB 4D8NA 2BVXH 2BZAA 1TQ7B 3NZIA 1YPJH 3D65E 1XXFA 8GCHF 4X2YA 4Q80A 3N99A 4MPUA 2G4UA 2HPPH 1C2DA 2FOGA 4AN7A 1GHYH 3KCGH 3ZYEA 1SHHB 1C2IA 1GI8B 1TBQH 2ALPA 2EC9H 3PM3A 3ATWA 1SGRE 1GGDB 2ZTYA 1O39A 1EPTC 2PR3A 4RN6A 1DFPA 3ITIA 5IDKA 2W3KA 4YZUA 4YLUA 2F43B 3PYHA 2W7UA 3SV8A 2FWWA 5CDFE 2OBQA 1E1QD 3LJJA 3UREA 4ZHAA 2FOMB 2AGGX 1NM6A 1T31A 3WW7A 1TOCB 1O3IA 3ZV8A 1GHZA 2QF5A 2BXTH 1MQ5A 1S6FA 4UE7H 4I86A 5B6OA 2PWXA 1NN6A 3S69A 1BMFD 2GMTB 4DT4A 3AW0A 1ZHPA 2J9NA 1HV7A 4DCDA 2EI8A 4LK4A 2FMJA 3DHKH 1VJ9U 5AVDA 2QC2A 4BTUB 1D6WA 2GDDA 1DDJA 2QXHA 4O3TA 3WWBA 3DFLA 1PQ7A 2ZHFH 1LHCH 1S5SA 4ABDA 3FAOA 5JYIA 1PPCE 4Y0YE 1V2LT 2CJIA 4OS5A 2BD2A 4HFPB 1DY8A 1L1NA 4ACBA 4X8VH 2FOHA 4X1RU 1J15A 2TPIZ 1V2JT 1GHXH 4U01A 2UWPA 2L6OA 2JH5D 2YOLA 1O2LA 2QF4A 1NRNH 1KDQA 2FIRH 2QXGA 1C2HA 2A4QA 1T4VH 4Q7ZA 5KEDA 2QE7D 1QR3E 5FPSA 5TCCA 3EA9A 1GG6C 2QAAA 1UHBB 3MTYA 1BTWA 3SNEA 5HKKD 3JZ2B 3SUGA 2A2XH 2BDGA 1F0TA 2VH6A 1UMAH 4ABAA 4ABBA 3TK9A 1EP6A 2WPIS 2H9HA 4ABHA 3MHWU 5A0CA 3FP8E 4FU8A 4WH6A 1O5FH 1C1UH 1PPGE 4BANB 1LDTT 1N6XA 2TRMA 2AGIX 3EAJA 3RXCA 4ASHA 1C4V2 1L2EA 1AMHA 2AYWA 1QY6A 3UR6A 2BVSH 1MU6B 1HIAB 3VB6A 1P2MA 5TJXA 1YPHC 1TB6H 5JB8S 3I29A 4UEHH 3RUOA 2VU8E 5T6GA 3SW2B 1MD8A 5A09A 1LQEA 5GXPA 4I33A 4NFFA 1BMNH 1C5LH 2FX6A 1L0ZA 1TIOA 3VB3A 5C3NA 3BTQE 1EZQA 3LGIA 3LJOA 4CRGA 1SVPA 2PTNA 1HAHH 3SJKA 1MH0A 4K69A 3U1IB 1TNJA 2KX4A 1ZRKA 5FL7D 1FNIA 5JBAS 4D76A 1MTWA 2BD4A 2IPQX 1RGQA 3O8RA 3EYDA 1YPMH 1AHTH 1KTSB 3B23B 5K7RA 1Z8IB 1GJCB 1CHOF 4H4FA 1HPGA 2GMTC 1QBVH 3ENSB 1E34B 2Q1JA 3KQBA 1C1SA 4TY6A 2CF9H 1K1NA 3RLYH 3UNSA 3ZZ6A 4AYYB 4IMQA 3MU1A 4DT7B 3RU4E 1TABE 1N6YA 3FP7E 3ZZ3A 5A8XA 3P70B 4DGJA 4A1TA 1UHBA 3RC6A 3ATKA 3U8TH 2C93B 5BRRE 1J17T 1RD3B 2R0LA 3B8JA 3Q76A 1K0HA 4ISOA 1EQ9A 1G32B 1TPPA 1G3DA 5F03A 1E79D 1O2IA 2BDBA 2FI3E 6GCHG 3BG4C 1ZTLA 2FI5E 3ODDA 1THPB 1GGDC 1CA0C 1H9HE 1SL3A 1AFEH 1C9PA 3F9FA 4XBCA 2G81E 2ZGBH 5F8TA 1DUEA 1K2I1 1TNGA 1IQEA 4CHAB 1ANEA 1Y3XA 2A5AA 4FUCA 1GPZA 4NFEA 4OS7A 1P3EA 1JXPA 3HGPA 1AKSA 2Z3CA 1C2KA 2LPRA 2ZPQA 4DG4A 1Q3XA 2Y7ZA 5FAHA 1TALA 1YCPH 1O2MA 2PLXA 1NESE 1KXFA 1MKWK 2NU3E 2UUKB 1SHYA 4ZHLU 5C1XA 1OP0A 2ZHWH 1AE8H 4YOJA 2P8OC 2VIOA 3PLBA 3MH4A 2OC0A 4GLYA 4YTAA 1D9IA 3ZZ7A 1FLEE 3EDXB 3PTBA 1FZZA 6GCHF 3WWFA 1AB9B 3MNCA 1W7XH 2WPDD 2TGPZ 3PB1E 2ZDAH 1GI0A 5CHAC 5HIYA 2B9LA 1K1JA 1HAVA 2NU2E 1UJ1A 4FVDA 3ZV9A 1GI4A 1ZMJA 2M5TA 2FEQH 4BAMB 5EJZA 1VR1H 1C5WB 1ZTKA 5CMXH 2TGTA 1J14A 1W12U 1TMBH 4CBOA 1VJAU 1GI6A 2CGAA 4AOQA 1XM1A 3SV6A 1GHWH 2VNTA 5DKMA 4KKDA 3HGNA 1EAXA 3LH3A 5GWZA 1LMWB 4BXSA 1QBNA 1GHBG 1GBHA 2AFQB 1TA6A 2C4FH 3GY4A 1ELVA 2ANYA 2Z3EA 1SGYE 2RCEA 4X8UH 4YO9A 1P03A 1GDNA 3NKKA 3P8NA 1UTNA 1SOZA 2B5TB 2Q6FA 2CHAB 3TK6A 2ZDLA 2IOTA 5DK1A 4TWWA 1L4ZA 1FV9A 2CV3A 2VWOA 2IPHA 3A82A 4K1SA 1WDIA 3UQOA 4KTCA 3E16B 1SLVB 2VWLA 3HKJB 2KR7A 5DG6A 3EE7A 3UOPA 3A7XA 1QIXB 4XRNA 1B7XB 1SLWB 2D26C 2V35A 1V2VT 3SGBE 1GWAA 2QF3A 5E2OA 4SGAE 1AIXH 3SNAA 1Z8RA 3ZVGA 1NBME 5EPNA 1BQYA 1GBFA 1X7AC 1RIWC 3UNRA 3M5LA 1ACBE 2GGVB 4P00A 1UVSH 2ZP0H 5EIYA 2A45B 3U28C 2BX4A 2OC7A 1S6LA 1ARCA 1QJ7B 4J2YB 2XTTB 7LPRA 4GHTA 3SOSA 3CS7A 1LVYA 3A81A 5EXMA 5GIBA 4YOGA 1EPTA 2YNAA 4Z0KA 4XE4A 2ZDNA 1VCWA 1YPEH 3SU6A 1DPOA 4FUDA 3BN9A 1GJDB 2AH4X 4R8TB 3RMOH 2UWLA 1AFQC 4CH2B 5C67A 1FAXA 3I78A 1TA2A 1VCPA 3MNBA 4Z1MD 1NROH 2FZZA 3H09A 2ZIQH 2H9TH 6ESTA 3N7OA 4Y79A 2KCOA 1O3DA 2ZFQH 3AAVA 4JYUH 4AYVB 4MG3A 3GOVB 5T3HA 2OLGA 5DJ7A 1HGTH 3SV9A 1AU8A 1QJ6B 1QFKH 4WMFA 1IQGA 1C1MA 1TPOA 4GUXA 1SC8U 8KME2 4CR5A 4CR9A 2GV7A 2Z9JA 5JPMH 2UWOA 1V2OT 1A0JA 4D9RA 4F49A 2VWMA 1CVWH 1GHVH 1QB9A 1O2ZA 3QUMP 3RMMH 2ZPSA 1D4PB 1TE0A 3RXBA 3OSYA 1WU1A 4B2CA 3T28A 1MBQA 4TPYA 4MPWA 1J16A 2BLOA 3MU4A 3MU0A 5T6DA 2BTCE 1VITH 3BTWE 1U6QA 3H7OA 4TT3D 3DT0H 2B8OH 4Y8ZA 4ZKSU 1BMAA 1G2LA 3C1KA 1YYY1 5IK2D 1QL9A 4R0IA 2VINA 1HLTH 2AIPA 1O2TA 2XNIA 2C8WB 5DP8A 1P8VC 1QA7A 2Y80A 1MCTA 2WSSD 1GI7B 2BY5X 1D3TB 3SJOA 1GMDF 4FETA 5ESTE 3A7VA 3M36A 4HZHA 1Z1IA 1S83A 1AVGH 1A5HA 1AZ8A 1C5NH 1FY1A 3A8DA 1F2SE 3U8RH 1HAZB 1SFQB 5L2YH 1W13U 1O3JA 2ZCLP 1V3XA 1O3GA 2J94A 4I32A 3A86A 1ZSKA 4XOJA 3SV7A 1WQSA 3U8OH 1BMLA 1J9CH 4K8YA 3KYFA 1O2UA 4JZFH 3M35A 2A4OA 3U9AH 1QBOA 1MZDA 1UCYK 3E0NB 1L4DA 3T62A 3ATLA 4B6FA 5AFYH 5AF9H 3QDZB 3S7HB 4D9QA 1V2WT 2FYRA 2VGCB 4AG1A 1BIOA 1ZLRA 2ZECA 2ODPA 1F0SA 1A5GH 2F83A 1QNJA 3DFJA 3OEED 2ZFPH 1ESBA 3ZZ9A 1ESAA 3BTEE 3TU7H 3S7KB 4LXBH 4ISLA 1O5CB 3ZVBA 4O3UA 4IW4E 2ZCHP 2SGPE 1TBZH 2G55A 1P04A 2OCVB 4FU7A 4BXWA 1AQ7A 2L74A 4JYTA 1AN1E 2QY0B 3T5FH 2Y81A 1DICA 4ASUD 1WUNH 1TGTA 1THSH 3R3GB 3ODFA 1MQ6A 2O8WA 2AMDA 4CH8B 2JJ1D 9ESTA 2OP9A 5A0BA 6LPRA 1TYNA 5F53A 5C5NA 4Y8YA 1Z8GA 4XBBA 1JOUB 4HTCH 1W0ZU 4Y11E 3SGAE 1S85A 3SU3A 5JB9S 1XX9A 1LO6A 1AUJA 1C4U2 1K1PA 2A7JA 1LQDB 3FO8D 2ZA5A 3W95A 1ANCA 1NRQH 3O8DA 3GDSA 3SO3A 2R3YA 2ZPRA 5J4QA 3E0PB 1FN6A 1WOFA 2PKSC 1K1MA 1TX7A 4X8TH 1Y5UT 1PPEE 3ZVAA 2SGEE 4Q7YA 5CHAB 1QRZA 2OC8A 1SI5H 1ETRH 3VB4A 3RXIA 2XNDD 5DP7A 2PSXA 2J5UA 4FU9A 5CE1A 4HGCA 4MTBA 3MI4A 3RC4A 4FUEA 3K6YA 4ZCNA 2NWNA 1UCYH 3P17H 3TLOA 2P8OB 1O5DH 2WPLS 2BLQA 1PYTD 2XBVA 3PO1B 3ZZ4A 1CHOG 1BTXA 4XBDA 4E7NA 2PW8H 3W94A 1ZMLA 4UFFH 4X6OA 4Y8XA 2Z9IA 1EB2A 3SI3H 3Q77A 1ZR0A 1GJ4H 1CU1A 1GI5A 5A8YA 1OYTH 3MWIU 3AVZA 4I7YH 4WF8A 3KEEA 3ZVDA 2BD8A 2KZ4A 2ZDVH 3KQCA 4JZIA 2P94A 1A3BH 1IAUA 1CA0B 1C5VA 3VGCC 1QL8A 1C2LA 1AO5A 5H4IB 1Z6EA 3DUXH 1S82A 1V2QT 1V6DA 1HIAA 2H2ZA 1Y3YA 3GISB 1BJUA 4RI0A 3SI4H 5DGJA 3FFGA 3BTKE 2FLRH 1C1RA 5EGMA 2OUAA 4NIXA 3HPTB 2XBYA 4FUHA 3CNRA 2IJOB 4WXVA 1G3BA 1GL0E 1EJAA 1BRUP 2F4LA 3LPRA 1NTPA 1ZHMA 1O5EH 2JETB 2RG3A 1GBJA 2A7HA 3N7DA 3S9AA 5EXLA 3SZEA 1DSUA 2GCTC 2C8ZB 4FUFA 5B6LA 1F0UA 1TNHA 5HXFA 1NC6A 1O3BA 1HJ8A 4Q2KA 4Q4LA 1O2RA 1BITA 1ZSLA 3ESTA 1UTPA 3MQKC 3SYJA 1WYKA 4RSPA 2VIDA 1FN8A 2WPMS 1DSTA 4I8JA 5FCKA 1Y5BT 1O2HA 1M9UA 2LP6A 2ZG0H 1A4WH 2EEKA 4ZHMU 1RS0A 3VEQB 2ZF0H 1YCPM 2YMSB 1FONA 4Y0ZE 2C8XB 1OXGA 2F9UA 4JZEH 1BTZA 4H6SB 1DWBH 4AFUA 3CP7A 1NZQH 3SU1A 1VCQA 1ELBA 2Q6GA 4Y6DA 1HFDA 5EQSA 1UK2A 4U32A 1ELCA 3SN8A 1UVPA 1EZUC 3A7YA 1EZXC 2BD3A 1G30B 4I8LA 1IQMA 2O8UA 2ZU2A 4E7RG 1NU9A 5IYTA 2F9OA 3SHCH 1BCUH 4ZXYH 1FPHH 1Y3UA 3U1JB 3OYPA 1UVUH 1YLCA 3BTDE 2Z3DA 1EKBB 4AFSA 1O2JA 1RXPA 3NUMA 3RM2H 1B5GH 5HM2A 4WY3A 1V2UT 1WBGB 1TNIA 3MO3A 2XBWA 2V3MA 1SFIA 4M7GA 1LHGH 1DM4B 2ZGHA 2FOBA 4X1QU 4ZKRU 1FPCH 5KECA 1OP8A 4TPIZ 1THRH 2Z9LA 2VVVA 2WUCA 2WYGA 4SGBE 3VB5A 1UK4A 1C5ZB 2O9QA 3T2NA 5DN6D 1SGCA 4DURA 1JWTA 1W2KH 1XUGA 2QV1A 2ILNA 2DUCA 1EUFA 2JKHA 3BTME 3UY9A 1QHRB 4JK6A 1TGNA 1GI9B 1IQKA 3CENA 3ZZAA 1FUJA 5JBCS 2Y7XA 3SU2A 2JJ2D 3F9HA 2YNBA 1V2TT 2HNTE 3V3MA 2EA3A 4ZXXH 1C2EA 3EA8A 1O36A 1SB1H 3MOCA 3OX7U 4F55A 2H5DA 2VVUA 4Y10E 3S0NA 3GCHB 2BQWB 3P6ZB 4K5ZA 2GT7A 2ZZUH 2PUXB 2YMSC 3LC5A 1COWD 1T7CA 1GCDA 4O97A 5EW2H 4O03A 1V2MT 1OWDA 3URDA 2BX3A 1ARBA 1C5YB 1QRWA 3RXFA 1FDPA 2XC0A 4AB8A 1K9OE 2BOHB 4IN1A 4YT7H 2H6MA 3BG8A 2V6NA 3MFJA 4IBLH 2GCTB 3A8BA 3UTUH 1SMFE 3P92A 2AERH 3TIUA 1E1RD 3BTGE 3LGVA 1FY4A 2ZNKH 4DW2U 1K28D 1P02A 1SR5C 3GCTF 3GY3A 2ZU5A 3UAIC 3LGUA 1P3CA 2CXVA 5F8XA 4ZKNU 2QF0A 3A8CA 3BTFE 2J2UA 1O3LA 1K1OA 2ZFSA 2BY7X 1DXWA 1P11E 4AC9A 3GDUA 4MDSA 1TNKA 1YLDA 4LZ1H 1O2KA 1RTKA 3UR9A 1O2PA 2A4RA 4FUGA 4B74A 1EB1H 2KCPA 2GD4B 4M9FA 2PHBA 4H6TA 2HALA 1EATA 4CRAA 2JIZD 3F6UH 1ELTA 1W0YH 4Y7BA 4BTIB 4A92A 1S0QA 1FIZA 1AI8H 1YPHE 1YWUA 2HOBA 3RXKA 1HAXB 5GDSH 1BTPA 1L1JA 1FY5A 2BDCA 3PO1C 3ZZ8A 1IQFA 1P2OA 2HPQH 1CHGA 2V3OH 3Q3XA 2VVCA 1EX3A 2BY9X 1ELEE 1HRTH 1E35B 1ZYOA 2K0QA 3PRDA 1HDTH 1XVOA 1H4WA 1YY3A 2STBE 1EAIA 3BSQA 1Z7KA 2EY4C 1OX1A 2FXRA 1C1VH 2BDAA 1N8OB 5LH8A 4J1YA 1OWKA 1WQVH 3ZVFA 3TH3H 1NY22 2PKSB 4FUJA 4DVAU 4Q63A 1SLUB 1OOKB 1BRCE 4WMDA 3L33A 2W7SA 1C5OH 5GPIB 1P9SA 4CRDA 4Y76A 3TH2H 2J38A 1A1RA 4GPGA 5E0JA 1RTFB 3MNXA 2RDLA 5JDUB 1C1NA 3UWIA 2W3IA 3SUDA 4MNWA 3KQDA 2RDEA 2BQ7B 2I6QA 2GZ7A 4IC5A 3SBKA 3P95A 2AIQA 5C0UA 1KXCA 1O2YA 4F4OC 1C5TA 5ETXA 1GBAA 2V3HH 1QURH 3EA7A 3SGQE 3BEUA 1OS8A 2R9PA 3RMNH 1Q2WA 4B1TA 4RT0A 4DIHH 4RKOB 1YPLH 1G36A 3EGKH 1S0RA 1QRXA 5C0TA 2F9PA 2GJGA 1PFXC 1FY3A 1SG8B 2XC5A 3M7TA 3BIUH 4MNXA 4NZLA 1TMUH 2BOKA 2BLWA 1BTHH 1O3OA 2Y82A 2ZFTA 1GVLA 1TGCA 2XRCA 3QTVH 1T8LA 2VGCC 3SNDA 4AORA 4CRBA 2JETC 3ZZDA 1GBMA 1GJ7B 2Z9GA 3AASA 3LGYA 1DLEA 3U98H 1E38B 1O34A 2SGQE 1ETTH 3RXRA 3PV5A 4BNRA 3UUZA 2W5EA 5L6NH 4RT1A 1O0DH 1TQ0B 3A88A 1LTOA 1D6RA 1GBBA 2P3FH 1G37A 2OBOA 1PPBH 3SZNA 3PMHB 1EAWA 3ZIAD 1TLDA 2V0BA 3BEFB 4TY7A 1O2VA 5AHGH 4KELA 1CSOE 1W3CA 1BBRH 2KCAA 4X2VA 1O3PB 4YXWD 3F9EA 2ZFRH 5GCHG 1DANH 3KQ5A 3LKWA 3E1XB 3E91A 3OY5U 2PSYA 3RC5A 4ABJA 4X8SH 3K6ZA 3VGCB 3V0XA 4NA8A 1JRSA 1A7SA 1W7GH 4DJZB 2VWNA 2C3SA 1O3MA 3E8LA 3RXJA 5SGAE 4THNH 1PQAA 5C1YA 3O8CA 3KL6A 1YCPK 1O3CA 1LKBA 3PLKA 1C4Y2 1BDAA 3ZZCA 1GBTA 2KAIA 1P2QA 1SQTA 2A7CA 2BDHA 4OGYA 1SLXB 1O37A 2GCHG 2RA0A 2PGQB 4OS4A 3TJNA 4B75A 3DD2H 1HAIH 3P8GA 1G9IE 2VJ1A 3MO6A 4B76A 1BUIA 2GT8A 1IHSH 4OS2A 3EE0B 2SNWA 1VZQH 2FPZA 2ZHEH 5GCHF 2K8IA 3LH1A 1GJBB 3SORA 2VIQA 3LIWA 4BAQB 1HJ9A 2LELA 8LPRA 1VITF 1MAYA 1Y3WA 1GL1A 1GBIA 1OHHD 1WSSH 2PV9B 2IJD1 3UQVA 4FOUC 1D3QB 2XC4A 1EOLA 1QTFA 2PFEA 2ODYB 5DO4H 3WY8A 3P8FA 2FTMA 3VG8A
chains in the Genus database with same CATH topology
3ATIA 1SSXA 1HAOH 1PPFE 1Z8JB 3UOUA 3T25A 4VGCC 2TGDA 1QGFA 2GCHF 4X1PU 1C5PA 3V13A 1AY6H 2P3TB 1SGPE 4NA7A 3BTHE 1L1GA 1C5SA 3RXVA 4MLFB 1BT7A 1O2WA 1AWFH 2QXJA 1FI8A 2ZGCA 1CT2E 1WV7H 4VGCB 1H9IE 1UTKA 1P2NA 1W10U 3B9FH 3SUEA 2OQ5A 2PGBB 1IQNA 1V2KT 4AFQA 1ZHRA 1B0FA 1GBKA 7GCHG 4WVPE 3LONA 1ZSJA 3LC3A 3STJA 2ULLA 5G4BA 2A0QB 3CS0A 4AG2A 1O3AA 1LHDH 3M7QA 1C1QA 2B0FA 4WWYA 5LPRA 3A84A 1GHAG 1ABIH 2PKAA 4B73A 4JZDH 3MH6A 4LZ4B 2OTVA 1EASA 1D3DB 3H5CB 5HYOA 1C5UA 5AFZH 3PMJA 1C9TA 3PWCA 1A5IA 2FLBH 1CQQA 3GY6A 4UD9H 3OY6U 2GV6A 3RXHA 1GBDA 1V2RT 3PMAB 1B0EA 1GMCF 1ZTJA 1XXDA 1AB9C 2UUJB 3M3TA 3M61U 4ABFA 2GKVE 2WINI 1ANBA 3ELAH 3GCOA 4K1TA 3UWJH 2FESH 1YC0A 3TJVA 1GVZA 7ESTE 4U30A 1H1BA 1HB0B 4QT8C 1XUFA 5GJ4B 1XUJA 2BZ6H 2ZGJA 1AVXA 2TIOA 3C27B 1GVKB 2ZDMA 3RXAA 1UO6A 2ZQ2A 1LHEH 1UTQA 4NGAH 3SQEE 2ZC9H 1MU8B 3F9GA 1GI1A 3A89A 1NFXA 2VH0A 2D8WA 1PQ5A 3TNSA 3TGKE 1SGIB 2FTLE 2SGAA 1HNEE 1F5LA 5T6FA 4ZROA 4B2AA 1SGDE 1O2QA 4CHAC 2F9NA 1CT4E 2BVRH 1TGSZ 2Z9KA 1W8BH 2SGDE 1O2SA 1PYTC 2G51A 2QN5T 3OU0A 3ZYDA 5K0HA 3QGNB 3RXPA 2A32A 1GMCG 1ZPBA 1WAYB 1P09A 2GTBA 2BY6X 2G4TA 1NT1A 1PPZA 2HWLB 3EQ0H 3L6PA 3SNBA 3SUFA 3TGJE 1ETSH 2HVXA 2JH0D 4YESB 1BMMH 1JRTA 1A61H 1AFQB 4KTSA 2ZDKA 1BRAA 2RA3A 4K2YA 2GX4A 5DP9A 3RM0H 1O2NA 1C1PA 4A6LA 1O38A 1A0HB 4Y7AA 1CO7E 3TK5A 2BDIA 2PTCE 2O8LA 5ESBA 2R0KA 1T8NA 2P59A 2A5IA 1GI2A 3PWBA 1C2FA 1PJPA 1OWJA 2FI4E 3LGWA 1H8IH 1BRBE 3LU9B 1RJXB 1SQAA 2ANMH 2O8TA 2XWBI 3LGTA 1P57B 4IS5A 4INKA 1DT2A 1KSNA 1SBWA 1F92A 2ODQA 2P3UB 3M5OA 1CGJE 2EI6A 1IHTH 3ZVEA 1DWCH 4YM9A 1KYNA 1QQUA 5A8ZA 4KP0A 1MKXH 4A5TS 2CHAC 2GZ9A 1F5RA 3HATH 2TBSA 6CHAB 2FX4A 3SJ9A 1K21H 3KIDU 1UCYE 1BA8B 3D62A 4X2XA 3M7UA 1ZMNA 5ABWA 2R2WU 4BAHB 4Q7XA 5F6MA 1NRPH 3RMLH 1XUKA 5HMAA 1T8OA 2G52A 1TFXA 1WCZA 2BY8X 1ELGA 3GCNA 3H7TA 2THFB 1UTLM 1V2PT 5DPAA 4K3JA 4U2WA 1YBWA 4B2BA 5I25A 4UFDH 5LPFA 3VXEH 1HJAB 3Q3KA 3RXEA 4NIVA 1EZSC 2FO9A 3LDXH 1HXEH 1Z71A 1YP9A 1SPJA 3MH7A 4ZH8A 2PUQH 2BHGA 1C1WH 1NS3A 1GG6B 2C8YB 2BMGB 1UTMA 3SJIA 4DIIH 3A80A 4GVUA 4JZ1A 1HBTH 4IMZA 1NRSH 4PROA 4UFGH 1BTUA 3BV9B 3TVJB 2G8TA 2ZU3A 5E0GA 1ZZZA 2ZEBA 1MTSA 5FPTA 2FOEA 2WPJS 1IQJA 4UDWH 4YT6H 1GDQA 1YF4A 2K1QA 3GY7A 1ANDA 5PTPA 3RXGA 5EW1H 1NPMA 3MYWA 2ZKSA 2H5CA 2WV4A 3MU8A 4NSVA 2QCYA 2OC1A 4BAOB 1C5QA 4OGXA 3BG4B 3PROA 2Q6DA 1DLKB 1FAKH 2BDYA 2OXSA 1FJSA 2CN0H 2A2QH 1P2KA 1GHAF 4WJG2 2WUBA 1V2NT 1RRKA 4AFZA 4I8HA 3I77A 1AGJA 1V2ST 1P9UA 3QO6A 4INHA 4WH8A 1KDQB 4KTUA 1QB1A 3IITA 1JMOH 1MTVA 2Y5FA 4KGAA 4A1XA 3HKIB 3LOXA 4NA9H 2BB4A 1P06A 1LVOA 1H9LB 1HXFH 1T32A 3G01A 2XYAA 1E0FD 1KXAA 4HI3A 5HM9A 5E8EH 3TITA 3A87A 3RXMA 1P2IA 2A5KA 1INCA 3NCLA 4ZAEA 1XVMA 3TGIE 1XKBC 3R0FA 3E6PH 3GCHC 4ISHH 4MQAA 4B71A 2FOFA 2F3CE 4DOQA 9LPRA 2HGTH 4MNYA 4JYVH 1UVTH 1HAYB 5C1UA 3QZRA 4X6NA 1C2MA 1C5RA 3QWCH 1FQ3A 1OWEA 2FS9A 2Z94A 1MTUA 1W14U 1ID5H 3M5MA 4AB9A 3AW1A 1GDUA 2HRVA 1VITG 3JZ1B 4I31A 4CRCA 4ABGA 4AGJA 1XUIA 1ELAA 2ESTE 3RXSA 1KXEA 3RXOA 1QJ1B 1GJAB 2J95A 1PPHE 3URCA 4ISNA 5I46H 3FANA 4GHQA 2D2DA 1FY8E 3M3VA 3F1SB 1GCTB 3V7TA 3MH5A 1HAPH 1QL7A 4BOHA 3TJUA 3FZDA 1KLTA 3RDZA 1FMGA 1DWEH 4Z6AH 2D1JA 3SU0A 1HJAC 2BD7A 1O5GH 1W11U 1CE5A 1MKWH 1TPAE 1TNLA 3S9CA 1TAWA 1O3KA 3GYLB 2BLVA 3IG6B 2P93A 3A7TA 2GP9B 1O2GH 1TGBA 1O3FA 2B7DH 4K1EA 1O3HA 4OS6A 2LNCA 3SQHE 4TWYA 1O5BB 3KQEA 4MPVA 5C5OA 5HGGA 1LPZB 2HNTF 4NSYA 2I6SA 2KAIB 2CF8H 4MVNA 5EPYA 1DOJA 1CT0E 4E05H 1XKAC 3D23A 6CHAC 1LKAA 4Y71A 3RXTA 3VB7A 1RTLA 4MNVA 1E36B 2G00A 1HUTH 2JH6D 2W26A 1CGHA 4FXGH 1ELDE 1ORFA 3GY8A 3K65B 4NWLA 1CBWB 4IN2A 3QK1A 1BHXF 1NFWA 2WPHS 4GSOA 1AKSB 1DS2E 4AX9H 1BJVA 5EXNA 1J8AA 2H1UA 2VIVA 4X2WA 1F7ZA 1GMHG 1QB6A 3FVFB 3RXQA 3QZQA 1ZPZA 4JCNA 1P2JA 1KXDA 2G5NA 1YKTA 1KLIH 3SU5A 1TBRH 4D7FA 5L30H 2STAE 1O3EA 2C90B 4I8KA 1VGCC 2R3UA 1NFUA 3SU4A 2BD5A 4NZQA 1K22H 5FX5A 2FM2A 2GVFA 2WPKS 1O32A 4BAKB 5EU8A 3TH4H 4INLA 2ZCKP 2A31A 3UPEA 3PV4A 1SGNE 1RFNA 2AMPA 3PTNA 2XCNA 3MNSA 4O9VA 1EPTB 4YLQH 4X6PA 1AZZA 1EAUA 1LHFH 1O2XA 2TGAA 1SGEE 2VB0A 4DY7B 2HLCA 1GMDG 3HK3B 3RU4T 1EJNA 2QYIA 1EP5A 1KXBA 2ZU1A 2AEIH 2ANKH 2BM2A 3FZZA 4X6MA 1NRRH 1MBMA 1GJ8B 2FOCA 1MTNB 3STIA 1EOJA 3TPIZ 3RU4D 5A0AE 2F9VA 2FS8A 4CBNA 5FBEA 3GCTG 1BHXB 2XWAA 2ZU4A 1O5AB 7KMEH 5JBTA 5EQQA 1WTHD 3UIRA 4ZKOU 1C5MD 3E3TA 4X1NU 2WV5A 1IQLA 4GAWA 3ZZBA 2F91A 3OTJE 1K1IA 1AWHB 2J34A 2SGFE 1DVAH 5FCRA 1E37B 1A2CH 1UTOA 4WXIA 1BTYA 1P10A 2AGEX 1O31A 3V12A 4GCHG 5EODA 2QGRA 1C2JA 2CMYA 2BD9A 2FP7B 2UUFB 5TCAA 3GY5A 2OD3B 3SV2H 1IQIA 2A4GA 3NWUA 1ABJH 1MD7A 1G2MA 1GJ6A 1OPHB 1OWIA 1AD8H 3KHVA 1A3EH 3KF2A 1PQ8A 3LT3A 1Q31A 2FOAA 1ZPCA 3TNTA 1DXPA 1UVOA 2J92A 3IWMA 1QCPA 5LGOA 1GBLA 1Y5AT 1LCYA 4XDEA 3VXFH 2VIWA 1SGTA 1C5XB 1LVBA 3M37A 2BYAX 1DITH 3SHAH 5C2ZA 1A0LA 1IOEA 1ELFA 1ESTA 2NU4E 5DP6A 1K1LA 1OP2A 1TWXB 1MKXK 3Q3YA 1T4UH 1TRYA 3T29A 3KGPA 3TJOA 4CRFA 1MAXA 1Z1JA 3RXLA 1S84A 3QTOH 3HK6B 1NO9H 1QA0A 4LOYH 4A7IB 4GCHF 1UTJA 1ZJKA 4NIYA 5E2PA 3GYMA 8GCHG 2P16A 2O8MA 1DWDH 4FUIA 1CA8B 1CGIE 1H8DH 1F0RA 1OYQA 4NIWA 1TRNA 1KY9A 2OQUA 2ZHQH 1DY9A 1C2GA 2SNVA 1BOQA 1BB0B 2ZI2H 2DE8A 5FBIA 1D3PB 1TPSA 1LPGB 1O35A 3ZZ5A 3VPKA 4XSKU 4ABEA 3P8OA 3A7WA 2QXIA 3AAUA 1O33A 5FPYA 4AZ2B 2ZWLH 5LPEA 1GI3A 1UK3A 3MMGA 5A2MH 4FVBA 2G5VA 1DE7H 1SQOA 2FYQA 3SNCA 3ZVCA 1Y3VA 1P0SH 3L3TA 1TX8A 4BTTB 1GHBF 1GJ9B 4OS1A 1WTGH 1AE5A 1FXYA 3A83A 5DP4A 2Y5HA 4MPXA 3QN7A 2ZTXA 2GDEH 1TMTH 2ZO3H 4NWKA 3QLPH 3SJ8A 2HNTC 2J4IA 4ZUHA 2ZHDA 3D49H 4UFEH 4X1SU 3BIVH 1Y8TA 5FXLA 3ATMA 3GDVA 3K2UA 3F68H 1FIWA 2BXUH 4IGDA 1T8MA 3M3SA 5FHTA 5J4SA 1YPGH 1JIRA 2R2MB 2Z6BD 3T27A 3PMBB 3T26A 1KTTB 1MMJN 3RP2A 1HYLA 8ESTE 3NXPA 1EXFA 3GY2A 1P12E 4E06H 3BF6H 1GBEA 1S81A 4ESTE 2WYJA 7GCHF 1F5KU 1G3EA 4D7GA 3E90B 1ZGVA 3A8AA 4ZMAH 3Q00A 5BPEA 1EJMA 3QX5H 1N1LA 1ZJDA 3RLWH 1HAGE 1Z6JH 3UNQA 1TRMA 4H42U 1LPKB 2FODA 3O8BA 1VGCB 2SFAA 5EG4A 2OINA 1QQ4A 2XBXA 5F8ZA 1BBRE 1BZXE 1XUHA 1HCGA 3RXUA 1NFYA 3RXDA 1KIGH 2NU0E 1C1TA 1IQHA 2DE9A 4XFQA 3GICB 1GJ5H 1P01A 1RIWB 3QGJA 4A1VA 5JBBS 2QA9E 1TX6A 1HAVB 2Z7FE 3MU5A 1JIMA 4CREA 1LVMA 4ABIA 1GBCA 1G3CA 5L2ZH 4UONA 1XMNB 1YM0A 2ZTZA 1S6HA 1CBWC 4NG9H 2GZ8A 2XCFA 3A85A 1Y59T 1SOTA 4JK5A 3NK8A 4WMEA 1O30A 4X0WU 1O3NA 1OSSA 2P95A 4RKJB 1AVWA 2ZGXH 1BBRK 2A1DB 4YOIA 3BTTE 1KLJH 1O2OA 3A7ZA 3KNXA 2VIPA 1YGCH 3U69H 5EQRA 1TONA 2XXLA 2IN2A 1ZOMA 5DP5A 4K60A 2PKAB 1MUEB 1TOMH 1P05A 3K9XB 3VFEA 1YPKH 5C20A 2H9EH 3NPSA 4NCYA 5FX6A 1DUAA 1OKXA 1NU7B 2AMQA 3UFAA 2EI7A 4FUBA 2ASUB 1DX5M 1SGQE 4K8BA 1ZGIA 1N8OC 2FDAA 1OWHA 3MO9A 2BQ6B 1MCVA 2NU1E 2Y5GA 2AS9A 4JMYA 3S9BA 2QIQA 1GCTC 4TYDA 4ISIH 5DP3A 1A46H 4AGKA 3DA9B 4I8GA 4IC6A 1C1OA 3FP6E 1ZRBA 2UUYA 2ALVA 1GMHF 2ANWA 2ZQ1A 2Y6TA 3KN2A 3M5NA 2ZFFH 1AUTC 1SGFG 2F9BH 3PLPA 5EOKA 1MTNC 1JBUH 2XW9A 1MZAA 1SGFA 5E0HA 3BEIB 4D8NA 2BVXH 2BZAA 1TQ7B 3NZIA 1YPJH 3D65E 1XXFA 8GCHF 4X2YA 4Q80A 4MPUA 2G4UA 2HPPH 1C2DA 2FOGA 4AN7A 1GHYH 3KCGH 3ZYEA 1SHHB 1C2IA 1GI8B 1TBQH 2ALPA 2EC9H 3PM3A 3ATWA 1SGRE 1GGDB 2ZTYA 1O39A 1EPTC 2PR3A 4RN6A 1DFPA 3ITIA 5IDKA 2W3KA 4YZUA 4YLUA 3PYHA 2W7UA 3SV8A 2FWWA 2OBQA 3LJJA 3UREA 4ZHAA 2FOMB 2AGGX 1NM6A 1T31A 1TOCB 1O3IA 3ZV8A 1GHZA 2BXTH 1MQ5A 1S6FA 4UE7H 5B6OA 2PWXA 1NN6A 3S69A 2GMTB 3AW0A 1ZHPA 2J9NA 1HV7A 4DCDA 2EI8A 4LK4A 2FMJA 3DHKH 1VJ9U 5AVDA 2QC2A 4BTUB 1D6WA 2GDDA 1DDJA 2QXHA 4O3TA 3DFLA 1PQ7A 2ZHFH 1LHCH 1S5SA 4ABDA 3FAOA 5JYIA 1PPCE 4Y0YE 1V2LT 2CJIA 4OS5A 2BD2A 4HFPB 1DY8A 1L1NA 4X8VH 2FOHA 4X1RU 1J15A 2TPIZ 1V2JT 1GHXH 4U01A 2UWPA 2JH5D 2YOLA 1O2LA 1NRNH 1KDQA 2FIRH 2QXGA 1C2HA 2A4QA 1T4VH 4Q7ZA 1QR3E 5FPSA 5TCCA 3EA9A 1GG6C 2QAAA 1UHBB 3MTYA 1BTWA 3SNEA 3JZ2B 3SUGA 2A2XH 2BDGA 1F0TA 2VH6A 1UMAH 4ABAA 4ABBA 3TK9A 1EP6A 2WPIS 2H9HA 4ABHA 3MHWU 5A0CA 3FP8E 4FU8A 4WH6A 1O5FH 1C1UH 1PPGE 4BANB 1LDTT 1N6XA 2TRMA 2AGIX 3EAJA 3RXCA 4ASHA 1C4V2 1L2EA 1AMHA 2AYWA 1QY6A 3UR6A 2BVSH 1MU6B 1HIAB 3VB6A 1P2MA