2ZQ2A

Exploring trypsin s3 pocket
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq2A02
4TY7A 3ZYDA 2GT8A 3SBKA 3HKJB 1UK3A 4RSPA 4LXBH 1O2OA 4A1VA 5EU8A 1JOUB 3SV8A 1MKWH 4DIIH 1A7SA 1MZDA 4F49A 1O2KA 3M35A 2Y7ZA 2SFAA 3F1SB 1TNKA 3GDUA 3SU5A 4B2AA 2O8MA 1OWKA 2BQWB 4GAWA 3VEQB 3E6PH 3RUOA 4AX9H 1QRZA 4Q2KA 1L4ZA 3F9FA 1MD8A 1S5SA 1UJ1A 4CREA 5K7RA 1K9OE 1GWAA 3E3TA 3PYHA 1L2EA 1MTNC 1CT4E 3PWBA 3M5NA 4RKOB 4BNRA 5FBEA 1C5QA 4ISOA 1SHHB 1DICA 2ANWA 2F9OA 1K1IA 1DSUA 1JXPA 3MU5A 5I25A 1QR3E 1TNJA 3UWJH 2A45B 1L4DA 3ZZCA 1VZQH 1ANCA 4NFFA 5T6FA 4B2CA 4X8VH 4GHTA 2FDAA 2FESH 2P3TB 3O8BA 3PMAB 1P2NA 1BBRE 1O2QA 4UFGH 1BJVA 3RXMA 1EPTB 1ZHRA 1GHZA 1CO7E 4BXSA 3P70B 4JYVH 3RXHA 2ZHFH 3TITA 5DP7A 1UHBB 1G3DA 2BX3A 1HXFH 1ANDA 4FUDA 1BJUA 1GCDA 1TB6H 2ZFSA 4X1PU 4NGAH 3RM2H 2ASUB 5EQRA 3QTVH 1ABJH 3AAVA 3Q3XA 2BVSH 2CGAA 1HGTH 1TIOA 1FAKH 1OYTH 3VB5A 1SLVB 4ZHAA 1ZJDA 4MTBA 2Y5HA 7KMEH 2VIOA 3TJNA 2O8LA 1DSTA 4WF8A 1FONA 1VJAU 1AUTC 1V6DA 4FUEA 2XTTB 1GBMA 2ULLA 1IQIA 1SHYA 2F83A 2R3YA 3SORA 2ZCHP 1QA0A 1TNLA 2FS9A 2HNTE 2BD7A 3TPIZ 2P59A 1AVGH 2R2WU 2C8WB 4IN2A 3PTNA 1LHFH 4Y76A 1SGPE 2A4QA 3S7HB 2WPLS 2LPRA 2BDAA 4LOYH 1RRKA 1QBVH 1QA7A 1IHTH 1O2UA 2OC1A 1PJPA 3QK1A 3SU1A 3RXCA 3MO9A 2TGTA 3RXEA 3UFAA 1C5SA 3NKKA 2GT7A 3RMNH 2QF0A 5E2OA 1JIMA 5T6GA 4NWKA 3ZZAA 3GCOA 2WUBA 5A0BA 1TPPA 2GX4A 1NFWA 4MVNA 1A0HB 4Y79A 2P8OB 2VIDA 4YT6H 5DG6A 4JYUH 6CHAC 4ISHH 1ZHMA 3SNCA 5DJ7A 2WPHS 1TGSZ 1UO6A 1P12E 1LQDB 1QRWA 1U6QA 1B0FA 2NU4E 4CR5A 3T2NA 3RXFA 1MTUA 4GSOA 1EQ9A 4YOIA 1ANEA 1HJ8A 2ZDVH 5AFYH 1P01A 5ESBA 3T28A 4XBCA 3S0NA 3SJOA 3BTHE 3BG4B 3LIWA 2PSYA 1E38B 3VB4A 4MNXA 1TQ7B 4AFUA 3PV4A 1DDJA 4IBLH 1C4Y2 1KLTA 1C4V2 1TRYA 4O3UA 1BQYA 1ZZZA 3UY9A 5L30H 2BTCE 1IQMA 3ATMA 4XSKU 1HPGA 3PO1B 3SOSA 5JPMH 2BZAA 3GICB 1V2KT 1J8AA 1CT0E 1KDQB 2QXHA 2ZFTA 1O2WA 3NUMA 4XBDA 2WINI 1Y5UT 1RS0A 1W13U 2PW8H 1MKWK 1AN1E 2Y7XA 1CHOF 2W7UA 2BLOA 4AN7A 1EAIA 5DP8A 1NO9H 5TCAA 3UR6A 3QZRA 1GJDB 4UE7H 1BRUP 3BF6H 1QIXB 1V2MT 3GY5A 3LKWA 1O2ZA 4LK4A 2OCVB 3A7VA 3IWMA 5BRRE 3TJUA 3PMJA 5E8EH 3GCTG 1C1QA 1MH0A 2VIPA 5LPRA 1T8LA 3BTGE 7ESTE 1H8IH 3SV9A 1C2KA 1ABIH 2HPPH 1K1LA 3V0XA 3CS0A 1WYKA 1ZTJA 1N6YA 1DOJA 4O03A 2OC8A 3N7OA 2I6QA 1C1PA 1EKBB 4ABJA 1QCPA 4AOQA 1NROH 1PQAA 1XX9A 4XDEA 2V0BA 1FPHH 3VB6A 1DWCH 3PROA 1TYNA 4WXIA 2Z3DA 2ZDNA 1FY3A 3BEFB 3MH6A 2XBYA 1X7AC 1Z8RA 2TBSA 6ESTA 1Y3XA 1OP0A 2R2MB 3GY3A 4F4OC 3SGAE 1NFYA 2WV4A 1K2I1 3P8NA 5JB9S 3BSQA 4R8TB 2DE8A 3SZNA 1QJ6B 1C9PA 2BDBA 1F5KU 4I8KA 1O2HA 2KAIB 1ZMLA 1HBTH 1OWHA 2C3SA 2OC0A 3UTUH 1WTGH 2AEIH 3VPKA 2W26A 5GXPA 1MAXA 2Y5GA 5HGGA 1GI7B 2C4FH 1O32A 1HAVB 1MBMA 1TOMH 2NU1E 4YT7H 4WH6A 2OBQA 1A3BH 1EPTC 4MG3A 4DG4A 1GHBG 1AVXA 3SQHE 2D26C 1NRSH 4GLYA 5DK1A 1O3BA 3Q3YA 2XWBI 2BXTH 3TNTA 1ELCA 1UVSH 2ZGCA 3A83A 1ZMNA 1SGIB 3ZZBA 3ZZ9A 1K22H 3SU2A 1O3AA 1JRSA 1P05A 3TGIE 1GG6B 5DPAA 2FMJA 1OWEA 1SGDE 4CBNA 5F8ZA 1HJ9A 3K65B 4E06H 4K8YA 1O3EA 1DANH 5IYTA 3ELAH 1VJ9U 3MU1A 2RCEA 3LJJA 3GY6A 2K1QA 3Q77A 3ZVEA 5CE1A 3ENSB 2H9HA 1O31A 4TPIZ 5IDKA 1TGTA 2G51A 5FXLA 2BZ6H 1HFDA 4I7YH 3ZVFA 1TGBA 2UWOA 1O0DH 3GOVB 1EB1H 1C5YB 1VCWA 4MNYA 1O3KA 1CGJE 2VU8E 3RC6A 2SGDE 3QGNB 1ETSH 8KME2 4CRCA 2WV5A 1DXPA 2FTLE 1YPHC 2TGAA 1YPGH 1Y3YA 4Q7XA 1BRCE 2XC4A 1CGIE 1CHGA 3MYWA 1OOKB 4A1TA 1HRTH 1O3NA 1CBWB 5L6NH 2AGIX 2H6MA 4WWYA 3LOXA 3GYLB 3RU4E 1UTNA 3LC5A 4Y7AA 3RXAA 2ALPA 4DJZB 1T8MA 3A82A 1S81A 3LGTA 1BHXF 3HK6B 1SFIA 4WH8A 1GJBB 4WXVA 4X2WA 1QFKH 1ZTLA 1YPEH 3A80A 3BV9B 5GIBA 1O5CB 1O2RA 3P92A 2ZDKA 2G4UA 2TGDA 2ZP0H 2Z7FE 1V3XA 1C2FA 1WQSA 2BHGA 3MHWU 1LQEA 3I78A 2GV7A 1LPGB 1MU6B 1SGNE 4FUJA 1VCQA 1F5LA 1S0QA 4JZFH 5GWZA 3BG4C 1THRH 2OD3B 2XBWA 4NG9H 1K1PA 2PGBB 2RA0A 1Z8JB 1FDPA 3HPTB 2ANYA 3B9FH 3T62A 2Z9LA 2JH5D 3PO1C 4U2WA 1EPTA 5PTPA 1GPZA 1TPAE 2FIRH 4IGDA 4X2XA 2VH0A 4A7IB 1O3GA 1TX7A 3FVFB 1UHBA 4D7GA 2FI4E 2O9QA 1NESE 3ZV9A 1NRRH 3P8GA 2PUQH 4THNH 1DX5M 3U1IB 1HAOH 3L33A 5FPYA 2VVUA 4BTUB 2VINA 3AW0A 5JBAS 3SU4A 1NRPH 3M61U 4FU8A 5ETXA 1GI6A 2BLWA 2ZU4A 2OQUA 2EC9H 4K1EA 4Y8XA 3MH5A 4ZHLU 1SGRE 1LHGH 3MNSA 5C5NA 3O8RA 1DUAA 2ZNKH 3RMLH 5TJXA 4AGKA 1OX1A 1THSH 2OINA 4BAHB 2GCHG 5GDSH 1FY8E 1O3MA 1KXDA 1YPLH 1BMAA 1AMHA 1TNHA 5FHTA 2H9EH 5C67A 4NA8A 2PWXA 4AFQA 4X6PA 2A7JA 4NFEA 2FOBA 1C1RA 3ZZ5A 1D6WA 1SGTA 1TAWA 5FX5A 3TGKE 2UUFB 1J17T 3K6ZA 7GCHG 2J92A 1DWDH 1RXPA 1FIZA 1KLJH 2TPIZ 3MO6A 2A5AA 4B73A 1WU1A 1NRNH 3EA9A 2W5EA 2O8WA 2BD2A 1XXFA 2GMTB 3RXRA 1RGQA 1FPCH 3U1JB 3T29A 1SR5C 4MDSA 4K1SA 2WPKS 4VGCC 4MNWA 1H8DH 5TCCA 3NWUA 5CMXH 3RXGA 3T27A 1ANBA 4D7FA 1XUGA 2F9UA 6GCHG 1AZZA 2P95A 4ZXXH 1BMNH 1ETTH 1RD3B 4IMQA 4INHA 2ESTE 4I8GA 2PKAA 1GI5A 3ZVCA 4YM9A 2FOHA 4BOHA 5F6MA 3QTOH 1A1RA 1HAHH 2BD8A 1A4WH 1YLCA 3S9AA 1S82A 5C2ZA 1E35B 4Q7YA 3S69A 6LPRA 1QGFA 2BVXH 2VIVA 1GBAA 1GL0E 3GCHB 1C2LA 2ANKH 1DT2A 4ISNA 4X6NA 3LGUA 1D9IA 2FPZA 4GPGA 1V2NT 1Y3UA 1SLWB 2VVVA 3HGNA 1UVTH 4U30A 2VGCB 2ZGHA 1YCPK 1AQ7A 1TX6A 2C8YB 1FIWA 2J9NA 1GBFA 1UTLM 1ELDE 5JDUB 2HRVA 2GCTB 4A5TS 4DT7B 4AYYB 1O3CA 3TVJB 1IQFA 1FQ3A 3ATLA 1W8BH 3A87A 1C1VH 3SNBA 2P94A 2ZC9H 3EQ0H 2TGPZ 1GI0A 1ZPBA 5GPIB 1MMJN 5ABWA 1P09A 1ZHPA 4YOJA 1UCYE 1BTPA 5EGMA 2BB4A 2AMPA 3GCTF 3AVZA 1SLXB 4FU9A 1P9UA 1FY1A 3F9EA 1IAUA 2FS8A 1LPKB 1GI3A 4X1NU 1FXYA 1LDTT 3MFJA 1CBWC 2WUCA 1O5DH 3DFJA 4CHAB 2J2UA 1AUJA 2QXJA 1ZPZA 3A89A 1P9SA 2BY8X 1W14U 4FVDA 3CS7A 1XUJA 2FOEA 2PUXB 2CV3A 1TMTH 4AYVB 2A2QH 3BTDE 1LHDH 1V2TT 4FUCA 3JZ1B 4ABHA 2V3OH 1TRNA 2A7CA 1WCZA 2CHAB 5DO4H 3PWCA 1O5BB 1GBEA 4MLFB 1O2IA 3OY5U 4OS4A 4M7GA 1EZUC 2J95A 2OBOA 3TK5A 3OSYA 1P8VC 1YGCH 1K21H 4J2YB 3HGPA 4ABBA 1SI5H 3V12A 4O3TA 1Z6JH 5JB8S 4K69A 1TBZH 5A2MH 2ZO3H 1GHBF 4Y10E 2Z3CA 3D65E 4YLUA 1O2XA 2FO9A 3L6PA 1AFEH 3B8JA 1HCGA 3RXVA 2G5VA 3SI4H 3SHAH 5DP3A 3E16B 2F91A 2RA3A 3OU0A 5A0AE 4UONA 4DURA 3MU4A 2G55A 2C8ZB 1THPB 1LMWB 2A2XH 1OYQA 2SGFE 2GV6A 2Z9KA 2QV1A 4KGAA 1C2HA 1TX8A 3RXBA 4FUFA 1HDTH 3M3SA 2F9NA 4IMZA 2QCYA 1SPJA 2BY5X 2SGEE 1N1LA 1EAUA 1P2QA 3TJVA 3RC5A 2HGTH 3RP2A 3AAUA 1FI8A 1YF4A 2FOGA 1ZSKA 1LHEH 3ESTA 1SQAA 3F9GA 3UOUA 1A5GH 1MBQA 1C1UH 1H9LB 3UREA 2A31A 2PSXA 3T25A 1E0FD 4ZMAH 3TK6A 1F5RA 2FX4A 3KHVA 1IQKA 5HM2A 3TNSA 4RN6A 3ATIA 1EP5A 2Q1JA 5ESTE 3FAOA 1W7XH 1AO5A 2V6NA 1AB9C 3A7ZA 3QDZB 1PYTC 4H6TA 4TYDA 5HMAA 1A0JA 1EP6A 2VNTA 2B5TB 2C8XB 2XBVA 4JCNA 1DXWA 2GDEH 1HIAA 4CRBA 1Q3XA 3QX5H 2STAE 1UTOA 2ANMH 1A46H 1CT2E 4NA7A 2TIOA 2WPMS 1OSSA 3KQEA 3QUMP 1GCTB 1XMNB 1IQHA 5E2PA 2JKHA 5EG4A 3A8DA 1TMBH 3RDZA 1HAYB 2BY7X 4XBBA 5AHGH 1RIWC 1AVWA 3EE0B 2FTMA 3F68H 2BXUH 1AIXH 2VJ1A 1S84A 1DFPA 4MQAA 3SJ8A 1OWJA 4K1TA 1SMFE 1W0ZU 3U8OH 4X2YA 4ZROA 1ZSJA 5E0GA 2W3IA 1CSOE 3ZZ6A 2AMDA 3NPSA 4FUIA 1NT1A 2F9PA 1TWXB 4SGBE 8ESTE 1OP8A 1WV7H 2STBE 3RXPA 4IC5A 1MZAA 1HB0B 2R0KA 5DKMA 1W3CA 1C5UA 1PQ7A 3LU9B 4X1QU 4OGYA 3DUXH 1GL1A 3ATKA 1TA2A 1EAXA 5A8ZA 3RXQA 2H9TH 2PGQB 1SQTA 3KF2A 1TRMA 1SFQB 3RLYH 2SGQE 1O3LA 3Q00A 1EUFA 2UUKB 2YNAA 2ZDMA 1MCTA 1A3EH 1O36A 2VGCC 4HTCH 4KTCA 1A5HA 3BIVH 2HLCA 1QHRB 2O8UA 1N8OB 2QAAA 4NA9H 1GVZA 5EQQA 3K9XB 1WQVH 1YCPM 2IPHA 2PHBA 3W94A 3A81A 2G5NA 3QN7A 3D62A 1S6HA 1P2JA 3D49H 4XE4A 4X2VA 3F6UH 1UK2A 1KTSB 4I33A 1L1NA 1O3DA 2ALVA 1QRXA 3RM0H 3SV2H 1GVLA 2VIWA 2XWAA 3MNBA 1HAPH 1D6RA 1GHYH 1HXEH 2GCHF 1PPBH 4AFSA 1ELGA 1ELFA 3SGBE 1G37A 5FBIA 2EA3A 2GGVB 3BTQE 4D9RA 1O2SA 2G00A 1F0SA 2JH6D 2WPIS 4UFEH 1BZXE 4CHAC 2ZG0H 1C1WH 1D4PB 1P11E 4IS5A 2ZHEH 3A88A 5C20A 3UR9A 2ZGBH 2HWLB 3E91A 4ABFA 3GISB 2ZDLA 1VCPA 1O34A 5A09A 2DUCA 1GDNA 3H5CB 1P03A 1K1NA 1C2EA 3PM3A 7GCHF 1GJAB 4PROA 2CHAC 1UCYK 2Y80A 1FMGA 1EB2A 5AF9H 1P0SH 1E34B 3QLPH 2BLQA 1C2IA 3SNEA 2H5DA 2BVRH 2AGGX 1ID5H 3MNXA 1GBHA 1C5WB 6GCHF 5FCKA 4ESTE 4D76A 1AWFH 1A5IA 1BRAA 1CGHA 2ZQ2A 1O33A 3Q76A 3S9BA 3E0NB 3KIDU 3SN8A 1O2NA 1QJ7B 2AH4X 2GVFA 2ODQA 3O8DA 3A86A 1S83A 1W0YH 2P93A 4YESB 1YBWA 4IW4E 2HALA 2HNTC 5HXFA 1PYTD 3SUDA 5I46H 1ELEE 1Y3VA 1ZMJA 1BA8B 1GBIA 2O8TA 4YO9A 4ABEA 1AE8H 1MCVA 1C4U2 3M5OA 1MTWA 1GHAF 4ZUHA 3RMOH 3RU4T 2FOAA 1TBRH 1W7GH 1OKXA 2VB0A 1BBRK 3A8BA 1D3DB 1YCPH 3DFLA 2Z9JA 3VGCB 2AGEX 3GY7A 2A5IA 3I77A 2VH6A 2BX4A 1YC0A 3K6YA 2PKSB 1TNIA 4NIVA 1KY9A 1O30A 4WMDA 2CMYA 3ODFA 2A4GA 1FZZA 5T6DA 3P95A 2BDYA 2ZFPH 1F0RA 3SNDA 5EXLA 1G32B 3DHKH 3SV7A 1QL8A 1HUTH 3LPRA 2ZZUH 8LPRA 4DIHH 2IJOB 3URCA 3IITA 4BTTB 1YP9A 1MKXK 1KTTB 1Y59T 2H5CA 3L3TA 3EA7A 1JIRA 2ZQ1A 3KQBA 1TOCB 2A32A 1ORFA 4R0IA 5EXMA 1AFQB 1Z7KA 3FP7E 5LH8A 4H42U 4E7NA 2BM2A 1HAZB 1YPJH 2XCNA 1EOLA 1P3EA 1GBKA 4Y8ZA 1RTKA 3LGWA 5E0HA 3UNQA 1GJ7B 1C1NA 2P8OC 4ZH8A 1O2GH 1OP2A 1WUNH 1G36A 1ELBA 3M5MA 1EJMA 4NCYA 3QGJA 1ELTA 4FXGH 9ESTA 4NSVA 2ZDAH 2I6SA 4J1YA 5K0HA 1MTNB 1Q2WA 4GCHF 1LVOA 2XBXA 2OQ5A 3TLOA 4CH8B 4H4FA 1SGFG 2G81E 3TU7H 4ABGA 1O38A 1ZPCA 2QYIA 1BTXA 1GBTA 4FUHA 1QQUA 2P3UB 1V2LT 1VITH 1XUFA 5JBCS 1G9IE 5EW2H 3EYDA 5DP6A 2SGAA 2BD4A 4DVAU 5B6OA 1AU8A 2J34A 3BTFE 4NZQA 1O2VA 2ZIQH 4DOQA 4Q80A 2WYJA 1PPFE 1UTJA 4BAOB 1PPCE 3G01A 2C93B 2GKVE 1WAYB 5CHAB 4NIXA 1GJCB 1N8OC 1FAXA 1MTVA 1Q31A 1DWBH 1K1JA 4K3JA 2ODYB 3ZV8A 4AFZA 3AW1A 2R9PA 3BG8A 1G3BA 4H6SB 4Y11E 1CE5A 7LPRA 4CRDA 2GZ9A 5EPNA 2AERH 1W10U 3FP8E 3V13A 4LZ4B 1GJ5H 3VXFH 4A6LA 4CH2B 1OXGA 4YZUA 3BIUH 1EX3A 1C1TA 1P2IA 1S85A 2ZU3A 4NIWA 4SGAE 1T4UH 3FANA 5A0CA 1LHCH 1IQGA 2OLGA 1Z6EA 2B8OH 1C5PA 2BQ7B 1O2TA 3A8CA 1V2VT 1SGFA 1P06A 3MH7A 1BTUA 3MNCA 5EXNA 2ZHDA 2PV9B 1UTPA 1CVWH 1TLDA 3CP7A 2ZFQH 4B71A 9LPRA 3A7WA 1L0ZA 4B74A 1C5MD 2Y6TA 1OWDA 1QB9A 3BEIB 4FVBA 1F92A 4JK5A 1DLEA 4JMYA 2Q6GA 2Q6FA 4K5ZA 4UEHH 4X0WU 1QTFA 4CRGA 3O8CA 4GVUA 2PTCE 3EGKH 3V7TA 4UFDH 3SUFA 2FYRA 1SOTA 1DUEA 1T8OA 4DW2U 2R3UA 2ZTZA 4CBOA 4Y7BA 3SUEA 3BTKE 3M7TA 2H1UA 2D1JA 1GHWH 2GTBA 5C5OA 5EW1H 5HYOA 1FN8A 2FXRA 3A85A 1SG8B 3C27B 1SSXA 4ZXYH 1T4VH 1C5XB 1O2LA 1O2PA 4CRAA 3MOCA 1KXEA 2M5TA 1ESBA 5EQSA 4X6MA 1P57B 5L2YH 3U69H 4DGJA 2ZPRA 3M36A 3T5FH 2Z94A 3SU6A 1FV9A 1TONA 2J38A 3KQDA 4AB9A 1HNEE 1C1SA 2BDCA 1SC8U 2ILNA 4ZKOU 1GDQA 1SL3A 1MAYA 1LVYA 1P2MA 4GHQA 1SVPA 3GDVA 3ZZ4A 2GP9B 3H7OA 3MO3A 1AY6H 3M7QA 4HFPB 6CHAB 1QBNA 3SU3A 1ZRBA 2TRMA 1GG6C 1D3TB 2WYGA 2SGPE 1XUHA 1A2CH 3GY8A 3UIRA 1QL9A 1O3JA 3AASA 1BOQA 1UVOA 4I32A 5JYIA 1GHAG 2FI5E 3VGCC 1KYNA 1YPMH 2QN5T 3RXSA 4BAMB 2FWWA 2OUAA 4X6OA 4FU7A 1O2YA 3TH3H 2PKSC 1KXBA 4UD9H 1O39A 4K60A 1DE7H 1KDQA 4QT8C 5C3NA 2B7DH 1TBQH 4IN1A 2NU3E 3NCLA 2JETB 1ZRKA 4WMEA 4ZKNU 4I8JA 4ZHMU 2V35A 1G3CA 1XUKA 5C1XA 2OP9A 1K1MA 4X8SH 4NIYA 4AORA 3UNSA 1V2OT 2ZF0H 1TPSA 3ZZ8A 4AZ2B 2V3HH 2Z9IA 3UUZA 1BITA 4WVPE 1NPMA 2EI6A 2ZGXH 4RKJB 1GJ6A 1TE0A 1BRBE 1AFQC 1G2LA 3QZQA 3RC4A 4KP0A 2BDIA 1Y5AT 4Y6DA 4BXWA 1Y8TA 4ZKSU 1C5OH 2RG3A 4O97A 3M3TA 2G4TA 1G30B 3A7XA 4MPXA 1TMUH 2HOBA 3FFGA 4KTSA 1T8NA 1G2MA 3ITIA 1V2PT 1BTHH 3OYPA 4HI3A 3W95A 1C9TA 3OX7U 1ZTKA 1FN6A 3R3GB 3KL6A 4OS6A 1NU9A 1UCYH 2BDGA 1DVAH 3FZZA 1O5AB 1VITG 5F03A 1PPZA 1LKAA 1PFXC 3D23A 1F2SE 4OS5A 2CF8H 4IC6A 4NWLA 1W12U 4JZ1A 2EEKA 1BB0B 2H2ZA 4GCHG 2G8TA 1ARCA 1CU1A 1SGYE 3LC3A 1VGCB 1NU7B 2CXVA 2FZZA 2KAIA 2FM2A 1TGNA 4O9VA 1DY9A 1GBCA 3TGJE 1FJSA 5DP5A 1HAVA 1C5LH 2UWLA 4B76A 1QQ4A 1DS2E 1QB6A 5CHAC 2QC2A 1WBGB 2AIQA 1VR1H 1ZLRA 3PLBA 3Q3KA 4FUBA 4INLA 2F9BH 2BDHA 4GUXA 1PQ8A 3H7TA 4Y0ZE 4NSYA 5EOKA 1CA8B 1YM0A 1IQLA 4JZDH 1ZSLA 1UTQA 3EAJA 1ARBA 1BMMH 2RDLA 1GBDA 1KSNA 2PR3A 1TQ0B 3ZZDA 1BBRH 5AFZH 1P2KA 3RXDA 4MPVA 4TY6A 1KIGH 1H9IE 1H1BA 1H9HE 4K8BA 1P02A 3LGVA 1GMDG 3M7UA 3E90B 1GMHF 1ZJKA 1SGCA 1W11U 5HM9A 3U9AH 2FI3E 1NFXA 2QXIA 1LKBA 3JZ2B 3T26A 2BMGB 3SJ9A 3SO3A 3K2UA 3CENA 3GY2A 2AYWA 1BTZA 1GI2A 2A4RA 4OS7A 4UDWH 1WTHD 2XCFA 1MKXH 3GCNA 3UOPA 4MPUA 1DPOA 2HNTF 5C1UA 1GDUA 1J14A 1NS3A 1S0RA 2FYQA 1EZXC 3BTEE 1GMCG 3OY6U 5LPFA 2IOTA 1C5TA 1V2RT 4E7RG 4ISIH 1DY8A 1P2OA 2PLXA 1IHSH 1LCYA 1HYLA 1FLEE 1B5GH 2GMTC 2XYAA 4U32A 1SOZA 2ZFFH 3STJA 3S7KB 2NWNA 5L2ZH 1HJAB 4JYTA 5DP4A 3KN2A 3DD2H 3RXLA 2NU2E 3RU4D 3P6ZB 2P3FH 1EOJA 3KQCA 1BIOA 2C90B 1AKSB 1CA0B 4XOJA 2ZTYA 1GBLA 4CR9A 2BYAX 3ZZ7A 3MU8A 4JZIA 2UUYA 1P10A 1KXAA 4HZHA 3LGYA 5GCHF 3A84A 3RXOA 5F8XA 2BY9X 3ZVAA 1OS8A 4ABDA 5A8YA 2ZU5A 4KELA 4JZEH 3TK9A 4INKA 1NC6A 2PFEA 2PKAB 2GD4B 1J15A 4ISLA 5J4QA 1INCA 1MU8B 3GCHC 3STIA 2THFB 3RXUA 3SI3H 1T7CA 1SB1H 1YPHE 3PLPA 2BQ6B 1V2QT 1W2KH 1D3QB 2F9VA 4NZLA 2ZCLP 3KGPA 4X1SU 5JBBS 2ZWLH 3TJOA 2A4OA 1E37B 3WY8A 5DP9A 1UVPA 2A5KA 2GCTC 1AHTH 5J4SA 1O3FA 1UVUH 2Q6DA 2Y82A 2ZI2H 1HV7A 3TIUA 1EJAA 2WPJS 2QXGA 2ZHQH 8GCHG 2JETC 4ZKRU 2IN2A 1JWTA 1GHVH 3BTME 4KKDA 3ZVGA 2ZHWH 1Y5BT 1IOEA 3BTWE 4OS1A 2B0FA 3E1XB 1NFUA 1SBWA 4U01A 1FY5A 4A1XA 2ZFRH 1QBOA 4MNVA 1F0TA 1DLKB 2VWLA 1F0UA 1LVBA 3E8LA 3RXJA 1UTMA 2BD3A 2VVCA 3PMHB 2XXLA 4KTUA 5DGJA 5GJ4B 3VFEA 3MI4A 2JH0D 1Z71A 4TWYA 4DCDA 3U8RH 3KNXA 4X8TH 2YOLA 3ZYEA 1HAGE 4WJG2 2J4IA 2SNWA 3LH1A 2B9LA 1LO6A 1ESAA 5FPSA 1ZR0A 1RFNA 1Y3WA 4I8HA 2BY6X 3SV6A 1C2JA 3SW2B 2EI7A 1PPHE 5SGAE 3LGIA 1GHXH 2BD9A 1BMLA 2XRCA 4HGCA 5FX6A 3LONA 1XUIA 1RTLA 3DA9B 1O3HA 3UWIA 5A8XA 1HAIH 3U98H 2BD5A 5H4IB 1C5ZB 1G3EA 1BTYA 1GI8B 4WY3A 2ZEBA 3F9HA 1ETRH 1VGCC 4ASHA 4B2BA 2XNIA 1Z8GA 1GBBA 1O5EH 1YYY1 2D8WA 3PTBA 3KCGH 1LVMA 1ESTA 1CQQA 5G4BA 1GJ9B 1DWEH 2A1DB 1FY4A 4BTIB 2FOMB 4Y0YE 1Z1IA 1MUEB 1O35A 4TPYA 4VGCB 3DT0H 2FEQH 4YTAA 1LPZB 1C2DA 2FOCA 3VB7A 4TWWA 1O5GH 2FP7B 1GGDB 1K28D 4AG1A 3OTJE 3RMMH 1O5FH 1P04A 4D8NA 3M37A 1QURH 5C1YA 4ABAA 1RTFB 2OC7A 3C1KA 4AB8A 1AGJA 1PPGE 3ZVDA 4D9QA 1ELVA 1O37A 4BAKB 4JK6A 2OXSA 4I31A 1MQ5A 1K1OA 1TALA 4I8LA 2QIQA 2ZPQA 3A7YA 4A92A 3BEUA 1GBJA 5LGOA 2FX6A 3PLKA 1GMHG 1BHXB 3EA8A 2AIPA 1V2WT 3R0FA 1AD8H 5FCRA 1FUJA 2QGRA 1OWIA 1BT7A 1AE5A 2XC0A 1D3PB 3TH4H 1GJ8B 1TPOA 3URDA 2HVXA 1NY22 1MD7A 2BLVA 1WOFA 2CN0H 1BTWA 3RXIA 1NZQH 1NM6A 2ZTXA 3NXPA 1TFXA 4Q7ZA 2ZU1A 1GCTC 3SJIA 5E0JA 3B23B 1T32A 3P17H 1HIAB 1EXFA 2DE9A 1J9CH 4BAQB 4K2YA 5FAHA 1DITH 1QJ1B 2FLRH 2UWPA 1HJAC 1V2UT 3M3VA 1EATA 3FP6E 1GVKB 1VITF 1QL7A 3MMGA 1GI1A 3BN9A 1EAWA 1CA0C 3SU0A 1TNGA 3UQVA 2NU0E 1RJXB 1TABE 3ATWA 1AWHB 1N6XA 1C1MA 1AZ8A 2FOFA 2AS9A 3VB3A 1KXCA 5AVDA 1SLUB 1A0LA 1JMOH 1V2JT 5GCHG 4Z0KA 1O2JA 2R0LA 2AMQA 2F3CE 1IQJA 3IG6B 2ZPSA 4AG2A 3BTTE 1L1JA 2Z3EA 3FZDA 2J94A 1S6FA 1ACBE 1O3IA 1XVOA 2Z9GA 2ZA5A 4UFFH 1XXDA 2EI8A 4XFQA 1EJNA 3LDXH 2QF3A 3P8OA 5EPYA 1C5NH 1E36B 4Z6AH 2GDDA 3ODDA 3I29A 2ZECA 3P8FA 3QWCH 2G52A 3HATH 1GI9B 2UUJB 3RXTA 2ZGJA 4Y8YA 1O2MA 2W7SA 1MTSA 4LZ1H 3VXEH 4E05H 4B1TA 3LH3A 2YNBA 1EZSC 2XC5A 3QO6A 5JBTA 1GI4A 4AGJA 3MWIU 2CF9H 3LJOA 3SUGA 4DY7B 4Y71A 2VIQA 1GMDF 3U8TH 3EDXB 3SJKA 1UK4A 1KLIH 1IQNA 3M5LA 1SQOA 3MH4A 3MTYA 3RLWH 1O3PB 1AI8H 2GZ7A 2XW9A 1LTOA 3GY4A 1XVMA 3UQOA 1CHOG 4MPWA 4CRFA 1SGQE 3SGQE 4FUGA 3UPEA 1M9UA 2SNVA 1QY6A 1KXFA 5F8TA 2AFQB 4OGXA 1SGEE 5LPEA 2A7HA 1C5RA 1YLDA 1A61H 1GJ4H 1C5VA 1GMCF 1UMAH 1B7XB 2A0QB 2PTNA 2BOKA 3ZZ3A 4X8UH 1JRTA 2D2DA 2ZKSA 5T3HA 1AB9B 4WMFA 2QA9E 4YOGA 3TH2H 1ZGIA 1YKTA 2Z6BD 1ZGVA 1TA6A 1QB1A 1MQ6A 3SHCH 2FODA 2OTVA 2QY0B 3ZVBA 1PQ5A 4BANB 1HAXB 3LT3A 1H4WA 3A8AA 1ELAA 1NTPA 1UTKA 1HLTH 1Z1JA 2FLBH 3SQEE 2P16A 2HPQH 2BOHB 3NK8A 1O3OA 1RIWB 2ZU2A 1BUIA 3GDSA 4X1RU 5EODA 3RXKA 1AKSA 3A7TA 1EZQA 1IQEA 2ZCKP 4OS2A 2GZ8A 4ZAEA 1PPEE 2CJIA 3KEEA 1GGDC 5FPTA 4B75A 3UNRA 1ZYOA 1ZOMA 3V3MA 1EASA 2W3KA 5BPEA 1J16A 1NRQH 1NN6A 1T31A 1XKBC 1BCUH 2Y81A 1P3CA 1C1OA 3MU0A 3PB1E 3S9CA 3HK3B 1XKAC 1C2MA 4YLQH 3GYMA 1FNIA 4ABIA 1WSSH 2Y5FA 1Z8IB 3HKIB 1YPKH 1OPHB 1JBUH 1V2ST 2ODPA 1B0EA 2VWOA 3E0PB 8GCHF 1XM1A 3SNAA 1DM4B 1TGCA 2LNCA 2VWMA 2VWNA 1C2GA 1BDAA 1QNJA 3NZIA 3PMBB 1L1GA 1F7ZA
chains in the Genus database with same CATH superfamily
4TY7A 3ZYDA 2GT8A 3SBKA 3HKJB 1UK3A 4RSPA 4LXBH 1O2OA 4A1VA 5EU8A 1JOUB 3SV8A 1MKWH 4ACAA 4DIIH 1A7SA 1MZDA 4F49A 1O2KA 3M35A 2Y7ZA 2SFAA 3F1SB 1TNKA 3GDUA 3SU5A 4B2AA 2O8MA 3W1EA 5KEDA 1OWKA 2BQWB 2V3MA 4GAWA 3CNRA 3VEQB 3E6PH 3RUOA 4AX9H 1QRZA 4Q2KA 1W0JD 5HIYA 1WXRA 1L4ZA 3F9FA 1MD8A 1S5SA 1UJ1A 4CREA 5K7RA 1K9OE 1GWAA 3E3TA 3F0PA 3PYHA 1L2EA 1MTNC 1CT4E 3PWBA 3M5NA 4RKOB 4BNRA 5FBEA 1C5QA 4ISOA 1SHHB 1DICA 2ANWA 5C0TA 2F9OA 1K1IA 1DSUA 1JXPA 3MU5A 5I25A 1QR3E 1TNJA 3UWJH 2A45B 1L4DA 3ZZCA 1VZQH 1ANCA 4NFFA 5T6FA 4B2CA 4X8VH 4GHTA 2FDAA 2FESH 2P3TB 3O8BA 3PMAB 1P2NA 1BBRE 1O2QA 4UFGH 1BJVA 3RXMA 1EPTB 1ZHRA 1GHZA 2L74A 1CO7E 4BXSA 3P70B 4JYVH 3RXHA 2ZHFH 3TITA 2JJ1D 5DP7A 1UHBB 1G3DA 3DSPA 2BX3A 2XNDD 1HXFH 1ANDA 4FUDA 1BJUA 1GCDA 1TB6H 2ZFSA 4X1PU 4NGAH 3RM2H 1H8HD 2ASUB 5EQRA 3QTVH 1ABJH 3AAVA 3Q3XA 2BVSH 2CGAA 1HGTH 1TIOA 1FAKH 1OYTH 3VB5A 1SLVB 4ZHAA 1ZJDA 4MTBA 2Y5HA 7KMEH 2VIOA 3TJNA 2O8LA 1DSTA 4WF8A 1FONA 1VJAU 1AUTC 1V6DA 4FUEA 2XTTB 1GBMA 2ULLA 1IQIA 5EJZA 1SHYA 2F83A 2R3YA 3SORA 3N7EA 2ZCHP 1QA0A 1TNLA 2FS9A 2HNTE 2BD7A 3TPIZ 2P59A 1AVGH 2R2WU 2C8WB 4IN2A 3PTNA 3FN8A 1LHFH 4Y76A 2LP6A 1SGPE 2A4QA 3S7HB 2WPLS 1W0KD 2LPRA 2BDAA 4LOYH 1RRKA 1QBVH 1QA7A 1IHTH 1O2UA 2OC1A 1PJPA 3QK1A 3SU1A 3RXCA 4RT0A 3MO9A 2TGTA 3RXEA 3UFAA 1C5SA 3NKKA 2GT7A 3RMNH 2QF0A 5E2OA 1JIMA 5T6GA 2YMSD 4NWKA 2WZQA 3ZZAA 4Z1MD 3GCOA 2WUBA 5A0BA 3OTPA 1TPPA 2GX4A 1NFWA 4MVNA 1A0HB 4Y79A 2P8OB 2VIDA 4YT6H 5DG6A 4JYUH 6CHAC 4ISHH 1ZHMA 3SNCA 5DJ7A 2WPHS 1TGSZ 1UO6A 1P12E 1LQDB 1QRWA 1U6QA 1B0FA 2NU4E 4CR5A 1OHHD 3T2NA 3RXFA 1MTUA 4GSOA 1EQ9A 3N7DA 4YOIA 1ANEA 4YXWD 1HJ8A 2ZDVH 5AFYH 1P01A 5ESBA 3T28A 4XBCA 3S0NA 3SJOA 3BTHE 3BG4B 3LIWA 2PSYA 1E38B 3GS9A 3VB4A 4MNXA 1TQ7B 4AFUA 3PV4A 1DDJA 4IBLH 4RI0A 1C4Y2 1KLTA 1C4V2 1TRYA 4O3UA 1BQYA 1ZZZA 3UY9A 5L30H 2BTCE 1IQMA 3ATMA 4XSKU 1HPGA 3PO1B 3SOSA 5JPMH 2RDEA 2BZAA 3GICB 1V2KT 1J8AA 1CT0E 1KDQB 2QXHA 2ZFTA 1O2WA 3NUMA 4XBDA 2WINI 1Y5UT 1RS0A 1W13U 2PW8H 1MKWK 1AN1E 2Y7XA 1CHOF 2W7UA 2BLOA 4AN7A 4I86A 1EAIA 5DP8A 1NO9H 5TCAA 3UR6A 3QZRA 1GJDB 4UE7H 1BRUP 3BF6H 1QIXB 1V2MT 3GY5A 3LKWA 1O2ZA 4LK4A 2OCVB 3A7VA 3IWMA 5BRRE 3TJUA 3PMJA 5E8EH 3FKSD 3GCTG 1C1QA 1MH0A 2VIPA 5LPRA 1T8LA 3BTGE 7ESTE 1H8IH 3SV9A 3PV2A 2J97A 5CDFE 1C2KA 1ABIH 2HPPH 1K1LA 3V0XA 3CS0A 1WYKA 1ZTJA 1NBME 1N6YA 1DOJA 4O03A 2OC8A 3N7OA 2I6QA 1C1PA 1EKBB 4ABJA 1QCPA 1L1GA 4AOQA 1NROH 1PQAA 1XX9A 4XDEA 2V0BA 1FPHH 3VB6A 1DWCH 3PROA 1TYNA 4WXIA 2Z3DA 2ZDNA 1FY3A 3BEFB 3MH6A 2XBYA 1X7AC 1Z8RA 2TBSA 6ESTA 1Y3XA 1OP0A 2R2MB 3GY3A 4F4OC 3SGAE 3PRDA 1NFYA 2WV4A 1K2I1 3P8NA 5JB9S 3BSQA 4R8TB 2DE8A 3SZNA 1QJ6B 1C9PA 2BDBA 1F5KU 4I8KA 1O2HA 2KAIB 1ZMLA 1HBTH 1OWHA 2C3SA 2OC0A 3UTUH 1WTGH 2AEIH 3VPKA 2W26A 5GXPA 1MAXA 2Y5GA 5HGGA 1GI7B 1UW7A 2C4FH 1O32A 1HAVB 1MBMA 1TOMH 2NU1E 4YT7H 4XD7D 4WH6A 2OBQA 1A3BH 1EPTC 4MG3A 4DG4A 1GHBG 4B6FA 1AVXA 3SQHE 2D26C 1NRSH 4GLYA 1SQRA 5DK1A 4ACBA 1O3BA 3Q3YA 2XWBI 2BXTH 3TNTA 1ELCA 1UVSH 2ZGCA 3A83A 1ZMNA 1H8ED 1SGIB 3ZZBA 3ZZ9A 1K22H 3SU2A 1O3AA 2HVYB 1JRSA 1P05A 3TGIE 1GG6B 5DPAA 2FMJA 1OWEA 1SGDE 3VG8A 4CBNA 3OEHD 1HJ9A 5F8ZA 3K65B 4E06H 3H09A 4K8YA 1O3EA 1DANH 5IYTA 3ELAH 1VJ9U 3MU1A 2RCEA 3LJJA 3GY6A 2K1QA 3Q77A 3ZVEA 5CE1A 3ENSB 2H9HA 1O31A 4TPIZ 5IDKA 1TGTA 2G51A 5FXLA 2BZ6H 1HFDA 4I7YH 5KGOA 3ZVFA 1TGBA 2UWOA 1O0DH 3GOVB 1EB1H 1C5YB 1VCWA 4MNYA 4M9FA 1O3KA 1CGJE 2VU8E 3RC6A 2SGDE 3QGNB 1ETSH 8KME2 3DSGA 4CRCA 2K0QA 2WV5A 1DXPA 2FTLE 1YPHC 2TGAA 4F55A 1YPGH 1Y3YA 4Q7XA 1BRCE 2XC4A 1CGIE 1CHGA 3MYWA 1OOKB 4A1TA 1HRTH 1O3NA 1CBWB 5L6NH 4ASUD 2AGIX 2H6MA 4WWYA 3LOXA 3GYLB 3RU4E 1UTNA 3LC5A 4Y7AA 3RXAA 2ALPA 4DJZB 1T8MA 3A82A 1S81A 3LGTA 1BHXF 3HK6B 3WWBA 1SFIA 4WH8A 1GJBB 4WXVA 4X2WA 1QFKH 1ZTLA 1YPEH 3A80A 3BV9B 5GIBA 3PV5A 1O5CB 1O2RA 3P92A 2ZDKA 1S6LA 2G4UA 2TGDA 2ZP0H 2Z7FE 1V3XA 1E79D 1C2FA 1WQSA 2BHGA 3MHWU 1LQEA 3I78A 2GV7A 1LPGB 1MU6B 1SGNE 4FUJA 1VCQA 1F5LA 1S0QA 4JZFH 5GWZA 3BG4C 1THRH 2OD3B 2XBWA 4NG9H 1K1PA 2PGBB 2RA0A 2VBCA 1Z8JB 5KECA 1FDPA 3HPTB 2ANYA 3B9FH 3T62A 2Z9LA 2JH5D 3PO1C 4U2WA 1EPTA 5PTPA 1GPZA 1TPAE 2FIRH 4IGDA 4X2XA 2VH0A 4A7IB 1O3GA 1TX7A 3FVFB 1UHBA 4D7GA 2FI4E 2O9QA 1NESE 3ZV9A 1NRRH 3P8GA 2PUQH 5EJLA 4THNH 1DX5M 3U1IB 1HAOH 3L33A 5FPYA 2VVUA 4BTUB 2VINA 3AW0A 5JBAS 3SU4A 1NRPH 3M61U 4FU8A 5ETXA 1GI6A 2BLWA 2ZU4A 2OQUA 2EC9H 4K1EA 4Y8XA 3MH5A 4ZHLU 1KMHB 3F2HA 1SGRE 5DN6D 1LHGH 3MNSA 5C5NA 3O8RA 1DUAA 2ZNKH 3RMLH 5TJXA 4AGKA 1OX1A 1THSH 2OINA 4BAHB 2GCHG 5GDSH 1FY8E 1O3MA 1KXDA 1YPLH 1BMAA 1AMHA 1TNHA 5FHTA 2H9EH 5C67A 2QE7D 4NA8A 2PWXA 3FOAA 4AFQA 4X6PA 2A7JA 4NFEA 2FOBA 1C1RA 3ZZ5A 1D6WA 1SGTA 1TAWA 5FX5A 3TGKE 2UUFB 1J17T 3K6ZA 7GCHG 2J92A 1DWDH 1RXPA 1FIZA 1KLJH 5HKKD 2TPIZ 3MO6A 2A5AA 4B73A 1WU1A 1NRNH 3EA9A 2W5EA 2O8WA 2BD2A 1XXFA 2GMTB 3RXRA 1RGQA 1FPCH 3U1JB 3T29A 1SR5C 4MDSA 4K1SA 2WPKS 4VGCC 4MNWA 1H8DH 5TCCA 3NWUA 5CMXH 3RXGA 3T27A 1ANBA 4D7FA 1XUGA 2F9UA 6GCHG 1AZZA 2P95A 4ZXXH 1BMNH 1ETTH 1RD3B 4IMQA 4INHA 2ESTE 4I8GA 2PKAA 1GI5A 5C94A 3ZVCA 4YM9A 2FOHA 4BOHA 5F6MA 3QTOH 1A1RA 1HAHH 2BD8A 1A4WH 1YLCA 3S9AA 2WPDD 1S82A 5C2ZA 1E35B 4Q7YA 5HIZA 3S69A 6LPRA 1QZ8A 1QGFA 2BVXH 2VIVA 1GBAA 1GL0E 3GCHB 1C2LA 2ANKH 1DT2A 4ISNA 4X6NA 3LGUA 1D9IA 2FPZA 4GPGA 1V2NT 1Y3UA 1SLWB 1BMFD 2VVVA 1UVTH 3HGNA 4U30A 2VGCB 2ZGHA 1YCPK 3F3BA 1AQ7A 1TX6A 2C8YB 2EQNA 1FIWA 2J9NA 1GBFA 1UTLM 1ELDE 5JDUB 2HRVA 2GCTB 4A5TS 4DT7B 4AYYB 1O3CA 3TVJB 1IQFA 1FQ3A 3ATLA 1W8BH 3A87A 1C1VH 3SNBA 2P94A 2ZC9H 3EQ0H 2TGPZ 1GI0A 1ZPBA 5GPIB 1MMJN 5ABWA 1P09A 1ZHPA 4YOJA 1UCYE 1BTPA 5EGMA 2KCAA 2BB4A 2AMPA 3GCTF 3AVZA 2GJGA 1SLXB 4FU9A 1P9UA 1FY1A 3F9EA 1IAUA 2FS8A 1LPKB 1GI3A 4X1NU 1FXYA 1LDTT 3MFJA 1CBWC 2WUCA 1O5DH 3DFJA 4CHAB 2J2UA 1AUJA 2QXJA 1ZPZA 3A89A 1P9SA 2BY8X 1W14U 4FVDA 3CS7A 1XUJA 2FOEA 2PUXB 2CV3A 5FL7D 1TMTH 1EFRD 4AYVB 2A2QH 3BTDE 1LHDH 1V2TT 4FUCA 3JZ1B 4ABHA 2V3OH 1TRNA 2A7CA 1WCZA 2CHAB 5DO4H 3PWCA 1O5BB 1GBEA 4MLFB 1O2IA 3OY5U 4OS4A 4M7GA 1EZUC 2J95A 2OBOA 3TK5A 3OSYA 1P8VC 1YGCH 1K21H 4J2YB 1COWD 3HGPA 4ABBA 1SI5H 3V12A 4O3TA 1Z6JH 5JB8S 4K69A 1TBZH 5A2MH 3KQ5A 2ZO3H 1GHBF 4Y10E 2Z3CA 3D65E 4YLUA 2LELA 1O2XA 2FO9A 3L6PA 1AFEH 3B8JA 1HCGA 3RXVA 2G5VA 3SI4H 3SHAH 5DP3A 3E16B 2F91A 2RA3A 3OU0A 5A0AE 4UONA 4DURA 4ZCNA 3MU4A 2G55A 2C8ZB 1THPB 1LMWB 2A2XH 1OYQA 2SGFE 2GV6A 2Z9KA 2QV1A 4KGAA 1C2HA 1TX8A 3RXBA 4FUFA 1HDTH 3M3SA 2F9NA 4IMZA 2QCYA 1SPJA 2BY5X 2SGEE 1N1LA 1EAUA 1P2QA 3TJVA 3RC5A 2HGTH 3RP2A 3AAUA 1FI8A 1YF4A 2FOGA 1ZSKA 1LHEH 3ESTA 1SQAA 3F9GA 3UOUA 1A5GH 1MBQA 1C1UH 1H9LB 3UREA 2A31A 2PSXA 3T25A 1E0FD 4ZMAH 3TK6A 1F5RA 2FX4A 3KHVA 1IQKA 5HM2A 2IJD1 3TNSA 4RN6A 3ATIA 1EP5A 2Q1JA 5ESTE 3FAOA 1W7XH 1AO5A 2V6NA 1AB9C 3A7ZA 3QDZB 1PYTC 4H6TA 4TYDA 5HMAA 1A0JA 1EP6A 2VNTA 2B5TB 2EY4C 2C8XB 2XBVA 4JCNA 1DXWA 2GDEH 1HIAA 4CRBA 1Q3XA 3QX5H 2STAE 1UTOA 2ANMH 1A46H 1CT2E 3UAIC 4NA7A 2TIOA 2WPMS 1OSSA 3KQEA 3QUMP 1GCTB 1XMNB 1IQHA 5E2PA 2JKHA 5EG4A 3A8DA 1TMBH 3RDZA 1HAYB 2BY7X 4XBBA 5AHGH 1RIWC 1AVWA 3EE0B 2FTMA 3F68H 2BXUH 1AIXH 2VJ1A 1S84A 1DFPA 4MQAA 3SJ8A 1OWJA 4K1TA 1SMFE 1W0ZU 3U8OH 4X2YA 4ZROA 1ZSJA 5E0GA 2W3IA 1CSOE 3ZZ6A 2AMDA 3NPSA 4FUIA 4Q63A 1NT1A 2F9PA 1TWXB 4SGBE 8ESTE 1OP8A 1WV7H 2STBE 3RXPA 4IC5A 1MZAA 1HB0B 2R0KA 5DKMA 1E1RD 1W3CA 1C5UA 1PQ7A 3LU9B 4X1QU 4OGYA 3DUXH 1GL1A 3ATKA 1TA2A 1EAXA 5A8ZA 3RXQA 2H9TH 2PGQB 1SQTA 3KF2A 1TRMA 1SFQB 3RLYH 2SGQE 1O3LA 3Q00A 1EUFA 2UUKB 2YNAA 2ZDMA 1MCTA 1A3EH 1O36A 2VGCC 4HTCH 4KTCA 1A5HA 3BIVH 2HLCA 1QHRB 2O8UA 1N8OB 2L6OA 2QAAA 4NA9H 1GVZA 5EQQA 3K9XB 1WQVH 1YCPM 2IPHA 2PHBA 3W94A 3A81A 2G5NA 3QN7A 3D62A 1S6HA 1P2JA 3D49H 4XE4A 4X2VA 3F6UH 5C0UA 1UK2A 1KTSB 4I33A 1L1NA 1O3DA 2ALVA 1SKYE 1QRXA 3RM0H 3SV2H 1GVLA 2VIWA 2XWAA 3MNBA 1HAPH 1D6RA 1GHYH 1HXEH 2GCHF 1PPBH 4AFSA 1ELGA 1ELFA 3SGBE 1G37A 5FBIA 2EA3A 2GGVB 3BTQE 3KYGA 4D9RA 1O2SA 2G00A 1F0SA 2JH6D 2WPIS 4UFEH 1BZXE 4CHAC 2ZG0H 1C1WH 1D4PB 1P11E 4IS5A 2ZHEH 4AC9A 3A88A 5C20A 3UR9A 2ZGBH 2HWLB 3E91A 4ABFA 3GISB 2ZDLA 1VCPA 1O34A 5A09A 2DUCA 1GDNA 3H5CB 1P03A 1K1NA 1C2EA 3PM3A 7GCHF 3OAAD 1GJAB 4PROA 2CHAC 1UCYK 2Y80A 1FMGA 1EB2A 5AF9H 1P0SH 1E34B 3QLPH 2BLQA 4DT4A 1C2IA 3SNEA 2H5DA 2BVRH 2AGGX 1ID5H 3MNXA 1GBHA 1C5WB 2KX4A 6GCHF 5FCKA 4ESTE 4D76A 1AWFH 1A5IA 1BRAA 1CGHA 2ZQ2A 1O33A 3Q76A 3S9BA 3E0NB 3KIDU 3SN8A 1O2NA 1QJ7B 2AH4X 2GVFA 2ODQA 3O8DA 3A86A 1S83A 1W0YH 2P93A 4YESB 1YBWA 2J98B 4IW4E 2HALA 2HNTC 5HXFA 1PYTD 3SUDA 5I46H 1ELEE 2KCOA 1Y3VA 1ZMJA 1BA8B 1GBIA 2O8TA 1MABB 4YO9A 4ABEA 1AE8H 1MCVA 1C4U2 3M5OA 1MTWA 1GHAF 4ZUHA 3RMOH 3RU4T 2FOAA 1TBRH 1W7GH 1OKXA 2VB0A 1BBRK 3A8BA 1D3DB 1YCPH 3DFLA 2Z9JA 3VGCB 2AGEX 3GY7A 2A5IA 3I77A 2VH6A 2BX4A 1YC0A 3K6YA 2PKSB 1TNIA 4NIVA 1KY9A 1O30A 4WMDA 2CMYA 3ODFA 2A4GA 1FZZA 5T6DA 3P95A 2BDYA 2ZFPH 2YMSB 1F0RA 3SNDA 5EXLA 1G32B 3DHKH 3SV7A 1QL8A 1HUTH 3LPRA 2ZZUH 8LPRA 4DIHH 2IJOB 3URCA 3IITA 4BTTB 1YP9A 1MKXK 1KTTB 1Y59T 3PRBA 2H5CA 3L3TA 3EA7A 4TSFD 1JIRA 2ZQ1A 3KQBA 1TOCB 2A32A 1ORFA 4R0IA 5EXMA 1AFQB 1Z7KA 3FP7E 5LH8A 4H42U 4E7NA 2BM2A 1HAZB 1YPJH 2XCNA 1EOLA 1P3EA 1GBKA 4Y8ZA 1RTKA 3LGWA 5E0HA 3MQKC 3UNQA 1GJ7B 1C1NA 2P8OC 4ZH8A 1O2GH 1OP2A 1WUNH 1G36A 1ELBA 3M5MA 1EJMA 4NCYA 3QGJA 1ELTA 4FXGH 9ESTA 4NSVA 2ZDAH 2I6SA 4J1YA 5K0HA 1MTNB 1Q2WA 4GCHF 1LVOA 2XBXA 2OQ5A 3TLOA 4CH8B 4H4FA 3F2GA 1SGFG 2G81E 3TU7H 4ABGA 1O38A 1ZPCA 2QYIA 1BTXA 1GBTA 4FUHA 1QQUA 2P3UB 1V2LT 1VITH 1XUFA 5JBCS 1G9IE 5EW2H 3EYDA 5DP6A 3KYFA 2SGAA 2BD4A 4DVAU 5B6OA 1AU8A 2J34A 3BTFE 4NZQA 1O2VA 2ZIQH 4DOQA 4Q80A 2WYJA 1PPFE 1UTJA 4BAOB 1PPCE 3G01A 2C93B 2GKVE 1WAYB 5CHAB 4NIXA 1GJCB 1N8OC 1FAXA 1MTVA 1Q31A 1DWBH 1K1JA 4K3JA 2ODYB 3ZV8A 4AFZA 3AW1A 2KFWA 2R9PA 3BG8A 1G3BA 4H6SB 4Y11E 1CE5A 7LPRA 2KM0A 4CRDA 2W6JD 2GZ9A 5EPNA 2AERH 1W10U 3FP8E 3V13A 4LZ4B 1GJ5H 3VXFH 4A6LA 4CH2B 1OXGA 4YZUA 3BIUH 1EX3A 3ZIAD 1C1TA 1P2IA 1S85A 2ZU3A 4NIWA 4SGAE 1T4UH 3FANA 5A0CA 1LHCH 1IQGA 2OLGA 1Z6EA 2B8OH 1C5PA 1VKYA 2BQ7B 1O2TA 4XRNA 3A8CA 1V2VT 1SGFA 1P06A 3MH7A 1BTUA 3MNCA 2F43B 5EXNA 2ZHDA 2PV9B 1UTPA 1CVWH 1TLDA 3CP7A 2ZFQH 4B71A 9LPRA 3A7WA 1L0ZA 4B74A 1C5MD 2Y6TA 1OWDA 1QB9A 3BEIB 4FVBA 1F92A 4JK5A 1DLEA 4JMYA 2Q6GA 2Q6FA 4K5ZA 4UEHH 4X0WU 1QTFA 4CRGA 5T1VA 3O8CA 4GVUA 2PTCE 4OM9A 3EGKH 3V7TA 4UFDH 3SUFA 2FYRA 1SOTA 1DUEA 1T8OA 4DW2U 2R3UA 2ZTZA 5EIYA 4CBOA 4Y7BA 3SUEA 3BTKE 3M7TA 2H1UA 2D1JA 1GHWH 2GTBA 5C5OA 5EW1H 5HYOA 1FN8A 2FXRA 3A85A 1SG8B 3C27B 1SSXA 4ZXYH 1T4VH 1C5XB 1O2LA 1O2PA 2IPQX 4CRAA 3MOCA 1KXEA 2M5TA 1ESBA 4FOUC 4X6MA 5EQSA 3WWFA 1P57B 5L2YH 3U69H 4DGJA 2ZPRA 3M36A 3T5FH 2Z94A 3SU6A 1FV9A 1TONA 2J38A 3KQDA 4AB9A 1HNEE 1C1SA 2BDCA 1SC8U 2ILNA 4ZKOU 1GDQA 1SL3A 1MAYA 1LVYA 1P2MA 4GHQA 1SVPA 3GDVA 5F53A 2GP9B 3H7OA 3ZZ4A 3MO3A 1AY6H 3M7QA 4HFPB 6CHAB 1QBNA 3SU3A 1ZRBA 2TRMA 1GG6C 1YWUA 5B6LA 1D3TB 2WYGA 2SGPE 1XUHA 1A2CH 3GY8A 3UIRA 1QL9A 1O3JA 3AASA 1BOQA 1UVOA 4I32A 5JYIA 1GHAG 2FI5E 3OE7D 3VGCC 1KYNA 1YPMH 2QN5T 3RXSA 4BAMB 2FWWA 2OUAA 4X6OA 4FU7A 1O2YA 3TH3H 2PKSC 1KXBA 4UD9H 1O39A 4K60A 1DE7H 1KDQA 4QT8C 2YMSC 5C3NA 2B7DH 4RT1A 1TBQH 4IN1A 2NU3E 3NCLA 2JETB 1ZRKA 4WMEA 4ZKNU 4I8JA 4ZHMU 2V35A 1G3CA 1XUKA 5C1XA 5GNDA 2OP9A 1K1MA 4X8SH 4NIYA 4AORA 3UNSA 1V2OT 2ZF0H 3UB0A 1TPSA 3ZZ8A 4AZ2B 2V3HH 2Z9IA 3UUZA 1BITA 4WVPE 1NPMA 2EI6A 2ZGXH 4RKJB 1GJ6A 1TE0A 1BRBE 1AFQC 1G2LA 3QZQA 3RC4A 4KP0A 2BDIA 1Y5AT 3OEED 4Y6DA 4BXWA 5IK2D 1Y8TA 4ZKSU 1C5OH 2RG3A 4O97A 3M3TA 2G4TA 1G30B 1NBMD 3A7XA 4MPXA 1TMUH 2HOBA 3FFGA 4KTSA 1T8NA 1G2MA 3ITIA 1V2PT 1BTHH 3OYPA 4HI3A 3W95A 1C9TA 3OX7U 4P02A 1ZTKA 1FN6A 3R3GB 3KL6A 4OS6A 1NU9A 1UCYH 2BDGA 1DVAH 3FZZA 1O5AB 1VITG 5F03A 1PPZA 1LKAA 1PFXC 3D23A 1F2SE 4OS5A 2CF8H 2KCPA 4IC6A 4NWLA 1W12U 4JZ1A 2EEKA 1BB0B 2H2ZA 4GCHG 2G8TA 1ARCA 1CU1A 1SGYE 3LC3A 1VGCB 2AHME 1NU7B 2CXVA 2FZZA 2KAIA 2FM2A 1TGNA 4O9VA 1DY9A 1GBCA 3TGJE 1FJSA 5DP5A 1HAVA 2F4LA 1C5LH 2UWLA 4B76A 1QQ4A 1DS2E 1QB6A 5CHAC 2QC2A 1WBGB 2AIQA 1VR1H 1ZLRA 3PLBA 3Q3KA 2J98A 4FUBA 4INLA 2F9BH 3SZEA 2BDHA 4GUXA 1PQ8A 3H7TA 4Y0ZE 4NSYA 5EOKA 1CA8B 1YM0A 1IQLA 4JZDH 1ZSLA 1UTQA 3EAJA 1ARBA 1BMMH 2RDLA 1GBDA 1KSNA 2PR3A 1TQ0B 3ZZDA 1BBRH 5AFZH 1P2KA 3RXDA 4MPVA 4TY6A 1KIGH 1H9IE 1H1BA 1H9HE 4K8BA 1P02A 3LGVA 1GMDG 3M7UA 3E90B 1GMHF 1ZJKA 1SGCA 1W11U 5HM9A 3U9AH 2FI3E 1NFXA 2QXIA 1LKBA 3JZ2B 3T26A 2BMGB 3SJ9A 3SO3A 3K2UA 3CENA 3GY2A 2AYWA 1BTZA 1GI2A 2A4RA 4OS7A 4UDWH 1WTHD 2XCFA 4FETA 1MKXH 3GCNA 3UOPA 4MPUA 1DPOA 2HNTF 2OK5A 1GDUA 5C1UA 1J14A 1NS3A 1S0RA 2FYQA 1EZXC 3BTEE 1GMCG 3OY6U 5LPFA 2IOTA 1C5TA 1V2RT 4E7RG 4ISIH 1DY8A 1P2OA 2PLXA 1IHSH 1LCYA 1HYLA 1FLEE 1B5GH 2GMTC 2XYAA 4U32A 1SOZA 2ZFFH 3STJA 3S7KB 2NWNA 5L2ZH 1HJAB 4JYTA 5DP4A 3KN2A 3DD2H 3RXLA 2NU2E 3RU4D 3P6ZB 5CHBA 2P3FH 1EOJA 3KQCA 1BIOA 2C90B 1AKSB 1CA0B 3DSOA 2ZTYA 4XOJA 1GBLA 4CR9A 2BYAX 3ZZ7A 3MU8A 4JZIA 3NRLA 2UUYA 1P10A 1KXAA 4HZHA 3LGYA 5GCHF 3A84A 3RXOA 5DSFA 5F8XA 2BY9X 3ZVAA 1OS8A 4ABDA 5A8YA 2ZU5A 2V7QD 4KELA 4JZEH 3TK9A 4INKA 1NC6A 2PFEA 2PKAB 2GD4B 1J15A 4ISLA 5J4QA 1INCA 1MU8B 3GCHC 3STIA 2THFB 3RXUA 3SI3H 1T7CA 1SB1H 1YPHE 3PLPA 2BQ6B 1V2QT 1W2KH 1D3QB 2F9VA 1WDIA 4NZLA 2ZCLP 3KGPA 4X1SU 5JBBS 2ZWLH 3TJOA 2A4OA 1E37B 3WY8A 5DP9A 1UVPA 2A5KA 2GCTC 1AHTH 5J4SA 1O3FA 1UVUH 2Q6DA 2Y82A 2ZI2H 1HV7A 3TIUA 1EJAA 2WPJS 2QXGA 2ZHQH 8GCHG 2JETC 1YY3A 4ZKRU 2IN2A 1JWTA 1GHVH 3BTME 4KKDA 3ZVGA 2ZHWH 1Y5BT 1IOEA 3BTWE 4OS1A 2B0FA 3E1XB 1NFUA 1SBWA 4U01A 1FY5A 4A1XA 2ZFRH 3F0OA 1QBOA 4MNVA 1F0TA 1DLKB 2VWLA 1F0UA 1LVBA 3E8LA 3RXJA 1UTMA 2BD3A 2VVCA 3PMHB 2XXLA 4KTUA 5DGJA 5GJ4B 3VFEA 3MI4A 2JH0D 1Z71A 4TWYA 4DCDA 3U8RH 3KNXA 4Q4LA 2YOLA 4X8TH 3ZYEA 1HAGE 4WJG2 2J4IA 2SNWA 3LH1A 2B9LA 1LO6A 1ESAA 5FPSA 1ZR0A 1RFNA 1Y3WA 4I8HA 2BY6X 3SV6A 1C2JA 3SW2B 2EI7A 1PPHE 5SGAE 3LGIA 1GHXH 2BD9A 1BMLA 2XRCA 4HGCA 5FX6A 3LONA 1XUIA 1RTLA 3DA9B 1O3HA 3UWIA 5A8XA 1HAIH 2JJ2D 3U98H 2BD5A 5H4IB 1C5ZB 1G3EA 1BTYA 1GI8B 2WHXA 4WY3A 2ZEBA 3F9HA 1ETRH 1VGCC 4ASHA 4B2BA 4HG6A 2XNIA 1Z8GA 1GBBA 2KR7A 2XOKD 1O5EH 1YYY1 2D8WA 1YLNA 3PTBA 3KCGH 1LVMA 1ESTA 1CQQA 3OFND 5G4BA 1GJ9B 1DWEH 2A1DB 1FY4A 4BTIB 2FOMB 3DCLA 4Y0YE 1Z1IA 1MUEB 1O35A 4TPYA 4VGCB 3DT0H 2FEQH 4YTAA 1LPZB 1C2DA 2FOCA 3VB7A 4TWWA 1O5GH 2FP7B 1GGDB 1K28D 4AG1A 3OTJE 3RMMH 1O5FH 1P04A 4D8NA 3M37A 1QURH 5C1YA 4ABAA 1RTFB 2OC7A 3C1KA 2QF5A 4AB8A 1AGJA 1PPGE 3ZVDA 4D9QA 1ELVA 1O37A 4BAKB 4JK6A 2OXSA 4I31A 2PP6A 1MQ5A 3F2FA 1K1OA 1TALA 5C17A 4I8LA 2QIQA 2ZPQA 3A7YA 4A92A 3BEUA 1GBJA 5LGOA 2FX6A 3PLKA 1GMHG 1BHXB 3EA8A 2J5UA 2AIPA 1V2WT 3R0FA 1AD8H 5FCRA 1FUJA 2QGRA 1OWIA 1BT7A 1AE5A 2XC0A 1D3PB 3TH4H 1GJ8B 1TPOA 3URDA 2HVXA 1NY22 1MD7A 3N99A 2BLVA 1WOFA 2CN0H 1BTWA 3RXIA 1NZQH 1NM6A 2ZTXA 3NXPA 1TFXA 4Q7ZA 2ZU1A 1GCTC 4TT3D 3SJIA 5E0JA 3B23B 1T32A 3P17H 1HIAB 1EXFA 1K0HA 2DE9A 1J9CH 2WSSD 4BAQB 4K2YA 5FAHA 1DITH 1QJ1B 2FLRH 2UWPA 1HJAC 1V2UT 3M3VA 1EATA 3FP6E 1GVKB 1VITF 1QL7A 2M2AA 3MMGA 1GI1A 3BN9A 1EAWA 1CA0C 3SU0A 1TNGA 3UQVA 2HLDD 2NU0E 1RJXB 1TABE 3ATWA 1AWHB 3FO8D 1N6XA 1C1MA 1AZ8A 2FOFA 2AS9A 3VB3A 1KXCA 5AVDA 1SLUB 1A0LA 1JMOH 1V2JT 5GCHG 4Z0KA 1O2JA 2R0LA 2AMQA 2F3CE 1IQJA 3IG6B 2ZPSA 4AG2A 5EJ1A 3BTTE 1L1JA 2Z3EA 3FZDA 4F48B 3AK5A 2J94A 1S6FA 1ACBE 1O3IA 1XVOA 2Z9GA 2ZA5A 4UFFH 1XXDA 2EI8A 4XFQA 1EJNA 3LDXH 2QF3A 3P8OA 5EPYA 1C5NH 3U28C 1E36B 4Z6AH 2GDDA 3ODDA 3I29A 2ZECA 3P8FA 2JDID 2G52A 3QWCH 3HATH 1GI9B 2UUJB 3RXTA 3WW7A 2ZGJA 4Y8YA 1O2MA 2W7SA 2W6ID 1MTSA 4LZ1H 3VXEH 4E05H 4B1TA 3LH3A 2YNBA 1EZSC 2XC5A 4B6EA 3QO6A 5JBTA 1GI4A 4AGJA 3EE7A 2CF9H 3MWIU 3LJOA 3SUGA 4DY7B 4Y71A 2VIQA 1GMDF 3U8TH 3EDXB 3SJKA 1UK4A 1KLIH 1IQNA 3M5LA 1SQOA 3MH4A 3MTYA 3RLWH 1O3PB 1AI8H 2GZ7A 2XW9A 1LTOA 3GY4A 1XVMA 3UQOA 1CHOG 4MPWA 4CRFA 1SGQE 3SGQE 4FUGA 3UPEA 1M9UA 2SNVA 1QY6A 1KXFA 5F8TA 2AFQB 4OGXA 1SGEE 5LPEA 2A7HA 1C5RA 1YLDA 1A61H 1E1QD 1GJ4H 1C5VA 1GMCF 1UMAH 1B7XB 2A0QB 2PTNA 2BOKA 3ZZ3A 4X8UH 1JRTA 2KZ4A 2D2DA 2ZKSA 5T3HA 1AB9B 4WMFA 2QA9E 4YOGA 3TH2H 1ZGIA 1YKTA 2Z6BD 1ZGVA 1TA6A 3SYJA 1QB1A 1MQ6A 3SHCH 2FODA 2OTVA 2QY0B 3ZVBA 1PQ5A 4BANB 1HAXB 3LT3A 1H4WA 2WV9A 3A8AA 1ELAA 1NTPA 1UTKA 1HLTH 1Z1JA 2FLBH 3SQEE 2P16A 2HPQH 2BOHB 3NK8A 1O3OA 1RIWB 2ZU2A 1BUIA 3GDSA 4X1RU 5EODA 3RXKA 1AKSA 2KCYA 3A7TA 1EZQA 1IQEA 2ZCKP 4OS2A 2GZ8A 4ZAEA 1PPEE 2CJIA 3KEEA 1GGDC 5FPTA 4B75A 3UNRA 1ZYOA 1ZOMA 3V3MA 1EASA 2W3KA 5BPEA 1J16A 1NRQH 1NN6A 1T31A 2CK3D 1XKBC 1BCUH 2Y81A 1P3CA 1C1OA 3MU0A 3PB1E 4P00A 3S9CA 3HK3B 1XKAC 2QF4A 1C2MA 4YLQH 3GYMA 1FNIA 4ABIA 1WSSH 2RFKC 2Y5FA 1FX0B 1Z8IB 3HKIB 1YPKH 1OPHB 1JBUH 1V2ST 2ODPA 1B0EA 2VWOA 3E0PB 8GCHF 1XM1A 3SNAA 1DM4B 1TGCA 2LNCA 2VWMA 2VWNA 1C2GA 1BDAA 1QNJA 3NZIA 3PMBB 2JIZD 1F7ZA 2K8IA
chains in the Genus database with same CATH topology
4TY7A 3ZYDA 2GT8A 3SBKA 3HKJB 1UK3A 4RSPA 4LXBH 1O2OA 4A1VA 5EU8A 1JOUB 3SV8A 1MKWH 4DIIH 1A7SA 1MZDA 4F49A 1O2KA 3M35A 2Y7ZA 2SFAA 3F1SB 1TNKA 3GDUA 3SU5A 4B2AA 2O8MA 1OWKA 2BQWB 4GAWA 3VEQB 3E6PH 3RUOA 4AX9H 1QRZA 4Q2KA 1L4ZA 3F9FA 1MD8A 1S5SA 1UJ1A 4CREA 5K7RA 1K9OE 1GWAA 3E3TA 3PYHA 1L2EA 1MTNC 1CT4E 3PWBA 3M5NA 4RKOB 4BNRA 5FBEA 1C5QA 4ISOA 1SHHB 1DICA 2ANWA 2F9OA 1K1IA 1DSUA 1JXPA 3MU5A 5I25A 1QR3E 1TNJA 3UWJH 2A45B 1L4DA 3ZZCA 1VZQH 1ANCA 4NFFA 5T6FA 4B2CA 4X8VH 4GHTA 2FDAA 2FESH 2P3TB 3O8BA 3PMAB 1P2NA 1BBRE 1O2QA 4UFGH 1BJVA 3RXMA 1EPTB 1ZHRA 1GHZA 1CO7E 4BXSA 3P70B 4JYVH 3RXHA 2ZHFH 3TITA 5DP7A 1UHBB 1G3DA 2BX3A 1HXFH 1ANDA 4FUDA 1BJUA 1GCDA 1TB6H 2ZFSA 4X1PU 4NGAH 3RM2H 2ASUB 5EQRA 3QTVH 1ABJH 3AAVA 3Q3XA 2BVSH 2CGAA 1HGTH 1TIOA 1FAKH 1OYTH 3VB5A 1SLVB 4ZHAA 1ZJDA 4MTBA 2Y5HA 7KMEH 2VIOA 3TJNA 2O8LA 1DSTA 4WF8A 1FONA 1VJAU 1AUTC 1V6DA 4FUEA 2XTTB 1GBMA 2ULLA 1IQIA 1SHYA 2F83A 2R3YA 3SORA 2ZCHP 1QA0A 1TNLA 2FS9A 2HNTE 2BD7A 3TPIZ 2P59A 1AVGH 2R2WU 2C8WB 4IN2A 3PTNA 1LHFH 4Y76A 1SGPE 2A4QA 3S7HB 2WPLS 2LPRA 2BDAA 4LOYH 1RRKA 1QBVH 1QA7A 1IHTH 1O2UA 2OC1A 1PJPA 3QK1A 3SU1A 3RXCA 3MO9A 2TGTA 3RXEA 3UFAA 1C5SA 3NKKA 2GT7A 3RMNH 2QF0A 5E2OA 1JIMA 5T6GA 4NWKA 3ZZAA 3GCOA 2WUBA 5A0BA 1TPPA 2GX4A 1NFWA 4MVNA 1A0HB 4Y79A 2P8OB 2VIDA 4YT6H 5DG6A 4JYUH 6CHAC 4ISHH 1ZHMA 3SNCA 5DJ7A 2WPHS 1TGSZ 1UO6A 1P12E 1LQDB 1QRWA 1U6QA 1B0FA 2NU4E 4CR5A 3T2NA 3RXFA 1MTUA 4GSOA 1EQ9A 4YOIA 1ANEA 1HJ8A 2ZDVH 5AFYH 1P01A 5ESBA 3T28A 4XBCA 3S0NA 3SJOA 3BTHE 3BG4B 3LIWA 2PSYA 1E38B 3VB4A 4MNXA 1TQ7B 4AFUA 3PV4A 1DDJA 4IBLH 1C4Y2 1KLTA 1C4V2 1TRYA 4O3UA 1BQYA 1ZZZA 3UY9A 5L30H 2BTCE 1IQMA 3ATMA 4XSKU 1HPGA 3PO1B 3SOSA 5JPMH 2BZAA 3GICB 1V2KT 1J8AA 1CT0E 1KDQB 2QXHA 2ZFTA 1O2WA 3NUMA 4XBDA 2WINI 1Y5UT 1RS0A 1W13U 2PW8H 1MKWK 1AN1E 2Y7XA 1CHOF 2W7UA 2BLOA 4AN7A 1EAIA 5DP8A 1NO9H 5TCAA 3UR6A 3QZRA 1GJDB 4UE7H 1BRUP 3BF6H 1QIXB 1V2MT 3GY5A 3LKWA 1O2ZA 4LK4A 2OCVB 3A7VA 3IWMA 5BRRE 3TJUA 3PMJA 5E8EH 3GCTG 1C1QA 1MH0A 2VIPA 5LPRA 1T8LA 3BTGE 7ESTE 1H8IH 3SV9A 1C2KA 1ABIH 2HPPH 1K1LA 3V0XA 3CS0A 1WYKA 1ZTJA 1N6YA 1DOJA 4O03A 2OC8A 3N7OA 2I6QA 1C1PA 1EKBB 4ABJA 1QCPA 4AOQA 1NROH 1PQAA 1XX9A 4XDEA 2V0BA 1FPHH 3VB6A 1DWCH 3PROA 1TYNA 4WXIA 2Z3DA 2ZDNA 1FY3A 3BEFB 3MH6A 2XBYA 1X7AC 1Z8RA 2TBSA 6ESTA 1Y3XA 1OP0A 2R2MB 3GY3A 4F4OC 3SGAE 1NFYA 2WV4A 1K2I1 3P8NA 5JB9S 3BSQA 4R8TB 2DE8A 3SZNA 1QJ6B 1C9PA 2BDBA 1F5KU 4I8KA 1O2HA 2KAIB 1ZMLA 1HBTH 1OWHA 2C3SA 2OC0A 3UTUH 1WTGH 2AEIH 3VPKA 2W26A 5GXPA 1MAXA 2Y5GA 5HGGA 1GI7B 2C4FH 1O32A 1HAVB 1MBMA 1TOMH 2NU1E 4YT7H 4WH6A 2OBQA 1A3BH 1EPTC 4MG3A 4DG4A 1GHBG 1AVXA 3SQHE 2D26C 1NRSH 4GLYA 5DK1A 1O3BA 3Q3YA 2XWBI 2BXTH 3TNTA 1ELCA 1UVSH 2ZGCA 3A83A 1ZMNA 1SGIB 3ZZBA 3ZZ9A 1K22H 3SU2A 1O3AA 1JRSA 1P05A 3TGIE 1GG6B 5DPAA 2FMJA 1OWEA 1SGDE 4CBNA 5F8ZA 1HJ9A 3K65B 4E06H 4K8YA 1O3EA 1DANH 5IYTA 3ELAH 1VJ9U 3MU1A 2RCEA 3LJJA 3GY6A 2K1QA 3Q77A 3ZVEA 5CE1A 3ENSB 2H9HA 1O31A 4TPIZ 5IDKA 1TGTA 2G51A 5FXLA 2BZ6H 1HFDA 4I7YH 3ZVFA 1TGBA 2UWOA 1O0DH 3GOVB 1EB1H 1C5YB 1VCWA 4MNYA 1O3KA 1CGJE 2VU8E 3RC6A 2SGDE 3QGNB 1ETSH 8KME2 4CRCA 2WV5A 1DXPA 2FTLE 1YPHC 2TGAA 1YPGH 1Y3YA 4Q7XA 1BRCE 2XC4A 1CGIE 1CHGA 3MYWA 1OOKB 4A1TA 1HRTH 1O3NA 1CBWB 5L6NH 2AGIX 2H6MA 4WWYA 3LOXA 3GYLB 3RU4E 1UTNA 3LC5A 4Y7AA 3RXAA 2ALPA 4DJZB 1T8MA 3A82A 1S81A 3LGTA 1BHXF 3HK6B 1SFIA 4WH8A 1GJBB 4WXVA 4X2WA 1QFKH 1ZTLA 1YPEH 3A80A 3BV9B 5GIBA 1O5CB 1O2RA 3P92A 2ZDKA 2G4UA 2TGDA 2ZP0H 2Z7FE 1V3XA 1C2FA 1WQSA 2BHGA 3MHWU 1LQEA 3I78A 2GV7A 1LPGB 1MU6B 1SGNE 4FUJA 1VCQA 1F5LA 1S0QA 4JZFH 5GWZA 3BG4C 1THRH 2OD3B 2XBWA 4NG9H 1K1PA 2PGBB 2RA0A 1Z8JB 1FDPA 3HPTB 2ANYA 3B9FH 3T62A 2Z9LA 2JH5D 3PO1C 4U2WA 1EPTA 5PTPA 1GPZA 1TPAE 2FIRH 4IGDA 4X2XA 2VH0A 4A7IB 1O3GA 1TX7A 3FVFB 1UHBA 4D7GA 2FI4E 2O9QA 1NESE 3ZV9A 1NRRH 3P8GA 2PUQH 4THNH 1DX5M 3U1IB 1HAOH 3L33A 5FPYA 2VVUA 4BTUB 2VINA 3AW0A 5JBAS 3SU4A 1NRPH 3M61U 4FU8A 5ETXA 1GI6A 2BLWA 2ZU4A 2OQUA 2EC9H 4K1EA 4Y8XA 3MH5A 4ZHLU 1SGRE 1LHGH 3MNSA 5C5NA 3O8RA 1DUAA 2ZNKH 3RMLH 5TJXA 4AGKA 1OX1A 1THSH 2OINA 4BAHB 2GCHG 5GDSH 1FY8E 1O3MA 1KXDA 1YPLH 1BMAA 1AMHA 1TNHA 5FHTA 2H9EH 5C67A 4NA8A 2PWXA 4AFQA 4X6PA 2A7JA 4NFEA 2FOBA 1C1RA 3ZZ5A 1D6WA 1SGTA 1TAWA 5FX5A 3TGKE 2UUFB 1J17T 3K6ZA 7GCHG 2J92A 1DWDH 1RXPA 1FIZA 1KLJH 2TPIZ 3MO6A 2A5AA 4B73A 1WU1A 1NRNH 3EA9A 2W5EA 2O8WA 2BD2A 1XXFA 2GMTB 3RXRA 1RGQA 1FPCH 3U1JB 3T29A 1SR5C 4MDSA 4K1SA 2WPKS 4VGCC 4MNWA 1H8DH 5TCCA 3NWUA 5CMXH 3RXGA 3T27A 1ANBA 4D7FA 1XUGA 2F9UA 6GCHG 1AZZA 2P95A 4ZXXH 1BMNH 1ETTH 1RD3B 4IMQA 4INHA 2ESTE 4I8GA 2PKAA 1GI5A 3ZVCA 4YM9A 2FOHA 4BOHA 5F6MA 3QTOH 1A1RA 1HAHH 2BD8A 1A4WH 1YLCA 3S9AA 1S82A 5C2ZA 1E35B 4Q7YA 3S69A 6LPRA 1QGFA 2BVXH 2VIVA 1GBAA 1GL0E 3GCHB 1C2LA 2ANKH 1DT2A 4ISNA 4X6NA 3LGUA 1D9IA 2FPZA 4GPGA 1V2NT 1Y3UA 1SLWB 2VVVA 3HGNA 1UVTH 4U30A 2VGCB 2ZGHA 1YCPK 1AQ7A 1TX6A 2C8YB 1FIWA 2J9NA 1GBFA 1UTLM 1ELDE 5JDUB 2HRVA 2GCTB 4A5TS 4DT7B 4AYYB 1O3CA 3TVJB 1IQFA 1FQ3A 3ATLA 1W8BH 3A87A 1C1VH 3SNBA 2P94A 2ZC9H 3EQ0H 2TGPZ 1GI0A 1ZPBA 5GPIB 1MMJN 5ABWA 1P09A 1ZHPA 4YOJA 1UCYE 1BTPA 5EGMA 2BB4A 2AMPA 3GCTF 3AVZA 1SLXB 4FU9A 1P9UA 1FY1A 3F9EA 1IAUA 2FS8A 1LPKB 1GI3A 4X1NU 1FXYA 1LDTT 3MFJA 1CBWC 2WUCA 1O5DH 3DFJA 4CHAB 2J2UA 1AUJA 2QXJA 1ZPZA 3A89A 1P9SA 2BY8X 1W14U 4FVDA 3CS7A 1XUJA 2FOEA 2PUXB 2CV3A 1TMTH 4AYVB 2A2QH 3BTDE 1LHDH 1V2TT 4FUCA 3JZ1B 4ABHA 2V3OH 1TRNA 2A7CA 1WCZA 2CHAB 5DO4H 3PWCA 1O5BB 1GBEA 4MLFB 1O2IA 3OY5U 4OS4A 4M7GA 1EZUC 2J95A 2OBOA 3TK5A 3OSYA 1P8VC 1YGCH 1K21H 4J2YB 3HGPA 4ABBA 1SI5H 3V12A 4O3TA 1Z6JH 5JB8S 4K69A 1TBZH 5A2MH 2ZO3H 1GHBF 4Y10E 2Z3CA 3D65E 4YLUA 1O2XA 2FO9A 3L6PA 1AFEH 3B8JA 1HCGA 3RXVA 2G5VA 3SI4H 3SHAH 5DP3A 3E16B 2F91A 2RA3A 3OU0A 5A0AE 4UONA 4DURA 3MU4A 2G55A 2C8ZB 1THPB 1LMWB 2A2XH 1OYQA 2SGFE 2GV6A 2Z9KA 2QV1A 4KGAA 1C2HA 1TX8A 3RXBA 4FUFA 1HDTH 3M3SA 2F9NA 4IMZA 2QCYA 1SPJA 2BY5X 2SGEE 1N1LA 1EAUA 1P2QA 3TJVA 3RC5A 2HGTH 3RP2A 3AAUA 1FI8A 1YF4A 2FOGA 1ZSKA 1LHEH 3ESTA 1SQAA 3F9GA 3UOUA 1A5GH 1MBQA 1C1UH 1H9LB 3UREA 2A31A 2PSXA 3T25A 1E0FD 4ZMAH 3TK6A 1F5RA 2FX4A 3KHVA 1IQKA 5HM2A 3TNSA 4RN6A 3ATIA 1EP5A 2Q1JA 5ESTE 3FAOA 1W7XH 1AO5A 2V6NA 1AB9C 3A7ZA 3QDZB 1PYTC 4H6TA 4TYDA 5HMAA 1A0JA 1EP6A 2VNTA 2B5TB 2C8XB 2XBVA 4JCNA 1DXWA 2GDEH 1HIAA 4CRBA 1Q3XA 3QX5H 2STAE 1UTOA 2ANMH 1A46H 1CT2E 4NA7A 2TIOA 2WPMS 1OSSA 3KQEA 3QUMP 1GCTB 1XMNB 1IQHA 5E2PA 2JKHA 5EG4A 3A8DA 1TMBH 3RDZA 1HAYB 2BY7X 4XBBA 5AHGH 1RIWC 1AVWA 3EE0B 2FTMA 3F68H 2BXUH 1AIXH 2VJ1A 1S84A 1DFPA 4MQAA 3SJ8A 1OWJA 4K1TA 1SMFE 1W0ZU 3U8OH 4X2YA 4ZROA 1ZSJA 5E0GA 2W3IA 1CSOE 3ZZ6A 2AMDA 3NPSA 4FUIA 1NT1A 2F9PA 1TWXB 4SGBE 8ESTE 1OP8A 1WV7H 2STBE 3RXPA 4IC5A 1MZAA 1HB0B 2R0KA 5DKMA 1W3CA 1C5UA 1PQ7A 3LU9B 4X1QU 4OGYA 3DUXH 1GL1A 3ATKA 1TA2A 1EAXA 5A8ZA 3RXQA 2H9TH 2PGQB 1SQTA 3KF2A 1TRMA 1SFQB 3RLYH 2SGQE 1O3LA 3Q00A 1EUFA 2UUKB 2YNAA 2ZDMA 1MCTA 1A3EH 1O36A 2VGCC 4HTCH 4KTCA 1A5HA 3BIVH 2HLCA 1QHRB 2O8UA 1N8OB 2QAAA 4NA9H 1GVZA 5EQQA 3K9XB 1WQVH 1YCPM 2IPHA 2PHBA 3W94A 3A81A 2G5NA 3QN7A 3D62A 1S6HA 1P2JA 3D49H 4XE4A 4X2VA 3F6UH 1UK2A 1KTSB 4I33A 1L1NA 1O3DA 2ALVA 1QRXA 3RM0H 3SV2H 1GVLA 2VIWA 2XWAA 3MNBA 1HAPH 1D6RA 1GHYH 1HXEH 2GCHF 1PPBH 4AFSA 1ELGA 1ELFA 3SGBE 1G37A 5FBIA 2EA3A 2GGVB 3BTQE 4D9RA 1O2SA 2G00A 1F0SA 2JH6D 2WPIS 4UFEH 1BZXE 4CHAC 2ZG0H 1C1WH 1D4PB 1P11E 4IS5A 2ZHEH 3A88A 5C20A 3UR9A 2ZGBH 2HWLB 3E91A 4ABFA 3GISB 2ZDLA 1VCPA 1O34A 5A09A 2DUCA 1GDNA 3H5CB 1P03A 1K1NA 1C2EA 3PM3A 7GCHF 1GJAB 4PROA 2CHAC 1UCYK 2Y80A 1FMGA 1EB2A 5AF9H 1P0SH 1E34B 3QLPH 2BLQA 1C2IA 3SNEA 2H5DA 2BVRH 2AGGX 1ID5H 3MNXA 1GBHA 1C5WB 6GCHF 5FCKA 4ESTE 4D76A 1AWFH 1A5IA 1BRAA 1CGHA 2ZQ2A 1O33A 3Q76A 3S9BA 3E0NB 3KIDU 3SN8A 1O2NA 1QJ7B 2AH4X 2GVFA 2ODQA 3O8DA 3A86A 1S83A 1W0YH 2P93A 4YESB 1YBWA 4IW4E 2HALA 2HNTC 5HXFA 1PYTD 3SUDA 5I46H 1ELEE 1Y3VA 1ZMJA 1BA8B 1GBIA 2O8TA 4YO9A 4ABEA 1AE8H 1MCVA