1O3OA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3oA02
5E2PA 1XUIA 3GCHB 2LNCA 4F49A 2TGPZ 1QTFA 2GZ9A 2Y81A 2BVRH 1TA2A 4YOIA 3I78A 1QHRB 4A5TS 1NZQH 1BRCE 1P12E 5A0CA 3SU5A 3SV7A 1O5CB 1A61H 5EODA 1GDQA 2H1UA 5EXLA 4NG9H 4UFGH 2AGEX 3SUGA 3D62A 5AHGH 3RLWH 5T6DA 1EZQA 2NU4E 1HAVB 2XWBI 1X7AC 4MVNA 4AFSA 3RXOA 4AX9H 1CHOF 1TB6H 1TX7A 1Y3XA 1K1OA 1HJ8A 1TNKA 3FP6E 4FU8A 1IQNA 1WQVH 1A5IA 3BEIB 4A1TA 1KYNA 3K6ZA 2V6NA 3UNSA 2PSYA 2XCNA 2SGEE 1GBFA 1SGIB 3BTKE 3ZZ5A 2BZAA 1SQOA 4TYDA 1EPTC 2BQWB 4AYYB 2CF9H 3M3SA 2PV9B 4H4FA 4J2YB 3LIWA 1HDTH 3M5MA 5L30H 1TYNA 4ZXXH 5A8ZA 4CREA 4Y0ZE 1WSSH 3HK6B 3TK6A 1BTWA 5EW1H 1G32B 1O2LA 3M7UA 5EW2H 4ABIA 2XC4A 3K6YA 4NSVA 3T62A 1B7XB 3TLOA 1MTNB 2ZFRH 2FP7B 2TGAA 4Z0KA 1C5SA 1ZMJA 2ZGBH 5EG4A 5ABWA 3A81A 2JH6D 3P8OA 4ZHAA 3KQDA 3SU1A 4VGCC 1EP6A 5ESTE 5A8XA 5DP5A 1AI8H 1BMLA 2AS9A 3DUXH 1FY5A 4H42U 1SLWB 1O2IA 4ISLA 1AZ8A 3GY7A 5A0BA 2ZTZA 1SQAA 2UUJB 3A87A 1GHVH 5A09A 1ZR0A 3ODFA 3QN7A 2BDIA 5IYTA 3C27B 1PPGE 1SI5H 2ZZUH 4NA9H 1QL9A 2BDYA 1O32A 1CA8B 1IHSH 2BDCA 1E34B 2J2UA 4WY3A 3GY3A 1MH0A 4XSKU 2NU2E 5AF9H 3PMJA 2EC9H 1PYTC 1F5LA 2ZFPH 2R2MB 1EAUA 2V3OH 3T29A 2AIPA 1C5NH 1K22H 4CRFA 3O8RA 5E0JA 3S7KB 4J1YA 2JKHA 1LHGH 2ANYA 4X1NU 2V35A 3ATIA 1AIXH 2A4GA 3RXEA 4GHTA 2AGIX 1XM1A 1GVZA 2F9VA 2WUCA 4Y8ZA 1CA0C 3MHWU 4K69A 1AB9C 1HIAA 4NFFA 3RU4E 4A92A 3LH1A 2D8WA 1GL1A 1SPJA 3SJ8A 1QRXA 2C8WB 2Q6FA 3OYPA 4X8UH 2IPHA 3C1KA 2Z9GA 2RG3A 1FY8E 1YGCH 1HXEH 1QCPA 1TOCB 1V2WT 1BTUA 2EI7A 3CP7A 4K1SA 4OS7A 2VU8E 1NTPA 2AH4X 4GLYA 3RXVA 3SGAE 4X1SU 2W5EA 3AASA 3A80A 4DW2U 4K60A 2VIPA 2C4FH 2GCHF 3VXEH 1MZAA 4A6LA 7ESTE 3GCTG 1E35B 1O3AA 2FS9A 3V13A 1XUGA 5EU8A 3EQ0H 1V6DA 1IQHA 3MWIU 1A2CH 1O2XA 5FXLA 3BG4B 2FOFA 5JYIA 2W3IA 3KEEA 3DD2H 1OP8A 2WPMS 1ANBA 1LMWB 1Z6JH 1ZGVA 2H9TH 1SOTA 4BAQB 1JXPA 2BZ6H 3P6ZB 3B23B 1LVOA 2VGCC 2ODPA 2ZU2A 4JZFH 2W7SA 5GCHG 1GHAG 4RN6A 2ZU3A 2OBQA 1GBLA 1DWCH 1TLDA 1FQ3A 4K1TA 2FS8A 1V2JT 3ATWA 1TBQH 1C2GA 3SI3H 1DXPA 3SJ9A 2O8TA 1GJAB 3CENA 4MPXA 2ZO3H 2FWWA 3LGYA 2FLBH 5F8ZA 1P3EA 1AFEH 2WUBA 1B0EA 4E7RG 1LVMA 1TONA 3EGKH 4E7NA 2QY0B 1UK2A 1AKSB 1QJ1B 3RXGA 4NWLA 1WOFA 3UR6A 3LC5A 3TITA 1XX9A 5F03A 1C1QA 2G81E 2CXVA 3PV4A 5HYOA 1C5RA 1SGQE 5SGAE 1XKBC 1C5OH 1AFQC 1WTHD 1YPKH 1WAYB 1A0JA 4K5ZA 4X8VH 1LKBA 2FZZA 1FMGA 4X6NA 2ZTXA 1LQEA 1QA7A 5HMAA 1RD3B 5F8XA 3ENSB 4UFEH 1UMAH 1K9OE 5E0HA 4VGCB 1PPEE 1VITH 4Q2KA 1TALA 1S81A 1A7SA 4WWYA 5FX6A 1RS0A 1P03A 1WQSA 3SU4A 1TNGA 1EJMA 3MMGA 3VGCC 1B5GH 4B2BA 4AGJA 2ZHWH 2ZEBA 1ZJKA 2BDBA 3NCLA 1BBRK 1O2NA 3AAVA 1OWKA 4F4OC 1C1SA 1O2ZA 1Y5AT 1SGFA 2AIQA 3QLPH 1J17T 1N8OB 1Z1IA 1MBMA 1KXDA 1TBRH 4NIXA 3BTGE 4UDWH 1TRYA 4FUGA 5AFYH 1MZDA 2SNWA 4Y7AA 1W2KH 1MU6B 2TPIZ 3UNRA 1P2OA 2C93B 1UTLM 1UO6A 1MBQA 1UJ1A 1Y5UT 4CR9A 1ZOMA 1MTSA 1YPHE 3EDXB 2FOCA 1HUTH 2FDAA 4AFUA 5L2ZH 3PTNA 5C5OA 2ALVA 3AW1A 5FBIA 3SUEA 4DGJA 1VITF 5H4IB 3FZZA 1S6FA 1ARCA 4Y11E 1Y3VA 3EA8A 1FY3A 2W26A 3M7TA 1QJ6B 2P3UB 4MDSA 3H7TA 3LKWA 4YLQH 2OQ5A 1NFUA 2QA9E 2C8XB 1C9TA 1CA0B 2QAAA 1AB9B 2ZHFH 1C1RA 4ISHH 1UCYE 3ZVFA 1FY4A 3A8CA 2FYRA 1P05A 3MI4A 3M3VA 1HAVA 2P59A 4X8SH 1Q3XA 3NUMA 1AUTC 2UUKB 2FLRH 1V2ST 3N7OA 1OWHA 2NU0E 1YPMH 2ZF0H 1QB6A 1BTZA 2OLGA 5L2YH 1GHAF 3IG6B 3W94A 1THSH 3LJJA 3LGVA 1QBNA 1F0TA 1Z6EA 5EXMA 4UONA 4HI3A 3F9FA 3PLBA 1HJ9A 3ZZ3A 1H9LB 1FNIA 2BD7A 4ZHMU 1XUJA 1G37A 1MD8A 2EEKA 1ZJDA 2A7JA 2SNVA 1ZPZA 1C4U2 3QDZB 1H4WA 3U98H 4AG2A 2FODA 5FX5A 3K65B 1SGRE 3M3TA 2R3UA 3RC6A 2UUFB 2JETC 4TY6A 2VGCB 1QBOA 3TK5A 4AOQA 1NT1A 2HPPH 4NSYA 2ZC9H 1HXFH 2VNTA 1ZTKA 5AVDA 1C5YB 4B76A 3UIRA 4O03A 4U2WA 4X2WA 1DSTA 3E90B 1TGSZ 2FOAA 4Y0YE 4CRBA 2HVXA 2KAIB 4MG3A 1TE0A 1GBDA 6ESTA 3GOVB 1NROH 2XBWA 4JK5A 1HFDA 2A0QB 3SQEE 3SNDA 3D23A 4X6PA 3BTEE 1QURH 4XBBA 1O3EA 2BD8A 2O8LA 3U8OH 1J14A 1SGCA 1GHWH 1G9IE 3SV6A 2Y82A 2Z3DA 1H9IE 2FOMB 2P94A 1BTYA 3DHKH 2QCYA 3SUFA 4WXIA 1HJAC 4O3TA 2VIVA 1SVPA 3RMLH 3EAJA 3VB7A 1ANEA 2FO9A 3A8DA 5JBBS 4ISOA 3S9AA 1NO9H 4DT7B 3GDSA 1BTPA 1UTKA 2A4OA 7GCHF 4Q80A 1NC6A 2FIRH 2VIQA 2BDHA 4X0WU 1YP9A 4CRAA 2BD3A 2R0LA 2VH6A 5C1YA 5TCAA 1FONA 1XVMA 1MQ5A 9ESTA 3VGCB 5DKMA 2Q1JA 4NIYA 1ID5H 1CGJE 3QTVH 2Z94A 3T25A 3MO6A 4NWKA 4PROA 4LZ1H 3E6PH 1K2I1 1ELBA 4YT6H 1B0FA 2XXLA 1GI9B 1F0UA 1ELVA 8GCHG 1MUEB 1GL0E 5T6GA 3TJVA 2WPKS 1SL3A 4DOQA 3IWMA 2G52A 1AD8H 3MFJA 1O3PB 2XYAA 1DLEA 1BRBE 2JH0D 5FCKA 3CS0A 4MNXA 3URDA 4IC5A 5FBEA 2GP9B 1ZSLA 4ZUHA 1GJBB 2ZGXH 1HYLA 5HM2A 1TRMA 4NGAH 1TQ0B 2OC1A 3LPRA 4WH8A 2G51A 1V2QT 2BD9A 1ZRBA 1AY6H 4D7GA 3K2UA 1EQ9A 1ZHMA 1OPHB 1C5ZB 1P04A 4IN2A 1V3XA 1SGFG 3EYDA 5C2ZA 1FJSA 1Z8GA 2P16A 1S6HA 4MPWA 3OTJE 1Q2WA 4O9VA 1JBUH 4IGDA 2ZPSA 4B2AA 1P3CA 1E37B 1NPMA 2ZCLP 3SO3A 3I29A 2ZDKA 3QK1A 1GHBF 4WMEA 1C5XB 5C5NA 1DX5M 3GY5A 1O5AB 3A7TA 1AKSA 1F92A 3D49H 4DY7B 1C5LH 1C1MA 3U1JB 2H6MA 1BMNH 1C5VA 1EOLA 1T8LA 2QXHA 2FESH 5TJXA 3RXSA 1AZZA 4XE4A 2Y7ZA 1ELGA 2XTTB 2XBXA 2ZU5A 1NFWA 3PMBB 1L1GA 4X2VA 2JETB 1EJAA 1MAXA 1ANCA 2VWLA 4E06H 5FHTA 4GAWA 2SGFE 4GCHF 1BMAA 2BDGA 4INLA 1GI8B 3O8CA 1DWBH 1MKWK 1P10A 1C1OA 4SGBE 1F0RA 1O3MA 4YOGA 1O3HA 5GXPA 1DOJA 1D3QB 1FY1A 2GDDA 2HLCA 2P93A 1S5SA 2ZI2H 1HRTH 5HM9A 3PLPA 3UWIA 1LHEH 1TNHA 2GV6A 2A31A 1XXFA 3PTBA 2J94A 2ZA5A 3UUZA 1C2DA 1P8VC 4CR5A 3P8FA 2A7HA 1QB9A 1O39A 1ELTA 1HV7A 5BPEA 3RXRA 1GI5A 1KXCA 3BG4C 3BTME 2J34A 3Q3KA 1H1BA 1HJAB 2GTBA 8GCHF 1ABIH 2STAE 3VB5A 1UK4A 2Z9KA 5LPEA 4UE7H 3ZVBA 1ESTA 1KY9A 3UWJH 2CV3A 1O0DH 1O2SA 2C8ZB 3KQCA 4D9QA 2Z6BD 1HPGA 5T6FA 3PB1E 2FMJA 5EXNA 2OC0A 1OYQA 4U30A 2A2QH 1GJ8B 4I32A 4UFDH 2CHAC 3M5OA 1DY9A 4FUDA 4MQAA 1ELAA 2HNTE 3FP8E 1J15A 1THRH 3PMAB 1O2YA 1DWEH 2ZECA 1SHHB 4IS5A 2ZQ1A 4THNH 3S69A 2TBSA 3RUOA 1BHXB 1W7XH 1G36A 1V2UT 5K7RA 4ZKRU 3FVFB 1T8OA 2ZDLA 2FPZA 3L3TA 1F0SA 1ORFA 1GMHG 4Q7YA 1VJ9U 3MTYA 1IQFA 4CH8B 4D8NA 4BANB 1CT4E 1GI1A 3M7QA 3BTQE 4GHQA 2IJOB 1TGCA 1JIMA 4ABEA 1THPB 3VFEA 2BY8X 1GMDG 3KN2A 1O35A 3S7HB 3QWCH 3S0NA 2TIOA 4AB9A 1H8DH 2C8YB 4K3JA 4I8KA 1MKXH 1A4WH 5FCRA 1IQMA 2ULLA 2WPJS 1G2LA 2QXGA 4GSOA 1PJPA 3MNBA 2ZFQH 4CRDA 2YNBA 4YZUA 1ZSKA 3VXFH 1OX1A 3ESTA 1O3GA 3JZ1B 1O2MA 1ETSH 4QT8C 1DXWA 1TIOA 2H5DA 3OY5U 1O5DH 3A84A 1TX6A 1FN6A 1NRRH 3E91A 1N8OC 3A88A 3B9FH 4BTUB 2PSXA 2KAIA 3A8AA 3PLKA 2WPLS 2J92A 2P3TB 3VEQB 1TMBH 3GY4A 4XDEA 4ABHA 1FI8A 4K8YA 1BBRH 3H5CB 4IMQA 3SU0A 1UHBB 3BIUH 4Y79A 1GBKA 1UTJA 4ABAA 1GMCG 1KIGH 3S9BA 1S85A 3ZVCA 2ZGJA 2P3FH 4RKJB 1FUJA 2OCVB 1V2OT 4Q7XA 2FI5E 2BVXH 2PKSC 4Y71A 3FANA 2Y6TA 1C1VH 1PPFE 3UQVA 1UVPA 3RXBA 1NRNH 4NIWA 4TWWA 1C5WB 1RTFB 2ZQ2A 4Y8YA 5HXFA 3GYMA 1O2TA 2XBYA 1GHZA 8ESTE 5JB9S 4H6SB 3P92A 3MU4A 3DFLA 1SFQB 3RXUA 1OKXA 1PFXC 1GBCA 3BTDE 3QUMP 1ZYOA 3AAUA 2ASUB 3TJNA 3U8TH 1TNJA 2A5AA 1O3LA 1TPAE 1AMHA 1EUFA 2HNTF 1VCPA 2BOKA 3TGJE 5DP7A 4M7GA 4MNVA 1P2MA 1C2JA 2QC2A 1TNLA 4JYUH 1CO7E 2H5CA 3LGTA 3SGQE 1F7ZA 5I25A 5ESBA 2VINA 2ZCHP 4X1PU 4DCDA 2CMYA 2DUCA 3UY9A 4BTTB 4I33A 1C2IA 1G3EA 3SOSA 1GI3A 4B2CA 2A4RA 3RXDA 5DP3A 4AG1A 1TMUH 4ABGA 1M9UA 3RXFA 2GMTC 2J95A 1O2JA 1YCPH 2XC5A 1LPZB 3A85A 2FOBA 2ODQA 1FN8A 1Z8IB 1CQQA 3O8DA 4UEHH 1KLIH 3ODDA 2F3CE 2AEIH 2ZNKH 2GCTC 1GMDF 1O36A 1DUAA 1GI2A 1QL8A 1XUFA 1YPGH 2CHAB 4ABBA 1ZTLA 1NU9A 3NK8A 1BJVA 3ZVAA 1A0HB 1J16A 1IAUA 1ARBA 3I77A 4WMDA 3LU9B 1KXBA 1KXEA 2ZU1A 4HZHA 3PYHA 1UVSH 2PW8H 1LHFH 4I8GA 4CRGA 5IDKA 2BB4A 3SZNA 1TMTH 2XW9A 5E8EH 4D9RA 2I6QA 1BUIA 1YYY1 1T8NA 3SU2A 1QY6A 2Z3CA 3A89A 1EZSC 1Y59T 2FYQA 2FEQH 1W3CA 2VH0A 1TAWA 3SQHE 1O5EH 4MTBA 1AWFH 3A7XA 4U32A 2V3HH 3F9GA 3BN9A 1QNJA 1XUKA 2ZDMA 3LGUA 1VZQH 3SNAA 3RXJA 5F6MA 2F91A 2QYIA 4MLFB 4LZ4B 1OYTH 9LPRA 7KMEH 4LOYH 1P2QA 1Y3WA 8LPRA 1E36B 3URCA 1V2PT 4RKOB 2PR3A 2GKVE 1O3DA 1P2KA 2YOLA 2J9NA 3PM3A 1O2RA 1HAZB 1W0YH 1SFIA 2R2WU 3GY8A 3HATH 3TNSA 1ELCA 3NWUA 1LDTT 4ZKOU 1GI7B 3RDZA 1A3EH 2SGPE 1DS2E 1LO6A 3T27A 4DG4A 3UFAA 1VGCC 3LGIA 1RJXB 2J4IA 4YO9A 3KQEA 4A1XA 2A4QA 1C5PA 4TWYA 4MNWA 1OWDA 3GICB 2XCFA 2XNIA 1N6YA 3RXCA 1NU7B 5AFZH 1O3KA 3AW0A 3GCOA 1N1LA 4NZQA 1E0FD 1JOUB 4MNYA 1PPHE 2ZDAH 1YKTA 2PKSB 2Z7FE 1O31A 3GCTF 2VVVA 1K1LA 2OXSA 3SGBE 1ETRH 1GJ5H 1K1IA 3BV9B 3L33A 4JZDH 3MH6A 4FUEA 4XOJA 4KGAA 1C1WH 1FAXA 3KF2A 5DJ7A 2PTNA 1T8MA 2B7DH 1MQ6A 1HAGE 1C1NA 1BJUA 2ZHQH 3F9EA 4TPYA 4B74A 3WY8A 1MMJN 5FPYA 4DURA 5GCHF 1Z8RA 1PYTD 1AE8H 1MTUA 5E2OA 3BEUA 2BQ7B 3ZVGA 3LONA 3SNCA 5C3NA 2SGDE 4ESTE 2XWAA 1KTTB 4YESB 1L2EA 1ELEE 2BY6X 2Y80A 1AVWA 1VCQA 1LKAA 1NM6A 2TGDA 3SJKA 1BZXE 2OP9A 2G5NA 5EQQA 3MNCA 3RXHA 2GD4B 4LK4A 1QR3E 6GCHG 4WMFA 1RTLA 1TRNA 4ZH8A 1NRPH 1TPOA 1W0ZU 1GCDA 3QGJA 2BDAA 1NESE 4BAMB 5EOKA 1W8BH 2BD2A 1GJ9B 2GMTB 2WINI 2BY9X 3R0FA 1Z1JA 1P09A 1P2IA 1FDPA 2Y5HA 2SGAA 3FZDA 1CGIE 1Y8TA 2CF8H 3PWCA 2P95A 3Q77A 1AUJA 2OUAA 2EI6A 4Y10E 1C1UH 1L1NA 2AYWA 2GZ7A 3MU0A 2GCTB 2ZPRA 3RMNH 2BXUH 2A1DB 1TWXB 2AERH 4D76A 3EA9A 2ZU4A 4FVDA 3RLYH 1YBWA 3UOPA 3HK3B 1S0QA 4Z6AH 1O3IA 1TABE 3IITA 3RM2H 1T4VH 1Y5BT 1DLKB 3M61U 1SB1H 1O2HA 1MKWH 3MU5A 1C5QA 4I8LA 4KELA 2OBOA 5ETXA 2F83A 2ZDVH 1JMOH 2ZFFH 2PGQB 3UREA 2B0FA 2VVCA 1YM0A 1CSOE 2Y5GA 1GBIA 1IQKA 3P8GA 4AFZA 1GVLA 3RXAA 1QIXB 2QF0A 1IQEA 1PQAA 4FUBA 2VVUA 1A46H 1UHBA 4JZ1A 1L4ZA 4BOHA 3RXTA 1O3JA 4SGAE 1PQ5A 1DE7H 1FIZA 4BXWA 1SHYA 1GBAA 1L0ZA 2UUYA 2WYJA 4OS6A 2A5IA 4YT7H 1UK3A 2G4UA 1CE5A 1ZGIA 1A5HA 4X8TH 1WBGB 5F8TA 2IOTA 4DVAU 2W7UA 3NPSA 2A5KA 1RTKA 4WH6A 1FLEE 1XKAC 1KXFA 2FX6A 1DUEA 2BLVA 2THFB 1FXYA 1QGFA 3OY6U 1C1TA 1WU1A 1C2KA 4WXVA 2EI8A 2VB0A 1TGNA 1VGCB 1G3CA 2UWOA 5GPIB 3MOCA 1TGTA 1A3BH 1QB1A 2FXRA 5DO4H 4O97A 4R0IA 1GI6A 1V2MT 2J38A 2M5TA 1H8IH 1YPLH 1O3OA 2A32A 2ZIQH 3A7VA 2O8MA 1C1PA 1G3DA 1F2SE 1SR5C 3HGPA 3E0PB 4ZMAH 7LPRA 1ACBE 1VJAU 1LHDH 1CT0E 3BF6H 2UWLA 1NRSH 1GBMA 4OS4A 4JZEH 1RFNA 3BEFB 1CHOG 1WYKA 4E05H 5HGGA 3V0XA 3O8BA 5LPFA 3SV8A 3SNEA 2PHBA 6GCHF 1FV9A 1AQ7A 3S9CA 1SSXA 4U01A 1HAYB 1RXPA 5EGMA 4YM9A 2BQ6B 4BAKB 1UTOA 3M35A 4IC6A 5GWZA 2B8OH 2SFAA 1O3CA 2NU3E 1AHTH 2GT7A 3STIA 3QGNB 1SGEE 3Q00A 4X2YA 1W12U 1JIRA 1AU8A 1EZUC 2AGGX 2Y5FA 4FUFA 2F9UA 3TK9A 1K1NA 3UNQA 2ZG0H 1EOJA 1C2LA 3A86A 2O8WA 3RXIA 1HAHH 1O38A 3ITIA 1OP0A 2VWNA 1D3DB 3BTHE 4FUJA 5FAHA 2ZPQA 5GIBA 3TPIZ 3ZZ8A 2GT8A 3RP2A 2F9NA 4IMZA 4NFEA 1ELFA 1ZZZA 1IQJA 1ZPBA 3SHAH 1J9CH 5CMXH 1UVTH 2BLOA 3BTFE 2GDEH 3A8BA 5DP9A 1YPEH 3PO1B 1W10U 1ZTJA 1CBWC 1MTVA 2BHGA 3KGPA 3T5FH 2H9HA 2D2DA 2ZGHA 2DE8A 5JBCS 1QBVH 3P17H 4JYTA 4B75A 4XBCA 5DP6A 3TU7H 2FX4A 1CU1A 2HALA 1Y3UA 1JRTA 3FAOA 1C5UA 4KTCA 3RXMA 4AFQA 1GDUA 1RIWC 1ESAA 1UCYK 5DK1A 1TBZH 2ZFTA 3M36A 1K1PA 3ZZDA 5TCCA 3ZZBA 2Q6GA 4DIHH 2R3YA 4X6OA 4A1VA 3SV9A 1K1JA 3UOUA 3ZYDA 2FTLE 3UPEA 4BTIB 1W13U 3NXPA 2BTCE 1GBJA 3F1SB 1AVGH 2VIOA 5BRRE 2Z3EA 2ZDNA 1SG8B 1CVWH 1V2LT 3MH5A 4YTAA 5DGJA 3SBKA 1J8AA 1GVKB 4I31A 5DP8A 2B9LA 2CJIA 3UR9A 1LPKB 1EB1H 1BBRE 4NCYA 1SGDE 2WPHS 4CBNA 5DPAA 1GI4A 1BQYA 3E0NB 3SORA 3ZYEA 3U8RH 2NWNA 3OU0A 3TVJB 1DICA 3H7OA 3LOXA 2GCHG 3JZ2B 2PKAB 5GJ4B 1TQ7B 1ETTH 3ZV8A 1ZMLA 2A2XH 2QF3A 4JMYA 3T2NA 2QIQA 4GUXA 1INCA 2RCEA 5DG6A 1NY22 1P02A 1OP2A 1KLTA 1P57B 2BY7X 4AGKA 2RDLA 1O34A 1T7CA 1NRQH 1EXFA 1OSSA 1CHGA 1BMMH 1O2VA 4OS5A 3SV2H 2SGQE 3TH4H 1LCYA 3GY2A 2OC7A 2FI3E 1KXAA 2F9OA 2STBE 3TGKE 3RMOH 3KL6A 3F68H 1GJDB 2CGAA 1D4PB 1CT2E 1D3TB 1DITH 2FM2A 3GDVA 1Y3YA 1DWDH 1ZRKA 1DY8A 4OS2A 2ANMH 3MU8A 3PWBA 2GGVB 3KHVA 1ESBA 1D3PB 4AORA 1DSUA 1V2NT 1G3BA 3RMMH 3MH7A 1SGPE 1LHCH 3NZIA 1HAIH 1UTMA 4UFFH 1O2KA 1WV7H 3QTOH 1KLJH 1EB2A 4FUIA 1LTOA 3UTUH 2NU1E 5LH8A 2ALPA 5K0HA 2LPRA 3HPTB 4NA7A 4Y76A 1O3BA 1HAXB 2EA3A 2ZHDA 3EE0B 1DPOA 5E0GA 1QL7A 2GVFA 4AYVB 1BHXF 2TRMA 1GJ6A 1KTSB 1O2UA 2GX4A 3AVZA 1RRKA 4MPUA 4ZXYH 2P8OB 3QX5H 2G4TA 1SGTA 2A7CA 1ZHRA 1GHYH 4INHA 1TX8A 1CBWB 3BSQA 3P8NA 4ZKNU 1GBTA 2PUXB 1FAKH 5FPTA 1XVOA 1G2MA 1O30A 3VB4A 1EJNA 2HOBA 2C90B 4CHAC 2VIWA 3HKIB 1HAPH 3DFJA 4WJG2 1BDAA 3T28A 1ANDA 1IQGA 2PLXA 2H2ZA 1RIWB 1P9SA 3SI4H 2ZTYA 3OSYA 5A8YA 4FUCA 2Z9LA 6CHAC 1RGQA 2BXTH 4X1QU 1O2PA 1YPHC 2R9PA 4ABJA 4D7FA 2FOHA 5EQRA 3ZVDA 1OWIA 1HGTH 2HRVA 1IHTH 1HBTH 1VITG 1YF4A 2CN0H 4K1EA 1GMHF 3ZV9A 5J4QA 1VR1H 1O2OA 2A45B 3U9AH 1TGBA 3K9XB 1YCPM 1PPZA 3GDUA 1SGNE 1UTPA 5DP4A 4CRCA 1FPHH 1HB0B 4HFPB 1D9IA 1GJ7B 1AE5A 3U69H 3SN8A 1O2QA 2Z9JA 3TH2H 3P70B 4GPGA 1IQIA 1O2GH 1ZSJA 2VJ1A 1IQLA 2BD5A 1T31A 1QRWA 1AN1E 1GGDC 3GY6A 3SUDA 1P2JA 4OGXA 1SLUB 2F9BH 5C67A 3M37A 3Q76A 4AN7A 1BITA 1P11E 3B8JA 3SJOA 4ABDA 3TH3H 1WTGH 4X6MA 2PFEA 1YLDA 2TGTA 1FZZA 1EPTB 1P0SH 2FOEA 5C1XA 4FU7A 1OS8A 1QJ7B 2QXIA 1DFPA 1GHXH 1LQDB 5CHAC 1C2FA 3TGIE 1GMCF 1N6XA 4TPIZ 3RU4D 3RXPA 4TY7A 1MKXK 1BIOA 2BX4A 1PPCE 3FP7E 1KDQB 1S82A 1ZLRA 4I7YH 1Q31A 1DVAH 1CGHA 4INKA 3ZVEA 2QN5T 3RC5A 1QA0A 3LGWA 4A7IB 1D6WA 1SLXB 4KTUA 1KSNA 1LPGB 2OQUA 3LT3A 3V7TA 2ILNA 1Z8JB 3SHCH 2O8UA 3GISB 1O5BB 1GCTC 4IN1A 2FI4E 1C5MD 1F5RA 3ZZ7A 4FXGH 3SJIA 3KIDU 2AFQB 1C2MA 1E38B 5LPRA 2GZ8A 1NS3A 2BMGB 4BNRA 2UWPA 3A7ZA 2R0KA 1BTHH 2Y7XA 1DANH 3BIVH 4ISNA 2G55A 1GG6C 2C3SA 3E8LA 4BAHB 1C9PA 1O37A 3GCNA 3RC4A 1O33A 3E16B 2HWLB 7GCHG 5G4BA 1JWTA 2FOGA 1ZHPA 1C4Y2 3HKJB 3CS7A 4OGYA 3ATMA 4H6TA 2D26C 2JH5D 1XXDA 2BOHB 1SGYE 4CH2B 2OD3B 1MCTA 1Z7KA 1K1MA 3LJOA 1SLVB 1DM4B 4KKDA 3A82A 4CHAB 1OOKB 4BAOB 2AMQA 3TJUA 1IOEA 1AO5A 4DJZB 4KP0A 3VB3A 2PGBB 1BOQA 1Z71A 2D1JA 2ZFSA 4YOJA 1K21H 1NFYA 4X2XA 1C5TA 4GVUA 1ZPCA 2ANKH 3BTTE 1TNIA 2FTMA 6CHAB 4ZKSU 2WV4A 2PKAA 1A0LA 3E3TA 1P9UA 1OXGA 2XBVA 2ZCKP 3KCGH 1L4DA 1BB0B 2BLQA 4FUHA 2W3KA 3QO6A 3L6PA 1NFXA 4WF8A 1MCVA 4OS1A 3TJOA 1V2RT 1W14U 5JPMH 1EATA 1YCPK 1NN6A 3PO1C 1T32A 3ZZAA 3DT0H 1UTNA 1BCUH 1MU8B 2Z9IA 4JZIA 4XFQA 4JYVH 1TPPA 3FFGA 2F9PA 1EKBB 3D65E 4K8BA 3MH4A 3V3MA 1C2HA 1GGDB 1EP5A 3R3GB 3BG8A 1MTWA 4FU9A 2PUQH 3RU4T 4JCNA 2ZGCA 4R8TB 2VWMA 1GHBG 3Q3YA 1GBHA 4NZLA 1SBWA 4RSPA 3RXQA 1QQUA 1GI0A 5EPNA 3PROA 1UTQA 1HCGA 3MNSA 3SW2B 5EPYA 3G01A 1P2NA 5EQSA 1GDNA 4AB8A 1UCYH 3ATLA 1S83A 2YNAA 1GBEA 1BRUP 5CHAB 5C20A 1WUNH 1MD7A 4WVPE 3W95A 3GCHC 2RA3A 1L1JA 1AFQB 1OWEA 3QZRA 1SOZA 3KNXA 4NA8A 2AMDA 1SQTA 1P06A 3HGNA 4GCHG 5A2MH 2GV7A 3NKKA 1U6QA 5JB8S 4ASHA 4IBLH 2G00A 3A7WA 1HAOH 2WPIS 1P01A 3F6UH 3RXLA 1HIAB 1H9HE 1W7GH 1YPJH 3VB6A 4UD9H 5LGOA 2AMPA 3ZZ4A 2PWXA 1D6RA 1GCTB 1UVUH 1XUHA 3ZZ6A 4X1RU 3LC3A 3MYWA 1ZMNA 5L6NH 4Y6DA 4JK6A 2ZKSA 2VIDA 4ABFA 5PTPA 1S84A 1W11U 2ZWLH 5J4SA 1O3FA 3OX7U 1EASA 1LVYA 2XC0A 3LH3A 5FPSA 1TFXA 1BTXA 3V12A 1ELDE 2DE9A 3SNBA 1TA6A 2QXJA 1GJCB 5C1UA 4I8HA 1OWJA 4B73A 1GG6B 1PQ7A 3ZZCA 3BTWE 4I8JA 3QZQA 1A5GH 2OTVA 2QGRA 3TIUA 2G5VA 5I46H 1HNEE 4LXBH 1TPSA 1G30B 4Y7BA 2I6SA 1FPCH 4BXSA 1QFKH 2O9QA 3SU6A 4NIVA 4XBDA 2BVSH 1MTNC 1AGJA 3RXKA 5JBAS 3LDXH 4CBOA 5GDSH 3U1IB 3VPKA 1EX3A 1MAYA 3SU3A 3M5LA 1DT2A 1FIWA 1JRSA 1LVBA 4FVBA 1O3NA 2HNTC 3T26A 2OINA 1O5GH 2WYGA 3MNXA 3UQOA 4HGCA 2IN2A 2ANWA 1GPZA 3GYLB 1UVOA 4ISIH 3A7YA 5JBTA 2RA0A 1F5KU 1GBBA 2BM2A 4O3UA 6LPRA 1K28D 2K1QA 1DDJA 2ZHEH 3MO9A 4MPVA 3F9HA 2BYAX 2QV1A 2G8TA 4B71A 1QRZA 2V0BA 1AVXA 1V2KT 5JDUB 3MO3A 2PTCE 5A0AE 1EAIA 3DA9B 3ELAH 1PPBH 5B6OA 3STJA 1EPTA 1EAXA 3ZZ9A 3A83A 1YLCA 1O2WA 2XRCA 2P8OC 1HLTH 4YLUA 3P95A 4DIIH 1SMFE 1GWAA 1A1RA 1BT7A 4Q7ZA 2Q6DA 1YC0A 1C4V2 1V2VT 5CE1A 2ZP0H 1WCZA 3RM0H 1BRAA 1XMNB 5T3HA 4Y8XA 1KDQA 2ODYB 4ZHLU 2H9EH 1PQ8A 2HPQH 2HGTH 3KQBA 4ZROA 3EA7A 2ESTE 4B1TA 1V2TT 1SC8U 3E1XB 2VWOA 8KME2 4ZAEA 4K2YA 3Q3XA 1VCWA 2BX3A 3M5NA 2OC8A 3TNTA 4IW4E 1GJ4H 3PMHB 4AZ2B 2WV5A 1BA8B 1ABJH 1C2EA 1S0RA 1EZXC 4HTCH 1QQ4A 2BY5X 4KTSA 1T4UH 2BD4A 1EAWA 2B5TB 1AWHB 1TOMH 3MU1A 1O5FH 3ATKA 2BLWA
chains in the Genus database with same CATH superfamily
5E2PA 1XUIA 3GCHB 2LNCA 4F49A 2TGPZ 1QTFA 2GZ9A 2Y81A 2BVRH 1TA2A 4YOIA 3I78A 1QHRB 4A5TS 1NZQH 1BRCE 1P12E 5A0CA 3SU5A 3SV7A 1O5CB 1A61H 4RT1A 5EODA 1GDQA 2H1UA 5EXLA 4NG9H 4UFGH 2AGEX 3SUGA 3D62A 5AHGH 3RLWH 5T6DA 1EZQA 2NU4E 1HAVB 2XWBI 1X7AC 4MVNA 4AFSA 3RXOA 4AX9H 1CHOF 1TB6H 1TX7A 1Y3XA 1K1OA 1HJ8A 1TNKA 3FP6E 4FU8A 1IQNA 1WQVH 1A5IA 3BEIB 4A1TA 1KYNA 3K6ZA 2V6NA 3UNSA 2PSYA 2XCNA 2SGEE 1GBFA 1SGIB 3BTKE 2F4LA 3ZZ5A 2BZAA 1SQOA 4TYDA 1EPTC 2BQWB 4AYYB 3H09A 2CF9H 3M3SA 1E1RD 2PV9B 4H4FA 2W6ID 4J2YB 3LIWA 1HDTH 3M5MA 5L30H 1TYNA 4ZXXH 5A8ZA 4CREA 4Y0ZE 1WSSH 3HK6B 3TK6A 1BTWA 5EW1H 1G32B 1O2LA 3M7UA 5EW2H 4ABIA 2XC4A 3W1EA 3K6YA 4NSVA 3F2FA 3T62A 1B7XB 3TLOA 1MTNB 2ZFRH 2FP7B 2TGAA 5FL7D 4Z0KA 1C5SA 1ZMJA 2ZGBH 5EG4A 5ABWA 3SZEA 3A81A 5DSFA 2JH6D 3P8OA 4ZHAA 3KQDA 2J97A 3SU1A 4VGCC 1YLNA 1EP6A 5ESTE 5A8XA 5DP5A 1AI8H 2W6JD 1BMLA 2AS9A 3DUXH 1FY5A 4H42U 1SLWB 1O2IA 4ISLA 1AZ8A 4DT4A 3GY7A 5A0BA 2ZTZA 1SQAA 2UUJB 3A87A 1GHVH 2WZQA 5A09A 3GS9A 1ZR0A 3ODFA 3QN7A 2BDIA 5IYTA 3C27B 2XNDD 1PPGE 1SI5H 2ZZUH 4NA9H 1QL9A 2BDYA 1O32A 1CA8B 1IHSH 2BDCA 1E34B 2J2UA 4WY3A 3GY3A 1MH0A 4XSKU 2NU2E 5AF9H 3PMJA 2EC9H 1PYTC 1F5LA 3PV2A 2ZFPH 2R2MB 1EAUA 2V3OH 3T29A 2AIPA 1C5NH 1K22H 4CRFA 3O8RA 5E0JA 3S7KB 4J1YA 2JKHA 1LHGH 2ANYA 2JJ2D 4X1NU 2V35A 3ATIA 1AIXH 2A4GA 3RXEA 4GHTA 2AGIX 1XM1A 1GVZA 2F9VA 2WUCA 4Y8ZA 1CA0C 3MHWU 4K69A 1AB9C 1HIAA 4NFFA 3RU4E 4A92A 3LH1A 2D8WA 1GL1A 1SPJA 3SJ8A 1QRXA 2C8WB 2Q6FA 3OYPA 4X8UH 2IPHA 3C1KA 2Z9GA 2RG3A 1FY8E 1YGCH 1H8HD 1HXEH 1QCPA 1TOCB 1BTUA 1V2WT 2EI7A 3CP7A 4K1SA 4OS7A 2VU8E 1NTPA 2AH4X 4GLYA 3RXVA 3SGAE 4X1SU 2W5EA 3AASA 3A80A 4DW2U 4K60A 3DSGA 2VIPA 2C4FH 2GCHF 3VXEH 1MZAA 4A6LA 7ESTE 3GCTG 1E35B 1O3AA 2FS9A 3V13A 1XUGA 5EU8A 3EQ0H 1V6DA 1IQHA 3MWIU 1A2CH 1O2XA 5FXLA 3BG4B 2FOFA 5JYIA 2W3IA 3KEEA 3DD2H 1OP8A 2WPMS 5KECA 1ANBA 1LMWB 1Z6JH 1ZGVA 2H9TH 1SOTA 4BAQB 1JXPA 2BZ6H 3P6ZB 3B23B 1LVOA 2VGCC 2ODPA 2ZU2A 4JZFH 2W7SA 5GCHG 1GHAG 4RN6A 2ZU3A 2OBQA 1GBLA 1DWCH 1TLDA 1FQ3A 4K1TA 2FS8A 1V2JT 3ATWA 1TBQH 1C2GA 3SI3H 1DXPA 3SJ9A 2O8TA 1GJAB 3CENA 4MPXA 2ZO3H 2FWWA 3LGYA 2FLBH 5F8ZA 1P3EA 4XRNA 1AFEH 2WUBA 1B0EA 4E7RG 1LVMA 1TONA 3EGKH 4E7NA 1W0KD 2QY0B 1UK2A 1AKSB 1QJ1B 3PRBA 3RXGA 4NWLA 1WOFA 3UR6A 3LC5A 3TITA 1XX9A 5F03A 1C1QA 2G81E 2CXVA 3PV4A 3DCLA 5HYOA 1C5RA 1SGQE 5SGAE 1XKBC 1C5OH 1AFQC 1WTHD 1YPKH 1WAYB 1A0JA 4K5ZA 4X8VH 1LKBA 2FZZA 1FMGA 4X6NA 2ZTXA 1LQEA 1QA7A 5HMAA 1RD3B 5F8XA 3ENSB 4UFEH 1UMAH 1K9OE 5E0HA 4VGCB 1PPEE 1VITH 4Q2KA 1TALA 1S81A 1A7SA 4WWYA 5FX6A 4XD7D 1RS0A 1P03A 1WQSA 3SU4A 1TNGA 1EJMA 3MMGA 3VGCC 1B5GH 4B2BA 4AGJA 2ZHWH 2ZEBA 1ZJKA 2BDBA 3NCLA 1BBRK 1O2NA 3AAVA 1OWKA 4F4OC 1C1SA 1O2ZA 1Y5AT 1SGFA 2AIQA 3QLPH 1J17T 1N8OB 1Z1IA 1MBMA 1KXDA 2AHME 1TBRH 4NIXA 3BTGE 4UDWH 1TRYA 4FUGA 5AFYH 1MZDA 2SNWA 4Y7AA 1W2KH 1MU6B 2TPIZ 3UNRA 1P2OA 2C93B 1UTLM 1UO6A 1MBQA 1UJ1A 1Y5UT 4CR9A 1ZOMA 1MTSA 1YPHE 3EDXB 2FOCA 1HUTH 2FDAA 4AFUA 5L2ZH 3PTNA 5C5OA 2ALVA 3AW1A 5FBIA 3SUEA 4DGJA 1VITF 5H4IB 3FZZA 1S6FA 1ARCA 4Y11E 1Y3VA 3EA8A 1FY3A 2W26A 3M7TA 1QJ6B 4HG6A 2P3UB 4MDSA 3H7TA 3LKWA 4YLQH 2OQ5A 1NFUA 2QA9E 2C8XB 1C9TA 1CA0B 2QAAA 1AB9B 2QF4A 1C1RA 2ZHFH 4ISHH 1UCYE 3ZVFA 1FY4A 3A8CA 2FYRA 1P05A 3MI4A 3M3VA 1HAVA 2P59A 4X8SH 1Q3XA 3NUMA 1AUTC 2UUKB 2FLRH 1V2ST 3N7OA 1OWHA 2NU0E 1YPMH 2ZF0H 1QB6A 1MABB 1BTZA 2OLGA 5L2YH 1GHAF 3IG6B 3W94A 1THSH 3LJJA 3LGVA 1QBNA 1F0TA 1Z6EA 5EXMA 4UONA 4HI3A 5EJZA 3F9FA 3PLBA 1HJ9A 3ZZ3A 1H9LB 1FNIA 2BD7A 4ZHMU 1XUJA 1G37A 1MD8A 2EEKA 1ZJDA 2A7JA 2SNVA 1ZPZA 4AC9A 1C4U2 3QDZB 1H4WA 3U98H 4AG2A 2FODA 5FX5A 2JJ1D 3K65B 1SGRE 3M3TA 2R3UA 1H8ED 3RC6A 2UUFB 2JETC 4TY6A 2VGCB 4RI0A 1QBOA 3TK5A 4AOQA 1NT1A 2HPPH 4NSYA 2ZC9H 1HXFH 2VNTA 1ZTKA 5AVDA 1C5YB 4B76A 3UIRA 4O03A 4U2WA 4X2WA 5HIZA 1DSTA 3E90B 1TGSZ 2FOAA 4Y0YE 4CRBA 2HVXA 2KAIB 4MG3A 1TE0A 1GBDA 6ESTA 3GOVB 1NROH 2XBWA 4JK5A 1HFDA 2A0QB 3SQEE 3SNDA 3D23A 2J98B 4X6PA 3BTEE 1QURH 4XBBA 1O3EA 2BD8A 2O8LA 3U8OH 4TSFD 1J14A 1SGCA 1GHWH 1G9IE 3SV6A 2Y82A 2Z3DA 1H9IE 2FOMB 2P94A 1BTYA 3DHKH 1SQRA 2QCYA 3SUFA 4WXIA 1HJAC 4O3TA 2VIVA 1SVPA 3RMLH 3EAJA 3VB7A 1ANEA 2FO9A 3A8DA 5JBBS 4ISOA 3S9AA 1NO9H 4DT7B 3GDSA 1BTPA 1OHHD 1UTKA 2A4OA 2CK3D 2KCPA 4Q80A 7GCHF 1NC6A 2FIRH 5B6LA 2VIQA 2BDHA 4X0WU 5GNDA 1YP9A 1VKYA 4CRAA 2BD3A 2R0LA 2VH6A 5C1YA 5TCAA 1FONA 1XVMA 1MQ5A 9ESTA 3VGCB 5DKMA 2Q1JA 4NIYA 1ID5H 1CGJE 3QTVH 2Z94A 3T25A 3MO6A 4FETA 4NWKA 4PROA 4LZ1H 3E6PH 1K2I1 1ELBA 4YT6H 1B0FA 2XXLA 1GI9B 1F0UA 1ELVA 8GCHG 1MUEB 1GL0E 5T6GA 3TJVA 2WPKS 1SL3A 4DOQA 3IWMA 2G52A 1AD8H 3MFJA 1O3PB 2XYAA 1DLEA 1BRBE 2JH0D 5FCKA 3CS0A 4MNXA 3URDA 4IC5A 5FBEA 2GP9B 1ZSLA 3FN8A 4ZUHA 1GJBB 2ZGXH 1HYLA 5HM2A 1TRMA 4NGAH 1TQ0B 2OC1A 3LPRA 4WH8A 2IJD1 2G51A 1V2QT 2BD9A 1ZRBA 2VBCA 1AY6H 4D7GA 3K2UA 1EQ9A 1YY3A 1NBMD 1ZHMA 1OPHB 1C5ZB 1P04A 4IN2A 1V3XA 1SGFG 5KEDA 3EYDA 5C2ZA 1FJSA 1Z8GA 2P16A 1S6HA 4MPWA 3OTJE 1Q2WA 4TT3D 2L6OA 4O9VA 1JBUH 4IGDA 2ZPSA 4B2AA 1P3CA 1E37B 1NPMA 2ZCLP 3SO3A 1BMFD 3I29A 2ZDKA 3QK1A 1GHBF 4WMEA 1C5XB 5C5NA 1DX5M 3GY5A 1O5AB 3A7TA 1AKSA 3VG8A 2YMSC 1F92A 3D49H 4DY7B 1C5LH 1C1MA 3U1JB 2H6MA 1BMNH 1C5VA 1EOLA 1T8LA 2QXHA 2FESH 5TJXA 3RXSA 1AZZA 1W0JD 4XE4A 2Y7ZA 1ELGA 2XTTB 2XBXA 2ZU5A 1NFWA 3PMBB 1L1GA 4X2VA 2JETB 1EJAA 1MAXA 1ANCA 2VWLA 4E06H 5FHTA 4GAWA 2SGFE 4GCHF 1BMAA 2BDGA 4INLA 1GI8B 3O8CA 1DWBH 1MKWK 1P10A 1C1OA 4SGBE 1F0RA 1O3MA 4YOGA 1O3HA 5GXPA 1DOJA 1D3QB 1FY1A 2GDDA 2HLCA 2P93A 1S5SA 2ZI2H 1HRTH 5HM9A 3PLPA 3UWIA 1LHEH 1TNHA 2GV6A 2A31A 1XXFA 3PTBA 2J94A 2ZA5A 3UUZA 1C2DA 1P8VC 4CR5A 3P8FA 2A7HA 1QB9A 1O39A 1ELTA 1HV7A 5BPEA 3RXRA 1GI5A 1KXCA 3BG4C 3BTME 2J34A 4ASUD 3Q3KA 1H1BA 1HJAB 2GTBA 8GCHF 1ABIH 2STAE 3VB5A 1UK4A 2Z9KA 5LPEA 4UE7H 3ZVBA 1ESTA 1KY9A 3UWJH 2CV3A 1O0DH 1O2SA 2C8ZB 3KQCA 4D9QA 2Z6BD 1HPGA 5T6FA 3PB1E 2FMJA 5EXNA 2OC0A 1OYQA 4U30A 2A2QH 1GJ8B 4I32A 4UFDH 2CHAC 3M5OA 1DY9A 4FUDA 4MQAA 1ELAA 2HNTE 3FP8E 1J15A 1THRH 3PMAB 1O2YA 1DWEH 2ZECA 1SHHB 2J5UA 4IS5A 2ZQ1A 4THNH 3S69A 2TBSA 3RUOA 1BHXB 1W7XH 1G36A 1V2UT 5K7RA 4ZKRU 3FVFB 1T8OA 2ZDLA 2FPZA 3L3TA 1F0SA 1ORFA 1GMHG 4Q7YA 1VJ9U 3MTYA 1IQFA 4CH8B 4D8NA 4BANB 1CT4E 4Q63A 1GI1A 3M7QA 3BTQE 4GHQA 2IJOB 1TGCA 1JIMA 4ABEA 1THPB 3VFEA 2KX4A 2BY8X 1GMDG 3KN2A 1O35A 3S7HB 3QWCH 3S0NA 2TIOA 4AB9A 1H8DH 2C8YB 4K3JA 4I8KA 1MKXH 1A4WH 5FCRA 5EJ1A 1IQMA 2ULLA 2WPJS 1G2LA 2QXGA 4GSOA 1PJPA 2WHXA 3MNBA 2ZFQH 4CRDA 2YNBA 4YZUA 1ZSKA 3VXFH 1OX1A 3ESTA 1O3GA 3JZ1B 1O2MA 1ETSH 4QT8C 1DXWA 1TIOA 2H5DA 3OY5U 1O5DH 3A84A 1TX6A 1FN6A 1NRRH 3E91A 1N8OC 3A88A 3B9FH 4BTUB 2PSXA 2KAIA 1FX0B 3A8AA 3PLKA 2WPLS 2J92A 2P3TB 3VEQB 1TMBH 3GY4A 4XDEA 4ABHA 1FI8A 2J98A 4K8YA 1BBRH 3H5CB 4IMQA 3SU0A 1UHBB 3BIUH 4Y79A 1GBKA 1UTJA 4ABAA 1GMCG 1KIGH 3S9BA 1S85A 2YMSB 3ZVCA 2ZGJA 2P3FH 4RKJB 1FUJA 3OEHD 2OCVB 1V2OT 4Q7XA 2FI5E 2BVXH 2PKSC 2GJGA 4Y71A 3FANA 2Y6TA 1C1VH 1PPFE 3OAAD 3UQVA 1UVPA 3RXBA 1NRNH 4NIWA 4TWWA 1C5WB 1RTFB 2ZQ2A 4Y8YA 5HXFA 3DSOA 3GYMA 1O2TA 2XBYA 1GHZA 8ESTE 5JB9S 4H6SB 1UW7A 3P92A 3MU4A 3DFLA 1SFQB 3RXUA 1OKXA 1PFXC 1GBCA 3BTDE 3QUMP 1ZYOA 3AAUA 2ASUB 3TJNA 3U8TH 1TNJA 2A5AA 1O3LA 3AK5A 1TPAE 1AMHA 1EUFA 2HNTF 1VCPA 2BOKA 3TGJE 5DP7A 5CDFE 4M7GA 4MNVA 3OFND 1P2MA 1C2JA 2QC2A 1TNLA 4JYUH 1CO7E 2H5CA 3LGTA 3SGQE 1F7ZA 5I25A 5ESBA 2VINA 2ZCHP 4X1PU 4DCDA 2CMYA 2DUCA 3UY9A 4BTTB 4I33A 1C2IA 1G3EA 3SOSA 1GI3A 4B2CA 2A4RA 3RXDA 5DP3A 4AG1A 1E79D 1TMUH 4ABGA 1M9UA 3RXFA 2GMTC 2J95A 1O2JA 1YCPH 2XC5A 1LPZB 3A85A 2FOBA 2ODQA 1FN8A 1Z8IB 1EFRD 1CQQA 3O8DA 4UEHH 3U28C 1KLIH 3ODDA 2F3CE 2AEIH 2ZNKH 2GCTC 1GMDF 1O36A 1DUAA 1GI2A 1QL8A 1XUFA 1YPGH 2CHAB 4ABBA 1ZTLA 1NU9A 3NK8A 1BJVA 3ZVAA 1A0HB 1J16A 1IAUA 1ARBA 3I77A 4WMDA 3LU9B 1KXBA 1KXEA 2ZU1A 4HZHA 2RDEA 3PYHA 1UVSH 2PW8H 1LHFH 4I8GA 4CRGA 3MQKC 5IDKA 2BB4A 3SZNA 1TMTH 2XW9A 5E8EH 4D9RA 2I6QA 1BUIA 1YYY1 1T8NA 3SU2A 1QY6A 2Z3CA 3A89A 1EZSC 1Y59T 2FYQA 2FEQH 1W3CA 2VH0A 1TAWA 3SQHE 1O5EH 4MTBA 1AWFH 3A7XA 4U32A 2V3HH 3F9GA 3BN9A 1QNJA 1XUKA 2ZDMA 3LGUA 1VZQH 3SNAA 3RXJA 5F6MA 1COWD 2F91A 2QYIA 4MLFB 3WW7A 4LZ4B 1OYTH 9LPRA 7KMEH 4LOYH 1P2QA 1Y3WA 8LPRA 1E36B 5T1VA 3URCA 1V2PT 4RKOB 2PR3A 2GKVE 1O3DA 1P2KA 2YOLA 2J9NA 3PM3A 1O2RA 1HAZB 1W0YH 1SFIA 2R2WU 3GY8A 3HATH 3TNSA 1ELCA 3NWUA 1LDTT 4ZKOU 2PP6A 1GI7B 3RDZA 1A3EH 2SGPE 1DS2E 3ZIAD 1LO6A 3T27A 4DG4A 3UFAA 1VGCC 2XOKD 3LGIA 1RJXB 2J4IA 3WWBA 4YO9A 3FOAA 3KQEA 4A1XA 2A4QA 1C5PA 4TWYA 4MNWA 1OWDA 3GICB 2XCFA 2XNIA 1N6YA 3RXCA 1NU7B 5AFZH 1O3KA 3AW0A 3GCOA 1N1LA 4NZQA 1E0FD 1JOUB 4MNYA 3KYGA 1PPHE 2ZDAH 1YKTA 2PKSB 2Z7FE 1O31A 3GCTF 2VVVA 1K1LA 2OXSA 3SGBE 1ETRH 1GJ5H 1K1IA 3BV9B 3L33A 4JZDH 3MH6A 4FUEA 4XOJA 4KGAA 1C1WH 1FAXA 3KF2A 5DJ7A 2PTNA 1T8MA 2B7DH 1MQ6A 1HAGE 1C1NA 1BJUA 2ZHQH 3F9EA 4TPYA 4B74A 3WY8A 1MMJN 5FPYA 4DURA 5GCHF 1Z8RA 5HKKD 1PYTD 1AE8H 1MTUA 5E2OA 3BEUA 2BQ7B 3ZVGA 3LONA 3SNCA 5C3NA 2SGDE 4ESTE 2XWAA 1KTTB 3PRDA 4YESB 1L2EA 1ELEE 2BY6X 2Y80A 1AVWA 4F55A 1VCQA 1LKAA 1NM6A 2TGDA 2WSSD 3SJKA 1BZXE 2OP9A 2G5NA 5EQQA 3MNCA 3RXHA 2GD4B 4LK4A 1QR3E 1SKYE 6GCHG 4WMFA 1RTLA 1TRNA 4Q4LA 4ZH8A 1NRPH 1TPOA 1W0ZU 1GCDA 3QGJA 2BDAA 1NESE 4BAMB 5EOKA 1W8BH 2BD2A 1GJ9B 2GMTB 2WINI 2BY9X 3R0FA 1Z1JA 1P09A 1P2IA 1FDPA 2Y5HA 2SGAA 3FZDA 1CGIE 1Y8TA 2CF8H 3PWCA 2P95A 3Q77A 1AUJA 2OUAA 2EI6A 4Y10E 1C1UH 1L1NA 2AYWA 2GZ7A 3MU0A 2GCTB 2ZPRA 4YXWD 3RMNH 2BXUH 2A1DB 1TWXB 2AERH 4D76A 3EA9A 2ZU4A 4FVDA 3RLYH 1YBWA 3UOPA 3HK3B 1S0QA 4Z6AH 1O3IA 1TABE 3IITA 3RM2H 1T4VH 1Y5BT 1DLKB 3M61U 1SB1H 1O2HA 1MKWH 3MU5A 1C5QA 4I8LA 4KELA 2OBOA 5ETXA 2F83A 2ZDVH 1JMOH 2ZFFH 2PGQB 3UREA 2B0FA 2VVCA 1YM0A 1CSOE 2Y5GA 5KGOA 2JDID 1GBIA 1IQKA 3P8GA 4AFZA 1GVLA 3RXAA 1NBME 1QIXB 2QF0A 1IQEA 1PQAA 4FUBA 2VVUA 1A46H 1UHBA 4JZ1A 1L4ZA 4BOHA 3RXTA 1O3JA 2QE7D 4SGAE 1PQ5A 1DE7H 1FIZA 4P00A 1SHYA 4BXWA 1GBAA 1L0ZA 2UUYA 2WYJA 4OS6A 2A5IA 4YT7H 5EIYA 1UK3A 2G4UA 1CE5A 1ZGIA 1A5HA 4X8TH 1WBGB 5DN6D 5F8TA 2IOTA 4DVAU 2W7UA 3NPSA 2A5KA 1RTKA 4WH6A 1FLEE 1XKAC 2KZ4A 1KXFA 2FX6A 1DUEA 2BLVA 2THFB 1FXYA 1QGFA 3OY6U 1C1TA 1WU1A 1C2KA 4WXVA 2EI8A 2VB0A 1TGNA 1VGCB 1G3CA 2UWOA 5GPIB 3MOCA 1TGTA 1A3BH 1QB1A 2FXRA 5DO4H 4O97A 4R0IA 1GI6A 4Z1MD 3OEED 1V2MT 2J38A 2M5TA 1H8IH 1YPLH 1O3OA 2A32A 2ZIQH 3A7VA 2O8MA 1C1PA 1G3DA 1F2SE 1SR5C 3HGPA 3E0PB 4ZMAH 7LPRA 1ACBE 2EY4C 1VJAU 1LHDH 1CT0E 3BF6H 2UWLA 1NRSH 1GBMA 4OS4A 4JZEH 1RFNA 3BEFB 1CHOG 1WYKA 4E05H 5HGGA 3V0XA 3O8BA 5LPFA 3SV8A 3SNEA 2PHBA 6GCHF 1FV9A 1AQ7A 3S9CA 1SSXA 4U01A 1HAYB 1RXPA 5EGMA 4YM9A 2BQ6B 4BAKB 1UTOA 3M35A 4IC6A 5GWZA 2B8OH 2SFAA 2LP6A 1O3CA 2NU3E 1AHTH 2GT7A 3STIA 3QGNB 1SGEE 3Q00A 4X2YA 1W12U 1JIRA 2EQNA 1AU8A 1EZUC 2AGGX 2Y5FA 4FUFA 2F9UA 3TK9A 1K1NA 3UNQA 2ZG0H 1EOJA 1C2LA 2WV9A 3A86A 2O8WA 3RXIA 1HAHH 5CHBA 1YWUA 1O38A 3ITIA 4B6FA 3FO8D 1OP0A 2VWNA 1D3DB 3BTHE 4FUJA 5FAHA 2ZPQA 5GIBA 3TPIZ 3ZZ8A 2GT8A 3RP2A 2F9NA 4IMZA 4NFEA 1ELFA 1ZZZA 1IQJA 1ZPBA 3SHAH 1J9CH 5CMXH 5C0TA 1UVTH 2BLOA 3BTFE 2GDEH 3A8BA 5DP9A 1YPEH 3PO1B 4RT0A 1W10U 1ZTJA 1CBWC 1MTVA 2BHGA 3KGPA 3T5FH 2H9HA 2D2DA 2ZGHA 2DE8A 5JBCS 1QBVH 3P17H 4JYTA 4B75A 4XBCA 4M9FA 5DP6A 3TU7H 2FX4A 2IPQX 1CU1A 2HALA 1Y3UA 1JRTA 3FAOA 1C5UA 4KTCA 3RXMA 4AFQA 1GDUA 1RIWC 1ESAA 1UCYK 5DK1A 1TBZH 2ZFTA 3M36A 1K1PA 3ZZDA 5TCCA 3ZZBA 2Q6GA 4DIHH 2R3YA 4X6OA 2L74A 4A1VA 3SV9A 1K1JA 3UOUA 3ZYDA 2FTLE 3UPEA 1WXRA 4BTIB 1W13U 3NXPA 2BTCE 1GBJA 3F1SB 1AVGH 2VIOA 5BRRE 2Z3EA 2ZDNA 1SG8B 1CVWH 1V2LT 3MH5A 4YTAA 5DGJA 3SBKA 1J8AA 1GVKB 4I31A 5DP8A 2B9LA 2M2AA 2CJIA 3UR9A 1LPKB 1EB1H 1BBRE 4NCYA 3SYJA 1SGDE 2WPHS 4CBNA 5DPAA 1GI4A 1K0HA 5EJLA 1BQYA 3E0NB 3SORA 3ZYEA 4I86A 3U8RH 2NWNA 3OU0A 3TVJB 1DICA 3H7OA 3LOXA 2GCHG 3JZ2B 2PKAB 5GJ4B 1TQ7B 1ETTH 3ZV8A 1ZMLA 2A2XH 2K0QA 2QF3A 4JMYA 3T2NA 2QIQA 4GUXA 1INCA 2RCEA 5DG6A 1NY22 1P02A 1OP2A 1KLTA 1P57B 2BY7X 4AGKA 2RDLA 1O34A 1T7CA 1NRQH 1EXFA 1OSSA 1CHGA 2KCAA 1BMMH 1O2VA 4OS5A 3SV2H 2SGQE 3TH4H 1LCYA 3GY2A 2OC7A 2FI3E 1KXAA 2F9OA 2STBE 3TGKE 3RMOH 3KL6A 3F68H 1GJDB 2CGAA 1D4PB 1CT2E 1D3TB 1DITH 1WDIA 2FM2A 3GDVA 1Y3YA 2KCOA 1DWDH 1ZRKA 1DY8A 4OS2A 2ANMH 1QZ8A 3MU8A 3PWBA 2GGVB 3KHVA 1ESBA 1D3PB 4AORA 1DSUA 5HIYA 1V2NT 1G3BA 3RMMH 3MH7A 1SGPE 1LHCH 3NZIA 1HAIH 1UTMA 4UFFH 1O2KA 1WV7H 3QTOH 1KLJH 1EB2A 3KYFA 4FUIA 1LTOA 3UTUH 2NU1E 5LH8A 2ALPA 5K0HA 2LPRA 4ZCNA 3HPTB 4NA7A 4Y76A 1O3BA 1HAXB 2EA3A 2ZHDA 3EE0B 1DPOA 5E0GA 1QL7A 2GVFA 4AYVB 1BHXF 2TRMA 1GJ6A 1KTSB 1O2UA 2GX4A 3AVZA 1RRKA 4MPUA 4ZXYH 2P8OB 3QX5H 2G4TA 1SGTA 2A7CA 1ZHRA 1GHYH 4INHA 1TX8A 1CBWB 3BSQA 3P8NA 4ZKNU 1GBTA 2PUXB 1FAKH 5FPTA 1XVOA 1G2MA 1O30A 3VB4A 1EJNA 2HOBA 2C90B 2F43B 4CHAC 2VIWA 2YMSD 3HKIB 3N7EA 1HAPH 3DFJA 4WJG2 1BDAA 4P02A 3T28A 3N7DA 2KFWA 1ANDA 1IQGA 2PLXA 2H2ZA 1RIWB 1P9SA 3SI4H 2ZTYA 5C0UA 3OSYA 5A8YA 4FUCA 2Z9LA 6CHAC 1RGQA 2BXTH 2LELA 4X1QU 1O2PA 1YPHC 2R9PA 4ABJA 4D7FA 2FOHA 5EQRA 3ZVDA 1OWIA 1HGTH 2HRVA 1IHTH 1HBTH 1VITG 1YF4A 2CN0H 4K1EA 1GMHF 3ZV9A 5J4QA 1VR1H 1O2OA 2A45B 3U9AH 1TGBA 3K9XB 1YCPM 1PPZA 5C17A 3GDUA 1SGNE 1UTPA 5DP4A 3UAIC 4CRCA 1FPHH 1HB0B 4HFPB 1D9IA 1GJ7B 1AE5A 2QF5A 1E1QD 3U69H 3SN8A 1O2QA 2Z9JA 3TH2H 3P70B 2HLDD 4GPGA 1IQIA 1O2GH 1ZSJA 2VJ1A 1IQLA 2BD5A 1T31A 1QRWA 1AN1E 1GGDC 4F48B 3GY6A 3SUDA 1P2JA 4OGXA 1SLUB 3OTPA 2F9BH 5C67A 3M37A 3Q76A 4AN7A 1BITA 1P11E 3B8JA 3SJOA 4ABDA 3TH3H 1WTGH 4X6MA 2PFEA 1YLDA 2TGTA 1FZZA 1EPTB 1P0SH 2FOEA 5C1XA 4FU7A 1OS8A 1QJ7B 2QXIA 1DFPA 1GHXH 1LQDB 5CHAC 1C2FA 3TGIE 1GMCF 1N6XA 4TPIZ 3RU4D 3RXPA 2RFKC 4TY7A 1MKXK 3N99A 1BIOA 2BX4A 1PPCE 3FP7E 1KDQB 1S82A 1ZLRA 4I7YH 1KMHB 1Q31A 1DVAH 1CGHA 4INKA 3ZVEA 2QN5T 3RC5A 1QA0A 3LGWA 4A7IB 1D6WA 1SLXB 4KTUA 1KSNA 1LPGB 2OQUA 3LT3A 3V7TA 2ILNA 1Z8JB 3SHCH 2O8UA 3GISB 1O5BB 1GCTC 2KR7A 4IN1A 2FI4E 1C5MD 1F5RA 3ZZ7A 4FXGH 3SJIA 3KIDU 2AFQB 1C2MA 1E38B 5LPRA 2GZ8A 1NS3A 2BMGB 4BNRA 2UWPA 3A7ZA 2R0KA 1BTHH 3NRLA 2Y7XA 1DANH 3BIVH 4ISNA 2G55A 1GG6C 2C3SA 3E8LA 4BAHB 1C9PA 1O37A 3GCNA 3RC4A 1O33A 3E16B 2WPDD 2KM0A 2HWLB 7GCHG 5G4BA 1JWTA 2FOGA 1ZHPA 1C4Y2 3HKJB 3CS7A 4OGYA 3ATMA 4H6TA 2D26C 2JH5D 1XXDA 2BOHB 1SGYE 4CH2B 2OD3B 1MCTA 1Z7KA 1K1MA 3EE7A 3LJOA 1SLVB 1DM4B 4KKDA 3A82A 4CHAB 1OOKB 4BAOB 2AMQA 3TJUA 1IOEA 1AO5A 4DJZB 4KP0A 3VB3A 2PGBB 1BOQA 1Z71A 2D1JA 5IK2D 2ZFSA 4YOJA 1K21H 1NFYA 4X2XA 1C5TA 4GVUA 1ZPCA 2ANKH 3BTTE 1TNIA 3KQ5A 2FTMA 6CHAB 4ZKSU 2WV4A 2PKAA 1A0LA 3E3TA 1P9UA 4B6EA 1OXGA 2XBVA 3F2GA 3F2HA 5C94A 2ZCKP 3KCGH 1L4DA 1BB0B 2BLQA 4FUHA 2W3KA 3QO6A 3L6PA 1NFXA 4WF8A 1MCVA 4OS1A 3TJOA 1V2RT 1W14U 5JPMH 1EATA 1YCPK 1NN6A 3PO1C 1T32A 3DSPA 3ZZAA 3DT0H 1UTNA 1BCUH 1MU8B 2Z9IA 2HVYB 4JZIA 4XFQA 4JYVH 1TPPA 3FFGA 2F9PA 1EKBB 3D65E 4K8BA 3MH4A 3V3MA 1C2HA 1GGDB 1EP5A 2K8IA 3R3GB 3BG8A 4ACAA 1MTWA 4FU9A 2PUQH 3RU4T 4JCNA 2ZGCA 4R8TB 2VWMA 1GHBG 3Q3YA 1GBHA 4NZLA 1SBWA 4RSPA 3RXQA 1QQUA 1GI0A 5EPNA 3PROA 3FKSD 1UTQA 1HCGA 3MNSA 3SW2B 5EPYA 3G01A 1P2NA 5EQSA 1GDNA 4AB8A 1UCYH 3ATLA 1S83A 2YNAA 1GBEA 1BRUP 5CHAB 5C20A 1WUNH 1MD7A 4ACBA 4WVPE 3W95A 3GCHC 2RA3A 1L1JA 2JIZD 1AFQB 1OWEA 3QZRA 1SOZA 3KNXA 4NA8A 2AMDA 1SQTA 1P06A 3HGNA 4GCHG 5A2MH 2GV7A 3NKKA 1U6QA 3PV5A 4ASHA 5JB8S 4IBLH 2G00A 3A7WA 1HAOH 2WPIS 1P01A 3F6UH 3RXLA 1HIAB 1H9HE 1W7GH 1YPJH 3VB6A 4UD9H 5LGOA 2AMPA 3ZZ4A 2PWXA 1D6RA 1GCTB 1UVUH 1XUHA 3UB0A 3ZZ6A 4X1RU 3LC3A 3MYWA 1ZMNA 5L6NH 4Y6DA 4JK6A 2ZKSA 2VIDA 4ABFA 5PTPA 1S84A 1W11U 2ZWLH 5J4SA 1O3FA 3OX7U 1EASA 1LVYA 2XC0A 3LH3A 5FPSA 1TFXA 1BTXA 3V12A 1ELDE 2DE9A 3SNBA 1TA6A 2QXJA 1GJCB 5C1UA 4I8HA 1OWJA 4B73A 1GG6B 1PQ7A 3ZZCA 3BTWE 4I8JA 3F0PA 3F3BA 3QZQA 1A5GH 2OTVA 2QGRA 3TIUA 2G5VA 4OM9A 5I46H 1HNEE 4LXBH 1TPSA 1G30B 4Y7BA 2I6SA 1FPCH 4BXSA 1QFKH 2O9QA 3SU6A 4NIVA 3CNRA 4XBDA 2BVSH 1MTNC 1AGJA 3RXKA 5JBAS 3LDXH 4CBOA 5GDSH 3U1IB 3VPKA 1EX3A 1MAYA 3SU3A 3M5LA 1DT2A 1FIWA 1JRSA 1LVBA 4FVBA 1S6LA 1O3NA 2HNTC 3T26A 2OINA 1O5GH 2WYGA 3MNXA 3UQOA 2KCYA 4HGCA 2IN2A 2ANWA 1GPZA 3GYLB 1UVOA 2V7QD 3A7YA 4ISIH 5JBTA 2RA0A 3WWFA 5F53A 1F5KU 1GBBA 2BM2A 4O3UA 6LPRA 1K28D 2K1QA 1DDJA 2ZHEH 3MO9A 4MPVA 3F9HA 2BYAX 2QV1A 2G8TA 4B71A 1QRZA 2V0BA 1AVXA 1V2KT 5JDUB 3MO3A 2PTCE 5A0AE 1EAIA 3DA9B 3F0OA 3ELAH 1PPBH 5B6OA 3STJA 1EPTA 3OE7D 1EAXA 3ZZ9A 3A83A 1YLCA 1O2WA 2XRCA 2P8OC 1HLTH 4YLUA 3P95A 4DIIH 1SMFE 1GWAA 1A1RA 1BT7A 4Q7ZA 2Q6DA 1YC0A 4FOUC 1C4V2 1V2VT 5CE1A 2ZP0H 1WCZA 3RM0H 1BRAA 1XMNB 5T3HA 4Y8XA 1KDQA 2ODYB 4ZHLU 2H9EH 1PQ8A 2HPQH 2HGTH 3KQBA 4ZROA 3EA7A 2ESTE 4B1TA 1V2TT 1SC8U 2V3MA 3E1XB 2VWOA 8KME2 4ZAEA 4K2YA 3Q3XA 1VCWA 2BX3A 3M5NA 2OC8A 3TNTA 4IW4E 1GJ4H 3PMHB 4AZ2B 2WV5A 1BA8B 1ABJH 1C2EA 1S0RA 1EZXC 4HTCH 1QQ4A 2BY5X 4KTSA 1T4UH 2BD4A 1EAWA 2B5TB 1AWHB 2OK5A 1TOMH 3MU1A 1O5FH 3ATKA 2BLWA
chains in the Genus database with same CATH topology
5E2PA 1XUIA 3GCHB 2LNCA 4F49A 2TGPZ 1QTFA 2GZ9A 2Y81A 2BVRH 1TA2A 4YOIA 3I78A 1QHRB 4A5TS 1NZQH 1BRCE 1P12E 5A0CA 3SU5A 3SV7A 1O5CB 1A61H 5EODA 1GDQA 2H1UA 5EXLA 4NG9H 4UFGH 2AGEX 3SUGA 3D62A 5AHGH 3RLWH 5T6DA 1EZQA 2NU4E 1HAVB 2XWBI 1X7AC 4MVNA 4AFSA 3RXOA 4AX9H 1CHOF 1TB6H 1TX7A 1Y3XA 1K1OA 1HJ8A 1TNKA 3FP6E 4FU8A 1IQNA 1WQVH 1A5IA 3BEIB 4A1TA 1KYNA 3K6ZA 2V6NA 3UNSA 2PSYA 2XCNA 2SGEE 1GBFA 1SGIB 3BTKE 3ZZ5A 2BZAA 1SQOA 4TYDA 1EPTC 2BQWB 4AYYB 2CF9H 3M3SA 2PV9B 4H4FA 4J2YB 3LIWA 1HDTH 3M5MA 5L30H 1TYNA 4ZXXH 5A8ZA 4CREA 4Y0ZE 1WSSH 3HK6B 3TK6A 1BTWA 5EW1H 1G32B 1O2LA 3M7UA 5EW2H 4ABIA 2XC4A 3K6YA 4NSVA 3T62A 1B7XB 3TLOA 1MTNB 2ZFRH 2FP7B 2TGAA 4Z0KA 1C5SA 1ZMJA 2ZGBH 5EG4A 5ABWA 3A81A 2JH6D 3P8OA 4ZHAA 3KQDA 3SU1A 4VGCC 1EP6A 5ESTE 5A8XA 5DP5A 1AI8H 1BMLA 2AS9A 3DUXH 1FY5A 4H42U 1SLWB 1O2IA 4ISLA 1AZ8A 3GY7A 5A0BA 2ZTZA 1SQAA 2UUJB 3A87A 1GHVH 5A09A 1ZR0A 3ODFA 3QN7A 2BDIA 5IYTA 3C27B 1PPGE 1SI5H 2ZZUH 4NA9H 1QL9A 2BDYA 1O32A 1CA8B 1IHSH 2BDCA 1E34B 2J2UA 4WY3A 3GY3A 1MH0A 4XSKU 2NU2E 5AF9H 3PMJA 2EC9H 1PYTC 1F5LA 2ZFPH 2R2MB 1EAUA 2V3OH 3T29A 2AIPA 1C5NH 1K22H 4CRFA 3O8RA 5E0JA 3S7KB 4J1YA 2JKHA 1LHGH 2ANYA 4X1NU 2V35A 3ATIA 1AIXH 2A4GA 3RXEA 4GHTA 2AGIX 1XM1A 1GVZA 2F9VA 2WUCA 4Y8ZA 1CA0C 3MHWU 4K69A 1AB9C 1HIAA 4NFFA 3RU4E 4A92A 3LH1A 2D8WA 1GL1A 1SPJA 3SJ8A 1QRXA 2C8WB 2Q6FA 3OYPA 4X8UH 2IPHA 3C1KA 2Z9GA 2RG3A 1FY8E 1YGCH 1HXEH 1QCPA 1TOCB 1V2WT 1BTUA 2EI7A 3CP7A 4K1SA 4OS7A 2VU8E 1NTPA 2AH4X 4GLYA 3RXVA 3SGAE 4X1SU 2W5EA 3AASA 3A80A 4DW2U 4K60A 2VIPA 2C4FH 2GCHF 3VXEH 1MZAA 4A6LA 7ESTE 3GCTG 1E35B 1O3AA 2FS9A 3V13A 1XUGA 5EU8A 3EQ0H 1V6DA 1IQHA 3MWIU 1A2CH 1O2XA 5FXLA 3BG4B 2FOFA 5JYIA 2W3IA 3KEEA 3DD2H 1OP8A 2WPMS 1ANBA 1LMWB 1Z6JH 1ZGVA 2H9TH 1SOTA 4BAQB 1JXPA 2BZ6H 3P6ZB 3B23B 1LVOA 2VGCC 2ODPA 2ZU2A 4JZFH 2W7SA 5GCHG 1GHAG 4RN6A 2ZU3A 2OBQA 1GBLA 1DWCH 1TLDA 1FQ3A 4K1TA 2FS8A 1V2JT 3ATWA 1TBQH 1C2GA 3SI3H 1DXPA 3SJ9A 2O8TA 1GJAB 3CENA 4MPXA 2ZO3H 2FWWA 3LGYA 2FLBH 5F8ZA 1P3EA 1AFEH 2WUBA 1B0EA 4E7RG 1LVMA 1TONA 3EGKH 4E7NA 2QY0B 1UK2A 1AKSB 1QJ1B 3RXGA 4NWLA 1WOFA 3UR6A 3LC5A 3TITA 1XX9A 5F03A 1C1QA 2G81E 2CXVA 3PV4A 5HYOA 1C5RA 1SGQE 5SGAE 1XKBC 1C5OH 1AFQC 1WTHD 1YPKH 1WAYB 1A0JA 4K5ZA 4X8VH 1LKBA 2FZZA 1FMGA 4X6NA 2ZTXA 1LQEA 1QA7A 5HMAA 1RD3B 5F8XA 3ENSB 4UFEH 1UMAH 1K9OE 5E0HA 4VGCB 1PPEE 1VITH 4Q2KA 1TALA 1S81A 1A7SA 4WWYA 5FX6A 1RS0A 1P03A 1WQSA 3SU4A 1TNGA 1EJMA 3MMGA 3VGCC 1B5GH 4B2BA 4AGJA 2ZHWH 2ZEBA 1ZJKA 2BDBA 3NCLA 1BBRK 1O2NA 3AAVA 1OWKA 4F4OC 1C1SA 1O2ZA 1Y5AT 1SGFA 2AIQA 3QLPH 1J17T 1N8OB 1Z1IA 1MBMA 1KXDA 1TBRH 4NIXA 3BTGE 4UDWH 1TRYA 4FUGA 5AFYH 1MZDA 2SNWA 4Y7AA 1W2KH 1MU6B 2TPIZ 3UNRA 1P2OA 2C93B 1UTLM 1UO6A 1MBQA 1UJ1A 1Y5UT 4CR9A 1ZOMA 1MTSA 1YPHE 3EDXB 2FOCA 1HUTH 2FDAA 4AFUA 5L2ZH 3PTNA 5C5OA 2ALVA 3AW1A 5FBIA 3SUEA 4DGJA 1VITF 5H4IB 3FZZA 1S6FA 1ARCA 4Y11E 1Y3VA 3EA8A 1FY3A 2W26A 3M7TA 1QJ6B 2P3UB 4MDSA 3H7TA 3LKWA 4YLQH 2OQ5A 1NFUA 2QA9E 2C8XB 1C9TA 1CA0B 2QAAA 1AB9B 2ZHFH 1C1RA 4ISHH 1UCYE 3ZVFA 1FY4A 3A8CA 2FYRA 1P05A 3MI4A 3M3VA 1HAVA 2P59A 4X8SH 1Q3XA 3NUMA 1AUTC 2UUKB 2FLRH 1V2ST 3N7OA 1OWHA 2NU0E 1YPMH 2ZF0H 1QB6A 1BTZA 2OLGA 5L2YH 1GHAF 3IG6B 3W94A 1THSH 3LJJA 3LGVA 1QBNA 1F0TA 1Z6EA 5EXMA 4UONA 4HI3A 3F9FA 3PLBA 1HJ9A 3ZZ3A 1H9LB 1FNIA 2BD7A 4ZHMU 1XUJA 1G37A 1MD8A 2EEKA 1ZJDA 2A7JA 2SNVA 1ZPZA 1C4U2 3QDZB 1H4WA 3U98H 4AG2A 2FODA 5FX5A 3K65B 1SGRE 3M3TA 2R3UA 3RC6A 2UUFB 2JETC 4TY6A 2VGCB 1QBOA 3TK5A 4AOQA 1NT1A 2HPPH 4NSYA 2ZC9H 1HXFH 2VNTA 1ZTKA 5AVDA 1C5YB 4B76A 3UIRA 4O03A 4U2WA 4X2WA 1DSTA 3E90B 1TGSZ 2FOAA 4Y0YE 4CRBA 2HVXA 2KAIB 4MG3A 1TE0A 1GBDA 6ESTA 3GOVB 1NROH 2XBWA 4JK5A 1HFDA 2A0QB 3SQEE 3SNDA 3D23A 4X6PA 3BTEE 1QURH 4XBBA 1O3EA 2BD8A 2O8LA 3U8OH 1J14A 1SGCA 1GHWH 1G9IE 3SV6A 2Y82A 2Z3DA 1H9IE 2FOMB 2P94A 1BTYA 3DHKH 2QCYA 3SUFA 4WXIA 1HJAC 4O3TA 2VIVA 1SVPA 3RMLH 3EAJA 3VB7A 1ANEA 2FO9A 3A8DA 5JBBS 4ISOA 3S9AA 1NO9H 4DT7B 3GDSA 1BTPA 1UTKA 2A4OA 7GCHF 4Q80A 1NC6A 2FIRH 2VIQA 2BDHA 4X0WU 1YP9A 4CRAA 2BD3A 2R0LA 2VH6A 5C1YA 5TCAA 1FONA 1XVMA 1MQ5A 9ESTA 3VGCB 5DKMA 2Q1JA 4NIYA 1ID5H 1CGJE 3QTVH 2Z94A 3T25A 3MO6A 4NWKA 4PROA 4LZ1H 3E6PH 1K2I1 1ELBA 4YT6H 1B0FA 2XXLA 1GI9B 1F0UA 1ELVA 8GCHG 1MUEB 1GL0E 5T6GA 3TJVA 2WPKS 1SL3A 4DOQA 3IWMA 2G52A 1AD8H 3MFJA 1O3PB 2XYAA 1DLEA 1BRBE 2JH0D 5FCKA 3CS0A 4MNXA 3URDA 4IC5A 5FBEA 2GP9B 1ZSLA 4ZUHA 1GJBB 2ZGXH 1HYLA 5HM2A 1TRMA 4NGAH 1TQ0B 2OC1A 3LPRA 4WH8A 2G51A 1V2QT 2BD9A 1ZRBA 1AY6H 4D7GA 3K2UA 1EQ9A 1ZHMA 1OPHB 1C5ZB 1P04A 4IN2A 1V3XA 1SGFG 3EYDA 5C2ZA 1FJSA 1Z8GA 2P16A 1S6HA 4MPWA 3OTJE 1Q2WA 4O9VA 1JBUH 4IGDA 2ZPSA 4B2AA 1P3CA 1E37B 1NPMA 2ZCLP 3SO3A 3I29A 2ZDKA 3QK1A 1GHBF 4WMEA 1C5XB 5C5NA 1DX5M 3GY5A 1O5AB 3A7TA 1AKSA 1F92A 3D49H 4DY7B 1C5LH 1C1MA 3U1JB 2H6MA 1BMNH 1C5VA 1EOLA 1T8LA 2QXHA 2FESH 5TJXA 3RXSA 1AZZA 4XE4A 2Y7ZA 1ELGA 2XTTB 2XBXA 2ZU5A 1NFWA 3PMBB 1L1GA 4X2VA 2JETB 1EJAA 1MAXA 1ANCA 2VWLA 4E06H 5FHTA 4GAWA 2SGFE 4GCHF 1BMAA 2BDGA 4INLA 1GI8B 3O8CA 1DWBH 1MKWK 1P10A 1C1OA 4SGBE 1F0RA 1O3MA 4YOGA 1O3HA 5GXPA 1DOJA 1D3QB 1FY1A 2GDDA 2HLCA 2P93A 1S5SA 2ZI2H 1HRTH 5HM9A 3PLPA 3UWIA 1LHEH 1TNHA 2GV6A 2A31A 1XXFA 3PTBA 2J94A 2ZA5A 3UUZA 1C2DA 1P8VC 4CR5A 3P8FA 2A7HA 1QB9A 1O39A 1ELTA 1HV7A 5BPEA 3RXRA 1GI5A 1KXCA 3BG4C 3BTME 2J34A 3Q3KA 1H1BA 1HJAB 2GTBA 8GCHF 1ABIH 2STAE 3VB5A 1UK4A 2Z9KA 5LPEA 4UE7H 3ZVBA 1ESTA 1KY9A 3UWJH 2CV3A 1O0DH 1O2SA 2C8ZB 3KQCA 4D9QA 2Z6BD 1HPGA 5T6FA 3PB1E 2FMJA 5EXNA 2OC0A 1OYQA 4U30A 2A2QH 1GJ8B 4I32A 4UFDH 2CHAC 3M5OA 1DY9A 4FUDA 4MQAA 1ELAA 2HNTE 3FP8E 1J15A 1THRH 3PMAB 1O2YA 1DWEH 2ZECA 1SHHB 4IS5A 2ZQ1A 4THNH 3S69A 2TBSA 3RUOA 1BHXB 1W7XH 1G36A 1V2UT 5K7RA 4ZKRU 3FVFB 1T8OA 2ZDLA 2FPZA 3L3TA 1F0SA 1ORFA 1GMHG 4Q7YA 1VJ9U 3MTYA 1IQFA 4CH8B 4D8NA 4BANB 1CT4E 1GI1A 3M7QA 3BTQE 4GHQA 2IJOB 1TGCA 1JIMA 4ABEA 1THPB 3VFEA 2BY8X 1GMDG 3KN2A 1O35A 3S7HB 3QWCH 3S0NA 2TIOA 4AB9A 1H8DH 2C8YB 4K3JA 4I8KA 1MKXH 1A4WH 5FCRA 1IQMA 2ULLA 2WPJS 1G2LA 2QXGA 4GSOA 1PJPA 3MNBA 2ZFQH 4CRDA 2YNBA 4YZUA 1ZSKA 3VXFH 1OX1A 3ESTA 1O3GA 3JZ1B 1O2MA 1ETSH 4QT8C 1DXWA 1TIOA 2H5DA 3OY5U 1O5DH 3A84A 1TX6A 1FN6A 1NRRH 3E91A 1N8OC 3A88A 3B9FH 4BTUB 2PSXA 2KAIA 3A8AA 3PLKA 2WPLS 2J92A 2P3TB 3VEQB 1TMBH 3GY4A 4XDEA 4ABHA 1FI8A 4K8YA 1BBRH 3H5CB 4IMQA 3SU0A 1UHBB 3BIUH 4Y79A 1GBKA 1UTJA 4ABAA 1GMCG 1KIGH 3S9BA 1S85A 3ZVCA 2ZGJA 2P3FH 4RKJB 1FUJA 2OCVB 1V2OT 4Q7XA 2FI5E 2BVXH 2PKSC 4Y71A 3FANA 2Y6TA 1C1VH 1PPFE 3UQVA 1UVPA 3RXBA 1NRNH 4NIWA 4TWWA 1C5WB 1RTFB 2ZQ2A 4Y8YA 5HXFA 3GYMA 1O2TA 2XBYA 1GHZA 8ESTE 5JB9S 4H6SB 3P92A 3MU4A 3DFLA 1SFQB 3RXUA 1OKXA 1PFXC 1GBCA 3BTDE 3QUMP 1ZYOA 3AAUA 2ASUB 3TJNA 3U8TH 1TNJA 2A5AA 1O3LA 1TPAE 1AMHA 1EUFA 2HNTF 1VCPA 2BOKA 3TGJE 5DP7A 4M7GA 4MNVA 1P2MA 1C2JA 2QC2A 1TNLA 4JYUH 1CO7E 2H5CA 3LGTA 3SGQE 1F7ZA 5I25A 5ESBA 2VINA 2ZCHP 4X1PU 4DCDA 2CMYA 2DUCA 3UY9A 4BTTB 4I33A 1C2IA 1G3EA 3SOSA 1GI3A 4B2CA 2A4RA 3RXDA 5DP3A 4AG1A 1TMUH 4ABGA 1M9UA 3RXFA 2GMTC 2J95A 1O2JA 1YCPH 2XC5A 1LPZB 3A85A 2FOBA 2ODQA 1FN8A 1Z8IB 1CQQA 3O8DA 4UEHH 1KLIH 3ODDA 2F3CE 2AEIH 2ZNKH 2GCTC 1GMDF 1O36A 1DUAA 1GI2A 1QL8A 1XUFA 1YPGH 2CHAB 4ABBA 1ZTLA 1NU9A 3NK8A 1BJVA 3ZVAA 1A0HB 1J16A 1IAUA 1ARBA 3I77A 4WMDA 3LU9B 1KXBA 1KXEA 2ZU1A 4HZHA 3PYHA 1UVSH 2PW8H 1LHFH 4I8GA 4CRGA 5IDKA 2BB4A 3SZNA 1TMTH 2XW9A 5E8EH 4D9RA 2I6QA 1BUIA 1YYY1 1T8NA 3SU2A 1QY6A 2Z3CA 3A89A 1EZSC 1Y59T 2FYQA 2FEQH 1W3CA 2VH0A 1TAWA 3SQHE 1O5EH 4MTBA 1AWFH 3A7XA 4U32A 2V3HH 3F9GA 3BN9A 1QNJA 1XUKA 2ZDMA 3LGUA 1VZQH 3SNAA 3RXJA 5F6MA 2F91A 2QYIA 4MLFB 4LZ4B 1OYTH 9LPRA 7KMEH 4LOYH 1P2QA 1Y3WA 8LPRA 1E36B 3URCA 1V2PT 4RKOB 2PR3A 2GKVE 1O3DA 1P2KA 2YOLA 2J9NA 3PM3A 1O2RA 1HAZB 1W0YH 1SFIA 2R2WU 3GY8A 3HATH 3TNSA 1ELCA 3NWUA 1LDTT 4ZKOU 1GI7B 3RDZA 1A3EH 2SGPE 1DS2E 1LO6A 3T27A 4DG4A 3UFAA 1VGCC 3LGIA 1RJXB 2J4IA 4YO9A 3KQEA 4A1XA 2A4QA 1C5PA 4TWYA 4MNWA 1OWDA 3GICB 2XCFA 2XNIA 1N6YA