3M7UA

Crystal structure of alpha-lytic protease sb1+2 r64a/e182q mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDAAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFQRLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantifying protein unfolding cooperativity with acid sensitive probes: Interdomain salt bridge contributions to unfolding cooperativity are combined efficiently in alpha-Lytic Protease
rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
molecule keywords Alpha-lytic protease
total genus 54
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7uA01
4DIIH 1CGHA 3FP8E 4I33A 3F6UH 1KLJH 2Z9JA 2ZPRA 2XBYA 3I29A 5JPMH 1GJBB 3SJOA 1AI8H 1F5KU 1ETTH 1CBWB 3UWIA 1FPHH 2W3IA 1O3PB 3L3TA 4INKA 2BD2A 2VH0A 2DE8A 4CRBA 5E2OA 4WMFA 5FX5A 3SBKA 2V3HH 3A7TA 1TBQH 3F9EA 3MTYA 1D3PB 1IQNA 1KXEA 3S9AA 1G3EA 2VWMA 2ZWLH 3EA9A 4FXGH 3SU1A 1FIZA 3VB3A 4BTUB 1VGCB 9ESTA 4LZ1H 1QTFA 4BXSA 1LVYA 1OWJA 2FOBA 1LQEA 5CMXH 3BTGE 2O9QA 1G2LA 1HIAA 3FZZA 3GYLB 4Y76A 3A8CA 4INLA 1ESTA 3PWBA 3RUOA 5DP7A 1SLXB 1KXFA 3BF6H 2GGVB 1GDQA 2BD7A 3TH4H 2OQUA 4INHA 3RP2A 1AB9B 4Z0KA 3VXFH 3ZZ6A 3ELAH 2F9BH 1TRYA 1FN8A 5F8ZA 2EI8A 2G4UA 3SW2B 3T26A 1GHYH 1EB2A 2UUFB 2DE9A 2ZA5A 3SO3A 4K8BA 3VB6A 3U1IB 2PR3A 3BTEE 2Z9IA 1V2NT 1YCPM 5F6MA 1P01A 2JKHA 3A89A 3MH5A 3GCTG 5BRRE 2W3KA 1C5PA 1KLIH 2G8TA 1GHZA 1TMUH 1A7SA 1P09A 3RXPA 1ZMLA 1O36A 1C5YB 8ESTE 1C1VH 3LH1A 4K1SA 4CRFA 1GGDC 2JH6D 4DOQA 2LNCA 2ULLA 1HAZB 2HWLB 5T6FA 4Y0ZE 1AVWA 3U9AH 5EODA 2ZGBH 2V35A 1JRSA 4UE7H 2SFAA 2XW9A 2FXRA 1TGSZ 4LOYH 1O3LA 7GCHF 4NWKA 5CHAC 1P11E 3RMOH 2OP9A 2F91A 3P8OA 3TGKE 3ZVFA 2G4TA 3P6ZB 3UR6A 5TCAA 4KTCA 3SV6A 2Z9KA 2R2MB 1RTFB 5DO4H 1SI5H 2FI4E 1U6QA 1Y5UT 2CN0H 4MTBA 1GDUA 3SJ8A 1K1PA 1G30B 2A5AA 1BTYA 1L4DA 1PYTD 4K1EA 1ABIH 1LKBA 4A6LA 1GJAB 2BOKA 1F5LA 2FOFA 1WOFA 1UCYH 1ESAA 1ZHMA 4NFFA 2PFEA 2SGFE 3PMJA 1HAHH 1UK4A 3QO6A 5EG4A 4CRGA 3QZQA 1ZMNA 3QZRA 4MNYA 1V2KT 1RFNA 1TNKA 2VIOA 1AZ8A 1GJDB 1TX7A 3MMGA 1O3CA 3H7TA 4K69A 1SGDE 3FP6E 4X8UH 1QGFA 2P93A 3MU4A 1CE5A 3TK5A 1O2ZA 4OS5A 1DPOA 1M9UA 2ZU4A 2PSXA 2VGCB 5EW1H 5L2YH 4Y10E 1TALA 1V2TT 3RLYH 4AB8A 2QC2A 1IQJA 1V2ST 1VZQH 1N6XA 1D6RA 3S0NA 1GBFA 2O8WA 1GG6B 1PPBH 4NGAH 1P3EA 1YYY1 1CHGA 4ESTE 2H6MA 4CR9A 1YKTA 1HAIH 1VITG 1FJSA 1GBMA 2XBXA 1BTXA 1FN6A 3SORA 1FONA 1TPAE 3PO1B 1T4VH 3ZVBA 1WCZA 1O2UA 3EDXB 1S5SA 4ZKOU 2ANKH 1F92A 1O3JA 1BHXF 1GCDA 5LH8A 2OLGA 1VCWA 5C1YA 1XUJA 4TY6A 1BRAA 2H2ZA 2J94A 4TPIZ 1ZPCA 2FOHA 1TNHA 1ZJKA 3RMNH 2GCHF 3ZYDA 1PFXC 1SLVB 3VFEA 5E0HA 2FMJA 2IJOB 5ETXA 2O8TA 1OKXA 3A8BA 1ZPZA 3GY5A 2Q6DA 1O2GH 2ANWA 1HAVA 1ELDE 1ETRH 1PPEE 3EE0B 3UIRA 2HOBA 1A46H 5LGOA 3T29A 3UQOA 3EQ0H 1HXFH 4Q7YA 1YPGH 3SI3H 1DSTA 1GI0A 1UVOA 5J4QA 1C5MD 1FLEE 1PYTC 1GHVH 1S82A 1TA2A 2BY8X 4R0IA 3ATKA 2ZU2A 5GCHG 2SGDE 4FUEA 3LGTA 4X8VH 5JBBS 1KLTA 1LPKB 5A0AE 8GCHG 4NIWA 4ZKRU 1NC6A 3LONA 1ETSH 2EA3A 4ABDA 3U8OH 3V12A 2ZFPH 4WXVA 1BRBE 4XE4A 4Z6AH 2ZHWH 1C1QA 2XYAA 5A8ZA 5T6DA 1IOEA 4UFFH 4X8SH 2XNIA 1IHTH 2CF8H 5E0JA 3RXHA 2Y81A 3PTNA 1IQGA 2PV9B 3TK9A 1ANCA 4AZ2B 2Z7FE 3SOSA 3RU4D 1NRRH 4FUJA 1SOTA 1AHTH 1O2HA 1PQ5A 3FP7E 1Z6JH 4I8JA 2QF3A 1UTMA 3K65B 1NN6A 2Y5HA 3F68H 3K6YA 3SNCA 5FX6A 3MH6A 1BRCE 1LKAA 1A5GH 4IMZA 1V2JT 2CGAA 4YOGA 2A7HA 3JZ1B 1INCA 1QRZA 1CA0B 1RTKA 3RM0H 3A88A 1J14A 2A4GA 1C2LA 2BDIA 2Y80A 1FQ3A 3VGCC 2A31A 1O3MA 1QIXB 1TONA 1P2NA 2QF0A 4I8KA 2GT8A 2ZNKH 1HAOH 4SGAE 3SU5A 4YOIA 1TMBH 4CH8B 3SQEE 4ZH8A 2ZFFH 4KELA 4I32A 1A5IA 2VGCC 3SQHE 4ISLA 1E37B 1MTWA 1PQ7A 1TE0A 1A4WH 1HAXB 1UTOA 4NA9H 1GL0E 4MPVA 3NWUA 5IDKA 4I8LA 1LVMA 3LT3A 2F9VA 5FAHA 1O5EH 3UR9A 5DP9A 3MFJA 2A32A 2H9TH 1MZAA 2FODA 1CGJE 4AOQA 1CBWC 1TABE 2ALPA 3M7QA 1MAYA 2BZAA 4JZEH 1JOUB 3T28A 5IYTA 1SGTA 3A7ZA 1JXPA 2BVRH 2EEKA 5GIBA 2VVVA 4Y7BA 1GBDA 2BMGB 1O3DA 1GI1A 1ZZZA 2QAAA 2KAIA 1TA6A 1EP5A 1IQLA 2A2QH 3P95A 1TIOA 2EI7A 2GVFA 2Y7ZA 3P92A 4ISIH 1TQ0B 1OWIA 1T8NA 2BD8A 2ZHFH 2CXVA 3QLPH 1JWTA 1BBRK 3ZVDA 2O8UA 4B1TA 2ZCKP 8GCHF 2D1JA 4E7NA 1IQHA 1BDAA 2OCVB 3ZZ9A 2AGEX 1AIXH 1J17T 2ZO3H 1SGIB 3K9XB 3MNBA 3Q76A 1DLKB 4DURA 4JYVH 1ZR0A 2BY5X 1WAYB 3F1SB 1LTOA 1P05A 1W3CA 1IQIA 3HPTB 3R0FA 1YLCA 4FU9A 4FUBA 1G32B 5JBCS 3SV8A 3LPRA 4ZXXH 3BV9B 5EQQA 2IPHA 1SSXA 1TX6A 4YESB 1NY22 5FHTA 4A1VA 1ZSKA 3DFJA 3BG4C 4JZDH 1SHHB 1SGNE 1GPZA 3PM3A 1V2WT 1BB0B 2QCYA 2BLWA 1W2KH 3M61U 1XUHA 2VWLA 4AG1A 4YLQH 2HVXA 1VCPA 1QA0A 3RXRA 3K6ZA 4MNWA 1EX3A 3RXGA 2B7DH 2Y6TA 7ESTE 1C5ZB 1JRTA 2A0QB 4TWYA 3UNSA 4AFUA 4LK4A 1BT7A 1UHBA 1GJ8B 1QBOA 1WQVH 2WUCA 6GCHF 3PV4A 2PTNA 2BQ7B 2QXGA 1L1GA 2G00A 4K2YA 1GJ7B 3V3MA 5JBAS 3NCLA 1C2EA 1AKSA 5HYOA 1QBVH 3SNAA 3O8DA 4JYTA 4XBBA 3ZZCA 1FUJA 3LH3A 1GVLA 3RMLH 1PPFE 3RXMA 1ZTKA 2B5TB 1EPTB 2ZGCA 4OS2A 4XDEA 3O8BA 1B7XB 3KQDA 2WYJA 2TRMA 2R9PA 1EJAA 1D4PB 2ALVA 1TLDA 1O3GA 2PUQH 1ZRKA 3ZVEA 4NIVA 1V2UT 4ZUHA 4BAHB 1TPOA 4UEHH 1RS0A 5E0GA 3SU3A 3NXPA 4NCYA 3SUFA 1TBZH 1Z8RA 3RXLA 3S9BA 1MKWH 1WV7H 4JMYA 2Z3EA 5HM9A 3GCHB 2QXHA 2FI3E 1O32A 4Q2KA 3RXTA 2W7UA 1A2CH 1ELGA 5AHGH 3TU7H 2FLBH 2D2DA 1GL1A 2BY9X 3BIUH 1CVWH 5C5OA 2TGDA 2ZEBA 3GCNA 4DIHH 1O3AA 1EPTC 4X6PA 2XC4A 1FV9A 1EASA 1MQ5A 3KIDU 1C5WB 4ABGA 2BXTH 3LJOA 1LQDB 2ANYA 5DK1A 3ZZDA 2C90B 5GWZA 1LVBA 3ZZ7A 4IN1A 1NRPH 1QL9A 3D62A 1T31A 1TX8A 1HJAC 1CA0C 1MCTA 3NPSA 5AFYH 1BRUP 1OOKB 1DS2E 4WH8A 2BLQA 3LOXA 2TPIZ 3E8LA 1EZSC 4JYUH 2C8WB 1Y3VA 2OUAA 3Q77A 1XX9A 3GOVB 3LU9B 2BDCA 1SLWB 2ZPSA 1GJ6A 3AAUA 1XUFA 2GZ9A 1KXDA 1O2SA 3ATMA 3UOPA 4NSVA 2BVXH 2ZFRH 5T3HA 1P04A 1AFQB 4UFDH 3QN7A 1W0YH 3A81A 4D76A 1FXYA 2D8WA 4MNVA 4GCHF 1T32A 4NFEA 4VGCC 1TNIA 4XFQA 2Y5GA 1C9TA 4U32A 5ABWA 3SZNA 1K1LA 2C8XB 1W7XH 1MCVA 5DP5A 3TITA 1N8OB 1GVZA 2THFB 1PJPA 1UTLM 3BG4B 2OBQA 3U1JB 1FMGA 2HPQH 2H5DA 1V2QT 1GJ4H 1FY5A 1K9OE 1O34A 2CF9H 2F3CE 3HATH 2AERH 1J8AA 2GZ7A 2EC9H 1O3EA 3OYPA 3RXSA 6CHAC 1C1MA 4BAMB 2BXUH 1H9IE 3U98H 4X2VA 1YGCH 1UHBB 1TGNA 4IN2A 1SQTA 2ZHDA 1YPEH 3KQBA 1P2OA 2D26C 4ABHA 1OWDA 1Q2WA 3E0NB 3VB4A 3TLOA 1HCGA 1BJUA 1SGFA 3MH7A 1K1OA 3OY5U 2IN2A 2SNWA 1UTNA 1GBEA 1OP2A 4ISHH 4D7GA 3BEIB 3EAJA 3FZDA 3MWIU 4BANB 2WPHS 4X1PU 2PKAA 2ZI2H 1O3NA 3IITA 1ZMJA 1TMTH 2ESTE 1XMNB 1P10A 2FWWA 3RM2H 3EA8A 1NT1A 2FIRH 2GTBA 1EP6A 2BDAA 1ZYOA 4RKOB 5JB9S 1K1JA 3AW1A 1V2VT 3SGAE 3RXEA 1SC8U 1GI9B 2ZFQH 1HFDA 2WUBA 3TGJE 4U2WA 1QL8A 1SR5C 2ANMH 3TJNA 1VR1H 4WY3A 1HRTH 1A61H 4FUIA 1IQEA 4WF8A 1AQ7A 1EOLA 2F9NA 4ZROA 1EB1H 1S6HA 1BHXB 3KQCA 1NFUA 1C2MA 3BEFB 1O0DH 2TGPZ 2XCNA 1G37A 3SV2H 2UUKB 3SV7A 1ZLRA 1ID5H 3P70B 1MTUA 2ODPA 1PPZA 4MPUA 3PMAB 4UDWH 1G3BA 1C1NA 1GMDF 1NZQH 2ZIQH 1ELCA 3RXBA 3SI4H 4UFEH 4E05H 3A85A 1O2YA 2UWLA 2VIVA 1WSSH 2V3OH 2FS9A 5A8YA 1UK3A 2AFQB 4XBDA 1E38B 1ELEE 1P06A 4MDSA 3B9FH 1GBKA 3E1XB 1ELTA 1ZHRA 1TOCB 1Z71A 1DXWA 1O5GH 4GUXA 5DGJA 1V2MT 3A84A 3H5CB 5I25A 1O3FA 1ARBA 1GBBA 1P2MA 1P0SH 1C5UA 3NK8A 3EYDA 3W95A 1ELFA 3M5MA 4X6OA 1AGJA 1Q31A 3DA9B 2NU2E 3BIVH 4CH2B 2JETC 1JIRA 1PQ8A 1NFXA 1SQOA 1O5FH 1DT2A 4IMQA 4NA7A 5PTPA 3VPKA 3STJA 3U8TH 1FY4A 2TGAA 1P2QA 3MO6A 2WV4A 1C5VA 2UUJB 2FOGA 3ZV8A 1HAVB 1K22H 5K0HA 3WY8A 1J9CH 2ZCHP 5I46H 3CENA 3M5NA 1HB0B 1QQUA 3UFAA 3UWJH 1GHXH 2SGQE 1WTGH 2R3UA 2RA0A 5A2MH 2SGPE 3OSYA 1DWEH 3A82A 3ATWA 4BTTB 1ABJH 4DT7B 1SVPA 2PKSC 2AMQA 1O5BB 1QNJA 1XUKA 2JH0D 1T8OA 1C1RA 1FIWA 4WWYA 1C5SA 1FI8A 1C4U2 3QK1A 2J38A 2FYQA 3G01A 4Y7AA 1AE8H 2ZGHA 2CV3A 1V2RT 1LHDH 3SUDA 3E91A 2FX6A 4KP0A 2GV7A 1N1LA 4HGCA 2FI5E 2QXJA 2F83A 1CQQA 3RU4E 1C1UH 5DP3A 4YT7H 3A7XA 2P95A 1XVMA 4WMDA 1L1NA 1UCYE 2ZDMA 2J34A 1VITF 1O2XA 3C1KA 1O3BA 2FTLE 1BQYA 1O3HA 5EQRA 3KHVA 2F9UA 4H6TA 1GHBF 3LJJA 5EXLA 1P8VC 3CS7A 4ABIA 2M5TA 2XWBI 3ZV9A 4TPYA 1C5TA 2BDGA 1C5NH 1ZRBA 1GMHF 2WPKS 9LPRA 3SGBE 2HNTC 2P3FH 1VGCC 1EXFA 1MBQA 3AVZA 1C1TA 1GJ5H 4UONA 1NRQH 1OSSA 3UTUH 2PSYA 3ZZ4A 1OWEA 1WU1A 2A4QA 3GISB 1ESBA 1KXAA 1SGQE 1NU7B 1VJ9U 1SGRE 1LHGH 3ODDA 3Q00A 2AYWA 1QRXA 3KNXA 1MU8B 2VIPA 1W13U 3PLBA 4AG2A 3KN2A 3STIA 3SJ9A 5FXLA 1Z6EA 1O5DH 1C2FA 2XC0A 1WTHD 1OWHA 4FU7A 3LIWA 3ZVGA 3SU2A 1CU1A 1Y3YA 7LPRA 2HNTE 3ENSB 2ZHQH 2OTVA 3UNRA 2ZU1A 2A7JA 2ZFTA 2BY6X 5C1XA 1EZXC 4X8TH 3LGWA 2BZ6H 5GPIB 1C5LH 5E8EH 1QBNA 3PTBA 3QX5H 1THRH 1QB1A 1D3QB 5DP4A 3TPIZ 5GXPA 3B23B 1QURH 3A86A 3TGIE 1T8LA 4KTUA 4ZKSU 2PLXA 3OTJE 3QGNB 2STAE 1AVXA 4BXWA 1LCYA 1YPLH 4X1SU 1NESE 4FVBA 3GY6A 3TIUA 2ZDLA 3DD2H 1XKAC 3LC5A 1LMWB 2JETB 2ZGXH 1XKBC 1MTVA 1NRSH 1O2TA 1RXPA 2J95A 4GPGA 1MZDA 3BTTE 2VIQA 4BAQB 1O35A 4ZHAA 1MTSA 1L2EA 1O30A 1O2OA 1HV7A 3M7TA 1MMJN 1AD8H 3ZZAA 2Y82A 2P8OB 2C93B 2P94A 1HJAB 3D65E 4I7YH 2QY0B 2PWXA 1ARCA 4O3TA 2C3SA 1AUTC 1AKSB 3ZVAA 4RSPA 4WMEA 2Z9LA 1GVKB 1P02A 1P9SA 1QL7A 1TNJA 1CT2E 1QA7A 2ZC9H 1C4V2 4BNRA 2QIQA 3A7WA 3GCTF 5AF9H 2YNAA 5LPEA 1IQFA 1FNIA 3DT0H 1QB9A 3M35A 3S69A 1AZZA 5AVDA 3A80A 2H9HA 3RU4T 3SUGA 1A3EH 1CGIE 3E3TA 2NU0E 1KXBA 3ESTA 3D23A 2A45B 4U30A 2OQ5A 1O2KA 1G36A 3QDZB 2Z3CA 4U01A 3GDSA 4MPWA 2OINA 3MOCA 1TRMA 3PO1C 2QN5T 1HPGA 4LZ4B 1ANEA 4FUGA 3CP7A 1GGDB 3RXDA 1P2JA 4UFGH 4JZFH 2FOCA 3TJVA 1AWFH 1F7ZA 2A2XH 1XXFA 3KEEA 4THNH 1NFWA 1UO6A 1BTZA 1SGFG 2K1QA 3HK3B 2FO9A 5HM2A 1OS8A 2PGBB 1AWHB 1ACBE 2XBVA 2ZDVH 1A3BH 4B75A 3HGPA 1DWBH 3TH2H 1DY9A 2VNTA 2GCTB 2ZG0H 2GDEH 7GCHG 1ZTLA 2BDYA 3V7TA 1BMAA 1MD7A 4CBNA 3SNEA 2BX4A 5A09A 1C4Y2 1OPHB 1AUJA 3B8JA 2RG3A 1HDTH 2ZU5A 2PUXB 2NU4E 3F9FA 1ZHPA 1EAUA 1BMNH 1ZGVA 1AVGH 1SFQB 2PKAB 2ZCLP 4I8GA 1P12E 1ZPBA 1QJ6B 4NSYA 1P2KA 5FCKA 2ZTZA 1B0EA 3Q3XA 4X1QU 1GI5A 3MH4A 2QYIA 2OC0A 2BDBA 3A87A 2I6SA 1C2KA 3HKJB 4D9RA 1BTWA 1MKXH 3AAVA 4B73A 1FAXA 3LGUA 3MO9A 2PKSB 4HTCH 1DX5M 5EW2H 2H1UA 4FVDA 3CS0A 1DE7H 2YNBA 4Y11E 1LDTT 4AYVB 1KYNA 1O5AB 2HGTH 4DGJA 1WUNH 2BQWB 2P59A 1EUFA 2VJ1A 3KCGH 3BTWE 4AX9H 4H6SB 3UPEA 1T7CA 5F03A 3RXAA 1C2HA 1O2WA 4GLYA 2I6QA 3S7HB 2NU3E 3GYMA 3Q3YA 3NUMA 4K1TA 3VGCB 1RIWB 1YC0A 1A5HA 4AYYB 1Y3UA 5EQSA 1G9IE 3LGIA 3OY6U 2GP9B 1H9LB 1O39A 1TBRH 1IHSH 1YF4A 1C1PA 2FZZA 2FESH 3O8CA 1CT4E 1UTKA 1O2MA 3QTVH 1E35B 2BVSH 4MQAA 2GKVE 1LHEH 4NIXA 4AGKA 1BBRE 1MKWK 1GBCA 1OYQA 1SLUB 3E0PB 1T8MA 2HALA 3LGVA 1TFXA 2AIPA 4CRDA 1EAXA 3FANA 1O37A 2Y5FA 2ASUB 2R3YA 2VVUA 1VITH 1KIGH 1HIAB 4MPXA 1UCYK 5L6NH 1KTTB 1E36B 1RIWC 3URCA 4A5TS 1UJ1A 3OX7U 4B2CA 3RXIA 2AMPA 3HGNA 2UUYA 3A7VA 2ZKSA 2ZPQA 2ZZUH 3AW0A 1O3IA 2QV1A 1V6DA 4X2YA 1GMHG 1DLEA 4KTSA 1GI8B 2XC5A 3SN8A 3T27A 1GBTA 2CJIA 2A7CA 2GD4B 5EXNA 2A1DB 4SGBE 1F0RA 4X2WA 4H4FA 1C5OH 2BOHB 2Q6FA 3MNXA 1BIOA 3P8FA 3BTQE 3HK6B 1KY9A 4FUCA 1BTUA 1F0TA 4AGJA 2FPZA 1YP9A 4OGYA 4DG4A 2R2WU 1W0ZU 2HLCA 2AGGX 1EZQA 1QJ7B 1N6YA 6ESTA 5JB8S 2R0KA 2NWNA 2BD4A 3L6PA 3RC4A 1D3DB 1J16A 2C8ZB 5AFZH 1EJNA 2GZ8A 4NZLA 3L33A 1ZOMA 4ZXYH 2ILNA 4YOJA 3AASA 5T6GA 1V2LT 3F9HA 4IBLH 1QRWA 4YLUA 3PWCA 3QTOH 1K1NA 4MG3A 1C1SA 2VB0A 2VINA 1CHOG 4Q7ZA 1BMLA 3BTDE 4FUDA 3Q3KA 2G5NA 3GY4A 3GCHC 4F49A 1GMCG 1P9UA 1FPCH 2RA3A 1TRNA 4ASHA 1B0FA 1LPZB 3M3SA 1FY1A 3T25A 2AMDA 3PB1E 2OD3B 2ODQA 1TNGA 5FPYA 2Q1JA 4ABFA 1SHYA 5EU8A 1CA8B 1F5RA 2ZTYA 1GI7B 1L4ZA 3RXQA 1G2MA 4CHAC 3UNQA 3PYHA 1C1WH 3LKWA 2OXSA 1LO6A 1O2RA 2JH5D 3HKIB 3TNTA 4X1RU 1GHAF 4X6MA 2XBWA 1IAUA 1O2IA 1JBUH 3MNCA 3TK6A 2ZDNA 5GCHF 3ZZ8A 3UY9A 1AFEH 1E34B 4X6NA 4IC5A 4CRCA 1UTQA 1XM1A 3ZVCA 1S6FA 1C2GA 2Y7XA 2P8OC 1DANH 1A1RA 3UREA 5K7RA 1DFPA 3T2NA 1GCTC 2VIWA 1RD3B 1MAXA 1W12U 2WPJS 2H9EH 2OC1A 1EZUC 1SL3A 3JZ2B 2AGIX 1ELAA 1GJCB 1YPMH 4ISNA 1ANDA 1C9PA 3GY7A 2W5EA 2BLOA 2J92A 2WINI 4O3UA 2PHBA 1MQ6A 3RXOA 5F8XA 3DUXH 5EXMA 3E16B 3U8RH 3SUEA 5EPYA 3ATIA 4NG9H 3PMBB 1Y8TA 1O31A 1YCPH 4KGAA 5TCCA 2QGRA 4JZ1A 2AS9A 1HAPH 4NIYA 3A8DA 2BYAX 4NZQA 1MU6B 2BB4A 2BD9A 2FTMA 4Y8XA 3F9GA 3QUMP 5HMAA 1XUIA 5LPFA 6GCHG 1QQ4A 2V6NA 2BM2A 2EI6A 2PGQB 4A92A 1S85A 1O3OA 4GCHG 1H8DH 1K1MA 2B9LA 3RXJA 5SGAE 3V0XA 5FBEA 1X7AC 2OC7A 1AFQC 1DWDH 1W8BH 1FAKH 3H7OA 1WYKA 3GICB 4OS1A 1YPHE 2GX4A 3BTKE 1HBTH 3GY3A 1C2IA 2FS8A 1H1BA 2GT7A 1DSUA 1G3CA 1MKXK 1NS3A 3EA7A 2QXIA 1P2IA 3M3TA 4XBCA 3TNSA 4KKDA 4YT6H 3BN9A 4RKJB 2FM2A 4LXBH 1HJ8A 1NU9A 4TY7A 2A4OA 4GAWA 4CHAB 2WV5A 1C5RA 1NFYA 1PQAA 3BSQA 4IC6A 2YOLA 1WBGB 2ZF0H 4ZMAH 1G3DA 4YO9A 4CREA 1HAGE 7KMEH 4H42U 1GI2A 4O97A 3S7KB 2RDLA 3SGQE 3DHKH 3W94A 1OP0A 4Y71A 1O2PA 1GHAG 1ZSJA 1ZGIA 2GMTB 1S0QA 2VU8E 4ABEA 1JMOH 1QB6A 1XUGA 1W7GH 4Y79A 1K28D 1NPMA 1TGCA 1VCQA 3PLPA 1D3TB 1YM0A 4JK6A 3VB5A 4ABAA 3FAOA 3KQEA 2A5IA 5FBIA 1EQ9A 2IOTA 2B8OH 2BD5A 1W11U 1DICA 1BOQA 1L0ZA 3SJIA 1Z1JA 1GI6A 1PPCE 3UOUA 4XOJA 1K2I1 1NTPA 2BY7X 2G52A 4ABJA 2C8YB 5C2ZA 1Z8IB 3LGYA 3MO3A 3UUZA 2VIDA 5EPNA 2W26A 2O8LA 2G51A 5F8TA 2BDHA 1F0SA 1OYTH 2Z3DA 1DXPA 1UTPA 4FUHA 2BQ6B 1SGCA 2HRVA 3R3GB 4MLFB 1TPSA 4GHTA 1THPB 4VGCB 4ZHLU 2VVCA 1HAYB 4TWWA 1BTHH 1GMCF 2GCTC 1TWXB 1XXDA 5ESBA 2W7SA 3URDA 1C1OA 1UVTH 1WQSA 3MU0A 5H4IB 1IQMA 1PPGE 4AFSA 1AU8A 1YBWA 4K60A 1Y5BT 3OU0A 2ZQ2A 3TJOA 1AN1E 2UWPA 3SV9A 1Y5AT 3MU8A 1HNEE 1GBAA 1DWCH 4NA8A 3ATLA 3S9CA 1ANBA 1V3XA 3A8AA 3P8GA 3MHWU 1PPHE 2WPIS 4ISOA 1FDPA 3M37A 4AB9A 1GDNA 1D6WA 2WYGA 2HNTF 3VXEH 5FPTA 1D9IA 5ESTE 1BZXE 5DP8A 2RCEA 1HUTH 2Z9GA 5L30H 3SU4A 1S0RA 2G5VA 1BBRH 4J1YA 4RN6A 5DP6A 3KL6A 1DM4B 5TJXA 4JCNA 2ZTXA 1O2LA 2XCFA 5G4BA 4WH6A 5DKMA 3RXFA 1Q3XA 1Z8GA 3ZZ3A 4AFZA 5LPRA 1GCTB 1BUIA 1SOZA 3GY2A 2P3TB 3M36A 3ITIA 3RXUA 3EGKH 4Y6DA 4E7RG 1FY8E 1HGTH 2J2UA 2VH6A 1K21H 2ZECA 1MTNC 4YM9A 1YPKH 4I31A 5E2PA 3RXVA 4Y8ZA 3ZYEA 5L2ZH 4DY7B 1ZSLA 3TVJB 1O2QA 2FDAA 4A1XA 1O5CB 4A7IB 2SNVA 1MUEB 1THSH 2F9OA 3M5OA 1GI3A 1Y3WA 1MBMA 2FLRH 5DPAA 1NM6A 3C27B 1TNLA 4K5ZA 4ABBA 4BAKB 1H8IH 4DJZB 4GVUA 1RJXB 4J2YB 2G55A 1TAWA 3MU1A 1AMHA 2WPMS 5A8XA 1QJ1B 1GWAA 5JYIA 2C4FH 1S81A 1CO7E 3RMMH 1O2NA 1TGBA 1QFKH 4F4OC 3BTME 4Y8YA 1UK2A 4AFQA 2TBSA 4MNXA 2XXLA 1EOJA 1SB1H 1NO9H 1GHWH 1ORFA 2QA9E 3SU6A 2V0BA 4XSKU 1HXEH 4Y0YE 2BHGA 2DUCA 2STBE 5JDUB 2WPLS 1AO5A 4K3JA 2UWOA 6LPRA 2J4IA 1YCPK 2PTCE 1SGPE 1ZTJA 3NKKA 4D7FA 2FP7B 4M7GA 1H4WA 3DFLA 4BTIB 1UMAH 4WXIA 4B76A 4K8YA 2BTCE 4DVAU 1UVUH 1AB9C 4ZAEA 1P3CA 2OBOA 1QCPA 1GBIA 3PLKA 1XVOA 5HXFA 2ODYB 4DCDA 1OP8A 1CHOF 5EGMA 1ELBA 1LPGB 2BD3A 5BPEA 1A0HB 1FY3A 2B0FA 4HFPB 3V13A 1F0UA 2OC8A 3ZZ5A 2HPPH 4HZHA 3IG6B 1N8OC 5C3NA 3E90B 3BEUA 3O8RA 2G81E 4X2XA 2Q6GA 1O38A 1RTLA 1TQ7B 4IGDA 2PW8H 2GV6A 3NZIA 1OWKA 1OX1A 3MNSA 1GMDG 4FU8A 4GHQA 1NROH 2GDDA 6CHAB 1V2PT 1EJMA 4GSOA 1SPJA 3SJKA 4YZUA 4MVNA 1QR3E 4OS6A 1Z7KA 1YPHC 2XRCA 3GDUA 1RRKA 3UQVA 1KSNA 1VJAU 2BLVA 4NWLA 2P3UB 1DUEA 1BMMH 2XWAA 1GBHA 1C5XB 1Z8JB 3BTHE 3ODFA 1J15A 1LVOA 1BTPA 1FZZA 3GDVA 2F9PA 3I77A 2ZDAH 1LHFH 3RXCA 1T4UH 2FOMB 3SNDA 1SG8B 3PROA 1V2OT 2O8MA 5DG6A 5GJ4B 4OS7A 1S83A 1B5GH 1QY6A 1P03A 2P16A 3SNBA 1QHRB 2VWOA 2ZU3A 4CR5A 4O9VA 2VWNA 5FCRA 1EAWA 2AIQA 3TJUA 1Z1IA 2FEQH 4CBOA 1KTSB 2CHAB 5DJ7A 4B74A 1O33A 1EATA 1HJ9A 3K2UA 3T5FH 1CSOE 1EPTA 1BCUH 4CRAA 1KXCA 1OXGA 1O3KA 1S84A 5EOKA 1TYNA 4OGXA 4O03A 5A0BA 1ELVA 2FYRA 1GBLA 3N7OA 4B2AA 1DITH 2KAIB 3RC6A 3TH3H 1AE5A 1KDQA 3IWMA 1TB6H 4PROA 2R0LA 1EAIA 1GG6C 1TGTA 4X1NU 1H9HE 3M3VA 3MI4A 2FX4A 3KF2A 4OS4A 5C67A 8LPRA 3PMHB 2ZDKA 5B6OA 2CHAC 3M5LA 2ZQ1A 4ZHMU 4UD9H 5GDSH 2LPRA 4IW4E 3T62A 1E0FD 2SGEE 1SFIA 1UTJA 3SU0A 5C20A 3BG8A 1W14U 2H5CA 1K1IA 1C2JA 4AORA 1BITA 1YPJH 1C2DA 1KDQB 4WJG2 1BA8B 1SGEE 3P17H 2AEIH 3E6PH 2SGAA 1DDJA 1CT0E 3KGPA 3D49H 3U69H 4E06H 1P57B 1RGQA 1TPPA 4R8TB 5JBTA 1Y59T 3MYWA 3SHCH 4BOHA 1EKBB 1MH0A 1YLDA 3QWCH 3ZZBA 2BX3A 2J9NA 3RDZA 1JIMA 1W10U 1HLTH 5A0CA 4JZIA 1MTNB 4DW2U 3A7YA 3FFGA 1BJVA 3I78A 1GJ9B 1MD8A 2XTTB 1Y3XA 2Z94A 1A0LA 3RXKA 4B2BA 3P8NA 3FVFB 1DUAA 3VEQB 1AY6H 1LHCH 5C1UA 3LDXH 1A0JA 2FOAA 3GY8A 2Z6BD 3A83A 2TGTA 5HGGA 2NU1E 1IQKA 1SQAA 4YTAA 1HYLA 1UVPA 4A1TA 4QT8C 2A4RA 3VB7A 2CMYA 4BAOB 2TIOA 2ZGJA 2GMTC 3GCOA 1O2JA 4AN7A 2ZFSA 3SHAH 1ZJDA 8KME2 3QGJA 1L1JA 4Q7XA 3MU5A 5CE1A 1GI4A 4Q80A 1TOMH 2ZP0H 1SBWA 3RLWH 5CHAB 5J4SA 4ZKNU 4D9QA 2AH4X 4WVPE 1NRNH 4JK5A 1UVSH 4D8NA 2GCHG 1C5QA 1O2VA 1DOJA 1DY8A 1F2SE 1SGYE 1SMFE 4B71A 3M7UA 4I8HA 1GBJA 5FPSA 4TYDA 3BTFE 4HI3A 3RC5A 4IS5A 5C5NA 2FOEA 1GHBG 2A5KA 1DVAH 3LC3A 4FUFA 2ZHEH 4X0WU
chains in the Genus database with same CATH superfamily
4DIIH 1CGHA 1WXRA 3FP8E 4I33A 3F6UH 1KLJH 2Z9JA 2ZPRA 2XBYA 5CHBA 3I29A 5JPMH 1GJBB 3SJOA 1AI8H 1H8HD 5T1VA 1F5KU 1ETTH 1CBWB 3UWIA 1FPHH 2W3IA 1O3PB 3L3TA 4INKA 2BD2A 2VH0A 2DE8A 4CRBA 5E2OA 4RT1A 4WMFA 5FX5A 3SBKA 2V3HH 3A7TA 1VKYA 1TBQH 3F9EA 2F43B 3MTYA 1D3PB 1IQNA 1KXEA 3S9AA 1G3EA 5CDFE 2VWMA 2ZWLH 3EA9A 4FXGH 3SU1A 1FIZA 3VB3A 4BTUB 1VGCB 9ESTA 4LZ1H 1QTFA 4BXSA 1LVYA 2RFKC 1OWJA 2FOBA 1LQEA 5CMXH 3BTGE 2O9QA 1G2LA 1HIAA 3FZZA 3GYLB 4Y76A 3A8CA 4INLA 1ESTA 3PWBA 3RUOA 5DP7A 1SLXB 1KXFA 3BF6H 2GGVB 1GDQA 2BD7A 3TH4H 2OQUA 4INHA 3RP2A 1AB9B 4Z0KA 3VXFH 3ZZ6A 3ELAH 2F9BH 1TRYA 1FN8A 5F8ZA 2EI8A 2G4UA 3SW2B 3T26A 1GHYH 1EB2A 2UUFB 2DE9A 2ZA5A 3SO3A 4K8BA 3VB6A 3U1IB 2KCYA 2PR3A 3BTEE 2Z9IA 1YWUA 1V2NT 1YCPM 5F6MA 1P01A 2JKHA 3A89A 3MH5A 3GCTG 5BRRE 2XOKD 2W3KA 1C5PA 1KLIH 2G8TA 1GHZA 1TMUH 1A7SA 1P09A 3RXPA 1ZMLA 1O36A 1C5YB 8ESTE 1C1VH 3LH1A 4K1SA 4CRFA 1GGDC 2JH6D 4DOQA 2LNCA 2ULLA 1HAZB 2HWLB 5T6FA 3FO8D 4Y0ZE 4AC9A 1AVWA 3U9AH 5EODA 2ZGBH 2V35A 4F48B 1JRSA 4UE7H 2SFAA 2XW9A 2FXRA 1TGSZ 4LOYH 1O3LA 7GCHF 4NWKA 5CHAC 1P11E 3RMOH 2OP9A 2F91A 3P8OA 3TGKE 2M2AA 3ZVFA 2G4TA 3P6ZB 3F2FA 3UR6A 5TCAA 4KTCA 3SV6A 2Z9KA 2R2MB 1RTFB 5DO4H 1SI5H 2FI4E 1U6QA 1Y5UT 2CN0H 4MTBA 1GDUA 3SJ8A 1K1PA 1G30B 2A5AA 1BTYA 1L4DA 1PYTD 4K1EA 1ABIH 1LKBA 4A6LA 1GJAB 2BOKA 1F5LA 2FOFA 1WOFA 1UCYH 1ESAA 1ZHMA 4NFFA 2PFEA 2SGFE 3PMJA 1HAHH 1UK4A 3QO6A 5EG4A 4CRGA 3QZQA 1ZMNA 3QZRA 4MNYA 1V2KT 1RFNA 1TNKA 2VIOA 1AZ8A 1GJDB 1TX7A 3MMGA 1O3CA 3H7TA 4K69A 1SGDE 3FP6E 4X8UH 1QGFA 2VBCA 2P93A 3MU4A 1CE5A 3TK5A 2KM0A 1O2ZA 4OS5A 1DPOA 1M9UA 2ZU4A 2PSXA 2VGCB 5EW1H 5L2YH 4Y10E 1TALA 1V2TT 3RLYH 4AB8A 2QC2A 1IQJA 1V2ST 1VZQH 3WW7A 1N6XA 1D6RA 3S0NA 1GBFA 2O8WA 1GG6B 1PPBH 4NGAH 1P3EA 1YYY1 1CHGA 4ESTE 2H6MA 4CR9A 1YKTA 1HAIH 1VITG 3FN8A 1FJSA 1GBMA 1BTXA 2XBXA 1FN6A 3SORA 1FONA 1TPAE 3PO1B 1T4VH 3ZVBA 1WCZA 1O2UA 3EDXB 1S5SA 4ZKOU 2ANKH 1F92A 1O3JA 1BHXF 1GCDA 5LH8A 2OLGA 2KCAA 1VCWA 5C1YA 1XUJA 4TY6A 1BRAA 2H2ZA 2J94A 4TPIZ 1ZPCA 2FOHA 1TNHA 1ZJKA 3RMNH 2GCHF 3ZYDA 1PFXC 1SLVB 3VFEA 5E0HA 2FMJA 2IJOB 5ETXA 2O8TA 1OKXA 3A8BA 1ZPZA 3GY5A 2Q6DA 1O2GH 2ANWA 1HAVA 1ELDE 1ETRH 1PPEE 3EE0B 3UIRA 2HOBA 1A46H 5LGOA 3T29A 3UQOA 3EQ0H 1HXFH 4Q7YA 1YPGH 3SI3H 1DSTA 1GI0A 1UVOA 5J4QA 1C5MD 1FLEE 1PYTC 1GHVH 1S82A 1TA2A 2BY8X 4R0IA 3ATKA 2ZU2A 5GCHG 2SGDE 4FUEA 3LGTA 1MABB 4X8VH 5JBBS 1KLTA 1LPKB 5A0AE 8GCHG 4NIWA 4ZKRU 1NC6A 3LONA 1ETSH 2EA3A 4ABDA 3U8OH 3V12A 2ZFPH 4WXVA 1BRBE 4XE4A 4Z6AH 2ZHWH 1C1QA 2XYAA 5A8ZA 5T6DA 1IOEA 4UFFH 4X8SH 2XNIA 1IHTH 2CF8H 5E0JA 3RXHA 2Y81A 3PTNA 1IQGA 3OAAD 2PV9B 3TK9A 1ANCA 4AZ2B 2Z7FE 3SOSA 3OTPA 3RU4D 1NRRH 4FUJA 1SOTA 1AHTH 1O2HA 1PQ5A 1SKYE 1Z6JH 3FP7E 4I8JA 2QF3A 1UTMA 3K65B 1NN6A 2Y5HA 3F68H 3K6YA 3SNCA 5FX6A 3MH6A 1BRCE 1LKAA 1A5GH 4IMZA 1V2JT 2CGAA 4YOGA 2A7HA 3JZ1B 1INCA 1QRZA 1CA0B 5C0UA 1RTKA 3RM0H 3A88A 1J14A 2A4GA 1COWD 1C2LA 2BDIA 2Y80A 1FQ3A 3VGCC 2A31A 1O3MA 1QIXB 4ZCNA 1TONA 1P2NA 2QF0A 4I8KA 2GT8A 2RDEA 2ZNKH 2CK3D 1HAOH 4SGAE 2EQNA 3SU5A 4YOIA 1TMBH 4CH8B 3SQEE 4ZH8A 2ZFFH 4KELA 4I32A 1A5IA 2VGCC 3SQHE 4ISLA 1E37B 1MTWA 1PQ7A 1TE0A 1A4WH 1HAXB 1UTOA 2OK5A 4NA9H 1GL0E 2V7QD 4MPVA 3NWUA 5IDKA 4I8LA 1LVMA 3LT3A 2F9VA 5FAHA 1O5EH 3UR9A 5DP9A 3MFJA 2A32A 2H9TH 4YXWD 1MZAA 2FODA 1CGJE 4AOQA 1CBWC 1TABE 2ALPA 3M7QA 1MAYA 2BZAA 4JZEH 1JOUB 3T28A 5IYTA 1SGTA 3A7ZA 1JXPA 2BVRH 2EEKA 5GIBA 2VVVA 4Y7BA 1GBDA 2BMGB 1O3DA 1GI1A 1ZZZA 2QAAA 2KAIA 1TA6A 1EP5A 1IQLA 2A2QH 3P95A 1TIOA 2EI7A 2GVFA 2Y7ZA 3P92A 4ISIH 1TQ0B 1OWIA 1E1QD 1T8NA 2BD8A 2ZHFH 2LP6A 2CXVA 3QLPH 5HKKD 1JWTA 1BBRK 3ZVDA 2O8UA 4B1TA 3OFND 2ZCKP 8GCHF 2D1JA 4E7NA 1IQHA 1BDAA 2OCVB 3ZZ9A 2AGEX 2V3MA 1AIXH 1J17T 2ZO3H 1SGIB 3K9XB 3MNBA 3Q76A 1DLKB 4DURA 4JYVH 1ZR0A 2BY5X 1WAYB 3F1SB 1LTOA 1P05A 1W3CA 1IQIA 3HPTB 3R0FA 1YLCA 3GS9A 4FU9A 2JDID 4FUBA 1G32B 5JBCS 3SV8A 3LPRA 4ZXXH 3BV9B 5EQQA 3W1EA 2IPHA 1SSXA 1TX6A 4YESB 1NY22 5FHTA 4A1VA 4RI0A 1ZSKA 3DFJA 3BG4C 4JZDH 1SHHB 1SGNE 1GPZA 3PM3A 2QCYA 1V2WT 1BB0B 2BLWA 1W2KH 3M61U 1XUHA 2VWLA 4AG1A 4YLQH 2HVXA 1VCPA 1QA0A 3RXRA 1W0JD 3K6ZA 4MNWA 1EX3A 3RXGA 2B7DH 2Y6TA 7ESTE 1C5ZB 1JRTA 2A0QB 4TWYA 3UNSA 4AFUA 4LK4A 1BT7A 1UHBA 1GJ8B 1QBOA 1WQVH 2WUCA 6GCHF 3PV4A 2PTNA 2BQ7B 2QXGA 1L1GA 2G00A 4K2YA 1GJ7B 3V3MA 5JBAS 3NCLA 1C2EA 1AKSA 5HYOA 1QBVH 3SNAA 3O8DA 4JYTA 4XBBA 3ZZCA 1FUJA 3LH3A 1GVLA 3RMLH 4M9FA 1PPFE 3RXMA 1ZTKA 2B5TB 3UB0A 1EPTB 2ZGCA 4OS2A 4XDEA 3O8BA 1B7XB 3KQDA 2WYJA 2J98B 2TRMA 2R9PA 1EJAA 1D4PB 2ALVA 1TLDA 1O3GA 2PUQH 1ZRKA 3ZVEA 4NIVA 1V2UT 4ZUHA 4BAHB 1TPOA 4UEHH 1RS0A 5E0GA 3SU3A 3NXPA 4NCYA 3SUFA 1TBZH 1Z8RA 3RXLA 3S9BA 1MKWH 1WV7H 4JMYA 2Z3EA 5HM9A 3GCHB 2QXHA 2FI3E 1O32A 3DSGA 4Q2KA 3RXTA 2W7UA 1A2CH 1ELGA 5AHGH 3TU7H 2FLBH 2D2DA 1GL1A 2BY9X 3BIUH 1CVWH 5C5OA 2TGDA 2ZEBA 3GCNA 4DIHH 1O3AA 1EPTC 4X6PA 2XC4A 1FV9A 1EASA 1MQ5A 3KIDU 1C5WB 4ABGA 2BXTH 3LJOA 1LQDB 2ANYA 5DK1A 3ZZDA 2C90B 5GWZA 1LVBA 3ZZ7A 4IN1A 1NRPH 1QL9A 3D62A 1T31A 1TX8A 1HJAC 3F0OA 1CA0C 1MCTA 3NPSA 5AFYH 1BRUP 1OOKB 1DS2E 4WH8A 2BLQA 3LOXA 2TPIZ 3E8LA 1EZSC 4JYUH 2C8WB 1Y3VA 2OUAA 3Q77A 1XX9A 3GOVB 3LU9B 2BDCA 1SLWB 2ZPSA 1GJ6A 3AAUA 1XUFA 2GZ9A 1KXDA 1O2SA 3ATMA 3UOPA 4NSVA 2BVXH 2ZFRH 5T3HA 1P04A 3SYJA 1AFQB 4UFDH 3QN7A 1W0YH 3A81A 4D76A 1FXYA 2D8WA 4MNVA 4GCHF 1T32A 4NFEA 4VGCC 1TNIA 4XFQA 2Y5GA 1C9TA 4U32A 5ABWA 3SZNA 1K1LA 2C8XB 1W7XH 1MCVA 5DP5A 3TITA 1N8OB 1GVZA 2THFB 1PJPA 3DSOA 1UTLM 3BG4B 2OBQA 2QE7D 3U1JB 1FMGA 2HPQH 2H5DA 1V2QT 1GJ4H 1FY5A 2L74A 1K9OE 1O34A 2CF9H 2F3CE 3HATH 2AERH 1J8AA 2GZ7A 2EC9H 5C94A 1O3EA 3OYPA 3RXSA 6CHAC 1C1MA 4BAMB 2BXUH 1H9IE 3U98H 4X2VA 5KECA 1YGCH 1UHBB 1TGNA 4IN2A 1SQTA 2ZHDA 1YPEH 3KQBA 1P2OA 2D26C 4ABHA 4XRNA 1OWDA 1Q2WA 3E0NB 3VB4A 3TLOA 1HCGA 1BJUA 1SGFA 3MH7A 1K1OA 3OY5U 2IN2A 2SNWA 1UTNA 1GBEA 1OP2A 4ISHH 4D7GA 3BEIB 3EAJA 3FZDA 3MWIU 4BANB 2WPHS 4X1PU 2PKAA 2ZI2H 1O3NA 3IITA 1ZMJA 1TMTH 2ESTE 4TSFD 1XMNB 1P10A 2FWWA 3RM2H 3EA8A 1NT1A 2FIRH 2GTBA 1EP6A 2BDAA 1ZYOA 5IK2D 4RKOB 5JB9S 1K1JA 3AW1A 1V2VT 3SGAE 3RXEA 1SC8U 1GI9B 2ZFQH 1HFDA 2WUBA 3TGJE 2W6ID 4U2WA 1QL8A 1SR5C 2ANMH 3TJNA 1VR1H 4WY3A 1HRTH 1A61H 3VG8A 4FUIA 1IQEA 4WF8A 3AK5A 1AQ7A 1EOLA 2F9NA 4ZROA 1EB1H 1S6HA 3SZEA 4HG6A 1BHXB 3KQCA 1NFUA 1C2MA 3BEFB 1O0DH 2TGPZ 2XCNA 1G37A 3SV2H 2UUKB 3SV7A 1ZLRA 1ID5H 3P70B 1MTUA 2ODPA 1PPZA 4MPUA 3PMAB 4UDWH 1G3BA 1C1NA 1GMDF 1NZQH 2ZIQH 1ELCA 2L6OA 3RXBA 5C0TA 3SI4H 4UFEH 4E05H 3A85A 1O2YA 2UWLA 2VIVA 1WSSH 2V3OH 2FS9A 5A8YA 1UK3A 2AFQB 4XBDA 1E38B 1ELEE 1P06A 4MDSA 3B9FH 1GBKA 1QZ8A 3E1XB 1ELTA 1ZHRA 1TOCB 1Z71A 1DXWA 1O5GH 4GUXA 4Z1MD 5DGJA 1V2MT 3A84A 3H5CB 5I25A 1O3FA 1ARBA 1GBBA 1P2MA 1P0SH 1C5UA 3NK8A 1UW7A 3EYDA 3W95A 1ELFA 3M5MA 4X6OA 1KMHB 1AGJA 1Q31A 3DA9B 1YLNA 2NU2E 3BIVH 2KX4A 4CH2B 2JETC 1JIRA 1PQ8A 1NFXA 1SQOA 1O5FH 1DT2A 4IMQA 4NA7A 5PTPA 3VPKA 3STJA 3U8TH 1FY4A 2TGAA 1P2QA 3MO6A 2WV4A 1C5VA 2UUJB 2FOGA 3ZV8A 1HAVB 1K22H 5K0HA 3WY8A 1J9CH 2ZCHP 5I46H 3CENA 3M5NA 1HB0B 1QQUA 5FL7D 3UFAA 3UWJH 1GHXH 2SGQE 1WTGH 2R3UA 2RA0A 5A2MH 2SGPE 3OSYA 1DWEH 3A82A 3ATWA 4BTTB 1ABJH 4DT7B 1SVPA 2PKSC 4Q63A 2AMQA 1O5BB 1QNJA 1XUKA 2JH0D 1T8OA 1C1RA 1FIWA 4WWYA 1C5SA 1FI8A 1C4U2 3QK1A 2J38A 2FYQA 3G01A 4Y7AA 1AE8H 2ZGHA 2CV3A 2K8IA 1V2RT 1LHDH 2J97A 3SUDA 3E91A 2FX6A 4KP0A 2GV7A 1N1LA 4HGCA 2FI5E 2QXJA 2F83A 1CQQA 3RU4E 1C1UH 5DP3A 4YT7H 3A7XA 2P95A 1XVMA 4WMDA 1L1NA 1UCYE 2ZDMA 2J34A 1VITF 1O2XA 3C1KA 1O3BA 2FTLE 1BQYA 1O3HA 5EQRA 3KHVA 2F9UA 4H6TA 1GHBF 3LJJA 5EXLA 1P8VC 3CS7A 4ABIA 2M5TA 2XWBI 3ZV9A 4TPYA 1C5TA 2BDGA 1C5NH 1ZRBA 1GMHF 2WPKS 3UAIC 9LPRA 3SGBE 2HNTC 2P3FH 1VGCC 1EXFA 1MBQA 3AVZA 1C1TA 1GJ5H 4B6EA 4UONA 1NRQH 1OSSA 3UTUH 2PSYA 3ZZ4A 1OWEA 1WU1A 2A4QA 3GISB 1ESBA 1KXAA 1SGQE 1NU7B 1VJ9U 1SGRE 1LHGH 3ODDA 3Q00A 2AYWA 1QRXA 5HIYA 3KNXA 1MU8B 2VIPA 1W13U 3PLBA 4AG2A 3KN2A 3STIA 3SJ9A 5FXLA 1Z6EA 1O5DH 1C2FA 2XC0A 1WTHD 1OWHA 4FU7A 3LIWA 3ZVGA 3SU2A 1CU1A 1Y3YA 7LPRA 5GNDA 2HNTE 3ENSB 2ZHQH 2OTVA 3UNRA 2ZU1A 2A7JA 2ZFTA 2BY6X 3KQ5A 5C1XA 1EZXC 4X8TH 2AHME 3LGWA 2BZ6H 5GPIB 1C5LH 1FX0B 5E8EH 1QBNA 2HLDD 3PTBA 3QX5H 5DSFA 1THRH 1QB1A 5KGOA 1D3QB 5DP4A 3TPIZ 5GXPA 3B23B 4ACBA 1QURH 3A86A 3TGIE 1T8LA 4KTUA 4ZKSU 2PLXA 3OTJE 3QGNB 2STAE 1AVXA 4BXWA 1LCYA 1YPLH 4X1SU 1NESE 4FVBA 3GY6A 3TIUA 2ZDLA 3DD2H 1XKAC 3LC5A 1LMWB 2JETB 2W6JD 2ZGXH 1XKBC 1MTVA 1NRSH 1O2TA 1RXPA 2J95A 4GPGA 1MZDA 2YMSC 3BTTE 2VIQA 4BAQB 1O35A 4ZHAA 1MTSA 1L2EA 1O30A 1O2OA 1HV7A 3M7TA 1MMJN 1AD8H 3ZZAA 2Y82A 2P8OB 2C93B 2P94A 1HJAB 3D65E 4I7YH 2QY0B 2PWXA 1ARCA 2LELA 2C3SA 4O3TA 1AUTC 1AKSB 3ZVAA 3KYGA 4RSPA 5EJLA 4WMEA 2Z9LA 1GVKB 1P02A 1P9SA 1QL7A 1TNJA 1CT2E 1QA7A 2ZC9H 1C4V2 4BNRA 2QIQA 3A7WA 3GCTF 5AF9H 2YNAA 5LPEA 1IQFA 1FNIA 3DT0H 1QB9A 3M35A 3S69A 1AZZA 5AVDA 3A80A 2H9HA 3RU4T 3SUGA 1A3EH 1CGIE 3E3TA 2NU0E 1KXBA 3ESTA 3D23A 2A45B 4U30A 2OQ5A 1O2KA 1G36A 3QDZB 2Z3CA 4U01A 3GDSA 4MPWA 2OINA 3MOCA 1TRMA 3PO1C 2QN5T 1HPGA 4LZ4B 1ANEA 4FUGA 3CP7A 1GGDB 3RXDA 1P2JA 4UFGH 4JZFH 2FOCA 5DN6D 3TJVA 1AWFH 1F7ZA 2A2XH 1XXFA 3KEEA 5EJZA 4THNH 1NFWA 1UO6A 1BTZA 1SGFG 2K1QA 3HK3B 2FO9A 5HM2A 1OS8A 2PGBB 1AWHB 1ACBE 2XBVA 2ZDVH 1A3BH 4B75A 3HGPA 1DWBH 3TH2H 1DY9A 2VNTA 2WHXA 2GCTB 2ZG0H 2GDEH 7GCHG 1ZTLA 2BDYA 3V7TA 3EE7A 2PP6A 3KYFA 1BMAA 1MD7A 5KEDA 4CBNA 4P00A 2BX4A 3SNEA 5A09A 1C4Y2 1OPHB 1AUJA 3B8JA 2RG3A 1HDTH 2ZU5A 2PUXB 2NU4E 3F9FA 1ZHPA 1EAUA 1BMNH 1ZGVA 1AVGH 1SFQB 2PKAB 2ZCLP 4I8GA 1P12E 1ZPBA 1QJ6B 4NSYA 1P2KA 5FCKA 2ZTZA 1B0EA 3Q3XA 4X1QU 1GI5A 3MH4A 2QYIA 2OC0A 2BDBA 3A87A 2I6SA 1C2KA 3HKJB 2JIZD 4D9RA 1BTWA 1MKXH 3AAVA 4B73A 1FAXA 3LGUA 3MO9A 2PKSB 4HTCH 1DX5M 5EW2H 2H1UA 4FVDA 3CS0A 1DE7H 2YNBA 4Y11E 1LDTT 4AYVB 1KYNA 1O5AB 2HGTH 4DGJA 1WUNH 2BQWB 2P59A 1EUFA 2VJ1A 3KCGH 3BTWE 4AX9H 4H6SB 3UPEA 1T7CA 5F03A 3RXAA 1C2HA 1O2WA 2K0QA 4GLYA 5F53A 2I6QA 3S7HB 2NU3E 3GYMA 3Q3YA 3NUMA 4K1TA 3VGCB 1RIWB 1YC0A 1A5HA 4AYYB 1Y3UA 5EQSA 1G9IE 3U28C 3LGIA 3OY6U 2GP9B 1H9LB 1O39A 1TBRH 1IHSH 1YF4A 1C1PA 2FZZA 2FESH 3O8CA 1CT4E 1UTKA 1O2MA 3QTVH 1E35B 2BVSH 4MQAA 2GKVE 1LHEH 3DCLA 4NIXA 4AGKA 1BBRE 1MKWK 1GBCA 1OYQA 1SLUB 3E0PB 1T8MA 2HALA 3LGVA 1TFXA 2AIPA 4CRDA 1EAXA 3FANA 2QF4A 1O37A 2Y5FA 2ASUB 2R3YA 2VVUA 1VITH 1KIGH 1HIAB 4MPXA 1UCYK 5L6NH 3F0PA 1KTTB 1E36B 1RIWC 3N7EA 3URCA 4A5TS 1UJ1A 3OX7U 4B2CA 3RXIA 2AMPA 3HGNA 5C17A 2UUYA 3F2GA 3A7VA 2ZKSA 2ZPQA 2ZZUH 3AW0A 1O3IA 2QV1A 1V6DA 4X2YA 1GMHG 1DLEA 4KTSA 1GI8B 2XC5A 3SN8A 3T27A 1GBTA 2CJIA 2A7CA 2GD4B 5EXNA 2A1DB 4SGBE 1F0RA 4X2WA 4H4FA 1C5OH 2BOHB 2Q6FA 3MNXA 1BIOA 3P8FA 3BTQE 3HK6B 1KY9A 4FUCA 1BTUA 1F0TA 4AGJA 2FPZA 1YP9A 4OGYA 4DG4A 2R2WU 1W0ZU 2HLCA 2AGGX 1EZQA 1QJ7B 1N6YA 1W0KD 6ESTA 5JB8S 2R0KA 2NWNA 2BD4A 3L6PA 3RC4A 1D3DB 1J16A 2C8ZB 5AFZH 1EJNA 2GZ8A 4NZLA 3L33A 1ZOMA 4ZXYH 2ILNA 4YOJA 3AASA 5T6GA 1V2LT 3F9HA 4IBLH 2JJ2D 1QRWA 4YLUA 3PWCA 3QTOH 1K1NA 4MG3A 1C1SA 2VB0A 2VINA 1CHOG 4Q7ZA 1BMLA 3BTDE 4FUDA 3Q3KA 2G5NA 3GY4A 3GCHC 4F49A 1GMCG 1P9UA 1FPCH 2RA3A 2IJD1 1TRNA 4ASHA 1B0FA 1LPZB 3M3SA 1FY1A 3T25A 2AMDA 3PB1E 2OD3B 2KFWA 2ODQA 1TNGA 5FPYA 2Q1JA 4ABFA 1SHYA 5EU8A 1CA8B 1F5RA 2ZTYA 1GI7B 1L4ZA 3RXQA 1G2MA 4CHAC 3UNQA 3PYHA 1C1WH 3LKWA 2OXSA 1LO6A 1O2RA 2JH5D 3OE7D 3F2HA 3HKIB 3TNTA 4X1RU 1GHAF 4X6MA 2XBWA 1IAUA 1O2IA 1JBUH 3MNCA 3TK6A 2ZDNA 5GCHF 3ZZ8A 3UY9A 2YMSB 1AFEH 1E34B 4X6NA 4IC5A 4CRCA 1UTQA 1XM1A 3ZVCA 1S6FA 1C2GA 3H09A 2Y7XA 2P8OC 3NRLA 1E79D 1DANH 1A1RA 3UREA 5K7RA 1DFPA 3T2NA 1GCTC 2VIWA 1RD3B 1MAXA 1W12U 2H9EH 2WPJS 2OC1A 1EZUC 1SL3A 3JZ2B 2AGIX 1ELAA 1GJCB 1YPMH 4ISNA 1ANDA 1C9PA 3GY7A 2W5EA 2BLOA 2J92A 2WINI 4O3UA 2PHBA 1MQ6A 3RXOA 5F8XA 3DUXH 5EXMA 3E16B 3U8RH 3SUEA 5EPYA 3ATIA 4NG9H 3PMBB 1Y8TA 1O31A 1YCPH 4KGAA 5TCCA 4FETA 2QGRA 1OHHD 2AS9A 4JZ1A 1HAPH 4NIYA 3A8DA 2BYAX 4NZQA 1MU6B 2BB4A 5EJ1A 2BD9A 2FTMA 4Y8XA 3F9GA 3QUMP 2KCPA 5HMAA 1XUIA 5LPFA 6GCHG 1QQ4A 2V6NA 2BM2A 2EI6A 2PGQB 4A92A 1S85A 3WWBA 1O3OA 4GCHG 1H8DH 1K1MA 2B9LA 4P02A 3RXJA 5SGAE 3V0XA 5HIZA 5FBEA 3PRBA 1X7AC 2OC7A 1AFQC 1DWDH 1W8BH 1FAKH 3H7OA 1WYKA 3GICB 4OS1A 1YPHE 2GX4A 3BTKE 1HBTH 3GY3A 1C2IA 2FS8A 1H1BA 2GT7A 1DSUA 1G3CA 1MKXK 1NS3A 3EA7A 2J5UA 2QXIA 3FKSD 1P2IA 3M3TA 4XBCA 3TNSA 3WWFA 1NBMD 4KKDA 4YT6H 3BN9A 4RKJB 2FM2A 4LXBH 1HJ8A 1NU9A 4TY7A 2A4OA 4GAWA 4CHAB 2WV5A 1C5RA 1NFYA 1PQAA 3BSQA 4IC6A 2YOLA 1WBGB 2ZF0H 4ACAA 4ZMAH 1G3DA 4YO9A 4CREA 1HAGE 7KMEH 4H42U 1GI2A 4O97A 3S7KB 1YY3A 2RDLA 3SGQE 3DHKH 1H8ED 3W94A 1OP0A 4Y71A 1O2PA 1GHAG 1ZSJA 1ZGIA 2EY4C 2GMTB 1S0QA 4XD7D 2VU8E 4ABEA 1JMOH 1QB6A 1XUGA 1W7GH 4Y79A 1K28D 1NPMA 1TGCA 1VCQA 3PLPA 1D3TB 1YM0A 4JK6A 3VB5A 4ABAA 3FAOA 3KQEA 2A5IA 5FBIA 1EQ9A 2IOTA 4B6FA 2B8OH 2BD5A 1W11U 1DICA 1BOQA 3OEED 1L0ZA 3SJIA 2WZQA 1Z1JA 1GI6A 1PPCE 3UOUA 2JJ1D 4XOJA 1E1RD 1K2I1 1NTPA 2BY7X 2G52A 4ABJA 2C8YB 5C2ZA 1Z8IB 3LGYA 3MO3A 3UUZA 2VIDA 5EPNA 2W26A 2O8LA 2G51A 5F8TA 2BDHA 1F0SA 1OYTH 2Z3DA 1DXPA 1UTPA 5B6LA 4FUHA 2BQ6B 2WPDD 1SGCA 2HRVA 3R3GB 4MLFB 1TPSA 4GHTA 1THPB 4VGCB 4ZHLU 2VVCA 1HAYB 4TWWA 1BTHH 1GMCF 2GCTC 1TWXB 1XXDA 5ESBA 2W7SA 4Q4LA 3URDA 1C1OA 1UVTH 3PRDA 1WQSA 3MU0A 5H4IB 1IQMA 1PPGE 4AFSA 1AU8A 1YBWA 4K60A 1Y5BT 3OU0A 2ZQ2A 3TJOA 1AN1E 2UWPA 3SV9A 1Y5AT 3MU8A 1HNEE 1GBAA 1DWCH 4NA8A 3ATLA 3S9CA 1ANBA 1V3XA 3A8AA 3P8GA 3MHWU 1PPHE 2WPIS 4ISOA 1FDPA 3M37A 2WV9A 2KZ4A 4AB9A 1GDNA 1D6WA 2HNTF 2WYGA 3VXEH 5FPTA 1D9IA 5ESTE 1BZXE 5DP8A 2RCEA 1HUTH 2Z9GA 5L30H 3SU4A 1S0RA 2G5VA 1BBRH 4J1YA 4RN6A 5DP6A 3KL6A 1DM4B 5TJXA 4JCNA 2ZTXA 1O2LA 2XCFA 5G4BA 4WH6A 5DKMA 3RXFA 1Q3XA 1Z8GA 3ZZ3A 4AFZA 5LPRA 1GCTB 1BUIA 1SOZA 3GY2A 2P3TB 3M36A 3ITIA 3RXUA 3EGKH 4Y6DA 4E7RG 1FY8E 1HGTH 2J2UA 2VH6A 1K21H 3F3BA 2GJGA 2ZECA 1MTNC 4YM9A 1YPKH 4I31A 5E2PA 3RXVA 4Y8ZA 3ZYEA 3N99A 3OEHD 5L2ZH 4DY7B 3N7DA 1ZSLA 3TVJB 1O2QA 2FDAA 4A1XA 1O5CB 4A7IB 2SNVA 1MUEB 1THSH 2F9OA 3M5OA 1GI3A 1Y3WA 1MBMA 2FLRH 5DPAA 3PV5A 1NM6A 1S6LA 3C27B 1TNLA 4K5ZA 4ABBA 4BAKB 1H8IH 4DJZB 4GVUA 1RJXB 4J2YB 2G55A 1TAWA 3MU1A 1AMHA 2WPMS 5A8XA 1QJ1B 1GWAA 5JYIA 2C4FH 1S81A 1CO7E 2YMSD 3RMMH 1O2NA 1TGBA 1QFKH 4F4OC 3BTME 4Y8YA 1UK2A 4AFQA 2TBSA 4MNXA 2XXLA 1EOJA 1SB1H 1NO9H 1GHWH 1ORFA 2QA9E 3SU6A 2V0BA 4XSKU 1HXEH 4Y0YE 2BHGA 2DUCA 1NBME 2STBE 5JDUB 2WPLS 1AO5A 4K3JA 2UWOA 6LPRA 2J4IA 1YCPK 2PTCE 3ZIAD 1SGPE 1ZTJA 3NKKA 4D7FA 2FP7B 4M7GA 1H4WA 3DFLA 4BTIB 1UMAH 4WXIA 4B76A 4K8YA 2BTCE 4DVAU 1UVUH 1AB9C 4ZAEA 1P3CA 2OBOA 1QCPA 1GBIA 3PLKA 1XVOA 5HXFA 2ODYB 4DCDA 1OP8A 1CHOF 5EGMA 1WDIA 1ELBA 1LPGB 2BD3A 5BPEA 1A0HB 1FY3A 2B0FA 4HFPB 3V13A 2IPQX 1F0UA 2OC8A 3ZZ5A 2HPPH 4HZHA 3IG6B 2WSSD 1N8OC 5C3NA 3E90B 3BEUA 3O8RA 2G81E 4X2XA 1K0HA 2Q6GA 1O38A 1RTLA 1TQ7B 4IGDA 2PW8H 2GV6A 3NZIA 1OWKA 1OX1A 3MNSA 1GMDG 4FU8A 4GHQA 1NROH 2KR7A 2GDDA 6CHAB 1V2PT 1EJMA 4GSOA 1SPJA 3SJKA 4YZUA 4MVNA 1QR3E 4OS6A 1Z7KA 1YPHC 2XRCA 3GDUA 1RRKA 3UQVA 1KSNA 1VJAU 2BLVA 4NWLA 2P3UB 1DUEA 1BMMH 2XWAA 1GBHA 1C5XB 1Z8JB 3BTHE 3ODFA 4F55A 1J15A 1LVOA 1BTPA 1FZZA 2QF5A 3GDVA 2F9PA 3I77A 2ZDAH 1LHFH 3RXCA 1T4UH 2FOMB 3CNRA 3SNDA 1SG8B 3PROA 1V2OT 2O8MA 5DG6A 5GJ4B 4OS7A 1S83A 1B5GH 1QY6A 2KCOA 1P03A 2P16A 3SNBA 1QHRB 2VWOA 2ZU3A 4CR5A 4O9VA 2VWNA 5FCRA 1EAWA 2AIQA 3TJUA 1Z1IA 2FEQH 4CBOA 1KTSB 2CHAB 5DJ7A 4B74A 1O33A 1EATA 1HJ9A 3K2UA 3T5FH 1CSOE 1EPTA 1BCUH 4CRAA 1KXCA 1OXGA 1O3KA 2J98A 1S84A 5EOKA 3DSPA 1TYNA 4OGXA 4O03A 5A0BA 1ELVA 2FYRA 1GBLA 3N7OA 3MQKC 4B2AA 1DITH 2KAIB 3RC6A 3TH3H 1AE5A 1KDQA 3IWMA 1TB6H 4PROA 2R0LA 1EAIA 1GG6C 1TGTA 4X1NU 1H9HE 3M3VA 3PV2A 3MI4A 2FX4A 3KF2A 4OS4A 5C67A 8LPRA 3PMHB 2ZDKA 5B6OA 2CHAC 3M5LA 2ZQ1A 4ZHMU 4UD9H 5GDSH 2LPRA 4IW4E 3T62A 1E0FD 2SGEE 1SFIA 1UTJA 4TT3D 3SU0A 5C20A 3BG8A 1W14U 2F4LA 2H5CA 1K1IA 1C2JA 4AORA 1BITA 1YPJH 1C2DA 1KDQB 4WJG2 1BA8B 1SGEE 3P17H 2AEIH 3E6PH 2SGAA 1DDJA 1CT0E 3KGPA 3D49H 3U69H 4E06H 1P57B 1RGQA 1TPPA 4I86A 4R8TB 5JBTA 1Y59T 3MYWA 3SHCH 4BOHA 1EKBB 1MH0A 1YLDA 3QWCH 3ZZBA 2BX3A 2J9NA 3RDZA 1JIMA 1W10U 4DT4A 1HLTH 5A0CA 4JZIA 1MTNB 2HVYB 4DW2U 3A7YA 3FFGA 1BMFD 1BJVA 3I78A 1GJ9B 1MD8A 2XTTB 1Y3XA 2Z94A 1A0LA 3RXKA 4B2BA 3P8NA 3FVFB 1DUAA 3VEQB 1AY6H 1LHCH 5C1UA 3LDXH 1A0JA 2FOAA 3GY8A 4FOUC 2Z6BD 3A83A 2TGTA 5HGGA 2NU1E 3FOAA 1IQKA 1SQAA 1EFRD 4YTAA 1HYLA 2XNDD 1UVPA 4A1TA 4QT8C 2A4RA 3VB7A 2CMYA 4BAOB 2TIOA 2ZGJA 2GMTC 3GCOA 1O2JA 4AN7A 2ZFSA 3SHAH 1ZJDA 8KME2 3QGJA 1L1JA 4Q7XA 3MU5A 5CE1A 1GI4A 4OM9A 4Q80A 1TOMH 2ZP0H 1SBWA 3RLWH 5CHAB 5J4SA 4ZKNU 4D9QA 2AH4X 4WVPE 1NRNH 4JK5A 1UVSH 4D8NA 2GCHG 1C5QA 1O2VA 1DOJA 1DY8A 1F2SE 1SGYE 1SMFE 4ASUD 4B71A 3M7UA 4RT0A 4I8HA 1GBJA 5FPSA 4TYDA 3BTFE 1SQRA 4HI3A 3RC5A 4IS5A 5C5NA 2FOEA 1GHBG 2A5KA 1DVAH 3LC3A 4FUFA 2ZHEH 5EIYA 4X0WU
chains in the Genus database with same CATH topology
4DIIH 1CGHA 3FP8E 4I33A 3F6UH 1KLJH 2Z9JA 2ZPRA 2XBYA 3I29A 5JPMH 1GJBB 3SJOA 1AI8H 1F5KU 1ETTH 1CBWB 3UWIA 1FPHH 2W3IA 1O3PB 3L3TA 4INKA 2BD2A 2VH0A 2DE8A 4CRBA 5E2OA 4WMFA 5FX5A 3SBKA 2V3HH 3A7TA 1TBQH 3F9EA 3MTYA 1D3PB 1IQNA 1KXEA 3S9AA 1G3EA 2VWMA 2ZWLH 3EA9A 4FXGH 3SU1A 1FIZA 3VB3A 4BTUB 1VGCB 9ESTA 4LZ1H 1QTFA 4BXSA 1LVYA 1OWJA 2FOBA 1LQEA 5CMXH 3BTGE 2O9QA 1G2LA 1HIAA 3FZZA 3GYLB 4Y76A 3A8CA 4INLA 1ESTA 3PWBA 3RUOA 5DP7A 1SLXB 1KXFA 3BF6H 2GGVB 1GDQA 2BD7A 3TH4H 2OQUA 4INHA 3RP2A 1AB9B 4Z0KA 3VXFH 3ZZ6A 3ELAH 2F9BH 1TRYA 1FN8A 5F8ZA 2EI8A 2G4UA 3SW2B 3T26A 1GHYH 1EB2A 2UUFB 2DE9A 2ZA5A 3SO3A 4K8BA 3VB6A 3U1IB 2PR3A 3BTEE 2Z9IA 1V2NT 1YCPM 5F6MA 1P01A 2JKHA 3A89A 3MH5A 3GCTG 5BRRE 2W3KA 1C5PA 1KLIH 2G8TA 1GHZA 1TMUH 1A7SA 1P09A 3RXPA 1ZMLA 1O36A 1C5YB 8ESTE 1C1VH 3LH1A 4K1SA 4CRFA 1GGDC 2JH6D 4DOQA 2LNCA 2ULLA 1HAZB 2HWLB 5T6FA 4Y0ZE 1AVWA 3U9AH 5EODA 2ZGBH 2V35A 1JRSA 4UE7H 2SFAA 2XW9A 2FXRA 1TGSZ 4LOYH 1O3LA 7GCHF 4NWKA 5CHAC 1P11E 3RMOH 2OP9A 2F91A 3P8OA 3TGKE 3ZVFA 2G4TA 3P6ZB 3UR6A 5TCAA 4KTCA 3SV6A 2Z9KA 2R2MB 1RTFB 5DO4H 1SI5H 2FI4E 1U6QA 1Y5UT 2CN0H 4MTBA 1GDUA 3SJ8A 1K1PA 1G30B 2A5AA 1BTYA 1L4DA 1PYTD 4K1EA 1ABIH 1LKBA 4A6LA 1GJAB 2BOKA 1F5LA 2FOFA 1WOFA 1UCYH 1ESAA 1ZHMA 4NFFA 2PFEA 2SGFE 3PMJA 1HAHH 1UK4A 3QO6A 5EG4A 4CRGA 3QZQA 1ZMNA 3QZRA 4MNYA 1V2KT 1RFNA 1TNKA 2VIOA 1AZ8A 1GJDB 1TX7A 3MMGA 1O3CA 3H7TA 4K69A 1SGDE 3FP6E 4X8UH 1QGFA 2P93A 3MU4A 1CE5A 3TK5A 1O2ZA 4OS5A 1DPOA 1M9UA 2ZU4A 2PSXA 2VGCB 5EW1H 5L2YH 4Y10E 1TALA 1V2TT 3RLYH 4AB8A 2QC2A 1IQJA 1V2ST 1VZQH 1N6XA 1D6RA 3S0NA 1GBFA 2O8WA 1GG6B 1PPBH 4NGAH 1P3EA 1YYY1 1CHGA 4ESTE 2H6MA 4CR9A 1YKTA 1HAIH 1VITG 1FJSA 1GBMA 2XBXA 1BTXA 1FN6A 3SORA 1FONA 1TPAE 3PO1B 1T4VH 3ZVBA 1WCZA 1O2UA 3EDXB 1S5SA 4ZKOU 2ANKH 1F92A 1O3JA 1BHXF 1GCDA 5LH8A 2OLGA 1VCWA 5C1YA 1XUJA 4TY6A 1BRAA 2H2ZA 2J94A 4TPIZ 1ZPCA 2FOHA 1TNHA 1ZJKA 3RMNH 2GCHF 3ZYDA 1PFXC 1SLVB 3VFEA 5E0HA 2FMJA 2IJOB 5ETXA 2O8TA 1OKXA 3A8BA 1ZPZA 3GY5A 2Q6DA 1O2GH 2ANWA 1HAVA 1ELDE 1ETRH 1PPEE 3EE0B 3UIRA 2HOBA 1A46H 5LGOA 3T29A 3UQOA 3EQ0H 1HXFH 4Q7YA 1YPGH 3SI3H 1DSTA 1GI0A 1UVOA 5J4QA 1C5MD 1FLEE 1PYTC 1GHVH 1S82A 1TA2A 2BY8X 4R0IA 3ATKA 2ZU2A 5GCHG 2SGDE 4FUEA 3LGTA 4X8VH 5JBBS 1KLTA 1LPKB 5A0AE 8GCHG 4NIWA 4ZKRU 1NC6A 3LONA 1ETSH 2EA3A 4ABDA 3U8OH 3V12A 2ZFPH 4WXVA 1BRBE 4XE4A 4Z6AH 2ZHWH 1C1QA 2XYAA 5A8ZA 5T6DA 1IOEA 4UFFH 4X8SH 2XNIA 1IHTH 2CF8H 5E0JA 3RXHA 2Y81A 3PTNA 1IQGA 2PV9B 3TK9A 1ANCA 4AZ2B 2Z7FE 3SOSA 3RU4D 1NRRH 4FUJA 1SOTA 1AHTH 1O2HA 1PQ5A 3FP7E 1Z6JH 4I8JA 2QF3A 1UTMA 3K65B 1NN6A 2Y5HA 3F68H 3K6YA 3SNCA 5FX6A 3MH6A 1BRCE 1LKAA 1A5GH 4IMZA 1V2JT 2CGAA 4YOGA 2A7HA 3JZ1B 1INCA 1QRZA 1CA0B 1RTKA 3RM0H 3A88A 1J14A 2A4GA 1C2LA 2BDIA 2Y80A 1FQ3A 3VGCC 2A31A 1O3MA 1QIXB 1TONA 1P2NA 2QF0A 4I8KA 2GT8A 2ZNKH 1HAOH 4SGAE 3SU5A 4YOIA 1TMBH 4CH8B 3SQEE 4ZH8A 2ZFFH 4KELA 4I32A 1A5IA 2VGCC 3SQHE 4ISLA 1E37B 1MTWA 1PQ7A 1TE0A 1A4WH 1HAXB 1UTOA 4NA9H 1GL0E 4MPVA 3NWUA 5IDKA 4I8LA 1LVMA 3LT3A 2F9VA 5FAHA 1O5EH 3UR9A 5DP9A 3MFJA 2A32A 2H9TH 1MZAA 2FODA 1CGJE 4AOQA 1CBWC 1TABE 2ALPA 3M7QA 1MAYA 2BZAA 4JZEH 1JOUB 3T28A 5IYTA 1SGTA 3A7ZA 1JXPA 2BVRH 2EEKA 5GIBA 2VVVA 4Y7BA 1GBDA 2BMGB 1O3DA 1GI1A 1ZZZA 2QAAA 2KAIA 1TA6A 1EP5A 1IQLA 2A2QH 3P95A 1TIOA 2EI7A 2GVFA 2Y7ZA 3P92A 4ISIH 1TQ0B 1OWIA 1T8NA 2BD8A 2ZHFH 2CXVA 3QLPH 1JWTA 1BBRK 3ZVDA 2O8UA 4B1TA 2ZCKP 8GCHF 2D1JA 4E7NA 1IQHA 1BDAA 2OCVB 3ZZ9A 2AGEX 1AIXH 1J17T 2ZO3H 1SGIB 3K9XB 3MNBA 3Q76A 1DLKB 4DURA 4JYVH 1ZR0A 2BY5X 1WAYB 3F1SB 1LTOA 1P05A 1W3CA 1IQIA 3HPTB 3R0FA 1YLCA 4FU9A 4FUBA 1G32B 5JBCS 3SV8A 3LPRA 4ZXXH 3BV9B 5EQQA 2IPHA 1SSXA 1TX6A 4YESB 1NY22 5FHTA 4A1VA 1ZSKA 3DFJA 3BG4C 4JZDH 1SHHB 1SGNE 1GPZA 3PM3A 1V2WT 1BB0B 2QCYA 2BLWA 1W2KH 3M61U 1XUHA 2VWLA 4AG1A 4YLQH 2HVXA 1VCPA 1QA0A 3RXRA 3K6ZA 4MNWA 1EX3A 3RXGA 2B7DH 2Y6TA 7ESTE 1C5ZB 1JRTA 2A0QB 4TWYA 3UNSA 4AFUA 4LK4A 1BT7A 1UHBA 1GJ8B 1QBOA 1WQVH 2WUCA 6GCHF 3PV4A 2PTNA 2BQ7B 2QXGA 1L1GA 2G00A 4K2YA 1GJ7B 3V3MA 5JBAS 3NCLA 1C2EA 1AKSA 5HYOA 1QBVH 3SNAA 3O8DA 4JYTA 4XBBA 3ZZCA 1FUJA 3LH3A 1GVLA 3RMLH 1PPFE 3RXMA 1ZTKA 2B5TB 1EPTB 2ZGCA 4OS2A 4XDEA 3O8BA 1B7XB 3KQDA 2WYJA 2TRMA 2R9PA 1EJAA 1D4PB 2ALVA 1TLDA 1O3GA 2PUQH 1ZRKA 3ZVEA 4NIVA 1V2UT 4ZUHA 4BAHB 1TPOA 4UEHH 1RS0A 5E0GA 3SU3A 3NXPA 4NCYA 3SUFA 1TBZH 1Z8RA 3RXLA 3S9BA 1MKWH 1WV7H 4JMYA 2Z3EA 5HM9A 3GCHB 2QXHA 2FI3E 1O32A 4Q2KA 3RXTA 2W7UA 1A2CH 1ELGA 5AHGH 3TU7H 2FLBH 2D2DA 1GL1A 2BY9X 3BIUH 1CVWH 5C5OA 2TGDA 2ZEBA 3GCNA 4DIHH 1O3AA 1EPTC 4X6PA 2XC4A 1FV9A 1EASA 1MQ5A 3KIDU 1C5WB 4ABGA 2BXTH 3LJOA 1LQDB 2ANYA 5DK1A 3ZZDA 2C90B 5GWZA 1LVBA 3ZZ7A 4IN1A 1NRPH 1QL9A 3D62A 1T31A 1TX8A 1HJAC 1CA0C 1MCTA 3NPSA 5AFYH 1BRUP 1OOKB 1DS2E 4WH8A 2BLQA 3LOXA 2TPIZ 3E8LA 1EZSC 4JYUH 2C8WB 1Y3VA 2OUAA 3Q77A 1XX9A 3GOVB 3LU9B 2BDCA 1SLWB 2ZPSA 1GJ6A 3AAUA 1XUFA 2GZ9A 1KXDA 1O2SA 3ATMA 3UOPA 4NSVA 2BVXH 2ZFRH 5T3HA 1P04A 1AFQB 4UFDH 3QN7A 1W0YH 3A81A 4D76A 1FXYA 2D8WA 4MNVA 4GCHF 1T32A 4NFEA 4VGCC 1TNIA 4XFQA 2Y5GA 1C9TA 4U32A 5ABWA 3SZNA 1K1LA 2C8XB 1W7XH 1MCVA 5DP5A 3TITA 1N8OB 1GVZA 2THFB 1PJPA 1UTLM 3BG4B 2OBQA 3U1JB 1FMGA 2HPQH 2H5DA 1V2QT 1GJ4H 1FY5A 1K9OE 1O34A 2CF9H 2F3CE 3HATH 2AERH 1J8AA 2GZ7A 2EC9H 1O3EA 3OYPA 3RXSA 6CHAC 1C1MA 4BAMB 2BXUH 1H9IE 3U98H 4X2VA 1YGCH 1UHBB 1TGNA 4IN2A 1SQTA 2ZHDA 1YPEH 3KQBA 1P2OA 2D26C 4ABHA 1OWDA 1Q2WA 3E0NB 3VB4A 3TLOA 1HCGA 1BJUA 1SGFA 3MH7A 1K1OA 3OY5U 2IN2A 2SNWA 1UTNA 1GBEA 1OP2A 4ISHH 4D7GA 3BEIB 3EAJA 3FZDA 3MWIU 4BANB 2WPHS 4X1PU 2PKAA 2ZI2H 1O3NA 3IITA 1ZMJA 1TMTH 2ESTE 1XMNB 1P10A 2FWWA 3RM2H 3EA8A 1NT1A 2FIRH 2GTBA 1EP6A 2BDAA 1ZYOA 4RKOB 5JB9S 1K1JA 3AW1A 1V2VT 3SGAE 3RXEA 1SC8U 1GI9B 2ZFQH 1HFDA 2WUBA 3TGJE 4U2WA 1QL8A 1SR5C 2ANMH 3TJNA 1VR1H 4WY3A 1HRTH 1A61H 4FUIA 1IQEA 4WF8A 1AQ7A 1EOLA 2F9NA 4ZROA 1EB1H 1S6HA 1BHXB 3KQCA 1NFUA 1C2MA 3BEFB 1O0DH 2TGPZ 2XCNA 1G37A 3SV2H 2UUKB 3SV7A 1ZLRA 1ID5H 3P70B 1MTUA 2ODPA 1PPZA 4MPUA 3PMAB 4UDWH 1G3BA 1C1NA 1GMDF 1NZQH 2ZIQH 1ELCA 3RXBA 3SI4H 4UFEH 4E05H 3A85A 1O2YA 2UWLA 2VIVA 1WSSH 2V3OH 2FS9A 5A8YA 1UK3A 2AFQB 4XBDA 1E38B 1ELEE 1P06A 4MDSA 3B9FH 1GBKA 3E1XB 1ELTA 1ZHRA 1TOCB 1Z71A 1DXWA 1O5GH 4GUXA 5DGJA 1V2MT 3A84A 3H5CB 5I25A 1O3FA 1ARBA 1GBBA 1P2MA 1P0SH 1C5UA 3NK8A 3EYDA 3W95A 1ELFA 3M5MA 4X6OA 1AGJA 1Q31A 3DA9B 2NU2E 3BIVH 4CH2B 2JETC 1JIRA 1PQ8A 1NFXA 1SQOA 1O5FH 1DT2A 4IMQA 4NA7A 5PTPA 3VPKA 3STJA 3U8TH 1FY4A 2TGAA 1P2QA 3MO6A 2WV4A 1C5VA 2UUJB 2FOGA 3ZV8A 1HAVB 1K22H 5K0HA 3WY8A 1J9CH 2ZCHP 5I46H 3CENA 3M5NA 1HB0B 1QQUA 3UFAA 3UWJH 1GHXH 2SGQE 1WTGH 2R3UA 2RA0A 5A2MH 2SGPE 3OSYA 1DWEH 3A82A 3ATWA 4BTTB 1ABJH 4DT7B 1SVPA 2PKSC 2AMQA 1O5BB 1QNJA 1XUKA 2JH0D 1T8OA 1C1RA 1FIWA 4WWYA 1C5SA 1FI8A 1C4U2 3QK1A 2J38A 2FYQA 3G01A 4Y7AA 1AE8H 2ZGHA 2CV3A 1V2RT 1LHDH 3SUDA 3E91A 2FX6A 4KP0A 2GV7A 1N1LA 4HGCA 2FI5E 2QXJA 2F83A 1CQQA 3RU4E 1C1UH 5DP3A 4YT7H 3A7XA 2P95A 1XVMA 4WMDA 1L1NA 1UCYE 2ZDMA 2J34A 1VITF 1O2XA 3C1KA 1O3BA 2FTLE 1BQYA 1O3HA 5EQRA 3KHVA 2F9UA 4H6TA 1GHBF 3LJJA 5EXLA 1P8VC 3CS7A 4ABIA 2M5TA 2XWBI 3ZV9A 4TPYA 1C5TA 2BDGA 1C5NH 1ZRBA 1GMHF 2WPKS 9LPRA 3SGBE 2HNTC 2P3FH 1VGCC 1EXFA 1MBQA 3AVZA 1C1TA 1GJ5H 4UONA 1NRQH 1OSSA 3UTUH 2PSYA 3ZZ4A 1OWEA 1WU1A 2A4QA 3GISB 1ESBA 1KXAA 1SGQE 1NU7B 1VJ9U 1SGRE 1LHGH 3ODDA 3Q00A 2AYWA 1QRXA 3KNXA 1MU8B 2VIPA 1W13U 3PLBA 4AG2A 3KN2A 3STIA 3SJ9A 5FXLA 1Z6EA 1O5DH 1C2FA 2XC0A 1WTHD 1OWHA 4FU7A 3LIWA 3ZVGA 3SU2A 1CU1A 1Y3YA 7LPRA 2HNTE 3ENSB 2ZHQH 2OTVA 3UNRA 2ZU1A 2A7JA 2ZFTA 2BY6X 5C1XA 1EZXC 4X8TH 3LGWA 2BZ6H 5GPIB 1C5LH 5E8EH 1QBNA 3PTBA 3QX5H 1THRH 1QB1A 1D3QB 5DP4A 3TPIZ 5GXPA 3B23B 1QURH 3A86A 3TGIE 1T8LA 4KTUA 4ZKSU 2PLXA 3OTJE 3QGNB 2STAE 1AVXA 4BXWA 1LCYA 1YPLH 4X1SU 1NESE 4FVBA 3GY6A 3TIUA 2ZDLA 3DD2H 1XKAC 3LC5A 1LMWB 2JETB 2ZGXH 1XKBC 1MTVA 1NRSH 1O2TA 1RXPA 2J95A 4GPGA 1MZDA 3BTTE 2VIQA 4BAQB 1O35A 4ZHAA 1MTSA 1L2EA 1O30A 1O2OA 1HV7A