3M7UA

Crystal structure of alpha-lytic protease sb1+2 r64a/e182q mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDAAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFQRLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lytic protease
publication title Quantifying protein unfolding cooperativity with acid sensitive probes: Interdomain salt bridge contributions to unfolding cooperativity are combined efficiently in alpha-Lytic Protease
rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
total genus 54
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7uA01
7KMEH 2GZ9A 3OY5U 4CH2B 5JB8S 1RXPA 1SLXB 1VITF 1HXFH 2BDGA 4B2BA 3KF2A 2GMTC 1ZSLA 1UMAH 4MNYA 5SGAE 2FI3E 4BAMB 2V6NA 4YOIA 5GWZA 2FESH 3I29A 4DGJA 1O3KA 2TGPZ 2ZIQH 3E1XB 3RXVA 4NIYA 4YOGA 1LDTT 4BTUB 3E0PB 1YM0A 1NZQH 2VGCB 2A7JA 2ZFFH 1GCDA 2P94A 3HPTB 1Y59T 2ZHWH 4Y10E 5EGMA 1YP9A 4E05H 3SU2A 1S6FA 2Y5FA 1D4PB 4A1XA 1G37A 3E8LA 1L1GA 1MUEB 3U8TH 4IGDA 1HAIH 3V12A 2BLOA 5LPRA 1UTPA 1BT7A 4AYYB 2ZCKP 4MPXA 1GMDF 3HK6B 1MAXA 1EB2A 2AIQA 3U69H 1Y3YA 1MCTA 3A82A 1QA7A 2ALPA 2OLGA 1JIMA 2BY5X 1AU8A 2ULLA 1HAPH 4LZ1H 2HLCA 5AHGH 1QY6A 1Q31A 1JBUH 2GCHG 4OS6A 2HNTF 3M7QA 1W7XH 4DVAU 3RXRA 1C5NH 1ZR0A 1O3NA 5C20A 3Q00A 3DUXH 1O38A 2FOMB 2C90B 3GOVB 3PTBA 1MTNB 4ZHLU 2J95A 3BTEE 3TJUA 1BTHH 1OP2A 1TWXB 1O5CB 2BDCA 1Z8RA 3UWIA 2VIOA 3RU4D 1GHVH 1NTPA 2XRCA 4AN7A 1Z8JB 3VEQB 2DE9A 2FS8A 4HZHA 1H8IH 5DP3A 4B76A 1HAHH 4Q7YA 1W13U 2XWBI 4FUHA 4MG3A 3SV2H 2ZGCA 1FNIA 1SPJA 3MO9A 1F5LA 2VJ1A 1P2KA 1TOMH 4F49A 1QJ1B 1C5VA 3M3TA 2XXLA 5LGOA 1F2SE 3RC5A 1ZTLA 1DXWA 3OTJE 4XBDA 4XDEA 1C5OH 1PPBH 1ETTH 3TVJB 2GGVB 1TABE 1FJSA 1GI1A 3KQCA 3U8RH 1EKBB 1YPKH 2VB0A 2ZFTA 4J2YB 4TY7A 1UTKA 2ODQA 1A5IA 1HAVB 4D8NA 5ETXA 2OC7A 1TA2A 4FVDA 3RXSA 1XUKA 2Q6GA 1O2KA 3M37A 1NRPH 2BHGA 2OTVA 2GCTB 2QC2A 2Q6FA 1G9IE 1SGFA 4BXWA 2VIDA 1SOZA 1WOFA 1WV7H 1GHXH 1NFWA 3T25A 1BTXA 3MO6A 2G5NA 2BD5A 9ESTA 2DE8A 1GBAA 1IOEA 2ZFPH 4X0WU 5C2ZA 1DE7H 3W94A 1W10U 3UQVA 3GISB 1F92A 2ZCLP 1A7SA 1FLEE 1MKWK 3U98H 3LGIA 4K1EA 2FIRH 2GVFA 3GY7A 5DG6A 1LVOA 1UTMA 1G2MA 1T7CA 3D62A 4WMDA 5FBIA 3E3TA 3A7ZA 4UD9H 4QT8C 1QQUA 3P70B 1SGQE 2ZO3H 1BIOA 1F5KU 4YOJA 1OSSA 1IQJA 1D9IA 4U30A 2A32A 4I32A 5EQQA 5JPMH 1BMMH 2VH0A 1SGIB 3KIDU 3A7VA 5F8XA 3PROA 1L0ZA 2BDHA 2BOHB 2QN5T 1QL8A 2Z3CA 2ALVA 1D3TB 4E06H 4Y71A 1GGDB 1SQOA 1O3LA 1MD7A 3DFLA 3GCHC 5F8TA 3TK5A 1XUJA 2I6QA 4GCHG 5EXNA 1GHZA 1LHEH 2YOLA 3ATIA 1O2VA 4LOYH 2EI8A 1MTWA 1ELDE 4NFEA 3UR6A 4RN6A 4MTBA 2J2UA 1O36A 2FTMA 3VB4A 1QA0A 3NXPA 1VITG 1K9OE 1MKXK 4NZQA 5T6FA 1D3DB 2G4TA 1QJ6B 1TNKA 2W3IA 3GY2A 3BTKE 3RU4E 5F8ZA 1W0ZU 1H9HE 1ID5H 3MO3A 1LVBA 1NU9A 3ZZ8A 5DP5A 2F9PA 4HI3A 5CHAC 2PGQB 1AZZA 1K1JA 1LVYA 1DSUA 1K1MA 1BQYA 2FMJA 1WSSH 4UEHH 2Y5HA 5JBCS 2QGRA 1IQFA 3LGTA 2VWMA 1CHGA 1G3BA 3K9XB 1EOLA 2EC9H 1QHRB 3P8GA 3F1SB 1O3GA 4XBCA 4AFSA 1WYKA 3TK9A 1A3BH 1XUHA 3A87A 1ELEE 1GMDG 3JZ1B 1DICA 1BDAA 1AE8H 1AN1E 4KTSA 5LPEA 4UFDH 1QIXB 3M5LA 1AE5A 1CA0B 4NWKA 1AY6H 1QRWA 1YPMH 3MU8A 2FX6A 3SNCA 1D6RA 4X6NA 1P2MA 1JRTA 3BSQA 1MH0A 1AVWA 1EP6A 4Y0ZE 1C9PA 4YLUA 3SJIA 1C5ZB 2ZQ2A 3ZVCA 3ZZ6A 1ANCA 1P9SA 1O3EA 1WTHD 3ATLA 2TPIZ 3HK3B 3BTWE 4X1QU 2BLQA 1QFKH 2W3KA 5TCAA 3U1IB 3BG4C 1RD3B 1HRTH 3A8AA 2GMTB 1HNEE 3O8DA 1P0SH 1AFEH 1O3JA 1G36A 4MPVA 4IC5A 1XVMA 1GBMA 3IITA 2ZU5A 1J15A 1H9LB 1KY9A 3D23A 3I77A 1GDQA 1CHOG 1AFQC 1OWEA 1OWKA 4X6MA 3RLYH 1C2MA 3SJ9A 1GVZA 1ZRBA 3SQEE 1IQMA 2FOHA 4M7GA 1O2QA 5EQSA 1XXFA 5JBAS 3QGNB 3S7KB 1ZGVA 3RMMH 3TGJE 5EXLA 4UFFH 1O2NA 1O5EH 1QR3E 2HNTE 1MTVA 1GHAF 3RU4T 2NU2E 3UUZA 1O2UA 5HM9A 1B7XB 4ABAA 1BMLA 1BCUH 1RFNA 4DT7B 2OXSA 1V2NT 2ZG0H 4O3UA 1YLCA 3QX5H 2JH6D 4NIVA 4JK5A 1VGCC 1ESAA 3SI4H 1A1RA 3OSYA 4NIWA 4NA9H 1C2LA 3URDA 1HIAB 3SQHE 2ZHDA 4CRGA 2WINI 1TNJA 1P09A 2BD4A 1SSXA 2GX4A 1O3AA 2XTTB 8LPRA 3BIVH 3FVFB 4MVNA 3LC5A 2J9NA 4MNVA 2PUQH 4DW2U 1Y5UT 2OQ5A 3CS7A 1YYY1 2ZU2A 3S7HB 2OCVB 1TNIA 3U8OH 1GMCF 1AMHA 1Z7KA 4WVPE 1GI9B 2B0FA 5T6DA 2XBXA 2ZF0H 1DPOA 1UTLM 1GBLA 1UTQA 2J34A 3PB1E 3NUMA 4WXIA 1QB9A 2BZAA 1YCPK 3RUOA 3T29A 3GY6A 1GVLA 5L2ZH 1TMTH 3UTUH 1RTLA 4FUDA 1IQEA 4E7NA 1IQHA 1DY9A 2FLRH 4HGCA 4FUJA 4UFGH 1O2IA 1HAYB 1L1NA 4GSOA 4AGKA 2PV9B 2M5TA 1AVXA 5I25A 3KQBA 1NRQH 2BY6X 4AB9A 1UK3A 5E2PA 4ABDA 3ZYEA 3MU0A 5G4BA 3UNSA 3SGAE 4JYUH 4B74A 2ZGJA 1A0JA 1EZSC 1QTFA 4NSVA 2OUAA 4BANB 1V2MT 2ZNKH 2WV4A 2BXUH 3GY3A 3LGYA 4ASHA 1E38B 3QTVH 1J9CH 1W11U 3QDZB 1KXCA 2ZZUH 4Y79A 1PFXC 2CV3A 1O2RA 4YT7H 4R0IA 1ZMJA 5E2OA 1O0DH 2C93B 2CGAA 1C9TA 1ESTA 3LKWA 1PPZA 2IPHA 2H9HA 1EXFA 1V2UT 2ZI2H 3VGCC 2G4UA 3RXKA 1J17T 1HGTH 5GDSH 2Y80A 1QRXA 3OU0A 5JBBS 1FY8E 3U1JB 3SHAH 3V3MA 2OINA 4Y8XA 3SGQE 2AGGX 2Z94A 4WY3A 4BAHB 1C2EA 2VH6A 4YLQH 3MH7A 4ISNA 2UUFB 3A88A 3GCHB 3SI3H 1CBWC 3JZ2B 4DJZB 2BB4A 1YLDA 2CF9H 5EW2H 2QF0A 4MNWA 3LPRA 1P2NA 4A1VA 1HJAC 2XWAA 1O37A 3PWBA 4JZDH 4ZMAH 1MCVA 2FDAA 1T8NA 1LHCH 1GBCA 3FP8E 2VIPA 1ETRH 5DO4H 1N8OC 1GI0A 2ZTXA 1TA6A 1HAZB 5L30H 2RA0A 2HPQH 4HTCH 1BHXF 1INCA 1MQ6A 2XBWA 3DA9B 4R8TB 5LPFA 5DP4A 3B9FH 1AWHB 2CXVA 1ANBA 1TGTA 3A7TA 3SN8A 1GHYH 3SJKA 2SGQE 3KN2A 1THSH 1Y8TA 5CHAB 3K2UA 3C27B 1O2JA 1QB6A 3OY6U 2AS9A 3MNXA 5A0AE 1C5MD 1Y3WA 2XCNA 2FM2A 1THPB 1O31A 1SGFG 1ZPBA 1S5SA 1C1SA 3EA7A 2YNAA 2Y81A 1BMNH 1G3DA 1S6HA 1TFXA 1DFPA 2RCEA 1P03A 5A0CA 3T5FH 2ZECA 1C5RA 2BM2A 3SV6A 1O3OA 2UWOA 2A7HA 2F9OA 1QRZA 1TBRH 3QUMP 1G30B 2EEKA 4Z0KA 2GV7A 1O32A 5DPAA 4YZUA 1S84A 1FY1A 5J4SA 2SGPE 2JH0D 4KGAA 4I31A 3SU1A 2C8YB 1NRNH 2XC5A 1QBVH 1YPHC 4NZLA 1OPHB 3NZIA 3I78A 1TNLA 4H4FA 5GCHG 1GBIA 2FOAA 1LQDB 4B73A 3RXMA 2F83A 1O2XA 3RMOH 1HCGA 3RXFA 3TGKE 2AMQA 1IQNA 3PV4A 1F0TA 1LHFH 1O3CA 4CR5A 2ZFRH 1P10A 4PROA 3SNAA 4CREA 2Z7FE 3ATKA 2STBE 1C5UA 2ZQ1A 5FPSA 3BG4B 1KTTB 3U9AH 2ODPA 1DSTA 3RXQA 1ACBE 2O9QA 3SBKA 1BTPA 1DWDH 3C1KA 3P92A 6CHAC 3HGPA 1JMOH 3RXDA 3ZZ7A 2TRMA 1RRKA 5F03A 1BRCE 1AFQB 3MI4A 4IBLH 1HIAA 1P9UA 1FIWA 1GCTB 2OBQA 4UONA 1VCPA 1O2MA 2BD7A 4WMEA 4AGJA 1W7GH 1TPAE 1EAXA 2STAE 1ELVA 1O30A 3ATWA 3CENA 1BJVA 2FYRA 4ABHA 2FODA 1QCPA 1GWAA 3P6ZB 3RMNH 3Q76A 3EA9A 3RLWH 5ESBA 4O9VA 1ZGIA 1AD8H 1F0SA 1TGNA 3ZYDA 4X8SH 2XBVA 4H6SB 1TBQH 2FO9A 5H4IB 1V2VT 3L33A 1O34A 2CF8H 1GJ8B 3TJVA 3EA8A 4GUXA 1S85A 6GCHG 2ZHFH 1UCYH 1VGCB 2ZU1A 3SU5A 1WQVH 3M36A 1VJ9U 2V3OH 1A0HB 1BBRH 1K1IA 4TWYA 2GT7A 2AGEX 3BF6H 3RDZA 1C5XB 1DX5M 1XVOA 2PSXA 5C1XA 1EAUA 1D3QB 1GJ6A 2ZTYA 5IDKA 3T62A 1K1PA 5JBTA 1BHXB 1N6XA 1DS2E 1T8LA 5E0GA 3IWMA 1FY4A 2QXHA 4U01A 1TE0A 4TYDA 2BX4A 4B71A 4D9QA 5K0HA 4CRDA 1A46H 2F3CE 4Q2KA 2BVRH 1P05A 1AQ7A 1HAXB 3TITA 1HJ8A 3TGIE 1XX9A 1EASA 3KQEA 2BDAA 2ANYA 4XBBA 1LCYA 4FUCA 3E16B 5DK1A 1BRAA 2W7SA 1ZMNA 3A85A 1MBMA 1EB1H 1C5QA 1QL9A 5JB9S 3AW1A 3TH3H 1D3PB 5T6GA 1ZHRA 1EAWA 3QK1A 3QTOH 1XKAC 1C5TA 3AAVA 3RM2H 1LPZB 2VIWA 1DLEA 3A7YA 1NESE 2GP9B 3QGJA 2QV1A 4FUBA 5FXLA 4IC6A 1Y3VA 1BTZA 3LJOA 1UTJA 3ENSB 1AWFH 2H9TH 1FPHH 4ESTE 3D49H 1B0FA 5EW1H 3FZZA 4VGCC 2ZDKA 3T27A 1TMUH 3UFAA 1TGSZ 5FCRA 1LMWB 4WF8A 1CT4E 1W14U 1Z6JH 4XFQA 2A0QB 2PUXB 1OP0A 3ZZAA 4ISIH 3PO1C 4H6TA 2ANWA 5FX6A 4KTCA 1C2KA 1MZAA 2UUYA 4JMYA 1HFDA 4O03A 1BRBE 1YGCH 3B8JA 3MNSA 3V7TA 1GJAB 1FDPA 2JETC 1K2I1 1GI2A 1O2PA 1K1OA 5AFYH 2AMDA 1EPTA 2FX4A 2ODYB 3ZVEA 1MQ5A 1P04A 1TALA 1GHBG 1BTYA 1EX3A 2C3SA 2FP7B 1JXPA 1MZDA 4B75A 3ZVAA 3QN7A 4X8UH 1C2HA 1GBKA 1MU6B 3P95A 1C2FA 2ZP0H 2R0LA 3VFEA 2EI6A 4AFZA 4AG2A 3F68H 1V2TT 4MPUA 1ZTKA 2FOCA 3BIUH 1C4U2 1J16A 1SFQB 3PYHA 1TLDA 2A4RA 2J94A 1HJAB 2BD3A 2ZPSA 3SU0A 5F6MA 1IQLA 1N8OB 4A7IB 4CHAC 1PPHE 2NU1E 1C5LH 1QQ4A 1GL1A 2XBYA 2A7CA 6LPRA 1EPTC 1W12U 1L2EA 3D65E 1ABJH 4FUIA 3ZZ4A 1M9UA 1PPGE 1TPSA 5B6OA 3HKJB 1GMHF 3SV9A 4IN1A 1BTUA 1FUJA 2R2WU 3A8DA 1K22H 5AF9H 1QBNA 1O33A 1IQIA 3ELAH 1FAXA 2G00A 1DY8A 3UOUA 4JCNA 1GDNA 1DANH 2TGDA 1HPGA 3KQDA 3LOXA 1NC6A 1T4VH 1TAWA 3PTNA 1ELGA 2IN2A 2AIPA 2ZPRA 3KCGH 1GBHA 1XKBC 4I8LA 3VB6A 3W95A 1AZ8A 3E6PH 3SOSA 1D6WA 5IYTA 2TBSA 2A31A 3ODFA 1A0LA 1NS3A 1A4WH 2AH4X 2P16A 3BTQE 3LH3A 1X7AC 4X6PA 1C5WB 2F9VA 4X1NU 4ABBA 1O3FA 4SGBE 3EAJA 4OS1A 3RM0H 3K65B 4X2XA 2VINA 2H6MA 4ZKOU 5A8YA 2BDBA 2G81E 3RXOA 2Z9IA 2Y7XA 3UOPA 1P2IA 3Q3YA 3V0XA 1PYTD 2ILNA 1QURH 1C1OA 2PFEA 2Z6BD 1FI8A 3S9BA 1KSNA 4XOJA 3H5CB 1GJ5H 2GTBA 1W8BH 1TPPA 4ZHMU 1OP8A 4IN2A 1O2ZA 4ABFA 1O2TA 2PKAA 4WH6A 3TLOA 3M3SA 1TX6A 4ABJA 2P8OC 2ZA5A 4ZH8A 1GJDB 3F9EA 1QB1A 3UY9A 5GXPA 1CO7E 2F9UA 3RMLH 5DP7A 1AGJA 1FZZA 3R3GB 3GY5A 3RXTA 5DGJA 1P57B 1TX8A 3KHVA 2VWNA 3SU4A 4ISLA 1V2KT 4AORA 1T31A 3T28A 1XUIA 4FU7A 3P17H 2PW8H 3A80A 1O3IA 3MWIU 1ZRKA 5L6NH 1YBWA 1MKWH 3FP7E 3GY8A 1QJ7B 1LHDH 1RJXB 2B5TB 2UUKB 1YPLH 3A83A 4K3JA 1O3BA 5A8ZA 1NFXA 3BTFE 3UREA 1DITH 1H8DH 3SUDA 2OC1A 4A6LA 2VVCA 1VZQH 1PPCE 2B9LA 4KKDA 4K5ZA 1Q3XA 3UNQA 1P2QA 2PHBA 2BLWA 1YC0A 3P8OA 1IQGA 3ZZBA 1CVWH 3WY8A 5A0BA 2Q6DA 1OKXA 1SI5H 3AVZA 1RGQA 3FAOA 5EQRA 2QXIA 1AIXH 2SFAA 1E0FD 1C5SA 4GVUA 3Q3KA 2SNWA 4U2WA 3RXCA 1HAGE 3SGBE 1DT2A 1ZSKA 1HV7A 2XW9A 3M7UA 1O2HA 1QBOA 5FHTA 5E8EH 4K2YA 1GG6C 1THRH 1TRNA 2VWOA 4B2CA 2CMYA 1BITA 1MKXH 4BAQB 5DP9A 3PMJA 5LH8A 1U6QA 2A2XH 2GZ8A 1V2OT 1ZJDA 1SGRE 1GDUA 5FAHA 1A5GH 3BTDE 1NFYA 2SGFE 3TJNA 2P59A 1AO5A 4U32A 3M61U 1MU8B 3CP7A 2BQ6B 4KP0A 1A3EH 1J8AA 3M5OA 3ZVFA 1O2WA 3GDVA 1RS0A 4FU8A 1ZOMA 4CBNA 1W2KH 4NFFA 2FEQH 4H42U 1FXYA 3VB3A 4WXVA 1DUAA 1WBGB 3OX7U 1C1QA 4AX9H 1A5HA 3MFJA 2ZHEH 4I8KA 9LPRA 1JOUB 1AI8H 2KAIA 5FBEA 4Q80A 1V2WT 2Y7ZA 5DP6A 1UK4A 1DWEH 4CBOA 3UWJH 2WPMS 1OWDA 2XC0A 2D1JA 8KME2 2QAAA 5PTPA 1SHYA 3Q77A 1GMHG 4JZFH 3GCNA 3GICB 1EATA 3PMAB 5A09A 1LTOA 2BXTH 1P2OA 1AVGH 1TOCB 3PO1B 3PLBA 1HLTH 3LIWA 3RC6A 1Z1JA 1TMBH 2CHAC 4D9RA 2F9NA 2TGTA 3F6UH 1TQ7B 1FQ3A 2ZGBH 2JETB 7GCHF 4AFUA 4ABGA 1SL3A 2R3YA 3SU3A 5C3NA 4X2YA 2P93A 3MNCA 1NU7B 1ABIH 5GJ4B 2OC0A 2XNIA 4I8JA 5CE1A 3EDXB 1S82A 1BJUA 5E0HA 5BPEA 4UE7H 1S0QA 1ZPZA 1KXEA 4ZKSU 2G52A 4A5TS 1C1VH 3KGPA 3QO6A 4F4OC 1HB0B 5K7RA 1Z71A 4FUEA 3ATMA 4K60A 3SUFA 1O3PB 1GI5A 1VCQA 2QF3A 2SGAA 1SGDE 3NCLA 1EJAA 3BEUA 1EZQA 3ITIA 2ZDLA 4I7YH 1FPCH 4I33A 4CHAB 3VB5A 1EP5A 1L1JA 2R3UA 1PQAA 4WWYA 1TPOA 1UVUH 1N6YA 1V2RT 1EPTB 4NWLA 4D7FA 7ESTE 2BDIA 1O2SA 1KTSB 1VCWA 1KDQA 4BAKB 3BTGE 2ZGXH 2WPIS 2VNTA 3RXIA 1V6DA 2H2ZA 4I8HA 1NN6A 5JYIA 1Z8GA 3PLKA 1SGYE 2AYWA 4O3TA 1E36B 3VXEH 4BOHA 1OWJA 3SV8A 1KIGH 2ESTE 2FZZA 2PTCE 2QIQA 3NK8A 5HGGA 1FN8A 1KXDA 1Q2WA 1AUJA 1F0RA 1DM4B 2NU0E 1ANDA 2FPZA 1A2CH 2HNTC 2VVUA 1BA8B 2G8TA 3HGNA 4UFEH 1HAOH 3F9HA 4BTIB 1GHAG 1V3XA 2G51A 1N1LA 1WQSA 2C4FH 1SVPA 1K28D 1S81A 1XUFA 1G32B 2HVXA 1RIWC 3RXEA 1NRSH 1SC8U 4B2AA 1TBZH 1KLIH 4BNRA 2EA3A 3S69A 3ZZDA 4ISHH 3LU9B 2HRVA 2Z9JA 2P3FH 1TNGA 2EI7A 1YCPH 2D8WA 4GHQA 3BEFB 4ZROA 1CQQA 4ZXYH 3T26A 2XCFA 1C1RA 1EZUC 1IHSH 2Y82A 4THNH 2BQ7B 1VITH 7LPRA 4E7RG 1P12E 3M5MA 4CRFA 1E34B 1XXDA 2P8OB 1TQ0B 5CMXH 4DOQA 1KLJH 5L2YH 1YCPM 3E0NB 3L3TA 2Y6TA 5HYOA 2XYAA 2F91A 1OWHA 3BTTE 2ANKH 6ESTA 4NIXA 3HKIB 1ESBA 1GMCG 4A1TA 1CGIE 4MDSA 1XM1A 3AAUA 1FY5A 1BB0B 4AB8A 1GJ7B 3QZRA 1SHHB 4DCDA 3GY4A 1C2DA 1TRMA 4OS4A 2GDEH 1YF4A 1TGBA 3TPIZ 5HXFA 5A2MH 1FN6A 1PYTC 1EZXC 2GDDA 3SNEA 2FS9A 3GDUA 1JWTA 5EPYA 4I8GA 4BAOB 1SQTA 2PKAB 1AUTC 4YT6H 2PWXA 4DY7B 2HOBA 4GHTA 1DVAH 1O2LA 2UUJB 3UQOA 1H4WA 1HXEH 3N7OA 1PPEE 1O35A 2B8OH 2ZWLH 2BVXH 2Z9KA 3P8FA 1EJMA 3F9FA 4JZEH 2A1DB 3M5NA 2JH5D 4INHA 1GBEA 5HM2A 1SBWA 1YPEH 1FONA 1UTNA 2A5IA 2Q1JA 1AHTH 3DHKH 3KNXA 3FANA 1FV9A 4UDWH 1GHWH 2BMGB 4TY6A 2FOBA 3PMHB 4LK4A 4DIIH 4FUGA 4ZKNU 3RXGA 3STJA 5DJ7A 1AKSB 3EQ0H 1GG6B 1TRYA 3O8RA 1C2IA 1C2JA 2Z3EA 3LGWA 1B0EA 3STIA 1XMNB 2NWNA 1HJ9A 7GCHG 3A8BA 2RA3A 3A84A 4X1RU 2P3TB 1O5FH 4ZXXH 4ABIA 1GI3A 4CH8B 1GBDA 4GLYA 2P3UB 1NO9H 3P8NA 2ZFQH 4Y7BA 3FFGA 4OGYA 2FYQA 2H5DA 3GYLB 4TPIZ 1BUIA 1K21H 3H7OA 2R0KA 2FI5E 3MU1A 1EUFA 1FAKH 3CS0A 1DWCH 3IG6B 2A5AA 3SW2B 1ETSH 2THFB 1P02A 1ARBA 2WYGA 2WPKS 1YPJH 3PMBB 1SB1H 3RXPA 1ELCA 1C5PA 2BDYA 1UHBA 2BOKA 3NWUA 2ZHQH 3AASA 2PGBB 4WJG2 2O8WA 2R2MB 4Y0YE 3A89A 3TH4H 4MLFB 4MNXA 1SFIA 4WMFA 1ORFA 2QXJA 1CHOF 1NY22 3TNTA 1O2YA 2VU8E 2WUBA 3B23B 1RTKA 3UPEA 3OYPA 2VIVA 3BN9A 4DIHH 1O5BB 3MTYA 1G3CA 1FMGA 2HALA 4MQAA 1VJAU 2H9EH 1ELBA 1GJCB 5AVDA 1O39A 1GBTA 2I6SA 4ABEA 3SJ8A 5HMAA 4WH8A 4X2VA 4YO9A 4J1YA 3QLPH 3BTHE 3UIRA 2CHAB 5C1UA 2WPLS 2NU4E 2ASUB 1ZTJA 5EODA 1GPZA 1NT1A 3SNBA 1Y3XA 2V35A 2A2QH 2GKVE 3ZVGA 1Y5AT 1HDTH 1CGJE 3VGCB 3PM3A 3LT3A 2FTLE 2BZ6H 2KAIB 4K8BA 1MD8A 1O5DH 2ZC9H 1S83A 1C4V2 8GCHF 1SGEE 4RSPA 4GPGA 2PLXA 2BVSH 2YNBA 1GJ4H 4X8VH 3SO3A 2BLVA 2R9PA 1UO6A 2ZFSA 4ZHAA 1PQ8A 1P11E 2ZKSA 3EE0B 1SGPE 1C1TA 1CBWB 2OC8A 3R0FA 2A4GA 1BZXE 2O8LA 2AEIH 1G3EA 3S9AA 3QZQA 2C8WB 3T2NA 4JYTA 3K6YA 4INKA 1BOQA 1DXPA 4FVBA 1O3DA 3RC4A 2DUCA 1KYNA 3ODDA 4Q7XA 2TIOA 4OS7A 3BG8A 2QXGA 3MNBA 2TGAA 2Y5GA 2PTNA 5ESTE 1WAYB 5GIBA 4Z6AH 4RKOB 1F0UA 5JDUB 4NA7A 1GBBA 1Y5BT 3ZVBA 2A45B 1FIZA 2QCYA 2BTCE 1QL7A 2SGDE 1A61H 1TX7A 5BRRE 2PKSC 4AG1A 1HBTH 1ANEA 1DLKB 1V2JT 2F9BH 2A4QA 3URCA 2FWWA 1KLTA 1NPMA 3MYWA 2VIQA 3TH2H 1V2ST 1UJ1A 1TYNA 2UWLA 1Y3UA 5DKMA 4CRBA 4YM9A 5TJXA 1TGCA 1T8OA 1GL0E 1MTSA 2QYIA 3SZNA 1RIWB 3KL6A 1MMJN 3ZVDA 1G2LA 3S0NA 1UTOA 1AB9C 3GCTF 1CA8B 5C5OA 2A5KA 1KDQB 3TIUA 4JZ1A 2GD4B 4JYVH 2H5CA 5GPIB 4K69A 5C5NA 3L6PA 1T8MA 4ZAEA 4Y11E 4CRCA 3ZV8A 4FXGH 1O2OA 1QGFA 3FZDA 1OYTH 1WU1A 3MU5A 2AMPA 2LPRA 1OWIA 1L4DA 3ZZ9A 4AFQA 3A86A 1ZPCA 1ELFA 1ZHPA 1PQ7A 1S0RA 4ISOA 4Y7AA 2Z9LA 4GAWA 4DG4A 5EU8A 3RXBA 1LPGB 1SMFE 2W26A 1ELAA 1SR5C 1P2JA 8ESTE 1Z6EA 1O5AB 4IMZA 2FLBH 1OS8A 6CHAB 3SUGA 3BV9B 1TB6H 1UK2A 1ELTA 3H7TA 3M3VA 1MBQA 4NG9H 3ZZ5A 1MTUA 1YKTA 1O2GH 4XE4A 3E91A 1LO6A 2SGEE 1DUEA 3MH5A 1ARCA 1HUTH 1AKSA 1EAIA 1YPGH 4LZ4B 1XUGA 3A81A 2FOEA 2BD8A 1PJPA 5EG4A 2BQWB 3G01A 1K1LA 1ZJKA 3S9CA 2AFQB 2BYAX 3RXHA 1GI8B 1V2LT 3MH6A 2VGCC 4K1SA 2V0BA 4B1TA 1GCTC 3UNRA 3ESTA 2IOTA 3MHWU 4YTAA 2C8XB 3LJJA 4Y8YA 4AOQA 2RDLA 3RXJA 1CGHA 2WYJA 3LH1A 1CT2E 1LPKB 2FXRA 4RKJB 1NM6A 3A7WA 1TONA 2BD9A 1PQ5A 1UCYE 4OS5A 2Z9GA 4A92A 4BTTB 2ZEBA 1P3EA 1BBRE 1O3HA 5EXMA 5FPTA 1WCZA 2GT8A 4TPYA 1C1WH 4X2WA 1ZYOA 2PSYA 1B5GH 2P95A 2ZU4A 1EOJA 5DP8A 2A4OA 5GCHF 1ZSJA 2WUCA 1GBFA 2CN0H 3M35A 5E0JA 1YPHE 1TIOA 1ZZZA 2W7UA 3NPSA 3V13A 1UVSH 1JIRA 1CT0E 4IS5A 1LHGH 3MH4A 3PWCA 3SU6A 1SGNE 1NFUA 5C67A 1HAVA 1SOTA 1MTNC 8GCHG 2G5VA 5TCCA 1C1UH 1T32A 1W3CA 4Y8ZA 4Y76A 2JKHA 2VVVA 1GBJA 5J4QA 1V2PT 1UVPA 1GI7B 2AERH 1SQAA 1ZMLA 3VXFH 3MMGA 4IMQA 4FUFA 3KEEA 4KELA 3RXUA 4CR9A 3Q3XA 1ZLRA 1SG8B 2J38A 1RTFB 1SLWB 2ZDNA 2ZU3A 5FX5A 1ZHMA 4X1SU 1OYQA 4NGAH 2J4IA 1KXFA 3GDSA 3RXAA 3E90B 5C1YA 2ZPQA 2FOFA 4VGCB 1KXAA 3TU7H 5A8XA 2W5EA 4TWWA 1T4UH 2FI4E 2XC4A 3MOCA 5I46H 1C1PA 2PR3A 4Y6DA 1P06A 1GI6A 2GZ7A 4NA8A 1PPFE 2GCTC 1P8VC 2NU3E 3DD2H 4O97A 1Z8IB 1CE5A 2H1UA 2D2DA 3EGKH 6GCHF 1UHBB 4JZIA 1WTGH 1UVOA 4ZUHA 1GJBB 3SNDA 1F5RA 3LGVA 1LKBA 3NKKA 2GCHF 4SGAE 3M7TA 2O8TA 4Q7ZA 1C5YB 3LONA 5FPYA 1LQEA 4X8TH 5AFZH 4DURA 1OOKB 3BEIB 5T3HA 4YESB 4INLA 3GCTG 2WPHS 1SLUB 3VPKA 2C8ZB 3O8BA 1H9IE 1O3MA 1P01A 1LKAA 1C1MA 1NRRH 3RXLA 1C4Y2 2WPJS 2D26C 1TNHA 4CRAA 1BRUP 2LNCA 4D7GA 2CJIA 2UWPA 4K1TA 2G55A 2RG3A 3SJOA 3GYMA 2GV6A 1SGTA 1V2QT 3ZZCA 1E37B 1GVKB 4X6OA 3RP2A 4K8YA 2OBOA 1K1NA 4MPWA 1DDJA 1UCYK 1CSOE 3LGUA 1BBRK 1EQ9A 4JK6A 2ZDMA 1GI4A 1GGDC 1IAUA 1WUNH 2AGIX 1P3CA 4IW4E 4OGXA 1NROH 1UVTH 2OP9A 3SHCH 3VB7A 2K1QA 1IHTH 2ZDVH 1EJNA 2HPPH 2BD2A 4LXBH 2ZCHP 1BMAA 2IJOB 2ANMH 2PKSB 4XSKU 2OQUA 1J14A 1W0YH 1L4ZA 3K6ZA 3TK6A 2HGTH 5ABWA 1DWBH 3A8CA 5FCKA 1GJ9B 3DT0H 1CU1A 1SGCA 1IQKA 1KXBA 2QA9E 3EYDA 2FOGA 3AW0A 4KTUA 2OD3B 3ZV9A 3BTME 3TJOA 5EOKA 1OXGA 1Z1IA 3UR9A 2Z3DA 1SLVB 3SUEA 1LVMA 4OS2A 1BTWA 3QWCH 3TNSA 4AYVB 2ZDAH 3O8CA 1AB9B 2HWLB 2WV5A 1E35B 4BXSA 2O8UA 2V3HH 2BY8X 3LDXH 4ZKRU 3DFJA 3F9GA 1C1NA 1QNJA 2B7DH 1C2GA 3GCOA 1GHBF 1H1BA 1HYLA 3MU4A 4D76A 3ZZ3A 1CA0C 2BY7X 2J92A 3PLPA 1O5GH 1MAYA 1DOJA 2O8MA 1VR1H 3A7XA 3FP6E 2QY0B 3LC3A 4GCHF 3SV7A 4NSYA 3SORA 2ZTZA 2BY9X 1JRSA 4AZ2B 2BX3A 2ZGHA 4HFPB 4NCYA 2SNVA 4FU9A 3HATH 2VWLA 5EPNA 1F7ZA 1OX1A 4X1PU 1FY3A
chains in the Genus database with same CATH superfamily
7KMEH 2GZ9A 3OY5U 4CH2B 5JB8S 1RXPA 1SLXB 1VITF 1HXFH 2BDGA 4B2BA 3KF2A 2GMTC 1ZSLA 1UMAH 4MNYA 5SGAE 2FI3E 4BAMB 2V6NA 4YOIA 5GWZA 2FESH 3I29A 4DGJA 1O3KA 2TGPZ 2ZIQH 3N99A 3E1XB 3RXVA 4NIYA 4YOGA 1LDTT 4BTUB 3E0PB 1YM0A 1NZQH 2VGCB 2A7JA 2ZFFH 1GCDA 2P94A 3HPTB 1Y59T 2ZHWH 4Y10E 5EGMA 1YP9A 4E05H 3SU2A 1S6FA 2Y5FA 1D4PB 4A1XA 1G37A 3E8LA 1L1GA 1MUEB 3U8TH 4IGDA 1HAIH 3V12A 2BLOA 5LPRA 1UTPA 2PP6A 1BT7A 4AYYB 2ZCKP 4MPXA 1GMDF 3HK6B 1MAXA 1EB2A 2AIQA 3U69H 1Y3YA 4F48B 1MCTA 3A82A 1QA7A 2ALPA 2OLGA 1JIMA 2BY5X 1AU8A 2ULLA 1HAPH 4LZ1H 2HLCA 5AHGH 1QY6A 1Q31A 1JBUH 2GCHG 4OS6A 2HNTF 3M7QA 1W7XH 4DVAU 3RXRA 1C5NH 1ZR0A 1O3NA 5C20A 3Q00A 3DUXH 1O38A 2FOMB 2C90B 3GOVB 3PTBA 1MTNB 4ZHLU 2J95A 3BTEE 3TJUA 1BTHH 1OP2A 1TWXB 1O5CB 2BDCA 1Z8RA 3UWIA 2VIOA 3RU4D 1GHVH 1NTPA 2XRCA 4AN7A 1Z8JB 3VEQB 2DE9A 2FS8A 4HZHA 1H8IH 5DP3A 4B76A 1HAHH 4Q7YA 1W13U 3AK5A 2XWBI 4FUHA 4MG3A 2KCYA 3SV2H 2ZGCA 1FNIA 1SPJA 3MO9A 1F5LA 2VJ1A 1P2KA 1TOMH 4F49A 1QJ1B 1C5VA 3M3TA 2XXLA 5LGOA 1F2SE 3RC5A 1ZTLA 1DXWA 3OTJE 4XBDA 4XDEA 1C5OH 1PPBH 1ETTH 3TVJB 2GGVB 1TABE 1FJSA 1GI1A 3KQCA 3U8RH 3W1EA 1EKBB 1YPKH 2VB0A 2ZFTA 4J2YB 2EQNA 4TY7A 3PV2A 1UTKA 2ODQA 1A5IA 1HAVB 4D8NA 5ETXA 2OC7A 1TA2A 4FVDA 3RXSA 1XUKA 2Q6GA 1O2KA 3M37A 1NRPH 2BHGA 4AC9A 2OTVA 2GCTB 5B6LA 2QC2A 2Q6FA 1G9IE 1SGFA 4BXWA 2VIDA 1SOZA 1WOFA 1WV7H 1GHXH 1NFWA 3T25A 1BTXA 3MO6A 2G5NA 2BD5A 9ESTA 2DE8A 4P00A 1GBAA 1IOEA 2ZFPH 4X0WU 5C2ZA 1DE7H 3W94A 1W10U 3UQVA 3GISB 1F92A 2ZCLP 1A7SA 1FLEE 1MKWK 3U98H 3LGIA 4K1EA 2FIRH 2GVFA 3GY7A 5DG6A 1LVOA 1UTMA 1G2MA 1T7CA 3D62A 4WMDA 5FBIA 5C94A 3E3TA 3UB0A 3A7ZA 4UD9H 4QT8C 1QQUA 3P70B 1SGQE 2ZO3H 1BIOA 1F5KU 4YOJA 1OSSA 1IQJA 1D9IA 4U30A 2A32A 4I32A 5EQQA 5JPMH 1BMMH 2VH0A 1SGIB 2JDID 3KIDU 3A7VA 5F8XA 3PROA 1L0ZA 2BDHA 2BOHB 2QN5T 1QL8A 2Z3CA 2ALVA 1D3TB 4E06H 5EJ1A 4Y71A 1GGDB 1SQOA 1O3LA 1MD7A 3DFLA 3GCHC 5F8TA 3TK5A 1XUJA 2I6QA 4GCHG 5EXNA 1GHZA 1LHEH 2YOLA 3ATIA 1O2VA 2M2AA 3N7EA 4LOYH 2EI8A 1MTWA 1ELDE 4NFEA 3UR6A 4RN6A 4MTBA 2J2UA 1O36A 2FTMA 3VB4A 1QA0A 3NXPA 1VITG 1K9OE 1MKXK 4NZQA 5T6FA 1D3DB 2G4TA 1QJ6B 1TNKA 2W3IA 3GY2A 3F3BA 3BTKE 3RU4E 5F8ZA 1W0ZU 1H9HE 1ID5H 3MO3A 1LVBA 1NU9A 3ZZ8A 5DP5A 2F9PA 4HI3A 5CHAC 2PGQB 1AZZA 1K1JA 1LVYA 1DSUA 1K1MA 1BQYA 2K8IA 2FMJA 1WSSH 4UEHH 2WZQA 2Y5HA 5JBCS 2QGRA 1IQFA 3LGTA 2VWMA 1CHGA 1G3BA 3K9XB 1EOLA 5FL7D 2EC9H 1QHRB 3P8GA 5T1VA 3F1SB 1O3GA 4XBCA 4AFSA 1WYKA 3TK9A 1A3BH 1XUHA 3A87A 1ELEE 1GMDG 3JZ1B 1DICA 1BDAA 1AE8H 1AN1E 4KTSA 5LPEA 4UFDH 1QIXB 3M5LA 1AE5A 1CA0B 4NWKA 1AY6H 1QRWA 1YPMH 3MU8A 2FX6A 3SNCA 1D6RA 2IPQX 4X6NA 1P2MA 1JRTA 3BSQA 1MH0A 1AVWA 1EP6A 4Y0ZE 1C9PA 4YLUA 3SJIA 1C5ZB 2ZQ2A 3ZVCA 3ZZ6A 1ANCA 1P9SA 1O3EA 1WTHD 3ATLA 1E1RD 2V7QD 2TPIZ 3HK3B 3BTWE 3OFND 4X1QU 2BLQA 1QFKH 2W3KA 5TCAA 3U1IB 3BG4C 1RD3B 5CHBA 3DSOA 1HRTH 3A8AA 2GMTB 1HNEE 3O8DA 1P0SH 1AFEH 1O3JA 1G36A 4MPVA 4IC5A 1XVMA 1GBMA 3IITA 2ZU5A 1J15A 1H9LB 1KY9A 3D23A 3I77A 1GDQA 1CHOG 1AFQC 1OWEA 1OWKA 4X6MA 3RLYH 1C2MA 3SJ9A 1GVZA 1COWD 1ZRBA 3SQEE 1IQMA 2FOHA 4M7GA 1O2QA 5EQSA 1XXFA 5JBAS 3QGNB 3S7KB 1ZGVA 3RMMH 3TGJE 5EXLA 4UFFH 1O2NA 1O5EH 1QR3E 5EIYA 2HNTE 1MTVA 1GHAF 3RU4T 2NU2E 3UUZA 1O2UA 3GS9A 5HM9A 1B7XB 4ABAA 1BMLA 1BCUH 1RFNA 4DT7B 2OXSA 1V2NT 2ZG0H 4O3UA 1YLCA 3QX5H 2JH6D 4NIVA 4JK5A 1VGCC 1ESAA 4XRNA 3SI4H 1A1RA 3OSYA 4NIWA 4NA9H 1C2LA 3URDA 1HIAB 3SQHE 2ZHDA 4CRGA 2WINI 1TNJA 1P09A 2BD4A 1SSXA 2GX4A 1O3AA 2XTTB 8LPRA 3BIVH 3FVFB 4MVNA 3LC5A 2J9NA 4MNVA 2PUQH 4DW2U 1Y5UT 2OQ5A 3CS7A 1YYY1 2ZU2A 3S7HB 2OCVB 1TNIA 3U8OH 1GMCF 1AMHA 1Z7KA 4WVPE 1GI9B 2B0FA 5T6DA 2XBXA 2ZF0H 1DPOA 1UTLM 1GBLA 1UTQA 2J34A 3PB1E 3NUMA 2L74A 2GJGA 4WXIA 1QB9A 2BZAA 1YCPK 3RUOA 3T29A 2KFWA 3GY6A 1GVLA 5L2ZH 1TMTH 3UTUH 1RTLA 4FUDA 1IQEA 4E7NA 1IQHA 1DY9A 2FLRH 4HGCA 4FUJA 3U28C 4UFGH 1O2IA 1HAYB 1L1NA 4GSOA 4AGKA 3WWFA 4DT4A 2PV9B 2XNDD 2M5TA 1AVXA 5I25A 3KQBA 1NRQH 2BY6X 4AB9A 1UK3A 5E2PA 4ABDA 3ZYEA 3MU0A 1K0HA 5G4BA 3UNSA 3SGAE 4JYUH 4B74A 2ZGJA 1A0JA 1EZSC 1QTFA 4NSVA 2OUAA 4BANB 1V2MT 2ZNKH 2WV4A 2BXUH 3GY3A 1KMHB 3LGYA 4ASHA 1E38B 3QTVH 1J9CH 1YWUA 5IK2D 1W11U 3QDZB 1EFRD 1KXCA 2ZZUH 4Y79A 2WSSD 1PFXC 2CV3A 1O2RA 4YT7H 4R0IA 1ZMJA 5E2OA 1O0DH 2C93B 2CGAA 1C9TA 1ESTA 3LKWA 1PPZA 4OM9A 2IPHA 2H9HA 1EXFA 1V2UT 2ZI2H 3VGCC 2G4UA 3RXKA 1J17T 1HGTH 5GDSH 2Y80A 1QRXA 3OU0A 5JBBS 1FY8E 3U1JB 3SHAH 3V3MA 2OINA 4Y8XA 3SGQE 2AGGX 2Z94A 4WY3A 4BAHB 1C2EA 2VH6A 4YLQH 3MH7A 4ISNA 2UUFB 3A88A 3GCHB 3SI3H 1CBWC 3JZ2B 4DJZB 2BB4A 1YLDA 2CF9H 5EW2H 2QF0A 4MNWA 3LPRA 1P2NA 4A1VA 1HJAC 2XWAA 1O37A 3PWBA 4JZDH 4ZMAH 1MCVA 4Z1MD 2FDAA 1T8NA 1LHCH 1GBCA 3FP8E 2VIPA 1ETRH 5DO4H 1N8OC 4ACBA 1GI0A 2ZTXA 1TA6A 1HAZB 5L30H 2RA0A 2HPQH 4HTCH 3F2FA 1BHXF 1INCA 1MQ6A 2XBWA 3DA9B 4R8TB 5LPFA 5DP4A 3B9FH 1AWHB 2CXVA 1ANBA 1TGTA 3A7TA 3SN8A 1GHYH 3SJKA 2SGQE 3KN2A 1THSH 1Y8TA 5CHAB 3K2UA 3C27B 1O2JA 1QB6A 3OY6U 2AS9A 3MNXA 5A0AE 1C5MD 1Y3WA 2XCNA 2FM2A 1THPB 1O31A 1SGFG 1ZPBA 1S5SA 1C1SA 3EA7A 2YNAA 2Y81A 1BMNH 1G3DA 1S6HA 1TFXA 1DFPA 2RCEA 1P03A 5A0CA 3T5FH 2ZECA 1C5RA 2BM2A 3SV6A 1O3OA 2UWOA 2A7HA 2F9OA 1QRZA 1TBRH 3QUMP 1G30B 2EEKA 2CK3D 4Z0KA 2GV7A 1O32A 5DPAA 4YZUA 1S84A 1FY1A 5J4SA 2SGPE 2JH0D 4KGAA 4I31A 3SU1A 2C8YB 1NRNH 2XC5A 1QBVH 1YPHC 4NZLA 1OPHB 3NZIA 3I78A 1TNLA 4H4FA 5GCHG 1GBIA 2FOAA 1LQDB 2JJ2D 4B73A 3RXMA 2F83A 1O2XA 3RMOH 1HCGA 2IJD1 3RXFA 5HKKD 3TGKE 2AMQA 1IQNA 3PV4A 1F0TA 1LHFH 1O3CA 4CR5A 2ZFRH 2LELA 1P10A 4PROA 3SNAA 4CREA 2Z7FE 3ATKA 2STBE 1C5UA 2ZQ1A 5FPSA 3BG4B 1KTTB 3U9AH 2ODPA 1DSTA 3RXQA 1ACBE 2O9QA 3SBKA 1BTPA 1DWDH 3C1KA 3P92A 6CHAC 3HGPA 1JMOH 4RT0A 3RXDA 3ZZ7A 2TRMA 1RRKA 5F03A 1BRCE 1AFQB 3MI4A 4IBLH 1HIAA 1P9UA 1FIWA 1GCTB 2OBQA 4UONA 1VCPA 1O2MA 2BD7A 4WMEA 4AGJA 1W7GH 1TPAE 1EAXA 2STAE 1ELVA 1O30A 3ATWA 3CENA 5C0UA 2KCPA 1BJVA 2FYRA 4ABHA 2FODA 1QCPA 1GWAA 3P6ZB 3RMNH 3Q76A 3EA9A 3RLWH 5ESBA 4O9VA 1ZGIA 1AD8H 1F0SA 1TGNA 3KQ5A 3ZYDA 4X8SH 2XBVA 4H6SB 1TBQH 2FO9A 5H4IB 1V2VT 3L33A 1O34A 2CF8H 1GJ8B 3TJVA 3EA8A 4GUXA 1S85A 6GCHG 2ZHFH 1UCYH 1VGCB 2ZU1A 3SU5A 1WQVH 3M36A 1VJ9U 2V3OH 1A0HB 1BBRH 1K1IA 4TWYA 2GT7A 2AGEX 3BF6H 3PRBA 3RDZA 1C5XB 1DX5M 1XVOA 2PSXA 5C1XA 1EAUA 1D3QB 1GJ6A 2ZTYA 5IDKA 3T62A 1K1PA 5JBTA 1BHXB 1N6XA 1DS2E 1T8LA 1H8ED 5E0GA 3IWMA 1FY4A 2QXHA 4U01A 1TE0A 4TYDA 2BX4A 4B71A 4D9QA 5K0HA 4CRDA 2WPDD 1A46H 2F3CE 4Q2KA 2BVRH 1P05A 1AQ7A 1HAXB 3TITA 1HJ8A 3TGIE 1XX9A 1EASA 3KQEA 2BDAA 2ANYA 4XBBA 1LCYA 4FUCA 3E16B 5DK1A 1BRAA 2W7SA 1ZMNA 3A85A 1MBMA 1EB1H 1C5QA 1QL9A 5JB9S 3AW1A 3TH3H 1D3PB 5T6GA 1ZHRA 1EAWA 3QK1A 3QTOH 1XKAC 1C5TA 3AAVA 3RM2H 1LPZB 2VIWA 1DLEA 3A7YA 1NESE 2GP9B 3OTPA 2QV1A 3QGJA 4FUBA 5FXLA 4IC6A 1Y3VA 1BTZA 3LJOA 2KX4A 1UTJA 3ENSB 1AWFH 2H9TH 3F2HA 1FPHH 4ESTE 3D49H 1B0FA 5EW1H 3FZZA 4VGCC 2ZDKA 3T27A 1TMUH 3UFAA 1TGSZ 5FCRA 2YMSD 5F53A 1LMWB 4WF8A 1CT4E 1W14U 1Z6JH 2QF4A 4XFQA 2A0QB 2PUXB 1OP0A 3ZZAA 4ISIH 3PO1C 4H6TA 2ANWA 5FX6A 4KTCA 1C2KA 1MZAA 2UUYA 4JMYA 1HFDA 4O03A 1BRBE 1YGCH 3B8JA 3MNSA 4B6FA 3V7TA 1GJAB 1FDPA 2JETC 1K2I1 1GI2A 1O2PA 1K1OA 5AFYH 2AMDA 1EPTA 2FX4A 2ODYB 3ZVEA 1MQ5A 1P04A 1TALA 1GHBG 1BTYA 1EX3A 2C3SA 2FP7B 1JXPA 1MZDA 4B75A 3ZVAA 3QN7A 4X8UH 1C2HA 1GBKA 1MU6B 3P95A 1C2FA 2ZP0H 3ZIAD 2R0LA 3VFEA 2EI6A 4AFZA 4AG2A 3F68H 1V2TT 4MPUA 1ZTKA 2FOCA 3BIUH 1C4U2 1J16A 1SFQB 3PYHA 3WWBA 1TLDA 2A4RA 2J94A 4Q4LA 1HJAB 2BD3A 2ZPSA 1QZ8A 3SU0A 5F6MA 1IQLA 1N8OB 4A7IB 4CHAC 1PPHE 2NU1E 1C5LH 1QQ4A 1GL1A 2XBYA 2A7CA 6LPRA 1EPTC 1W12U 1L2EA 3D65E 1ABJH 4FUIA 2AHME 1M9UA 1PPGE 1TPSA 3ZZ4A 5B6OA 3HKJB 1GMHF 3SV9A 4IN1A 1BTUA 1FUJA 2R2WU 3A8DA 1K22H 5AF9H 1QBNA 1O33A 1IQIA 3ELAH 1FAXA 2G00A 1DY8A 3UOUA 4JCNA 1GDNA 1DANH 2TGDA 3SYJA 1HPGA 3KQDA 3LOXA 1NC6A 1T4VH 1TAWA 3PTNA 5C0TA 1ELGA 2IN2A 2AIPA 2ZPRA 3KCGH 1GBHA 1XKBC 4I8LA 3VB6A 3W95A 1AZ8A 3E6PH 3SOSA 1D6WA 5IYTA 3CNRA 2TBSA 2QE7D 1FX0B 2A31A 3ODFA 4YXWD 1A0LA 1NS3A 1A4WH 2AH4X 2P16A 3BTQE 3LH3A 5KGOA 1X7AC 4X6PA 1C5WB 2F9VA 4X1NU 4ABBA 1O3FA 4SGBE 3EAJA 4OS1A 3RM0H 3K65B 4X2XA 2VINA 2H6MA 4ZKOU 5A8YA 2BDBA 2G81E 3RXOA 2Z9IA 2Y7XA 3UOPA 1P2IA 3Q3YA 3V0XA 1PYTD 2ILNA 1QURH 1C1OA 2PFEA 2Z6BD 1FI8A 3S9BA 1KSNA 4XOJA 3H5CB 1GJ5H 2GTBA 2XOKD 1W8BH 1TPPA 4ZHMU 1OP8A 4IN2A 1O2ZA 4ABFA 1O2TA 2PKAA 4WH6A 3TLOA 3M3SA 1TX6A 4ABJA 2P8OC 2ZA5A 4ZH8A 1GJDB 3F9EA 1QB1A 3UY9A 5GXPA 1CO7E 2F9UA 3RMLH 5DP7A 1AGJA 1FZZA 3R3GB 3GY5A 3RXTA 5DGJA 1P57B 1TX8A 3KHVA 2VWNA 1S6LA 3SU4A 4ISLA 1V2KT 4AORA 1T31A 3T28A 1XUIA 4FU7A 3P17H 2PW8H 3A80A 1O3IA 3MWIU 1ZRKA 5L6NH 1YBWA 1MKWH 3FP7E 3GY8A 1QJ7B 1LHDH 1RJXB 2B5TB 2UUKB 1YPLH 3A83A 4K3JA 1O3BA 5A8ZA 1NFXA 3BTFE 3UREA 1DITH 1H8DH 4TT3D 3SUDA 2OC1A 4A6LA 2VVCA 1VZQH 1PPCE 2B9LA 4KKDA 4K5ZA 1Q3XA 3UNQA 1P2QA 2PHBA 2BLWA 3NRLA 1YC0A 3P8OA 1IQGA 3ZZBA 1CVWH 3WY8A 5A0BA 2Q6DA 1OKXA 1SI5H 3AVZA 1RGQA 3FAOA 5EQRA 2QXIA 1AIXH 2SFAA 1E0FD 1C5SA 4GVUA 3Q3KA 2SNWA 4U2WA 3RXCA 1HAGE 3SGBE 1DT2A 1ZSKA 1HV7A 2XW9A 3M7UA 1O2HA 1QBOA 5FHTA 5E8EH 4K2YA 1GG6C 1THRH 1TRNA 2VWOA 4B2CA 2CMYA 1BITA 4I86A 1MKXH 4BAQB 5DP9A 3PMJA 5LH8A 1U6QA 2A2XH 2GZ8A 1V2OT 1ZJDA 1SGRE 4Q63A 1GDUA 5FAHA 1A5GH 3BTDE 5GNDA 1NFYA 2SGFE 3TJNA 2P59A 1AO5A 4U32A 3M61U 3VG8A 1MU8B 3CP7A 2BQ6B 2KM0A 4KP0A 1A3EH 1J8AA 3M5OA 3ZVFA 1O2WA 3GDVA 1RS0A 4FU8A 1ZOMA 4CBNA 1W2KH 4NFFA 2FEQH 4H42U 1FXYA 1VKYA 3VB3A 2LP6A 4WXVA 1DUAA 1WBGB 3OX7U 1C1QA 4AX9H 1MABB 1A5HA 3MFJA 2ZHEH 4I8KA 2JIZD 9LPRA 1JOUB 1AI8H 2KAIA 5FBEA 4Q80A 1V2WT 2Y7ZA 5DP6A 1UK4A 1DWEH 4CBOA 3UWJH 2WPMS 1OWDA 2XC0A 2D1JA 8KME2 2QAAA 5PTPA 1SHYA 3Q77A 1GMHG 4JZFH 3GCNA 3GICB 1EATA 2KR7A 3PMAB 4HG6A 5A09A 1LTOA 2BXTH 1P2OA 1AVGH 1TOCB 2L6OA 3PO1B 4TSFD 3PLBA 1HLTH 3LIWA 3RC6A 1Z1JA 1TMBH 2CHAC 4D9RA 2F9NA 2TGTA 3F6UH 1TQ7B 1FQ3A 2ZGBH 3DSGA 2JETB 7GCHF 4AFUA 4ABGA 1SL3A 2R3YA 3SU3A 5C3NA 4X2YA 2P93A 3MNCA 1NU7B 1ABIH 5GJ4B 2OC0A 2XNIA 4I8JA 5CE1A 3EDXB 1S82A 1BJUA 5E0HA 5BPEA 4UE7H 1S0QA 1ZPZA 1KXEA 2F43B 4ZKSU 2G52A 4A5TS 1C1VH 3KGPA 3QO6A 4F4OC 1HB0B 5K7RA 5DN6D 1Z71A 3OEED 4FUEA 2YMSC 3ATMA 4K60A 3SUFA 1O3PB 1GI5A 1VCQA 2QF3A 2SGAA 1SGDE 3NCLA 1EJAA 3BEUA 1EZQA 3ITIA 2ZDLA 4I7YH 1FPCH 4I33A 2WV9A 3OE7D 4CHAB 3VB5A 1EP5A 1L1JA 2R3UA 1PQAA 4WWYA 1TPOA 1UVUH 1N6YA 1V2RT 1EPTB 4NWLA 4D7FA 7ESTE 2BDIA 1O2SA 1KTSB 1VCWA 2HLDD 1KDQA 4BAKB 3BTGE 2ZGXH 2WPIS 2VNTA 3RXIA 1V6DA 2H2ZA 4I8HA 1NN6A 5JYIA 1Z8GA 3PLKA 1SGYE 2AYWA 4O3TA 1E36B 3VXEH 4BOHA 1OWJA 3SV8A 1KIGH 2ESTE 2FZZA 2PTCE 2QIQA 3NK8A 5HGGA 1FN8A 1KXDA 1Q2WA 1AUJA 1F0RA 1DM4B 2NU0E 1ANDA 3F0PA 2FPZA 1A2CH 2HNTC 2VVUA 1BA8B 2G8TA 3HGNA 4UFEH 1HAOH 3F9HA 5EJZA 4BTIB 1GHAG 1V3XA 2G51A 1N1LA 2J97A 1WQSA 2C4FH 1SVPA 1K28D 1S81A 1XUFA 1G32B 2HVXA 1RIWC 3RXEA 1H8HD 1NRSH 1SC8U 4B2AA 1TBZH 1KLIH 4BNRA 2EA3A 3S69A 3ZZDA 4ISHH 3LU9B 2HRVA 2Z9JA 2P3FH 1TNGA 2EI7A 1YCPH 2D8WA 4GHQA 3BEFB 2W6ID 2J5UA 4ZROA 1CQQA 4ZXYH 3T26A 2XCFA 1C1RA 1EZUC 1IHSH 2Y82A 4THNH 2BQ7B 1VITH 7LPRA 4E7RG 1P12E 3M5MA 4CRFA 1E34B 1XXDA 2P8OB 1TQ0B 5CMXH 4DOQA 1KLJH 5L2YH 1YCPM 3E0NB 3L3TA 2Y6TA 5HYOA 2XYAA 2F91A 1OWHA 1NBME 3BTTE 2ANKH 6ESTA 4NIXA 3HKIB 1ESBA 1GMCG 4A1TA 1CGIE 5CDFE 4MDSA 1XM1A 3AAUA 1FY5A 1BB0B 4AB8A 1GJ7B 3QZRA 1SHHB 4DCDA 3GY4A 1C2DA 1TRMA 4OS4A 1BMFD 1YF4A 2GDEH 1TGBA 3TPIZ 5HXFA 5A2MH 1FN6A 1PYTC 1EZXC 2GDDA 3SNEA 2FS9A 3GDUA 1JWTA 5EPYA 4I8GA 4BAOB 1SQTA 2PKAB 1W0JD 1AUTC 4RI0A 4YT6H 2PWXA 4DY7B 2HOBA 4GHTA 1DVAH 1O2LA 2UUJB 3UQOA 1H4WA 1HXEH 3N7OA 1PPEE 1O35A 2B8OH 2ZWLH 2BVXH 2Z9KA 3P8FA 1EJMA 3F9FA 4JZEH 2A1DB 3M5NA 2JH5D 4INHA 1GBEA 5HM2A 1SBWA 1YPEH 1FONA 1UTNA 2A5IA 2Q1JA 1AHTH 3DHKH 3KNXA 3FANA 1FV9A 4UDWH 1GHWH 2BMGB 4TY6A 2FOBA 3PMHB 4LK4A 4DIIH 4FUGA 4ZKNU 3RXGA 3STJA 5DJ7A 1AKSB 3EQ0H 1GG6B 1TRYA 3O8RA 5HIYA 1C2IA 1C2JA 2Z3EA 3LGWA 1B0EA 3STIA 1XMNB 2NWNA 1HJ9A 7GCHG 3A8BA 3N7DA 2RA3A 3A84A 3FO8D 4X1RU 2P3TB 1O5FH 4ZXXH 4ABIA 1GI3A 4CH8B 3DCLA 1GBDA 4GLYA 2P3UB 1NO9H 3P8NA 2ZFQH 4Y7BA 3FFGA 4OGYA 2FYQA 2H5DA 3GYLB 4TPIZ 1BUIA 1K21H 3H7OA 4M9FA 3UAIC 2KCOA 2FI5E 2R0KA 3MU1A 1EUFA 1FAKH 3CS0A 1DWCH 3IG6B 2A5AA 3SW2B 1ETSH 2THFB 1P02A 1ARBA 2WYGA 2WPKS 1YPJH 3PMBB 1SB1H 3RXPA 1ELCA 1C5PA 2BDYA 1UHBA 2BOKA 3NWUA 2ZHQH 3AASA 2PGBB 4WJG2 2O8WA 2R2MB 4Y0YE 3A89A 3TH4H 4MLFB 4MNXA 1SFIA 4WMFA 1ORFA 2QXJA 1CHOF 1NY22 5HIZA 3TNTA 1O2YA 2VU8E 2WUBA 3B23B 1RTKA 5EJLA 3UPEA 3OYPA 2VIVA 3BN9A 4DIHH 1O5BB 3DSPA 3H09A 3MTYA 1G3CA 1FMGA 2HALA 4MQAA 1VJAU 1YY3A 2H9EH 1ELBA 5KECA 1GJCB 5AVDA 1O39A 1GBTA 2I6SA 4ABEA 3SJ8A 5HMAA 3WW7A 3FN8A 4WH8A 4X2VA 3KYGA 4YO9A 4J1YA 3QLPH 3BTHE 3UIRA 2CHAB 5C1UA 2WPLS 2NU4E 2ASUB 1ZTJA 5EODA 1GPZA 1NT1A 3SNBA 1Y3XA 2V35A 2A2QH 2GKVE 3ZVGA 1Y5AT 1HDTH 1CGJE 3VGCB 3PM3A 3LT3A 2FTLE 2BZ6H 2KAIB 4K8BA 1MD8A 1O5DH 2ZC9H 2J98A 1S83A 1C4V2 8GCHF 1SGEE 4RSPA 4GPGA 2PLXA 2BVSH 1WXRA 2YNBA 1GJ4H 4X8VH 3SO3A 2BLVA 2R9PA 1UO6A 4F55A 2ZFSA 4ZHAA 1PQ8A 1P11E 2ZKSA 3EE0B 4FOUC 1SGPE 1C1TA 1CBWB 2OC8A 3R0FA 4FETA 2A4GA 2KZ4A 2YMSB 1BZXE 2O8LA 2AEIH 1G3EA 3S9AA 3QZQA 2C8WB 3T2NA 4JYTA 3K6YA 4INKA 1BOQA 1DXPA 4FVBA 1O3DA 3RC4A 2DUCA 1KYNA 3ODDA 4Q7XA 2TIOA 4OS7A 3BG8A 2QXGA 3MNBA 2TGAA 2Y5GA 2PTNA 5ESTE 1WAYB 5GIBA 4Z6AH 4RKOB 1F0UA 5JDUB 4NA7A 1GBBA 1Y5BT 3ZVBA 2A45B 1FIZA 2QCYA 2BTCE 1QL7A 2SGDE 1A61H 5KEDA 1TX7A 5BRRE 2PKSC 4AG1A 1HBTH 1ANEA 1DLKB 1V2JT 2F9BH 2A4QA 3URCA 2FWWA 1KLTA 1NPMA 4ZCNA 3MYWA 2VIQA 3TH2H 1V2ST 1UJ1A 1TYNA 2UWLA 1Y3UA 5DKMA 4CRBA 4YM9A 5TJXA 1TGCA 1T8OA 1GL0E 1MTSA 2QYIA 3SZNA 1RIWB 3EE7A 3KL6A 1MMJN 3ZVDA 1G2LA 3S0NA 1UTOA 1AB9C 3GCTF 1CA8B 5C5OA 2A5KA 1KDQB 3TIUA 4JZ1A 2GD4B 4JYVH 2H5CA 5GPIB 4K69A 5C5NA 2RDEA 3L6PA 1T8MA 4ZAEA 2KCAA 4Y11E 4CRCA 3ZV8A 4FXGH 1O2OA 1QGFA 3FZDA 1OYTH 1WU1A 3MU5A 2AMPA 2LPRA 1OWIA 1L4DA 3ZZ9A 4AFQA 3A86A 1ZPCA 3PRDA 1ELFA 1ZHPA 1PQ7A 1S0RA 4ISOA 4Y7AA 2Z9LA 4GAWA 4DG4A 5EU8A 3RXBA 1LPGB 1SMFE 2W26A 2K0QA 1ELAA 1SR5C 1P2JA 2F4LA 8ESTE 1Z6EA 1O5AB 2RFKC 4IMZA 2FLBH 1OS8A 6CHAB 3SUGA 3BV9B 1TB6H 1UK2A 1ELTA 3H7TA 3M3VA 1MBQA 4NG9H 3ZZ5A 1MTUA 1YKTA 1O2GH 4XE4A 3E91A 1LO6A 2SGEE 1DUEA 3MH5A 1ARCA 1HUTH 1AKSA 1EAIA 1YPGH 4LZ4B 1XUGA 3A81A 2FOEA 2BD8A 1PJPA 5EG4A 2BQWB 3G01A 1K1LA 1ZJKA 3S9CA 2AFQB 4ASUD 2BYAX 3RXHA 1GI8B 1V2LT 3MH6A 2VGCC 1WDIA 4K1SA 3PV5A 2V0BA 2V3MA 4B1TA 1GCTC 3UNRA 3ESTA 2IOTA 3MHWU 4YTAA 2C8XB 3LJJA 4Y8YA 4AOQA 2RDLA 3RXJA 1CGHA 2WYJA 3LH1A 1CT2E 1LPKB 2FXRA 4RKJB 1NM6A 3A7WA 1TONA 2BD9A 1PQ5A 1UCYE 4OS5A 2Z9GA 4A92A 2W6JD 4BTTB 2ZEBA 1P3EA 2HVYB 1BBRE 1O3HA 1YLNA 5EXMA 5FPTA 1WCZA 2GT8A 3OEHD 4TPYA 1C1WH 4X2WA 1ZYOA 2PSYA 1B5GH 2P95A 2ZU4A 5C17A 1EOJA 5DP8A 2A4OA 5GCHF 1ZSJA 2WUCA 1GBFA 2CN0H 3M35A 5E0JA 1YPHE 1TIOA 1ZZZA 2W7UA 3NPSA 3V13A 1UVSH 1JIRA 3KYFA 1CT0E 4IS5A 1LHGH 3MH4A 3PWCA 3SU6A 1SGNE 1NFUA 5C67A 1HAVA 1SOTA 1MTNC 8GCHG 2G5VA 5TCCA 1C1UH 1T32A 1W3CA 4Y8ZA 4Y76A 2JKHA 2VVVA 1GBJA 5J4QA 1V2PT 1UVPA 1GI7B 2AERH 1SQAA 1ZMLA 3VXFH 3MMGA 4IMQA 4FUFA 3KEEA 1UW7A 4KELA 3RXUA 4CR9A 3Q3XA 1ZLRA 1SG8B 2J38A 4B6EA 1RTFB 3SZEA 1SLWB 2ZDNA 2ZU3A 5FX5A 1ZHMA 4X1SU 1OYQA 4NGAH 3FOAA 2J4IA 5DSFA 1KXFA 1E79D 3GDSA 3RXAA 3E90B 5C1YA 2ZPQA 2FOFA 4VGCB 1KXAA 3TU7H 5A8XA 2W5EA 4TWWA 1T4UH 2FI4E 2XC4A 3MOCA 5I46H 1C1PA 2PR3A 2JJ1D 4Y6DA 1P06A 1GI6A 2GZ7A 4NA8A 1PPFE 2GCTC 1P8VC 2NU3E 3DD2H 1SKYE 4O97A 1Z8IB 1NBMD 1CE5A 2H1UA 2D2DA 3EGKH 6GCHF 1UHBB 4JZIA 1WTGH 3MQKC 1UVOA 4ZUHA 1GJBB 3SNDA 1F5RA 3LGVA 1LKBA 3NKKA 2GCHF 4SGAE 3M7TA 2O8TA 4Q7ZA 1C5YB 3LONA 5FPYA 1LQEA 4X8TH 5AFZH 4DURA 1OOKB 3BEIB 4ACAA 5T3HA 4YESB 4INLA 3GCTG 2WPHS 1SLUB 3VPKA 2C8ZB 3O8BA 1H9IE 1O3MA 1P01A 1LKAA 1C1MA 1NRRH 3RXLA 1C4Y2 2WPJS 2D26C 1TNHA 4CRAA 1BRUP 2LNCA 4D7GA 2CJIA 2UWPA 4K1TA 2G55A 2RG3A 3SJOA 3GYMA 2GV6A 1SGTA 1V2QT 3ZZCA 1E37B 1GVKB 4X6OA 3RP2A 4P02A 4K8YA 2OBOA 1K1NA 4MPWA 1DDJA 1UCYK 1CSOE 3LGUA 1BBRK 1EQ9A 4JK6A 2ZDMA 1GI4A 1GGDC 1IAUA 1WUNH 4RT1A 2AGIX 1P3CA 4IW4E 4OGXA 1NROH 2OK5A 1UVTH 2OP9A 3SHCH 3VB7A 2EY4C 2K1QA 1IHTH 2ZDVH 1EJNA 2HPPH 2BD2A 2J98B 4LXBH 2ZCHP 1BMAA 2IJOB 2ANMH 2PKSB 4XSKU 2OQUA 1J14A 1W0YH 1L4ZA 3K6ZA 3TK6A 2HGTH 5ABWA 1DWBH 3A8CA 5FCKA 1GJ9B 3DT0H 1CU1A 2WHXA 1SGCA 3F2GA 1IQKA 1KXBA 1W0KD 2QA9E 1E1QD 2VBCA 3EYDA 2FOGA 3AW0A 4KTUA 2OD3B 3ZV9A 3BTME 3TJOA 5EOKA 1OXGA 1Z1IA 3UR9A 2Z3DA 1SLVB 3SUEA 1LVMA 1OHHD 4OS2A 2QF5A 1BTWA 3QWCH 3TNSA 4AYVB 4XD7D 2ZDAH 3O8CA 1AB9B 2HWLB 2WV5A 1E35B 4BXSA 2O8UA 2V3HH 2BY8X 3LDXH 4ZKRU 1SQRA 3DFJA 3F9GA 1C1NA 1QNJA 2B7DH 1C2GA 3GCOA 3OAAD 1GHBF 1H1BA 1HYLA 3MU4A 4D76A 3ZZ3A 1CA0C 2BY7X 2J92A 3PLPA 1O5GH 1MAYA 1DOJA 2O8MA 3F0OA 1VR1H 3A7XA 3FP6E 2QY0B 3LC3A 4GCHF 3SV7A 4NSYA 3SORA 3FKSD 2ZTZA 2BY9X 1JRSA 4AZ2B 2BX3A 2ZGHA 4HFPB 4NCYA 2SNVA 4FU9A 3HATH 2VWLA 5EPNA 1F7ZA 1OX1A 4X1PU 1FY3A
chains in the Genus database with same CATH topology
7KMEH 2GZ9A 3OY5U 4CH2B 5JB8S 1RXPA 1SLXB 1VITF 1HXFH 2BDGA 4B2BA 3KF2A 2GMTC 1ZSLA 1UMAH 4MNYA 5SGAE 2FI3E 4BAMB 2V6NA 4YOIA 5GWZA 2FESH 3I29A 4DGJA 1O3KA 2TGPZ 2ZIQH 3E1XB 3RXVA 4NIYA 4YOGA 1LDTT 4BTUB 3E0PB 1YM0A 1NZQH 2VGCB 2A7JA 2ZFFH 1GCDA 2P94A 3HPTB 1Y59T 2ZHWH 4Y10E 5EGMA 1YP9A 4E05H 3SU2A 1S6FA 2Y5FA 1D4PB 4A1XA 1G37A 3E8LA 1L1GA 1MUEB 3U8TH 4IGDA 1HAIH 3V12A 2BLOA 5LPRA 1UTPA 1BT7A 4AYYB 2ZCKP 4MPXA 1GMDF 3HK6B 1MAXA 1EB2A 2AIQA 3U69H 1Y3YA 1MCTA 3A82A 1QA7A 2ALPA 2OLGA 1JIMA 2BY5X 1AU8A 2ULLA 1HAPH 4LZ1H 2HLCA 5AHGH 1QY6A 1Q31A 1JBUH 2GCHG 4OS6A 2HNTF 3M7QA 1W7XH 4DVAU 3RXRA 1C5NH 1ZR0A 1O3NA 5C20A 3Q00A 3DUXH 1O38A 2FOMB 2C90B 3GOVB 3PTBA 1MTNB 4ZHLU 2J95A 3BTEE 3TJUA 1BTHH 1OP2A 1TWXB 1O5CB 2BDCA 1Z8RA 3UWIA 2VIOA 3RU4D 1GHVH 1NTPA 2XRCA 4AN7A 1Z8JB 3VEQB 2DE9A 2FS8A 4HZHA 1H8IH 5DP3A 4B76A 1HAHH 4Q7YA 1W13U 2XWBI 4FUHA 4MG3A 3SV2H 2ZGCA 1FNIA 1SPJA 3MO9A 1F5LA 2VJ1A 1P2KA 1TOMH 4F49A 1QJ1B 1C5VA 3M3TA 2XXLA 5LGOA 1F2SE 3RC5A 1ZTLA 1DXWA 3OTJE 4XBDA 4XDEA 1C5OH 1PPBH 1ETTH 3TVJB 2GGVB 1TABE 1FJSA 1GI1A 3KQCA 3U8RH 1EKBB 1YPKH 2VB0A 2ZFTA 4J2YB 4TY7A 1UTKA 2ODQA 1A5IA 1HAVB 4D8NA 5ETXA 2OC7A 1TA2A 4FVDA 3RXSA 1XUKA 2Q6GA 1O2KA 3M37A 1NRPH 2BHGA 2OTVA 2GCTB 2QC2A 2Q6FA 1G9IE 1SGFA 4BXWA 2VIDA 1SOZA 1WOFA 1WV7H 1GHXH 1NFWA 3T25A 1BTXA 3MO6A 2G5NA 2BD5A 9ESTA 2DE8A 1GBAA 1IOEA 2ZFPH 4X0WU 5C2ZA 1DE7H 3W94A 1W10U 3UQVA 3GISB 1F92A 2ZCLP 1A7SA 1FLEE 1MKWK 3U98H 3LGIA 4K1EA 2FIRH 2GVFA 3GY7A 5DG6A 1LVOA 1UTMA 1G2MA 1T7CA 3D62A 4WMDA 5FBIA 3E3TA 3A7ZA 4UD9H 4QT8C 1QQUA 3P70B 1SGQE 2ZO3H 1BIOA 1F5KU 4YOJA 1OSSA 1IQJA 1D9IA 4U30A 2A32A 4I32A 5EQQA 5JPMH 1BMMH 2VH0A 1SGIB 3KIDU 3A7VA 5F8XA 3PROA 1L0ZA 2BDHA 2BOHB 2QN5T 1QL8A 2Z3CA 2ALVA 1D3TB 4E06H 4Y71A 1GGDB 1SQOA 1O3LA 1MD7A 3DFLA 3GCHC 5F8TA 3TK5A 1XUJA 2I6QA 4GCHG 5EXNA 1GHZA 1LHEH 2YOLA 3ATIA 1O2VA 4LOYH 2EI8A 1MTWA 1ELDE 4NFEA 3UR6A 4RN6A 4MTBA 2J2UA 1O36A 2FTMA 3VB4A 1QA0A 3NXPA 1VITG 1K9OE 1MKXK 4NZQA 5T6FA 1D3DB 2G4TA 1QJ6B 1TNKA 2W3IA 3GY2A 3BTKE 3RU4E 5F8ZA 1W0ZU 1H9HE 1ID5H 3MO3A 1LVBA 1NU9A 3ZZ8A 5DP5A 2F9PA 4HI3A 5CHAC 2PGQB 1AZZA 1K1JA 1LVYA 1DSUA 1K1MA 1BQYA 2FMJA 1WSSH 4UEHH 2Y5HA 5JBCS 2QGRA 1IQFA 3LGTA 2VWMA 1CHGA 1G3BA 3K9XB 1EOLA 2EC9H 1QHRB 3P8GA 3F1SB 1O3GA 4XBCA 4AFSA 1WYKA 3TK9A 1A3BH 1XUHA 3A87A 1ELEE 1GMDG 3JZ1B 1DICA 1BDAA 1AE8H 1AN1E 4KTSA 5LPEA 4UFDH 1QIXB 3M5LA 1AE5A 1CA0B 4NWKA 1AY6H 1QRWA 1YPMH 3MU8A 2FX6A 3SNCA 1D6RA 4X6NA 1P2MA 1JRTA 3BSQA 1MH0A 1AVWA 1EP6A 4Y0ZE 1C9PA 4YLUA 3SJIA 1C5ZB 2ZQ2A 3ZVCA 3ZZ6A 1ANCA 1P9SA 1O3EA 1WTHD 3ATLA 2TPIZ 3HK3B 3BTWE 4X1QU 2BLQA 1QFKH 2W3KA 5TCAA 3U1IB 3BG4C 1RD3B 1HRTH 3A8AA 2GMTB 1HNEE 3O8DA 1P0SH 1AFEH 1O3JA 1G36A 4MPVA 4IC5A 1XVMA 1GBMA 3IITA 2ZU5A 1J15A 1H9LB 1KY9A 3D23A 3I77A 1GDQA 1CHOG 1AFQC 1OWEA 1OWKA 4X6MA 3RLYH 1C2MA 3SJ9A 1GVZA 1ZRBA 3SQEE 1IQMA 2FOHA 4M7GA 1O2QA 5EQSA 1XXFA 5JBAS 3QGNB 3S7KB 1ZGVA 3RMMH 3TGJE 5EXLA 4UFFH 1O2NA 1O5EH 1QR3E 2HNTE 1MTVA 1GHAF 3RU4T 2NU2E 3UUZA 1O2UA 5HM9A 1B7XB 4ABAA 1BMLA 1BCUH 1RFNA 4DT7B 2OXSA 1V2NT 2ZG0H 4O3UA 1YLCA 3QX5H 2JH6D 4NIVA 4JK5A 1VGCC 1ESAA 3SI4H 1A1RA 3OSYA 4NIWA 4NA9H 1C2LA 3URDA 1HIAB 3SQHE 2ZHDA 4CRGA 2WINI 1TNJA 1P09A 2BD4A 1SSXA 2GX4A 1O3AA 2XTTB 8LPRA 3BIVH 3FVFB 4MVNA 3LC5A 2J9NA 4MNVA 2PUQH 4DW2U 1Y5UT 2OQ5A 3CS7A 1YYY1 2ZU2A 3S7HB 2OCVB 1TNIA 3U8OH 1GMCF 1AMHA 1Z7KA 4WVPE 1GI9B 2B0FA 5T6DA 2XBXA 2ZF0H 1DPOA 1UTLM 1GBLA 1UTQA 2J34A 3PB1E 3NUMA 4WXIA 1QB9A 2BZAA 1YCPK 3RUOA 3T29A 3GY6A 1GVLA 5L2ZH 1TMTH 3UTUH 1RTLA 4FUDA 1IQEA 4E7NA 1IQHA 1DY9A 2FLRH 4HGCA 4FUJA 4UFGH 1O2IA 1HAYB 1L1NA 4GSOA 4AGKA 2PV9B 2M5TA 1AVXA 5I25A 3KQBA 1NRQH 2BY6X 4AB9A 1UK3A 5E2PA 4ABDA 3ZYEA 3MU0A 5G4BA 3UNSA 3SGAE 4JYUH 4B74A 2ZGJA 1A0JA 1EZSC 1QTFA 4NSVA 2OUAA 4BANB 1V2MT 2ZNKH 2WV4A 2BXUH 3GY3A 3LGYA 4ASHA 1E38B 3QTVH 1J9CH 1W11U 3QDZB 1KXCA 2ZZUH 4Y79A 1PFXC 2CV3A 1O2RA 4YT7H 4R0IA 1ZMJA 5E2OA 1O0DH 2C93B 2CGAA 1C9TA 1ESTA 3LKWA 1PPZA 2IPHA 2H9HA 1EXFA 1V2UT 2ZI2H 3VGCC 2G4UA 3RXKA 1J17T 1HGTH 5GDSH 2Y80A 1QRXA 3OU0A 5JBBS 1FY8E 3U1JB 3SHAH 3V3MA 2OINA 4Y8XA 3SGQE 2AGGX 2Z94A 4WY3A 4BAHB 1C2EA 2VH6A 4YLQH 3MH7A 4ISNA 2UUFB 3A88A 3GCHB 3SI3H 1CBWC 3JZ2B 4DJZB 2BB4A 1YLDA 2CF9H 5EW2H 2QF0A 4MNWA 3LPRA 1P2NA 4A1VA 1HJAC 2XWAA 1O37A 3PWBA 4JZDH 4ZMAH 1MCVA 2FDAA 1T8NA 1LHCH 1GBCA 3FP8E 2VIPA 1ETRH 5DO4H 1N8OC 1GI0A 2ZTXA 1TA6A 1HAZB 5L30H 2RA0A 2HPQH 4HTCH 1BHXF 1INCA 1MQ6A 2XBWA 3DA9B 4R8TB 5LPFA 5DP4A 3B9FH 1AWHB 2CXVA 1ANBA 1TGTA 3A7TA 3SN8A 1GHYH 3SJKA 2SGQE 3KN2A 1THSH 1Y8TA 5CHAB 3K2UA 3C27B 1O2JA 1QB6A 3OY6U 2AS9A 3MNXA 5A0AE 1C5MD 1Y3WA 2XCNA 2FM2A 1THPB 1O31A 1SGFG 1ZPBA 1S5SA 1C1SA 3EA7A 2YNAA 2Y81A 1BMNH 1G3DA 1S6HA 1TFXA 1DFPA 2RCEA 1P03A 5A0CA 3T5FH 2ZECA 1C5RA 2BM2A 3SV6A 1O3OA 2UWOA 2A7HA 2F9OA 1QRZA 1TBRH 3QUMP 1G30B 2EEKA 4Z0KA 2GV7A 1O32A 5DPAA 4YZUA 1S84A 1FY1A 5J4SA 2SGPE 2JH0D 4KGAA 4I31A 3SU1A 2C8YB 1NRNH 2XC5A 1QBVH 1YPHC 4NZLA 1OPHB 3NZIA 3I78A 1TNLA 4H4FA 5GCHG 1GBIA 2FOAA 1LQDB 4B73A 3RXMA 2F83A 1O2XA 3RMOH 1HCGA 3RXFA 3TGKE 2AMQA 1IQNA 3PV4A 1F0TA 1LHFH 1O3CA 4CR5A 2ZFRH 1P10A 4PROA 3SNAA 4CREA 2Z7FE 3ATKA 2STBE 1C5UA 2ZQ1A 5FPSA 3BG4B 1KTTB 3U9AH 2ODPA 1DSTA 3RXQA 1ACBE 2O9QA 3SBKA 1BTPA 1DWDH 3C1KA 3P92A 6CHAC 3HGPA 1JMOH 3RXDA 3ZZ7A 2TRMA 1RRKA 5F03A 1BRCE 1AFQB 3MI4A 4IBLH 1HIAA 1P9UA 1FIWA 1GCTB 2OBQA 4UONA 1VCPA 1O2MA 2BD7A 4WMEA 4AGJA 1W7GH 1TPAE 1EAXA 2STAE 1ELVA 1O30A 3ATWA 3CENA 1BJVA 2FYRA 4ABHA 2FODA 1QCPA 1GWAA 3P6ZB 3RMNH 3Q76A 3EA9A 3RLWH 5ESBA 4O9VA 1ZGIA 1AD8H 1F0SA 1TGNA 3ZYDA 4X8SH 2XBVA 4H6SB 1TBQH 2FO9A 5H4IB 1V2VT 3L33A 1O34A 2CF8H 1GJ8B 3TJVA 3EA8A 4GUXA 1S85A 6GCHG 2ZHFH 1UCYH 1VGCB 2ZU1A 3SU5A 1WQVH 3M36A 1VJ9U 2V3OH 1A0HB 1BBRH 1K1IA 4TWYA 2GT7A 2AGEX 3BF6H 3RDZA 1C5XB 1DX5M 1XVOA 2PSXA 5C1XA 1EAUA 1D3QB 1GJ6A 2ZTYA 5IDKA 3T62A 1K1PA 5JBTA 1BHXB 1N6XA 1DS2E 1T8LA 5E0GA 3IWMA 1FY4A 2QXHA 4U01A 1TE0A 4TYDA 2BX4A 4B71A 4D9QA 5K0HA 4CRDA 1A46H 2F3CE 4Q2KA 2BVRH 1P05A 1AQ7A 1HAXB 3TITA 1HJ8A 3TGIE 1XX9A 1EASA 3KQEA 2BDAA 2ANYA 4XBBA 1LCYA 4FUCA 3E16B 5DK1A 1BRAA 2W7SA 1ZMNA 3A85A 1MBMA 1EB1H 1C5QA 1QL9A 5JB9S 3AW1A 3TH3H 1D3PB 5T6GA 1ZHRA 1EAWA 3QK1A 3QTOH 1XKAC 1C5TA 3AAVA 3RM2H 1LPZB 2VIWA 1DLEA 3A7YA 1NESE 2GP9B 3QGJA 2QV1A 4FUBA 5FXLA 4IC6A 1Y3VA 1BTZA 3LJOA 1UTJA 3ENSB 1AWFH 2H9TH 1FPHH 4ESTE 3D49H 1B0FA 5EW1H 3FZZA 4VGCC 2ZDKA 3T27A 1TMUH 3UFAA 1TGSZ 5FCRA 1LMWB 4WF8A 1CT4E 1W14U 1Z6JH 4XFQA 2A0QB 2PUXB 1OP0A 3ZZAA 4ISIH 3PO1C 4H6TA 2ANWA 5FX6A 4KTCA 1C2KA 1MZAA 2UUYA 4JMYA 1HFDA 4O03A 1BRBE 1YGCH 3B8JA 3MNSA 3V7TA 1GJAB 1FDPA 2JETC 1K2I1 1GI2A 1O2PA 1K1OA 5AFYH 2AMDA 1EPTA 2FX4A 2ODYB 3ZVEA 1MQ5A 1P04A 1TALA 1GHBG 1BTYA 1EX3A 2C3SA 2FP7B 1JXPA 1MZDA 4B75A 3ZVAA 3QN7A 4X8UH 1C2HA 1GBKA 1MU6B 3P95A 1C2FA 2ZP0H 2R0LA 3VFEA 2EI6A 4AFZA 4AG2A 3F68H 1V2TT 4MPUA 1ZTKA 2FOCA 3BIUH 1C4U2 1J16A 1SFQB 3PYHA 1TLDA 2A4RA 2J94A 1HJAB 2BD3A 2ZPSA 3SU0A 5F6MA 1IQLA 1N8OB 4A7IB 4CHAC 1PPHE 2NU1E 1C5LH 1QQ4A 1GL1A 2XBYA 2A7CA 6LPRA 1EPTC 1W12U 1L2EA 3D65E 1ABJH 4FUIA 3ZZ4A 1M9UA 1PPGE 1TPSA 5B6OA 3HKJB 1GMHF 3SV9A 4IN1A 1BTUA 1FUJA 2R2WU 3A8DA 1K22H 5AF9H 1QBNA 1O33A 1IQIA 3ELAH 1FAXA 2G00A 1DY8A 3UOUA 4JCNA 1GDNA 1DANH 2TGDA 1HPGA 3KQDA 3LOXA 1NC6A 1T4VH 1TAWA 3PTNA 1ELGA 2IN2A 2AIPA 2ZPRA 3KCGH 1GBHA 1XKBC 4I8LA 3VB6A 3W95A 1AZ8A 3E6PH 3SOSA 1D6WA 5IYTA 2TBSA 2A31A 3ODFA 1A0LA 1NS3A 1A4WH 2AH4X 2P16A 3BTQE 3LH3A 1X7AC 4X6PA 1C5WB 2F9VA 4X1NU 4ABBA 1O3FA 4SGBE 3EAJA 4OS1A 3RM0H 3K65B 4X2XA 2VINA 2H6MA 4ZKOU 5A8YA 2BDBA 2G81E 3RXOA 2Z9IA 2Y7XA 3UOPA 1P2IA 3Q3YA 3V0XA 1PYTD 2ILNA 1QURH 1C1OA 2PFEA 2Z6BD 1FI8A 3S9BA 1KSNA 4XOJA 3H5CB 1GJ5H 2GTBA 1W8BH 1TPPA 4ZHMU 1OP8A 4IN2A 1O2ZA 4ABFA 1O2TA 2PKAA 4WH6A 3TLOA 3M3SA 1TX6A 4ABJA 2P8OC 2ZA5A 4ZH8A 1GJDB 3F9EA 1QB1A 3UY9A 5GXPA 1CO7E 2F9UA 3RMLH 5DP7A 1AGJA 1FZZA 3R3GB 3GY5A 3RXTA 5DGJA 1P57B 1TX8A 3KHVA 2VWNA 3SU4A