2ZQ2A

Exploring trypsin s3 pocket
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq2A02
2OUAA 1YCPK 3AAUA 3S69A 4GUXA 1DM4B 5F8XA 3D49H 4R0IA 3STJA 2GKVE 4WXIA 3SJOA 1B0EA 1PQ8A 1O36A 1YPLH 2RG3A 1ZPBA 2HGTH 1KXEA 3B23B 3M37A 3ENSB 1TGNA 2JH0D 1LDTT 4OS7A 4B1TA 5HM2A 1S5SA 4LK4A 3D62A 4CR9A 1TNKA 2ALPA 3PM3A 2R0KA 4FXGH 3SU0A 1ETRH 3M3TA 1K1PA 1PPFE 5JBBS 2C8XB 2GDEH 3GY2A 5DPAA 5DP7A 2F9BH 1OXGA 4D9RA 3MO9A 3MU8A 3UOPA 1MAYA 2ZPSA 3Q3KA 5ESTE 3RP2A 3A7TA 4YZUA 1EPTB 5F03A 2F83A 1V6DA 6ESTA 2WYJA 4X1QU 2C4FH 4ZHAA 1SGYE 1ZRBA 4HFPB 2J34A 4O3UA 1EZXC 3KF2A 5FAHA 1TQ0B 1AFQC 1O5CB 3SV6A 3ZZ8A 3PTNA 2A4GA 4X8VH 3A8CA 4CRBA 5A8ZA 1DS2E 1BRBE 1HRTH 1GL0E 1ZSLA 1QURH 2VVVA 2PGQB 3EA9A 2BD3A 2CF9H 2O8WA 2J2UA 1SGEE 5A8XA 4O03A 1CBWC 1LVYA 3TGJE 4TY6A 3SU2A 1GHZA 1CSOE 1WV7H 3A7YA 1GBMA 1FAXA 3SORA 1Z6JH 5C1XA 2EA3A 3QTVH 1K1OA 1MU6B 3RM2H 4KGAA 1O5FH 1C1PA 5GDSH 1C5WB 2ZPRA 1BDAA 6GCHF 4LOYH 8GCHF 2BZAA 1WCZA 1OYTH 5EPYA 5CMXH 2J4IA 4A1TA 3MYWA 2ESTE 1BMMH 2V35A 1C1SA 1A2CH 4PROA 1XUJA 5EOKA 2BQWB 1JMOH 2ZC9H 1C1UH 1UTLM 2IN2A 4R8TB 3SO3A 4KKDA 2HLCA 1SSXA 1CT2E 2XCNA 1ELBA 2FI4E 1K28D 1GBAA 1TBZH 4ZKRU 1O3DA 5GCHG 1QA7A 1O3GA 5TCCA 3DFLA 1YCPH 3FP7E 1AY6H 1EQ9A 1FUJA 1QBVH 2F91A 2SGDE 4X6PA 1JOUB 2GDDA 1J17T 2FM2A 3MH4A 4CBNA 5L30H 4ZKNU 4A7IB 1P2NA 4YESB 1PJPA 2VGCC 2ZDAH 1XUGA 3QLPH 1HLTH 1INCA 3R3GB 4FUFA 2OC1A 1TRNA 1EZSC 1DWEH 3LJOA 2ASUB 3ZZ9A 3BTWE 1P09A 3A80A 3RXFA 1A0HB 3RXCA 1O31A 3U8TH 1DPOA 5A8YA 1NESE 2FIRH 4O3TA 2NWNA 1PYTD 4JYVH 2BDHA 1ANBA 1BTHH 1G2MA 1UVPA 1TQ7B 4BNRA 5EW2H 1Z71A 3TJUA 1TWXB 1T32A 2TGAA 2HALA 5EODA 1EXFA 1O2HA 1P0SH 1VZQH 4OS5A 1F92A 3E6PH 4Y8XA 3TJNA 4B73A 5E2OA 1Y5UT 2BXTH 3TITA 4JMYA 1A5IA 1QHRB 4NA9H 4YLQH 4DG4A 3A7XA 3MU0A 1MMJN 2R2MB 1OSSA 4FUJA 3SV8A 3LPRA 3AVZA 3C27B 2ZCKP 3M7QA 5E0GA 1ZHPA 2FODA 1KDQB 1C5MD 4YOGA 2P95A 2BQ7B 1E0FD 1Y8TA 2BMGB 2J94A 4K8YA 1ACBE 1NT1A 4UEHH 4X2YA 1TBRH 2GZ8A 4HI3A 3I78A 1GBLA 4AYVB 3S9CA 1O5DH 5AFZH 3EA7A 2BYAX 2ZIQH 3I29A 2BY9X 4IMZA 2SGPE 2Y7ZA 1W13U 5JB8S 1AE5A 4ZROA 3RXDA 3SV9A 3GCTG 2H9HA 3LDXH 1W0YH 5GCHF 1C1WH 4MTBA 3RU4T 3A7VA 4GVUA 2ODPA 1C2GA 4XSKU 5FHTA 1BMAA 1FPHH 2OQ5A 4AX9H 3MH5A 4J2YB 2OXSA 1XVMA 1UK3A 4I8LA 2HPPH 1C2EA 2UUFB 4WH6A 2F9UA 4NA8A 1W7XH 2WV4A 2VVCA 5C3NA 1Z6EA 1ZTKA 1MAXA 5E8EH 2M5TA 1VITG 3TH2H 5K0HA 2O8MA 1FJSA 3MU4A 1YP9A 1UVUH 1TE0A 2F9VA 1NPMA 3LGTA 5LH8A 3ZV8A 2O8LA 1D3QB 2WPMS 1KIGH 4X1SU 1TAWA 2KAIA 3F68H 1ETSH 3VGCB 4B2BA 1EAXA 5C1YA 3CS0A 3PO1B 3GCHC 4NZLA 6CHAB 1K1IA 4VGCB 1OX1A 1TGTA 3A8DA 4OS1A 1GCTB 3TNSA 4CH8B 5C5NA 1O3MA 5DGJA 1IQLA 1AWHB 1W10U 3STIA 4TPYA 5DKMA 1HDTH 1HGTH 4ABAA 3RXPA 2FOFA 2ZGHA 3QX5H 1OPHB 4ZAEA 3MNBA 1UTNA 1DICA 3PWCA 2FYRA 2WPLS 3NPSA 3UPEA 1W2KH 1GHVH 1FY3A 3VB4A 2BXUH 1P2KA 5DP8A 1YGCH 1L1NA 1XKAC 1IHTH 1O3HA 1ZOMA 1ELEE 1UTJA 2J38A 1IQKA 2GX4A 7GCHG 1CA0B 1D6WA 1GBTA 4UONA 3ZVCA 3UWIA 4I8HA 5HYOA 3QUMP 1AIXH 1C5UA 1MTNB 1QB1A 2EI6A 2IJOB 2YNAA 4WMFA 3GCTF 2AGEX 1C5VA 3VFEA 2A5IA 1ANDA 1JRSA 2ULLA 2Z3DA 3SUEA 5DO4H 2ZEBA 2WINI 1K1MA 1TPPA 1C5RA 3IWMA 1YPJH 2VJ1A 3A84A 2CXVA 1SGDE 2ZPQA 3GICB 1A4WH 4UFDH 1QL8A 1DSUA 4BAHB 4BTUB 1DX5M 2I6QA 2GCTB 1PQ5A 1EAWA 3RXQA 2QV1A 3UR6A 1P12E 4NFEA 1QA0A 1SBWA 1P2QA 2THFB 4U32A 3M36A 3PTBA 1P2JA 2PWXA 1C5OH 1KTTB 2TGPZ 1VITF 2QXIA 4XBCA 1HJAC 3UR9A 2AMDA 3OY6U 3LONA 1O2VA 2VIPA 5EPNA 3RC4A 3TU7H 1ETTH 4LZ1H 3RXEA 2GV7A 4OS4A 3UY9A 4UE7H 3H5CB 1ABJH 4DURA 2PKSB 3L6PA 1C2HA 1MZDA 1P9SA 1VGCC 3A7ZA 2AH4X 4F49A 1O2JA 5E0JA 5K7RA 3RMNH 2ZU1A 4BTTB 2UWOA 4JK5A 4JYUH 1EJNA 1GJ9B 3FFGA 1O33A 3U8RH 2AEIH 2QXGA 1TNIA 4ZH8A 1Y3XA 1MD8A 2A2XH 2H1UA 3T26A 3RUOA 1HCGA 1G3DA 2ZGXH 5EXNA 5FPYA 3V13A 3ODFA 5F8ZA 1ZMLA 1FLEE 2A1DB 1A61H 1GI6A 1YPMH 3A83A 3QDZB 1S6FA 1KLJH 3ATMA 1BUIA 1V2WT 1GBIA 1ZGIA 1EZQA 2VU8E 1Z1IA 1O39A 3BF6H 4ISOA 1NRRH 2FWWA 3EYDA 1AFQB 1MCTA 1SGRE 2CN0H 2WUBA 3QGNB 2BDGA 4UFEH 4WMEA 1O5AB 2PSYA 7GCHF 1AHTH 3OX7U 1RJXB 2GV6A 3HPTB 1SG8B 1YPHC 2TGDA 4A1VA 2Z94A 3TK9A 1DVAH 2BVSH 5DP5A 1QIXB 1CBWB 1O2TA 3UFAA 1C5PA 7LPRA 2HNTE 1VJAU 3HKIB 1O3OA 4DJZB 1WQVH 1Y5AT 2Y81A 1GCDA 1O3FA 5FCRA 2BLQA 2SGFE 3DT0H 1SFIA 2FTLE 3UQOA 2QCYA 5BRRE 1OWEA 1L4DA 1OWKA 1UTMA 2P3UB 4A6LA 3KEEA 1NRQH 1F2SE 2QXHA 2J95A 4Y11E 4CRAA 1XUKA 4CH2B 1K22H 1O3JA 4BAOB 1DITH 4CRFA 1O30A 1KTSB 3URDA 4CR5A 2R3UA 4INLA 3LJJA 2OD3B 2ZU4A 1T8MA 3GDUA 1O2WA 4Y0ZE 3O8CA 4KTSA 1SOZA 2ZI2H 2FLBH 4NCYA 3VB7A 2A4OA 3K2UA 5FBEA 4JCNA 1KXAA 1C4U2 3SNEA 3SHCH 2ZHDA 3BG8A 1SQTA 2BD8A 3E3TA 1ZMNA 4BAQB 1O32A 4X0WU 2BVRH 1O5BB 1NM6A 1BTWA 1CHOG 5FPSA 4Q80A 5TJXA 1OOKB 2FTMA 2ZWLH 2G52A 1BRAA 2TBSA 1SB1H 3KL6A 2OP9A 1C5QA 4DIIH 2C8WB 1O2UA 4AYYB 2P16A 3ITIA 1LCYA 3M5NA 1Y59T 1SHYA 1FPCH 3GDSA 2PW8H 2ZNKH 1XVOA 2PSXA 4MPVA 1XX9A 3HK6B 3RMMH 1LMWB 1Q2WA 2W5EA 5FBIA 3GCOA 2VH0A 2SFAA 3GOVB 1V2UT 1AZ8A 3P95A 4LZ4B 4Y7BA 1MBMA 1P02A 3W95A 3RXBA 2VWNA 1MKWH 4H6TA 3RC6A 4XBDA 2WV5A 1AKSB 4XFQA 2Q6FA 4AG1A 2FX6A 2ZU2A 3T28A 3U98H 2XW9A 1NROH 3MWIU 3RXIA 1GBEA 3SQHE 3HKJB 2SNWA 4QT8C 3UNSA 1O3CA 4GCHG 3O8DA 1FIWA 3OTJE 4K5ZA 2P3FH 3GISB 5JPMH 1AVXA 3RMLH 1J15A 4WJG2 1O3PB 1ZHRA 3KQBA 3SHAH 1A3BH 2BLOA 3OY5U 3DA9B 1SLUB 4JZFH 1BTYA 2B9LA 3DD2H 1GMCG 2ZDLA 1ZMJA 4X8SH 5A2MH 1BTUA 1ANCA 1E37B 3BSQA 2BTCE 1SOTA 1O2IA 3KQCA 2P93A 3S0NA 4INKA 1GPZA 1HIAA 4X8UH 1SGQE 2W7SA 1UHBA 2FOBA 2CGAA 4E06H 3U9AH 3RXVA 1TONA 2ZFPH 1S6HA 4FU8A 1GMDF 4FVBA 2OLGA 2ZKSA 3K6YA 3OYPA 1SLWB 2Y5GA 3M61U 1HAOH 1XMNB 1FONA 3GY8A 4MVNA 2BD4A 1O2ZA 1CHOF 3A88A 1SQOA 2ZCHP 2G55A 1ELDE 1IAUA 3ZZAA 1V2ST 1UVTH 1ELFA 2NU0E 2PLXA 1Y5BT 9ESTA 3ZZ3A 1S85A 2ZU5A 1TA6A 1XKBC 2BY5X 1JRTA 2Z9JA 2O9QA 1ZLRA 1HXEH 3RC5A 1KXBA 2A32A 5C1UA 1RGQA 3TH4H 2XCFA 3TNTA 1Z8IB 1O2NA 3SV7A 1B5GH 3FZZA 1KLIH 5GWZA 1O2KA 1FI8A 4RKJB 3GCHB 4YOIA 1QTFA 3ZZ4A 1ZGVA 2SGEE 1TABE 4D9QA 1G32B 3ATLA 1Z1JA 4D8NA 1VITH 4MDSA 4KTCA 1O2XA 2C90B 4HGCA 1V2RT 5C2ZA 3ZZ5A 3KIDU 5L2YH 1ELTA 3CENA 1K1LA 4AORA 3SGQE 1UCYE 1FN6A 1S84A 1T8LA 3OU0A 1GJ5H 1NRSH 1SHHB 1FQ3A 1GJ4H 3BG4C 3PMBB 4GCHF 1TGCA 1FIZA 2BM2A 3BTQE 1ANEA 4NSYA 4HTCH 3BEIB 4DVAU 1ESBA 2HRVA 1IQJA 2Z9KA 3QZRA 4A1XA 3TGIE 3ZZBA 2AMPA 4FUGA 3T27A 1SI5H 2A2QH 5HMAA 4Z6AH 4ZHMU 1GMCF 3ZVAA 2ZFRH 2VIVA 4NIWA 1TNLA 3BTTE 4IBLH 2YNBA 1EX3A 1P05A 1V2TT 4ISHH 1D6RA 2G4UA 1KYNA 4I8GA 4U2WA 1GHAG 1LO6A 2PKAA 1D3PB 5A0CA 1DE7H 2PTNA 1ZJDA 3BN9A 2WPJS 2OTVA 1LPZB 4IC6A 4MPWA 1HXFH 1AZZA 1BMLA 1MTVA 1NTPA 2BD2A 2H9EH 3A81A 3ATIA 1ZRKA 3ZVFA 4ABHA 1FZZA 2D8WA 4UFGH 1GWAA 3FVFB 1BRCE 3E8LA 4JZIA 1QRXA 5TCAA 3SNBA 3E90B 3A8AA 1MU8B 2ZGCA 1OKXA 3NKKA 4WXVA 1N8OC 2RDLA 1IQMA 1HAYB 2Z9GA 1C1NA 1KXDA 1PQ7A 3P8FA 1HJAB 1ZTJA 2GMTC 1JBUH 1S83A 1W14U 3F9EA 2BZ6H 4ISIH 3E1XB 1LQEA 1SGTA 3ZVEA 1DXPA 2BDBA 1T31A 1H9HE 1HPGA 1MTUA 1VGCB 1DANH 3BTGE 3LGYA 3PYHA 3CP7A 5GPIB 1C9TA 2OQUA 2QAAA 4FUCA 1H8DH 5C20A 2FS9A 1O3AA 1C5YB 1HAXB 4Y10E 4X2XA 5BPEA 2P8OC 1EPTA 2GTBA 2VWLA 2GZ7A 1LHGH 2V0BA 1SGFA 3MH7A 1BOQA 2Z3EA 4K3JA 2H9TH 2BLVA 1EKBB 2ZU3A 3SU3A 1C2JA 2FOAA 2TIOA 3ZVDA 1OS8A 3M5LA 1LHEH 2FEQH 1AD8H 3LGIA 4GHQA 1W3CA 2OC7A 4I8KA 1UK2A 2BOHB 5H4IB 2F9PA 1AB9C 3UTUH 2VIWA 4E7NA 4ABFA 1TX6A 4Y8YA 5EXLA 1IQEA 1W7GH 1GL1A 2SNVA 1G2LA 2F9OA 1N6XA 1BBRE 2ZP0H 4GLYA 1TX8A 1KXCA 4X1RU 1QB6A 3PMJA 3V3MA 3F9FA 4MNYA 2GD4B 1QFKH 1O0DH 1GHAF 1EUFA 3F9GA 1O2PA 4THNH 1XUIA 1EOJA 2ZHWH 3RXGA 1YPGH 4Q7YA 5HXFA 3AW1A 1TNHA 1HBTH 3KQEA 5FX6A 2Q1JA 1SLXB 2WPIS 1K2I1 4DY7B 1HUTH 1TALA 1UTPA 3KQDA 1QR3E 1TNGA 2LNCA 1C1OA 1EAIA 1O3IA 1RXPA 2OC8A 4BXSA 2CMYA 5JDUB 2JETC 4X6NA 5JYIA 1V2LT 2XWBI 3KNXA 1MH0A 2A5AA 3AW0A 5J4SA 2GT7A 3FANA 1QGFA 1EJAA 1FXYA 1DWDH 5T6FA 2ZDMA 1OWJA 1D3DB 4IMQA 5JBTA 4XOJA 1NU7B 2QIQA 3FP6E 3TLOA 4B75A 1O3BA 1QRWA 2Y6TA 2JKHA 1GI9B 1PPCE 1DOJA 5AVDA 3UUZA 5DJ7A 1GI0A 1O2MA 5LGOA 1EATA 2GP9B 4HZHA 1NZQH 2Z9LA 1GI7B 3BTEE 3T5FH 3SU6A 1GI8B 3JZ2B 4AOQA 1BHXF 2SGAA 4SGAE 1O3EA 4TYDA 4JZDH 3Q3YA 4AFQA 3M35A 3SJ9A 1Z8JB 1ZTLA 3EE0B 1QJ1B 1V2KT 2ZG0H 3PMHB 4K1TA 3LC3A 2ANYA 4FUEA 3C1KA 1C4Y2 5GXPA 4GPGA 2UUKB 3BTDE 2HNTF 1NU9A 5HGGA 1C2FA 4JYTA 1VCQA 1F0TA 1ZJKA 1G36A 1GDUA 1GJ6A 1C1QA 2V6NA 4U30A 1H4WA 1RFNA 3A7WA 4X1PU 4GSOA 1WSSH 1YLCA 4O97A 2R0LA 1BMNH 2AGIX 1A3EH 2B8OH 1TIOA 1QY6A 2A45B 3SN8A 1UJ1A 2Y5FA 2QF3A 1C2KA 1KY9A 1K9OE 1YPHE 1NY22 3BTHE 3SU5A 2W3KA 1YPEH 4I8JA 3VB6A 5ETXA 1THRH 2Z9IA 1HAVB 1KDQA 4ESTE 3EGKH 4JZEH 4AB9A 2AFQB 1V2QT 1E36B 4NIVA 1WTHD 3NZIA 3ESTA 3MNSA 2QYIA 4TWYA 3A89A 3RXSA 1ZPZA 3S7KB 4NIXA 3BIVH 2EC9H 1SFQB 3BIUH 3GY7A 1ELVA 1BQYA 2TRMA 1ESAA 4BTIB 4NWKA 1S0QA 2K1QA 2QY0B 1A46H 5EGMA 1AMHA 4Z0KA 4NZQA 1E38B 2Y7XA 1L0ZA 3SI3H 3RXHA 1IHSH 1CGHA 3QN7A 4Q7ZA 2W7UA 2FOGA 4X1NU 1FY5A 1NC6A 3RXRA 4I33A 1YCPM 1DUEA 4WH8A 3UWJH 4I31A 2R2WU 3SGBE 2BOKA 1NFYA 1WAYB 1C1RA 3RXTA 3P92A 5EQRA 3KGPA 4ABEA 2FI5E 1SGCA 2ZQ1A 1BITA 3ZZDA 1V2MT 1X7AC 4AB8A 2PV9B 1C2LA 1GDQA 3T2NA 5EG4A 1MKWK 3UNRA 1ZZZA 1ARCA 3SQEE 4IC5A 3VB3A 2ZDVH 1H1BA 3U1JB 3U8OH 1TGSZ 2ZO3H 1MTSA 1TRMA 2ZTXA 1F5KU 4JZ1A 3B9FH 4AFSA 1C2MA 1O3NA 1G37A 2C8ZB 1LHFH 3Q00A 5CE1A 5L2ZH 2Q6DA 2WPKS 1EAUA 1THSH 1XUHA 3P17H 4U01A 1G3CA 5DP4A 1NFUA 3CS7A 3M5MA 1TB6H 1PPEE 3Q76A 1Q3XA 5DK1A 1AGJA 1AE8H 1K21H 1S0RA 1VCWA 2W3IA 3JZ1B 5T6DA 1T8NA 1L1GA 1TMTH 2H2ZA 1BIOA 1YYY1 3F9HA 2ANMH 2AIQA 4DOQA 2UUJB 4F4OC 1GI3A 3RXLA 1YLDA 1GBDA 3M7TA 3BG4B 1TPAE 2A4QA 3M5OA 5LPFA 2ZFSA 1L2EA 2ILNA 1CO7E 2EI8A 3RDZA 1SGFG 2A7JA 2QA9E 1C5SA 3DHKH 5JBAS 3NK8A 1C5LH 1THPB 5E0HA 4UD9H 2P3TB 1WQSA 3D23A 2XYAA 1DDJA 1EZUC 2BB4A 1P3EA 1V2NT 2G5NA 2GZ9A 1LVOA 4M7GA 1EB2A 1ZSJA 2UWPA 1T7CA 3RLWH 1B7XB 3UNQA 4GHTA 2XC4A 4BAMB 3G01A 3ZZ7A 1FN8A 1LVMA 4XE4A 1V3XA 4RN6A 4B71A 2F3CE 2VGCB 2W26A 1WBGB 4IS5A 1GDNA 3GY4A 2ALVA 3Q77A 1NRNH 4B76A 3EDXB 1QB9A 3RU4D 2A7CA 2CHAC 1EP5A 1JIRA 1ZR0A 1GBHA 1DWCH 1W8BH 1SL3A 2R3YA 1LHDH 1OWIA 3IG6B 1N8OB 2STBE 4DIHH 3M3SA 5IYTA 1YKTA 4KTUA 3W94A 3LKWA 1ABIH 1GJDB 2OBQA 3MI4A 4YTAA 4FUHA 3E0NB 1LKAA 2Z6BD 1GJAB 1CA0C 2GMTB 3RXAA 3SV2H 4DGJA 5B6OA 1W12U 2FESH 2BX3A 5EU8A 2C3SA 1GBFA 3ELAH 2AYWA 1TYNA 2Z7FE 3GY3A 4JK6A 3U69H 1FDPA 2XC5A 1A7SA 2HPQH 1F0UA 4Y79A 1QQUA 2O8UA 3LH1A 4ZKSU 5F8TA 2G5VA 4LXBH 4YO9A 2OCVB 1C1VH 4GAWA 3QTOH 3PWBA 2QF0A 2P8OB 1XXDA 2PGBB 1QL7A 1C9PA 3NUMA 3QK1A 3GY6A 8GCHG 1OYQA 1HYLA 2J92A 1QCPA 1O2GH 9LPRA 1GBJA 1QRZA 4K2YA 1TMBH 4ABIA 2FYQA 5EXMA 1P04A 2XBVA 3S9AA 3ZYDA 3VPKA 3PB1E 1FY1A 1LPKB 2XRCA 2ZCLP 1Y3VA 1LVBA 2YOLA 4YT7H 2XTTB 1AB9B 1GI5A 1QL9A 4NWLA 4IGDA 2PUQH 4BAKB 5PTPA 1J8AA 1SMFE 2PKSC 5C5OA 2WYGA 6LPRA 1O34A 1VR1H 3TVJB 3FP8E 1ZYOA 3B8JA 1EASA 1YM0A 3AASA 1G3BA 4ZHLU 1ELAA 4B74A 3K6ZA 1QNJA 4WF8A 3NWUA 1BTZA 1UVSH 1IQGA 2FP7B 1PYTC 3T62A 3MNCA 1RS0A 3F6UH 3SOSA 2ANKH 1IQFA 1G9IE 1Z8RA 1DLKB 1A0JA 1D9IA 4NIYA 4E7RG 3UQVA 5A0BA 2IPHA 1SGNE 2JETB 3L3TA 1AVWA 5FX5A 2JH6D 1P11E 1AU8A 2AS9A 5EQSA 1DLEA 1MQ6A 4K1EA 4D7FA 5JBCS 3BEFB 2A5KA 4MNVA 4FUBA 4K8BA 5FPTA 1DFPA 1P03A 1MKXH 8ESTE 2EEKA 1TPOA 1BJUA 3AAVA 1FNIA 1C2DA 4H42U 1E35B 4RSPA 2XBXA 4CHAC 2VWMA 1H9LB 1PPBH 1WU1A 2D2DA 3T29A 3I77A 1LHCH 2AMQA 4OGYA 2ZQ2A 4CRCA 3RMOH 4ABGA 1O37A 3FZDA 3UIRA 2CF8H 1LPGB 1MCVA 3BEUA 1RTLA 2OBOA 2P59A 2FOCA 2FMJA 1RIWC 3MO6A 3SJKA 1HAPH 3MMGA 2O8TA 1MTWA 2FPZA 4H6SB 1UCYK 2PFEA 7ESTE 2FOMB 1HNEE 2PTCE 3PLKA 1DXWA 4K60A 5T6GA 3PLPA 1IQHA 1BTPA 2GGVB 5L6NH 2GT8A 1J9CH 1M9UA 1O2SA 2DE8A 4Q7XA 5FXLA 4D7GA 4MG3A 3WY8A 1C5NH 1AKSA 1IQNA 1FV9A 2C93B 1CHGA 2KAIB 3SU4A 1CGJE 4INHA 1P3CA 2SGQE 3P8NA 4J1YA 4DCDA 3RXMA 2G51A 1GJ8B 5AHGH 4A5TS 1GBBA 1RTKA 1GHWH 3QZQA 4MPUA 3VXFH 2BHGA 3H7OA 5I46H 4OS6A 1F5LA 3F1SB 1HAZB 2I6SA 3TGKE 4XDEA 2VINA 4MLFB 2NU1E 4X2VA 1J16A 1K1JA 1V2VT 4K69A 4CRGA 2HVXA 5C67A 1KXFA 3MO3A 4Q2KA 1NS3A 1P8VC 1RRKA 2VB0A 4YLUA 1CQQA 5ESBA 1HAGE 2XC0A 1G3EA 1GG6C 1FAKH 2ZGBH 1GMHG 1MUEB 2J9NA 5JB9S 3EA8A 1AFEH 4UFFH 2FXRA 1SR5C 8LPRA 1HV7A 3LT3A 1CE5A 1P2OA 2FX4A 2QN5T 1WYKA 4B2AA 1J14A 5CHAC 3ATKA 1UTQA 2CJIA 1Q31A 1NFXA 1QBOA 1JIMA 4KP0A 1O2LA 3A8BA 4YM9A 5EW1H 3MOCA 1O5GH 1MZAA 2ZHEH 4Y0YE 5A0AE 3QGJA 1GGDC 2FS8A 1C5XB 1WTGH 3BTFE 2BVXH 3P6ZB 3A85A 1DY9A 3IITA 1W0ZU 1E34B 2BDIA 3SW2B 1ARBA 4AFUA 5A09A 2BD5A 1T8OA 1GBKA 4UDWH 1PQAA 2FZZA 3K65B 4ABJA 1UVOA 4YT6H 3LH3A 5DP6A 1IOEA 2C8YB 4BANB 5DG6A 1D4PB 1VJ9U 2QXJA 2STAE 3DFJA 4NFFA 1MBQA 4IN1A 2OINA 3SUFA 2B7DH 1P01A 1SLVB 4I7YH 1Y3WA 1GVZA 2ZZUH 4TWWA 4WMDA 4YOJA 1Y3UA 1BB0B 2Y5HA 1WOFA 1CVWH 1AUTC 2FLRH 4IN2A 2AIPA 1OWHA 3E0PB 5I25A 1V2PT 1C4V2 1ORFA 3SZNA 2V3OH 1ZPCA 1UCYH 1BBRK 3ZZCA 1C1TA 2FDAA 1ZHMA 5F6MA 1DSTA 2Y80A 4OS2A 1TOCB 3ATWA 3E91A 2AGGX 4D76A 2BD7A 1G30B 1IQIA 2G00A 1EPTC 1S81A 2BQ6B 4SGBE 2FOHA 5T3HA 1YBWA 1W11U 3M3VA 3ZV9A 4XBBA 2ZA5A 1K1NA 1GJ7B 1LQDB 4FU7A 4MQAA 1Z7KA 2BDAA 2VWOA 2BX4A 4CBOA 1GJCB 1GMHF 1KLTA 2BDYA 1O5EH 1TMUH 4H4FA 2NU2E 3PMAB 3RU4E 1CGIE 1SC8U 1NN6A 1TPSA 1AI8H 2TPIZ 2GCHG 1GJBB 1GI2A 3R0FA 3SUGA 3TK6A 1C1MA 4TPIZ 2XBYA 1QJ6B 1OP8A 3UREA 1AWFH 3KHVA 2ZHQH 3HATH 1SVPA 3TH3H 1WUNH 4FUIA 2Q6GA 2H6MA 3KN2A 3RXKA 4AZ2B 1TFXA 1Y3YA 2ZECA 3RXJA 4WVPE 2DE9A 3TIUA 1C5ZB 1TGBA 2RCEA 3HK3B 3SBKA 2FOEA 2ZGJA 2XXLA 2CHAB 1P9UA 1P2IA 2BY6X 1UK4A 2ZFTA 4ZXYH 4DW2U 2NU4E 3D65E 2A4RA 4Y6DA 4ZMAH 3GCNA 1C2IA 1ELGA 1L4ZA 1TRYA 1MD7A 4X8TH 3VEQB 3RLYH 2VIQA 3PLBA 4NA7A 4O9VA 1SPJA 5GJ4B 2AERH 8KME2 3LGVA 1P06A 2QC2A 1HB0B 3A87A 3MNXA 2PR3A 2BY7X 1BHXB 1HFDA 4K1SA 1SGPE 3P8OA 1S82A 3GDVA 1FY8E 3S9BA 3TPIZ 2FI3E 2Y82A 1O2YA 3P70B 1PPZA 2VIDA 2XWAA 3O8RA 1NRPH 1O2RA 1O35A 3U1IB 1VCPA 2P94A 3SU1A 3SJ8A 1SQAA 1ESTA 2BDCA 1YPKH 3KCGH 1YC0A 2ANWA 2A7HA 3BV9B 3MU1A 3SI4H 4ISNA 3NXPA 5HM9A 2HOBA 2PHBA 2QGRA 3O8BA 1YF4A 2ZFFH 3QO6A 3RXUA 7KMEH 3MU5A 3V0XA 4BOHA 3HGNA 1GI4A 2ZDKA 1SGIB 3HGPA 3GYLB 4Y7AA 1DY8A 3MFJA 1QJ7B 1GHBG 2VIOA 1CU1A 2H5CA 1QBNA 3A82A 1BBRH 1AVGH 4X6OA 1BTXA 5IDKA 1T4VH 3LC5A 1HAIH 1GBCA 1HJ9A 1HJ8A 5DP3A 3TJVA 1FMGA 3RXOA 1F5RA 2UUYA 3PROA 2R9PA 2WPHS 1BJVA 1MQ5A 4MNXA 1CT0E 1F0RA 4AFZA 2GCHF 1XXFA 1UTKA 1BT7A 1DT2A 1KSNA 1NFWA 2OC0A 3SUDA 3VXEH 2RA0A 4WY3A 3V7TA 4Y8ZA 1BRUP 1NO9H 3EQ0H 1TBQH 1V2OT 2A31A 1GVLA 1L1JA 3PV4A 3VB5A 1O2OA 3TK5A 3ZZ6A 2ZFQH 3GY5A 3N7OA 3K9XB 1LTOA 1OWDA 2A0QB 3M7UA 4FVDA 4NGAH 4X6MA 2B5TB 1F7ZA 1A0LA 4TY7A 1GI1A 1O2QA 4ZXXH 2ZDNA 2ZF0H 1PFXC 3MTYA 4NG9H 1O3LA 1N1LA 3MHWU 4WWYA 1ID5H 3V12A 4NSVA 1CT4E 4BXWA 4CREA 3EAJA 4IW4E 3ODDA 1UMAH 1XM1A 3Q3XA 5G4BA 4ABBA 1HIAB 5EQQA 4KELA 2RA3A 2VVUA 5E2PA 3BTKE 1UHBB 1DWBH 3L33A 1GHYH 4CHAB 2XNIA 4FU9A 1H9IE 3LGUA 2G4TA 1XUFA 3SNCA 2BD9A 2G8TA 4ABDA 3LOXA 1TOMH 3NCLA 2NU3E 2TGTA 5ABWA 5DP9A 1D3TB 1BZXE 1H8IH 1AUJA 2ODQA 3LIWA 3DUXH 1JWTA 2WUCA 5FCKA 1RIWB 1BA8B 2DUCA 5AF9H 1HAHH 1TA2A 1GHBF 2ZHFH 3MH6A 3UOUA 4AN7A 2FO9A 3GYMA 1QQ4A 4AGJA 4DT7B 1B0FA 3VGCC 3PO1C 5AFYH 4B2CA 3BTME 4MPXA 1T4UH 4OGXA 6CHAC 2BY8X 1TLDA 4AG2A 1HAVA 1DUAA 4VGCC 1JXPA 3FAOA 1EP6A 4ISLA 1C5TA 4Y76A 1GCTC 2ZTYA 4X2WA 4I32A 4E05H 1GMDG 1A1RA 4CRDA 1EJMA 5J4QA 1P2MA 3H7TA 3ZYEA 4AGKA 1BCUH 1MKXK 2EI7A 3T25A 4ZUHA 1OP2A 3S7HB 1UTOA 2CV3A 2VNTA 1AQ7A 1EOLA 4RKOB 5LPEA 1ELCA 4FUDA 2D26C 1TX7A 3LGWA 3OSYA 3SGAE 3TJOA 1FY4A 1GHXH 1ZSKA 1PPHE 2GVFA 3A86A 3RM0H 1RTFB 2D1JA 1GG6B 3P8GA 2H5DA 1O3KA 1RD3B 1P10A 1AO5A 3SNAA 2B0FA 1A5HA 1Z8GA 3LU9B 2BLWA 3URCA 1LKBA 1TNJA 4MNWA 3SJIA 1MTNC 2LPRA 2XBWA 5CHAB 2JH5D 2VH6A 2UWLA 1EB1H 1CA8B 4Y71A 2HNTC 2PUXB 3ZVGA 2F9NA 4ZKOU 3ZVBA 1OP0A 2IOTA 2ODYB 1U6QA 1O38A 1AN1E 2V3HH 5SGAE 3QWCH 2PKAB 1GGDB 1V2JT 3SNDA 4A92A 6GCHG 1PPGE 5LPRA 1UO6A 1F0SA 1N6YA 1P57B 2G81E 2GCTC 3E16B 4ASHA 1GVKB 1A5GH 2HWLB 2Z3CA 2ZTZA 5GIBA
chains in the Genus database with same CATH superfamily
2OUAA 1YCPK 3AAUA 3S69A 4GUXA 1DM4B 5F8XA 3D49H 4R0IA 3STJA 2GKVE 4WXIA 1BMFD 3SJOA 1B0EA 1PQ8A 1O36A 1YPLH 2RG3A 1ZPBA 2HGTH 1KXEA 3B23B 3M37A 3ENSB 1TGNA 2JH0D 1LDTT 4OS7A 4B1TA 5HM2A 1S5SA 4LK4A 3D62A 4CR9A 1TNKA 2ALPA 3PM3A 2IPQX 2R0KA 2WPDD 4FXGH 3SU0A 1ETRH 3M3TA 1K1PA 1PPFE 5JBBS 2C8XB 2GDEH 3GY2A 5DPAA 5DP7A 2F9BH 1OXGA 4D9RA 5KECA 3MO9A 3MU8A 3UOPA 1MAYA 2ZPSA 3Q3KA 2HLDD 5ESTE 3RP2A 3A7TA 4YZUA 1EPTB 5F03A 2F83A 1V6DA 6ESTA 2YMSC 2WYJA 2J97A 4X1QU 2C4FH 4ZHAA 1SGYE 1ZRBA 4HFPB 2J34A 4O3UA 1EZXC 3KF2A 5FAHA 1TQ0B 1AFQC 1O5CB 3SV6A 3ZZ8A 3PTNA 2A4GA 4X8VH 3A8CA 4CRBA 5A8ZA 1DS2E 1BRBE 1HRTH 1GL0E 5EJZA 1ZSLA 1QURH 2VVVA 2PGQB 3EA9A 2BD3A 2CF9H 2O8WA 2J2UA 1SGEE 5A8XA 4O03A 1CBWC 1LVYA 3TGJE 4TY6A 3SU2A 1GHZA 1CSOE 1WV7H 3A7YA 1GBMA 1FAXA 3SORA 1Z6JH 2HVYB 5C1XA 2EA3A 3QTVH 1K1OA 1MU6B 3RM2H 4KGAA 1O5FH 1C1PA 5GDSH 1C5WB 2ZPRA 1BDAA 6GCHF 4LOYH 8GCHF 2BZAA 3PV5A 1WCZA 1OYTH 5EPYA 5CMXH 2J4IA 4A1TA 3MYWA 2ESTE 1BMMH 2V35A 1C1SA 1A2CH 4PROA 1XUJA 5EOKA 2BQWB 1JMOH 2ZC9H 1C1UH 1UTLM 2IN2A 4R8TB 3SO3A 4KKDA 2HLCA 5GNDA 1SSXA 1CT2E 2XCNA 1ELBA 2FI4E 1K28D 1GBAA 1TBZH 4ZKRU 1O3DA 5GCHG 1QA7A 1O3GA 5TCCA 3DFLA 4DT4A 1YCPH 3FP7E 1AY6H 1EQ9A 1FUJA 1QBVH 2F91A 2SGDE 1NBME 4X6PA 1JOUB 2GDDA 1J17T 2FM2A 3MH4A 4CBNA 1E1QD 5L30H 4ZKNU 4A7IB 1P2NA 4YESB 2CK3D 1PJPA 2VGCC 2ZDAH 1XUGA 3QLPH 1HLTH 2QF5A 1INCA 3R3GB 4FUFA 2OC1A 3PRDA 1TRNA 1EZSC 1DWEH 3LJOA 2ASUB 3ZZ9A 3BTWE 1P09A 1WDIA 3A80A 3RXFA 1A0HB 3RXCA 1O31A 3U8TH 1DPOA 5A8YA 1NESE 2FIRH 4O3TA 2NWNA 4OM9A 1PYTD 4JYVH 2BDHA 1ANBA 1BTHH 1G2MA 1UVPA 1TQ7B 4BNRA 5EW2H 1Z71A 3TJUA 1TWXB 1T32A 2TGAA 2HALA 5EODA 1EXFA 1O2HA 1P0SH 1VZQH 4FOUC 4OS5A 1F92A 3E6PH 4Y8XA 1OHHD 3TJNA 4B73A 5E2OA 1Y5UT 2BXTH 3TITA 4JMYA 1A5IA 1QHRB 4NA9H 4YLQH 4DG4A 3A7XA 3MU0A 1MMJN 2R2MB 1OSSA 4FUJA 3SV8A 4YXWD 3LPRA 3AVZA 3C27B 2ZCKP 3M7QA 5E0GA 1ZHPA 2FODA 1KDQB 2J98A 1C5MD 4YOGA 2P95A 2BQ7B 1E0FD 1Y8TA 2BMGB 2J94A 4K8YA 1ACBE 1NT1A 4UEHH 4X2YA 4RI0A 1TBRH 2GZ8A 4HI3A 3I78A 1GBLA 4AYVB 3S9CA 1O5DH 5AFZH 3EA7A 2BYAX 2ZIQH 3I29A 2BY9X 4IMZA 2SGPE 2Y7ZA 1W13U 5JB8S 1AE5A 4ZROA 3RXDA 3SV9A 3GCTG 2H9HA 3FO8D 3LDXH 1W0YH 5GCHF 1C1WH 4MTBA 3DSOA 3RU4T 3A7VA 4GVUA 2ODPA 1C2GA 4XSKU 5FHTA 1BMAA 1FPHH 2OQ5A 4AX9H 3MH5A 4J2YB 2OXSA 1XVMA 1UK3A 4I8LA 2HPPH 4ACAA 1C2EA 1YY3A 2UUFB 4WH6A 2F9UA 4NA8A 1W7XH 2WV4A 2VVCA 5C3NA 1Z6EA 1ZTKA 1MAXA 5E8EH 1VITG 2M5TA 3TH2H 3WW7A 5K0HA 2O8MA 1FJSA 2EY4C 3MU4A 1YP9A 1UVUH 1TE0A 2F9VA 1NPMA 3LGTA 5LH8A 3ZV8A 2O8LA 1D3QB 2WPMS 1KIGH 4X1SU 1TAWA 2KAIA 3F68H 1ETSH 3VGCB 4B2BA 1EAXA 5C1YA 3CS0A 3PO1B 3GCHC 4NZLA 6CHAB 1K1IA 4VGCB 1OX1A 1TGTA 3A8DA 3H09A 4OS1A 1GCTB 3TNSA 4CH8B 5C5NA 4RT0A 1O3MA 5DGJA 1IQLA 1AWHB 1W10U 3F0OA 3STIA 4TPYA 5DKMA 1HDTH 1HGTH 3OEED 1QZ8A 4ABAA 3RXPA 2FOFA 2ZGHA 3QX5H 1OPHB 4ZAEA 3MNBA 1UTNA 1DICA 3PWCA 2FYRA 2WPLS 3NPSA 3UPEA 1W2KH 1GHVH 1FY3A 3VB4A 2BXUH 1P2KA 2WHXA 5DP8A 1YGCH 1L1NA 3N7EA 1XKAC 1IHTH 1O3HA 1ZOMA 1ELEE 1UTJA 2J38A 1IQKA 5EIYA 2GX4A 7GCHG 1CA0B 1D6WA 1GBTA 4UONA 3ZVCA 3UWIA 4I8HA 5HYOA 3QUMP 1AIXH 1C5UA 1MTNB 1QB1A 2EI6A 2IJOB 2YNAA 4WMFA 3GCTF 2AGEX 1C5VA 3VFEA 2A5IA 1ANDA 1JRSA 2ULLA 2Z3DA 3SUEA 5DO4H 2ZEBA 2WINI 1K1MA 1TPPA 1C5RA 3IWMA 1YPJH 2VJ1A 3A84A 2CXVA 1SGDE 2ZPQA 3GICB 1A4WH 4UFDH 1QL8A 1DSUA 4BAHB 4BTUB 1DX5M 2I6QA 5KEDA 2GCTB 1PQ5A 1EAWA 3RXQA 2QV1A 3UR6A 1P12E 4NFEA 1QA0A 1SBWA 1P2QA 2THFB 4U32A 3M36A 3PTBA 2KFWA 1P2JA 2PWXA 1C5OH 1KTTB 2TGPZ 1VITF 2QXIA 4XBCA 1HJAC 3UR9A 2AMDA 3OY6U 3LONA 1O2VA 2VIPA 5EPNA 3RC4A 3TU7H 1ETTH 4LZ1H 3RXEA 2GV7A 4OS4A 3UY9A 2VBCA 4UE7H 3H5CB 1ABJH 4DURA 2PKSB 3L6PA 1C2HA 1MZDA 1P9SA 1VGCC 3A7ZA 2AH4X 4F49A 1O2JA 5E0JA 5K7RA 3RMNH 2ZU1A 4BTTB 2UWOA 4JK5A 4JYUH 1EJNA 1GJ9B 3FFGA 1O33A 3U8RH 2AEIH 2QXGA 1TNIA 4ZH8A 5IK2D 1Y3XA 1MD8A 2A2XH 2H1UA 3T26A 3RUOA 1HCGA 1G3DA 2ZGXH 5EXNA 5FPYA 2KX4A 3V13A 3ODFA 5F8ZA 1ZMLA 1FLEE 2A1DB 1A61H 2YMSB 3OTPA 1GI6A 1YPMH 3A83A 3QDZB 1S6FA 1KLJH 3ATMA 1BUIA 1V2WT 1GBIA 1ZGIA 1EZQA 2VU8E 1Z1IA 1O39A 3BF6H 4ISOA 1NRRH 2FWWA 3EYDA 1AFQB 1MCTA 1SGRE 2CN0H 2WUBA 3QGNB 2BDGA 2KCYA 4UFEH 1O5AB 2PSYA 4WMEA 7GCHF 1AHTH 3OX7U 1RJXB 2GV6A 3HPTB 1SG8B 1YPHC 2TGDA 4A1VA 2Z94A 3TK9A 1DVAH 2BVSH 5DP5A 1QIXB 1CBWB 1O2TA 3UFAA 4F55A 1C5PA 7LPRA 2HNTE 1VJAU 3HKIB 1O3OA 4DJZB 1WQVH 1Y5AT 2Y81A 1GCDA 1O3FA 5FCRA 2BLQA 2SGFE 3DT0H 1SFIA 2FTLE 3KQ5A 3UQOA 2QCYA 5BRRE 1OWEA 1L4DA 1OWKA 1UTMA 3VG8A 2P3UB 4A6LA 3KEEA 1NRQH 1F2SE 5EJLA 2QXHA 2J95A 4Y11E 4CRAA 3W1EA 1XUKA 4CH2B 1K22H 1O3JA 4BAOB 1DITH 4CRFA 1O30A 1KTSB 4TT3D 3URDA 4CR5A 2R3UA 4INLA 3LJJA 2OD3B 2ZU4A 1T8MA 3F2HA 3GDUA 1O2WA 4Y0ZE 3O8CA 4KTSA 1SOZA 2ZI2H 2FLBH 4NCYA 3VB7A 2A4OA 4Z1MD 3K2UA 5FBEA 4JCNA 1KXAA 1C4U2 3SNEA 3SHCH 2ZHDA 3BG8A 1SQTA 2BD8A 3E3TA 1ZMNA 4BAQB 1O32A 2QE7D 4X0WU 2BVRH 1O5BB 1NM6A 1BTWA 1CHOG 5FPSA 4Q80A 5TJXA 1OOKB 2FTMA 2ZWLH 2G52A 1BRAA 3KYFA 2TBSA 1SB1H 3KL6A 2OP9A 1C5QA 4DIIH 2C8WB 1O2UA 4AYYB 2P16A 3ITIA 1LCYA 3M5NA 1Y59T 1SHYA 3F0PA 1FPCH 3GDSA 2PW8H 2ZNKH 1XVOA 2PSXA 4MPVA 1XX9A 3HK6B 3RMMH 1LMWB 1Q2WA 2W5EA 5FBIA 3GCOA 2VH0A 2SFAA 3GOVB 1V2UT 1AZ8A 3P95A 4LZ4B 4Y7BA 1MBMA 1P02A 4AC9A 3W95A 3RXBA 2VWNA 1MKWH 4H6TA 3RC6A 4XBDA 2WV5A 1AKSB 4XFQA 2Q6FA 4AG1A 2FX6A 2ZU2A 3T28A 3U98H 2XW9A 1NROH 3MWIU 3RXIA 1GBEA 3SQHE 3HKJB 2SNWA 4QT8C 3UNSA 1O3CA 3OE7D 4GCHG 3O8DA 1FIWA 3OTJE 4K5ZA 2P3FH 3GISB 3UB0A 4XRNA 5JPMH 1AVXA 3RMLH 1J15A 4WJG2 1O3PB 1ZHRA 3KQBA 3SHAH 1A3BH 2BLOA 3OY5U 3DA9B 1SLUB 4JZFH 2W6JD 1BTYA 2B9LA 2KZ4A 3DD2H 1GMCG 2ZDLA 1ZMJA 4X8SH 5A2MH 1BTUA 1ANCA 1E37B 3BSQA 2BTCE 1SOTA 1O2IA 3KQCA 1S6LA 2P93A 3S0NA 4INKA 1GPZA 1HIAA 4X8UH 1SGQE 2W7SA 1UHBA 2FOBA 2CGAA 4E06H 3U9AH 3RXVA 1TONA 2ZFPH 1S6HA 4FU8A 1GMDF 2K8IA 4FVBA 2OLGA 2ZKSA 3K6YA 3OYPA 1SLWB 2Y5GA 3M61U 1HAOH 1XMNB 1FONA 3GY8A 4MVNA 2BD4A 1O2ZA 1CHOF 3A88A 1SQOA 2ZCHP 2G55A 1ELDE 1IAUA 3ZZAA 1V2ST 1UVTH 1ELFA 2NU0E 2PLXA 1Y5BT 9ESTA 3ZZ3A 1S85A 2IJD1 2ZU5A 1TA6A 1XKBC 3U28C 2BY5X 1W0JD 1JRTA 2Z9JA 2O9QA 1ZLRA 1HXEH 3RC5A 1KXBA 2A32A 5C1UA 1RGQA 3TH4H 2XCFA 3TNTA 1Z8IB 1O2NA 3SV7A 1B5GH 2F4LA 3FZZA 1KLIH 5GWZA 3NRLA 1O2KA 1FI8A 4RKJB 3GCHB 2L6OA 4YOIA 1QTFA 3ZZ4A 1ZGVA 2SGEE 1TABE 4D9QA 1KMHB 1G32B 3ATLA 1Z1JA 4D8NA 1VITH 4MDSA 2KM0A 4KTCA 1O2XA 2C90B 4HGCA 1V2RT 5CHBA 5C2ZA 3ZZ5A 3KIDU 5L2YH 1ELTA 2OK5A 3N99A 3CENA 1K1LA 4AORA 3SGQE 4P00A 1UCYE 1FN6A 1S84A 1T8LA 3OU0A 1GJ5H 1NRSH 1SHHB 1FQ3A 1GJ4H 3BG4C 3PMBB 4GCHF 1TGCA 1FIZA 2BM2A 3BTQE 1ANEA 4NSYA 4HTCH 3BEIB 4DVAU 1ESBA 2HRVA 1IQJA 2Z9KA 3QZRA 4A1XA 3TGIE 3ZZBA 2AMPA 4FUGA 3T27A 1SI5H 2A2QH 5HMAA 4Z6AH 4ZHMU 1GMCF 3ZVAA 2ZFRH 2VIVA 4NIWA 1TNLA 3BTTE 4IBLH 2YNBA 1EX3A 1P05A 1V2TT 4ISHH 1D6RA 3OEHD 2G4UA 1KYNA 4I8GA 4U2WA 1GHAG 1LO6A 2PKAA 1D3PB 5A0CA 1DE7H 1K0HA 2PTNA 1COWD 1ZJDA 3BN9A 2WPJS 2OTVA 1LPZB 4IC6A 4MPWA 1HXFH 1AZZA 1BMLA 1MTVA 1NTPA 2BD2A 2RFKC 2H9EH 3A81A 3ATIA 1ZRKA 3ZVFA 3KYGA 4ABHA 1FZZA 2D8WA 4UFGH 1GWAA 3FVFB 1BRCE 3E8LA 4JZIA 1QRXA 5TCAA 3SNBA 3E90B 3A8AA 1MU8B 2ZGCA 1OKXA 2JJ1D 3NKKA 4WXVA 5B6LA 1N8OC 2RDLA 4ACBA 1IQMA 1HAYB 2Z9GA 1C1NA 1KXDA 1PQ7A 3P8FA 1HJAB 2M2AA 1ZTJA 2GMTC 1JBUH 1S83A 1W14U 3F9EA 2BZ6H 2YMSD 4ISIH 3E1XB 1LQEA 1SGTA 3ZVEA 1DXPA 2BDBA 1T31A 1H9HE 1HPGA 1MTUA 1VGCB 1DANH 3BTGE 3LGYA 3PYHA 5C0TA 3CP7A 5GPIB 1C9TA 2OQUA 2QAAA 4FUCA 3DCLA 1H8DH 5C20A 2FS9A 1O3AA 1C5YB 1HAXB 4Y10E 4X2XA 5BPEA 2P8OC 1EPTA 2GTBA 2VWLA 2GZ7A 1LHGH 2V0BA 1SGFA 3MH7A 1BOQA 2Z3EA 4K3JA 2H9TH 2BLVA 1EKBB 2ZU3A 3SU3A 1C2JA 2FOAA 2TIOA 3ZVDA 1OS8A 3M5LA 1LHEH 2FEQH 1AD8H 4ASUD 3LGIA 4GHQA 1W3CA 2OC7A 4I8KA 1UK2A 2BOHB 5HKKD 5H4IB 2F9PA 1AB9C 3UTUH 2VIWA 4E7NA 4ABFA 1TX6A 4Y8YA 5EXLA 1IQEA 1W7GH 1GL1A 2SNVA 2JIZD 1G2LA 2F9OA 1N6XA 1BBRE 2ZP0H 4GLYA 1TX8A 1KXCA 4X1RU 1QB6A 3PMJA 3V3MA 3F9FA 4MNYA 2GD4B 1QFKH 1O0DH 1GHAF 1EUFA 3F9GA 1O2PA 4THNH 1XUIA 1EOJA 2ZHWH 3RXGA 1YPGH 4Q7YA 5HXFA 3AW1A 1TNHA 1HBTH 3KQEA 5FX6A 2Q1JA 4XD7D 1SLXB 2WPIS 1K2I1 4DY7B 1HUTH 1TALA 1UTPA 3KQDA 1QR3E 1TNGA 2LNCA 1C1OA 1EAIA 4B6FA 1O3IA 1RXPA 2OC8A 4BXSA 2CMYA 5JDUB 1E79D 2JETC 4X6NA 5JYIA 1V2LT 2XWBI 3KNXA 1MH0A 2A5AA 3AW0A 5J4SA 2GT7A 3FANA 1QGFA 1EJAA 1FXYA 1DWDH 5T6FA 2ZDMA 1OWJA 1D3DB 4IMQA 5JBTA 4XOJA 1NU7B 2QIQA 3FP6E 3TLOA 4B75A 1O3BA 1QRWA 2Y6TA 2JKHA 1GI9B 1PPCE 1DOJA 5AVDA 3UUZA 5DJ7A 1GI0A 1O2MA 5LGOA 1EATA 2GP9B 4HZHA 1NZQH 2Z9LA 1GI7B 3BTEE 3T5FH 3SU6A 1GI8B 3JZ2B 4AOQA 1BHXF 2SGAA 4SGAE 1O3EA 4TYDA 4JZDH 3Q3YA 4AFQA 3M35A 3SJ9A 4B6EA 1Z8JB 1ZTLA 3EE0B 1QJ1B 1V2KT 2ZG0H 3PMHB 4K1TA 3LC3A 2ANYA 4FUEA 3C1KA 1C4Y2 5GXPA 4GPGA 3FOAA 2UUKB 3BTDE 4P02A 2HNTF 1NU9A 5HGGA 1VKYA 1C2FA 4JYTA 2AHME 1VCQA 1F0TA 1ZJKA 3WWBA 1G36A 1GDUA 1GJ6A 1SQRA 1C1QA 2V6NA 4U30A 1H4WA 1RFNA 3A7WA 4X1PU 4GSOA 1WSSH 1YLCA 3FKSD 4O97A 2R0LA 1BMNH 2AGIX 1A3EH 2B8OH 1TIOA 1QY6A 2A45B 3SN8A 1UJ1A 2Y5FA 2QF3A 1C2KA 1KY9A 1K9OE 1YPHE 1NY22 3BTHE 3SU5A 2W3KA 1YPEH 4I8JA 3VB6A 5ETXA 1THRH 2Z9IA 1HAVB 1KDQA 4ESTE 3EGKH 4JZEH 4AB9A 2AFQB 1V2QT 1E36B 4NIVA 2WZQA 1WTHD 3NZIA 3OFND 3ESTA 3MNSA 2QYIA 4TWYA 3A89A 3RXSA 1ZPZA 3S7KB 4NIXA 3BIVH 2EC9H 1SFQB 3BIUH 3GY7A 1ELVA 1BQYA 2TRMA 1ESAA 4BTIB 4NWKA 1S0QA 2K1QA 2QY0B 1A46H 5EGMA 1AMHA 4Z0KA 4NZQA 1E38B 2Y7XA 1L0ZA 3SI3H 3RXHA 1IHSH 1CGHA 3QN7A 4Q7ZA 2W7UA 5EJ1A 2FOGA 4X1NU 1FY5A 1NC6A 3RXRA 4I33A 1YCPM 1DUEA 4WH8A 3UWJH 4I31A 2R2WU 3SGBE 2BOKA 1NFYA 1WAYB 1C1RA 3RXTA 3P92A 5EQRA 3KGPA 4ABEA 2FI5E 1SGCA 2ZQ1A 1BITA 3ZZDA 1V2MT 1X7AC 4AB8A 2PV9B 1C2LA 1GDQA 3T2NA 3ZIAD 5EG4A 1MKWK 3UNRA 1ZZZA 1ARCA 3SQEE 4IC5A 3VB3A 2ZDVH 1H1BA 3U1JB 3U8OH 1TGSZ 2ZO3H 1MTSA 1TRMA 1W0KD 2ZTXA 1F5KU 4JZ1A 3B9FH 4AFSA 1C2MA 1O3NA 1G37A 2C8ZB 1LHFH 3Q00A 5CE1A 5L2ZH 2Q6DA 2WPKS 1EAUA 1THSH 1XUHA 3P17H 4U01A 1G3CA 5DP4A 1NFUA 3CS7A 3M5MA 1TB6H 5DSFA 1PPEE 3Q76A 1Q3XA 2J5UA 5DK1A 1AGJA 1AE8H 1UW7A 1K21H 1S0RA 1VCWA 2W3IA 3JZ1B 5T6DA 1T8NA 1L1GA 1TMTH 2H2ZA 1BIOA 1YYY1 3F9HA 2ANMH 2AIQA 2KR7A 4DOQA 2UUJB 4F4OC 1GI3A 3RXLA 1YLDA 1GBDA 3M7TA 3BG4B 1TPAE 2A4QA 3M5OA 5LPFA 2ZFSA 1L2EA 2ILNA 1CO7E 2EI8A 3RDZA 1SGFG 2A7JA 2QA9E 1C5SA 3DHKH 5JBAS 3NK8A 1C5LH 1THPB 5E0HA 4UD9H 2P3TB 1WQSA 3D23A 2XYAA 1DDJA 1EZUC 2BB4A 1P3EA 1V2NT 2G5NA 2JDID 2GZ9A 1LVOA 4M7GA 1EB2A 1ZSJA 2UWPA 1T7CA 5FL7D 3RLWH 1B7XB 3UNQA 4GHTA 4M9FA 2XC4A 4BAMB 3G01A 3ZZ7A 1FN8A 1LVMA 4XE4A 1V3XA 4RN6A 4B71A 2F3CE 2VGCB 2W26A 1WBGB 4IS5A 1GDNA 3GY4A 2ALVA 3Q77A 2XOKD 1NRNH 4B76A 3EDXB 1QB9A 3RU4D 2A7CA 2CHAC 1EP5A 1JIRA 1ZR0A 1GBHA 1DWCH 1W8BH 1SL3A 2R3YA 1LHDH 1OWIA 3IG6B 1N8OB 2STBE 4DIHH 3FN8A 3M3SA 5IYTA 1YKTA 4KTUA 3W94A 3LKWA 1ABIH 1GJDB 2OBQA 3MI4A 4YTAA 4FUHA 3E0NB 1LKAA 2Z6BD 1GJAB 1CA0C 2GMTB 3RXAA 3WWFA 3SV2H 4DGJA 5B6OA 1W12U 2FESH 2BX3A 5EU8A 2C3SA 1GBFA 3ELAH 2AYWA 1TYNA 2Z7FE 3GY3A 4JK6A 3U69H 1FDPA 2XC5A 1A7SA 2HPQH 1F0UA 4Y79A 1QQUA 2O8UA 3LH1A 4ZKSU 5F8TA 2G5VA 4LXBH 4YO9A 2OCVB 1C1VH 4GAWA 3QTOH 3PWBA 2QF0A 2P8OB 1XXDA 2PGBB 1QL7A 1C9PA 3NUMA 3QK1A 1FX0B 3GY6A 8GCHG 3CNRA 1OYQA 1HYLA 2J92A 1QCPA 1O2GH 9LPRA 1GBJA 1QRZA 4K2YA 1TMBH 4ABIA 2FYQA 5EXMA 1P04A 2LELA 2XBVA 3S9AA 3VPKA 3ZYDA 3PB1E 1FY1A 1LPKB 2XRCA 1H8HD 1Y3VA 2ZCLP 1LVBA 2YOLA 4YT7H 2XTTB 1AB9B 1GI5A 1QL9A 4NWLA 4IGDA 2PUQH 4BAKB 5PTPA 1J8AA 1SMFE 2PKSC 5C5OA 2WYGA 6LPRA 1O34A 1VR1H 3TVJB 3FP8E 1ZYOA 3B8JA 3PV2A 1EASA 1YM0A 3AASA 1G3BA 4ZHLU 1ELAA 4B74A 3K6ZA 1QNJA 4WF8A 3NWUA 1BTZA 1UVSH 4HG6A 1IQGA 2FP7B 1PYTC 3T62A 3MNCA 1RS0A 3F6UH 3SOSA 2ANKH 1IQFA 1G9IE 1Z8RA 1DLKB 1A0JA 1D9IA 4NIYA 4E7RG 3UQVA 2J98B 5A0BA 2IPHA 2EQNA 1SGNE 2JETB 3L3TA 1AVWA 5FX5A 2JH6D 1P11E 1AU8A 2AS9A 5EQSA 1DLEA 2K0QA 1MQ6A 4K1EA 4D7FA 5JBCS 3BEFB 2A5KA 4MNVA 4FUBA 4K8BA 5FPTA 1DFPA 1P03A 1MKXH 8ESTE 2EEKA 1TPOA 1BJUA 3AAVA 1FNIA 3N7DA 1C2DA 4H42U 5HIYA 1E35B 4RSPA 2XBXA 4CHAC 2VWMA 1H9LB 1PPBH 1WU1A 2D2DA 3T29A 3I77A 1LHCH 2AMQA 4OGYA 2ZQ2A 4CRCA 3RMOH 4ABGA 1O37A 3FZDA 3UIRA 2CF8H 3F3BA 1LPGB 1MCVA 3BEUA 1RTLA 4Q63A 2OBOA 2P59A 2FOCA 2FMJA 1RIWC 3MO6A 3SJKA 1HAPH 3MMGA 2O8TA 5F53A 1MTWA 2FPZA 2KCOA 4H6SB 1UCYK 2PFEA 7ESTE 2FOMB 1HNEE 2PTCE 3PLKA 1DXWA 4K60A 5T6GA 3PLPA 1IQHA 1BTPA 2GGVB 5L6NH 2GT8A 1J9CH 1M9UA 1O2SA 5C17A 2DE8A 4Q7XA 5FXLA 4D7GA 4MG3A 3WY8A 1C5NH 1AKSA 1IQNA 1FV9A 2C93B 1CHGA 2KAIB 3SU4A 1CGJE 4INHA 1P3CA 2SGQE 3P8NA 4J1YA 4DCDA 3RXMA 4ZCNA 2G51A 1GJ8B 5AHGH 4A5TS 1GBBA 1RTKA 1GHWH 3QZQA 4MPUA 3VXFH 2BHGA 3H7OA 3GS9A 5I46H 4OS6A 1F5LA 3F1SB 1HAZB 2I6SA 3TGKE 4XDEA 2VINA 4MLFB 2NU1E 4X2VA 1J16A 2WV9A 1K1JA 1V2VT 4K69A 4CRGA 2HVXA 5C67A 1KXFA 3MO3A 4Q2KA 1NS3A 1P8VC 1RRKA 2VB0A 4YLUA 1CQQA 5ESBA 3MQKC 1HAGE 2XC0A 1G3EA 1GG6C 1FAKH 2ZGBH 1GMHG 1MUEB 2J9NA 5JB9S 3EA8A 1AFEH 4UFFH 2FXRA 1SR5C 3OAAD 8LPRA 1HV7A 3LT3A 1CE5A 1P2OA 2FX4A 2QN5T 1WYKA 4B2AA 1J14A 5CHAC 3ATKA 1UTQA 2CJIA 1Q31A 1NFXA 1QBOA 1JIMA 4KP0A 1O2LA 3A8BA 4YM9A 5EW1H 3MOCA 1O5GH 1MZAA 2F43B 2ZHEH 4Y0YE 5A0AE 3QGJA 2GJGA 1GGDC 2FS8A 1C5XB 2PP6A 1WTGH 3BTFE 2BVXH 3P6ZB 3A85A 1DY9A 3IITA 1W0ZU 1E34B 2BDIA 3SW2B 2QF4A 1ARBA 1YWUA 4AFUA 5A09A 2BD5A 1T8OA 1GBKA 4UDWH 1PQAA 5C94A 2FZZA 3K65B 4ABJA 1UVOA 4YT6H 3LH3A 5DP6A 1IOEA 2C8YB 4BANB 1H8ED 2L74A 1YLNA 5DG6A 1D4PB 1VJ9U 2QXJA 2STAE 3DFJA 4NFFA 1MBQA 4IN1A 2OINA 3SUFA 2B7DH 1P01A 1SLVB 4I7YH 1Y3WA 1GVZA 2ZZUH 4TWWA 4WMDA 4YOJA 1Y3UA 1BB0B 2Y5HA 4RT1A 1WOFA 1CVWH 1AUTC 2FLRH 4IN2A 2AIPA 1OWHA 3E0PB 5I25A 1V2PT 1C4V2 1ORFA 3SZNA 2V3OH 1ZPCA 1UCYH 1BBRK 3ZZCA 1C1TA 2FDAA 1ZHMA 5F6MA 1DSTA 2Y80A 4OS2A 1TOCB 2WSSD 3ATWA 3E91A 2AGGX 4D76A 2BD7A 1G30B 1IQIA 2G00A 1EPTC 1S81A 2BQ6B 4SGBE 2FOHA 5T3HA 1YBWA 1W11U 3M3VA 3EE7A 3ZV9A 4XBBA 4F48B 2ZA5A 1K1NA 1GJ7B 1LQDB 4FU7A 4MQAA 1Z7KA 2BDAA 2VWOA 2BX4A 5T1VA 4CBOA 1GJCB 1GMHF 1KLTA 2BDYA 1O5EH 1TMUH 4H4FA 2NU2E 3PMAB 3RU4E 1CGIE 1SC8U 1NN6A 1TPSA 1AI8H 2TPIZ 2GCHG 1GJBB 1GI2A 3R0FA 3SUGA 3TK6A 1C1MA 4TPIZ 2XBYA 1QJ6B 1OP8A 3UREA 1AWFH 3KHVA 2ZHQH 3HATH 1SVPA 3TH3H 1WUNH 4FUIA 2Q6GA 2H6MA 3KN2A 3RXKA 4AZ2B 1TFXA 1Y3YA 2ZECA 3RXJA 1EFRD 4WVPE 2DE9A 3TIUA 1C5ZB 1TGBA 2RCEA 3HK3B 3SBKA 2FOEA 2ZGJA 2XXLA 2CHAB 1P9UA 1P2IA 2BY6X 1UK4A 5KGOA 2ZFTA 4ZXYH 4DW2U 2NU4E 3D65E 2KCPA 2A4RA 4Y6DA 4ZMAH 3GCNA 1C2IA 1ELGA 1L4ZA 1TRYA 1MD7A 4X8TH 3VEQB 3RLYH 2VIQA 3PLBA 4NA7A 4O9VA 1SPJA 3AK5A 5GJ4B 2AERH 8KME2 3LGVA 1P06A 2QC2A 1HB0B 3A87A 3MNXA 2PR3A 2BY7X 1BHXB 1HFDA 4K1SA 1SGPE 3P8OA 1S82A 3GDVA 1FY8E 3S9BA 3TPIZ 2FI3E 2Y82A 1O2YA 3P70B 1PPZA 2VIDA 2XWAA 3O8RA 1NRPH 1O2RA 1O35A 3U1IB 1VCPA 2KCAA 2P94A 2LP6A 3SU1A 3SJ8A 1SQAA 1ESTA 2BDCA 5HIZA 1YPKH 3KCGH 3UAIC 1YC0A 2ANWA 2A7HA 3BV9B 1MABB 3MU1A 3SI4H 4ISNA 3NXPA 5HM9A 1E1RD 2HOBA 2PHBA 2QGRA 2RDEA 3O8BA 1YF4A 2ZFFH 3QO6A 3RXUA 7KMEH 3MU5A 3V0XA 4BOHA 1NBMD 3HGNA 1GI4A 2ZDKA 1SGIB 3HGPA 3GYLB 4Y7AA 1DY8A 3MFJA 1QJ7B 1GHBG 2JJ2D 2VIOA 1CU1A 2H5CA 1QBNA 3A82A 1BBRH 1AVGH 4X6OA 3F2GA 1BTXA 5IDKA 1T4VH 3LC5A 1HAIH 1GBCA 1HJ9A 1HJ8A 5DP3A 3TJVA 1FMGA 3RXOA 1F5RA 2UUYA 3PROA 2R9PA 2WPHS 1BJVA 1MQ5A 4MNXA 1CT0E 1F0RA 4FETA 2GCHF 4AFZA 1XXFA 1UTKA 1BT7A 1DT2A 1KSNA 1NFWA 2OC0A 3SUDA 3VXEH 2RA0A 4WY3A 3V7TA 5DN6D 4Y8ZA 1BRUP 1NO9H 3DSPA 3EQ0H 1TBQH 1V2OT 2A31A 1GVLA 1L1JA 3PV4A 3VB5A 1SKYE 3F2FA 1O2OA 3TK5A 3ZZ6A 2ZFQH 3GY5A 3N7OA 3K9XB 1LTOA 1OWDA 2A0QB 3M7UA 4FVDA 4NGAH 4X6MA 2B5TB 1F7ZA 1A0LA 4TY7A 1GI1A 1O2QA 4ZXXH 2ZDNA 2ZF0H 1PFXC 3MTYA 4NG9H 1O3LA 1N1LA 3MHWU 4WWYA 1ID5H 3V12A 4NSVA 4I86A 1CT4E 4BXWA 4CREA 3EAJA 4IW4E 3ODDA 1UMAH 1XM1A 3Q3XA 5G4BA 3DSGA 4ABBA 1HIAB 5EQQA 4KELA 2RA3A 2VVUA 5E2PA 3BTKE 1UHBB 1DWBH 3L33A 1GHYH 4CHAB 2XNIA 4FU9A 1H9IE 3SYJA 3LGUA 2G4TA 1XUFA 2XNDD 2BD9A 2G8TA 3SNCA 4ABDA 3LOXA 1TOMH 3NCLA 2NU3E 2TGTA 5ABWA 5DP9A 1D3TB 1BZXE 1H8IH 1AUJA 2ODQA 3LIWA 3DUXH 1JWTA 2WUCA 5FCKA 1RIWB 1BA8B 2DUCA 5AF9H 1HAHH 1TA2A 2V3MA 1GHBF 2ZHFH 3MH6A 3UOUA 4AN7A 2FO9A 3GYMA 1QQ4A 4AGJA 4DT7B 1B0FA 3VGCC 3PO1C 5AFYH 4B2CA 3BTME 4MPXA 1T4UH 4OGXA 6CHAC 2BY8X 1TLDA 4AG2A 1HAVA 1DUAA 4VGCC 1JXPA 1WXRA 3FAOA 1EP6A 5C0UA 4ISLA 1C5TA 4Y76A 1GCTC 2ZTYA 4Q4LA 4X2WA 4I32A 4E05H 1GMDG 1A1RA 4CRDA 1EJMA 3SZEA 5J4QA 1P2MA 3H7TA 3ZYEA 4AGKA 1BCUH 1MKXK 2EI7A 3T25A 4ZUHA 1OP2A 3S7HB 1UTOA 2CV3A 2VNTA 1AQ7A 2W6ID 1EOLA 4RKOB 5LPEA 1ELCA 4FUDA 2D26C 1TX7A 3LGWA 3OSYA 3SGAE 3TJOA 1FY4A 1GHXH 1ZSKA 1PPHE 2GVFA 4TSFD 3A86A 3RM0H 1RTFB 2D1JA 2V7QD 1GG6B 3P8GA 2H5DA 1O3KA 1RD3B 1P10A 1AO5A 3SNAA 2B0FA 1A5HA 1Z8GA 3LU9B 2BLWA 3URCA 1LKBA 1TNJA 4MNWA 3SJIA 1MTNC 2LPRA 2XBWA 5CHAB 2JH5D 2VH6A 5CDFE 2UWLA 1EB1H 1CA8B 4Y71A 2HNTC 2PUXB 3ZVGA 2F9NA 4ZKOU 3ZVBA 1OP0A 2IOTA 2ODYB 1U6QA 1O38A 1AN1E 2V3HH 5SGAE 3QWCH 2PKAB 1GGDB 1V2JT 3PRBA 3SNDA 4A92A 6GCHG 1PPGE 5LPRA 1UO6A 1F0SA 1N6YA 1P57B 2G81E 2GCTC 3E16B 4ASHA 1GVKB 1A5GH 2HWLB 2Z3CA 2ZTZA 5GIBA
chains in the Genus database with same CATH topology
2OUAA 1YCPK 3AAUA 3S69A 4GUXA 1DM4B 5F8XA 3D49H 4R0IA 3STJA 2GKVE 4WXIA 3SJOA 1B0EA 1PQ8A 1O36A 1YPLH 2RG3A 1ZPBA 2HGTH 1KXEA 3B23B 3M37A 3ENSB 1TGNA 2JH0D 1LDTT 4OS7A 4B1TA 5HM2A 1S5SA 4LK4A 3D62A 4CR9A 1TNKA 2ALPA 3PM3A 2R0KA 4FXGH 3SU0A 1ETRH 3M3TA 1K1PA 1PPFE 5JBBS 2C8XB 2GDEH 3GY2A 5DPAA 5DP7A 2F9BH 1OXGA 4D9RA 3MO9A 3MU8A 3UOPA 1MAYA 2ZPSA 3Q3KA 5ESTE 3RP2A 3A7TA 4YZUA 1EPTB 5F03A 2F83A 1V6DA 6ESTA 2WYJA 4X1QU 2C4FH 4ZHAA 1SGYE 1ZRBA 4HFPB 2J34A 4O3UA 1EZXC 3KF2A 5FAHA 1TQ0B 1AFQC 1O5CB 3SV6A 3ZZ8A 3PTNA 2A4GA 4X8VH 3A8CA 4CRBA 5A8ZA 1DS2E 1BRBE 1HRTH 1GL0E 1ZSLA 1QURH 2VVVA 2PGQB 3EA9A 2BD3A 2CF9H 2O8WA 2J2UA 1SGEE 5A8XA 4O03A 1CBWC 1LVYA 3TGJE 4TY6A 3SU2A 1GHZA 1CSOE 1WV7H 3A7YA 1GBMA 1FAXA 3SORA 1Z6JH 5C1XA 2EA3A 3QTVH 1K1OA 1MU6B 3RM2H 4KGAA 1O5FH 1C1PA 5GDSH 1C5WB 2ZPRA 1BDAA 6GCHF 4LOYH 8GCHF 2BZAA 1WCZA 1OYTH 5EPYA 5CMXH 2J4IA 4A1TA 3MYWA 2ESTE 1BMMH 2V35A 1C1SA 1A2CH 4PROA 1XUJA 5EOKA 2BQWB 1JMOH 2ZC9H 1C1UH 1UTLM 2IN2A 4R8TB 3SO3A 4KKDA 2HLCA 1SSXA 1CT2E 2XCNA 1ELBA 2FI4E 1K28D 1GBAA 1TBZH 4ZKRU 1O3DA 5GCHG 1QA7A 1O3GA 5TCCA 3DFLA 1YCPH 3FP7E 1AY6H 1EQ9A 1FUJA 1QBVH 2F91A 2SGDE 4X6PA 1JOUB 2GDDA 1J17T 2FM2A 3MH4A 4CBNA 5L30H 4ZKNU 4A7IB 1P2NA 4YESB 1PJPA 2VGCC 2ZDAH 1XUGA 3QLPH 1HLTH 1INCA 3R3GB 4FUFA 2OC1A 1TRNA 1EZSC 1DWEH 3LJOA 2ASUB 3ZZ9A 3BTWE 1P09A 3A80A 3RXFA 1A0HB 3RXCA 1O31A 3U8TH 1DPOA 5A8YA 1NESE 2FIRH 4O3TA 2NWNA 1PYTD 4JYVH 2BDHA 1ANBA 1BTHH 1G2MA 1UVPA 1TQ7B 4BNRA 5EW2H 1Z71A 3TJUA 1TWXB 1T32A 2TGAA 2HALA 5EODA 1EXFA 1O2HA 1P0SH 1VZQH 4OS5A 1F92A 3E6PH 4Y8XA 3TJNA 4B73A 5E2OA 1Y5UT 2BXTH 3TITA 4JMYA 1A5IA 1QHRB 4NA9H 4YLQH 4DG4A 3A7XA 3MU0A 1MMJN 2R2MB 1OSSA 4FUJA 3SV8A 3LPRA 3AVZA 3C27B 2ZCKP 3M7QA 5E0GA 1ZHPA 2FODA 1KDQB 1C5MD 4YOGA 2P95A 2BQ7B 1E0FD 1Y8TA 2BMGB 2J94A 4K8YA 1ACBE 1NT1A 4UEHH 4X2YA 1TBRH 2GZ8A 4HI3A 3I78A 1GBLA 4AYVB 3S9CA 1O5DH 5AFZH 3EA7A 2BYAX 2ZIQH 3I29A 2BY9X 4IMZA 2SGPE 2Y7ZA 1W13U 5JB8S 1AE5A 4ZROA 3RXDA 3SV9A 3GCTG 2H9HA 3LDXH 1W0YH 5GCHF 1C1WH 4MTBA 3RU4T 3A7VA 4GVUA 2ODPA 1C2GA 4XSKU 5FHTA 1BMAA 1FPHH 2OQ5A 4AX9H 3MH5A 4J2YB 2OXSA 1XVMA 1UK3A 4I8LA 2HPPH 1C2EA 2UUFB 4WH6A 2F9UA 4NA8A 1W7XH 2WV4A 2VVCA 5C3NA 1Z6EA 1ZTKA 1MAXA 5E8EH 2M5TA 1VITG 3TH2H 5K0HA 2O8MA 1FJSA 3MU4A 1YP9A 1UVUH 1TE0A 2F9VA 1NPMA 3LGTA 5LH8A 3ZV8A 2O8LA 1D3QB 2WPMS 1KIGH 4X1SU 1TAWA 2KAIA 3F68H 1ETSH 3VGCB 4B2BA 1EAXA 5C1YA 3CS0A 3PO1B 3GCHC 4NZLA 6CHAB 1K1IA 4VGCB 1OX1A 1TGTA 3A8DA 4OS1A 1GCTB 3TNSA 4CH8B 5C5NA 1O3MA 5DGJA 1IQLA 1AWHB 1W10U 3STIA 4TPYA 5DKMA 1HDTH 1HGTH 4ABAA 3RXPA 2FOFA 2ZGHA 3QX5H 1OPHB 4ZAEA 3MNBA 1UTNA 1DICA 3PWCA 2FYRA 2WPLS 3NPSA 3UPEA 1W2KH 1GHVH 1FY3A 3VB4A 2BXUH 1P2KA 5DP8A 1YGCH 1L1NA 1XKAC 1IHTH 1O3HA 1ZOMA 1ELEE 1UTJA 2J38A 1IQKA 2GX4A 7GCHG 1CA0B 1D6WA 1GBTA 4UONA 3ZVCA 3UWIA 4I8HA 5HYOA 3QUMP 1AIXH 1C5UA 1MTNB 1QB1A 2EI6A 2IJOB 2YNAA 4WMFA 3GCTF 2AGEX 1C5VA 3VFEA 2A5IA 1ANDA 1JRSA 2ULLA 2Z3DA 3SUEA 5DO4H 2ZEBA 2WINI 1K1MA 1TPPA 1C5RA 3IWMA 1YPJH 2VJ1A 3A84A 2CXVA 1SGDE 2ZPQA 3GICB 1A4WH 4UFDH 1QL8A 1DSUA 4BAHB 4BTUB 1DX5M 2I6QA 2GCTB 1PQ5A 1EAWA 3RXQA 2QV1A 3UR6A 1P12E 4NFEA 1QA0A 1SBWA 1P2QA 2THFB 4U32A 3M36A 3PTBA 1P2JA 2PWXA 1C5OH 1KTTB 2TGPZ 1VITF 2QXIA 4XBCA 1HJAC 3UR9A 2AMDA 3OY6U 3LONA 1O2VA 2VIPA 5EPNA 3RC4A 3TU7H 1ETTH 4LZ1H 3RXEA 2GV7A 4OS4A 3UY9A 4UE7H 3H5CB 1ABJH 4DURA 2PKSB 3L6PA 1C2HA 1MZDA 1P9SA 1VGCC 3A7ZA 2AH4X 4F49A 1O2JA 5E0JA 5K7RA 3RMNH 2ZU1A 4BTTB 2UWOA 4JK5A 4JYUH 1EJNA 1GJ9B 3FFGA 1O33A 3U8RH 2AEIH 2QXGA 1TNIA 4ZH8A 1Y3XA 1MD8A 2A2XH 2H1UA 3T26A 3RUOA 1HCGA 1G3DA 2ZGXH 5EXNA 5FPYA 3V13A 3ODFA 5F8ZA 1ZMLA 1FLEE 2A1DB 1A61H 1GI6A 1YPMH 3A83A 3QDZB 1S6FA 1KLJH 3ATMA 1BUIA 1V2WT 1GBIA 1ZGIA 1EZQA 2VU8E 1Z1IA 1O39A 3BF6H 4ISOA 1NRRH 2FWWA 3EYDA 1AFQB 1MCTA 1SGRE 2CN0H 2WUBA 3QGNB 2BDGA 4UFEH 4WMEA 1O5AB 2PSYA 7GCHF 1AHTH 3OX7U 1RJXB 2GV6A 3HPTB 1SG8B 1YPHC 2TGDA 4A1VA 2Z94A 3TK9A 1DVAH 2BVSH 5DP5A 1QIXB 1CBWB 1O2TA 3UFAA 1C5PA 7LPRA 2HNTE 1VJAU 3HKIB 1O3OA 4DJZB 1WQVH 1Y5AT 2Y81A 1GCDA 1O3FA 5FCRA 2BLQA 2SGFE 3DT0H 1SFIA 2FTLE 3UQOA 2QCYA 5BRRE 1OWEA 1L4DA 1OWKA 1UTMA 2P3UB 4A6LA 3KEEA 1NRQH 1F2SE 2QXHA 2J95A 4Y11E 4CRAA 1XUKA 4CH2B 1K22H 1O3JA 4BAOB 1DITH 4CRFA 1O30A 1KTSB 3URDA 4CR5A 2R3UA 4INLA 3LJJA 2OD3B 2ZU4A 1T8MA 3GDUA 1O2WA 4Y0ZE 3O8CA 4KTSA 1SOZA 2ZI2H 2FLBH 4NCYA 3VB7A 2A4OA 3K2UA 5FBEA 4JCNA 1KXAA 1C4U2 3SNEA 3SHCH 2ZHDA 3BG8A 1SQTA 2BD8A 3E3TA 1ZMNA 4BAQB 1O32A 4X0WU 2BVRH 1O5BB 1NM6A 1BTWA 1CHOG 5FPSA 4Q80A 5TJXA 1OOKB 2FTMA 2ZWLH 2G52A 1BRAA 2TBSA 1SB1H 3KL6A 2OP9A 1C5QA 4DIIH 2C8WB 1O2UA 4AYYB 2P16A 3ITIA 1LCYA 3M5NA 1Y59T 1SHYA 1FPCH 3GDSA 2PW8H 2ZNKH 1XVOA 2PSXA 4MPVA 1XX9A 3HK6B 3RMMH 1LMWB 1Q2WA 2W5EA 5FBIA 3GCOA 2VH0A 2SFAA 3GOVB 1V2UT 1AZ8A 3P95A 4LZ4B 4Y7BA 1MBMA 1P02A 3W95A 3RXBA 2VWNA 1MKWH 4H6TA 3RC6A 4XBDA 2WV5A 1AKSB 4XFQA 2Q6FA 4AG1A 2FX6A 2ZU2A 3T28A 3U98H 2XW9A 1NROH 3MWIU 3RXIA 1GBEA 3SQHE 3HKJB 2SNWA 4QT8C 3UNSA 1O3CA 4GCHG 3O8DA 1FIWA 3OTJE 4K5ZA 2P3FH 3GISB 5JPMH 1AVXA 3RMLH 1J15A 4WJG2 1O3PB 1ZHRA 3KQBA 3SHAH 1A3BH 2BLOA 3OY5U 3DA9B 1SLUB 4JZFH 1BTYA 2B9LA 3DD2H 1GMCG 2ZDLA 1ZMJA 4X8SH 5A2MH 1BTUA 1ANCA 1E37B 3BSQA 2BTCE 1SOTA 1O2IA 3KQCA 2P93A 3S0NA 4INKA 1GPZA 1HIAA 4X8UH 1SGQE 2W7SA 1UHBA 2FOBA 2CGAA 4E06H 3U9AH 3RXVA 1TONA 2ZFPH 1S6HA 4FU8A 1GMDF 4FVBA 2OLGA 2ZKSA 3K6YA 3OYPA 1SLWB 2Y5GA 3M61U 1HAOH 1XMNB 1FONA 3GY8A 4MVNA 2BD4A 1O2ZA 1CHOF 3A88A 1SQOA 2ZCHP 2G55A 1ELDE 1IAUA 3ZZAA 1V2ST 1UVTH 1ELFA 2NU0E 2PLXA 1Y5BT 9ESTA 3ZZ3A 1S85A 2ZU5A 1TA6A 1XKBC 2BY5X 1JRTA 2Z9JA 2O9QA 1ZLRA 1HXEH 3RC5A 1KXBA 2A32A 5C1UA 1RGQA 3TH4H 2XCFA 3TNTA 1Z8IB 1O2NA 3SV7A 1B5GH 3FZZA 1KLIH 5GWZA 1O2KA 1FI8A 4RKJB 3GCHB 4YOIA 1QTFA 3ZZ4A 1ZGVA 2SGEE 1TABE 4D9QA 1G32B 3ATLA 1Z1JA 4D8NA 1VITH 4MDSA 4KTCA 1O2XA 2C90B 4HGCA 1V2RT 5C2ZA 3ZZ5A 3KIDU 5L2YH 1ELTA 3CENA 1K1LA 4AORA 3SGQE 1UCYE 1FN6A 1S84A 1T8LA 3OU0A 1GJ5H 1NRSH 1SHHB 1FQ3A 1GJ4H 3BG4C 3PMBB 4GCHF 1TGCA 1FIZA 2BM2A 3BTQE 1ANEA 4NSYA 4HTCH 3BEIB 4DVAU 1ESBA 2HRVA 1IQJA 2Z9KA 3QZRA 4A1XA 3TGIE 3ZZBA 2AMPA 4FUGA 3T27A 1SI5H 2A2QH 5HMAA 4Z6AH 4ZHMU 1GMCF 3ZVAA 2ZFRH 2VIVA 4NIWA 1TNLA 3BTTE 4IBLH 2YNBA 1EX3A 1P05A 1V2TT 4ISHH 1D6RA 2G4UA 1KYNA 4I8GA 4U2WA 1GHAG 1LO6A 2PKAA 1D3PB 5A0CA 1DE7H 2PTNA 1ZJDA 3BN9A 2WPJS 2OTVA 1LPZB 4IC6A 4MPWA 1HXFH 1AZZA 1BMLA 1MTVA 1NTPA 2BD2A 2H9EH 3A81A 3ATIA 1ZRKA 3ZVFA 4ABHA 1FZZA 2D8WA 4UFGH 1GWAA 3FVFB 1BRCE 3E8LA 4JZIA 1QRXA 5TCAA 3SNBA 3E90B 3A8AA 1MU8B 2ZGCA 1OKXA 3NKKA 4WXVA 1N8OC 2RDLA 1IQMA 1HAYB 2Z9GA 1C1NA 1KXDA 1PQ7A 3P8FA 1HJAB 1ZTJA 2GMTC 1JBUH 1S83A 1W14U 3F9EA 2BZ6H 4ISIH 3E1XB 1LQEA 1SGTA 3ZVEA 1DXPA 2BDBA 1T31A 1H9HE 1HPGA 1MTUA 1VGCB 1DANH 3BTGE 3LGYA 3PYHA 3CP7A 5GPIB 1C9TA 2OQUA 2QAAA 4FUCA 1H8DH 5C20A 2FS9A 1O3AA 1C5YB 1HAXB 4Y10E 4X2XA 5BPEA 2P8OC 1EPTA 2GTBA 2VWLA 2GZ7A 1LHGH 2V0BA 1SGFA 3MH7A 1BOQA 2Z3EA 4K3JA 2H9TH 2BLVA 1EKBB 2ZU3A 3SU3A 1C2JA 2FOAA 2TIOA 3ZVDA 1OS8A 3M5LA 1LHEH 2FEQH 1AD8H 3LGIA 4GHQA 1W3CA 2OC7A 4I8KA 1UK2A 2BOHB 5H4IB 2F9PA 1AB9C 3UTUH 2VIWA 4E7NA 4ABFA 1TX6A 4Y8YA 5EXLA 1IQEA 1W7GH 1GL1A 2SNVA 1G2LA 2F9OA 1N6XA 1BBRE 2ZP0H 4GLYA 1TX8A 1KXCA 4X1RU 1QB6A 3PMJA 3V3MA 3F9FA 4MNYA 2GD4B 1QFKH 1O0DH 1GHAF 1EUFA 3F9GA 1O2PA 4THNH 1XUIA 1EOJA 2ZHWH 3RXGA 1YPGH 4Q7YA 5HXFA 3AW1A 1TNHA 1HBTH 3KQEA 5FX6A 2Q1JA 1SLXB 2WPIS 1K2I1 4DY7B 1HUTH 1TALA 1UTPA 3KQDA 1QR3E 1TNGA 2LNCA 1C1OA 1EAIA 1O3IA 1RXPA 2OC8A 4BXSA 2CMYA 5JDUB 2JETC 4X6NA 5JYIA 1V2LT 2XWBI 3KNXA 1MH0A 2A5AA 3AW0A 5J4SA 2GT7A 3FANA 1QGFA 1EJAA 1FXYA 1DWDH 5T6FA 2ZDMA 1OWJA 1D3DB 4IMQA 5JBTA 4XOJA 1NU7B 2QIQA 3FP6E 3TLOA 4B75A 1O3BA 1QRWA 2Y6TA 2JKHA 1GI9B 1PPCE 1DOJA 5AVDA 3UUZA 5DJ7A 1GI0A 1O2MA 5LGOA 1EATA 2GP9B 4HZHA 1NZQH 2Z9LA 1GI7B 3BTEE 3T5FH 3SU6A 1GI8B 3JZ2B 4AOQA 1BHXF 2SGAA 4SGAE 1O3EA 4TYDA 4JZDH 3Q3YA 4AFQA 3M35A 3SJ9A 1Z8JB 1ZTLA 3EE0B 1QJ1B 1V2KT 2ZG0H 3PMHB 4K1TA 3LC3A