3M7UA

Crystal structure of alpha-lytic protease sb1+2 r64a/e182q mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDAAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFQRLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-lytic protease
publication title Quantifying protein unfolding cooperativity with acid sensitive probes: Interdomain salt bridge contributions to unfolding cooperativity are combined efficiently in alpha-Lytic Protease
rcsb
source organism Lysobacter enzymogenes
total genus 54
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7uA01
2VWMA 1DPOA 1W7GH 3E1XB 5EXNA 1ANBA 1O3GA 1TONA 1VJAU 1DXPA 3R0FA 1P04A 3PTNA 1T4UH 4AORA 1BBRK 5E8EH 4OGYA 1D3QB 3ESTA 1TNKA 1V2NT 2AH4X 3Q00A 2J2UA 1SFQB 1PPGE 1AMHA 4NIXA 5LGOA 1T7CA 3ODFA 1G2LA 1DUAA 1F5LA 2FOHA 3AAUA 4MQAA 2IOTA 1O3PB 1XXFA 2BVXH 3CENA 1SGPE 4TYDA 2Z3EA 1WSSH 3HKIB 1GJCB 1Y5BT 3TJOA 3SN8A 1Z7KA 1KYNA 2JH6D 2ZGHA 2BLWA 1XUKA 1XXDA 2Z3DA 3LJJA 1IHSH 3T25A 3EAJA 3JZ1B 1Z8JB 3PM3A 2G51A 2J34A 1TBQH 5DP5A 4NSYA 1AWFH 3M3SA 1UTPA 1TAWA 2FX6A 4CR5A 2Y5GA 5JB8S 2K1QA 1DVAH 2CV3A 5LH8A 3P92A 4K60A 3MWIU 2A2QH 3MO3A 2QYIA 2AFQB 4WWYA 2LNCA 3VB5A 3DFLA 3KIDU 4GCHG 2ZDNA 4M7GA 1O3DA 1O2VA 1BHXF 2UUKB 1LMWB 5LPRA 5E2PA 1UCYH 1O2WA 2FOFA 3DFJA 2JKHA 3P8NA 3MU5A 2OBOA 2ODQA 3TNTA 3UQOA 4X8VH 1NRSH 2AGEX 2NU2E 2WUCA 3PMJA 6LPRA 1UVSH 1WYKA 4OS7A 3RM2H 1AFQB 1KXBA 4WXVA 2RCEA 2GMTB 1V2VT 4GCHF 1F5RA 1VCQA 4JYVH 2GGVB 1N6XA 3GYMA 3UPEA 1AWHB 1BRBE 1TQ7B 2A7JA 2ZFSA 2PW8H 2WYJA 3UNQA 1FQ3A 7KMEH 1DITH 1GI4A 5B6OA 1P06A 3Q77A 1GDNA 1HXFH 4NFEA 1G3EA 1T31A 3RC5A 1D9IA 1SR5C 4Z0KA 3HK6B 1SQAA 4NIWA 2B5TB 1DICA 2FX4A 2PKSB 4RKOB 3OX7U 4Y6DA 1C5MD 1SFIA 5JBTA 1EZSC 3UWIA 3W94A 4BANB 3MYWA 1W0ZU 3PYHA 3VB6A 1ESAA 8GCHG 4AFQA 1CT0E 4DIHH 3VXEH 4AFUA 2ZU3A 1O34A 4ZHMU 1SGQE 2SFAA 1S6FA 2Y81A 2ASUB 2WUBA 1KSNA 1EZQA 5DK1A 3SNAA 3SUFA 3ZVEA 1NS3A 4YESB 3NUMA 5C67A 1ZSKA 3DUXH 2VWNA 3BTFE 1K28D 4ABJA 1O5AB 4UDWH 1VGCB 1TGSZ 3MU8A 4TY6A 3U8TH 2ZTZA 3RXVA 1O3KA 1LVYA 1SGIB 1F0RA 4ISIH 3M7UA 4AB9A 3LDXH 4IN2A 5DPAA 5FPYA 1C2IA 1FZZA 1V2ST 1GI2A 3T29A 3T26A 2O9QA 4OS2A 6GCHG 1TRNA 4WH8A 3F9FA 5EQSA 1A4WH 2B9LA 1A5GH 3FP7E 4PROA 1BQYA 3FP6E 1O2LA 2OLGA 5ETXA 2RA0A 4Y11E 3ZZ6A 1RXPA 1Y3VA 2W26A 1K1JA 1YCPM 1IQJA 3RM0H 3U1JB 5CMXH 2ZU1A 3QK1A 3SO3A 1TNJA 1EUFA 5HMAA 1QA7A 4AGKA 1UK3A 2TRMA 3KN2A 1O2PA 4ABDA 4ZUHA 1QIXB 3QGJA 1CBWC 5JBAS 1O2RA 1VCPA 2GZ8A 1RJXB 3SNEA 1KLTA 4MNYA 4BAKB 4INLA 4CRAA 2XRCA 1C1RA 1XKBC 3FVFB 4LZ4B 3DHKH 3M61U 4RKJB 3EYDA 5EXLA 2TGDA 1HJAC 1CGHA 4GLYA 4D7GA 2FTMA 1AD8H 1EP6A 2KAIA 1HUTH 2O8MA 1AUTC 4JZ1A 1INCA 4U2WA 4WMDA 2Y6TA 2VIVA 4AZ2B 1QNJA 2ZIQH 5E0HA 3BTHE 4MLFB 1XUIA 4KTSA 3ZZ7A 1EZXC 3C1KA 1ZMJA 4I33A 3MU0A 2VIOA 5F03A 1MKWH 2QXIA 4ISLA 2PSYA 1D6RA 2SGAA 1K9OE 4K1EA 2PFEA 2BD4A 2R0LA 3RXAA 3GDSA 3SBKA 1K1OA 2F9UA 4K1SA 5GCHG 1GHAG 1LQDB 1KDQB 4Y76A 2UWOA 1C5QA 2NU0E 1AKSB 1QB9A 4IMQA 2A7HA 4O03A 2JETB 1PQ5A 1DWBH 3W95A 2HOBA 1MZAA 3URCA 7GCHF 2Y7ZA 1DOJA 3NWUA 3SJIA 3O8CA 1RIWB 3GOVB 2VWLA 4NA9H 4HZHA 1EX3A 5GCHF 1GHAF 2VIWA 1FUJA 5E0JA 1O2QA 2V3OH 1LHCH 4MNVA 1AFEH 2EI8A 3SI4H 3GY3A 2BM2A 1LO6A 3RXDA 3TK6A 2BY7X 3QWCH 2WINI 1W11U 2BZAA 4I8HA 3FANA 5EG4A 3TVJB 1THRH 4DJZB 1WTGH 2SNWA 1O5GH 1A5IA 1A5HA 3QDZB 1TX8A 1SHHB 3U8OH 2GX4A 1MU6B 2PGQB 1H4WA 2OC8A 2FXRA 4YLQH 1TGTA 4K8BA 3BG4C 4GUXA 1YF4A 4XE4A 3M5LA 4NG9H 2P8OB 2FS9A 1HJ8A 4H6TA 3RMMH 2A5KA 2RG3A 4YT7H 4YOIA 5F8ZA 1T8OA 2BLVA 1W2KH 5AHGH 3ZYDA 1GHVH 1GMCF 1BTXA 3EA9A 1HIAB 2G55A 2HPQH 2Z9IA 5GDSH 1ZZZA 3TJNA 2AGGX 1C9TA 5TCCA 4CH2B 1AVGH 4DURA 3DT0H 1BBRE 2PHBA 2BTCE 4WH6A 2ZCKP 3GYLB 1SBWA 2G5NA 3RXEA 1K1MA 1TRMA 1SGCA 1N1LA 4ZKSU 4K69A 4X2VA 3LKWA 2DE9A 2AMDA 1BTZA 2PWXA 1GHYH 2UWLA 1AFQC 4LK4A 2A45B 3LT3A 3A85A 2F3CE 2C90B 1ZGIA 3PWCA 1GI0A 5DO4H 1AI8H 1L4DA 4SGBE 1YPEH 3RXQA 2WYGA 2HPPH 1F92A 5J4SA 1ZR0A 1BMLA 2G4UA 4FUEA 2ZDAH 4JZIA 3O8RA 3Q3KA 4X8SH 2W7UA 2BHGA 4TPYA 3VB7A 1WOFA 1THPB 3GISB 4X2XA 2PKSC 2PUXB 2W5EA 1IQKA 1FJSA 4CRCA 2JH5D 1BTUA 1V2PT 1FY8E 1GMDF 1WQSA 4X1NU 2BOKA 4NA8A 3S9BA 1C1QA 1QBVH 3SOSA 4INHA 5DJ7A 4NGAH 1GHXH 3ATKA 3EA8A 3A8CA 5L2ZH 3BTME 4IMZA 1QHRB 4HFPB 5HM2A 4YM9A 3D65E 3PROA 3EA7A 1BRAA 1Q31A 3T28A 3PO1C 2XYAA 1HB0B 1OWJA 4YOJA 2ZDMA 2BQ6B 3IWMA 3BTEE 1ZMLA 3FZDA 5C1YA 2SGEE 2IPHA 3OTJE 1W10U 2ZF0H 1V6DA 1GVLA 2BY8X 3S7HB 1PJPA 1UHBB 2SGPE 1SHYA 1TALA 3DD2H 2D26C 3T2NA 1O2KA 5E0GA 2ZFRH 1C5PA 3BTDE 2BX4A 3RC6A 1GBMA 3BF6H 1EAWA 5FX5A 3UR6A 4AB8A 1BCUH 1MMJN 4ISHH 2ZFPH 1Y3YA 1HAHH 2UUFB 2Z9KA 2C8ZB 1Q3XA 2NU1E 5EW1H 1VJ9U 3BG8A 3FAOA 1A2CH 1A0LA 3MMGA 1P2KA 1PPEE 4XDEA 2FOMB 5L2YH 1TGNA 2FYQA 1ZGVA 1UMAH 5C20A 2H5CA 2XC5A 3SUEA 1GBFA 1C5RA 3M7QA 2RDLA 1GI7B 1CBWB 1O5EH 1O3FA 1W3CA 4IN1A 1EAXA 1HAOH 1TWXB 3TU7H 3RUOA 3TGIE 1DM4B 3C27B 1TNHA 4DGJA 1C5NH 1NPMA 1UTKA 3TGKE 5AFYH 2FPZA 1J9CH 3PMHB 2BLQA 1EJMA 1TGCA 5F8XA 3GY2A 1CHOG 1PFXC 1TFXA 3E8LA 3BSQA 3MNCA 4AX9H 4Y71A 4XFQA 3G01A 2BD9A 2QIQA 2W3IA 3PLBA 1Z8RA 2OQ5A 1ACBE 5FAHA 3M37A 1DLEA 5EXMA 9ESTA 1GL1A 2ZU4A 2QA9E 1ZTKA 1NU7B 1ZTLA 4Y79A 1SLVB 1T32A 1FY5A 1PYTC 4Q80A 1TIOA 1YLCA 1ZHMA 1IOEA 1CHOF 1S5SA 3UUZA 4MNWA 1CQQA 3SORA 3ZZAA 1OWIA 2VVCA 2BY5X 1O2TA 1GI8B 3QTVH 5IDKA 2Y5FA 2FOEA 2FESH 4ZKRU 2QV1A 1F0UA 2H1UA 1TX6A 4JMYA 1P10A 2O8WA 2Y7XA 3MH4A 2GV6A 2ZFQH 2VNTA 4A1VA 2A5AA 1RIWC 2NWNA 1UCYK 4UFFH 5A8XA 1WAYB 3SGQE 1FPHH 1SGFA 3B8JA 4B73A 3KF2A 1ZHRA 4OGXA 1HAXB 1Y5UT 1ANCA 1BHXB 5JYIA 2BQWB 1SB1H 3LGYA 2BXTH 4RN6A 3EE0B 3K6ZA 2XC4A 1C1UH 2FOCA 3L3TA 1ZSLA 1JXPA 4Y10E 5H4IB 4DT7B 1KLIH 4ZXYH 4D8NA 1GPZA 1GI6A 4BTUB 3KQDA 2VJ1A 2BX3A 3SQEE 1SSXA 4ABEA 3QGNB 1P2QA 3N7OA 2Q6GA 1SVPA 2Z6BD 3PV4A 4FVDA 2XXLA 1XM1A 1ZLRA 5HXFA 1QCPA 1NO9H 2FM2A 2IN2A 1FY1A 1WUNH 4I7YH 1XVOA 5FPSA 2ULLA 2P8OC 2ZGBH 1H9HE 1TQ0B 3TH4H 5JPMH 2P3UB 1MTWA 4MPWA 4XBBA 1L4ZA 1IQHA 1GHBF 1SMFE 3BG4B 3HPTB 2ZFFH 3SHCH 2THFB 4X1RU 1CVWH 2EC9H 1TMTH 1F0TA 1V2OT 4BXSA 1BRUP 1Z8IB 1LVBA 3RXFA 2VGCB 1C5WB 1XUJA 1NT1A 1BMNH 1NN6A 1GBEA 2Z3CA 1FN6A 1O3OA 3FFGA 1FNIA 1L1NA 3RXRA 3SV6A 4VGCC 2ALVA 1TA2A 5J4QA 4O9VA 1UVTH 3V13A 5FBIA 3URDA 1DS2E 1MZDA 2FDAA 1QL9A 5CHAB 3A7VA 1ZRKA 1TBZH 4GVUA 1DY9A 1FIWA 5JBCS 1A0HB 1DANH 1G3CA 1EJAA 3LGTA 5C5NA 1K1PA 3E90B 4KTUA 4WMEA 1AE8H 1ETTH 3MTYA 3RXIA 5GXPA 3RXBA 3OYPA 3VGCB 3RMLH 1ZYOA 1SLUB 3MHWU 3MH7A 1SGFG 4TWYA 1ANDA 2OC1A 4CH8B 1RTLA 3HKJB 2VH6A 2CF9H 2A0QB 2OXSA 3S69A 1EB1H 4U32A 4AG1A 1EXFA 3F1SB 4Q2KA 2ZI2H 1GGDC 1UTLM 1LHEH 4ZKOU 1CA0C 5EODA 4Q7ZA 4HI3A 1CU1A 1EPTA 1KTSB 4A7IB 2CHAC 1HAVA 3SU1A 1G9IE 3TH3H 1X7AC 3VB3A 2BDBA 1KXDA 2Y82A 4SGAE 3T27A 3SV9A 1P2MA 2TPIZ 1PPZA 1Z1JA 5SGAE 1GBTA 2BDHA 2YNAA 1GHZA 1IHTH 4NZLA 1TPAE 3ZZBA 2QF0A 1QQUA 5K0HA 4F4OC 4FU7A 4H6SB 2A31A 2FS8A 1C2KA 2DE8A 1FLEE 2HNTF 4A1XA 1SGNE 1B0EA 3QTOH 1C5YB 3K6YA 3PO1B 5ESTE 3T62A 3A82A 3MH6A 2GT8A 5FCKA 2BXUH 3A7TA 2VVVA 3RU4T 1M9UA 1S0RA 1VZQH 2WV4A 5DP9A 5EU8A 1FI8A 4D9RA 3IITA 4MPVA 3UNSA 2GVFA 5E2OA 1V2KT 4FXGH 1AB9B 1MKXH 2FOAA 2FMJA 3T5FH 1OWEA 4X6MA 1MKWK 1BTHH 2HRVA 1PQ7A 1CT2E 1ID5H 4IBLH 2J38A 1AVWA 1V2UT 2AYWA 2G8TA 2R2MB 3EDXB 1DY8A 3Q3YA 5FXLA 1SLXB 1Q2WA 3PTBA 1MCTA 2PUQH 2H5DA 1AHTH 1IQIA 1H1BA 1RD3B 1C2MA 2FYRA 1EPTB 3RDZA 1V2QT 3ATWA 2OP9A 1NFWA 4XBDA 1ELFA 3M5MA 2OD3B 4YT6H 4UEHH 2J92A 2H9TH 3OY6U 4B75A 3OY5U 1FXYA 1K2I1 3TK5A 5EGMA 1P12E 3M7TA 1BZXE 1AZ8A 3V12A 1C4V2 1O3LA 2CGAA 9LPRA 3TGJE 2GT7A 2BYAX 2ZEBA 4IC5A 1UK2A 1ZMNA 4NSVA 4AFZA 4NWKA 1J8AA 1W8BH 4KGAA 1NY22 1C1PA 1GJAB 1O5BB 2R9PA 2UWPA 2BD3A 2FP7B 5A0CA 3F9GA 4IS5A 1ARBA 2VH0A 3F9HA 1ETRH 2QXHA 5LPFA 2OCVB 1KY9A 1L1GA 1MCVA 4CHAB 1C2JA 2WPKS 4JZFH 2BOHB 4LXBH 2VIDA 1PPBH 3GY8A 4NCYA 4GHQA 4MVNA 3VXFH 4ZROA 1BIOA 7GCHG 1QA0A 1BT7A 3U98H 1ANEA 3HK3B 1NU9A 1S81A 3MFJA 5C1UA 3A87A 1ELAA 3LGVA 2GKVE 2ZQ2A 1C5TA 1NFUA 3SNBA 1DWEH 1IAUA 2QC2A 2ZDKA 1GBKA 2J4IA 1GI1A 6ESTA 2WPHS 1QR3E 3MI4A 3BTKE 4TY7A 1L2EA 1MBQA 2F9VA 3UREA 2D1JA 4CRGA 1G37A 3NPSA 1JMOH 1JRTA 3TIUA 1QTFA 1TPSA 3SQHE 2J94A 4I32A 3SV2H 2VIPA 2BQ7B 1B0FA 3SU5A 3CS7A 4J2YB 2O8TA 1TNGA 3ATLA 4CRBA 4O3TA 1EAUA 2KAIB 3ZV8A 1N8OB 1C1MA 3ZZ9A 1O36A 5L30H 2F9PA 1C2LA 4X2WA 2ZHFH 1A1RA 1UTQA 1FAXA 1MTSA 4FUDA 1F5KU 1SGRE 1D3TB 1CT4E 3GY4A 1UVUH 1LKBA 4JYTA 2BVSH 2ZDVH 3RMOH 2YNBA 2Z94A 3KQBA 1AN1E 3QX5H 1GMCG 2ZPRA 4Y0YE 1BMAA 2A1DB 1FDPA 2TGPZ 3F9EA 4ABHA 1C1OA 3M5NA 3K9XB 1V2MT 2A4GA 1C5UA 4TPIZ 1BITA 1UCYE 3P17H 3ZZ5A 1ZPCA 1C2GA 2VGCC 3HGNA 3H5CB 3AW0A 5TJXA 1T8NA 2CN0H 3PB1E 3RLWH 4U30A 4LZ1H 3RXMA 5I46H 1UJ1A 1Z1IA 4BAHB 5GJ4B 3OSYA 1ZPBA 4FUGA 5CHAC 5A8ZA 4VGCB 1S82A 3E91A 2ZC9H 4NFFA 2FI3E 2I6SA 2SGQE 1GBDA 5G4BA 2ZDLA 3GDUA 1Z8GA 1O3IA 1B5GH 1MQ6A 4FUIA 2AMPA 1KLJH 2JH0D 1W14U 4GHTA 1VITH 2EI6A 3SUGA 4K1TA 3A80A 3VGCC 1LVOA 1GMDG 2XCFA 5C3NA 1EKBB 1J17T 3SU3A 1C5OH 2W7SA 2GCHG 2PTCE 1FN8A 1OKXA 4Y8XA 1B7XB 1C5VA 3L6PA 4XSKU 1ZRBA 2VINA 1ELDE 3MOCA 1Y5AT 1NRQH 3RXHA 2WPIS 1YBWA 3SJOA 4QT8C 1O5FH 3UQVA 4H4FA 3MO6A 4JZEH 1FONA 1UVPA 1NZQH 2C4FH 4ABIA 1ZOMA 4GSOA 2XBVA 4ABFA 5HGGA 2GCHF 2UUJB 1ELBA 1GGDB 1ELGA 2NU4E 1CA0B 2BY6X 3ZVDA 1C5LH 1W7XH 2CHAB 1GL0E 1LCYA 1C2EA 1A61H 2FI5E 3F68H 3P6ZB 3SU2A 4Y7BA 5T3HA 1G36A 2BVRH 1C4Y2 2A5IA 2C8XB 1RS0A 4R0IA 5AFZH 1ELVA 3SNCA 4LOYH 2CMYA 1QBNA 2J9NA 2GZ7A 4FU9A 5F8TA 1C2DA 4E7RG 4X1QU 1AVXA 2F91A 1P01A 1WBGB 1T8LA 1O2HA 3A83A 2BD5A 2OQUA 2P3FH 1AO5A 3CS0A 3E6PH 3A81A 2IJOB 1MTUA 1AB9C 3BTTE 2QXJA 1KTTB 2GZ9A 2BLOA 4ZHAA 2WPLS 5FCRA 1Z6EA 1CA8B 1MD7A 1XUHA 2GTBA 4NA7A 3GY6A 4MPXA 1BOQA 2SNVA 1O2IA 1J14A 2PKAA 3RXOA 1HLTH 3BTGE 2STBE 1BTPA 1WTHD 2R3YA 5DP8A 2FOGA 1EZUC 2AIQA 1IQEA 1MBMA 1EPTC 1GBBA 1TOMH 2G81E 3MU1A 2PR3A 2TBSA 3TLOA 1V2LT 4YZUA 1RGQA 6CHAC 3P8FA 1JIRA 1JIMA 2Q6DA 3RMNH 2BDGA 1O39A 3E16B 1YP9A 1S6HA 2C8WB 4X6NA 2Y80A 1OP0A 3P8OA 3OU0A 1GBLA 4IGDA 2QY0B 1DLKB 2O8UA 3Q76A 4O3UA 3GCNA 4X1PU 1SGYE 3GY7A 4A1TA 2C3SA 4AYYB 3UY9A 1K21H 1ELCA 1QB6A 1ZTJA 2H2ZA 2QXGA 1CGIE 5A2MH 1GI5A 2AIPA 3BV9B 3RXPA 3S9CA 2R3UA 3A7XA 1RFNA 4OS6A 3ITIA 4A5TS 2G00A 3PMAB 1SQTA 4CHAC 1GG6B 4BTIB 3GICB 3LPRA 1YPJH 3KGPA 4IC6A 3SUDA 1MUEB 1GJBB 1MD8A 4Z6AH 2ZTYA 1PQ8A 1EASA 4AN7A 1O3HA 3I29A 1SPJA 1HXEH 3VEQB 1J16A 2ZHDA 3RXKA 1E38B 1O2JA 3RXSA 3ELAH 2XC0A 3FP8E 4BAOB 1IQNA 3V0XA 1CO7E 1T8MA 1GJ6A 4B2AA 1O2YA 2ZNKH 3BTQE 1GJDB 1QJ6B 1UTJA 2EI7A 2P3TB 1O5DH 4JK5A 2OTVA 1K1NA 1P03A 2A32A 1GBJA 1HV7A 1ESTA 5GPIB 2O8LA 3ZVCA 1NRRH 2WPJS 1EOJA 1AUJA 4AOQA 1GJ7B 1H8DH 4ABGA 4Q7XA 1NFXA 5T6GA 5BPEA 1U6QA 1L0ZA 1OOKB 4BTTB 3A89A 1TPPA 1N8OC 4X6OA 4R8TB 4Y7AA 2CF8H 1CSOE 4E05H 2Z7FE 2BDYA 3PMBB 2P93A 5GIBA 1GBHA 3TJUA 3UIRA 1O38A 2BD8A 1LPKB 1DWDH 3LC3A 2BB4A 1GHBG 3BN9A 2ZGJA 3JZ2B 1GDQA 4HGCA 1GMHF 1N6YA 4FUBA 4GAWA 1VCWA 3NKKA 5EPYA 2AGIX 3ZZ8A 1G32B 1HDTH 1VR1H 4HTCH 5EQQA 5ESBA 3F6UH 2V35A 4UONA 1TRYA 2V6NA 1L1JA 1W12U 3LGIA 3MNXA 4I8GA 1O31A 1UTNA 3LOXA 3ZVFA 1O30A 4CRFA 1P57B 1OWHA 2BD7A 4JK6A 1TMBH 4B71A 3D62A 4B74A 1EOLA 5FBEA 1ZJKA 1K1LA 1OX1A 1O3CA 1O2MA 1XUFA 1FY4A 2ZPSA 1H9LB 5EPNA 2BD2A 1LVMA 2VU8E 4X8TH 2ZKSA 4YLUA 2Z9LA 1O2SA 1O35A 3STIA 1EP5A 4MG3A 1HRTH 5A0AE 1ABJH 1HYLA 1C9PA 4JCNA 1DSTA 4DVAU 1TOCB 2WV5A 4B2CA 1RTFB 1E34B 2ZP0H 2EEKA 2CJIA 1QRZA 2Q1JA 1OS8A 1YYY1 3QO6A 3SJKA 3LH3A 1MKXK 2F83A 1GVZA 4MDSA 4K8YA 1FPCH 2P16A 2ODPA 1ZJDA 3Q3XA 1A46H 1O2NA 1G3BA 5DP7A 4AFSA 1F2SE 5PTPA 2V3HH 4YOGA 1FIZA 3KQEA 2BDIA 3SV7A 2V0BA 8ESTE 1BBRH 1TX7A 4NZQA 1QQ4A 3GCHC 3SU0A 1P2OA 2R2WU 4DCDA 2FIRH 3TPIZ 5C5OA 2BDAA 2FEQH 4ZMAH 1D4PB 1LDTT 3BEUA 3P70B 4XOJA 4X8UH 1QGFA 4FUCA 1TBRH 1IQMA 5CE1A 3UTUH 1P8VC 1KXCA 1ZPZA 1XUGA 1T4VH 2ZU5A 1P11E 4WY3A 2I6QA 3QZQA 4KTCA 1DUEA 3LGWA 4UE7H 1YPLH 3PLKA 1MTVA 3GCOA 2PGBB 4OS1A 1O3JA 1V2JT 4OS5A 1TGBA 1GCTC 2XCNA 2ZCLP 2B8OH 1CGJE 3SU4A 2A4QA 1C1NA 4FU8A 2ZHEH 4Y8YA 4YO9A 1Z71A 2ZO3H 5BRRE 3LIWA 4NIYA 3KL6A 1P9UA 3ZZ4A 1O3BA 3LC5A 1QRWA 2CXVA 1MTNC 2VVUA 8GCHF 1DX5M 1KXEA 1GWAA 2ILNA 3S7KB 1LHGH 1OP8A 1EATA 1HBTH 4D76A 1WQVH 2F9NA 2OBQA 1WV7H 2HALA 1Y8TA 5JB9S 1V2WT 2XBYA 1E37B 3VB4A 3QN7A 1SI5H 4WVPE 4E06H 2W3KA 4AG2A 1Z6JH 3LH1A 1GBCA 1AE5A 2ZTXA 1LTOA 5A8YA 3M5OA 4U01A 1C5XB 2ANWA 2HWLB 3AAVA 1TPOA 5IYTA 1G30B 5EOKA 4NIVA 4Q7YA 5K7RA 2XTTB 3ZVBA 1HAVB 1TA6A 3A8AA 1ETSH 4FUFA 4ZAEA 3ZVGA 1BDAA 1P2IA 5HYOA 2FWWA 1C1VH 6CHAB 2EA3A 4ZHLU 5DP4A 2ESTE 2B0FA 1YKTA 1BTYA 4YTAA 3SI3H 1A3BH 1BTWA 1SOZA 2OC7A 1GVKB 1O3AA 1C2HA 1V2RT 6GCHF 1NC6A 3EGKH 1OPHB 3IG6B 1A7SA 1AGJA 1KDQA 3NCLA 1NRNH 1IQGA 1G2MA 1D3PB 3LJOA 1AKSA 1YPHC 3RXUA 2G5VA 5A0BA 3I77A 1V3XA 3M3VA 1S83A 2P59A 2GDEH 3V7TA 1XVMA 3RU4D 2ANYA 1QL7A 1GG6C 1QY6A 1GBAA 1Y3XA 3AW1A 1K22H 3ZYEA 1NRPH 1GDUA 3SZNA 2H9EH 3U1IB 1BMMH 5T6DA 4B1TA 1NFYA 4B2BA 1YPGH 3GDVA 1C5SA 2HLCA 4I8KA 3GCTG 3MNBA 4RSPA 2ALPA 5AF9H 1PPFE 1LHFH 1A0JA 1YPHE 3ATMA 2C8YB 1SC8U 3KQCA 4IW4E 4ESTE 2BY9X 1EAIA 1A3EH 2VIQA 1EJNA 2PV9B 5JDUB 3BTWE 1TABE 5A09A 3K2UA 2ZHWH 5TCAA 1ELEE 2G4TA 3BEIB 3GCTF 1V2TT 2OUAA 4UD9H 2GCTC 4I8JA 1HJ9A 1BB0B 1D3DB 4KP0A 1AIXH 3NZIA 2A2XH 3SJ9A 4MPUA 3LU9B 3PWBA 1HAPH 2ANMH 2QN5T 1P3CA 2XWBI 3ENSB 3S0NA 3HGPA 2BDCA 2DUCA 2OINA 3KEEA 1GJ8B 1MAYA 1TE0A 2FODA 2PSXA 1GJ5H 4O97A 1OYQA 1GI9B 5DGJA 1TNLA 3RU4E 2P94A 3A86A 5I25A 1LPZB 2GP9B 1GCDA 1OWKA 1HIAA 3U69H 1AU8A 1ZHPA 4WMFA 1H9IE 3O8DA 5JBBS 3MNSA 3UOPA 3RXJA 1O32A 2QCYA 3L33A 3B23B 1FY3A 2RA3A 3MH5A 3NK8A 4NWLA 4A6LA 4CBOA 1SOTA 1E0FD 3AASA 2M5TA 4B76A 3RXGA 2J95A 3O8BA 1O3MA 1YGCH 2ZECA 4D7FA 5EQRA 2H6MA 2G52A 2FZZA 5LPEA 1RTKA 2SGDE 2FI4E 5DP3A 1NM6A 2TIOA 3LGUA 8LPRA 1SGEE 4FUJA 2Y5HA 4K3JA 3RXCA 1S85A 3QUMP 1BJUA 1THSH 1PPHE 2NU3E 1OP2A 4DY7B 1HAIH 4BOHA 2XNIA 1GI3A 1C1WH 1PPCE 1TNIA 2VWOA 1YPKH 5FPTA 1HPGA 2F9BH 4WXIA 4DIIH 2A4OA 4KELA 1DWCH 1DT2A 1C2FA 1MAXA 2GD4B 1WCZA 1BJVA 4E7NA 3E3TA 1RRKA 1P3EA 4TWWA 3MO9A 1J15A 4UFEH 1DE7H 2D8WA 3A88A 1HGTH 3ODDA 3LONA 2Z9GA 3A84A 1H8IH 2XWAA 1D6WA 5AVDA 1ABIH 1LPGB 3WY8A 5F6MA 2HNTC 2STAE 3P8GA 3P95A 1S0QA 3RC4A 1Y3UA 3KNXA 1C4U2 3HATH 1ARCA 3PLPA 4ZKNU 2ZHQH 4ABAA 1VITG 3SGBE 1MU8B 1O2XA 3M35A 3UFAA 4D9QA 4BNRA 2WPMS 1E36B 4OS4A 3TH2H 3RXLA 1FAKH 5DP6A 3UNRA 1BUIA 3I78A 3E0NB 1TYNA 3SGAE 1O2UA 2HNTE 5DKMA 1DXWA 3A7WA 1BA8B 1P0SH 3GY5A 2GMTC 1ORFA 2FOBA 2ZWLH 2BMGB 3D49H 2Q6FA 2FLBH 2HGTH 3B9FH 2ZGCA 1MQ5A 1VITF 2R0KA 1YM0A 3U8RH 4ISNA 1O3NA 1HFDA 1UVOA 1UHBA 3GCHB 3A8BA 4CREA 1OSSA 1O3EA 4INKA 4ASHA 3A8DA 4X1SU 4ABBA 4JYUH 4I8LA 3H7OA 1JRSA 2VB0A 3STJA 4MTBA 3V3MA 4DG4A 1FV9A 1YLDA 3R3GB 5HM9A 5FHTA 2A7CA 2GDDA 2F9OA 1ELTA 1MH0A 1SL3A 3UWJH 2ZFTA 3BIVH 2SGFE 7ESTE 1QRXA 3BEFB 1NROH 4WJG2 1AQ7A 3ZV9A 1C1SA 1LHDH 5EW2H 1GJ9B 3CP7A 1YCPK 4ZXXH 4F49A 1P09A 1GCTB 4K2YA 1GBIA 1UK4A 2AMQA 1Y59T 2TGTA 2PLXA 4H42U 1EQ9A 2AEIH 1S84A 4ZH8A 2ZCHP 1QJ7B 3SHAH 1F0SA 1LQEA 1VGCC 1LKAA 1NTPA 1GHWH 3A7YA 1HAZB 2LPRA 1MTNB 1UO6A 1FMGA 1ZSJA 3TK9A 1HCGA 1O33A 5ABWA 1K1IA 5T6FA 4MNXA 1HAYB 4AYVB 3U9AH 1YPMH 4CR9A 1SLWB 5C1XA 1P02A 2QAAA 2FTLE 1O5CB 1P9SA 4CBNA 1OYTH 3A7ZA 4XBCA 3SU6A 1O37A 2A4RA 4UFGH 2XBXA 4UFDH 1JOUB 1O0DH 4K5ZA 1QB1A 4FUHA 5GWZA 1C1TA 1P05A 2AS9A 2ZZUH 2QGRA 1KXFA 4FVBA 1IQLA 2PTNA 4Y0ZE 1F7ZA 4DOQA 1CE5A 3QZRA 2ZU2A 1AZZA 2UUYA 3M36A 2ZG0H 3TJVA 2H9HA 2HVXA 1SQOA 2ODYB 4BAQB 2ANKH 1TB6H 1G3DA 1TMUH 3VFEA 1NESE 1KIGH 4JZDH 3K65B 3QLPH 1C5ZB 1PYTD 2TGAA 1QBOA 1YC0A 2XBWA 1SGDE 1DSUA 1SG8B 2OC0A 4X0WU 4A92A 3SW2B 1YCPH 4X2YA 1DFPA 1XX9A 3RP2A 1HNEE 2FO9A 3UR9A 3EQ0H 4KKDA 3ATIA 1AY6H 4BAMB 5L6NH 4WF8A 3ZZDA 1IQFA 3S9AA 1W13U 3ZZ3A 2PKAB 1XMNB 3TITA 1HJAB 2BZ6H 4J1YA 1P2JA 2B7DH 3AVZA 4AGJA 1GJ4H 2AERH 2ZA5A 3SNDA 1BRCE 1O2GH 7LPRA 4BXWA 1CHGA 3TNSA 4I31A 2FLRH 2ZPQA 3M3TA 1OXGA 1QFKH 2ZQ1A 5C2ZA 3FZZA 3KHVA 2Z9JA 1JWTA 1O2ZA 1UTMA 2D2DA 2XW9A 3DA9B 1PQAA 3SV8A 3MU4A 3RXTA 4ISOA 1TLDA 1W0YH 3RLYH 3ZZCA 1E35B 1QL8A 2ZGXH 5DG6A 2GCTB 3E0PB 1QJ1B 2C93B 1DDJA 3ZVAA 2P95A 3BIUH 2GV7A 1HAGE 3SJ8A 2QF3A 4Y8ZA 4X6PA 1JBUH 3UOUA 1GMHG 1Y3WA 4GPGA 3NXPA 4CRDA 2YOLA 3KCGH 5FX6A 8KME2 2JETC 1QURH 1ESBA 1O2OA 1EB2A 1XKAC 3H7TA 4DW2U 3VPKA 1UTOA 1WU1A 1KXAA 1P2NA 3D23A 4THNH 1SGTA 1OWDA
chains in the Genus database with same CATH superfamily
2VWMA 1DPOA 1W7GH 3E1XB 5EXNA 1ANBA 1O3GA 1TONA 1VJAU 1DXPA 3R0FA 1P04A 3PTNA 1T4UH 2L6OA 4AORA 1BBRK 5E8EH 4OGYA 1D3QB 2KR7A 3ESTA 1TNKA 1V2NT 2AH4X 3Q00A 2J2UA 1SFQB 1PPGE 1AMHA 4NIXA 5LGOA 1T7CA 3ODFA 1G2LA 1DUAA 1F5LA 2FOHA 3AAUA 4MQAA 5C17A 2IOTA 1O3PB 1XXFA 2BVXH 3CENA 1SGPE 4TYDA 2Z3EA 1WSSH 3HKIB 1GJCB 1Y5BT 3TJOA 3SN8A 1Z7KA 1KYNA 2JH6D 2ZGHA 2BLWA 1XUKA 1XXDA 2Z3DA 3LJJA 1IHSH 3T25A 3EAJA 3JZ1B 1Z8JB 3PM3A 4ACBA 2G51A 2J34A 1TBQH 5DP5A 4NSYA 1AWFH 3M3SA 1UTPA 1TAWA 2FX6A 4CR5A 2Y5GA 5JB8S 2K1QA 1DVAH 2CV3A 5LH8A 3WWBA 3P92A 4K60A 3MWIU 2A2QH 3MO3A 2QYIA 2AFQB 4WWYA 2LNCA 3VB5A 3DFLA 3KIDU 4GCHG 2ZDNA 4M7GA 1O3DA 1O2VA 1BHXF 2UUKB 2J5UA 1LMWB 5LPRA 5E2PA 1UCYH 1O2WA 2FOFA 3DFJA 2JKHA 3DCLA 3P8NA 3MU5A 2OBOA 2ODQA 3TNTA 3UQOA 4X8VH 1NRSH 2AGEX 2NU2E 2WUCA 3PMJA 6LPRA 4RT1A 1UVSH 1WYKA 4OS7A 3RM2H 1AFQB 1KXBA 4WXVA 2RCEA 2GMTB 1V2VT 4GCHF 1F5RA 1VCQA 3FO8D 2GGVB 4JYVH 1N6XA 3GYMA 3UPEA 1AWHB 1BRBE 1TQ7B 2A7JA 2ZFSA 2PW8H 2WYJA 3UNQA 1FQ3A 7KMEH 1DITH 1GI4A 5B6OA 1P06A 3Q77A 1GDNA 1HXFH 4NFEA 1G3EA 1T31A 3RC5A 1D9IA 1SR5C 4Z0KA 3HK6B 1SQAA 4NIWA 2B5TB 1DICA 2FX4A 2PKSB 4RKOB 3OX7U 4Y6DA 1C5MD 1SFIA 5JBTA 1EZSC 3UWIA 3W94A 4BANB 3MYWA 1W0ZU 3PYHA 3VB6A 1ESAA 8GCHG 4AFQA 2KX4A 1CT0E 4DIHH 3DSPA 3VXEH 4AFUA 2ZU3A 1O34A 4ZHMU 3SZEA 1SGQE 2SFAA 1S6FA 2Y81A 2ASUB 2WUBA 1KSNA 1EZQA 5DK1A 3SNAA 3SUFA 2PP6A 3ZVEA 1NS3A 2J98A 4YESB 3NUMA 5C67A 1ZSKA 3DUXH 2VWNA 3BTFE 1K28D 4ABJA 1O5AB 4UDWH 1VGCB 1TGSZ 3MU8A 4TY6A 3U8TH 2ZTZA 3RXVA 1O3KA 1LVYA 1SGIB 1F0RA 4ISIH 3M7UA 4AB9A 3LDXH 4IN2A 5DPAA 5FPYA 1C2IA 1FZZA 1V2ST 1GI2A 3T29A 3T26A 2O9QA 4OS2A 6GCHG 1TRNA 4WH8A 3F9FA 3OEHD 5EQSA 5CHBA 1A4WH 2B9LA 2QE7D 1A5GH 3FP7E 4M9FA 4PROA 1BQYA 3FP6E 1O2LA 2OLGA 2GJGA 5ETXA 2RA0A 4Y11E 3ZZ6A 1RXPA 1Y3VA 2W26A 1K1JA 1YCPM 1IQJA 3RM0H 3U1JB 5CMXH 2ZU1A 3QK1A 3SO3A 1TNJA 1EUFA 5HMAA 1FX0B 1QA7A 4AGKA 1UK3A 2JJ2D 2TRMA 3KN2A 3FKSD 1O2PA 4ABDA 4ZUHA 1QIXB 3QGJA 1CBWC 5JBAS 1O2RA 1VCPA 2GZ8A 1RJXB 3SNEA 1KLTA 4MNYA 4BAKB 2WV9A 4INLA 4CRAA 2XRCA 1C1RA 1XKBC 3FVFB 4LZ4B 3DHKH 3M61U 4RKJB 3EYDA 1E1QD 5EXLA 2TGDA 1HJAC 1CGHA 4GLYA 4D7GA 2FTMA 1AD8H 1EP6A 2KAIA 1HUTH 3W1EA 2O8MA 1AUTC 4JZ1A 1INCA 4U2WA 4WMDA 2Y6TA 2VIVA 4AZ2B 1QNJA 2ZIQH 5E0HA 3BTHE 4MLFB 1XUIA 4KTSA 3ZZ7A 1EZXC 3C1KA 1ZMJA 4I33A 3MU0A 2VIOA 5F03A 4RT0A 1MKWH 2QXIA 4ISLA 2PSYA 1D6RA 2SGAA 1K9OE 4K1EA 2PFEA 2BD4A 2R0LA 3RXAA 3GDSA 2F4LA 1K1OA 3SBKA 2F9UA 4K1SA 5GCHG 1GHAG 1LQDB 1KDQB 4Y76A 2UWOA 1C5QA 2NU0E 1AKSB 1QB9A 4IMQA 2A7HA 4O03A 2JETB 1PQ5A 1DWBH 3W95A 2HOBA 4XD7D 1MZAA 3URCA 7GCHF 2Y7ZA 1DOJA 3NWUA 3SJIA 3O8CA 1RIWB 3GOVB 2VWLA 4NA9H 4HZHA 1EX3A 5GCHF 1GHAF 2VIWA 1FUJA 5E0JA 1O2QA 2V3OH 1LHCH 4MNVA 1AFEH 2EI8A 3SI4H 3GY3A 2BM2A 1LO6A 3RXDA 3TK6A 2BY7X 3QWCH 2WINI 1W11U 2BZAA 4I8HA 3FANA 5EG4A 3TVJB 1THRH 4DJZB 1WTGH 2SNWA 1O5GH 1A5IA 5T1VA 1A5HA 3QDZB 1TX8A 1SHHB 3U8OH 2GX4A 1MU6B 2PGQB 1H4WA 2OC8A 2FXRA 4YLQH 1TGTA 4K8BA 3BG4C 4GUXA 1YF4A 4XE4A 3M5LA 4NG9H 2P8OB 2FS9A 1HJ8A 4H6TA 3RMMH 2A5KA 2RG3A 4YT7H 5KECA 4YOIA 5F8ZA 1T8OA 2BLVA 1W2KH 5AHGH 3ZYDA 1GHVH 1GMCF 1BTXA 3EA9A 1HIAB 2G55A 2HPQH 2Z9IA 5GDSH 1ZZZA 3TJNA 2AGGX 1C9TA 5TCCA 4CH2B 1AVGH 3UB0A 2KCOA 3DT0H 1BBRE 4DURA 2PHBA 2BTCE 4WH6A 2ZCKP 3GYLB 1SBWA 2G5NA 3RXEA 1K1MA 1TRMA 1SGCA 1N1LA 4ZKSU 3UAIC 4K69A 4X2VA 3LKWA 2DE9A 2AMDA 1BTZA 2PWXA 1GHYH 2UWLA 1AFQC 4LK4A 5GNDA 2A45B 3LT3A 3A85A 4ASUD 2F3CE 2C90B 1ZGIA 3PWCA 1GI0A 5DO4H 1AI8H 1L4DA 4SGBE 1YPEH 3RXQA 2WYGA 2HPPH 1F92A 2KFWA 5J4SA 1ZR0A 1BMLA 2G4UA 4FUEA 2ZDAH 4JZIA 3O8RA 3Q3KA 4X8SH 2W7UA 2BHGA 4TPYA 3VB7A 1WOFA 4HG6A 1THPB 3GISB 4X2XA 2PKSC 2PUXB 2W5EA 1IQKA 1FJSA 4CRCA 2JH5D 1BTUA 1V2PT 1FY8E 1GMDF 1WQSA 2EQNA 4X1NU 2BOKA 4NA8A 3S9BA 1C1QA 1QBVH 3SOSA 4INHA 5DJ7A 5B6LA 2IJD1 4NGAH 1GHXH 3ATKA 3EA8A 3A8CA 5L2ZH 3BTME 4IMZA 1QHRB 4HFPB 2K8IA 3CNRA 5HM2A 4YM9A 3D65E 5HIZA 3PROA 3EA7A 1BRAA 1Q31A 3T28A 3PO1C 2XYAA 1HB0B 1OWJA 4YOJA 2ZDMA 2BQ6B 3IWMA 3BTEE 1ZMLA 3FZDA 5C1YA 2SGEE 2HVYB 2IPHA 3OTJE 1W10U 2ZF0H 1V6DA 1GVLA 2BY8X 3S7HB 1PJPA 1UHBB 2SGPE 1SHYA 1TALA 3DD2H 1YY3A 2D26C 3T2NA 1O2KA 5E0GA 2ZFRH 1C5PA 3BTDE 2BX4A 3RC6A 1GBMA 3BF6H 1EAWA 5FX5A 3UR6A 4AB8A 1BCUH 1MMJN 4ISHH 2ZFPH 1Y3YA 1HAHH 2UUFB 2Z9KA 2C8ZB 1Q3XA 2NU1E 5EW1H 3GS9A 1VJ9U 3BG8A 3FAOA 1A2CH 1A0LA 3MMGA 1P2KA 1PPEE 4XDEA 2FOMB 5L2YH 1TGNA 2FYQA 1ZGVA 1UMAH 5C20A 2H5CA 2XC5A 3SUEA 1GBFA 1C5RA 3M7QA 2RDLA 1GI7B 1CBWB 1O5EH 1O3FA 1W3CA 4IN1A 1EAXA 1HAOH 1TWXB 3TU7H 3RUOA 3TGIE 1DM4B 3C27B 1TNHA 4DGJA 1C5NH 1NPMA 1UTKA 3TGKE 5AFYH 2FPZA 1J9CH 3PMHB 2BLQA 1EJMA 1TGCA 5F8XA 2WSSD 3GY2A 1CHOG 1PFXC 1TFXA 3E8LA 3BSQA 3MNCA 4AX9H 4Y71A 4XFQA 3G01A 2BD9A 2QIQA 2W3IA 3PLBA 1Z8RA 3EE7A 2OQ5A 1ACBE 5FAHA 2EY4C 1DLEA 3M37A 5EXMA 9ESTA 1GL1A 2ZU4A 2QA9E 1ZTKA 1NU7B 1ZTLA 4Y79A 1SLVB 1T32A 1FY5A 1PYTC 4Q80A 1TIOA 1YLCA 1ZHMA 1IOEA 1CHOF 1S5SA 3UUZA 4MNWA 1CQQA 3SORA 3ZZAA 1COWD 1OWIA 2VVCA 2BY5X 1O2TA 1GI8B 3QTVH 5IDKA 2Y5FA 2FOEA 2FESH 4ZKRU 2QV1A 1F0UA 2H1UA 1TX6A 2YMSD 4JMYA 1P10A 2O8WA 2Y7XA 3MH4A 2GV6A 2ZFQH 2VNTA 4A1VA 2A5AA 1RIWC 2NWNA 1UCYK 4UFFH 5A8XA 1WAYB 3SGQE 1FPHH 4P02A 1SGFA 3B8JA 4B73A 5EJLA 3KF2A 1ZHRA 4OGXA 1HAXB 1Y5UT 1ANCA 1BHXB 5JYIA 2BQWB 1SB1H 3LGYA 2BXTH 4RN6A 3EE0B 3K6ZA 2XC4A 1C1UH 2FOCA 3L3TA 1ZSLA 4RI0A 1JXPA 4Y10E 5H4IB 5C0TA 4DT7B 1KLIH 4ZXYH 4D8NA 1GPZA 2KCYA 2KM0A 1GI6A 4BTUB 3KQDA 2VJ1A 2BX3A 3SQEE 1SSXA 4ABEA 3QGNB 1P2QA 3N7OA 2Q6GA 1SVPA 2HLDD 2Z6BD 3N99A 2XXLA 1XM1A 1ZLRA 3PV4A 4FVDA 1QCPA 1NO9H 2FM2A 2IN2A 1FY1A 1WUNH 4I7YH 1XVOA 5FPSA 2ULLA 2P8OC 2ZGBH 1H9HE 1TQ0B 3TH4H 5JPMH 2P3UB 1MTWA 4MPWA 4XBBA 1L4ZA 1IQHA 1GHBF 1SMFE 3BG4B 3HPTB 2ZFFH 3SHCH 2THFB 4X1RU 1CVWH 2EC9H 1TMTH 1F0TA 1V2OT 4BXSA 1BRUP 1Z8IB 1LVBA 3RXFA 2VGCB 1C5WB 1XUJA 1NT1A 1BMNH 1NN6A 1GBEA 2Z3CA 1FN6A 1O3OA 3FFGA 1FNIA 1L1NA 3RXRA 3SV6A 4VGCC 2ALVA 1TA2A 5J4QA 4O9VA 1UVTH 3V13A 5FBIA 3URDA 1DS2E 1MZDA 3OFND 2FDAA 1QL9A 5CHAB 3A7VA 1ZRKA 1TBZH 4ACAA 4GVUA 1DY9A 1FIWA 5JBCS 1A0HB 1DANH 1G3CA 1EJAA 3LGTA 5C5NA 1K1PA 3E90B 4KTUA 4WMEA 4YXWD 1AE8H 1ETTH 3MTYA 3RXIA 5GXPA 3RXBA 3OYPA 3VGCB 3RMLH 1ZYOA 1SLUB 3MHWU 2WHXA 3MH7A 1SGFG 4TWYA 1ANDA 2OC1A 4CH8B 1RTLA 3HKJB 2VH6A 2CF9H 2A0QB 2OXSA 3S69A 1EB1H 3NRLA 4U32A 4AG1A 1EXFA 3F1SB 4Q2KA 2ZI2H 1GGDC 1UTLM 1LHEH 4ZKOU 1CA0C 5EODA 4Q7ZA 4HI3A 1CU1A 1EPTA 1KTSB 4A7IB 2CHAC 3KQ5A 1HAVA 3SU1A 1G9IE 3TH3H 1X7AC 3FOAA 3VB3A 2BDBA 1KXDA 2Y82A 4SGAE 3T27A 3SV9A 1P2MA 2TPIZ 1PPZA 1Z1JA 5SGAE 1GBTA 2KCPA 2BDHA 2YNAA 1GHZA 1IHTH 5HKKD 4NZLA 1TPAE 3ZZBA 2QF0A 1QQUA 5K0HA 4F4OC 4FU7A 4H6SB 2A31A 2FS8A 1YLNA 1C2KA 2DE8A 1FLEE 2HNTF 5C0UA 4A1XA 1SGNE 1B0EA 3QTOH 1C5YB 3K6YA 3PO1B 5ESTE 3T62A 3A82A 3MH6A 2GT8A 5FCKA 2BXUH 3A7TA 2VVVA 3RU4T 1M9UA 1S0RA 1VZQH 2WV4A 5DP9A 5EU8A 2KCAA 1FI8A 4D9RA 3IITA 4MPVA 3UNSA 2GVFA 5E2OA 1V2KT 4FXGH 1AB9B 1MKXH 2FOAA 2FMJA 3T5FH 3DSOA 1OWEA 4X6MA 2F43B 1MKWK 1BTHH 2HRVA 3MQKC 1PQ7A 1CT2E 1ID5H 4IBLH 1E1RD 2J38A 1AVWA 1V2UT 4XRNA 2AYWA 2G8TA 2R2MB 3EDXB 1DY8A 3Q3YA 5FXLA 1SLXB 1Q2WA 3PTBA 1MCTA 2PUQH 2H5DA 1AHTH 1IQIA 1H1BA 1RD3B 1C2MA 2FYRA 3PV5A 1EPTB 3RDZA 1V2QT 3ATWA 2OP9A 1NFWA 4XBDA 1ELFA 3M5MA 2OD3B 4YT6H 4UEHH 2J92A 2H9TH 3OY6U 4B75A 3OY5U 1FXYA 1K2I1 2J98B 3TK5A 5EGMA 1P12E 3M7TA 1BZXE 1AZ8A 3V12A 1C4V2 1O3LA 2CGAA 9LPRA 1E79D 3TGJE 2GT7A 2BYAX 2ZEBA 4IC5A 1UK2A 1ZMNA 4NSVA 4AFZA 4NWKA 1J8AA 1W8BH 4KGAA 1NY22 1C1PA 1GJAB 1O5BB 2R9PA 2UWPA 2BD3A 2FP7B 5A0CA 3F9GA 4IS5A 1ARBA 2VH0A 3F9HA 1ETRH 2QXHA 5LPFA 2OCVB 1KY9A 1L1GA 1MCVA 4CHAB 1C2JA 2WPKS 4JZFH 2BOHB 4LXBH 2VIDA 1PPBH 3GY8A 4NCYA 4GHQA 4MVNA 3VXFH 4ZROA 1BIOA 7GCHG 1QA0A 1BT7A 3U98H 1ANEA 3HK3B 1NU9A 1S81A 3MFJA 3SYJA 5C1UA 3A87A 1ELAA 3U28C 3LGVA 2GKVE 2ZQ2A 1C5TA 1NFUA 3SNBA 1DWEH 1IAUA 2QC2A 2ZDKA 1GBKA 2J4IA 1GI1A 6ESTA 2WPHS 1QR3E 3MI4A 3BTKE 4TY7A 1L2EA 1MBQA 2F9VA 3UREA 2D1JA 4CRGA 1G37A 3NPSA 1JMOH 1JRTA 3TIUA 1QTFA 1TPSA 3SQHE 2J94A 4I32A 3SV2H 2VIPA 2BQ7B 1B0FA 3SU5A 3CS7A 4J2YB 2O8TA 3F2GA 1TNGA 2WPDD 3ATLA 4CRBA 4O3TA 1EAUA 2KAIB 3ZV8A 1N8OB 1C1MA 3ZZ9A 1O36A 5L30H 2F9PA 1C2LA 4X2WA 1UW7A 2ZHFH 1A1RA 1UTQA 1FAXA 1MTSA 4FUDA 1F5KU 1SGRE 1D3TB 1CT4E 3GY4A 1UVUH 2YMSB 1LKBA 4JYTA 2BVSH 2ZDVH 3RMOH 2YNBA 2Z94A 3KQBA 1AN1E 3QX5H 1GMCG 1SKYE 2ZPRA 5HIYA 4Y0YE 1BMAA 2A1DB 1FDPA 2TGPZ 3F9EA 4ABHA 1C1OA 3M5NA 3K9XB 1V2MT 5EJZA 2A4GA 1C5UA 4TPIZ 1BITA 1UCYE 3P17H 3ZZ5A 1ZPCA 1C2GA 2VGCC 3HGNA 2OK5A 3H5CB 3AW0A 5TJXA 1T8NA 2CN0H 3PB1E 3RLWH 4U30A 4LZ1H 3RXMA 5I46H 1UJ1A 1Z1IA 2QF4A 4BAHB 5GJ4B 3OSYA 1ZPBA 4FUGA 5CHAC 5A8ZA 4VGCB 1S82A 3E91A 2ZC9H 4NFFA 2FI3E 2I6SA 2SGQE 1GBDA 5G4BA 2ZDLA 3GDUA 1Z8GA 4AC9A 1O3IA 1B5GH 1MQ6A 4FUIA 2AMPA 1KLJH 2JH0D 1W14U 4GHTA 1VITH 2EI6A 4OM9A 3SUGA 4K1TA 3A80A 3VGCC 1LVOA 1GMDG 2XCFA 5C3NA 1EKBB 1J17T 3SU3A 1C5OH 2W7SA 2GCHG 2PTCE 1FN8A 1OKXA 4Y8XA 1B7XB 1C5VA 3L6PA 4XSKU 1ZRBA 2VINA 1ELDE 3MOCA 1Y5AT 1NRQH 3RXHA 2WPIS 1YBWA 3SJOA 4QT8C 1O5FH 3UQVA 4H4FA 3MO6A 4JZEH 1FONA 1UVPA 1NZQH 2C4FH 4ABIA 1ZOMA 4GSOA 2XBVA 4ABFA 5HGGA 2GCHF 2UUJB 1ELBA 1GGDB 1ELGA 2AHME 1CA0B 2NU4E 2BY6X 3ZVDA 1C5LH 1W7XH 5IK2D 2CHAB 1GL0E 1LCYA 1C2EA 1A61H 2FI5E 3F68H 3P6ZB 3SU2A 4Y7BA 5T3HA 1G36A 3F0PA 2BVRH 1C4Y2 2A5IA 2C8XB 1RS0A 4R0IA 5AFZH 1ELVA 3SNCA 4LOYH 2CMYA 1QBNA 2J9NA 2GZ7A 4FU9A 5F8TA 1C2DA 4E7RG 4X1QU 3WW7A 1AVXA 4TSFD 2F91A 1P01A 1WBGB 4F48B 1T8LA 1O2HA 3A83A 2BD5A 2OQUA 2P3FH 1AO5A 3CS0A 3E6PH 3A81A 2IJOB 1MTUA 1AB9C 3BTTE 2QXJA 1KTTB 2GZ9A 2BLOA 4ZHAA 2WPLS 4F55A 5FCRA 1Z6EA 1CA8B 1MD7A 1XUHA 2GTBA 4NA7A 3GY6A 4MPXA 1BOQA 2JJ1D 1O2IA 2SNVA 2J97A 1H8ED 1J14A 2PKAA 3RXOA 1HLTH 3BTGE 2QF5A 2STBE 1BTPA 1WTHD 2R3YA 5DP8A 2FOGA 1EZUC 2AIQA 1IQEA 1MBMA 1EPTC 1GBBA 1TOMH 2G81E 3MU1A 2PR3A 2TBSA 3TLOA 1V2LT 4YZUA 1RGQA 6CHAC 3P8FA 1JIRA 1JIMA 2Q6DA 3RMNH 2BDGA 1O39A 3E16B 1YP9A 1S6HA 2C8WB 4X6NA 2Y80A 1OP0A 3P8OA 3OU0A 1GBLA 4IGDA 3F3BA 2QY0B 1DLKB 2O8UA 3Q76A 4O3UA 3GCNA 4X1PU 1SGYE 3GY7A 4A1TA 2C3SA 4AYYB 3UY9A 1K21H 1ELCA 1QB6A 1ZTJA 2H2ZA 2QXGA 1CGIE 5A2MH 1GI5A 2AIPA 3BV9B 3RXPA 3S9CA 2R3UA 3A7XA 1RFNA 4OS6A 3ITIA 4A5TS 2G00A 3PMAB 1SQTA 4CHAC 1GG6B 4BTIB 3GICB 3LPRA 1YPJH 3KGPA 4IC6A 3SUDA 1MABB 1MUEB 1GJBB 1MD8A 3PV2A 4Z6AH 2ZTYA 1PQ8A 1EASA 4AN7A 1O3HA 3I29A 1SPJA 1HXEH 3VEQB 1J16A 2ZHDA 3RXKA 1E38B 1O2JA 3RXSA 3ELAH 2XNDD 5DN6D 2XC0A 3FP8E 4BAOB 1IQNA 3V0XA 1CO7E 1T8MA 1GJ6A 4B2AA 2XOKD 2RFKC 1O2YA 2ZNKH 3BTQE 1GJDB 1OHHD 1QJ6B 1UTJA 2EI7A 1O5DH 2P3TB 4JK5A 2OTVA 1K1NA 1P03A 2A32A 1GBJA 1HV7A 1ESTA 5GPIB 2O8LA 3ZVCA 1KMHB 1NRRH 2WPJS 1EOJA 1AUJA 4AOQA 1GJ7B 1H8DH 4ABGA 4Q7XA 1NFXA 5T6GA 5BPEA 1U6QA 1L0ZA 1OOKB 4BTTB 3A89A 1TPPA 1N8OC 3OTPA 4X6OA 4R8TB 4Y7AA 2CF8H 1CSOE 4E05H 2Z7FE 2BDYA 3PMBB 2P93A 5GIBA 1GBHA 3TJUA 3UIRA 1O38A 2BD8A 1LPKB 1DWDH 3LC3A 2BB4A 2YMSC 5HXFA 1GHBG 3BN9A 2ZGJA 3JZ2B 1GDQA 4HGCA 1GMHF 3H09A 1N6YA 4FUBA 4GAWA 1VCWA 3NKKA 5EPYA 2AGIX 3ZZ8A 1G32B 1HDTH 1VR1H 3AK5A 4HTCH 5EQQA 5ESBA 3F6UH 2V35A 4UONA 1TRYA 2V6NA 1L1JA 1W12U 3LGIA 3MNXA 3N7EA 4I8GA 1O31A 1UTNA 3LOXA 3ZVFA 1O30A 4CRFA 1WXRA 1P57B 1OWHA 3FN8A 2BD7A 4JK6A 1TMBH 4B71A 3D62A 4B74A 1EOLA 5FBEA 1ZJKA 1K1LA 1OX1A 1O3CA 1O2MA 1XUFA 3KYFA 1FY4A 2ZPSA 1BMFD 1H9LB 4TT3D 5EPNA 2BD2A 1LVMA 2VU8E 4X8TH 2ZKSA 4YLUA 2Z9LA 3KYGA 1O2SA 1O35A 3STIA 3PRDA 1EP5A 4MG3A 1HRTH 2L74A 5A0AE 1ABJH 1HYLA 1C9PA 4JCNA 1DSTA 4DVAU 1TOCB 2WV5A 4B2CA 1RTFB 1E34B 2ZP0H 2EEKA 2CJIA 1QRZA 2Q1JA 1OS8A 1YYY1 3QO6A 3SJKA 3LH3A 1MKXK 2F83A 1GVZA 4MDSA 4K8YA 1FPCH 2P16A 2ODPA 1ZJDA 3Q3XA 5KGOA 1A46H 1W0JD 1O2NA 1G3BA 5DP7A 4AFSA 1F2SE 5PTPA 2V3HH 4YOGA 1FIZA 3KQEA 5EIYA 2BDIA 3SV7A 2V0BA 8ESTE 1BBRH 1TX7A 4NZQA 1QQ4A 3GCHC 3SU0A 1P2OA 2R2WU 4DCDA 2FIRH 2VBCA 3TPIZ 5C5OA 2BDAA 2FEQH 4ZMAH 1D4PB 1LDTT 3BEUA 3P70B 4XOJA 4X8UH 1QGFA 4FUCA 1TBRH 1IQMA 5CE1A 3UTUH 1P8VC 1KXCA 2W6JD 1ZPZA 1XUGA 3F2HA 1T4VH 2ZU5A 1P11E 4WY3A 2I6QA 3QZQA 4KTCA 1DUEA 3LGWA 4UE7H 1YPLH 3PLKA 1MTVA 3GCOA 2PGBB 4OS1A 1O3JA 1V2JT 4OS5A 1TGBA 1GCTC 2XCNA 2ZCLP 2B8OH 1CGJE 1NBMD 2A4QA 3SU4A 1C1NA 4FU8A 2ZHEH 5FL7D 4Y8YA 4YO9A 1Z71A 2ZO3H 5BRRE 3LIWA 4NIYA 3KL6A 1P9UA 3ZZ4A 1O3BA 3LC5A 1S6LA 1QRWA 2CXVA 1MTNC 2VVUA 8GCHF 1DX5M 1KXEA 1GWAA 2ILNA 3S7KB 1LHGH 1OP8A 1EATA 4Q4LA 1HBTH 4D76A 2LP6A 1WQVH 2F9NA 2OBQA 1WV7H 2HALA 1Y8TA 2JIZD 1V2WT 2XBYA 5JB9S 1E37B 3VB4A 3QN7A 1SI5H 4WVPE 4E06H 2W3KA 4AG2A 1Z6JH 3LH1A 1GBCA 4FETA 1AE5A 2ZTXA 1LTOA 4DT4A 5A8YA 2V3MA 3M5OA 4U01A 1C5XB 2ANWA 2HWLB 3AAVA 1TPOA 3OEED 5IYTA 1G30B 5EOKA 4NIVA 4Q7YA 5K7RA 2XTTB 3ZVBA 1HAVB 1TA6A 3A8AA 1ETSH 4FUFA 4ZAEA 3ZVGA 1BDAA 1P2IA 3ZIAD 5HYOA 2FWWA 1C1VH 6CHAB 2EA3A 4ZHLU 5DP4A 2ESTE 2B0FA 2WZQA 1YKTA 1BTYA 4YTAA 3SI3H 1A3BH 1BTWA 1SOZA 4B6FA 2OC7A 1GVKB 1O3AA 1C2HA 1V2RT 6GCHF 1NC6A 3EGKH 1OPHB 3IG6B 1A7SA 1AGJA 1NBME 1KDQA 3NCLA 1NRNH 1IQGA 1G2MA 1D3PB 3LJOA 1AKSA 1YPHC 3RXUA 2G5VA 5A0BA 3I77A 1V3XA 3M3VA 1S83A 2GDEH 2P59A 3V7TA 1XVMA 2JDID 2ANYA 3RU4D 1QL7A 1GG6C 1QY6A 1GBAA 1Y3XA 3AW1A 1K22H 3ZYEA 1NRPH 1GDUA 3SZNA 2H9EH 3U1IB 1BMMH 5T6DA 4B1TA 1NFYA 4B2BA 1YPGH 3GDVA 1C5SA 2HLCA 2W6ID 4I8KA 3GCTG 3MNBA 4RSPA 2ALPA 5AF9H 1PPFE 1LHFH 1A0JA 1YPHE 3ATMA 2C8YB 1SC8U 3KQCA 4IW4E 4ESTE 2BY9X 1EAIA 1A3EH 5DSFA 2VIQA 3F0OA 4FOUC 1EJNA 5C94A 2PV9B 2M2AA 3DSGA 5JDUB 3BTWE 1TABE 5A09A 3K2UA 2ZHWH 5TCAA 1ELEE 2G4TA 3BEIB 3GCTF 1V2TT 2OUAA 4UD9H 2GCTC 4I8JA 1HJ9A 1BB0B 1D3DB 4KP0A 1AIXH 3NZIA 2A2XH 3SJ9A 4MPUA 3LU9B 3PWBA 1HAPH 2ANMH 2QN5T 1P3CA 2XWBI 3ENSB 3S0NA 3HGPA 2BDCA 2DUCA 2OINA 3KEEA 1GJ8B 1MAYA 1TE0A 2FODA 2PSXA 1GJ5H 4O97A 1OYQA 5F53A 1GI9B 5DGJA 4ZCNA 1TNLA 3RU4E 2P94A 3A86A 5I25A 1LPZB 2GP9B 1GCDA 1OWKA 1HIAA 3U69H 1AU8A 1ZHPA 4WMFA 1H9IE 3O8DA 2CK3D 5JBBS 3MNSA 3UOPA 3RXJA 1O32A 2QCYA 3L33A 3B23B 1FY3A 2RA3A 3MH5A 1YWUA 3NK8A 4NWLA 4A6LA 4CBOA 1SOTA 1E0FD 3AASA 2M5TA 4B76A 3RXGA 2J95A 3O8BA 1O3MA 1YGCH 2ZECA 4D7FA 5EQRA 2H6MA 2G52A 2FZZA 5LPEA 1RTKA 2SGDE 2FI4E 2V7QD 5DP3A 1NM6A 2TIOA 3LGUA 8LPRA 1SGEE 4FUJA 1K0HA 1H8HD 2Y5HA 4K3JA 3RXCA 2K0QA 1S85A 3QUMP 1BJUA 1THSH 1PPHE 2NU3E 1OP2A 4P00A 4DY7B 1HAIH 4BOHA 2XNIA 1GI3A 1C1WH 1VKYA 1PPCE 1TNIA 2VWOA 1YPKH 5FPTA 1HPGA 2F9BH 4WXIA 4DIIH 2A4OA 4KELA 1DWCH 1DT2A 1C2FA 1MAXA 2GD4B 1WCZA 4I86A 1BJVA 4E7NA 3E3TA 1RRKA 1P3EA 4TWWA 3MO9A 1J15A 4UFEH 1DE7H 2D8WA 3A88A 1HGTH 3ODDA 3LONA 2Z9GA 3A84A 1H8IH 2XWAA 1D6WA 5AVDA 1ABIH 1LPGB 3WY8A 5F6MA 2HNTC 2STAE 3P8GA 3P95A 1S0QA 3RC4A 1Y3UA 3KNXA 1C4U2 3HATH 1ARCA 3PLPA 4ZKNU 2ZHQH 4ABAA 1VITG 3SGBE 2KZ4A 1MU8B 1O2XA 1QZ8A 3M35A 3UFAA 4D9QA 4BNRA 2WPMS 1E36B 4OS4A 3TH2H 3RXLA 1FAKH 5DP6A 3UNRA 1BUIA 3I78A 5EJ1A 3E0NB 1TYNA 1WDIA 3SGAE 4B6EA 1O2UA 2HNTE 5DKMA 1DXWA 3A7WA 1BA8B 1P0SH 3GY5A 2GMTC 1ORFA 2FOBA 2ZWLH 5CDFE 2BMGB 3D49H 2Q6FA 2FLBH 2HGTH 3B9FH 2ZGCA 1MQ5A 1VITF 2R0KA 1YM0A 3OE7D 3U8RH 4ISNA 1O3NA 2LELA 1HFDA 1UVOA 1UHBA 2RDEA 3GCHB 3A8BA 4CREA 1OSSA 1O3EA 4INKA 4ASHA 2IPQX 3A8DA 4X1SU 1SQRA 4ABBA 4JYUH 4I8LA 3H7OA 1JRSA 2VB0A 3STJA 4MTBA 3V3MA 4DG4A 1FV9A 1YLDA 3R3GB 5HM9A 5FHTA 2A7CA 2GDDA 2F9OA 3PRBA 1ELTA 1MH0A 1SL3A 3UWJH 2ZFTA 3BIVH 2SGFE 7ESTE 1QRXA 3BEFB 1NROH 4WJG2 1AQ7A 3ZV9A 1C1SA 1LHDH 5EW2H 1GJ9B 3CP7A 1YCPK 4ZXXH 4F49A 1P09A 1GCTB 4K2YA 1GBIA 1UK4A 2AMQA 1Y59T 2TGTA 2PLXA 4H42U 1EQ9A 2AEIH 1S84A 4ZH8A 2ZCHP 1QJ7B 3SHAH 1F0SA 1LQEA 1VGCC 3WWFA 1LKAA 1NTPA 1GHWH 3A7YA 1HAZB 2LPRA 1MTNB 1UO6A 1FMGA 1ZSJA 3TK9A 1HCGA 1O33A 5ABWA 1K1IA 3N7DA 5T6FA 4MNXA 1HAYB 4AYVB 3U9AH 1YPMH 4CR9A 1SLWB 5C1XA 1P02A 2QAAA 2FTLE 1O5CB 1P9SA 4CBNA 1OYTH 3A7ZA 4XBCA 3SU6A 1O37A 2A4RA 4UFGH 2XBXA 4UFDH 1JOUB 1O0DH 4K5ZA 1QB1A 4FUHA 5GWZA 1C1TA 1P05A 2AS9A 2ZZUH 2QGRA 1KXFA 4FVBA 1IQLA 2PTNA 4Y0ZE 1F7ZA 4DOQA 1CE5A 3QZRA 2ZU2A 1AZZA 2UUYA 3M36A 2ZG0H 3TJVA 1W0KD 2H9HA 2HVXA 1SQOA 2ODYB 4BAQB 2ANKH 1TB6H 1G3DA 1TMUH 3VFEA 1NESE 1KIGH 4JZDH 3K65B 3QLPH 1C5ZB 1PYTD 2TGAA 1QBOA 1YC0A 2XBWA 1SGDE 1DSUA 1SG8B 2OC0A 4X0WU 4A92A 3SW2B 1YCPH 4X2YA 1DFPA 1XX9A 3F2FA 3RP2A 1HNEE 2FO9A 3UR9A 3EQ0H 4KKDA 3ATIA 1AY6H 4BAMB 5L6NH 4WF8A 3ZZDA 1IQFA 3S9AA 1W13U 3ZZ3A 2PKAB 1XMNB 3TITA 1HJAB 2BZ6H 4J1YA 1P2JA 2B7DH 3AVZA 4AGJA 1GJ4H 2AERH 2ZA5A 3SNDA 1BRCE 1O2GH 7LPRA 4BXWA 1CHGA 3TNSA 4I31A 2FLRH 2ZPQA 3M3TA 1OXGA 1QFKH 2ZQ1A 3OAAD 3FZZA 5C2ZA 3KHVA 2Z9JA 1JWTA 1O2ZA 1UTMA 2D2DA 2XW9A 3DA9B 1PQAA 3SV8A 4Z1MD 3MU4A 1EFRD 3RXTA 4ISOA 5KEDA 1TLDA 1W0YH 3RLYH 3ZZCA 1E35B 1QL8A 2ZGXH 5DG6A 2GCTB 3E0PB 1QJ1B 2C93B 1DDJA 3ZVAA 2P95A 3BIUH 2GV7A 1HAGE 3SJ8A 2QF3A 4Y8ZA 4X6PA 1JBUH 3UOUA 1GMHG 1Y3WA 4GPGA 3VG8A 3NXPA 4CRDA 2YOLA 3KCGH 5FX6A 8KME2 2JETC 1QURH 1ESBA 1O2OA 1EB2A 1XKAC 3H7TA 4Q63A 4DW2U 3VPKA 1UTOA 1WU1A 1KXAA 1P2NA 3D23A 4THNH 1SGTA 1OWDA
chains in the Genus database with same CATH topology
2VWMA 1DPOA 1W7GH 3E1XB 5EXNA 1ANBA 1O3GA 1TONA 1VJAU 1DXPA 3R0FA 1P04A 3PTNA 1T4UH 4AORA 1BBRK 5E8EH 4OGYA 1D3QB 3ESTA 1TNKA 1V2NT 2AH4X 3Q00A 2J2UA 1SFQB 1PPGE 1AMHA 4NIXA 5LGOA 1T7CA 3ODFA 1G2LA 1DUAA 1F5LA 2FOHA 3AAUA 4MQAA 2IOTA 1O3PB 1XXFA 2BVXH 3CENA 1SGPE 4TYDA 2Z3EA 1WSSH 3HKIB 1GJCB 1Y5BT 3TJOA 3SN8A 1Z7KA 1KYNA 2JH6D 2ZGHA 2BLWA 1XUKA 1XXDA 2Z3DA 3LJJA 1IHSH 3T25A 3EAJA 3JZ1B 1Z8JB 3PM3A 2G51A 2J34A 1TBQH 5DP5A 4NSYA 1AWFH 3M3SA 1UTPA 1TAWA 2FX6A 4CR5A 2Y5GA 5JB8S 2K1QA 1DVAH 2CV3A 5LH8A 3P92A 4K60A 3MWIU 2A2QH 3MO3A 2QYIA 2AFQB 4WWYA 2LNCA 3VB5A 3DFLA 3KIDU 4GCHG 2ZDNA 4M7GA 1O3DA 1O2VA 1BHXF 2UUKB 1LMWB 5LPRA 5E2PA 1UCYH 1O2WA 2FOFA 3DFJA 2JKHA 3P8NA 3MU5A 2OBOA 2ODQA 3TNTA 3UQOA 4X8VH 1NRSH 2AGEX 2NU2E 2WUCA 3PMJA 6LPRA 1UVSH 1WYKA 4OS7A 3RM2H 1AFQB 1KXBA 4WXVA 2RCEA 2GMTB 1V2VT 4GCHF 1F5RA 1VCQA 4JYVH 2GGVB 1N6XA 3GYMA 3UPEA 1AWHB 1BRBE 1TQ7B 2A7JA 2ZFSA 2PW8H 2WYJA 3UNQA 1FQ3A 7KMEH 1DITH 1GI4A 5B6OA 1P06A 3Q77A 1GDNA 1HXFH 4NFEA 1G3EA 1T31A 3RC5A 1D9IA 1SR5C 4Z0KA 3HK6B 1SQAA 4NIWA 2B5TB 1DICA 2FX4A 2PKSB 4RKOB 3OX7U 4Y6DA 1C5MD 1SFIA 5JBTA 1EZSC 3UWIA 3W94A 4BANB 3MYWA 1W0ZU 3PYHA 3VB6A 1ESAA 8GCHG 4AFQA 1CT0E 4DIHH 3VXEH 4AFUA 2ZU3A 1O34A 4ZHMU 1SGQE 2SFAA 1S6FA 2Y81A 2ASUB 2WUBA 1KSNA 1EZQA 5DK1A 3SNAA 3SUFA 3ZVEA 1NS3A 4YESB 3NUMA 5C67A 1ZSKA 3DUXH 2VWNA 3BTFE 1K28D 4ABJA 1O5AB 4UDWH 1VGCB 1TGSZ 3MU8A 4TY6A 3U8TH 2ZTZA 3RXVA 1O3KA 1LVYA 1SGIB 1F0RA 4ISIH 3M7UA 4AB9A 3LDXH 4IN2A 5DPAA 5FPYA 1C2IA 1FZZA 1V2ST 1GI2A 3T29A 3T26A 2O9QA 4OS2A 6GCHG 1TRNA 4WH8A 3F9FA 5EQSA 1A4WH 2B9LA 1A5GH 3FP7E 4PROA 1BQYA 3FP6E 1O2LA 2OLGA 5ETXA 2RA0A 4Y11E 3ZZ6A 1RXPA 1Y3VA 2W26A 1K1JA 1YCPM 1IQJA 3RM0H 3U1JB 5CMXH 2ZU1A 3QK1A 3SO3A 1TNJA 1EUFA 5HMAA 1QA7A 4AGKA 1UK3A 2TRMA 3KN2A 1O2PA 4ABDA 4ZUHA 1QIXB 3QGJA 1CBWC 5JBAS 1O2RA 1VCPA 2GZ8A 1RJXB 3SNEA 1KLTA 4MNYA 4BAKB 4INLA 4CRAA 2XRCA 1C1RA 1XKBC 3FVFB 4LZ4B 3DHKH 3M61U 4RKJB 3EYDA 5EXLA 2TGDA 1HJAC 1CGHA 4GLYA 4D7GA 2FTMA 1AD8H 1EP6A 2KAIA 1HUTH 2O8MA 1AUTC 4JZ1A 1INCA 4U2WA 4WMDA 2Y6TA 2VIVA 4AZ2B 1QNJA 2ZIQH 5E0HA 3BTHE 4MLFB 1XUIA 4KTSA 3ZZ7A 1EZXC 3C1KA 1ZMJA 4I33A 3MU0A 2VIOA 5F03A 1MKWH 2QXIA 4ISLA 2PSYA 1D6RA 2SGAA 1K9OE 4K1EA 2PFEA 2BD4A 2R0LA 3RXAA 3GDSA 3SBKA 1K1OA 2F9UA 4K1SA 5GCHG 1GHAG 1LQDB 1KDQB 4Y76A 2UWOA 1C5QA 2NU0E 1AKSB 1QB9A 4IMQA 2A7HA 4O03A 2JETB 1PQ5A 1DWBH 3W95A 2HOBA 1MZAA 3URCA 7GCHF 2Y7ZA 1DOJA 3NWUA 3SJIA 3O8CA 1RIWB 3GOVB 2VWLA 4NA9H 4HZHA 1EX3A 5GCHF 1GHAF 2VIWA 1FUJA 5E0JA 1O2QA 2V3OH 1LHCH 4MNVA 1AFEH 2EI8A 3SI4H 3GY3A 2BM2A 1LO6A 3RXDA 3TK6A 2BY7X 3QWCH 2WINI 1W11U 2BZAA 4I8HA 3FANA 5EG4A 3TVJB 1THRH 4DJZB 1WTGH 2SNWA 1O5GH 1A5IA 1A5HA 3QDZB 1TX8A 1SHHB 3U8OH 2GX4A 1MU6B 2PGQB 1H4WA 2OC8A 2FXRA 4YLQH 1TGTA 4K8BA 3BG4C 4GUXA 1YF4A 4XE4A 3M5LA 4NG9H 2P8OB 2FS9A 1HJ8A 4H6TA 3RMMH 2A5KA 2RG3A 4YT7H 4YOIA 5F8ZA 1T8OA 2BLVA 1W2KH 5AHGH 3ZYDA 1GHVH 1GMCF 1BTXA 3EA9A 1HIAB 2G55A 2HPQH 2Z9IA 5GDSH 1ZZZA 3TJNA 2AGGX 1C9TA 5TCCA 4CH2B 1AVGH 4DURA 3DT0H 1BBRE 2PHBA 2BTCE 4WH6A 2ZCKP 3GYLB 1SBWA 2G5NA 3RXEA 1K1MA 1TRMA 1SGCA 1N1LA 4ZKSU 4K69A 4X2VA 3LKWA 2DE9A 2AMDA 1BTZA 2PWXA 1GHYH 2UWLA 1AFQC 4LK4A 2A45B 3LT3A 3A85A 2F3CE 2C90B 1ZGIA 3PWCA 1GI0A 5DO4H 1AI8H 1L4DA 4SGBE 1YPEH 3RXQA 2WYGA 2HPPH 1F92A 5J4SA 1ZR0A 1BMLA 2G4UA 4FUEA 2ZDAH 4JZIA 3O8RA 3Q3KA 4X8SH 2W7UA 2BHGA 4TPYA 3VB7A 1WOFA 1THPB 3GISB 4X2XA 2PKSC 2PUXB 2W5EA 1IQKA 1FJSA 4CRCA 2JH5D 1BTUA 1V2PT 1FY8E 1GMDF 1WQSA 4X1NU 2BOKA 4NA8A 3S9BA 1C1QA 1QBVH 3SOSA 4INHA 5DJ7A 4NGAH 1GHXH 3ATKA 3EA8A 3A8CA 5L2ZH 3BTME 4IMZA 1QHRB 4HFPB 5HM2A 4YM9A 3D65E 3PROA 3EA7A 1BRAA 1Q31A 3T28A 3PO1C 2XYAA 1HB0B 1OWJA 4YOJA 2ZDMA 2BQ6B 3IWMA 3BTEE 1ZMLA 3FZDA 5C1YA 2SGEE 2IPHA 3OTJE 1W10U 2ZF0H 1V6DA 1GVLA 2BY8X 3S7HB 1PJPA 1UHBB 2SGPE 1SHYA 1TALA 3DD2H 2D26C 3T2NA 1O2KA 5E0GA 2ZFRH 1C5PA 3BTDE 2BX4A 3RC6A 1GBMA 3BF6H 1EAWA 5FX5A 3UR6A 4AB8A 1BCUH 1MMJN 4ISHH 2ZFPH 1Y3YA 1HAHH 2UUFB 2Z9KA 2C8ZB 1Q3XA 2NU1E 5EW1H 1VJ9U 3BG8A 3FAOA 1A2CH 1A0LA 3MMGA 1P2KA 1PPEE 4XDEA 2FOMB 5L2YH 1TGNA 2FYQA 1ZGVA 1UMAH 5C20A 2H5CA 2XC5A 3SUEA 1GBFA 1C5RA 3M7QA 2RDLA 1GI7B 1CBWB 1O5EH 1O3FA 1W3CA 4IN1A 1EAXA 1HAOH 1TWXB 3TU7H 3RUOA 3TGIE 1DM4B 3C27B 1TNHA 4DGJA 1C5NH 1NPMA 1UTKA 3TGKE 5AFYH 2FPZA 1J9CH 3PMHB 2BLQA 1EJMA 1TGCA 5F8XA 3GY2A 1CHOG 1PFXC 1TFXA 3E8LA 3BSQA 3MNCA 4AX9H 4Y71A 4XFQA 3G01A 2BD9A 2QIQA 2W3IA 3PLBA 1Z8RA 2OQ5A 1ACBE 5FAHA 3M37A 1DLEA 5EXMA 9ESTA 1GL1A 2ZU4A 2QA9E 1ZTKA 1NU7B 1ZTLA 4Y79A 1SLVB 1T32A 1FY5A 1PYTC 4Q80A 1TIOA 1YLCA 1ZHMA 1IOEA 1CHOF 1S5SA 3UUZA 4MNWA 1CQQA 3SORA 3ZZAA 1OWIA 2VVCA 2BY5X 1O2TA 1GI8B 3QTVH 5IDKA 2Y5FA 2FOEA 2FESH 4ZKRU 2QV1A 1F0UA 2H1UA 1TX6A 4JMYA 1P10A 2O8WA 2Y7XA 3MH4A 2GV6A 2ZFQH 2VNTA 4A1VA 2A5AA 1RIWC 2NWNA 1UCYK 4UFFH 5A8XA 1WAYB 3SGQE 1FPHH 1SGFA 3B8JA 4B73A 3KF2A 1ZHRA 4OGXA 1HAXB 1Y5UT 1ANCA 1BHXB 5JYIA 2BQWB 1SB1H 3LGYA 2BXTH 4RN6A 3EE0B 3K6ZA 2XC4A 1C1UH 2FOCA 3L3TA 1ZSLA 1JXPA 4Y10E 5H4IB 4DT7B 1KLIH 4ZXYH 4D8NA 1GPZA 1GI6A 4BTUB 3KQDA 2VJ1A 2BX3A 3SQEE 1SSXA 4ABEA 3QGNB 1P2QA 3N7OA 2Q6GA 1SVPA 2Z6BD 3PV4A 4FVDA 2XXLA 1XM1A 1ZLRA 5HXFA 1QCPA 1NO9H 2FM2A 2IN2A 1FY1A 1WUNH 4I7YH 1XVOA 5FPSA 2ULLA 2P8OC 2ZGBH 1H9HE 1TQ0B 3TH4H 5JPMH 2P3UB 1MTWA 4MPWA 4XBBA 1L4ZA 1IQHA 1GHBF 1SMFE 3BG4B 3HPTB 2ZFFH 3SHCH 2THFB 4X1RU 1CVWH 2EC9H 1TMTH 1F0TA 1V2OT 4BXSA 1BRUP 1Z8IB 1LVBA 3RXFA 2VGCB 1C5WB 1XUJA 1NT1A 1BMNH 1NN6A 1GBEA 2Z3CA 1FN6A 1O3OA 3FFGA 1FNIA 1L1NA 3RXRA 3SV6A 4VGCC 2ALVA 1TA2A 5J4QA 4O9VA 1UVTH 3V13A 5FBIA 3URDA 1DS2E 1MZDA 2FDAA 1QL9A 5CHAB 3A7VA 1ZRKA 1TBZH 4GVUA 1DY9A 1FIWA 5JBCS 1A0HB 1DANH 1G3CA 1EJAA 3LGTA 5C5NA 1K1PA 3E90B 4KTUA 4WMEA 1AE8H 1ETTH 3MTYA 3RXIA 5GXPA 3RXBA 3OYPA 3VGCB 3RMLH 1ZYOA 1SLUB 3MHWU 3MH7A 1SGFG 4TWYA 1ANDA 2OC1A 4CH8B 1RTLA 3HKJB 2VH6A 2CF9H 2A0QB 2OXSA 3S69A 1EB1H 4U32A 4AG1A 1EXFA 3F1SB 4Q2KA 2ZI2H 1GGDC 1UTLM 1LHEH 4ZKOU 1CA0C 5EODA 4Q7ZA 4HI3A 1CU1A 1EPTA 1KTSB 4A7IB 2CHAC 1HAVA 3SU1A 1G9IE 3TH3H 1X7AC 3VB3A 2BDBA 1KXDA 2Y82A 4SGAE 3T27A 3SV9A 1P2MA 2TPIZ 1PPZA 1Z1JA 5SGAE 1GBTA 2BDHA 2YNAA 1GHZA 1IHTH 4NZLA 1TPAE 3ZZBA 2QF0A 1QQUA 5K0HA 4F4OC 4FU7A 4H6SB 2A31A 2FS8A 1C2KA 2DE8A 1FLEE 2HNTF 4A1XA 1SGNE 1B0EA 3QTOH 1C5YB 3K6YA 3PO1B 5ESTE 3T62A 3A82A 3MH6A 2GT8A 5FCKA 2BXUH 3A7TA 2VVVA 3RU4T 1M9UA 1S0RA 1VZQH 2WV4A 5DP9A 5EU8A 1FI8A 4D9RA 3IITA 4MPVA 3UNSA 2GVFA 5E2OA 1V2KT 4FXGH 1AB9B 1MKXH 2FOAA 2FMJA 3T5FH 1OWEA 4X6MA 1MKWK 1BTHH 2HRVA 1PQ7A 1CT2E 1ID5H 4IBLH 2J38A 1AVWA 1V2UT 2AYWA 2G8TA 2R2MB 3EDXB 1DY8A 3Q3YA 5FXLA 1SLXB 1Q2WA 3PTBA 1MCTA 2PUQH 2H5DA 1AHTH 1IQIA 1H1BA 1RD3B 1C2MA 2FYRA 1EPTB 3RDZA 1V2QT 3ATWA 2OP9A 1NFWA 4XBDA 1ELFA 3M5MA 2OD3B 4YT6H 4UEHH 2J92A 2H9TH 3OY6U 4B75A 3OY5U 1FXYA 1K2I1 3TK5A 5EGMA 1P12E 3M7TA 1BZXE 1AZ8A 3V12A 1C4V2 1O3LA 2CGAA 9LPRA 3TGJE 2GT7A 2BYAX 2ZEBA 4IC5A 1UK2A 1ZMNA 4NSVA 4AFZA 4NWKA 1J8AA 1W8BH 4KGAA 1NY22 1C1PA 1GJAB 1O5BB 2R9PA 2UWPA 2BD3A 2FP7B 5A0CA 3F9GA 4IS5A 1ARBA 2VH0A 3F9HA 1ETRH 2QXHA 5LPFA 2OCVB 1KY9A 1L1GA 1MCVA 4CHAB 1C2JA 2WPKS 4JZFH 2BOHB 4LXBH 2VIDA 1PPBH 3GY8A 4NCYA 4GHQA 4MVNA 3VXFH 4ZROA 1BIOA 7GCHG 1QA0A 1BT7A 3U98H 1ANEA 3HK3B 1NU9A 1S81A 3MFJA 5C1UA 3A87A 1ELAA 3LGVA 2GKVE 2ZQ2A 1C5TA 1NFUA 3SNBA 1DWEH 1IAUA 2QC2A 2ZDKA 1GBKA 2J4IA 1GI1A 6ESTA 2WPHS 1QR3E 3MI4A 3BTKE 4TY7A 1L2EA 1MBQA 2F9VA 3UREA 2D1JA 4CRGA 1G37A 3NPSA 1JMOH 1JRTA 3TIUA 1QTFA 1TPSA 3SQHE 2J94A 4I32A 3SV2H 2VIPA 2BQ7B 1B0FA 3SU5A 3CS7A 4J2YB 2O8TA 1TNGA 3ATLA 4CRBA 4O3TA 1EAUA 2KAIB 3ZV8A 1N8OB 1C1MA 3ZZ9A 1O36A 5L30H 2F9PA 1C2LA 4X2WA 2ZHFH 1A1RA 1UTQA 1FAXA 1MTSA 4FUDA 1F5KU 1SGRE 1D3TB 1CT4E 3GY4A 1UVUH 1LKBA 4JYTA 2BVSH 2ZDVH 3RMOH 2YNBA 2Z94A 3KQBA 1AN1E 3QX5H 1GMCG 2ZPRA 4Y0YE 1BMAA 2A1DB 1FDPA 2TGPZ 3F9EA 4ABHA 1C1OA 3M5NA 3K9XB 1V2MT 2A4GA 1C5UA 4TPIZ 1BITA 1UCYE 3P17H 3ZZ5A 1ZPCA 1C2GA 2VGCC 3HGNA 3H5CB 3AW0A 5TJXA 1T8NA 2CN0H 3PB1