3B8JA

Q191a mutant of degs-deltapdz
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
184
Chain Sequence
DETPASYNLAVRRAAPAVVNVYNRGLLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNNFLATDASINHGNSGGALVNSLGELMGINTLSGIGFAIPFQLATKIMDKLIRDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title biochemical characterization of DegS-deltaPDZ q191A mutant
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 41
structure length 184
sequence length 212
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3b8jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3b8jA02
1QHRB 2I6QA 3SGAE 1DWDH 2LPRA 2HALA 3A84A 1PPCE 2WPMS 4XE4A 3H5CB 2ILNA 4AFSA 1DT2A 2W7SA 3A86A 4ISOA 1O3JA 1TPPA 3TK9A 1P9SA 5C67A 3AVZA 3MU8A 1AB9C 5L30H 4ABHA 4TWWA 1EB2A 1WCZA 4LK4A 1A3EH 4MPVA 2ZFRH 1QGFA 2GDEH 2ZI2H 3ITIA 1VCWA 4K8YA 3ZZ4A 4K1SA 3V0XA 5C20A 3RXVA 3GYLB 3KF2A 2FXRA 2C8ZB 4DOQA 5EODA 3ATKA 3MI4A 1ETTH 1OPHB 4K5ZA 2UWPA 3PO1B 1C5YB 3SU4A 2FOCA 1C2FA 1P01A 3TGIE 8GCHG 1GBEA 1THPB 2XC4A 3LH1A 1F0SA 1ELVA 5EXMA 2PTCE 3Q00A 1UHBB 1TGSZ 1SOZA 4WXVA 1HLTH 1O2ZA 2ZHWH 1HBTH 1OKXA 1S0RA 1QCPA 4R0IA 1AGJA 2GD4B 4JZEH 2Q1JA 1ZGIA 2G8TA 1HUTH 1LPKB 4KTUA 2Z7FE 1ZMNA 2J95A 1TOCB 4Z0KA 1NROH 1QB6A 1WUNH 3RXKA 2P8OB 5EPNA 3D23A 3M36A 1RJXB 3OY6U 3A7VA 5JB9S 4X2XA 2AGIX 3BTGE 1IQIA 1G32B 1YLCA 1NM6A 1O3GA 1ANCA 1XUKA 1OWDA 1C2KA 3SJOA 3QTOH 1WYKA 4NFEA 4NG9H 1LMWB 2WUBA 4YOJA 3TITA 1ZMLA 1P9UA 4NA8A 2FOMB 5LPRA 4BTTB 1NESE 2W5EA 5E2PA 1Y3VA 1MKWH 3A8AA 3RMLH 2F9PA 1EZUC 1KIGH 3ZVGA 1LVMA 2JKHA 3LC5A 1OWHA 2D26C 3RMMH 3SNDA 3A89A 4K2YA 4AYVB 3M3VA 2J2UA 7KMEH 1O3CA 1NFWA 1O31A 1ZOMA 3A8DA 2ZTZA 4GVUA 4A92A 1FIZA 1YPMH 1ZRBA 1HXFH 5DGJA 3T28A 3NUMA 3LJJA 2XW9A 3LH3A 1O2LA 1SOTA 2AFQB 4ISHH 4RKOB 4AFQA 4CRDA 2ESTE 2QXHA 2F9VA 2ZPRA 5T6DA 3RP2A 2ZQ2A 1YBWA 3I29A 4LXBH 2F91A 1EPTC 1LQDB 1O2UA 2GZ7A 1O2JA 4KP0A 4UFFH 2HNTC 4B76A 4IC6A 1UVUH 1EKBB 2ZPQA 1MKWK 3TJOA 2TRMA 1GL1A 1W14U 2Z9JA 3Q3YA 4JYUH 1OWIA 4Q7ZA 4ISIH 1FI8A 4K3JA 1OSSA 2BDGA 4BXWA 2AIQA 1G30B 1AKSB 4CBOA 1O35A 3PLPA 4ZUHA 4CRCA 2BXUH 3RMOH 1BJVA 1P09A 1O5EH 1EJMA 4A1XA 3SU1A 4OS6A 1MTUA 1SSXA 1EP6A 5EU8A 1A1RA 1TB6H 2DE8A 4GHQA 1NU7B 3ZZ7A 2R9PA 2B5TB 1BCUH 4B1TA 2ZDNA 1DUAA 3RXQA 5CE1A 2XTTB 1NTPA 2HVXA 4Y11E 1O2XA 3MYWA 1J16A 1OXGA 1UCYE 1UK2A 2BY8X 1QRWA 1D3DB 1DX5M 1TPAE 3MH4A 1S82A 3BTTE 3BTHE 3EA8A 3ODFA 3PO1C 1E36B 9ESTA 2HNTF 1Q3XA 3FVFB 1W3CA 3RXIA 2V3OH 1ETRH 2ASUB 1S5SA 1WTHD 1CT2E 1YPHE 2ZPSA 1Z1IA 1XX9A 5AHGH 1DE7H 4FUGA 2ZDVH 4FUEA 4QT8C 5EXLA 3U8TH 5DP7A 1PQ7A 2CMYA 3GY3A 3MNXA 4GHTA 3RM2H 2R2WU 2WPKS 3Q3XA 1C5TA 4O3TA 3T5FH 1C5UA 1HAZB 2ZGXH 1O5GH 1O3MA 2P8OC 2HLCA 3UQOA 1NFXA 3GCTF 1NZQH 3PROA 2FOFA 1ZJDA 3SZNA 1SGFG 5C5NA 3PTBA 4RKJB 2VB0A 1G3BA 2Q6DA 1O2WA 2OQUA 4NIWA 4X8UH 1K1IA 6ESTA 1O3DA 1ELAA 1MTWA 3OX7U 3ATLA 1NFYA 1SVPA 1IQKA 2TPIZ 3RXOA 2FMJA 3MFJA 2ZF0H 2ZDKA 1FMGA 1FY8E 1F2SE 1C1SA 4Y10E 2QC2A 3OYPA 1F92A 1O3EA 4Y76A 1Y5BT 1BTWA 4YLUA 1QJ6B 1FZZA 3CS0A 4OGYA 1CO7E 2QF0A 4CREA 1C2LA 3E1XB 1SL3A 3BTEE 1U6QA 3K6ZA 2A7CA 1CQQA 2AYWA 4A1VA 3F68H 1C2IA 1ANEA 1NS3A 1PYTD 1NT1A 1ZTJA 1LHGH 1O33A 1WV7H 2VIWA 1E38B 1ORFA 2BM2A 2WYJA 1ESTA 1O32A 1P12E 4NGAH 1Q2WA 2RCEA 2A5AA 2O9QA 2PUQH 5LPEA 3A7XA 4OS1A 1KSNA 1GI1A 4F49A 6LPRA 1MCTA 3EE0B 3EYDA 1AZZA 1TNGA 2V6NA 3MHWU 1YPGH 5LPFA 1P2QA 3HGPA 4YOIA 3SNEA 5JPMH 8LPRA 1CBWB 1Z8JB 5EQQA 3KGPA 4TYDA 4XFQA 4KTSA 2VIVA 1MCVA 1MU8B 5A0CA 2GGVB 1TPSA 5JBAS 1AUJA 1TRNA 3GDSA 3T62A 4WH6A 1D4PB 4NZLA 4YLQH 3NPSA 4UFDH 2ZG0H 1QL8A 1Y3WA 1BIOA 4GPGA 5ABWA 5CHAB 1JRTA 3EDXB 3O8RA 3LDXH 4ZHAA 4CR5A 4K69A 4ZXXH 3QUMP 1HAVB 4BANB 2O8TA 3OSYA 1QL7A 4Y71A 4MNWA 5FBEA 2BQ6B 1TNHA 2ALVA 3SHCH 3M5NA 3LT3A 4MTBA 4BAOB 2PGBB 2VIDA 1LHCH 1GBDA 5E0GA 3O8CA 3BG8A 1RFNA 1TWXB 1H8IH 1TALA 5T6GA 3UR6A 4U30A 1T31A 5EQSA 1C4Y2 3H7OA 1FUJA 4FXGH 2VIPA 5L6NH 2BY9X 1F5KU 1BMAA 3LGWA 3PLBA 5GCHF 1QFKH 4UDWH 3ZV8A 3C27B 1GBAA 2ZP0H 1T8MA 1V2RT 1E35B 1XUFA 3DFJA 3ENSB 1SGDE 1UVOA 5JDUB 2Z94A 1HAXB 2ZIQH 1NRQH 1ZTKA 5A8ZA 1NY22 1A46H 3KCGH 4NA7A 2AMDA 1BA8B 2GCTB 1O3HA 1C5RA 5E0HA 2G4TA 1Y3YA 4TPYA 3MU5A 1N8OB 1XKBC 2P95A 2XXLA 1MD7A 3UTUH 3SU5A 1ZTLA 1ABJH 1MD8A 2AS9A 1W8BH 1IQMA 3MNCA 2B9LA 1TQ7B 2BLVA 2ZHDA 3BEFB 3WY8A 1GBJA 1P06A 2D8WA 5K0HA 2SGAA 1AY6H 2GTBA 2WPHS 1RTFB 1XVOA 2C93B 2OP9A 4CBNA 3ZVFA 1GCDA 1O5AB 1A5GH 3K65B 4DIIH 1TNJA 1F0RA 1TQ0B 1O2IA 3BTDE 1PPZA 2PUXB 1TBZH 3C1KA 4FUDA 1QRZA 3N7OA 1SG8B 1GHXH 4FUJA 1UK3A 1L4ZA 1FY1A 2G55A 1DWCH 1TONA 2ODPA 3RMNH 2STBE 1AVXA 1IQEA 1H4WA 1FXYA 2XBWA 1UTMA 3SV6A 4SGBE 1O34A 1KLTA 2ZCKP 5T3HA 1O3BA 1A0JA 1L1NA 2A4QA 2FOAA 2BLWA 3BF6H 1TOMH 5GWZA 3BV9B 2R0LA 2B0FA 3ZVCA 1SGCA 3GY7A 2Z9GA 1LQEA 5H4IB 2ZDLA 5JYIA 1ELFA 1GBFA 3BG4B 1ELCA 1VITG 1VJ9U 1QQUA 4TPIZ 1E34B 3TJVA 1TMTH 1IQLA 1EZSC 1LVYA 1SI5H 3F9EA 3KQEA 3MTYA 1BQYA 2EI6A 1ARCA 4X2YA 5CHAC 2FOBA 4AYYB 2A1DB 2QXGA 3VB5A 3O8DA 1FY5A 3SV9A 1HJ8A 1E37B 1ZYOA 1HIAB 2R2MB 2TGAA 2QA9E 3ATIA 4MNYA 5EXNA 1L0ZA 2Y82A 4A7IB 1C5XB 4BOHA 2AERH 4IMQA 1MTVA 1RXPA 4FUBA 1BRCE 2FWWA 1BBRE 1GVZA 2FOGA 3FANA 5AF9H 4TWYA 3PLKA 3FZDA 2H2ZA 1EZXC 3QK1A 4GCHF 3BN9A 1CA0C 2F9UA 1V6DA 3RXPA 3UWIA 3TK5A 3LOXA 2HNTE 1QBNA 2AMPA 4Q7XA 8ESTE 1G3CA 1A5IA 1W12U 1LHEH 3UNSA 3GCTG 3ZVBA 1HRTH 3RXFA 2QXIA 1HJ9A 1H9IE 1P2IA 4E7RG 3A85A 1P3EA 2ZGCA 1O2YA 1OWKA 1O3AA 3I78A 2XCNA 1ABIH 2GCTC 2GZ9A 2Y5HA 1DLEA 2LNCA 3S9CA 1V2TT 1DVAH 3SNAA 4E7NA 2BZ6H 1N8OC 1EOLA 1NC6A 2ZDAH 2Q6FA 4IW4E 1T8LA 4OS2A 5C1YA 1SLWB 4OS4A 4CR9A 1YCPH 1BT7A 1DICA 4X6NA 5L2ZH 1K2I1 4Q7YA 1C5QA 3TJNA 4A1TA 4ABEA 2B8OH 2FTLE 1H1BA 1V3XA 2ZHQH 5AVDA 5A09A 2FI4E 1Y5UT 4MNXA 4MLFB 1HFDA 3ZZBA 1J9CH 1OYQA 3KN2A 3KQDA 1PQAA 2BD7A 4FUHA 4DJZB 1P03A 1EJAA 5G4BA 2P94A 1F0TA 2VINA 4ABFA 1UVPA 3RXTA 1PQ5A 2ZQ1A 1Z8GA 2ZGBH 1GI3A 2CJIA 3RDZA 1YLDA 5K7RA 1PYTC 1THRH 1EQ9A 1ZSKA 1B7XB 5BRRE 1C1QA 2ZFTA 1D3PB 3PMJA 1MAYA 3VB4A 3GOVB 2FEQH 2FESH 3RLYH 4B2AA 4CRGA 4M7GA 4K1EA 4DCDA 1C1OA 2R3UA 1ZPZA 1H9LB 1YP9A 3TJUA 1TLDA 1C5WB 1D3TB 2BDBA 3QGNB 1VCQA 4Y7AA 1K28D 2XCFA 5LH8A 2CF9H 1UHBA 1BMMH 1BUIA 1YCPK 2AIPA 4I31A 1SFIA 1S81A 3HPTB 2BTCE 4Q80A 3QZRA 4U01A 2QY0B 5GPIB 5B6OA 1ELBA 1P0SH 4D7GA 1PPEE 3BG4C 3KEEA 4XSKU 3SI4H 7GCHF 3BTQE 1BJUA 1LO6A 1TYNA 2WPIS 1C5MD 4YTAA 1DM4B 2OLGA 1GBKA 1O0DH 1TX8A 1DXPA 2IN2A 4UFEH 1C2EA 1N1LA 2ZWLH 2SFAA 1FN6A 4NSYA 2BQWB 4F4OC 5EG4A 2STAE 1K1MA 3DD2H 5FCRA 1ARBA 1T32A 4FU9A 2THFB 1RTLA 1UCYH 1KXDA 3SJ9A 1AFQB 1ZPCA 3ZVDA 3S9AA 3NKKA 4ESTE 5FHTA 1BTZA 1C9PA 4CH2B 3MWIU 3A80A 2G00A 1W0YH 1ZRKA 3RXUA 1CGIE 1FY4A 3PWBA 2O8WA 5GCHG 1TBQH 5F6MA 1B0EA 5A8YA 4MPXA 1EATA 3M7UA 4X6PA 3MH5A 5FCKA 1TMUH 2PHBA 2ZEBA 1SGQE 1QBVH 2ZC9H 3E0PB 3Q3KA 2H1UA 5EPYA 3TGJE 2Y5GA 2PLXA 2Z9IA 1HAIH 1K21H 1MQ6A 2CXVA 2ODYB 2ZKSA 1L1JA 2ANMH 3RXRA 3T27A 2FI5E 5JB8S 3E0NB 2GP9B 3SV7A 3OU0A 3VXFH 3S7KB 2FLRH 2NU4E 1UCYK 2TBSA 3UUZA 4B73A 2XNIA 1DDJA 1K1LA 1GHAF 4AB8A 4JYTA 1O3OA 1K9OE 1EP5A 2BZAA 1SGPE 1BITA 1AKSA 1HJAB 3M37A 1ZZZA 4I8KA 1ZGVA 1FNIA 1ZPBA 3H7TA 4GLYA 4E05H 1JRSA 5DP8A 1V2UT 3KQBA 1GDQA 3GCHB 2BD9A 1VR1H 2A31A 1AE8H 2BDIA 1BTUA 3LIWA 2J34A 2YNAA 3GICB 4BAHB 1O30A 1SBWA 6GCHF 4CRBA 4NFFA 1GI5A 2ZU3A 1L2EA 1FONA 2OC7A 3ESTA 2IOTA 4X8SH 5HM2A 4O3UA 4YT7H 4HZHA 5DO4H 2O8LA 1Y5AT 1KDQB 1DOJA 3STIA 3LONA 1AWHB 2A0QB 2AMQA 2OD3B 3V12A 2FP7B 2PTNA 3E3TA 1AZ8A 1GDNA 3DUXH 2FM2A 1RD3B 1DY8A 3W95A 1TGNA 3MO9A 1OWEA 3M35A 1C5PA 1O3LA 5HM9A 1SHYA 1P2KA 2RA3A 2Z9KA 3HATH 3TLOA 4O97A 2F9NA 3FAOA 4DGJA 2QYIA 1GBBA 1GMHG 1TPOA 3RXJA 5DKMA 2BX4A 4I33A 3I77A 2OBQA 3CENA 1C1UH 1WOFA 1N6YA 2O8UA 4I32A 4VGCB 1DFPA 4X0WU 1CHGA 2M5TA 2FLBH 1EB1H 1IQFA 1NU9A 5IDKA 2YOLA 2BD8A 4CHAB 2V3HH 1UK4A 4TY6A 1AD8H 2ZTYA 1EAWA 2P59A 1KXEA 1QIXB 1T8NA 5BPEA 1QA0A 2OQ5A 4CH8B 1A2CH 2QGRA 3EA9A 1QA7A 1AU8A 1AFEH 2WPLS 4GCHG 1G37A 1C1VH 4X1PU 2NU3E 4X8VH 4DT7B 1JBUH 2PR3A 2YNBA 3V3MA 1FDPA 3GY4A 1B0FA 3U1JB 2G5NA 4PROA 4O03A 3E6PH 1QB9A 5E8EH 1GJ6A 1KY9A 4UONA 4WY3A 2J92A 2FIRH 3A8CA 1GBLA 4ABJA 4BAQB 3F9GA 5AFYH 5F8TA 3GCOA 4Y6DA 1GHZA 3B8JA 1XM1A 2BDCA 2I6SA 2OBOA 1YCPM 2QXJA 2GMTB 2A4OA 5DG6A 1DITH 3SV8A 1HYLA 5T6FA 4AB9A 1G9IE 1O38A 5JBCS 5HGGA 1YF4A 3R3GB 3QDZB 1QTFA 1GHYH 1KTTB 1A0LA 3EAJA 1HXEH 2K1QA 4Y79A 5C1UA 1BMNH 4B71A 2EI8A 2CN0H 4JZIA 1UTPA 2J94A 2BX3A 3VB6A 1V2VT 3AW0A 1VCPA 2FO9A 1FPCH 4HI3A 3SO3A 4AORA 4YT6H 5EGMA 3STJA 1ELTA 1ZLRA 3ATMA 1V2OT 4JZFH 3L3TA 1J14A 3SORA 2SGEE 1O3FA 4NA9H 1SGTA 3BTKE 3S69A 2D1JA 1SQAA 2GKVE 1JMOH 1W11U 4X2WA 1S85A 1VGCB 1SLVB 4ZHLU 4IS5A 2G5VA 1LTOA 2ZU1A 3RU4E 1W2KH 3PMBB 3E16B 2NU2E 4AX9H 2FODA 5F03A 1HAVA 1W13U 1QBOA 4ABBA 3U98H 1D9IA 1BOQA 2EA3A 3ZVAA 1O2NA 1C4V2 1MKXH 3CS7A 3PV4A 1QY6A 1LPGB 1ESAA 1DSUA 3AAVA 3S0NA 3VFEA 1TNLA 1P2JA 3E91A 4AFUA 1W0ZU 3MU1A 1AWFH 3MU0A 2C3SA 2SGPE 5FXLA 1KYNA 5FX5A 2BOHB 3UY9A 2A5IA 2ZA5A 4XBCA 3ZV9A 2GX4A 3SJIA 2UUKB 3JZ2B 1GMCF 2BD5A 1QURH 3LJOA 1BB0B 1C1MA 2BYAX 3ZZ5A 7GCHG 2XWAA 1PQ8A 3UOPA 3K6YA 1G2MA 1QJ1B 5TCCA 2UUJB 3GDVA 4FUCA 3OY5U 4VGCC 1MTSA 3URCA 3SUFA 5A2MH 4TY7A 5PTPA 1INCA 1P04A 3NK8A 2DUCA 2PKSB 1GJCB 1C5ZB 3LU9B 1LHFH 1VITH 1O2GH 1CA8B 1MKXK 4JYVH 1SLUB 1CE5A 1O2QA 4MNVA 3P8NA 3SU2A 3RXEA 4BTIB 4ZKSU 1OS8A 1MMJN 1UVSH 1ZSJA 3DFLA 2W3IA 5FBIA 1HGTH 1BBRH 5C3NA 1DPOA 3M7QA 1MQ5A 4BXSA 1ANDA 1F7ZA 1DXWA 2HPQH 4LZ4B 1BRUP 2GV7A 1ELEE 1A61H 3BIUH 2VGCB 3SGBE 4RSPA 1XVMA 1V2QT 1AMHA 4E06H 5I25A 2KAIA 1C5LH 2KAIB 3RLWH 2BDYA 2OTVA 1P10A 2VIOA 4NIVA 3T25A 2F83A 5A0AE 1C9TA 2Q6GA 4WJG2 3M7TA 4GAWA 3V13A 1QJ7B 1FY3A 2ZFQH 2SGDE 4OGXA 1O2SA 4KELA 2BDHA 4X6OA 1C1NA 3F9HA 1GHAG 1BTHH 4A5TS 4IGDA 1YC0A 1EAXA 2R3YA 4WWYA 1TNIA 3SUGA 4D8NA 1SLXB 3K9XB 4JZ1A 4FVDA 3W94A 1CHOF 1MTNB 1D6WA 1TAWA 1BBRK 1CBWC 4UFGH 5DK1A 1AUTC 2A4RA 3UPEA 4ABDA 2AGEX 8KME2 1V2ST 1DY9A 7LPRA 1SGYE 3M3SA 2OC0A 1ZSLA 1EUFA 1IQGA 2BQ7B 4H6TA 3TVJB 1GDUA 1Z1JA 1LVBA 1O5DH 2PKAB 1YKTA 3DHKH 1BTXA 1VGCC 6GCHG 1HPGA 1MAXA 3A88A 2FYRA 3T2NA 1GI9B 2W3KA 1SR5C 1J8AA 1KXCA 5E2OA 7ESTE 1S83A 1TE0A 2P3TB 3SU3A 1HIAA 1SGRE 1M9UA 5DP4A 3SU0A 1SB1H 1GJAB 3SNCA 4I8GA 1JOUB 4X1QU 1UTLM 4YOGA 4NWLA 1AVWA 1T4UH 2FI3E 1MUEB 1OOKB 2BY7X 1C4U2 2JETB 2XRCA 1IAUA 1WQSA 2C4FH 2BVSH 2OCVB 2QF3A 4SGAE 5F8ZA 2AEIH 2B7DH 1S0QA 4UD9H 4NIYA 1UMAH 2BB4A 4Y8YA 5HYOA 1DWEH 1GI4A 2Z9LA 3MH6A 2XYAA 3A7WA 1H8DH 2R0KA 4MPWA 1GHBF 4THNH 4ZXYH 4WF8A 1VJAU 2BD2A 1AIXH 2NU1E 2F3CE 4NWKA 3PYHA 2OC8A 3SBKA 3GY6A 2H9TH 4WMFA 4A6LA 3VB3A 1W7GH 1D6RA 2F9OA 3ZZ6A 2V35A 5E0JA 2Z6BD 2PFEA 5SGAE 3SN8A 1V2LT 2ALPA 3Q77A 4YO9A 2PKSC 2FTMA 1O3NA 4INHA 3ZZAA 1O37A 1V2WT 2RG3A 1FAXA 2GCHF 4DW2U 1TRYA 3ZZDA 3KHVA 1KXFA 3D65E 1QRXA 3QN7A 3S9BA 1P11E 1IHSH 1HAGE 1QR3E 3LPRA 1OP8A 1EPTB 3SJKA 2HPPH 1HDTH 4JZDH 5HMAA 1V2KT 3SUEA 1FAKH 1H9HE 2GT8A 2WV4A 2Z3CA 4AFZA 2BVXH 1GI8B 3RC6A 1O36A 3FP6E 3S7HB 5FPYA 3RXHA 1WQVH 2D2DA 4YESB 4BNRA 1CGJE 1YYY1 4KGAA 2OXSA 2C8XB 3AAUA 1OP2A 3RXSA 2VGCC 4XBDA 2QV1A 3NZIA 1PJPA 1MBQA 3A7YA 1C2JA 1JIMA 3R0FA 1EOJA 3MOCA 1TA6A 1ZJKA 4D76A 1NN6A 4D7FA 1OYTH 1X7AC 4AGKA 3P8FA 1JWTA 2J4IA 1GJ9B 2NWNA 1O2KA 1XXFA 4ZROA 1HNEE 1YM0A 1Z7KA 2ZU5A 3UR9A 4AG1A 2IJOB 2ZZUH 2VVVA 4WH8A 1YPJH 3ZZ3A 4UE7H 1MBMA 4WVPE 1F5RA 1EAIA 1L1GA 3CP7A 4Y0YE 2Y81A 1Y3UA 1FN8A 1MTNC 3A7ZA 1GJ7B 2Y6TA 1EASA 1HV7A 2ZGHA 1Z8IB 4IBLH 4OS7A 3SUDA 2H5CA 2J38A 3VPKA 2GT7A 1NFUA 3AW1A 1P05A 3FP7E 1KTSB 5A0BA 1C1PA 2ZECA 1WSSH 1WAYB 2TGTA 2VVCA 2QAAA 2XBVA 3ZYEA 2VNTA 1T4VH 3A82A 2ZO3H 3M61U 1YPLH 2ZTXA 3A87A 5DP6A 2Y5FA 1RS0A 3U9AH 3F9FA 1AHTH 5EQRA 1PPHE 2DE9A 3T26A 4RN6A 3TU7H 1C5VA 2C90B 3G01A 4AN7A 5L2YH 1HAYB 1PPFE 4HGCA 5C1XA 4D9QA 1J17T 2BOKA 1P8VC 1O2OA 5CMXH 1L4DA 3HKIB 5FX6A 3VXEH 3P6ZB 2TGDA 1Y59T 2BMGB 1V2NT 2JETC 1XMNB 3QTVH 1QNJA 5GDSH 1ZMJA 3LGTA 1GJ5H 2ANWA 4H6SB 5A8XA 3E90B 1GMCG 3BTWE 3UIRA 4IMZA 3P70B 1UTOA 1QL9A 3NCLA 3FZZA 2SNWA 1EJNA 3OTJE 4LZ1H 3U1IB 2H9EH 1LCYA 2WINI 3ZVEA 2JH0D 1VZQH 2EC9H 1UTKA 2BY5X 4K1TA 3QX5H 2FOEA 1C1WH 3FP8E 3U8RH 2SGQE 2HGTH 3ODDA 4GUXA 2FX6A 3HK3B 4X1RU 5EW1H 1O3PB 2Y7XA 5ESTE 2ZDMA 1O2HA 2GDDA 3URDA 1V2MT 2AH4X 1ZHPA 2WYGA 4D9RA 2PSXA 1XUJA 4U2WA 1LPZB 5AFZH 3U69H 4KTCA 4KKDA 1TGCA 2A4GA 3TPIZ 1HAOH 2O8MA 1GWAA 1LKAA 5DP5A 1SPJA 1AN1E 3P95A 2CF8H 3ZZ9A 1S6HA 2H5DA 3ZZ8A 3RC4A 4IN2A 4BTUB 5C2ZA 3MMGA 3MNSA 3NWUA 3AASA 1TGBA 2IPHA 3QGJA 4MG3A 1K1JA 1FIWA 1OP0A 1ANBA 4DURA 2WPJS 1GI0A 2UUFB 2P93A 1SGIB 1C2MA 4B74A 1K1OA 4MQAA 1GBHA 1FJSA 3HK6B 3TGKE 1G3EA 1KDQA 1VITF 4WMEA 1A5HA 2VJ1A 1GHWH 1FV9A 3QLPH 3P17H 1TNKA 1V2JT 5GIBA 1CHOG 4ZHMU 1GGDB 1CGHA 3BEUA 3MO3A 2ODQA 1GVLA 2A2XH 2ZGJA 2RA0A 1P57B 3BTFE 4LOYH 3RU4D 4NZQA 1BMLA 3IWMA 3F1SB 1NRRH 3E8LA 5JBTA 1GBCA 4Y7BA 1JIRA 3SNBA 4ISLA 3UNQA 2SGFE 4BAMB 2HWLB 1O39A 5ETXA 1K1NA 3SQHE 2J9NA 3QZQA 1IQJA 3SHAH 2UWOA 2VWMA 3SJ8A 3PMHB 4AGJA 1UTNA 2VWOA 2XWBI 1O5FH 3A8BA 4MVNA 1O5CB 1HB0B 2G4UA 3SGQE 2V0BA 4ZKNU 1GBMA 1F5LA 3ELAH 4O9VA 1B5GH 3RXCA 2FDAA 1LDTT 1CT0E 1O2RA 1XUIA 3IG6B 1GVKB 3EGKH 5LGOA 3GY5A 1NO9H 1T7CA 4ZKOU 1AFQC 1RIWB 1K1PA 2HOBA 3PWCA 2CV3A 1GMDF 1P2OA 1IQHA 1HCGA 2PW8H 4DIHH 4HTCH 1BHXB 4AZ2B 2A5KA 1QB1A 1AI8H 5DP9A 1C2GA 1NRPH 4U32A 1EXFA 3PMAB 3VB7A 1N6XA 2GV6A 3RXLA 1GHBG 1XXDA 1Y8TA 4X1SU 2BLQA 4ASHA 4H4FA 1UTQA 1A4WH 2QCYA 1LVOA 4DY7B 2VWLA 2FYQA 4X8TH 1Z6JH 3ZZCA 1BTYA 1TABE 2XBYA 4FUFA 3UWJH 1SGFA 4K8BA 1SGNE 4X1NU 3SQEE 4I8LA 2CGAA 2AGGX 2GCHG 2G52A 2FPZA 4Y8ZA 2BDAA 3UFAA 1BDAA 4BAKB 2C8YB 1SQOA 1O2MA 4IN1A 2XC0A 4Q2KA 4R8TB 1ZHRA 3TNTA 3VGCB 3TH3H 1HJAC 1UVTH 1MU6B 2VWNA 3LKWA 3RXBA 3UREA 1EZQA 2VU8E 3EQ0H 3KIDU 1FPHH 1CVWH 1SQTA 1TMBH 6CHAB 3LGYA 1SFQB 3QO6A 1GI7B 3GISB 3MNBA 2ANYA 1W7XH 2F9BH 2PGQB 3M5LA 3B9FH 5C5OA 2XBXA 2ZHFH 5ESBA 3ATWA 1GJ8B 3L6PA 1DWBH 3BSQA 3LC3A 8GCHF 2VIQA 3GCHC 1BZXE 1GL0E 3TH2H 3A7TA 4ZH8A 5EW2H 4NCYA 1DUEA 3RXMA 3NXPA 4JMYA 1G36A 1S84A 1UO6A 5FPTA 1Z8RA 1G2LA 4Y8XA 3TIUA 1OX1A 1C5OH 2BXTH 3P8GA 2GVFA 1YPKH 3LGUA 3P92A 1DS2E 3HGNA 1IQNA 2QIQA 1CSOE 3V7TA 3RXGA 5FPSA 1GBTA 3D49H 2Y80A 4B2BA 1GGDC 1C2HA 1RTKA 1GHVH 4ISNA 4H42U 1CT4E 2HRVA 2BY6X 2BVRH 1F0UA 3FFGA 3M5OA 1A7SA 1GI6A 3GY2A 1EAUA 3P8OA 3QWCH 4NIXA 4K60A 1PPGE 5GJ4B 4X6MA 2BHGA 1YGCH 2WUCA 1WTGH 2A7HA 4WXIA 2G81E 4FU7A 1GG6B 3BTME 3D62A 4AG2A 4B75A 1TIOA 2NU0E 1A0HB 1TRMA 1E0FD 5HXFA 4CRFA 3LGVA 1CA0B 3EA7A 3TH4H 1IHTH 2Z3EA 2PWXA 1QQ4A 3SV2H 4CHAC 2GZ8A 1SHHB 2ZU4A 1J15A 3SI3H 4J1YA 1G3DA 2VH6A 1DANH 1OWJA 4WMDA 3M5MA 1IOEA 1THSH 3F6UH 3RU4T 2ANKH 1AE5A 1CU1A 1YPHC 4ZAEA 1RIWC 1NRSH 2ZFSA 2CHAB 2BLOA 2A2QH 2OUAA 4AOQA 1C2DA 5J4SA 1O2TA 1UTJA 1WU1A 1KLIH 5I46H 2H9HA 4IC5A 1A3BH 1ELGA 1NPMA 3RXDA 3TNSA 1LHDH 2UWLA 1O3IA 2G51A 4J2YB 2JH5D 1P3CA 3KQCA 1GCTB 2BD4A 3RC5A 1FQ3A 3IITA 2ZHEH 2PSYA 3MO6A 3A81A 4I8HA 1D3QB 1ID5H 4UEHH 3RM0H 4Z6AH 4MPUA 1O5BB 2ZNKH 2OINA 1PFXC 2FS8A 1S6FA 2FS9A 2C8WB 3GY8A 2TIOA 1C5NH 2GMTC 1SC8U 4ABIA 1GPZA 2A7JA 1ACBE 1AVGH 1RRKA 2TGPZ 1ZR0A 2QN5T 4ZKRU 5DPAA 4Y0ZE 1AB9B 4X2VA 4B2CA 3GYMA 3UOUA 4HFPB 2VH0A 5TCAA 3VGCC 1XUHA 3PTNA 1MH0A 3GCNA 3JZ1B 3Q76A 6CHAC 1C1TA 2EI7A 2FZZA 1BHXF 1PPBH 3A83A 2ZFFH 2PKAA 1T8OA 2WV5A 3LGIA 3HKJB 1MZAA 5FAHA 9LPRA 1V2PT 3GDUA 4DVAU 1TFXA 2BD3A 4JCNA 3UQVA 5J4QA 3M3TA 1ZHMA 3O8BA 2FX4A 1JXPA 1O3KA 1TX6A 3KL6A 1RGQA 1UJ1A 1AO5A 1KLJH 1KXAA 5F8XA 1GMHF 3PM3A 1TX7A 2P16A 1MZDA 4CRAA 5TJXA 1C5SA 1HAPH 5EOKA 4JK6A 1GBIA 1EX3A 4ZMAH 4INLA 1YPEH 1XUGA 1LKBA 1Z71A 3BEIB 1C1RA 2A45B 2ZU2A 4MDSA 1W10U 3PB1E 3T29A 3UNRA 1TA2A 3SOSA 2W7UA 5IYTA 1BTPA 1ETSH 1P2NA 2ZCHP 4YZUA 4ABAA 3SU6A 2ULLA 3VEQB 2EEKA 2JH6D 2XC5A 4FVBA 4XOJA 1GI2A 1Z6EA 3DT0H 1KXBA 1GG6C 1ESBA 2H6MA 3SW2B 2ZCLP 4JK5A 1BRBE 1TBRH 1BRAA 2Y7ZA 3BIVH 4FU8A 2Z3DA 2ZFPH 3RXAA 4XBBA 2VVUA 3DA9B 5DJ7A 3MU4A 1Y3XA 4I8JA 1Q31A 2OC1A 3B23B 2UUYA 2RDLA 1WBGB 1GMDG 3ZYDA 2PV9B 4I7YH 1DLKB 1GJ4H 4XDEA 1EPTA 4NSVA 4GSOA 3KNXA 2CHAC 4FUIA 1O2VA 1GJDB 1AQ7A 1P02A 4ABGA 3U8OH 1SGEE 4DG4A 1HAHH 1SMFE 1TGTA 1NRNH 1P2MA 3MH7A 2P3FH 1FLEE 2W26A 4OS5A 5GXPA 3K2UA 3RUOA 2FOHA 4YM9A 1DSTA 5DP3A 1ELDE 2SNVA 3L33A 2A32A 4INKA 1K22H 1XKAC 2P3UB 5JBBS 3TK6A 1GCTC 1O2PA 1GJBB
chains in the Genus database with same CATH superfamily
1QHRB 2I6QA 3SGAE 1DWDH 2LPRA 2HALA 3A84A 1PPCE 2WPMS 4XE4A 3H5CB 2ILNA 4AFSA 3DSGA 1DT2A 2W7SA 3A86A 4ISOA 1O3JA 1TPPA 2GJGA 3TK9A 1P9SA 5C67A 3AVZA 3MU8A 1AB9C 5L30H 4ABHA 2KM0A 4TWWA 1EB2A 3H09A 1WCZA 4LK4A 1A3EH 4MPVA 2ZFRH 1QGFA 2GDEH 2ZI2H 1VKYA 3ITIA 1VCWA 4K8YA 3ZZ4A 4K1SA 2YMSB 3V0XA 5C20A 3RXVA 3GYLB 3KF2A 3WWBA 2FXRA 2C8ZB 2QF4A 4DOQA 5EODA 3ATKA 3MI4A 1ETTH 1OPHB 4K5ZA 2UWPA 3PO1B 1C5YB 3SU4A 2FOCA 1C2FA 1P01A 2WZQA 3TGIE 8GCHG 1GBEA 1THPB 2XC4A 3LH1A 1F0SA 1ELVA 5EXMA 2PTCE 3Q00A 1UHBB 1TGSZ 1SOZA 4WXVA 1HLTH 1O2ZA 2ZHWH 1HBTH 1OKXA 1S0RA 1QCPA 2KCYA 4R0IA 1AGJA 2GD4B 4JZEH 2Q1JA 1ZGIA 1YWUA 2G8TA 1HUTH 1LPKB 3OTPA 4KTUA 2Z7FE 1ZMNA 2J95A 1TOCB 4Z0KA 1NROH 1QB6A 1WUNH 3RXKA 2P8OB 5EPNA 3D23A 3M36A 1RJXB 3OY6U 3A7VA 5JB9S 4X2XA 2AGIX 3BTGE 1IQIA 1G32B 1YLCA 1NM6A 1O3GA 1ANCA 1XUKA 1OWDA 1C2KA 3SJOA 3QTOH 1WYKA 4NFEA 4NG9H 1LMWB 2WUBA 4YOJA 3TITA 1ZMLA 1P9UA 4NA8A 2FOMB 5LPRA 4BTTB 1NESE 2W5EA 5E2PA 1Y3VA 1MKWH 3A8AA 3RMLH 2F9PA 1EZUC 1KIGH 3ZVGA 1LVMA 2JKHA 3LC5A 1OWHA 2D26C 3RMMH 3SNDA 3A89A 4K2YA 4AYVB 3M3VA 2J2UA 7KMEH 1O3CA 1NFWA 1O31A 1ZOMA 3A8DA 2ZTZA 4GVUA 4A92A 1FIZA 1YPMH 1ZRBA 1HXFH 5DGJA 3T28A 3NUMA 3LJJA 2XW9A 3LH3A 1O2LA 1SOTA 2AFQB 4ISHH 4RKOB 4AFQA 4CRDA 2ESTE 2QXHA 2F9VA 2ZPRA 5T6DA 3RP2A 2ZQ2A 1YBWA 3I29A 4LXBH 2F91A 5B6LA 1EPTC 1LQDB 1O2UA 2GZ7A 1O2JA 4KP0A 4UFFH 2HNTC 3U28C 4B76A 4IC6A 1UVUH 3FKSD 1EKBB 2ZPQA 1MKWK 3TJOA 2TRMA 1GL1A 1W14U 2Z9JA 3Q3YA 4JYUH 1OWIA 4Q7ZA 4ISIH 1FI8A 4K3JA 1OSSA 2BDGA 4BXWA 2AIQA 1G30B 1AKSB 4CBOA 1O35A 3PLPA 4ZUHA 4CRCA 2BXUH 3RMOH 1BJVA 1P09A 1O5EH 1EJMA 4A1XA 3SU1A 4OS6A 1MTUA 1SSXA 1EP6A 5EU8A 1A1RA 1TB6H 2DE8A 4GHQA 1NU7B 3ZZ7A 2R9PA 2B5TB 1BCUH 4B1TA 1NBME 2ZDNA 1DUAA 3RXQA 5CE1A 2XTTB 1NTPA 2HVXA 4Y11E 1O2XA 3MYWA 1J16A 1OXGA 1UCYE 1UK2A 2BY8X 1QRWA 1D3DB 1DX5M 1TPAE 3MH4A 2M2AA 1S82A 3BTTE 3BTHE 3EA8A 3ODFA 3PO1C 1E36B 9ESTA 2HNTF 1Q3XA 3FVFB 2F4LA 4DT4A 1W3CA 2F43B 3RXIA 2V3OH 1ETRH 2ASUB 1S5SA 1WTHD 1CT2E 1YPHE 2ZPSA 1Z1IA 1XX9A 5AHGH 1DE7H 4FUGA 2ZDVH 4FUEA 4QT8C 5EXLA 3U8TH 5DP7A 1PQ7A 2CMYA 3GY3A 3MNXA 4GHTA 3RM2H 2R2WU 2WPKS 3Q3XA 1C5TA 4O3TA 2J98A 3T5FH 1C5UA 1HAZB 2ZGXH 2WV9A 1O5GH 1O3MA 2P8OC 2HLCA 3UQOA 1NFXA 3GCTF 1NZQH 3PROA 2FOFA 1ZJDA 3SZNA 5IK2D 1SGFG 5C5NA 3PTBA 4RKJB 2VB0A 1G3BA 2Q6DA 1O2WA 2OQUA 4NIWA 1EFRD 1K1IA 4X8UH 6ESTA 1O3DA 1ELAA 1MTWA 3OX7U 4TSFD 3ATLA 1NFYA 5KECA 1SVPA 1IQKA 2TPIZ 3RXOA 2FMJA 3MFJA 2ZF0H 2ZDKA 1FMGA 1MABB 1FY8E 1F2SE 1C1SA 4Y10E 2QC2A 3OYPA 1F92A 1O3EA 4Y76A 1Y5BT 1BTWA 4YLUA 1QJ6B 1FZZA 3CS0A 4OGYA 1CO7E 2QF0A 4CREA 1C2LA 3E1XB 1SL3A 3BTEE 1U6QA 3SYJA 3K6ZA 2A7CA 1CQQA 2AYWA 4A1VA 3F68H 1C2IA 1ANEA 1NS3A 1PYTD 1NT1A 1ZTJA 1LHGH 1O33A 1WV7H 2VIWA 3OAAD 1E38B 1ORFA 2BM2A 2WYJA 1ESTA 1O32A 1P12E 4NGAH 1Q2WA 2RCEA 2A5AA 2O9QA 2PUQH 5LPEA 1E1RD 3A7XA 4OS1A 1KSNA 1GI1A 4F49A 6LPRA 1MCTA 4OM9A 3EE0B 3EYDA 1AZZA 1TNGA 2V6NA 3MHWU 1YPGH 2WPDD 5LPFA 1P2QA 3HGPA 4YOIA 3SNEA 5JPMH 8LPRA 1CBWB 5EJ1A 1Z8JB 5EQQA 3KGPA 4TYDA 4XFQA 4KTSA 2VIVA 1MCVA 1MU8B 5A0CA 2GGVB 1TPSA 4HG6A 5JBAS 1AUJA 1TRNA 3GDSA 3T62A 4B6FA 4WH6A 1D4PB 4NZLA 4YLQH 3NPSA 3F3BA 3OE7D 2ZG0H 4UFDH 1QL8A 1Y3WA 1BIOA 4GPGA 5ABWA 5CHAB 1JRTA 3EDXB 3O8RA 3LDXH 4ZHAA 4CR5A 4K69A 4ZXXH 3QUMP 1HAVB 4BANB 2O8TA 3OSYA 1QL7A 4Y71A 4MNWA 5FBEA 2BQ6B 1WXRA 1TNHA 2ALVA 3SHCH 3M5NA 2J5UA 3LT3A 4MTBA 4BAOB 2PGBB 2VIDA 1LHCH 1GBDA 3DSOA 5E0GA 3O8CA 3BG8A 1RFNA 1TWXB 1H8IH 1TALA 5T6GA 3UR6A 4U30A 1T31A 5EQSA 1C4Y2 3H7OA 1FUJA 4FXGH 2VIPA 5L6NH 2BY9X 1F5KU 1BMAA 3LGWA 3PLBA 5GCHF 1QFKH 4UDWH 4XD7D 3ZV8A 3C27B 1GBAA 2ZP0H 1T8MA 1V2RT 1E35B 1XUFA 3DFJA 3ENSB 1SGDE 1UVOA 5JDUB 2Z94A 1HAXB 2ZIQH 5KEDA 1NRQH 1ZTKA 5A8ZA 1NY22 1A46H 3KCGH 4NA7A 1H8HD 2AMDA 2KR7A 1BA8B 2GCTB 1O3HA 1C5RA 5E0HA 2G4TA 1Y3YA 4TPYA 3MU5A 1N8OB 1XKBC 2IJD1 2P95A 2XXLA 1MD7A 3UTUH 3SU5A 1ZTLA 1ABJH 1MD8A 2AS9A 1W8BH 1IQMA 3MNCA 2B9LA 1TQ7B 2BLVA 2ZHDA 5CHBA 3BEFB 3WY8A 1GBJA 1P06A 2D8WA 5K0HA 5EIYA 2SGAA 1AY6H 2GTBA 2WPHS 1RTFB 1XVOA 2C93B 2OP9A 4CBNA 3ZVFA 1GCDA 1O5AB 1A5GH 3K65B 4DIIH 1TNJA 1F0RA 1TQ0B 1O2IA 3BTDE 5T1VA 1PPZA 2PUXB 4TT3D 1TBZH 3C1KA 4FUDA 1QRZA 3N7OA 1SG8B 1GHXH 4FUJA 1UK3A 1L4ZA 1FY1A 2G55A 1DWCH 1TONA 2ODPA 3RMNH 2STBE 5DSFA 1AVXA 3N7DA 3MQKC 1IQEA 1H4WA 1FXYA 2XBWA 1UTMA 3SV6A 4SGBE 1O34A 1KLTA 3PV5A 2ZCKP 5T3HA 1O3BA 1A0JA 1L1NA 2A4QA 2FOAA 2BLWA 3BF6H 1TOMH 5GWZA 3BV9B 2R0LA 2B0FA 3ZVCA 1SGCA 3GY7A 2Z9GA 1LQEA 5H4IB 2ZDLA 5JYIA 1ELFA 1GBFA 3BG4B 1ELCA 1VITG 1VJ9U 1QQUA 4TPIZ 1E34B 3TJVA 1TMTH 1IQLA 1EZSC 1LVYA 1SI5H 3F9EA 3KQEA 3MTYA 1BQYA 2EI6A 2KZ4A 1ARCA 4X2YA 5CHAC 2FOBA 4AYYB 2A1DB 2QXGA 3VB5A 3O8DA 1FY5A 3SV9A 1HJ8A 1E37B 1ZYOA 1HIAB 2R2MB 2TGAA 2QA9E 3ATIA 4MNYA 5EXNA 1L0ZA 2Y82A 4A7IB 5HIZA 1C5XB 4BOHA 2AERH 2XNDD 4FOUC 1WDIA 4IMQA 1MTVA 1RXPA 4FUBA 1BRCE 2FWWA 1BBRE 1GVZA 2FOGA 3FANA 5AF9H 4TWYA 3PLKA 2L6OA 3FZDA 2H2ZA 1EZXC 3QK1A 4GCHF 3WWFA 3BN9A 1CA0C 2F9UA 1V6DA 3RXPA 3UWIA 5C17A 3TK5A 3LOXA 2HNTE 1QBNA 2AMPA 4Q7XA 8ESTE 1G3CA 1A5IA 1W12U 5GNDA 1LHEH 3UNSA 3GCTG 3ZVBA 5DN6D 1HRTH 3RXFA 2QXIA 1HJ9A 1H9IE 1P2IA 4E7RG 3A85A 1P3EA 2ZGCA 1O2YA 1OWKA 1O3AA 3I78A 2XCNA 1ABIH 1KMHB 2GCTC 2GZ9A 2Y5HA 1DLEA 2LNCA 3S9CA 1V2TT 1DVAH 3SNAA 4E7NA 2BZ6H 1N8OC 1EOLA 1NC6A 2ZDAH 2Q6FA 4IW4E 1T8LA 4OS2A 5C1YA 1SLWB 4OS4A 4CR9A 1YCPH 1BT7A 1DICA 4X6NA 5L2ZH 1K2I1 4Q7YA 1C5QA 3TJNA 4A1TA 4ABEA 2B8OH 2FTLE 1H1BA 1V3XA 2ZHQH 5AVDA 5A09A 2FI4E 1Y5UT 4MNXA 4MLFB 1HFDA 3ZZBA 1J9CH 1OYQA 3KN2A 3KQDA 1PQAA 2BD7A 4FUHA 4DJZB 1P03A 1EJAA 5G4BA 2P94A 1F0TA 2VINA 4ABFA 1BMFD 1UVPA 3RXTA 1PQ5A 2ZQ1A 5C0UA 1Z8GA 2ZGBH 1GI3A 2CJIA 3RDZA 1YLDA 5K7RA 1PYTC 1THRH 1EQ9A 1ZSKA 1B7XB 5BRRE 1C1QA 2ZFTA 1D3PB 3PMJA 1MAYA 3VB4A 3GOVB 2FEQH 2FESH 3RLYH 4B2AA 4CRGA 4M7GA 4K1EA 4DCDA 1C1OA 2R3UA 1ZPZA 1H9LB 1YP9A 3TJUA 1TLDA 1C5WB 1D3TB 2BDBA 3QGNB 1VCQA 4Y7AA 1K28D 3N99A 2XCFA 5LH8A 2CF9H 1UHBA 1BMMH 1NBMD 1BUIA 1YCPK 5C0TA 2AIPA 4I31A 1SFIA 1S81A 3HPTB 2BTCE 4Q80A 3QZRA 4U01A 2QY0B 5GPIB 5B6OA 2W6ID 1ELBA 1P0SH 4D7GA 1PPEE 3BG4C 3KEEA 4XSKU 3SI4H 7GCHF 3PRDA 3BTQE 1BJUA 1LO6A 1TYNA 2WPIS 3OFND 1C5MD 4YTAA 1DM4B 2OLGA 1GBKA 1O0DH 1TX8A 1DXPA 2IN2A 4UFEH 1C2EA 1N1LA 2ZWLH 2VBCA 2SFAA 3F2FA 1FN6A 4NSYA 2BQWB 4F4OC 5EG4A 2STAE 1K1MA 3DD2H 5FCRA 1ARBA 1T32A 4FU9A 2THFB 1RTLA 1UCYH 1KXDA 3SJ9A 1AFQB 1ZPCA 3ZVDA 2QF5A 3S9AA 3NKKA 4ESTE 5FHTA 1BTZA 1C9PA 4CH2B 3MWIU 3A80A 2G00A 1W0YH 1ZRKA 2EY4C 3RXUA 1CGIE 1FY4A 3PWBA 2O8WA 5GCHG 1TBQH 5F6MA 1B0EA 5A8YA 4MPXA 1EATA 3M7UA 4X6PA 3MH5A 5FCKA 1TMUH 2PHBA 2ZEBA 1SGQE 1QBVH 2ZC9H 3E0PB 3Q3KA 2H1UA 5EPYA 3TGJE 2Y5GA 2PLXA 4Q4LA 2Z9IA 1HAIH 1K21H 1MQ6A 2CXVA 2ODYB 2ZKSA 4Q63A 1L1JA 2ANMH 3RXRA 3T27A 2FI5E 5JB8S 3E0NB 2GP9B 3SV7A 3OU0A 3VXFH 3S7KB 2FLRH 2NU4E 1UCYK 2TBSA 3UUZA 4B73A 2XNIA 1DDJA 1K1LA 2L74A 1GHAF 4AB8A 4JYTA 1O3OA 1K9OE 1EP5A 2BZAA 1SGPE 1BITA 1E1QD 1AKSA 1HJAB 3M37A 1ZZZA 4I8KA 1ZGVA 1FNIA 1ZPBA 3H7TA 4GLYA 4E05H 1JRSA 5DP8A 1V2UT 3KQBA 1GDQA 3GCHB 1S6LA 2BD9A 4P00A 1VR1H 2A31A 1AE8H 2BDIA 1BTUA 3LIWA 2J34A 2YNAA 3GICB 4BAHB 2WSSD 1O30A 3KQ5A 1SBWA 6GCHF 4CRBA 4NFFA 2YMSC 1GI5A 2ZU3A 1L2EA 1FONA 2OC7A 3ESTA 2IOTA 4X8SH 5HM2A 4O3UA 4YT7H 4HZHA 5DO4H 2O8LA 1Y5AT 1KDQB 1DOJA 3STIA 3LONA 1AWHB 2A0QB 2AMQA 3OEED 2OD3B 3V12A 2FP7B 2PTNA 3E3TA 3ZIAD 1AZ8A 1GDNA 4AC9A 3DUXH 2FM2A 3DSPA 1RD3B 1DY8A 3W95A 1TGNA 3MO9A 1OWEA 3VG8A 3M35A 1C5PA 1O3LA 5HM9A 1SHYA 1P2KA 2RA3A 2Z9KA 3HATH 3TLOA 4O97A 2F9NA 3FAOA 4DGJA 2QYIA 1GBBA 1GMHG 1TPOA 3RXJA 5DKMA 2BX4A 4I33A 3I77A 2OBQA 3CENA 1C1UH 1WOFA 1N6YA 2O8UA 4I32A 4VGCB 1DFPA 4X0WU 1CHGA 2M5TA 2FLBH 1EB1H 1IQFA 1NU9A 5IDKA 3KYFA 2YOLA 2BD8A 4CHAB 2V3HH 1UK4A 4TY6A 1AD8H 2IPQX 2ZTYA 1EAWA 2P59A 1KXEA 1QIXB 1T8NA 5BPEA 1QA0A 2OQ5A 4CH8B 5C94A 1A2CH 2QGRA 3EA9A 1QA7A 1AU8A 1AFEH 2WPLS 4GCHG 1G37A 1C1VH 4X1PU 2NU3E 4X8VH 4DT7B 1JBUH 2PR3A 2YNBA 3V3MA 1FDPA 3GY4A 1B0FA 2WHXA 3U1JB 2G5NA 4PROA 4O03A 3E6PH 1QB9A 5E8EH 1GJ6A 1KY9A 4UONA 4WY3A 2J92A 2FIRH 3A8CA 1GBLA 4ABJA 4BAQB 3F9GA 5AFYH 5F8TA 3GCOA 4Y6DA 1GHZA 3B8JA 1XM1A 2BDCA 2I6SA 2OBOA 4F55A 1YCPM 2QXJA 2GMTB 2A4OA 5DG6A 1DITH 3SV8A 1HYLA 5T6FA 4AB9A 1G9IE 1O38A 5JBCS 5HGGA 1YF4A 3R3GB 3QDZB 1QTFA 1GHYH 1KTTB 1A0LA 3EAJA 1HXEH 2K1QA 4Y79A 5C1UA 1BMNH 4B71A 2EI8A 2CN0H 4JZIA 1UTPA 2J94A 2BX3A 3VB6A 1V2VT 3AW0A 1K0HA 1VCPA 2FO9A 3NRLA 1FPCH 4HI3A 3SO3A 4AORA 4YT6H 5EGMA 3STJA 1ELTA 1ZLRA 3ATMA 1V2OT 4JZFH 3L3TA 1J14A 3SORA 2SGEE 1O3FA 4NA9H 1SGTA 3BTKE 3S69A 2D1JA 1SQAA 2GKVE 1JMOH 1W11U 4X2WA 1S85A 1VGCB 1SLVB 4ZHLU 4IS5A 2G5VA 1LTOA 2ZU1A 3GS9A 1W2KH 3RU4E 3PMBB 5KGOA 4ZCNA 3E16B 2NU2E 4AX9H 2FODA 5F03A 1HAVA 1W13U 1QBOA 4ABBA 3U98H 1D9IA 1BOQA 2EA3A 3ZVAA 1O2NA 1C4V2 2JIZD 1MKXH 1FX0B 3CS7A 3PV4A 1QY6A 1LPGB 1ESAA 1DSUA 3AAVA 3S0NA 3VFEA 1TNLA 1P2JA 3E91A 4AFUA 1W0ZU 3MU1A 1AWFH 3MU0A 2C3SA 2SGPE 5FXLA 1KYNA 5FX5A 2BOHB 3UY9A 2A5IA 2ZA5A 4XBCA 3ZV9A 2GX4A 3SJIA 2UUKB 3JZ2B 1QZ8A 1YLNA 1GMCF 2BD5A 1QURH 3LJOA 1BB0B 1C1MA 2BYAX 3ZZ5A 7GCHG 2XWAA 1PQ8A 3UOPA 3K6YA 1G2MA 1QJ1B 5TCCA 2UUJB 3GDVA 4FUCA 3OY5U 4VGCC 1MTSA 3URCA 3SUFA 5A2MH 4TY7A 5PTPA 1INCA 1SQRA 4FETA 1P04A 3NK8A 2DUCA 2PKSB 1GJCB 1C5ZB 3LU9B 1LHFH 1VITH 1O2GH 1CA8B 1MKXK 4JYVH 1SLUB 1CE5A 1O2QA 4MNVA 3P8NA 3SU2A 3RXEA 4BTIB 4ZKSU 1OS8A 1MMJN 1UVSH 1ZSJA 3DFLA 2W3IA 5FBIA 3EE7A 1HGTH 1BBRH 5C3NA 1DPOA 3M7QA 1MQ5A 4BXSA 1ANDA 1F7ZA 1DXWA 2HPQH 4LZ4B 1BRUP 2GV7A 1ELEE 1A61H 3BIUH 2VGCB 3SGBE 4RSPA 1XVMA 1V2QT 1AMHA 4E06H 5I25A 2KAIA 2LELA 1C5LH 2KAIB 3RLWH 2BDYA 2OTVA 1P10A 2VIOA 4NIVA 3T25A 2F83A 5A0AE 1C9TA 2Q6GA 4WJG2 3M7TA 4GAWA 3V13A 1QJ7B 1FY3A 2ZFQH 2SGDE 4OGXA 1O2SA 4KELA 2BDHA 4X6OA 1C1NA 3F9HA 1GHAG 2HLDD 1BTHH 4A5TS 4IGDA 1YC0A 1EAXA 2R3YA 4WWYA 1TNIA 3SUGA 4D8NA 1SLXB 3W1EA 3K9XB 4JZ1A 4FVDA 3W94A 1CHOF 1MTNB 1D6WA 1TAWA 1BBRK 1CBWC 4UFGH 5DK1A 1AUTC 2A4RA 3UPEA 4ABDA 2AGEX 8KME2 1V2ST 1DY9A 7LPRA 1SGYE 2JJ1D 3M3SA 4M9FA 2OC0A 4RI0A 1ZSLA 1EUFA 1IQGA 2BQ7B 4H6TA 3TVJB 1GDUA 1Z1JA 1LVBA 1O5DH 2PKAB 1YKTA 3DHKH 1BTXA 1VGCC 6GCHG 1HPGA 1MAXA 3A88A 2FYRA 3T2NA 1GI9B 2W3KA 1SR5C 1J8AA 1KXCA 2KFWA 5E2OA 7ESTE 4ACAA 1S83A 4ACBA 1TE0A 2P3TB 1H8ED 3SU3A 1HIAA 1SGRE 1M9UA 5DP4A 3SU0A 1SB1H 1GJAB 3SNCA 4I8GA 1JOUB 4X1QU 1UTLM 4YOGA 4NWLA 1AVWA 1T4UH 2FI3E 1MUEB 1OOKB 2BY7X 1C4U2 2JETB 2XRCA 1IAUA 1WQSA 2C4FH 2BVSH 2OCVB 2QF3A 4SGAE 5F8ZA 2AEIH 2B7DH 1S0QA 4UD9H 4NIYA 1UMAH 2BB4A 4Y8YA 5HYOA 1DWEH 1GI4A 2Z9LA 3MH6A 2XYAA 3A7WA 1H8DH 2R0KA 4MPWA 1GHBF 4THNH 4ZXYH 4WF8A 1VJAU 2BD2A 1AIXH 2NU1E 2F3CE 4NWKA 3PYHA 2OC8A 3SBKA 3GY6A 2H9TH 4WMFA 4A6LA 3VB3A 1W7GH 1D6RA 2F9OA 3ZZ6A 2V35A 5E0JA 2Z6BD 5HIYA 2PFEA 5SGAE 3SN8A 1V2LT 2ALPA 3Q77A 4YO9A 2KCOA 2PKSC 2FTMA 1O3NA 4INHA 3ZZAA 1O37A 1V2WT 2RG3A 1FAXA 2GCHF 4DW2U 1TRYA 3ZZDA 3KHVA 1KXFA 3D65E 1QRXA 3QN7A 3S9BA 1P11E 1IHSH 1HAGE 1QR3E 3LPRA 1OP8A 1EPTB 3SJKA 2HPPH 1HDTH 4JZDH 5HMAA 1OHHD 1V2KT 2KCAA 3SUEA 1FAKH 1H9HE 2GT8A 2WV4A 2Z3CA 4AFZA 2BVXH 1GI8B 3RC6A 1O36A 3FP6E 2KX4A 3S7HB 5FPYA 3RXHA 1WQVH 2D2DA 4YESB 4BNRA 1SKYE 1CGJE 1YYY1 4KGAA 2OXSA 2C8XB 3AAUA 1OP2A 3RXSA 2VGCC 4XBDA 2RFKC 2QV1A 3NZIA 1PJPA 1MBQA 3A7YA 1C2JA 1JIMA 3R0FA 3UB0A 1EOJA 3MOCA 1TA6A 1ZJKA 4D76A 1NN6A 4D7FA 1OYTH 1X7AC 4AGKA 3P8FA 1JWTA 2J4IA 2V7QD 1GJ9B 2NWNA 1O2KA 1XXFA 4ZROA 1HNEE 1YM0A 1Z7KA 2ZU5A 3UR9A 4AG1A 2IJOB 2ZZUH 2VVVA 4WH8A 1YPJH 3ZZ3A 3FN8A 4UE7H 1MBMA 4WVPE 1F5RA 1EAIA 1L1GA 3CP7A 4Y0YE 2Y81A 1Y3UA 1FN8A 1MTNC 3A7ZA 1GJ7B 2Y6TA 1EASA 1HV7A 2ZGHA 1Z8IB 4IBLH 4OS7A 3SUDA 2H5CA 2J38A 3VPKA 2GT7A 1NFUA 3AW1A 1P05A 3FP7E 1KTSB 5A0BA 1C1PA 2ZECA 1WSSH 1WAYB 2TGTA 2VVCA 3F0PA 2QAAA 2XBVA 3ZYEA 2VNTA 1T4VH 3A82A 2ZO3H 3M61U 1YPLH 2ZTXA 3A87A 2JJ2D 5DP6A 2Y5FA 1RS0A 3U9AH 3F9FA 1AHTH 5EQRA 1PPHE 2DE9A 3T26A 4RN6A 3TU7H 1C5VA 2C90B 3G01A 4AN7A 5L2YH 1HAYB 1PPFE 4HGCA 5C1XA 4D9QA 1J17T 2BOKA 1P8VC 1O2OA 5CMXH 3F2GA 1L4DA 3HKIB 5FX6A 3VXEH 3P6ZB 2TGDA 1Y59T 2BMGB 1V2NT 2JETC 1XMNB 3QTVH 1QNJA 5GDSH 1ZMJA 3LGTA 1GJ5H 2ANWA 4H6SB 5A8XA 3E90B 1GMCG 3BTWE 3UIRA 4IMZA 3P70B 1UTOA 1QL9A 3NCLA 3FZZA 2SNWA 1EJNA 3OTJE 4LZ1H 3U1IB 2H9EH 1LCYA 2WINI 3ZVEA 2JH0D 3WW7A 1VZQH 2EC9H 4F48B 1UTKA 2BY5X 4K1TA 3QX5H 2FOEA 1C1WH 3FP8E 3U8RH 2SGQE 2HGTH 3ODDA 4GUXA 2FX6A 1COWD 3N7EA 3HK3B 4X1RU 5EW1H 1O3PB 2Y7XA 5ESTE 2ZDMA 1O2HA 2GDDA 3URDA 1V2MT 4P02A 2AH4X 1ZHPA 2WYGA 4D9RA 2PSXA 1XUJA 4U2WA 1LPZB 5AFZH 3U69H 4KTCA 4KKDA 1TGCA 2K8IA 2A4GA 3FOAA 3SZEA 3TPIZ 1HAOH 2O8MA 1GWAA 1LKAA 3PV2A 5DP5A 1SPJA 1AN1E 3P95A 2CF8H 3ZZ9A 1S6HA 2H5DA 3ZZ8A 3RC4A 4IN2A 4BTUB 3UAIC 5C2ZA 3MMGA 3MNSA 3NWUA 3AASA 1TGBA 2HVYB 2IPHA 3QGJA 4MG3A 1K1JA 1FIWA 1OP0A 1ANBA 4DURA 2WPJS 2EQNA 1GI0A 2UUFB 2P93A 1SGIB 1C2MA 4B74A 1K1OA 4MQAA 1GBHA 1FJSA 3HK6B 3TGKE 1G3EA 1KDQA 1VITF 3F0OA 4WMEA 1A5HA 2VJ1A 2OK5A 1GHWH 1FV9A 3QLPH 3P17H 1TNKA 1V2JT 4I86A 5GIBA 1CHOG 4ZHMU 1GGDB 1CGHA 3BEUA 3MO3A 2ODQA 1GVLA 2A2XH 2ZGJA 2RA0A 1P57B 3BTFE 4LOYH 3RU4D 4NZQA 1BMLA 3IWMA 3F1SB 1NRRH 3E8LA 5F53A 5JBTA 1GBCA 2K0QA 4Y7BA 1JIRA 3SNBA 4ISLA 3UNQA 2SGFE 4BAMB 2HWLB 1O39A 5ETXA 1K1NA 2AHME 3SQHE 2J9NA 3QZQA 1IQJA 3SHAH 2UWOA 2VWMA 3SJ8A 3PMHB 4AGJA 1UTNA 2VWOA 2JDID 2XWBI 1O5FH 3A8BA 4MVNA 1O5CB 1HB0B 2G4UA 3SGQE 2V0BA 4ZKNU 1F5LA 1GBMA 3ELAH 4RT0A 4O9VA 1B5GH 2J98B 3RXCA 2FDAA 1LDTT 1CT0E 1O2RA 1XUIA 3IG6B 1GVKB 3EGKH 5LGOA 3GY5A 1NO9H 1T7CA 4ZKOU 1AFQC 1RIWB 1K1PA 2HOBA 3PWCA 5FL7D 2CV3A 1GMDF 1P2OA 1IQHA 1HCGA 1W0JD 2PW8H 4DIHH 4HTCH 1BHXB 4AZ2B 2A5KA 1QB1A 1AI8H 5DP9A 1C2GA 1NRPH 4U32A 1EXFA 3PMAB 3VB7A 1N6XA 2GV6A 3RXLA 1GHBG 4ASUD 1XXDA 1Y8TA 4X1SU 2BLQA 4ASHA 4H4FA 1UTQA 1A4WH 2QCYA 1LVOA 4DY7B 2VWLA 2FYQA 4X8TH 1Z6JH 3ZZCA 1BTYA 3KYGA 1TABE 2XBYA 4FUFA 3UWJH 1SGFA 4K8BA 1SGNE 4X1NU 3SQEE 4I8LA 2CGAA 2AGGX 2GCHG 2G52A 2FPZA 4Y8ZA 2BDAA 3UFAA 1BDAA 4BAKB 1UW7A 2C8YB 1SQOA 1O2MA 4IN1A 2XC0A 4Q2KA 4R8TB 1ZHRA 3TNTA 3VGCB 3TH3H 1HJAC 1UVTH 1MU6B 2VWNA 3LKWA 3RXBA 3UREA 1EZQA 2VU8E 3EQ0H 3KIDU 1FPHH 1CVWH 1SQTA 1TMBH 6CHAB 3LGYA 1SFQB 3QO6A 1GI7B 3GISB 3MNBA 2ANYA 1W7XH 2F9BH 2PGQB 3M5LA 3B9FH 5C5OA 2XBXA 2ZHFH 5ESBA 3ATWA 1GJ8B 3L6PA 1DWBH 3BSQA 3LC3A 8GCHF 2VIQA 3GCHC 5HKKD 1BZXE 1GL0E 3TH2H 2QE7D 3A7TA 4ZH8A 5EW2H 4NCYA 1DUEA 3RXMA 3NXPA 4JMYA 1G36A 1S84A 1UO6A 5FPTA 1Z8RA 1G2LA 4Y8XA 3TIUA 1OX1A 1C5OH 2BXTH 3P8GA 2GVFA 1YPKH 3LGUA 3P92A 1DS2E 3HGNA 1IQNA 2QIQA 4YXWD 1CSOE 3V7TA 3RXGA 5FPSA 1GBTA 3D49H 2Y80A 1W0KD 1GGDC 4B2BA 1C2HA 1RTKA 1GHVH 4ISNA 4H42U 1CT4E 2HRVA 2BY6X 2BVRH 1F0UA 3FFGA 3M5OA 1A7SA 1GI6A 3GY2A 1EAUA 3P8OA 3QWCH 4NIXA 4K60A 1PPGE 5GJ4B 4X6MA 2BHGA 1YGCH 2WUCA 2LP6A 1WTGH 2A7HA 4WXIA 2G81E 4FU7A 1GG6B 3BTME 3D62A 4AG2A 4B75A 1TIOA 2NU0E 1A0HB 1TRMA 1E0FD 5HXFA 4CRFA 3LGVA 1CA0B 3EA7A 4XRNA 3TH4H 4RT1A 1IHTH 2Z3EA 2PWXA 1QQ4A 3SV2H 4CHAC 2GZ8A 1SHHB 2ZU4A 1J15A 3SI3H 4J1YA 4Z1MD 1G3DA 2VH6A 1DANH 1OWJA 4WMDA 3M5MA 1IOEA 1THSH 5EJZA 3F6UH 3RU4T 2ANKH 1AE5A 1CU1A 1YPHC 2J97A 4ZAEA 1RIWC 1NRSH 4B6EA 2ZFSA 2CHAB 2BLOA 2A2QH 2OUAA 4AOQA 1C2DA 5J4SA 1O2TA 1UTJA 1WU1A 1KLIH 5I46H 2H9HA 4IC5A 1A3BH 1ELGA 1NPMA 3RXDA 3TNSA 1LHDH 2UWLA 1O3IA 2G51A 4J2YB 2JH5D 1P3CA 3KQCA 1GCTB 2BD4A 3RC5A 1FQ3A 3IITA 2ZHEH 2PSYA 3MO6A 3A81A 2CK3D 1D3QB 1ID5H 4I8HA 4UEHH 3RM0H 4Z6AH 4MPUA 3AK5A 1O5BB 2ZNKH 2OINA 1PFXC 2FS8A 1S6FA 2FS9A 2C8WB 3GY8A 3CNRA 2TIOA 1C5NH 2GMTC 1SC8U 4ABIA 1GPZA 2A7JA 1ACBE 1AVGH 1RRKA 2TGPZ 1ZR0A 2QN5T 4ZKRU 5DPAA 2YMSD 4Y0ZE 1AB9B 4X2VA 4B2CA 3GYMA 3UOUA 4HFPB 2VH0A 5TCAA 3FO8D 3VGCC 1XUHA 3PTNA 1MH0A 3DCLA 3GCNA 3JZ1B 3Q76A 6CHAC 1C1TA 5CDFE 2EI7A 2FZZA 1BHXF 1PPBH 3A83A 2ZFFH 2PKAA 1T8OA 2V3MA 2WV5A 3LGIA 3HKJB 1MZAA 5FAHA 9LPRA 1V2PT 5EJLA 3GDUA 2XOKD 4DVAU 1TFXA 2BD3A 4JCNA 3UQVA 5J4QA 3M3TA 1ZHMA 3O8BA 2FX4A 1JXPA 1O3KA 1TX6A 3KL6A 1RGQA 1UJ1A 1AO5A 1KLJH 1KXAA 5F8XA 1GMHF 3PM3A 1TX7A 2P16A 1MZDA 4CRAA 5TJXA 1C5SA 1HAPH 5EOKA 4JK6A 1GBIA 1EX3A 4ZMAH 4INLA 1YPEH 1XUGA 1LKBA 1Z71A 3BEIB 1C1RA 2A45B 2ZU2A 4MDSA 1W10U 3PB1E 3T29A 3UNRA 1TA2A 2PP6A 2KCPA 3SOSA 2W7UA 5IYTA 1BTPA 1ETSH 1P2NA 2ZCHP 4YZUA 4ABAA 3SU6A 2ULLA 3VEQB 2EEKA 2JH6D 2XC5A 4FVBA 4XOJA 1GI2A 1Z6EA 3DT0H 1KXBA 1GG6C 1ESBA 2W6JD 2H6MA 3SW2B 2ZCLP 4JK5A 1BRBE 1TBRH 1BRAA 2Y7ZA 3BIVH 4FU8A 2Z3DA 2ZFPH 3RXAA 4XBBA 2VVUA 3DA9B 3F2HA 5DJ7A 3MU4A 1Y3XA 4I8JA 1Q31A 2OC1A 3B23B 2UUYA 3OEHD 2RDLA 1WBGB 1GMDG 3ZYDA 2PV9B 4I7YH 1DLKB 1GJ4H 4XDEA 1EPTA 4NSVA 4GSOA 3KNXA 2CHAC 4FUIA 1O2VA 1GJDB 1AQ7A 1P02A 4ABGA 3U8OH 1SGEE 4DG4A 1HAHH 1SMFE 1TGTA 1NRNH 1P2MA 3MH7A 2P3FH 1FLEE 2W26A 4OS5A 5GXPA 3K2UA 3PRBA 3RUOA 2FOHA 4YM9A 1DSTA 1YY3A 5DP3A 1ELDE 2SNVA 1E79D 3L33A 2A32A 4INKA 1K22H 1XKAC 2P3UB 5JBBS 3TK6A 1GCTC 1O2PA 2RDEA 1GJBB
chains in the Genus database with same CATH topology
1QHRB 2I6QA 3SGAE 1DWDH 2LPRA 2HALA 3A84A 1PPCE 2WPMS 4XE4A 3H5CB 2ILNA 4AFSA 1DT2A 2W7SA 3A86A 4ISOA 1O3JA 1TPPA 3TK9A 1P9SA 5C67A 3AVZA 3MU8A 1AB9C 5L30H 4ABHA 4TWWA 1EB2A 1WCZA 4LK4A 1A3EH 4MPVA 2ZFRH 1QGFA 2GDEH 2ZI2H 3ITIA 1VCWA 4K8YA 3ZZ4A 4K1SA 3V0XA 5C20A 3RXVA 3GYLB 3KF2A 2FXRA 2C8ZB 4DOQA 5EODA 3ATKA 3MI4A 1ETTH 1OPHB 4K5ZA 2UWPA 3PO1B 1C5YB 3SU4A 2FOCA 1C2FA 1P01A 3TGIE 8GCHG 1GBEA 1THPB 2XC4A 3LH1A 1F0SA 1ELVA 5EXMA 2PTCE 3Q00A 1UHBB 1TGSZ 1SOZA 4WXVA 1HLTH 1O2ZA 2ZHWH 1HBTH 1OKXA 1S0RA 1QCPA 4R0IA 1AGJA 2GD4B 4JZEH 2Q1JA 1ZGIA 2G8TA 1HUTH 1LPKB 4KTUA 2Z7FE 1ZMNA 2J95A 1TOCB 4Z0KA 1NROH 1QB6A 1WUNH 3RXKA 2P8OB 5EPNA 3D23A 3M36A 1RJXB 3OY6U 3A7VA 5JB9S 4X2XA 2AGIX 3BTGE 1IQIA 1G32B 1YLCA 1NM6A 1O3GA 1ANCA 1XUKA 1OWDA 1C2KA 3SJOA 3QTOH 1WYKA 4NFEA 4NG9H 1LMWB 2WUBA 4YOJA 3TITA 1ZMLA 1P9UA 4NA8A 2FOMB 5LPRA 4BTTB 1NESE 2W5EA 5E2PA 1Y3VA 1MKWH 3A8AA 3RMLH 2F9PA 1EZUC 1KIGH 3ZVGA 1LVMA 2JKHA 3LC5A 1OWHA 2D26C 3RMMH 3SNDA 3A89A 4K2YA 4AYVB 3M3VA 2J2UA 7KMEH 1O3CA 1NFWA 1O31A 1ZOMA 3A8DA 2ZTZA 4GVUA 4A92A 1FIZA 1YPMH 1ZRBA 1HXFH 5DGJA 3T28A 3NUMA 3LJJA 2XW9A 3LH3A 1O2LA 1SOTA 2AFQB 4ISHH 4RKOB 4AFQA 4CRDA 2ESTE 2QXHA 2F9VA 2ZPRA 5T6DA 3RP2A 2ZQ2A 1YBWA 3I29A 4LXBH 2F91A 1EPTC 1LQDB 1O2UA 2GZ7A 1O2JA 4KP0A 4UFFH 2HNTC 4B76A 4IC6A 1UVUH 1EKBB 2ZPQA 1MKWK 3TJOA 2TRMA 1GL1A 1W14U 2Z9JA 3Q3YA 4JYUH 1OWIA 4Q7ZA 4ISIH 1FI8A 4K3JA 1OSSA 2BDGA 4BXWA 2AIQA 1G30B 1AKSB 4CBOA 1O35A 3PLPA 4ZUHA 4CRCA 2BXUH 3RMOH 1BJVA 1P09A 1O5EH 1EJMA 4A1XA 3SU1A 4OS6A 1MTUA 1SSXA 1EP6A 5EU8A 1A1RA 1TB6H 2DE8A 4GHQA 1NU7B 3ZZ7A 2R9PA 2B5TB 1BCUH 4B1TA 2ZDNA 1DUAA 3RXQA 5CE1A 2XTTB 1NTPA 2HVXA 4Y11E 1O2XA 3MYWA 1J16A 1OXGA 1UCYE 1UK2A 2BY8X 1QRWA 1D3DB 1DX5M 1TPAE 3MH4A 1S82A 3BTTE 3BTHE 3EA8A 3ODFA 3PO1C 1E36B 9ESTA 2HNTF 1Q3XA 3FVFB 1W3CA 3RXIA 2V3OH 1ETRH 2ASUB 1S5SA 1WTHD 1CT2E 1YPHE 2ZPSA 1Z1IA 1XX9A 5AHGH 1DE7H 4FUGA 2ZDVH 4FUEA 4QT8C 5EXLA 3U8TH 5DP7A 1PQ7A 2CMYA 3GY3A 3MNXA 4GHTA 3RM2H 2R2WU 2WPKS 3Q3XA 1C5TA 4O3TA 3T5FH 1C5UA 1HAZB 2ZGXH 1O5GH 1O3MA 2P8OC 2HLCA 3UQOA 1NFXA 3GCTF 1NZQH 3PROA 2FOFA 1ZJDA 3SZNA 1SGFG 5C5NA 3PTBA 4RKJB 2VB0A 1G3BA 2Q6DA 1O2WA 2OQUA 4NIWA 4X8UH 1K1IA 6ESTA 1O3DA 1ELAA 1MTWA 3OX7U 3ATLA 1NFYA 1SVPA 1IQKA 2TPIZ 3RXOA 2FMJA 3MFJA 2ZF0H 2ZDKA 1FMGA 1FY8E 1F2SE 1C1SA 4Y10E 2QC2A 3OYPA 1F92A 1O3EA 4Y76A 1Y5BT 1BTWA 4YLUA 1QJ6B 1FZZA 3CS0A 4OGYA 1CO7E 2QF0A 4CREA 1C2LA 3E1XB 1SL3A 3BTEE 1U6QA 3K6ZA 2A7CA 1CQQA 2AYWA 4A1VA 3F68H 1C2IA 1ANEA 1NS3A 1PYTD 1NT1A 1ZTJA 1LHGH 1O33A 1WV7H 2VIWA 1E38B 1ORFA 2BM2A 2WYJA 1ESTA 1O32A 1P12E 4NGAH 1Q2WA 2RCEA 2A5AA 2O9QA 2PUQH 5LPEA 3A7XA 4OS1A 1KSNA 1GI1A 4F49A 6LPRA 1MCTA 3EE0B 3EYDA 1AZZA 1TNGA 2V6NA 3MHWU 1YPGH 5LPFA 1P2QA 3HGPA 4YOIA 3SNEA 5JPMH 8LPRA 1CBWB 1Z8JB 5EQQA 3KGPA 4TYDA 4XFQA 4KTSA 2VIVA 1MCVA 1MU8B 5A0CA 2GGVB 1TPSA 5JBAS 1AUJA 1TRNA 3GDSA 3T62A 4WH6A 1D4PB 4NZLA 4YLQH 3NPSA 4UFDH 2ZG0H 1QL8A 1Y3WA 1BIOA 4GPGA 5ABWA 5CHAB 1JRTA 3EDXB 3O8RA 3LDXH 4ZHAA 4CR5A 4K69A 4ZXXH 3QUMP 1HAVB 4BANB 2O8TA 3OSYA 1QL7A 4Y71A 4MNWA 5FBEA 2BQ6B 1TNHA 2ALVA 3SHCH 3M5NA 3LT3A 4MTBA 4BAOB 2PGBB 2VIDA 1LHCH 1GBDA 5E0GA 3O8CA 3BG8A 1RFNA 1TWXB 1H8IH 1TALA 5T6GA 3UR6A 4U30A 1T31A 5EQSA 1C4Y2 3H7OA 1FUJA 4FXGH 2VIPA 5L6NH 2BY9X 1F5KU 1BMAA 3LGWA 3PLBA 5GCHF 1QFKH 4UDWH 3ZV8A 3C27B 1GBAA 2ZP0H 1T8MA 1V2RT 1E35B 1XUFA 3DFJA 3ENSB 1SGDE 1UVOA 5JDUB 2Z94A 1HAXB 2ZIQH 1NRQH 1ZTKA 5A8ZA 1NY22 1A46H 3KCGH 4NA7A 2AMDA 1BA8B 2GCTB 1O3HA 1C5RA 5E0HA 2G4TA 1Y3YA 4TPYA 3MU5A 1N8OB 1XKBC 2P95A 2XXLA 1MD7A 3UTUH 3SU5A 1ZTLA 1ABJH 1MD8A 2AS9A 1W8BH 1IQMA 3MNCA 2B9LA 1TQ7B 2BLVA 2ZHDA 3BEFB 3WY8A 1GBJA 1P06A 2D8WA 5K0HA 2SGAA 1AY6H 2GTBA 2WPHS 1RTFB 1XVOA 2C93B 2OP9A 4CBNA 3ZVFA 1GCDA 1O5AB 1A5GH 3K65B 4DIIH 1TNJA 1F0RA 1TQ0B 1O2IA 3BTDE 1PPZA 2PUXB 1TBZH 3C1KA 4FUDA 1QRZA 3N7OA 1SG8B 1GHXH 4FUJA 1UK3A 1L4ZA 1FY1A 2G55A 1DWCH 1TONA 2ODPA 3RMNH 2STBE 1AVXA 1IQEA 1H4WA 1FXYA 2XBWA 1UTMA 3SV6A 4SGBE 1O34A 1KLTA 2ZCKP 5T3HA 1O3BA 1A0JA 1L1NA 2A4QA 2FOAA 2BLWA 3BF6H 1TOMH 5GWZA 3BV9B 2R0LA 2B0FA 3ZVCA 1SGCA 3GY7A 2Z9GA 1LQEA 5H4IB 2ZDLA 5JYIA 1ELFA 1GBFA 3BG4B 1ELCA 1VITG 1VJ9U 1QQUA 4TPIZ 1E34B 3TJVA 1TMTH 1IQLA 1EZSC 1LVYA 1SI5H 3F9EA 3KQEA 3MTYA 1BQYA 2EI6A 1ARCA 4X2YA 5CHAC 2FOBA 4AYYB 2A1DB 2QXGA 3VB5A 3O8DA 1FY5A 3SV9A 1HJ8A 1E37B 1ZYOA 1HIAB 2R2MB 2TGAA 2QA9E 3ATIA 4MNYA 5EXNA 1L0ZA 2Y82A 4A7IB 1C5XB 4BOHA 2AERH 4IMQA 1MTVA 1RXPA 4FUBA 1BRCE 2FWWA 1BBRE 1GVZA 2FOGA 3FANA 5AF9H 4TWYA 3PLKA 3FZDA 2H2ZA 1EZXC 3QK1A 4GCHF 3BN9A 1CA0C 2F9UA 1V6DA 3RXPA 3UWIA 3TK5A 3LOXA 2HNTE 1QBNA 2AMPA 4Q7XA 8ESTE 1G3CA 1A5IA 1W12U 1LHEH 3UNSA 3GCTG 3ZVBA 1HRTH 3RXFA 2QXIA 1HJ9A 1H9IE 1P2IA 4E7RG 3A85A 1P3EA 2ZGCA 1O2YA 1OWKA 1O3AA 3I78A 2XCNA 1ABIH 2GCTC 2GZ9A 2Y5HA 1DLEA 2LNCA 3S9CA 1V2TT 1DVAH 3SNAA 4E7NA 2BZ6H 1N8OC 1EOLA 1NC6A 2ZDAH 2Q6FA 4IW4E 1T8LA 4OS2A 5C1YA 1SLWB 4OS4A 4CR9A 1YCPH 1BT7A 1DICA 4X6NA 5L2ZH 1K2I1 4Q7YA 1C5QA 3TJNA 4A1TA 4ABEA 2B8OH 2FTLE 1H1BA 1V3XA 2ZHQH 5AVDA 5A09A 2FI4E 1Y5UT 4MNXA 4MLFB 1HFDA 3ZZBA 1J9CH 1OYQA 3KN2A 3KQDA 1PQAA 2BD7A 4FUHA 4DJZB 1P03A 1EJAA 5G4BA 2P94A 1F0TA 2VINA 4ABFA 1UVPA 3RXTA 1PQ5A 2ZQ1A 1Z8GA 2ZGBH 1GI3A 2CJIA 3RDZA 1YLDA 5K7RA 1PYTC 1THRH 1EQ9A 1ZSKA 1B7XB 5BRRE 1C1QA 2ZFTA 1D3PB 3PMJA 1MAYA 3VB4A 3GOVB 2FEQH 2FESH 3RLYH 4B2AA 4CRGA 4M7GA 4K1EA 4DCDA 1C1OA 2R3UA 1ZPZA 1H9LB 1YP9A 3TJUA 1TLDA 1C5WB 1D3TB 2BDBA 3QGNB 1VCQA 4Y7AA 1K28D 2XCFA 5LH8A 2CF9H 1UHBA 1BMMH 1BUIA 1YCPK 2AIPA 4I31A 1SFIA 1S81A 3HPTB 2BTCE 4Q80A 3QZRA 4U01A 2QY0B 5GPIB 5B6OA 1ELBA 1P0SH 4D7GA 1PPEE 3BG4C 3KEEA 4XSKU 3SI4H 7GCHF 3BTQE 1BJUA 1LO6A 1TYNA 2WPIS 1C5MD 4YTAA 1DM4B 2OLGA 1GBKA 1O0DH 1TX8A 1DXPA 2IN2A 4UFEH 1C2EA 1N1LA 2ZWLH 2SFAA 1FN6A 4NSYA 2BQWB 4F4OC 5EG4A 2STAE 1K1MA 3DD2H 5FCRA 1ARBA 1T32A 4FU9A 2THFB 1RTLA 1UCYH 1KXDA 3SJ9A 1AFQB 1ZPCA 3ZVDA 3S9AA 3NKKA 4ESTE 5FHTA 1BTZA 1C9PA 4CH2B 3MWIU 3A80A 2G00A 1W0YH 1ZRKA 3RXUA 1CGIE 1FY4A 3PWBA 2O8WA 5GCHG 1TBQH 5F6MA 1B0EA 5A8YA 4MPXA 1EATA 3M7UA 4X6PA 3MH5A 5FCKA 1TMUH 2PHBA 2ZEBA 1SGQE 1QBVH 2ZC9H 3E0PB 3Q3KA 2H1UA 5EPYA 3TGJE 2Y5GA 2PLXA 2Z9IA 1HAIH 1K21H 1MQ6A 2CXVA 2ODYB 2ZKSA 1L1JA 2ANMH 3RXRA 3T27A 2FI5E 5JB8S 3E0NB 2GP9B 3SV7A 3OU0A 3VXFH 3S7KB 2FLRH 2NU4E 1UCYK 2TBSA 3UUZA 4B73A 2XNIA 1DDJA 1K1LA 1GHAF 4AB8A 4JYTA 1O3OA 1K9OE 1EP5A 2BZAA 1SGPE 1BITA 1AKSA 1HJAB 3M37A 1ZZZA 4I8KA 1ZGVA 1FNIA 1ZPBA 3H7TA 4GLYA 4E05H 1JRSA 5DP8A 1V2UT 3KQBA 1GDQA 3GCHB 2BD9A 1VR1H 2A31A 1AE8H 2BDIA 1BTUA 3LIWA 2J34A 2YNAA 3GICB 4BAHB 1O30A 1SBWA 6GCHF 4CRBA 4NFFA 1GI5A 2ZU3A 1L2EA 1FONA 2OC7A 3ESTA 2IOTA 4X8SH 5HM2A 4O3UA 4YT7H 4HZHA 5DO4H 2O8LA 1Y5AT 1KDQB 1DOJA 3STIA 3LONA 1AWHB 2A0QB 2AMQA 2OD3B 3V12A 2FP7B 2PTNA 3E3TA 1AZ8A 1GDNA 3DUXH 2FM2A 1RD3B 1DY8A 3W95A 1TGNA 3MO9A 1OWEA 3M35A 1C5PA 1O3LA 5HM9A 1SHYA 1P2KA 2RA3A 2Z9KA 3HATH 3TLOA 4O97A 2F9NA 3FAOA 4DGJA 2QYIA 1GBBA 1GMHG 1TPOA 3RXJA 5DKMA 2BX4A 4I33A 3I77A 2OBQA 3CENA 1C1UH 1WOFA 1N6YA 2O8UA 4I32A 4VGCB 1DFPA 4X0WU 1CHGA 2M5TA 2FLBH 1EB1H 1IQFA 1NU9A 5IDKA 2YOLA 2BD8A 4CHAB 2V3HH 1UK4A 4TY6A 1AD8H 2ZTYA 1EAWA 2P59A 1KXEA 1QIXB 1T8NA 5BPEA 1QA0A 2OQ5A 4CH8B 1A2CH 2QGRA 3EA9A 1QA7A 1AU8A 1AFEH 2WPLS 4GCHG 1G37A 1C1VH 4X1PU 2NU3E 4X8VH 4DT7B 1JBUH 2PR3A 2YNBA 3V3MA 1FDPA 3GY4A 1B0FA 3U1JB 2G5NA 4PROA 4O03A 3E6PH 1QB9A 5E8EH 1GJ6A 1KY9A 4UONA 4WY3A 2J92A 2FIRH 3A8CA 1GBLA 4ABJA 4BAQB 3F9GA 5AFYH 5F8TA 3GCOA 4Y6DA 1GHZA 3B8JA 1XM1A 2BDCA 2I6SA 2OBOA 1YCPM 2QXJA 2GMTB 2A4OA 5DG6A 1DITH 3SV8A 1HYLA 5T6FA 4AB9A 1G9IE 1O38A 5JBCS 5HGGA 1YF4A 3R3GB 3QDZB 1QTFA 1GHYH 1KTTB 1A0LA 3EAJA 1HXEH 2K1QA 4Y79A 5C1UA 1BMNH 4B71A 2EI8A 2CN0H 4JZIA 1UTPA 2J94A 2BX3A 3VB6A 1V2VT 3AW0A 1VCPA 2FO9A 1FPCH 4HI3A 3SO3A 4AORA 4YT6H 5EGMA 3STJA 1ELTA 1ZLRA 3ATMA 1V2OT 4JZFH 3L3TA 1J14A 3SORA 2SGEE 1O3FA 4NA9H 1SGTA 3BTKE 3S69A 2D1JA 1SQAA 2GKVE 1JMOH 1W11U 4X2WA 1S85A