3B8JA

Q191a mutant of degs-deltapdz
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
184
Chain Sequence
DETPASYNLAVRRAAPAVVNVYNRGLLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNNFLATDASINHGNSGGALVNSLGELMGINTLSGIGFAIPFQLATKIMDKLIRDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title biochemical characterization of DegS-deltaPDZ q191A mutant
rcsb
source organism Escherichia coli
total genus 41
structure length 184
sequence length 212
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3b8jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3b8jA02
1GI6A 2BLVA 1SGTA 1PYTD 4IC6A 4CBOA 2J94A 1GBKA 2OD3B 4AFZA 2WPJS 3RXDA 1V2ST 2VIDA 1V2OT 5C5OA 4CRGA 1O2LA 4FUHA 1Y59T 1GHAF 1OP0A 1O3PB 1NRPH 3S7HB 1CBWB 2QXGA 4AB8A 1TE0A 1O0DH 2A5AA 3HGPA 4LOYH 1EOJA 1W14U 1GL0E 3KQCA 2FLRH 4O3UA 3RXMA 2W3KA 2FO9A 3PLBA 1QBOA 3M3VA 1MUEB 1TPPA 1O3CA 3IITA 1FONA 4E7NA 2OC8A 3MTYA 5C1XA 4Y79A 1C1NA 4I8LA 1P9UA 3MOCA 5EXLA 3GICB 1DY8A 2G55A 4NIWA 1CA0B 1EZQA 1FI8A 3B8JA 1EUFA 1P06A 3GCTG 3RXLA 1E35B 3Q3XA 1O2YA 2VWMA 1XM1A 1EZUC 2FI4E 1GMDF 4ABGA 1ESBA 1BTXA 1GBJA 3RC5A 1HJAC 3E8LA 3GCNA 4O3TA 1V2QT 1UTNA 1W0YH 2G8TA 2FS9A 1AI8H 2GZ9A 4ABJA 3MWIU 1Z6JH 3URDA 1CVWH 2FOFA 1IHSH 4ABAA 3GY3A 4MNWA 1CU1A 3M37A 1O3BA 1J15A 2ANKH 1ZGIA 1NFUA 1AE8H 1F2SE 1IQGA 3SNCA 1BRCE 1CT4E 4ASHA 1P57B 1Z7KA 3A80A 1CSOE 2XRCA 1ETTH 3ELAH 1GJDB 1NESE 1P2OA 4OS6A 1AU8A 4LZ1H 1NT1A 1FMGA 4B2BA 3NCLA 3PLKA 5C3NA 4FUFA 3LU9B 9ESTA 2Y80A 5A09A 5EQQA 1Z8IB 1DPOA 1OPHB 2OBQA 3EA9A 5CHAB 1EKBB 1YPLH 2FI3E 3A8BA 3TPIZ 4DCDA 1L0ZA 4UONA 3SV7A 1O3IA 2WYJA 7GCHG 1ANEA 1FPHH 2FOBA 3M5LA 1GI4A 1O3LA 1TOMH 2FIRH 1LKAA 1RFNA 3ZVFA 1ORFA 3Q77A 4B1TA 1VJAU 3E16B 5FBIA 1SB1H 4NWLA 1CQQA 4K1TA 1SFQB 2O8WA 1HNEE 1PFXC 1FIZA 2HNTC 2FOEA 3M5OA 1HPGA 4NFEA 5ETXA 1B0EA 2ZECA 1PQ8A 3QZQA 3RXBA 2Z7FE 1MZDA 3A8DA 3KEEA 1GMCG 1PQAA 1IQFA 2CGAA 2B9LA 3GCOA 5T6FA 2EI7A 3PYHA 5FX5A 1Z71A 3SNEA 5L2YH 1MTVA 1GI8B 3FP8E 2OBOA 1EAWA 1F5RA 2VGCB 2YNBA 1EJMA 3S9CA 4CR5A 1C2HA 4Y0ZE 4BANB 1IQHA 5IDKA 3ODFA 4FUGA 1O3OA 5JB9S 5LPFA 1FUJA 3BIVH 3GDVA 4FXGH 2F9NA 2BDYA 1TRMA 3UQVA 1E37B 3SU2A 2EI8A 2FESH 3IWMA 1UTKA 4FUEA 1LTOA 4B74A 1O36A 1AZ8A 4U2WA 3EAJA 4ZAEA 4CHAB 2ANMH 2BQ6B 2A5IA 1EB2A 3LJJA 1P2KA 1XXFA 1ESAA 2XYAA 3GOVB 4UD9H 4I8HA 1QCPA 4A1VA 4AFUA 2GVFA 1VITG 1JOUB 4AFSA 1C1WH 2HLCA 1SR5C 2OQ5A 1G32B 1PQ7A 1ABIH 3PO1C 3BTTE 1O3FA 3E6PH 2ZNKH 3K65B 1OXGA 1O34A 2SNWA 3S0NA 2QYIA 2W3IA 2JETC 1JMOH 3MU4A 1P8VC 3ATLA 1LVOA 2ZGBH 3MNBA 1F0TA 1O2KA 1LHCH 2J9NA 2AFQB 2Q6GA 5TCAA 1O5AB 1G2MA 3PWBA 1KTSB 1GMHF 1O3EA 1EAUA 4OS2A 5A8XA 1O2MA 1QL9A 3A86A 3H7TA 1C2JA 1Y3VA 1F0SA 1SC8U 1IAUA 5EQSA 1EOLA 3SUDA 4AN7A 2VIPA 2YOLA 5GXPA 2TBSA 2G81E 2CHAB 1S6FA 4B2CA 3S69A 1QA7A 4YTAA 1C5VA 3ZVAA 3SHCH 1EJAA 2O8MA 4ZKOU 4D8NA 5LGOA 1MU6B 2JH6D 2PR3A 1C2KA 1O2VA 2FYQA 1F5LA 1A5GH 3MU1A 3S9AA 1V3XA 2STBE 5BPEA 1Y3YA 2BD8A 5C1YA 1SOTA 1QQ4A 2AGGX 3BEUA 1DXPA 2BX4A 4WMDA 4K60A 1TNIA 3BTFE 4YOIA 4BAHB 1C4Y2 3TJNA 1GI9B 1KXFA 3MMGA 1O2WA 1TRNA 1BIOA 1TA2A 1OWEA 1SLVB 1GBTA 2IPHA 4I32A 1TAWA 1LKBA 4YO9A 1ZRKA 1TQ7B 1NZQH 1O2IA 1GPZA 2BOKA 3MNXA 4Q7YA 3R3GB 4AB9A 4WMFA 2ALPA 1BB0B 3RC4A 2ASUB 1DDJA 1D3QB 1L1NA 3F9EA 1P11E 1BHXB 4A7IB 1UHBA 4WJG2 1BMNH 2BXUH 3QK1A 1E0FD 3E0PB 1WUNH 2FOAA 3BTEE 3OTJE 3A87A 4QT8C 1JRSA 4O03A 2XW9A 1FQ3A 4THNH 4TPYA 5DJ7A 1AFEH 2B0FA 3M7UA 3ZZCA 1HAIH 3OY6U 1TMBH 2O8UA 2A7HA 4ABFA 3A81A 4KKDA 3QZRA 5FHTA 4X1QU 2WPMS 1J9CH 3ZV9A 4Q7XA 1T4VH 1Y5UT 2F83A 2BB4A 2H5CA 1L2EA 4WWYA 2ZDVH 5K7RA 4XFQA 1C4V2 2F9UA 3E91A 3F6UH 1S85A 4DVAU 3DUXH 2FTLE 2TRMA 4WVPE 1TRYA 2EEKA 5AFZH 1ANBA 1O3NA 1W12U 3M36A 1V2RT 1D3PB 1FY3A 4IN2A 1UTLM 2PHBA 4M7GA 1K1PA 5ABWA 3GY6A 2UUJB 3C1KA 1GCDA 2ZF0H 1O38A 1YBWA 2CF8H 4X6NA 1GI2A 2XCNA 1F0UA 2ZU4A 4ZMAH 1O35A 1AWFH 1OWKA 4X0WU 1IQLA 2LPRA 3BTDE 1ELDE 1Z1JA 1O2UA 1SQTA 3P92A 1UCYK 1GHYH 2ZGXH 1TNHA 3UIRA 2OINA 3V13A 1QBVH 2ZHDA 1P04A 2J92A 1C1QA 4U01A 1DXWA 1UJ1A 3MYWA 3SQEE 4JMYA 3TJOA 1CHGA 3RMNH 3ZZ8A 1TGSZ 1C9TA 2PKSC 4NIXA 3PMBB 4FUJA 3U9AH 2XCFA 1PPBH 4Q2KA 1H8DH 1OYTH 4K2YA 1WCZA 1XX9A 2PUXB 1BHXF 4CH8B 1P10A 2PGQB 1NU7B 8GCHF 1YPHC 4MVNA 1WV7H 3MU0A 2BD9A 1ABJH 1O2GH 1GDQA 1AZZA 3I77A 4JZDH 4GLYA 1IQNA 1GJ5H 5FPYA 1DUEA 2D1JA 2PWXA 4AYYB 1HRTH 2A4QA 1L1GA 2FI5E 1AN1E 3M5NA 3SNBA 2ZDLA 4H6TA 2ZDKA 3AVZA 2UUFB 4JZFH 3BTHE 5FCRA 1CGIE 1A3BH 1TGNA 2BQWB 3AAUA 2NWNA 1OOKB 1ZSKA 1WQSA 3UTUH 1ESTA 1ID5H 3LDXH 1YCPH 5PTPA 3SV8A 4ISHH 1OS8A 3QUMP 2RDLA 1O2NA 3TU7H 2OQUA 1LPKB 1QB6A 1RS0A 1MBQA 1G36A 1SFIA 1BJVA 1INCA 1XMNB 2A4OA 2ZU2A 3A7XA 3MO9A 5DP3A 3RU4E 3TK5A 3KCGH 1SHYA 3P17H 1NFYA 3TNTA 2ZDMA 2QGRA 1EPTA 1ELBA 4RSPA 1BBRH 1HIAB 2QY0B 3BIUH 4KTCA 4DGJA 1DLKB 2DE9A 4DIHH 1XUHA 1P3EA 1QY6A 1SPJA 1ELAA 5EOKA 1V2TT 5L30H 1MCVA 1BTUA 4D9QA 1HAVA 3WY8A 1GHZA 2ZCHP 2Z3EA 1TONA 3UWIA 4BTIB 4YOJA 5JB8S 2UWOA 4OS5A 1YLCA 1Q3XA 1QHRB 2BVXH 3TJUA 1NC6A 1U6QA 4ABDA 3SU4A 2WUBA 1AFQC 2J2UA 2AMDA 3D49H 1Y5BT 2Z94A 1ZSJA 4AG1A 1XUJA 1C2MA 1D4PB 3B9FH 1BCUH 4MNXA 2PSXA 3SJ9A 3W95A 2Y5FA 2ZHQH 3TJVA 1GBDA 1SLWB 2A32A 2FP7B 2Y7ZA 2F9BH 2B5TB 1QB1A 3HK3B 4JZEH 2Y81A 2XTTB 1OYQA 5J4SA 1S84A 2PW8H 1T8OA 4ZH8A 1QRXA 4NA8A 4Y8ZA 1TBRH 5C1UA 1ZYOA 3PO1B 1TMTH 1PPCE 1OKXA 2BLQA 1AVWA 5E0GA 1F7ZA 1NRQH 1ANCA 1EPTC 2OP9A 3PROA 3Q76A 3T2NA 1GHAG 2P8OC 2P16A 1DX5M 1MKWK 3DT0H 3TK9A 1THRH 2BDBA 2H1UA 3UFAA 1IQIA 3KQEA 3EYDA 2JETB 3ZZ5A 2HALA 3FP7E 2A31A 3LGIA 2G5NA 1HFDA 4IS5A 2GV6A 2BD3A 4OGXA 2UWPA 1TQ0B 2R2MB 1J8AA 4B76A 1MAYA 5HXFA 1TFXA 3I78A 3BG4C 3BEFB 4CRAA 2V3OH 1SGFG 3SU6A 4NWKA 3NWUA 1GJ9B 3QGJA 2A0QB 1LO6A 3RXHA 1BRBE 4ZUHA 3TH3H 4TY6A 1SGRE 3L33A 4SGAE 2BDIA 2JH0D 1C2DA 2Q6FA 3A8AA 5I46H 1MD7A 2EI6A 5E2PA 4NA9H 1P03A 1HJ8A 5E2OA 1RTLA 1YYY1 5EU8A 3M3TA 1O3KA 1P01A 1D6WA 4U32A 4ABBA 3P8OA 1AE5A 4UFFH 3VB7A 4X6MA 1DVAH 4R0IA 1LQDB 3LONA 4R8TB 3P8NA 1C5UA 3ATMA 2ZTYA 2ZHWH 2Q1JA 1TLDA 4ZHLU 2P3FH 1VGCC 4JZIA 1ZTJA 1FY4A 2XWBI 4NIYA 4RN6A 4ZROA 2QCYA 1K28D 3RXFA 4Y8XA 2GDEH 4WXIA 1FDPA 1AVGH 2J34A 4X8VH 3BEIB 1OWIA 1XKBC 1G3EA 2FXRA 1QTFA 4MDSA 1KXAA 1DSUA 3ZZBA 1ELVA 1ZTLA 1S6HA 3PMHB 3K9XB 3PTNA 1SGNE 2ZPSA 4MQAA 1OSSA 2VIQA 3PWCA 1ACBE 1UTMA 2STAE 1GGDC 1V2LT 2R0LA 1HUTH 3ZZ3A 4YM9A 2ZEBA 7LPRA 1AHTH 1YPJH 3SUFA 2I6SA 1FN8A 1SLXB 2XBXA 2IN2A 1YPMH 1NM6A 2QF0A 1DANH 1S82A 1WQVH 2BY6X 5EODA 1UVPA 3RXRA 3EA7A 6GCHF 2QXJA 3F9GA 3ODDA 3TH2H 3GY8A 1UK3A 5EG4A 1HXFH 2FS8A 2Z9JA 4KELA 1GWAA 4X1PU 4YESB 2ZFSA 1ZHRA 2XBWA 1TX8A 1O2OA 1FN6A 2Y7XA 3V7TA 4JYTA 2F9OA 1IHTH 4KP0A 3FZDA 3ZYDA 2ULLA 3LGVA 4GHTA 5FPSA 4YT7H 3ZZ9A 1CT2E 1QJ1B 2AIPA 1FY8E 1J14A 3P70B 1HGTH 1TMUH 2VNTA 5E8EH 3EGKH 2BD7A 3SHAH 3ZVDA 2PKSB 1MTNC 1ZOMA 4K3JA 1RXPA 5JYIA 1SHHB 1C5ZB 2FX6A 4INKA 3TVJB 4AG2A 1DLEA 1TB6H 5DP8A 2PKAB 3SV6A 1O5GH 1HAZB 1C1PA 3RXUA 3F9FA 4YLQH 3ZVEA 1OP8A 1S0QA 2RCEA 3VFEA 4DIIH 2A7JA 2ZG0H 4WH8A 2H9HA 1LHDH 1TX7A 5FX6A 1DWDH 1A0HB 1FAXA 2KAIA 1KDQA 1P0SH 4X2YA 4INLA 4ABEA 3VGCB 1MKXK 4K5ZA 5L2ZH 1W0ZU 4ABHA 1ELGA 3CS0A 4WMEA 3IG6B 1FZZA 2A2QH 1GVKB 2J95A 1Y5AT 3FFGA 4ESTE 3FVFB 1N6YA 4GCHF 4WF8A 1V6DA 1K2I1 1V2JT 3HKJB 1ZSLA 5EPNA 3BTME 3RXIA 1HAGE 2P59A 1P12E 3A89A 4HI3A 1TPSA 1ZJDA 2WYGA 1GVLA 3ZVGA 2AGEX 3SOSA 1EP6A 1DICA 3DHKH 2WPKS 3MH5A 4Y7AA 3U8RH 3RM2H 3GY7A 1W8BH 4HTCH 3LGUA 3K6YA 4J2YB 1SGFA 1B5GH 5GIBA 3UPEA 1ZPZA 2GGVB 1H9LB 2BD5A 3U8TH 2Z9GA 3EE0B 2SGEE 3SNDA 4J1YA 1NO9H 2ALVA 1O5FH 1QNJA 1SSXA 2ZHEH 1K21H 1BMLA 2GZ8A 3TK6A 1S81A 2OC1A 2RA3A 4K1SA 1A7SA 3UWJH 2CMYA 2K1QA 2UUYA 1WTGH 1L4DA 1BT7A 4CRFA 1TGBA 4GPGA 4CRCA 1P09A 1AFQB 1GG6C 1NPMA 4X1RU 5IYTA 5A0CA 2R3UA 3O8DA 1K1MA 3T29A 2HPQH 5DPAA 2ESTE 3VB3A 1NROH 3GY5A 3MNCA 2SNVA 5LPRA 3SU1A 2GT7A 1G3BA 2C3SA 1GDUA 2AYWA 1DWEH 3KHVA 3RM0H 3RXPA 1MU8B 5EXNA 2W5EA 1ZGVA 4DG4A 4XBBA 1V2WT 2SGAA 1BMAA 3RP2A 5F8ZA 1GCTC 5A2MH 9LPRA 4Y11E 1W2KH 2F91A 1GJ4H 3GCHC 3ZZDA 1AB9C 4X8TH 1GHBF 4Y76A 1K1LA 3NXPA 2NU1E 1GMCF 1QQUA 3BG8A 3SV2H 2SGDE 2F9VA 1CHOF 1W11U 4CBNA 5AVDA 2QV1A 2ZFTA 4MNYA 1P2IA 3TGJE 4X8UH 1BA8B 1PPFE 3KNXA 4AFQA 2VWOA 1BTPA 2EA3A 1EAXA 4IW4E 3W94A 2P3UB 3B23B 5DGJA 2FODA 2BX3A 1LCYA 2RG3A 3STIA 2Z3CA 2ZFRH 2IOTA 3RXTA 1C1MA 1Z8GA 3JZ2B 3QWCH 1X7AC 3VB6A 1O2QA 3UR9A 3BG4B 1RJXB 2BLWA 4NA7A 1QJ6B 1A5HA 2W7SA 3ZZ7A 2QIQA 2ZCKP 1V2VT 2ODQA 4UEHH 2VU8E 4ZXXH 3S9BA 1TNJA 1ELTA 3U1JB 1GI0A 2H9EH 3NKKA 2V3HH 2C4FH 1OX1A 2ZGHA 4AGJA 4NGAH 1ZPBA 4JCNA 2Y82A 2NU2E 6CHAC 1RD3B 2AMQA 2PGBB 1O2PA 4OGYA 4FU7A 3A88A 1W7GH 1FLEE 3O8CA 1C5PA 1A5IA 2ANYA 2GMTC 3MHWU 1AVXA 3LGTA 1P2QA 1C2EA 2BDHA 1WU1A 4CR9A 3UOPA 3VXFH 3STJA 2HRVA 5JPMH 3A7TA 4FU9A 1C5QA 4X6PA 1W3CA 4OS7A 2BTCE 1UVTH 1WBGB 5DP7A 1AQ7A 2GCHF 5I25A 1MMJN 1VGCB 4X2VA 5HM2A 2AS9A 3UY9A 4XE4A 1LHEH 3OX7U 2TGTA 1UTQA 4BTTB 3M61U 1RTFB 5GDSH 1UTOA 1V2UT 4H4FA 4NSVA 1JIMA 3SJOA 1D3DB 8GCHG 4WY3A 3QTVH 1HCGA 1HAXB 1PPGE 1AUJA 1O2XA 3UNQA 1O3HA 1ZTKA 4X8SH 5E0HA 4B2AA 4H42U 5H4IB 4BAMB 4I31A 3ZV8A 4Y7BA 8KME2 1G37A 2ZP0H 2B8OH 1TOCB 4LXBH 4E05H 6LPRA 1EB1H 3ZZ4A 3L3TA 1CE5A 2ZFPH 1ZLRA 1PQ5A 2HGTH 1G3DA 2C8XB 1K9OE 4LZ4B 1XVMA 5T3HA 1AUTC 1DUAA 1HJAB 5AF9H 3P6ZB 2AIQA 2FTMA 3QO6A 2XXLA 2JKHA 3Q3KA 5A8YA 1W10U 1GL1A 1KYNA 1QBNA 1YP9A 5F6MA 1C1OA 1Z6EA 3AASA 2G00A 3LJOA 1YKTA 1LPZB 1HLTH 3BTQE 2W7UA 1V2PT 3RXCA 3A82A 4IMZA 4ABIA 4B73A 1TIOA 5GCHF 3RUOA 2CV3A 3D62A 4ISIH 1DM4B 1GJBB 3LGYA 7KMEH 1ZMLA 1VJ9U 3RXGA 1T32A 1BTYA 3LPRA 1UCYE 4MPVA 2HOBA 4JK6A 1GBEA 3LIWA 1DS2E 1C5LH 2ZIQH 1Z8JB 2QC2A 4PROA 2FZZA 2P94A 1LDTT 1MTNB 3RXSA 1A0LA 1KY9A 1XKAC 2FYRA 4Y10E 1UVSH 1C9PA 4O9VA 2XC4A 1DFPA 5CHAC 3TITA 1PPZA 4E7RG 3EQ0H 4OS1A 1LPGB 1UCYH 5DKMA 3RXVA 3A83A 1LVBA 4Y71A 3MNSA 1JRTA 5A8ZA 2JH5D 1YCPM 4UE7H 3KQDA 2ZQ2A 1FPCH 3MU5A 2ILNA 5DP5A 3GYLB 2O8TA 5FXLA 1HBTH 3VPKA 2SFAA 1IQEA 1N1LA 3FZZA 3RLYH 3NUMA 3LH1A 3SJIA 4FUBA 6ESTA 2R0KA 2C8YB 1LQEA 1MAXA 3HATH 1L4ZA 1UTPA 5C2ZA 4AOQA 1BJUA 2BZAA 2H5DA 3PMJA 1EXFA 2C8ZB 4F49A 5BRRE 2C93B 3M7TA 4F4OC 3RMOH 2QF3A 2C90B 3H7OA 3Q00A 2VWNA 5DP9A 2V6NA 3SQHE 3U1IB 4A1TA 4AGKA 2FLBH 3UR6A 3G01A 5CMXH 2WUCA 1P3CA 4HGCA 2G4TA 4ISNA 4AYVB 2P93A 1C5YB 3GISB 4UDWH 2O9QA 2FDAA 3BTKE 2BD2A 1KLTA 2BVRH 5JBCS 2Y5HA 2ZHFH 1GHVH 1KTTB 1TPAE 3A84A 2TIOA 4K8YA 1KDQB 1O5BB 1GG6B 2ODPA 3SU3A 4YOGA 2ZA5A 1MBMA 1HYLA 4JZ1A 1BRUP 4DURA 3PTBA 1QJ7B 2EC9H 1Y3UA 1YM0A 3SORA 1F0RA 1THPB 3RXKA 1VCWA 2BY8X 1C5XB 1SGQE 1O5DH 1O31A 3ZYEA 2FEQH 3RLWH 1EATA 1JIRA 3PM3A 4B71A 2HNTF 4WH6A 3GDSA 1UK4A 5AFYH 1QL7A 2P3TB 2PFEA 2AEIH 2GDDA 3SU0A 1W7XH 1S5SA 1SGIB 2G51A 3F9HA 3GCHB 3QTOH 4X2WA 3URCA 1AB9B 4FVBA 4LK4A 1WYKA 4YLUA 2CF9H 3GY2A 1HAPH 3V3MA 4BNRA 3UREA 1HB0B 2Z9IA 5L6NH 4MTBA 1FXYA 1TABE 3SGAE 1QB9A 1E34B 4JK5A 3SBKA 1S83A 1NN6A 4GVUA 2NU4E 1L1JA 1KXEA 1GBFA 1XXDA 5TJXA 4X2XA 1JWTA 3VB4A 3MU8A 2PV9B 3EA8A 1KXDA 1O39A 1GMDG 4TWWA 1V2KT 2VINA 1O37A 4DT7B 2A2XH 2CJIA 2ZGJA 1GBCA 3V0XA 2ZU3A 3RU4T 2WPLS 1TBZH 1MKWH 1LHGH 3T5FH 4ISOA 1DE7H 2VIWA 3T28A 6GCHG 2ZC9H 1P2MA 3LGWA 2R9PA 1IQKA 2VVCA 4CRBA 4ZKNU 2Z6BD 4A5TS 4I7YH 2OC0A 3OY5U 1C1UH 1FY5A 3K2UA 2GT8A 2Y6TA 2GMTB 5G4BA 1ZHMA 2D26C 2ZTZA 2VWLA 3BF6H 3U98H 4DW2U 2FMJA 2ZFFH 1KLJH 3N7OA 1VR1H 2GCTC 1QRWA 3NK8A 1LVYA 1Y3XA 2I6QA 5FPTA 2BDAA 4AORA 1QURH 1V2NT 2B7DH 3FP6E 3UUZA 3RXEA 1H4WA 2GP9B 4A6LA 3RXOA 4X6OA 2J38A 3M7QA 2ANWA 2QXHA 1A46H 5HYOA 1QIXB 1ANDA 1YF4A 2BVSH 1EQ9A 2TGAA 1GBBA 1OWDA 5K0HA 1GJAB 4XDEA 5LPEA 2Z3DA 1ZZZA 1J16A 1C2GA 2F3CE 1SG8B 4JYUH 1JXPA 4BXSA 2R3YA 1TGTA 5JBTA 2BD4A 3D23A 4Y0YE 5F03A 1WTHD 3RXQA 1HXEH 2V35A 4KTUA 3RXAA 7ESTE 4K1EA 2BDCA 4NG9H 2HWLB 4CRDA 2SGFE 1RIWC 2Z9LA 1C5WB 1ZMJA 1YGCH 2GTBA 4GCHG 1C5TA 5EW1H 4NZLA 4X1SU 1Q2WA 1SGCA 3SI3H 1YPKH 3U8OH 4IBLH 2W26A 2PSYA 3ITIA 2J4IA 2VIOA 3KQBA 3E3TA 3A8CA 3HK6B 1UHBB 3MFJA 3OU0A 1ELCA 3UQOA 3TGKE 1HV7A 1KSNA 1RTKA 5EQRA 4O97A 1O2HA 4GSOA 1HIAA 5SGAE 4FUIA 1ELEE 1AKSA 1O2TA 2HNTE 2WV4A 3V12A 1NRSH 1KXCA 2D8WA 3SU5A 4MLFB 2PTCE 3DFLA 1BUIA 4A1XA 1C5OH 1WOFA 4UFDH 5EXMA 4Y8YA 5LH8A 3UNRA 3BN9A 4CH2B 3M5MA 1DITH 1C1VH 1A1RA 5FAHA 1DSTA 1JBUH 5T6GA 1MZAA 1XUFA 4BXWA 2WPIS 1Q31A 3PV4A 2QXIA 3FAOA 4ZKSU 3F68H 5TCCA 3VXEH 1ZPCA 4DOQA 3GCTF 1CGJE 3D65E 2G5VA 1ETRH 1P2JA 1PPEE 1C5MD 2ZPQA 3MH6A 1CA8B 2G52A 1VZQH 4GUXA 1K1IA 4B75A 2ZO3H 1C2IA 4GAWA 1SGDE 2ZKSA 1BITA 1MCTA 1T8LA 4IC5A 4MG3A 1T4UH 3MH7A 1GMHG 1GHBG 3MI4A 5FBEA 5HGGA 2OLGA 4ZXYH 1O5CB 1CHOG 2CN0H 4DY7B 1UMAH 4IN1A 1T31A 5T6DA 2F9PA 2H2ZA 1NRNH 2BM2A 1QRZA 1O3JA 1QGFA 2ODYB 4BTUB 4HFPB 3KIDU 1PPHE 3BTWE 2ZU5A 3RMLH 1B0FA 1O3GA 3TGIE 1GI3A 1H9HE 1MKXH 5DO4H 4TWYA 3A7VA 1FY1A 2HPPH 2ZI2H 2R2WU 2ZZUH 1LVMA 2BY7X 1TWXB 4IGDA 3HGNA 3RC6A 2XC5A 3QDZB 3U69H 2VVUA 1SBWA 2VH0A 7GCHF 1UO6A 4FUCA 4TYDA 2RA0A 1EASA 5E0JA 1O5EH 1O3MA 1TNKA 2UWLA 2GZ7A 3BSQA 2FOGA 1C4U2 3ZVCA 4DJZB 5EW2H 2BLOA 3P8GA 3TH4H 2BYAX 1G3CA 5GPIB 5JDUB 1O30A 2OTVA 4K69A 4NSYA 1C2LA 2BZ6H 3KGPA 2GKVE 4NCYA 3A7YA 1DY9A 8LPRA 2PLXA 1EPTB 3SUEA 2NU3E 2P8OB 2GCHG 1UK2A 4INHA 2Q6DA 2NU0E 1N8OC 3LC5A 1A2CH 4WXVA 4XBCA 4TY7A 3T62A 1ARCA 2QN5T 1TYNA 1BRAA 2ZGCA 1HAVB 2A45B 4A92A 4FU8A 1HDTH 1ZHPA 2FOMB 4VGCC 4XOJA 2TGPZ 3LT3A 3ATKA 3AW1A 3TIUA 3SI4H 4D7FA 3P8FA 4KTSA 3NZIA 1FAKH 3TNSA 3MH4A 3E90B 3AW0A 1G30B 1G2LA 3M35A 1VCPA 1O3AA 1EZXC 1P05A 1DT2A 1GJ7B 2D2DA 4I8JA 1GI1A 8ESTE 1GBLA 3H5CB 1CO7E 4Q7ZA 1NY22 3ESTA 1ARBA 2WPHS 1SQAA 3ZVBA 1E38B 2DUCA 1P02A 4Z0KA 1DOJA 1LHFH 1M9UA 2P95A 1H8IH 1SGEE 4AX9H 3GDUA 4NZQA 1TA6A 3NPSA 3A7WA 4X1NU 1THSH 1KIGH 1BOQA 1ELFA 3RXJA 1VITF 5C67A 4BAQB 1QR3E 2A5KA 4FVDA 3KN2A 3S7KB 3SUGA 1O3DA 1YC0A 1T7CA 3M3SA 4RKOB 5EGMA 4SGBE 5GCHG 2ZFQH 1TPOA 1HAHH 2GX4A 1AD8H 3O8BA 2WINI 1CBWC 3P95A 4ISLA 2SGPE 5F8TA 2GCTB 1D3TB 4NIVA 3BTGE 1BQYA 1C1SA 1SI5H 1GI5A 1TALA 4MPXA 2FPZA 3T26A 2SGQE 4Y6DA 1BZXE 3VEQB 2H6MA 1D9IA 1FIWA 1SGYE 4K8BA 1AGJA 1TGCA 1F92A 3SGQE 3A85A 4I8KA 1QA0A 1SGPE 1Z1IA 4H6SB 1ETSH 2XC0A 2ZCLP 1SMFE 2A4GA 2ZPRA 2VJ1A 1CA0C 1GGDB 5DP6A 1BTZA 2PKAA 1EP5A 1CT0E 2Z9KA 1NFWA 2YNAA 2VH6A 3A7ZA 3HPTB 2OC7A 1MTSA 4I8GA 1MD8A 1CGHA 2VB0A 2CXVA 1A61H 2Y5GA 2PTNA 1EZSC 1XUIA 2THFB 1O2SA 1QL8A 2BHGA 2AERH 1IQJA 3EDXB 3HKIB 1YPHE 1D6RA 2A4RA 1RIWB 1IOEA 4GHQA 3CP7A 3DA9B 1OWHA 1LMWB 2A1DB 3RDZA 3SNAA 2XWAA 2XBVA 2AGIX 4HZHA 1WAYB 1C1RA 1ZR0A 3ZZAA 3ATWA 1NS3A 2BXTH 2QA9E 5F8XA 1A3EH 1O32A 4ZHAA 5C20A 1YCPK 2TPIZ 5JBBS 3KF2A 1SOZA 5C5NA 1OP2A 1WSSH 1HAYB 2OCVB 1SVPA 1DWBH 4FUDA 3QGNB 3PLPA 3SJ8A 4XBDA 4D76A 1V2MT 3SGBE 1EX3A 1E36B 4Z6AH 2HVXA 3AAVA 1UVUH 2H9TH 5AHGH 4JYVH 1BBRK 1ZRBA 1ZMNA 2A7CA 1C5RA 1NU9A 5JBAS 1KLIH 1RGQA 1GDNA 1BMMH 1PJPA 3R0FA 1J17T 1O2JA 4YZUA 2OXSA 1K1OA 2C8WB 2ZWLH 4UFEH 1GI7B 1XUKA 2FX4A 3VGCC 3O8RA 4I33A 3RMMH 3SW2B 1VCQA 5HM9A 1Y3WA 5A0BA 5ESTE 1MTUA 4RKJB 1H1BA 3LC3A 1TNLA 1SQOA 1NTPA 1BBRE 1BDAA 3OSYA 4MPWA 1Z8RA 2ZU1A 1MTWA 1GJ8B 5EPYA 4D7GA 1AY6H 2BY9X 1C5SA 4MPUA 1AO5A 5GWZA 1MQ5A 1EAIA 1SLUB 2AMPA 2FOCA 2VGCC 3TLOA 4E06H 3C27B 1KXBA 2ZTXA 3LOXA 1C1TA 3SO3A 1IQMA 3JZ1B 4XSKU 1O33A 4NFFA 1AWHB 4YT6H 3T25A 1W13U 1AKSB 3LH3A 3FANA 4MNVA 3VB5A 1F5KU 4OS4A 1AIXH 3SV9A 3I29A 1VITH 2GV7A 2ZDNA 5GJ4B 3GYMA 4BAKB 2FOHA 3K6ZA 3QX5H 1A0JA 1BTWA 1GBIA 1O2RA 4CREA 4CHAC 5CE1A 4IMQA 1HJ9A 1YLDA 1FJSA 1GJ6A 2BY5X 4BOHA 2BOHB 1HAOH 2KAIB 2XNIA 1OWJA 3DD2H 1RRKA 1BTHH 1DWCH 3ATIA 1QFKH 1XUGA 1GVZA 3PMAB 3L6PA 4AZ2B 1NFXA 1TBQH 3Q3YA 3ZZ6A 1GBHA 1YPGH 1C5NH 5DK1A 2M5TA 1P9SA 5HMAA 2DE8A 4ZHMU 2ZQ1A 2BQ7B 3UNSA 4U30A 2GD4B 2VIVA 2ZDAH 2V0BA 1GCTB 1S0RA 3T27A 1PYTC 3PB1E 3KL6A 3BV9B 2BMGB 1FV9A 1GBAA 3UOUA 2O8LA 3SN8A 1UVOA 3MO3A 2OUAA 5DP4A 3SJKA 3DFJA 1N8OB 5DG6A 1YPEH 1GHWH 1O2ZA 1UTJA 2BDGA 1T8MA 2FWWA 5J4QA 4UFGH 2QAAA 5ESBA 1K1NA 1GJCB 1ZJKA 3QN7A 2CHAC 1Y8TA 3E0NB 3GY4A 1TX6A 1FNIA 1N6XA 4VGCB 5A0AE 3RU4D 3QLPH 1TNGA 3E1XB 3ENSB 1B7XB 2IJOB 1T8NA 3MO6A 2VVVA 1A4WH 1H9IE 3CENA 1C2FA 2WV5A 2LNCA 1SL3A 3LKWA 4ZKRU 2TGDA 1K22H 3F1SB 5FCKA 2FM2A 1XVOA 3OYPA 1GHXH 1K1JA 1G9IE 3SZNA 2PUQH 1GBMA 3CS7A 4KGAA 6CHAB 2AH4X 1AMHA 4BAOB 2XBYA 1EJNA 2UUKB 1P2NA 1MQ6A 1MH0A 2G4UA 4D9RA 4TPIZ 4Q80A 5B6OA 1NRRH
chains in the Genus database with same CATH superfamily
1GI6A 2BLVA 1SGTA 1PYTD 4IC6A 4CBOA 2J94A 1GBKA 2OD3B 4AFZA 3FN8A 2WPJS 3RXDA 1V2ST 2VIDA 1V2OT 5C5OA 4CRGA 1O2LA 4FUHA 1Y59T 1GHAF 1OP0A 1O3PB 1NRPH 3S7HB 1CBWB 2QXGA 4AB8A 1TE0A 1O0DH 2A5AA 3HGPA 4LOYH 1EOJA 4ACAA 1W14U 1GL0E 3KQCA 3F0PA 2FLRH 3N7EA 4O3UA 2M2AA 2W3KA 3RXMA 5DSFA 2FO9A 3PLBA 1QBOA 3M3VA 1MUEB 1TPPA 1O3CA 3IITA 1FONA 4E7NA 2OC8A 3MTYA 5C1XA 3GS9A 4Y79A 5HIZA 1C1NA 4I8LA 1P9UA 3MOCA 5EXLA 2WPDD 3GICB 1DY8A 2G55A 4NIWA 1CA0B 1EZQA 1FI8A 3B8JA 1EUFA 1P06A 3GCTG 3RXLA 1E35B 3Q3XA 1O2YA 2VWMA 2YMSC 1XM1A 1EZUC 2FI4E 1GMDF 4ABGA 1ESBA 1BTXA 1GBJA 3RC5A 1HJAC 3E8LA 3GCNA 4O3TA 1V2QT 1UTNA 1W0YH 2G8TA 2FS9A 1AI8H 2GZ9A 4ABJA 3MWIU 1Z6JH 3URDA 1CVWH 2FOFA 2QE7D 1IHSH 3DSOA 4ABAA 3GY3A 4MNWA 1CU1A 3M37A 1O3BA 1J15A 2ANKH 1ZGIA 1NFUA 3N99A 1AE8H 1F2SE 1IQGA 3SNCA 1BRCE 1FX0B 1CT4E 4ASHA 1P57B 1Z7KA 3A80A 3VG8A 1CSOE 2XRCA 1ETTH 3ELAH 1GJDB 1NESE 1P2OA 3KYGA 4OS6A 1AU8A 4LZ1H 1NT1A 1FMGA 4B2BA 3NCLA 3PLKA 5C3NA 5C17A 4FUFA 3LU9B 9ESTA 2Y80A 5A09A 5EQQA 1Z8IB 1DPOA 4B6FA 1OPHB 2OBQA 3EA9A 5CHAB 1EKBB 1YPLH 2FI3E 3A8BA 3TPIZ 4DCDA 1L0ZA 4UONA 3SV7A 1O3IA 2WYJA 2XOKD 7GCHG 1ANEA 1FPHH 2FOBA 3M5LA 1GI4A 1O3LA 1TOMH 2FIRH 1LKAA 1RFNA 3ZVFA 2YMSD 1ORFA 3Q77A 4B1TA 1VJAU 3E16B 5FBIA 1SB1H 4NWLA 1CQQA 4K1TA 1SFQB 2O8WA 1HNEE 1PFXC 1FIZA 2HNTC 2FOEA 3M5OA 1HPGA 4NFEA 5ETXA 1B0EA 2ZECA 1PQ8A 3QZQA 2KCOA 3RXBA 2Z7FE 1MZDA 3A8DA 3KEEA 1GMCG 1PQAA 1IQFA 2CGAA 2B9LA 3GCOA 4I86A 5T6FA 2EI7A 3PYHA 3DSPA 5FX5A 1Z71A 3SNEA 5L2YH 2WHXA 1MTVA 1GI8B 3FP8E 2OBOA 1EAWA 1F5RA 2VGCB 2YNBA 1EJMA 3S9CA 4CR5A 1C2HA 4Y0ZE 4BANB 1OHHD 1IQHA 5IDKA 3ODFA 4FUGA 1O3OA 5JB9S 5LPFA 1FUJA 3BIVH 3GDVA 2QF5A 4XD7D 4FXGH 2F9NA 2BDYA 4Q4LA 1TRMA 3UQVA 1E37B 3SU2A 2EI8A 2FESH 3IWMA 1UTKA 4FUEA 1LTOA 5FL7D 4B74A 1O36A 1AZ8A 4U2WA 3EAJA 4ZAEA 4CHAB 2ANMH 2BQ6B 2A5IA 1EB2A 3LJJA 1P2KA 1XXFA 3PV2A 1ESAA 2XYAA 3GOVB 4UD9H 4I8HA 1QCPA 4A1VA 4AFUA 2GVFA 1VITG 1JOUB 4AFSA 1C1WH 2HLCA 1SR5C 2OQ5A 1G32B 1PQ7A 1ABIH 3PO1C 3BTTE 1O3FA 3E6PH 2ZNKH 3K65B 1OXGA 1O34A 2SNWA 3S0NA 2QYIA 2W3IA 2JETC 1JMOH 3MU4A 1P8VC 3ATLA 1LVOA 2ZGBH 3MNBA 3OFND 1F0TA 2RDEA 1O2KA 1LHCH 2J9NA 2AFQB 2Q6GA 5TCAA 1O5AB 1G2MA 2J98A 3PWBA 1KTSB 1GMHF 1O3EA 1EAUA 4OS2A 5A8XA 1O2MA 1QL9A 3A86A 3H7TA 1C2JA 1Y3VA 1F0SA 1SC8U 1IAUA 5EQSA 1EOLA 2KZ4A 3SUDA 4AN7A 2VIPA 2YOLA 5GXPA 5C0TA 2TBSA 2G81E 2CHAB 1S6FA 4B2CA 3S69A 1QA7A 4YTAA 5F53A 1C5VA 3ZVAA 3SHCH 1EJAA 2O8MA 4ZKOU 4D8NA 5LGOA 1MU6B 2JH6D 2PR3A 1C2KA 1O2VA 2FYQA 1F5LA 1A5GH 3MU1A 3S9AA 1V3XA 3WWFA 2STBE 5BPEA 1Y3YA 2BD8A 2WV9A 5C1YA 1SOTA 1QQ4A 2AGGX 3BEUA 1DXPA 2BX4A 4WMDA 4K60A 1TNIA 3BTFE 4YOIA 4BAHB 1C4Y2 5GNDA 3TJNA 1GI9B 1KXFA 3MMGA 1O2WA 1TRNA 1BIOA 1TA2A 5EJZA 1OWEA 1SLVB 1GBTA 2IPHA 4I32A 1TAWA 1LKBA 4YO9A 1ZRKA 1TQ7B 1NZQH 1O2IA 3DCLA 1GPZA 2BOKA 3MNXA 4Q7YA 3R3GB 4AB9A 4WMFA 2ALPA 1BB0B 3RC4A 2ASUB 1DDJA 1D3QB 1L1NA 3F9EA 1P11E 1BHXB 4A7IB 1UHBA 4WJG2 1BMNH 2BXUH 3QK1A 1E0FD 3E0PB 1WUNH 2FOAA 3BTEE 3OTJE 3A87A 4QT8C 1JRSA 4O03A 2XW9A 1FQ3A 4THNH 4TPYA 5DJ7A 1AFEH 2B0FA 3M7UA 3ZZCA 1HAIH 3OY6U 1TMBH 2O8UA 2A7HA 4ABFA 3A81A 4KKDA 3QZRA 5FHTA 4X1QU 2WPMS 1J9CH 3ZV9A 4Q7XA 1T4VH 1Y5UT 2F83A 2BB4A 4FETA 2H5CA 1L2EA 4WWYA 2ZDVH 5K7RA 4XFQA 1C4V2 2F9UA 3E91A 3F6UH 1S85A 1W0JD 4DVAU 3DUXH 2FTLE 2TRMA 4WVPE 1TRYA 2EEKA 5AFZH 1ANBA 1O3NA 1W12U 3M36A 1V2RT 1D3PB 1FY3A 4IN2A 1UTLM 2PHBA 4M7GA 1K1PA 5ABWA 3GY6A 2UUJB 3C1KA 1GCDA 2ZF0H 1O38A 1YBWA 2CF8H 4X6NA 1GI2A 2XCNA 1F0UA 2ZU4A 4ZMAH 1O35A 1AWFH 1OWKA 4X0WU 2J97A 1IQLA 2LPRA 3BTDE 1ELDE 1Z1JA 1O2UA 1SQTA 3P92A 1UCYK 1GHYH 2ZGXH 1TNHA 3UIRA 2OINA 3V13A 1QBVH 2ZHDA 1P04A 2J92A 3EE7A 1C1QA 4U01A 1DXWA 1UJ1A 3MYWA 3SQEE 4JMYA 3TJOA 1CHGA 3RMNH 3ZZ8A 1TGSZ 1C9TA 2PKSC 4NIXA 3PMBB 4FUJA 3U9AH 2XCFA 1PPBH 4Q2KA 1H8DH 1OYTH 4K2YA 1WCZA 1XX9A 2PUXB 1BHXF 4CH8B 1P10A 2PGQB 1NU7B 8GCHF 1YPHC 4MVNA 1WV7H 3MU0A 2BD9A 1ABJH 1O2GH 1GDQA 1AZZA 3I77A 3WWBA 4JZDH 4GLYA 1IQNA 1GJ5H 5FPYA 1DUEA 2D1JA 2PWXA 4AYYB 1HRTH 2A4QA 1L1GA 2FI5E 1AN1E 3M5NA 3SNBA 2ZDLA 4H6TA 2JDID 2ZDKA 3AVZA 2UUFB 4JZFH 3BTHE 5FCRA 1CGIE 1A3BH 2F4LA 1TGNA 2BQWB 3AAUA 2NWNA 1OOKB 1ZSKA 1WQSA 3UTUH 1ESTA 1ID5H 3LDXH 1YCPH 5PTPA 3SV8A 4ISHH 1OS8A 3QUMP 2RDLA 1O2NA 3TU7H 2OQUA 1LPKB 1QB6A 5CHBA 1RS0A 1MBQA 1G36A 1SFIA 2JJ1D 1BJVA 1INCA 1XMNB 2A4OA 2ZU2A 2EY4C 3A7XA 3MO9A 5DP3A 3RU4E 3KCGH 3TK5A 1SHYA 3P17H 1NFYA 3TNTA 2ZDMA 2QGRA 2CK3D 1EPTA 1ELBA 4RSPA 1BBRH 1HIAB 2QY0B 3BIUH 4KTCA 4DGJA 1DLKB 2DE9A 4DIHH 1XUHA 1P3EA 1QY6A 1SPJA 1ELAA 4ZCNA 5EOKA 1V2TT 5L30H 1MCVA 1BTUA 4D9QA 1HAVA 3WY8A 1GHZA 2ZCHP 2Z3EA 1TONA 3UWIA 3PRBA 4BTIB 4YOJA 5JB8S 2UWOA 4OS5A 1YLCA 1Q3XA 1QHRB 2BVXH 3TJUA 1NC6A 1U6QA 4ABDA 2WZQA 3SU4A 3SYJA 2WUBA 1AFQC 2J2UA 2AMDA 3D49H 1Y5BT 2Z94A 1ZSJA 2W6ID 1XUJA 1C2MA 4AG1A 1D4PB 3B9FH 1BCUH 4MNXA 2PSXA 3SJ9A 3W95A 2Y5FA 2ZHQH 5HIYA 1WDIA 3TJVA 1GBDA 1SLWB 2A32A 2FP7B 2Y7ZA 2F9BH 2B5TB 4Q63A 1QB1A 3HK3B 4JZEH 2Y81A 2XTTB 1OYQA 5J4SA 1S84A 2PW8H 1T8OA 4ZH8A 3CNRA 1QRXA 4NA8A 4Y8ZA 1TBRH 5C1UA 1ZYOA 3PO1B 1TMTH 1PPCE 1OKXA 2BLQA 1AVWA 5E0GA 1F7ZA 1NRQH 1ANCA 1EPTC 2OP9A 3PROA 3Q76A 3T2NA 1GHAG 2P8OC 2P16A 1DX5M 1MKWK 3DT0H 3TK9A 1THRH 2BDBA 2H1UA 3UFAA 1IQIA 3KQEA 3EYDA 2JETB 3ZZ5A 2HALA 3FP7E 2A31A 3LGIA 1COWD 2G5NA 1HFDA 4IS5A 2GV6A 2BD3A 4OGXA 5DN6D 2UWPA 1TQ0B 2R2MB 1J8AA 4B76A 1MAYA 5HXFA 1TFXA 3I78A 3BG4C 3BEFB 4CRAA 2V3OH 1SGFG 3SU6A 4NWKA 3NWUA 1GJ9B 3QGJA 2A0QB 1LO6A 3OE7D 3RXHA 1BRBE 4ZUHA 3TH3H 4TY6A 1SGRE 3L33A 4SGAE 2BDIA 2JH0D 1C2DA 2Q6FA 3A8AA 5I46H 1MD7A 2EI6A 2LP6A 5E2PA 4NA9H 1P03A 1HJ8A 5E2OA 1RTLA 1YYY1 5EU8A 3MQKC 3M3TA 1O3KA 1P01A 1D6WA 4U32A 4ABBA 3P8OA 4RI0A 1AE5A 4UFFH 3VB7A 4RT0A 1DVAH 4X6MA 4R0IA 1LQDB 3LONA 4R8TB 5T1VA 3P8NA 1C5UA 3ATMA 2ZTYA 2ZHWH 2Q1JA 1TLDA 4ZHLU 2P3FH 1VGCC 4JZIA 1ZTJA 1FY4A 2XWBI 4NIYA 4RN6A 4ZROA 2QCYA 1K28D 3RXFA 4Y8XA 2GDEH 4WXIA 1FDPA 1AVGH 2J34A 4X8VH 3BEIB 1OWIA 1XKBC 1G3EA 2FXRA 1QTFA 4MDSA 1KXAA 1DSUA 3ZZBA 1ELVA 1ZTLA 1S6HA 3PMHB 3K9XB 3PTNA 1SGNE 4RT1A 2ZPSA 4P02A 2QF4A 4MQAA 1OSSA 2VIQA 3PWCA 1ACBE 1UTMA 2STAE 1GGDC 1V2LT 2R0LA 1HUTH 3ZZ3A 4YM9A 2ZEBA 7LPRA 1AHTH 1YPJH 3SUFA 2I6SA 1FN8A 1SLXB 2XBXA 2IN2A 1YPMH 1NM6A 2QF0A 1DANH 1S82A 1WQVH 2BY6X 5EODA 1UVPA 3FO8D 3RXRA 1BMFD 3EA7A 6GCHF 2QXJA 3F9GA 3ODDA 3TH2H 3GY8A 1UK3A 5EG4A 1HXFH 2FS8A 2Z9JA 4KELA 1GWAA 4X1PU 4YESB 2ZFSA 1ZHRA 2XBWA 1TX8A 1O2OA 1FN6A 2Y7XA 3V7TA 4JYTA 2F9OA 1IHTH 4KP0A 3FZDA 3ZYDA 2ULLA 3LGVA 4GHTA 4OM9A 5FPSA 4YT7H 5EJLA 3ZZ9A 2PP6A 1CT2E 1QJ1B 2AIPA 1FY8E 1J14A 3P70B 1HGTH 1TMUH 2VNTA 5E8EH 3EGKH 2BD7A 3SHAH 3ZVDA 2PKSB 1MTNC 1E1RD 1ZOMA 1RXPA 4K3JA 5JYIA 1SHHB 3PV5A 1C5ZB 2IPQX 4B6EA 2FX6A 4INKA 3TVJB 2L74A 4AG2A 2F43B 1DLEA 1TB6H 5DP8A 2PKAB 3SV6A 1O5GH 1HAZB 1C1PA 3RXUA 3F9FA 4YLQH 3ZVEA 1OP8A 1S0QA 2RCEA 3VFEA 4DIIH 2A7JA 2ZG0H 4WH8A 2H9HA 1LHDH 1TX7A 5FX6A 1DWDH 1A0HB 1FAXA 2KAIA 1KDQA 1P0SH 4X2YA 4INLA 4ABEA 3VGCB 1MKXK 4K5ZA 5L2ZH 1W0ZU 4ABHA 1ELGA 3CS0A 4WMEA 3IG6B 1FZZA 2A2QH 5B6LA 1GVKB 2J95A 1Y5AT 3FFGA 4ESTE 3FVFB 1N6YA 4GCHF 4WF8A 1V6DA 1K2I1 1V2JT 3HKJB 1ZSLA 5EPNA 3BTME 3OEHD 3RXIA 1HAGE 2P59A 1P12E 3A89A 4HI3A 1TPSA 1ZJDA 2WYGA 1GVLA 1KMHB 3ZVGA 2AGEX 3SOSA 1EP6A 1DICA 3DHKH 2EQNA 2WPKS 2W6JD 3MH5A 4Y7AA 3U8RH 2KCAA 3RM2H 3GY7A 1W8BH 4HTCH 3LGUA 3K6YA 4J2YB 1SGFA 1B5GH 5GIBA 3UPEA 1ZPZA 2GGVB 1H9LB 2BD5A 3U8TH 2Z9GA 3EE0B 2SGEE 3SNDA 2K8IA 4J1YA 1NO9H 2ALVA 1O5FH 1QNJA 1SSXA 2ZHEH 1K21H 1BMLA 4TT3D 2GZ8A 3TK6A 1S81A 2OC1A 2RA3A 4K1SA 1A7SA 3UWJH 2CMYA 2K1QA 2UUYA 1WTGH 2HVYB 1L4DA 1BT7A 4CRFA 1TGBA 4GPGA 4CRCA 1P09A 1AFQB 1GG6C 1NPMA 4X1RU 5IYTA 5A0CA 2R3UA 3O8DA 1K1MA 3T29A 2HPQH 5DPAA 2ESTE 3VB3A 5KGOA 1NROH 3GY5A 3MNCA 2SNVA 5LPRA 3SU1A 2GT7A 1G3BA 2C3SA 1GDUA 2AYWA 1DWEH 3KHVA 3RM0H 3RXPA 1NBME 1MU8B 5EXNA 2W5EA 1ZGVA 4DG4A 4XBBA 1V2WT 2SGAA 1BMAA 2OK5A 3RP2A 5F8ZA 1GCTC 5A2MH 9LPRA 4Y11E 1W2KH 2F91A 3FKSD 1GJ4H 5C0UA 3GCHC 3ZZDA 1AB9C 4X8TH 1GHBF 4Y76A 1K1LA 3NXPA 2NU1E 1GMCF 1QQUA 3BG8A 3SV2H 2SGDE 2F9VA 1CHOF 1W11U 4CBNA 5AVDA 2QV1A 2ZFTA 4MNYA 1P2IA 3TGJE 4X8UH 1BA8B 1PPFE 3KNXA 4AFQA 2VWOA 1BTPA 2EA3A 1EAXA 4IW4E 3W94A 2P3UB 3B23B 5DGJA 2FODA 2BX3A 1LCYA 4P00A 2RG3A 3STIA 2Z3CA 2ZFRH 2IOTA 3RXTA 1C1MA 1Z8GA 3JZ2B 3QWCH 1X7AC 3VB6A 1O2QA 3UR9A 3BG4B 1RJXB 3KQ5A 4M9FA 2BLWA 4NA7A 1QJ6B 1A5HA 2W7SA 3ZZ7A 2QIQA 2ZCKP 1V2VT 2ODQA 4UEHH 2VU8E 4ZXXH 3S9BA 1TNJA 1ELTA 3U1JB 1GI0A 2H9EH 3NKKA 2V3HH 2C4FH 1OX1A 2ZGHA 4AGJA 4NGAH 1ZPBA 4JCNA 2Y82A 2NU2E 6CHAC 1RD3B 2AMQA 2PGBB 1O2PA 4OGYA 4FU7A 3A88A 1W7GH 1FLEE 3O8CA 1C5PA 1A5IA 2ANYA 2GMTC 3MHWU 1S6LA 1AVXA 3LGTA 1P2QA 1C2EA 2BDHA 1WU1A 4CR9A 3UOPA 3VXFH 3STJA 2HRVA 5JPMH 3A7TA 4FU9A 1C5QA 4X6PA 1W3CA 4OS7A 2BTCE 1UVTH 1WBGB 5DP7A 1AQ7A 2GCHF 4Z1MD 1MMJN 1VGCB 4X2VA 5HM2A 2AS9A 3UY9A 5I25A 4XE4A 1LHEH 3OX7U 2TGTA 1UTQA 4BTTB 3M61U 1RTFB 5GDSH 1UTOA 1V2UT 1K0HA 4H4FA 4NSVA 1JIMA 3SJOA 1D3DB 8GCHG 4WY3A 3QTVH 1HCGA 1HAXB 1PPGE 1AUJA 1O2XA 3UNQA 1O3HA 1ZTKA 4X8SH 5E0HA 4B2AA 4H42U 5H4IB 4BAMB 4I31A 3ZV8A 4Y7BA 8KME2 1G37A 2ZP0H 2B8OH 1TOCB 4LXBH 4E05H 6LPRA 1EB1H 3ZZ4A 3L3TA 1CE5A 2ZFPH 2YMSB 1ZLRA 1PQ5A 2HGTH 1G3DA 2C8XB 1K9OE 4LZ4B 4FOUC 1XVMA 5T3HA 1AUTC 1DUAA 1HJAB 5AF9H 3P6ZB 2AIQA 2FTMA 3QO6A 2XXLA 2JKHA 3Q3KA 5A8YA 1W10U 1GL1A 1KYNA 1QBNA 1YP9A 5F6MA 1C1OA 1Z6EA 3AASA 2G00A 3LJOA 5EIYA 1YKTA 1LPZB 1HLTH 3BTQE 2W7UA 1V2PT 3RXCA 3A82A 4IMZA 4ABIA 4B73A 1TIOA 5GCHF 3RUOA 2CV3A 3D62A 4ISIH 1DM4B 1GJBB 3LGYA 7KMEH 2J5UA 1ZMLA 1VJ9U 3RXGA 1T32A 1BTYA 3LPRA 1UCYE 4MPVA 2HOBA 4JK6A 1GBEA 3LIWA 1DS2E 4TSFD 1C5LH 2ZIQH 1Z8JB 2QC2A 4PROA 2FZZA 2P94A 1LDTT 1MTNB 3RXSA 1A0LA 1KY9A 1XKAC 2FYRA 4Y10E 1UVSH 1C9PA 4O9VA 2XC4A 1DFPA 5CHAC 3TITA 1PPZA 4E7RG 3EQ0H 4OS1A 1LPGB 3SZEA 1UCYH 5DKMA 3RXVA 3A83A 1LVBA 4Y71A 3MNSA 1JRTA 3N7DA 5A8ZA 2JH5D 1YCPM 4UE7H 3KQDA 1QZ8A 2ZQ2A 1FPCH 3MU5A 2ILNA 5KECA 5DP5A 3GYLB 5C94A 2O8TA 5FXLA 1W0KD 5KEDA 1HBTH 3VPKA 2SFAA 1IQEA 1N1LA 3FZZA 3RLYH 3NUMA 3LH1A 3SJIA 4FUBA 6ESTA 2R0KA 2C8YB 1LQEA 1MAXA 3HATH 1L4ZA 1UTPA 5C2ZA 4AOQA 1BJUA 4F48B 2BZAA 2H5DA 3PMJA 5IK2D 1EXFA 2C8ZB 4F49A 5BRRE 2C93B 3M7TA 4F4OC 3RMOH 2QF3A 2C90B 3H7OA 3OTPA 3Q00A 2VWNA 5DP9A 2V6NA 3SQHE 3U1IB 4A1TA 4AGKA 2FLBH 3UR6A 3G01A 5CMXH 2WUCA 1P3CA 4HGCA 2G4TA 4ISNA 4AYVB 2P93A 1C5YB 3GISB 4UDWH 2GJGA 2O9QA 2FDAA 3BTKE 2BD2A 1KLTA 2BVRH 5JBCS 2Y5HA 2ZHFH 1GHVH 1KTTB 1TPAE 3A84A 2TIOA 4K8YA 1KDQB 1O5BB 1GG6B 2ODPA 3SU3A 2KM0A 4YOGA 2ZA5A 1MBMA 1HYLA 4JZ1A 1BRUP 4DURA 5HKKD 3PTBA 1QJ7B 2EC9H 1Y3UA 2KX4A 1YM0A 3SORA 1F0RA 1THPB 3RXKA 1VCWA 2BY8X 1C5XB 1SGQE 1O5DH 1O31A 3ZYEA 2FEQH 3NRLA 3RLWH 1EATA 1JIRA 3PM3A 4B71A 2K0QA 2HNTF 4WH6A 3GDSA 1UK4A 5AFYH 1QL7A 2P3TB 2PFEA 2AEIH 2GDDA 3SU0A 1W7XH 1S5SA 1SGIB 2G51A 3F9HA 3GCHB 3QTOH 4X2WA 3URCA 1AB9B 4FVBA 4LK4A 1WYKA 4YLUA 2CF9H 3GY2A 3ZIAD 1HAPH 3V3MA 4BNRA 3UREA 1HB0B 2Z9IA 5L6NH 4MTBA 1FXYA 1TABE 3SGAE 1QB9A 1E34B 4JK5A 3SBKA 1S83A 1NN6A 4GVUA 2NU4E 1L1JA 1KXEA 1GBFA 1XXDA 5TJXA 4X2XA 1JWTA 3VB4A 3MU8A 2PV9B 3EA8A 1KXDA 1O39A 1GMDG 4TWWA 1V2KT 2VINA 1O37A 4DT7B 2A2XH 2CJIA 2ZGJA 1GBCA 3V0XA 2ZU3A 3RU4T 2WPLS 1TBZH 1MKWH 1LHGH 3T5FH 4ISOA 1DE7H 2VIWA 3T28A 6GCHG 2ZC9H 1P2MA 3LGWA 2R9PA 1IQKA 2VVCA 4CRBA 4ZKNU 2Z6BD 4A5TS 4I7YH 2OC0A 3OY5U 1C1UH 1FY5A 3K2UA 2GT8A 2Y6TA 2GMTB 5G4BA 1ZHMA 2D26C 2ZTZA 2LELA 2VWLA 3BF6H 3U98H 4DW2U 2FMJA 2ZFFH 1KLJH 3N7OA 1VR1H 2GCTC 1QRWA 3NK8A 1H8ED 1LVYA 1Y3XA 2I6QA 5FPTA 2BDAA 2J98B 4AORA 1QURH 1V2NT 2B7DH 3FP6E 3UUZA 3RXEA 1H4WA 2GP9B 4A6LA 3RXOA 4X6OA 2J38A 3M7QA 2ANWA 2QXHA 1A46H 5HYOA 1QIXB 1E79D 1ANDA 1YF4A 2BVSH 1EQ9A 2TGAA 1GBBA 1OWDA 5K0HA 1GJAB 4XDEA 5LPEA 2Z3DA 1ZZZA 1J16A 1C2GA 2F3CE 1SG8B 4JYUH 1JXPA 3AK5A 3OAAD 4BXSA 2R3YA 4F55A 1TGTA 5JBTA 2BD4A 3D23A 4Y0YE 5F03A 1WTHD 3RXQA 1HXEH 2V35A 4KTUA 3RXAA 7ESTE 4K1EA 2BDCA 4NG9H 2HWLB 4CRDA 2SGFE 1RIWC 2Z9LA 1C5WB 1ZMJA 1YGCH 2GTBA 4GCHG 1C5TA 5EW1H 4NZLA 4X1SU 1Q2WA 1SGCA 3SI3H 1YPKH 3U8OH 4IBLH 2W26A 2PSYA 3ITIA 2J4IA 2VIOA 3KQBA 3E3TA 3A8CA 5EJ1A 3HK6B 1UHBB 3MFJA 3OU0A 1ELCA 3UQOA 3TGKE 1HV7A 1KSNA 1RTKA 5EQRA 4O97A 1O2HA 4GSOA 1HIAA 5SGAE 4FUIA 1ELEE 1AKSA 1O2TA 2HNTE 2WV4A 3V12A 1NRSH 1KXCA 2D8WA 3F2GA 4MLFB 3SU5A 2PTCE 3DFLA 1BUIA 4A1XA 1C5OH 1WOFA 4UFDH 5EXMA 4Y8YA 5LH8A 3UNRA 3BN9A 4CH2B 3M5MA 1DITH 1C1VH 1A1RA 5FAHA 3FOAA 1DSTA 1JBUH 3F0OA 5T6GA 1MZAA 1XUFA 4BXWA 2WPIS 1Q31A 3PV4A 2QXIA 3FAOA 1E1QD 3F68H 4ZKSU 5TCCA 3VXEH 1ZPCA 4DOQA 3GCTF 1CGJE 4DT4A 3D65E 2G5VA 1ETRH 1P2JA 2L6OA 1PPEE 1C5MD 4YXWD 2ZPQA 3MH6A 1CA8B 2G52A 1VZQH 4GUXA 1K1IA 2KCYA 2ZO3H 4B75A 1C2IA 4GAWA 1SGDE 2ZKSA 1BITA 1YLNA 3DSGA 1MCTA 1T8LA 4IC5A 4MG3A 1T4UH 3MH7A 4HG6A 1GMHG 1GHBG 3MI4A 2RFKC 5FBEA 5HGGA 2OLGA 4ZXYH 1O5CB 1CHOG 2CN0H 4AC9A 4DY7B 1UMAH 4IN1A 1T31A 5T6DA 2F9PA 2H2ZA 1NRNH 2BM2A 1QRZA 1O3JA 1QGFA 2ODYB 4BTUB 4HFPB 3KIDU 1PPHE 3OEED 3BTWE 2ZU5A 3RMLH 4ACBA 1B0FA 1O3GA 3TGIE 1GI3A 1H9HE 1MKXH 2KFWA 5DO4H 4TWYA 3A7VA 1FY1A 2HPPH 2ZI2H 2R2WU 2ZZUH 1LVMA 2BY7X 1TWXB 4IGDA 3HGNA 3RC6A 2XC5A 3QDZB 3U69H 2VVUA 1SBWA 2VH0A 7GCHF 1UO6A 4FUCA 4TYDA 2RA0A 1VKYA 1EASA 5E0JA 1O5EH 1O3MA 1TNKA 2UWLA 2GZ7A 3BSQA 2FOGA 1C4U2 3ZVCA 4DJZB 5EW2H 2BLOA 3P8GA 3TH4H 2BYAX 1G3CA 5GPIB 5JDUB 1O30A 2OTVA 4K69A 4NSYA 1C2LA 2BZ6H 3KGPA 2GKVE 4NCYA 3A7YA 1DY9A 8LPRA 2PLXA 1YY3A 1EPTB 3SUEA 2NU3E 2P8OB 2GCHG 1UK2A 4INHA 2Q6DA 2NU0E 1N8OC 3LC5A 1A2CH 4WXVA 4XBCA 4TY7A 3T62A 1ARCA 2QN5T 1TYNA 1BRAA 2ZGCA 1HAVB 2A45B 4A92A 4FU8A 1HDTH 1ZHPA 2FOMB 4VGCC 4XOJA 3W1EA 2TGPZ 2V3MA 3ATKA 3AW1A 3LT3A 3SI4H 3TIUA 3P8FA 4KTSA 4D7FA 3NZIA 1FAKH 3TNSA 3MH4A 3E90B 3AW0A 1G30B 1G2LA 3M35A 1VCPA 1O3AA 1EZXC 1P05A 1DT2A 1GJ7B 2D2DA 3KYFA 4I8JA 1GI1A 8ESTE 1GBLA 3H5CB 1CO7E 4Q7ZA 1NY22 3ESTA 1ARBA 2WPHS 1SQAA 3ZVBA 1E38B 2DUCA 1P02A 4Z0KA 1DOJA 1LHFH 1M9UA 2P95A 1H8IH 1SGEE 4AX9H 3GDUA 4NZQA 1TA6A 2KCPA 3H09A 3A7WA 3NPSA 4X1NU 1THSH 1KIGH 1BOQA 1ELFA 3RXJA 1VITF 5C67A 4BAQB 1QR3E 2A5KA 4FVDA 3KN2A 3S7KB 3SUGA 1O3DA 1YC0A 1T7CA 3M3SA 4RKOB 5EGMA 4SGBE 5GCHG 2ZFQH 1TPOA 1HAHH 2GX4A 1AD8H 3O8BA 2WINI 1CBWC 3P95A 4ISLA 2SGPE 5F8TA 2GCTB 1D3TB 4NIVA 3BTGE 1BQYA 1C1SA 1SI5H 1GI5A 1TALA 4MPXA 2FPZA 3T26A 2SGQE 4Y6DA 1BZXE 3VEQB 2H6MA 1D9IA 1FIWA 1SGYE 4K8BA 1AGJA 1TGCA 1F92A 4ASUD 3SGQE 3A85A 4I8KA 1QA0A 1SGPE 1Z1IA 4H6SB 1ETSH 2XC0A 1NBMD 2ZCLP 1SMFE 2JJ2D 2A4GA 2ZPRA 2VJ1A 1CA0C 1GGDB 5DP6A 1BTZA 2PKAA 1EP5A 1CT0E 2Z9KA 1NFWA 2YNAA 2VH6A 3A7ZA 3HPTB 2OC7A 1MTSA 4I8GA 1MD8A 1CGHA 2VB0A 2CXVA 1A61H 2Y5GA 2PTNA 1EZSC 1XUIA 2THFB 1O2SA 1QL8A 2BHGA 2AERH 1IQJA 3EDXB 3HKIB 1YPHE 1D6RA 1SKYE 2A4RA 1RIWB 1IOEA 4GHQA 3CP7A 3DA9B 1OWHA 1LMWB 2A1DB 3RDZA 3SNAA 2XWAA 2XBVA 4XRNA 2AGIX 4HZHA 1WAYB 1C1RA 1WXRA 1ZR0A 3ZZAA 3ATWA 1NS3A 2BXTH 2QA9E 5F8XA 1A3EH 1O32A 4ZHAA 5C20A 1YCPK 2TPIZ 5JBBS 3KF2A 1SOZA 5C5NA 1OP2A 1WSSH 3PRDA 1HAYB 2OCVB 1SVPA 1DWBH 4FUDA 1UW7A 3QGNB 3PLPA 3SJ8A 4XBDA 4D76A 1V2MT 2JIZD 3SGBE 1EX3A 1E36B 4Z6AH 2HVXA 3AAVA 1UVUH 2H9TH 5AHGH 4JYVH 1BBRK 1ZRBA 1ZMNA 2A7CA 1C5RA 1NU9A 5JBAS 1KLIH 1RGQA 1GDNA 1BMMH 1PJPA 3R0FA 1J17T 1O2JA 4YZUA 2OXSA 1K1OA 2C8WB 2ZWLH 4UFEH 1GI7B 2VBCA 1XUKA 2FX4A 3VGCC 3O8RA 4I33A 3RMMH 3SW2B 1VCQA 5HM9A 1Y3WA 5A0BA 5ESTE 1MTUA 2V7QD 4RKJB 1H1BA 3LC3A 1TNLA 1SQOA 1NTPA 1BBRE 1BDAA 3OSYA 4MPWA 1Z8RA 2ZU1A 1MTWA 1GJ8B 5EPYA 4D7GA 1AY6H 2BY9X 1C5SA 4MPUA 1AO5A 5GWZA 1MQ5A 1EAIA 1EFRD 1SLUB 2AMPA 2FOCA 2VGCC 3TLOA 4E06H 3C27B 1KXBA 2ZTXA 3LOXA 1C1TA 3SO3A 1IQMA 3JZ1B 3F2HA 4XSKU 1O33A 4NFFA 1AWHB 4YT6H 3T25A 1W13U 1AKSB 3LH3A 3FANA 4MNVA 3VB5A 1F5KU 4OS4A 1AIXH 3SV9A 3I29A 1VITH 2GV7A 2ZDNA 5GJ4B 3GYMA 4BAKB 2FOHA 3K6ZA 3QX5H 1A0JA 1BTWA 1GBIA 1O2RA 4CREA 4CHAC 5CE1A 4IMQA 1HJ9A 1YLDA 1FJSA 1GJ6A 2BY5X 4BOHA 2BOHB 1HAOH 2KAIB 2XNIA 1OWJA 3DD2H 1RRKA 5CDFE 1BTHH 1DWCH 3ATIA 1QFKH 1XUGA 1GVZA 3PMAB 3WW7A 3L6PA 4AZ2B 1NFXA 1TBQH 3Q3YA 3ZZ6A 1GBHA 2WSSD 3UAIC 1YPGH 1C5NH 2IJD1 3U28C 5DK1A 2M5TA 3F2FA 1P9SA 5HMAA 2DE8A 2XNDD 4ZHMU 2ZQ1A 2BQ7B 3UNSA 4U30A 2GD4B 2VIVA 2ZDAH 2HLDD 2V0BA 1GCTB 1S0RA 3T27A 1PYTC 3PB1E 3KL6A 3BV9B 2BMGB 1FV9A 1GBAA 3UOUA 2O8LA 3SN8A 1UVOA 3MO3A 2OUAA 5DP4A 3SJKA 3DFJA 1N8OB 5DG6A 1YPEH 1GHWH 1O2ZA 1UTJA 2BDGA 1T8MA 2KR7A 2FWWA 5J4QA 4UFGH 2QAAA 5ESBA 1K1NA 1MABB 1GJCB 1ZJKA 3QN7A 2CHAC 1Y8TA 3E0NB 3GY4A 1TX6A 1FNIA 1N6XA 4VGCB 5A0AE 3RU4D 3QLPH 1TNGA 3E1XB 3ENSB 1B7XB 2IJOB 1T8NA 3MO6A 2VVVA 1A4WH 1H9IE 3CENA 1C2FA 2AHME 2WV5A 2LNCA 1YWUA 1SL3A 3LKWA 4ZKRU 2TGDA 1K22H 3F1SB 5FCKA 2FM2A 1XVOA 3OYPA 1GHXH 1K1JA 1G9IE 3F3BA 3SZNA 2PUQH 1GBMA 3CS7A 4KGAA 6CHAB 2AH4X 1AMHA 4BAOB 2XBYA 1EJNA 2UUKB 1P2NA 1H8HD 1MQ6A 2G4UA 1MH0A 1SQRA 4D9RA 4TPIZ 4Q80A 5B6OA 3UB0A 1NRRH
chains in the Genus database with same CATH topology
1GI6A 2BLVA 1SGTA 1PYTD 4IC6A 4CBOA 2J94A 1GBKA 2OD3B 4AFZA 2WPJS 3RXDA 1V2ST 2VIDA 1V2OT 5C5OA 4CRGA 1O2LA 4FUHA 1Y59T 1GHAF 1OP0A 1O3PB 1NRPH 3S7HB 1CBWB 2QXGA 4AB8A 1TE0A 1O0DH 2A5AA 3HGPA 4LOYH 1EOJA 1W14U 1GL0E 3KQCA 2FLRH 4O3UA 3RXMA 2W3KA 2FO9A 3PLBA 1QBOA 3M3VA 1MUEB 1TPPA 1O3CA 3IITA 1FONA 4E7NA 2OC8A 3MTYA 5C1XA 4Y79A 1C1NA 4I8LA 1P9UA 3MOCA 5EXLA 3GICB 1DY8A 2G55A 4NIWA 1CA0B 1EZQA 1FI8A 3B8JA 1EUFA 1P06A 3GCTG 3RXLA 1E35B 3Q3XA 1O2YA 2VWMA 1XM1A 1EZUC 2FI4E 1GMDF 4ABGA 1ESBA 1BTXA 1GBJA 3RC5A 1HJAC 3E8LA 3GCNA 4O3TA 1V2QT 1UTNA 1W0YH 2G8TA 2FS9A 1AI8H 2GZ9A 4ABJA 3MWIU 1Z6JH 3URDA 1CVWH 2FOFA 1IHSH 4ABAA 3GY3A 4MNWA 1CU1A 3M37A 1O3BA 1J15A 2ANKH 1ZGIA 1NFUA 1AE8H 1F2SE 1IQGA 3SNCA 1BRCE 1CT4E 4ASHA 1P57B 1Z7KA 3A80A 1CSOE 2XRCA 1ETTH 3ELAH 1GJDB 1NESE 1P2OA 4OS6A 1AU8A 4LZ1H 1NT1A 1FMGA 4B2BA 3NCLA 3PLKA 5C3NA 4FUFA 3LU9B 9ESTA 2Y80A 5A09A 5EQQA 1Z8IB 1DPOA 1OPHB 2OBQA 3EA9A 5CHAB 1EKBB 1YPLH 2FI3E 3A8BA 3TPIZ 4DCDA 1L0ZA 4UONA 3SV7A 1O3IA 2WYJA 7GCHG 1ANEA 1FPHH 2FOBA 3M5LA 1GI4A 1O3LA 1TOMH 2FIRH 1LKAA 1RFNA 3ZVFA 1ORFA 3Q77A 4B1TA 1VJAU 3E16B 5FBIA 1SB1H 4NWLA 1CQQA 4K1TA 1SFQB 2O8WA 1HNEE 1PFXC 1FIZA 2HNTC 2FOEA 3M5OA 1HPGA 4NFEA 5ETXA 1B0EA 2ZECA 1PQ8A 3QZQA 3RXBA 2Z7FE 1MZDA 3A8DA 3KEEA 1GMCG 1PQAA 1IQFA 2CGAA 2B9LA 3GCOA 5T6FA 2EI7A 3PYHA 5FX5A 1Z71A 3SNEA 5L2YH 1MTVA 1GI8B 3FP8E 2OBOA 1EAWA 1F5RA 2VGCB 2YNBA 1EJMA 3S9CA 4CR5A 1C2HA 4Y0ZE 4BANB 1IQHA 5IDKA 3ODFA 4FUGA 1O3OA 5JB9S 5LPFA 1FUJA 3BIVH 3GDVA 4FXGH 2F9NA 2BDYA 1TRMA 3UQVA 1E37B 3SU2A 2EI8A 2FESH 3IWMA 1UTKA 4FUEA 1LTOA 4B74A 1O36A 1AZ8A 4U2WA 3EAJA 4ZAEA 4CHAB 2ANMH 2BQ6B 2A5IA 1EB2A 3LJJA 1P2KA 1XXFA 1ESAA 2XYAA 3GOVB 4UD9H 4I8HA 1QCPA 4A1VA 4AFUA 2GVFA 1VITG 1JOUB 4AFSA 1C1WH 2HLCA 1SR5C 2OQ5A 1G32B 1PQ7A 1ABIH 3PO1C 3BTTE 1O3FA 3E6PH 2ZNKH 3K65B 1OXGA 1O34A 2SNWA 3S0NA 2QYIA 2W3IA 2JETC 1JMOH 3MU4A 1P8VC 3ATLA 1LVOA 2ZGBH 3MNBA 1F0TA 1O2KA 1LHCH 2J9NA 2AFQB 2Q6GA 5TCAA 1O5AB 1G2MA 3PWBA 1KTSB 1GMHF 1O3EA 1EAUA 4OS2A 5A8XA 1O2MA 1QL9A 3A86A 3H7TA 1C2JA 1Y3VA 1F0SA 1SC8U 1IAUA 5EQSA 1EOLA 3SUDA 4AN7A 2VIPA 2YOLA 5GXPA 2TBSA 2G81E 2CHAB 1S6FA 4B2CA 3S69A 1QA7A 4YTAA 1C5VA 3ZVAA 3SHCH 1EJAA 2O8MA 4ZKOU 4D8NA 5LGOA 1MU6B 2JH6D 2PR3A 1C2KA 1O2VA 2FYQA 1F5LA 1A5GH 3MU1A 3S9AA 1V3XA 2STBE 5BPEA 1Y3YA 2BD8A 5C1YA 1SOTA 1QQ4A 2AGGX 3BEUA 1DXPA 2BX4A 4WMDA 4K60A 1TNIA 3BTFE 4YOIA 4BAHB 1C4Y2 3TJNA 1GI9B 1KXFA 3MMGA 1O2WA 1TRNA 1BIOA 1TA2A 1OWEA 1SLVB 1GBTA 2IPHA 4I32A 1TAWA 1LKBA 4YO9A 1ZRKA 1TQ7B 1NZQH 1O2IA 1GPZA 2BOKA 3MNXA 4Q7YA 3R3GB 4AB9A 4WMFA 2ALPA 1BB0B 3RC4A 2ASUB 1DDJA 1D3QB 1L1NA 3F9EA 1P11E 1BHXB 4A7IB 1UHBA 4WJG2 1BMNH 2BXUH 3QK1A 1E0FD 3E0PB 1WUNH 2FOAA 3BTEE 3OTJE 3A87A 4QT8C 1JRSA 4O03A 2XW9A 1FQ3A 4THNH 4TPYA 5DJ7A 1AFEH 2B0FA 3M7UA 3ZZCA 1HAIH 3OY6U 1TMBH 2O8UA 2A7HA 4ABFA 3A81A 4KKDA 3QZRA 5FHTA 4X1QU 2WPMS 1J9CH 3ZV9A 4Q7XA 1T4VH 1Y5UT 2F83A 2BB4A 2H5CA 1L2EA 4WWYA 2ZDVH 5K7RA 4XFQA 1C4V2 2F9UA 3E91A 3F6UH 1S85A 4DVAU 3DUXH 2FTLE 2TRMA 4WVPE 1TRYA 2EEKA 5AFZH 1ANBA 1O3NA 1W12U 3M36A 1V2RT 1D3PB 1FY3A 4IN2A 1UTLM 2PHBA 4M7GA 1K1PA 5ABWA 3GY6A 2UUJB 3C1KA 1GCDA 2ZF0H 1O38A 1YBWA 2CF8H 4X6NA 1GI2A 2XCNA 1F0UA 2ZU4A 4ZMAH 1O35A 1AWFH 1OWKA 4X0WU 1IQLA 2LPRA 3BTDE 1ELDE 1Z1JA 1O2UA 1SQTA 3P92A 1UCYK 1GHYH 2ZGXH 1TNHA 3UIRA 2OINA 3V13A 1QBVH 2ZHDA 1P04A 2J92A 1C1QA 4U01A 1DXWA 1UJ1A 3MYWA 3SQEE 4JMYA 3TJOA 1CHGA 3RMNH 3ZZ8A 1TGSZ 1C9TA 2PKSC 4NIXA 3PMBB 4FUJA 3U9AH 2XCFA 1PPBH 4Q2KA 1H8DH 1OYTH 4K2YA 1WCZA 1XX9A 2PUXB 1BHXF 4CH8B 1P10A 2PGQB 1NU7B 8GCHF 1YPHC 4MVNA 1WV7H 3MU0A 2BD9A 1ABJH 1O2GH 1GDQA 1AZZA 3I77A 4JZDH 4GLYA 1IQNA 1GJ5H 5FPYA 1DUEA 2D1JA 2PWXA 4AYYB 1HRTH 2A4QA 1L1GA 2FI5E 1AN1E 3M5NA 3SNBA 2ZDLA 4H6TA 2ZDKA 3AVZA 2UUFB 4JZFH 3BTHE 5FCRA 1CGIE 1A3BH 1TGNA 2BQWB 3AAUA 2NWNA 1OOKB 1ZSKA 1WQSA 3UTUH 1ESTA 1ID5H 3LDXH 1YCPH 5PTPA 3SV8A 4ISHH 1OS8A 3QUMP 2RDLA 1O2NA 3TU7H 2OQUA 1LPKB 1QB6A 1RS0A 1MBQA 1G36A 1SFIA 1BJVA 1INCA 1XMNB 2A4OA 2ZU2A 3A7XA 3MO9A 5DP3A 3RU4E 3TK5A 3KCGH 1SHYA 3P17H 1NFYA 3TNTA 2ZDMA 2QGRA 1EPTA 1ELBA 4RSPA 1BBRH 1HIAB 2QY0B 3BIUH 4KTCA 4DGJA 1DLKB 2DE9A 4DIHH 1XUHA 1P3EA 1QY6A 1SPJA 1ELAA 5EOKA 1V2TT 5L30H 1MCVA 1BTUA 4D9QA 1HAVA 3WY8A 1GHZA 2ZCHP 2Z3EA 1TONA 3UWIA 4BTIB 4YOJA 5JB8S 2UWOA 4OS5A 1YLCA 1Q3XA 1QHRB 2BVXH 3TJUA 1NC6A 1U6QA 4ABDA 3SU4A 2WUBA 1AFQC 2J2UA 2AMDA 3D49H 1Y5BT 2Z94A 1ZSJA 4AG1A 1XUJA 1C2MA 1D4PB 3B9FH 1BCUH 4MNXA 2PSXA 3SJ9A 3W95A 2Y5FA 2ZHQH 3TJVA 1GBDA 1SLWB 2A32A 2FP7B 2Y7ZA 2F9BH 2B5TB 1QB1A 3HK3B 4JZEH 2Y81A 2XTTB 1OYQA 5J4SA 1S84A 2PW8H 1T8OA 4ZH8A 1QRXA 4NA8A 4Y8ZA 1TBRH 5C1UA 1ZYOA 3PO1B 1TMTH 1PPCE 1OKXA 2BLQA 1AVWA 5E0GA 1F7ZA 1NRQH 1ANCA 1EPTC 2OP9A 3PROA 3Q76A 3T2NA 1GHAG 2P8OC 2P16A 1DX5M 1MKWK 3DT0H 3TK9A 1THRH 2BDBA 2H1UA 3UFAA 1IQIA 3KQEA 3EYDA 2JETB 3ZZ5A 2HALA 3FP7E 2A31A 3LGIA 2G5NA 1HFDA 4IS5A 2GV6A 2BD3A 4OGXA 2UWPA 1TQ0B 2R2MB 1J8AA 4B76A 1MAYA 5HXFA 1TFXA 3I78A 3BG4C 3BEFB 4CRAA 2V3OH 1SGFG 3SU6A 4NWKA 3NWUA 1GJ9B 3QGJA 2A0QB 1LO6A 3RXHA 1BRBE 4ZUHA 3TH3H 4TY6A 1SGRE 3L33A 4SGAE 2BDIA 2JH0D 1C2DA 2Q6FA 3A8AA 5I46H 1MD7A 2EI6A 5E2PA 4NA9H 1P03A 1HJ8A 5E2OA 1RTLA 1YYY1 5EU8A 3M3TA 1O3KA 1P01A 1D6WA 4U32A 4ABBA 3P8OA 1AE5A 4UFFH 3VB7A 4X6MA 1DVAH 4R0IA 1LQDB 3LONA 4R8TB 3P8NA 1C5UA 3ATMA 2ZTYA 2ZHWH 2Q1JA 1TLDA 4ZHLU 2P3FH 1VGCC 4JZIA 1ZTJA 1FY4A 2XWBI 4NIYA 4RN6A 4ZROA 2QCYA 1K28D 3RXFA 4Y8XA 2GDEH 4WXIA 1FDPA 1AVGH 2J34A 4X8VH 3BEIB 1OWIA 1XKBC 1G3EA 2FXRA 1QTFA 4MDSA 1KXAA 1DSUA 3ZZBA 1ELVA 1ZTLA 1S6HA 3PMHB 3K9XB 3PTNA 1SGNE 2ZPSA 4MQAA 1OSSA 2VIQA 3PWCA 1ACBE 1UTMA 2STAE 1GGDC 1V2LT 2R0LA 1HUTH 3ZZ3A 4YM9A 2ZEBA 7LPRA 1AHTH 1YPJH 3SUFA 2I6SA 1FN8A 1SLXB 2XBXA 2IN2A 1YPMH 1NM6A 2QF0A 1DANH 1S82A 1WQVH 2BY6X 5EODA 1UVPA 3RXRA 3EA7A 6GCHF 2QXJA 3F9GA 3ODDA 3TH2H 3GY8A 1UK3A 5EG4A 1HXFH 2FS8A 2Z9JA 4KELA 1GWAA 4X1PU 4YESB 2ZFSA 1ZHRA 2XBWA 1TX8A 1O2OA 1FN6A 2Y7XA 3V7TA 4JYTA 2F9OA 1IHTH 4KP0A 3FZDA 3ZYDA 2ULLA 3LGVA 4GHTA 5FPSA 4YT7H 3ZZ9A 1CT2E 1QJ1B 2AIPA 1FY8E 1J14A 3P70B 1HGTH 1TMUH 2VNTA 5E8EH 3EGKH 2BD7A 3SHAH 3ZVDA 2PKSB 1MTNC 1ZOMA 4K3JA 1RXPA 5JYIA 1SHHB 1C5ZB 2FX6A 4INKA 3TVJB 4AG2A 1DLEA 1TB6H 5DP8A 2PKAB 3SV6A 1O5GH 1HAZB 1C1PA 3RXUA 3F9FA 4YLQH 3ZVEA 1OP8A 1S0QA 2RCEA 3VFEA 4DIIH 2A7JA 2ZG0H 4WH8A 2H9HA 1LHDH 1TX7A 5FX6A 1DWDH 1A0HB 1FAXA 2KAIA 1KDQA 1P0SH 4X2YA 4INLA 4ABEA 3VGCB 1MKXK 4K5ZA 5L2ZH 1W0ZU 4ABHA 1ELGA 3CS0A 4WMEA 3IG6B 1FZZA 2A2QH 1GVKB 2J95A 1Y5AT 3FFGA 4ESTE 3FVFB 1N6YA 4GCHF 4WF8A 1V6DA 1K2I1 1V2JT 3HKJB 1ZSLA 5EPNA 3BTME 3RXIA 1HAGE 2P59A 1P12E 3A89A 4HI3A 1TPSA 1ZJDA 2WYGA 1GVLA 3ZVGA 2AGEX 3SOSA 1EP6A 1DICA 3DHKH 2WPKS 3MH5A 4Y7AA 3U8RH 3RM2H 3GY7A 1W8BH 4HTCH 3LGUA 3K6YA 4J2YB 1SGFA 1B5GH 5GIBA 3UPEA 1ZPZA 2GGVB 1H9LB 2BD5A 3U8TH 2Z9GA 3EE0B 2SGEE 3SNDA 4J1YA 1NO9H 2ALVA 1O5FH 1QNJA 1SSXA 2ZHEH 1K21H 1BMLA 2GZ8A 3TK6A 1S81A 2OC1A 2RA3A 4K1SA 1A7SA 3UWJH 2CMYA 2K1QA 2UUYA 1WTGH 1L4DA 1BT7A 4CRFA 1TGBA 4GPGA 4CRCA 1P09A 1AFQB 1GG6C 1NPMA 4X1RU 5IYTA 5A0CA 2R3UA 3O8DA 1K1MA 3T29A 2HPQH 5DPAA 2ESTE 3VB3A 1NROH 3GY5A 3MNCA 2SNVA 5LPRA 3SU1A 2GT7A 1G3BA 2C3SA 1GDUA 2AYWA 1DWEH 3KHVA 3RM0H 3RXPA 1MU8B 5EXNA 2W5EA 1ZGVA 4DG4A 4XBBA 1V2WT 2SGAA 1BMAA 3RP2A 5F8ZA 1GCTC 5A2MH 9LPRA 4Y11E 1W2KH 2F91A 1GJ4H 3GCHC 3ZZDA 1AB9C 4X8TH 1GHBF 4Y76A 1K1LA 3NXPA 2NU1E 1GMCF 1QQUA 3BG8A 3SV2H 2SGDE 2F9VA 1CHOF 1W11U 4CBNA 5AVDA 2QV1A 2ZFTA 4MNYA 1P2IA 3TGJE 4X8UH 1BA8B 1PPFE 3KNXA 4AFQA 2VWOA 1BTPA 2EA3A 1EAXA 4IW4E 3W94A 2P3UB 3B23B 5DGJA 2FODA 2BX3A 1LCYA 2RG3A 3STIA 2Z3CA 2ZFRH 2IOTA 3RXTA 1C1MA 1Z8GA 3JZ2B 3QWCH 1X7AC 3VB6A 1O2QA 3UR9A 3BG4B 1RJXB 2BLWA 4NA7A 1QJ6B 1A5HA 2W7SA 3ZZ7A 2QIQA 2ZCKP 1V2VT 2ODQA 4UEHH 2VU8E 4ZXXH 3S9BA 1TNJA 1ELTA 3U1JB 1GI0A 2H9EH 3NKKA 2V3HH 2C4FH 1OX1A 2ZGHA 4AGJA 4NGAH 1ZPBA 4JCNA 2Y82A 2NU2E 6CHAC 1RD3B 2AMQA 2PGBB 1O2PA 4OGYA 4FU7A 3A88A 1W7GH 1FLEE 3O8CA