1O3OA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3oA02
3EYDA 4ABEA 1QIXB 3RU4D 2A0QB 2XC4A 5C1YA 4D9RA 3A8BA 1ZTKA 1ZHPA 3DA9B 1C1VH 3KN2A 1F5KU 2J4IA 2P3UB 1GVZA 5LH8A 5A0AE 4GHTA 4FVBA 3NCLA 1CGJE 2W26A 5FXLA 1RTLA 5L2YH 1PQAA 1DXWA 1Z1IA 2R2WU 5B6OA 1IQKA 1W8BH 2G4UA 1IHSH 3V0XA 2FYRA 2PKAA 2EA3A 2OC1A 5F8ZA 1P02A 4WXVA 1GI7B 2FXRA 1AHTH 5CE1A 3FFGA 4XFQA 4X1PU 1CT0E 1EAXA 3N7OA 1BTYA 1HAGE 3GYLB 2TGAA 4ZROA 4OS6A 3EAJA 1DSTA 2XWBI 2WYJA 3TPIZ 3SU1A 5HGGA 3SUDA 5EOKA 3LGIA 3VGCB 2H5CA 4NA8A 4AGJA 1RS0A 1GJBB 2FLRH 4FUEA 1BTZA 1IQHA 2VNTA 3R0FA 1PJPA 1C2JA 2H9HA 1IHTH 1GI9B 2ZA5A 9ESTA 2GCTB 4SGBE 1O35A 2C93B 4U32A 3U69H 2GGVB 4BTTB 1TPAE 3L3TA 5C1XA 1BHXF 2P93A 3DFJA 4HTCH 1O3OA 1TRNA 2FOBA 2OQ5A 2QF0A 3SORA 3BIVH 3D23A 5C67A 1O37A 2AFQB 1GVLA 4WF8A 2F9UA 3ATIA 5T6FA 3ATLA 1UK2A 3K6ZA 3FP6E 1IQMA 3T25A 4A1TA 1C2GA 5G4BA 4A7IB 1UTMA 1AO5A 5HMAA 2QA9E 4TY7A 1QBVH 4Q2KA 2DE9A 3SGQE 1O2OA 3VEQB 1KXAA 2JETB 1ORFA 1WYKA 3MO9A 3OY5U 4A6LA 5DK1A 1CGHA 1GG6C 3S9AA 1BBRH 1O5BB 2ZFRH 2NU1E 1O2XA 5JBAS 2BB4A 4UE7H 3RXUA 1G30B 1CBWC 2FOHA 1WCZA 6CHAB 1A46H 1MZDA 2J34A 6LPRA 3F1SB 3DFLA 4KP0A 4DY7B 1HAPH 1S6HA 1IAUA 2G00A 3P6ZB 4AORA 1OX1A 3T29A 3LGUA 3ZYDA 2RDLA 3TH2H 2HNTF 2QXJA 3LPRA 8GCHG 2VWNA 3NUMA 1EJMA 1ELEE 4ZHAA 5K7RA 2A4GA 3SV6A 3ELAH 1FAKH 4NFEA 1WSSH 1C1MA 2BYAX 2VIOA 4X6PA 1IQIA 3VXFH 3LH3A 1NRQH 1NM6A 1QJ7B 2HGTH 1O5DH 3RMLH 2H5DA 1P57B 1L1NA 2ZDMA 2A2QH 1LPKB 3Q3KA 1TPOA 2EI8A 3QX5H 1NT1A 4THNH 4WWYA 2A7CA 4BAKB 3W94A 3H7OA 1XKBC 1C1WH 1C4U2 1JXPA 1DX5M 2FP7B 2GZ7A 1L1JA 4ZH8A 1SMFE 2Z3EA 4MNXA 1S82A 1Y3YA 2PSXA 3PV4A 4U30A 5DP3A 3RM0H 5EGMA 1BMAA 1NRRH 1BT7A 1K2I1 1J17T 3P17H 4MVNA 5FCRA 1C2FA 1H8DH 4CBOA 2JH6D 4R0IA 3BTGE 3U1JB 3GCTF 1UO6A 1LHDH 1N8OC 3Q3XA 5DO4H 1FONA 4MPXA 5C5OA 3STIA 4CH2B 5K0HA 2G4TA 1O5FH 4MPVA 1A0JA 1C5XB 3K9XB 3PWBA 2R9PA 1S0RA 3T26A 2F9PA 1S5SA 1Q3XA 3TJOA 4NSYA 1TNLA 1SSXA 1SI5H 5BPEA 2BTCE 5E8EH 1VITG 1GCTB 2STAE 1EOJA 1BA8B 3UQVA 3MH7A 1BUIA 1NN6A 2C3SA 1Q31A 4K1TA 1MTNC 1MAXA 2STBE 1FY3A 1L4DA 1P11E 2PUXB 1C2EA 1MUEB 1LVBA 1Y3XA 2BLWA 1TPPA 3O8BA 4WMEA 1GMCF 5C20A 2SGQE 1FN8A 1AE5A 2ZTXA 5CHAC 1MCTA 3P8NA 3PMBB 2BDBA 3BN9A 3UUZA 2ZFSA 4X0WU 3SJIA 4OS1A 1GBFA 1D3TB 3A7XA 2ZGJA 3LT3A 1PPHE 1QY6A 1OYTH 1WTGH 1L4ZA 2Y5HA 1HAIH 1NPMA 1BHXB 1THPB 2KAIB 1DS2E 3JZ2B 1D4PB 1SGYE 1GBTA 3MU0A 4GHQA 1BRCE 3HGNA 1W7XH 1GPZA 1C5WB 5T6GA 1AZ8A 1AKSA 1ESTA 1H8IH 4O9VA 1WBGB 2A31A 1MU6B 1NZQH 1K1NA 2ZFFH 3ZVBA 2OP9A 3BTQE 2GMTB 1ZMNA 3P70B 4MNWA 1ELTA 2C90B 1TNJA 1GHWH 2XBWA 2O8MA 2BQWB 1OXGA 2O8UA 2PR3A 4NFFA 4ZKNU 2PLXA 4JYTA 1XUHA 1FMGA 1EAIA 2GP9B 1AGJA 1GI0A 1EASA 1ZRBA 3KQBA 2P94A 1OPHB 2ZDNA 4D76A 1PPBH 4WJG2 4LK4A 2HNTE 4GUXA 1P09A 2OLGA 2HLCA 5TCAA 2PWXA 3T62A 3KQEA 4Y7BA 2O9QA 5JDUB 2VIPA 4UDWH 2WPHS 1GDUA 3V13A 1JIMA 1FY1A 3SV8A 6GCHG 2PHBA 1BMNH 1TIOA 4I8LA 4M7GA 2Z9IA 2Z7FE 2Q6FA 2ZWLH 4O3TA 1FZZA 1FI8A 3GY8A 1V2TT 1E34B 2VH6A 3UTUH 3SJOA 2ZU1A 3ATWA 3NWUA 3QN7A 1C4V2 1DITH 3RXIA 3RLYH 4CRCA 1O2VA 3M7QA 1SGQE 2ZPRA 1P05A 2A45B 1HFDA 3A7TA 5GCHF 4Q7XA 2RA3A 3S69A 4JZEH 1O31A 1TBZH 1FIZA 2ZCLP 5CHAB 3SNEA 3URCA 3KHVA 1GBAA 1T8NA 1EJAA 1UVSH 2VGCB 1KLIH 3R3GB 2GTBA 2WPKS 1K28D 3D49H 1S81A 1XX9A 1MTNB 3SV9A 1O3PB 5A8ZA 2OQUA 1IQGA 4AFZA 4E7NA 2IPHA 1ZRKA 1GMHF 1MD8A 1C4Y2 1KXBA 1Z8JB 2QXGA 4BOHA 3U8OH 1CQQA 3F9GA 4J2YB 4UFGH 2H9TH 2ZDAH 2PW8H 1WQVH 4LZ4B 8KME2 3CENA 4XBCA 5E0GA 1VJAU 2BY6X 5EXLA 1MKXK 1FUJA 1F0TA 4NWLA 2ANMH 4ZUHA 4Q7YA 2Z9LA 4B75A 1GBKA 1SBWA 1MAYA 1SGFG 4BTUB 2SGFE 1MKWK 4KELA 1GWAA 1O3BA 1BRBE 1QR3E 1BMLA 4BANB 1SLXB 2H6MA 1ZHRA 5EPYA 3S0NA 4FUDA 2BD7A 2Z3DA 1GBHA 3A89A 1WU1A 5J4SA 1SFIA 1P2KA 1SFQB 2D26C 1GMHG 4YLQH 4ZXXH 1C5NH 4UEHH 3SU4A 5C5NA 1W2KH 4YZUA 3ZV9A 4ZKRU 4IN2A 1SOZA 3W95A 3BTTE 1IQLA 1SGEE 7LPRA 4CRAA 2OUAA 3MU4A 5DPAA 1O34A 1W7GH 3ZV8A 4AB9A 2GZ8A 2ALPA 1W0YH 4LZ1H 1BTUA 2ZTZA 1LKBA 2J94A 3GY2A 1C2IA 1GHBG 1QB1A 4ZXYH 2HVXA 4ZHLU 1IQEA 3DT0H 4MTBA 1ELCA 1BB0B 3AW0A 1AIXH 2ANYA 3ESTA 3ZZCA 5A8XA 1ZPCA 4OS5A 3JZ1B 3FAOA 3RXOA 1OWJA 4ABJA 1VGCC 1QA7A 4X8UH 4Y0YE 2CF9H 1S83A 1Y5BT 3SI4H 1DY8A 3B9FH 1MBMA 5GWZA 2GV7A 7KMEH 1YCPM 1GHVH 3O8RA 1BQYA 1O3MA 1AFQB 1OWDA 1A1RA 1RTKA 1WQSA 2NU0E 2BD2A 1HAXB 2Y82A 5EXNA 2Y7XA 1LQEA 1KDQB 2V35A 5DJ7A 2G5NA 2HOBA 2I6QA 3K65B 1YCPH 2QV1A 3IWMA 3MHWU 2VVUA 3GCOA 4AX9H 4Y8XA 1T7CA 1LQDB 1DWBH 2FZZA 3I29A 3SQHE 2GZ9A 1PQ7A 2XWAA 4D9QA 2TIOA 1UCYE 4Y10E 5EW1H 1PFXC 3L6PA 3UIRA 1Z8RA 3BTEE 1O36A 1J14A 4K60A 3A86A 4NIVA 3ZZ4A 5F6MA 1XMNB 1O30A 2W3IA 2PKSB 1GJ9B 2P3TB 1ELVA 5EPNA 3M3VA 1X7AC 2BVSH 1TNIA 2NWNA 4DOQA 2ZC9H 1KLTA 1NFUA 1RIWC 2WPMS 1GL1A 1A3EH 1YPEH 1BITA 4HZHA 1V2RT 4I7YH 1Q2WA 1GI3A 2BVXH 4NCYA 1UVUH 2AMQA 4FUCA 1WTHD 3LH1A 3LJOA 1MTVA 2GDEH 1TA6A 3MO6A 1TX7A 5F8XA 2PTCE 3SHCH 2J9NA 1QL7A 3E6PH 5A09A 5EODA 5HXFA 3F6UH 2ZHDA 4FUJA 1PPCE 5C2ZA 2GT8A 3FZDA 4VGCC 2GCHG 2ZHQH 1UTJA 2ZDLA 2WUBA 1ZMLA 2AH4X 2BZAA 2FX4A 4KGAA 3VGCC 1O2YA 1T8OA 3FP7E 3RXTA 4MG3A 3A8DA 1K22H 1TALA 1RGQA 2CN0H 5TCCA 3EA7A 2OINA 4QT8C 3UNSA 1G32B 1TRYA 4TPYA 1D6RA 3VB5A 2ZO3H 3ZZ7A 5FHTA 3U8RH 1G37A 3A80A 2R2MB 2PGQB 4ABGA 1W12U 1E38B 4IS5A 4FUGA 1HAYB 4X8SH 5DP6A 1T31A 3CP7A 4XBBA 2BDYA 4CHAC 3F9EA 1ETRH 1N6YA 2V3OH 2XCNA 1ESBA 1S0QA 4FU9A 5EG4A 1QRXA 3ZVFA 1TBRH 3F9HA 5GIBA 3VB3A 1UTLM 3RXGA 1QQ4A 2W7UA 1TWXB 2QGRA 2G55A 1IQJA 5EU8A 2TGPZ 2GCHF 5AHGH 3M3SA 3FVFB 1ZYOA 1QJ6B 5DP7A 1AFQC 1BIOA 2XCFA 3KQCA 1SQAA 2WINI 5JBTA 2LPRA 3VPKA 4BNRA 1BTHH 1XVOA 1C2MA 3QO6A 2ZHFH 4Q7ZA 1YPHE 3AVZA 3DUXH 1XKAC 4BAQB 4OGXA 1O3DA 1AVXA 1YPKH 1NFWA 1O5EH 2W3KA 4CRGA 4B76A 2ZECA 4FVDA 3PMJA 4XE4A 1SGIB 1F92A 2BDHA 1O3KA 3L33A 1BRAA 3RXQA 1RD3B 3MTYA 3PTBA 1NC6A 2VU8E 3GY3A 1EPTC 1D6WA 1QRZA 1P3EA 2A4QA 3SUEA 3LDXH 3K6YA 1TMUH 2XC0A 1P9UA 2ZHEH 4BAHB 1FPCH 1C2LA 4I8GA 1AU8A 4NZQA 4TWWA 5PTPA 1SG8B 3SJ9A 1QQUA 2AGIX 3H7TA 1C1NA 1SGTA 3SNAA 1PQ8A 2BX4A 2B9LA 1GCDA 4Y11E 4RKOB 4TWYA 1YBWA 2ZGCA 3A8AA 1SVPA 2UWLA 2BQ7B 1OWKA 4CHAB 3RXCA 1O39A 3SGAE 1WUNH 2C8YB 1C5TA 1G36A 2BDGA 1UTOA 3V3MA 3MNCA 5GJ4B 4HFPB 4D7GA 3GY6A 2HPQH 4Y8ZA 4YESB 2ALVA 2FM2A 4I8HA 1H9IE 2HNTC 1O3EA 2A1DB 1QRWA 1H9HE 4YLUA 2ZTYA 1C1SA 1MD7A 4Z0KA 1ETSH 3ZVCA 1FNIA 1YCPK 1KSNA 1C5ZB 3AAUA 1QA0A 1GHBF 1NFYA 1AMHA 4K3JA 7GCHF 3ENSB 2ZDVH 4I32A 2G52A 3SOSA 2ZU5A 2ZCHP 2RG3A 1V2OT 2FOCA 1QBOA 2Z94A 2SGDE 1MTSA 1A7SA 1HDTH 1MTUA 2A5KA 2CJIA 3BSQA 3ZVEA 1QNJA 1N8OB 2OCVB 3P8FA 1C5RA 1P2QA 4YT7H 2FMJA 3SUFA 1ZTLA 1ABIH 3PM3A 3SI3H 3BV9B 3E3TA 4F49A 1LHGH 4H4FA 4FUIA 1OP0A 1BJVA 4ESTE 1GHZA 3KEEA 5FPTA 1TMTH 1D3DB 3NPSA 4NIXA 1FLEE 2BD8A 5IDKA 2ODQA 2W5EA 4A92A 1BBRE 1GI6A 3GDVA 1FXYA 1TGCA 1CGIE 3MH6A 4MNVA 2QXIA 2EI6A 1LVOA 1AWFH 3RXEA 1T4VH 1DXPA 1G3EA 3E16B 1VITH 1WV7H 1BTWA 1O3AA 1SQOA 3SQEE 4K8BA 1OWHA 3UR6A 4UFDH 2K1QA 4XSKU 1BRUP 3LGTA 3GOVB 4CR9A 1HIAB 1O2PA 1O3IA 3LGWA 4JZDH 2ZFPH 5LGOA 1C5MD 3RUOA 4MNYA 2GMTC 2GD4B 2P59A 3GDSA 1JMOH 1YPJH 1B0FA 2ZU2A 3U98H 2XYAA 1C1PA 3FP8E 2BXUH 1N1LA 1O32A 2DE8A 2ZHWH 1W13U 3KF2A 1TYNA 3ZZAA 3B23B 3BTHE 1GJ7B 1V2WT 3E8LA 1LPZB 4ABBA 3BTDE 1CE5A 5JPMH 1C9PA 2TRMA 2XRCA 4X6NA 1FJSA 1QHRB 2Y81A 4X1NU 1Y3UA 1BTXA 2BY9X 3URDA 3MFJA 1INCA 2DUCA 3KNXA 2IOTA 1LPGB 1RTFB 3KQDA 3ATKA 1Z71A 5E2PA 1O2ZA 5DP4A 1O3GA 1V2KT 2CHAB 5EQRA 4B74A 1BOQA 4CH8B 5ABWA 1OYQA 3ZZ3A 1GBMA 1FN6A 1EOLA 3UQOA 6GCHF 1PPGE 1VCPA 1ZSKA 2AIPA 5E2OA 3TH3H 4X8VH 1GDNA 1CHOF 2ANWA 1MMJN 2SGPE 2OTVA 3GICB 1O2LA 2XBXA 2BX3A 1JWTA 2LNCA 1SB1H 1GGDB 2TBSA 1ZSJA 1BZXE 1EAWA 1O2HA 1NU7B 5DGJA 2ZZUH 1W10U 1K1MA 1KLJH 1PPEE 4X2YA 4ZHMU 3UNRA 1QJ1B 2D8WA 1ETTH 3ZZBA 1L0ZA 1NRSH 1ZSLA 5EXMA 3SV7A 2OD3B 1GHXH 7ESTE 3MOCA 2ZU3A 3UWIA 1CO7E 3IITA 2C8XB 4JMYA 4DG4A 4NA9H 3RDZA 4AGKA 2NU2E 1UHBB 2FOEA 2XNIA 3RM2H 3SW2B 4HGCA 2FESH 1B5GH 1EZUC 2KAIA 4E7RG 3A84A 1LKAA 1AWHB 1ZTJA 1IQFA 1ZHMA 1C5YB 5FBEA 1E35B 3SUGA 1TX6A 1O3NA 3ZZ9A 5SGAE 2SGAA 4DGJA 2GX4A 3QUMP 2Z9KA 4KKDA 1SOTA 5H4IB 1C1TA 1CU1A 1LDTT 2CMYA 4YT6H 3P8OA 2OBQA 2C8ZB 2FWWA 3HATH 4WMFA 4DVAU 1P03A 2CHAC 5C3NA 1UJ1A 1EATA 1XM1A 3T5FH 1ZR0A 1EX3A 2FX6A 1GCTC 1LVMA 1KXEA 4HI3A 2Y5GA 4CREA 4Y79A 3C1KA 4JK6A 5L2ZH 1H9LB 2O8TA 2UUYA 1ANEA 3I78A 4K1EA 2BDIA 1V2MT 1O2NA 1LVYA 5J4QA 4CRBA 5T6DA 1VR1H 3MH5A 2R3YA 3PLKA 1GMCG 2J2UA 1ZPBA 2HPPH 1D3QB 1P2OA 1OP8A 1O2MA 1SHYA 3G01A 4NA7A 5E0JA 3T2NA 1TGNA 1GBCA 1UMAH 4ISHH 2FS8A 4RSPA 1EP6A 2BD3A 3U1IB 1TE0A 4ABIA 1A5HA 1O3JA 1PQ5A 1C5QA 4NG9H 2FO9A 2ZDKA 1UCYK 1M9UA 2P8OB 3A7ZA 2Z9JA 2FOGA 1EJNA 6CHAC 1CA0B 1EAUA 1QL9A 4JYUH 1Y8TA 1P10A 1Y5UT 2BHGA 4KTCA 1V2LT 1VCWA 1YYY1 2RA0A 1TABE 2F9BH 2Q1JA 5GPIB 4DIIH 3LJJA 2G51A 3MYWA 3HK6B 1KYNA 3GY4A 2QYIA 2GV6A 1YM0A 3BTME 1Y59T 1GJ5H 3HKIB 4WXIA 1YGCH 3TK9A 1QURH 4GLYA 1PPZA 3PLPA 1AVGH 2PKAB 3PTNA 3GCTG 1QB6A 4IC6A 3O8DA 1UTNA 1L2EA 5A2MH 1FY4A 1G3DA 1Z1JA 1TOMH 2ASUB 2FI4E 2BLQA 2WV4A 1TONA 1N6XA 5FCKA 1J8AA 4O03A 4NGAH 1Y5AT 1HJ8A 1YPGH 4X1SU 2J95A 4Y7AA 3EQ0H 1EZXC 3P95A 3QTVH 3F9FA 1TBQH 5A8YA 3ZZ8A 2VIVA 1C1UH 3MNXA 4NIYA 1A2CH 1FDPA 1TOCB 4INHA 1AUTC 4MPUA 1ELGA 1JRTA 3GY7A 2GCTC 2Q6GA 1C2KA 3NZIA 4A5TS 1QFKH 3M7TA 3MI4A 1L1GA 3S7HB 2FLBH 1HAOH 3HKJB 1OKXA 1GBBA 3GCNA 4D8NA 1DVAH 4FXGH 2R0KA 4K2YA 1TX8A 2BMGB 1HRTH 4Y6DA 3ATMA 4E05H 3MWIU 1HCGA 2VH0A 2XW9A 3D62A 1YPHC 5GDSH 1CT2E 4D7FA 3O8CA 1SLVB 1O0DH 2D1JA 8GCHF 3TJUA 1O2GH 1SGNE 2UWPA 4O97A 4ABDA 2VGCC 2M5TA 1S6FA 4Y71A 4NSVA 1P3CA 4YTAA 3MNBA 1HAVB 2F9NA 1P12E 4VGCB 3RXLA 3E0PB 1U6QA 1HAVA 1UVPA 1AZZA 1ANBA 2Y6TA 4A1VA 4INLA 3RC4A 3DHKH 3QWCH 3OY6U 3PMAB 3TNTA 1A3BH 3OU0A 3TH4H 5AVDA 4O3UA 1P06A 3AAVA 4ISNA 2VIWA 1SC8U 5HYOA 2A7HA 4IC5A 1JIRA 2ULLA 1BCUH 1G9IE 2B0FA 1PPFE 4ASHA 1DWEH 3UREA 2I6SA 2ZEBA 1W3CA 3OYPA 3U8TH 2C4FH 2GDDA 5EW2H 1W11U 4YO9A 3TLOA 3BTFE 1THRH 2V3HH 5FX6A 1J16A 3PO1C 1HXFH 3TK6A 4CBNA 2XTTB 1O3HA 4UONA 1V2VT 3S9CA 1FV9A 3QZRA 2BOKA 1OP2A 1YLDA 5TJXA 2OBOA 2B7DH 1HAZB 4DIHH 4ISOA 2AMPA 3LGVA 1HYLA 2WV5A 3A87A 3HPTB 2ZNKH 1HJAC 4Q80A 4SGAE 3UY9A 3RXBA 1TPSA 4J1YA 2V0BA 5DP8A 3AASA 1VCQA 1B7XB 5GXPA 1ACBE 1HJ9A 1A5GH 3NK8A 1TGTA 2QAAA 3GCHC 1IQNA 3RU4T 1DANH 1Z8GA 3SJKA 1O3LA 4DT7B 1V6DA 4GCHG 1K1PA 1YKTA 1KY9A 1YC0A 3QK1A 3MNSA 5I46H 1HIAA 1UCYH 3SN8A 1DUAA 1AVWA 2ZU4A 2FODA 3DD2H 5L6NH 3M61U 5JYIA 5ESTE 3SO3A 4JYVH 1V3XA 2ZFQH 2ODPA 3RC5A 1GJCB 3M35A 1QL8A 1AY6H 1EQ9A 1HXEH 4WVPE 1AB9C 1QBNA 3TVJB 1ID5H 2VIQA 4X2VA 1DFPA 1ELAA 2FOAA 1GVKB 4I8JA 5FBIA 2A5AA 1EXFA 2FI3E 1GJ6A 6ESTA 2H9EH 1JOUB 1TNGA 3UR9A 4AFSA 1E36B 1NRNH 2B8OH 4RKJB 1SLWB 4WY3A 5DP9A 4TYDA 1GBLA 4IGDA 5ESBA 1E37B 1YPLH 2EI7A 4X2WA 3RXMA 1HV7A 3WY8A 1T4UH 3BG8A 4Y8YA 1TFXA 4BAOB 2YNAA 1O2IA 2A4OA 5FPYA 1V2QT 4AOQA 2ZPQA 1H1BA 1YLCA 5GCHG 4FUFA 2AMDA 2ZGHA 3SU3A 2BD9A 4ZMAH 1ZMJA 1D9IA 4NZLA 3UOUA 1V2ST 1GI5A 2OXSA 4FUHA 4OS7A 3PB1E 4TPIZ 1CHOG 2YNBA 2BZ6H 1EPTA 1DPOA 1O2UA 1ELFA 3RU4E 1BBRK 3QLPH 3LKWA 1KTTB 4INKA 4X1QU 2VVVA 3KIDU 1GL0E 3ZVAA 3MMGA 4XOJA 2RCEA 1NY22 3MU5A 2BD5A 1DSUA 3A7VA 3AW1A 1C5UA 2FI5E 4FUBA 1GJDB 1G3CA 3M5NA 1ZJDA 3SJ8A 2IJOB 4JZFH 4Z6AH 1WAYB 4I31A 1UHBA 1RRKA 1P01A 1ZZZA 5DG6A 3GYMA 4WMDA 1P2JA 1F0RA 1TB6H 4B2AA 3EDXB 4K1SA 1Z6JH 1P8VC 3FANA 1HLTH 1MZAA 4MDSA 1ZLRA 5FX5A 4B73A 1VJ9U 3HK3B 4B1TA 1C1OA 3PLBA 4X6OA 4E06H 1HBTH 4I8KA 1DY9A 3P8GA 1CHGA 3F68H 1HGTH 1DWCH 1DT2A 1QGFA 4GCHF 3A83A 1F5RA 3MO3A 1PYTD 3M36A 4AZ2B 2HWLB 2FDAA 1DLEA 1F5LA 3BTKE 3ZZ5A 1MBQA 2PTNA 4IMQA 2H1UA 1ZOMA 1HJAB 1GG6B 4NIWA 1MU8B 4R8TB 1SGCA 1FY8E 3E90B 3SU0A 1CT4E 1TGSZ 1AQ7A 3FZZA 3ZVDA 3KGPA 4H6SB 1C1RA 8ESTE 3STJA 3LU9B 1ABJH 3A81A 1FPHH 5T3HA 3T28A 1C5VA 3Q00A 1ZGVA 4KTSA 2PSYA 3TITA 3M5MA 1GJAB 1QTFA 2AERH 3RXDA 1XUJA 2ILNA 1O2JA 2QF3A 1CA8B 3NXPA 2ZI2H 1T8MA 9LPRA 2A5IA 1K1LA 3TNSA 2CXVA 4OGYA 2A2XH 1EKBB 1FY5A 1P0SH 3UWJH 3SU2A 4XDEA 3QZQA 1O38A 1ZPZA 1OS8A 1YPMH 1GMDG 1TQ0B 1LTOA 3GCHB 3M37A 1O2TA 1XXDA 3MH4A 7GCHG 3A7WA 1Z7KA 4UFFH 1ANDA 2SFAA 1K9OE 5F03A 4Y76A 1C5OH 3BEIB 1O5GH 2TGTA 2W7SA 1CSOE 1LO6A 2PFEA 2ZQ1A 3V12A 1SL3A 2D2DA 3NKKA 1C5LH 3RP2A 4CRDA 1DOJA 2THFB 2F3CE 1T32A 1ELDE 2BVRH 2J92A 1BDAA 2AGEX 2ZIQH 1ZJKA 2TGDA 2SNWA 2ZKSA 4JZ1A 1DUEA 3RMOH 1TRMA 4GSOA 2ESTE 3M5OA 1SQTA 3RMNH 2QCYA 1AFEH 1GGDC 2CF8H 1NRPH 2A7JA 1IOEA 1ANCA 4I33A 1D3PB 1EB1H 1NS3A 4AFQA 1KXDA 2Z9GA 1EUFA 1E0FD 3MU1A 1B0EA 4CRFA 1MQ5A 1SGDE 4UD9H 3RC6A 2WYGA 1HAHH 1LHEH 2FTMA 2Z3CA 1AN1E 1C2DA 1KXFA 5FAHA 2WPIS 3OTJE 1F2SE 3A88A 5FPSA 4X8TH 2OC8A 4B71A 3Q76A 3A85A 1BMMH 3A82A 4RN6A 4BAMB 1O3CA 2BY5X 2P8OC 2Z6BD 2GKVE 1P2MA 2GVFA 4ABAA 1KDQA 1S85A 1VGCB 1GJ8B 4MLFB 2EEKA 2F9OA 3SU5A 4DW2U 2WUCA 3RXRA 2AGGX 1HB0B 1RIWB 1O5CB 1FAXA 1YP9A 2UUKB 3UPEA 1NO9H 4GAWA 2XC5A 3TJVA 4LOYH 1SGPE 3RXKA 1C5SA 1GHAG 2PUQH 1GJ4H 1VITF 1K1JA 3QGJA 2F9VA 1DWDH 5JB9S 1KXCA 2GT7A 1ELBA 2QXHA 3RXVA 2VINA 5JB8S 3GISB 3V7TA 2BQ6B 3BG4B 4Y0ZE 5DP5A 4ISLA 5CMXH 1A4WH 2FYQA 4YOJA 1EZQA 4X6MA 1O2KA 1RFNA 1LMWB 1SPJA 1TGBA 4FU7A 1QCPA 3QTOH 3D65E 1AB9B 2IN2A 3EA9A 1FIWA 2XXLA 2NU3E 2CGAA 4X2XA 1GI1A 1XUFA 1CA0C 5A0BA 2SNVA 1OSSA 3S9BA 4UFEH 3SHAH 3SBKA 1GI8B 1G2LA 1F7ZA 4IN1A 4WH6A 1HPGA 1SHHB 2Y7ZA 3OSYA 3PWCA 1VZQH 2A32A 2VWLA 3QDZB 1NESE 3E0NB 4FU8A 4YOIA 1KTSB 3U9AH 3KCGH 2R0LA 1O33A 4F4OC 4MQAA 4DURA 3RMMH 3BF6H 4NWKA 3M3TA 5AFZH 1GHAF 1TAWA 3PYHA 1EPTB 2ODYB 3K2UA 3T27A 2F91A 3SU6A 3SV2H 3VFEA 2R3UA 5JBBS 1MQ6A 1Z8IB 3C27B 4K69A 2AIQA 2QIQA 1DICA 5E0HA 4TY6A 1P9SA 2JH5D 3RXAA 3M7UA 1NROH 1HUTH 1MKWH 2JETC 2OC7A 3PMHB 4AYVB 3M5LA 1YF4A 3PO1B 2ZCKP 4OS4A 3TK5A 2TPIZ 3ZYEA 1GBDA 1XXFA 1GI2A 1K21H 5LPRA 1BJUA 1OOKB 5HM2A 4ZKSU 1DM4B 1ESAA 4H6TA 5ETXA 2BY8X 2FOFA 2Y80A 4AN7A 2BLVA 4K5ZA 4MPWA 3SNCA 3SNBA 4YOGA 4BTIB 3ODFA 1J15A 4WH8A 1LHFH 3EA8A 2NU4E 3MU8A 2JH0D 5EQQA 2UUFB 5BRRE 4AYYB 2BLOA 1V2NT 3LIWA 1LCYA 1W0ZU 4KTUA 4PROA 3S7KB 1GBJA 1UVOA 4ABHA 1Z6EA 1PYTC 2ZGBH 1UVTH 3ZZ6A 2VWMA 1FQ3A 3SGBE 2FS9A 2HALA 5A0CA 1THSH 3BTWE 3P92A 1OWIA 4AG2A 1C5PA 2VWOA 1P2NA 4ISIH 1GMDF 2AS9A 4U01A 3PROA 2FTLE 3RXHA 2G8TA 4IW4E 1W14U 2UWOA 1AUJA 1QB9A 1V2JT 2B5TB 1UTPA 1MCVA 3E91A 4B2BA 1TLDA 2CV3A 3RXSA 2XBVA 8LPRA 2O8LA 4IBLH 3VXEH 2BY7X 2VIDA 3KL6A 5F8TA 2SGEE 4AG1A 4AFUA 4ZKOU 2Q6DA 1TQ7B 1Y3WA 3VB7A 2BXTH 2FIRH 3VB6A 5JBCS 1C2HA 2AYWA 3ZZDA 1G2MA 1A0LA 3TGIE 1O2RA 2BDCA 1GBEA 1A5IA 4X1RU 1DDJA 1CBWB 3TU7H 2QY0B 1EP5A 1LHCH 1P2IA 1RJXB 1CVWH 1O2WA 2G5VA 4IMZA 1Y3VA 1SR5C 1MKXH 1XVMA 1O5AB 1HNEE 1S84A 2A4RA 4ZAEA 1GI4A 1ARCA 1P04A 3ODDA 1EZSC 3HGPA 5I25A 2F83A 1BTPA 5IYTA 1SGRE 5AFYH 3LONA 1AE8H 3LOXA 5DKMA 2PV9B 2PGBB 1ZGIA 3GDUA 3OX7U 1OWEA 4AB8A 1O3FA 2ANKH 4BXWA 1F0UA 2YOLA 3RXPA 2BD4A 3A8CA 1UTQA 3LC3A 3Q77A 1AKSB 3GY5A 3RLWH 3QGNB 2ZF0H 4K8YA 4OS2A 2Y5FA 1XUGA 1EB2A 1MH0A 4JCNA 4GPGA 4CR5A 4U2WA 4GVUA 2VB0A 4A1XA 2O8WA 2QC2A 2XBYA 2FEQH 1UTKA 1JRSA 3BIUH 1O2SA 5LPFA 2ZQ2A 1G3BA 3E1XB 1TA2A 3I77A 2ZPSA 1UK4A 2P3FH 1K1IA 2WPJS 2V6NA 1T8LA 2FPZA 2ZP0H 3A7YA 5L30H 1SGFA 1J9CH 2P95A 3EE0B 3TJNA 1TMBH 1WOFA 3SNDA 3UFAA 3CS7A 2VVCA 1A61H 1JBUH 2BDAA 1GDQA 2PKSC 2WPLS 3EGKH 2HRVA 1ARBA 2ZFTA 4BXSA 1XUIA 1AI8H 2EC9H 1RXPA 4B2CA 4XBDA 2H2ZA 3TIUA 4YM9A 1UK3A 4H42U 2UUJB 1TNKA 2VJ1A 3BG4C 2G81E 4ABFA 4DJZB 2BM2A 1MTWA 3TGKE 2FOMB 1NU9A 1KIGH 3LGYA 2BOHB 3SZNA 3UOPA 3CS0A 1SLUB 1F0SA 3BEFB 3IG6B 5LPEA 5HM9A 1NFXA 1C1QA 3ZVGA 2OC0A 1H4WA 1K1OA 2C8WB 3LC5A 3B8JA 1GHYH 3ITIA 3Q3YA 3RXJA 2QN5T 4DCDA 3TGJE 1TNHA 1V2UT 3UNQA 2J38A 5C1UA 2JKHA 1GBIA 5AF9H 2ZGXH 3BEUA 1AD8H 1O2QA 1V2PT 2AEIH 1C9TA 1XUKA 4JK5A 3VB4A 2ZG0H 1A0HB 4LXBH 5EQSA 3H5CB 1NTPA 2P16A 4JZIA 1DLKB 1DE7H 3RXFA
chains in the Genus database with same CATH superfamily
3EYDA 4ABEA 1QIXB 1W0KD 2A0QB 2XC4A 5C1YA 3RU4D 4D9RA 5C94A 3A8BA 1ZTKA 1ZHPA 3DA9B 1C1VH 3KN2A 1F5KU 2J4IA 2P3UB 3OAAD 1GVZA 5LH8A 5A0AE 4GHTA 4FVBA 3NCLA 1CGJE 2W26A 5FXLA 1RTLA 5L2YH 1PQAA 1DXWA 1Z1IA 2R2WU 5B6OA 1IQKA 1W8BH 2G4UA 1IHSH 3V0XA 2FYRA 2PKAA 1OHHD 2EA3A 2OC1A 5F8ZA 1P02A 4WXVA 1GI7B 2FXRA 5B6LA 1AHTH 5CE1A 3FFGA 4RI0A 4XFQA 4X1PU 1CT0E 1EAXA 3N7OA 1BTYA 1HAGE 3GYLB 2TGAA 4ZROA 4OS6A 3EAJA 1DSTA 2XWBI 2WYJA 3TPIZ 3SU1A 5HGGA 3SUDA 5EOKA 3LGIA 3VGCB 2H5CA 4NA8A 4AGJA 1RS0A 1GJBB 2FLRH 4FUEA 1BTZA 1IQHA 2VNTA 3R0FA 1PJPA 3UAIC 1C2JA 2H9HA 1IHTH 1GI9B 2ZA5A 9ESTA 2GCTB 4SGBE 1O35A 2C93B 4U32A 3U69H 2GGVB 1K0HA 4BTTB 1TPAE 3L3TA 5C1XA 1BHXF 2P93A 3DFJA 4HTCH 3N7EA 1O3OA 1TRNA 2FOBA 2OQ5A 2QF0A 3SORA 3BIVH 3D23A 5C67A 1O37A 2AFQB 1GVLA 3DSOA 4WF8A 2F9UA 3ATIA 5T6FA 3ATLA 1UK2A 3K6ZA 3FP6E 1IQMA 3T25A 4A1TA 1C2GA 5G4BA 3GS9A 4A7IB 1UTMA 1AO5A 5HMAA 2QA9E 4TY7A 1QBVH 4Q2KA 2DE9A 3SGQE 1O2OA 3VEQB 1KXAA 2JETB 1ORFA 1WYKA 3MO9A 5DSFA 3OY5U 4A6LA 5DK1A 2KM0A 1CGHA 1GG6C 3S9AA 1BBRH 1O5BB 2ZFRH 2NU1E 1O2XA 5JBAS 2BB4A 4UE7H 3RXUA 1G30B 1CBWC 2FOHA 1WCZA 6CHAB 1A46H 1MZDA 2J34A 6LPRA 3F1SB 3DFLA 4KP0A 4DY7B 1HAPH 3OE7D 1S6HA 1IAUA 2G00A 3P6ZB 4AORA 1OX1A 3T29A 3LGUA 3ZYDA 2RDLA 3TH2H 2HNTF 2QXJA 3LPRA 8GCHG 2VWNA 3NUMA 1EJMA 1ELEE 4ZHAA 5K7RA 2A4GA 3SV6A 3ELAH 1FAKH 4NFEA 1WSSH 1C1MA 2BYAX 2VIOA 4X6PA 1IQIA 3VXFH 3LH3A 1NRQH 1NM6A 1QJ7B 2HGTH 1O5DH 3RMLH 2H5DA 2KCYA 1P57B 1L1NA 2ZDMA 2A2QH 1LPKB 3Q3KA 1TPOA 2EI8A 4ASUD 3QX5H 1NT1A 4THNH 4WWYA 2A7CA 4BAKB 3W94A 3H7OA 1XKBC 1C1WH 2RDEA 1C4U2 1JXPA 1DX5M 2FP7B 2GZ7A 1L1JA 4ZH8A 1SMFE 2Z3EA 4MNXA 1S82A 1Y3YA 2PSXA 3PV4A 4U30A 5DP3A 3RM0H 5EGMA 1BMAA 1NRRH 1BT7A 1K2I1 1J17T 3NRLA 3P17H 4MVNA 5FCRA 1C2FA 1H8DH 2KCOA 4CBOA 2JIZD 3KYFA 2JH6D 4R0IA 3BTGE 3U1JB 3GCTF 1UO6A 1LHDH 1N8OC 3Q3XA 5DO4H 1FONA 4MPXA 5C5OA 3STIA 4CH2B 5K0HA 2G4TA 5T1VA 1O5FH 4MPVA 1A0JA 1C5XB 3K9XB 3PWBA 2R9PA 1S0RA 3T26A 3DSGA 2F9PA 1S5SA 1Q3XA 3TJOA 3UB0A 4NSYA 1TNLA 1SSXA 1SI5H 5BPEA 2BTCE 5E8EH 1VITG 3F2FA 1GCTB 2STAE 1EOJA 1BA8B 3UQVA 3MH7A 2V7QD 1BUIA 1NN6A 2C3SA 1Q31A 4K1TA 1MTNC 1MAXA 2STBE 1FY3A 1L4DA 1P11E 2PUXB 1C2EA 1MUEB 1LVBA 1Y3XA 2BLWA 1TPPA 3O8BA 4WMEA 1GMCF 5C20A 2SGQE 1FN8A 1AE5A 2ZTXA 5CHAC 1MCTA 3P8NA 3PMBB 2BDBA 3BN9A 3UUZA 2ZFSA 4X0WU 3SJIA 4OS1A 1GBFA 1D3TB 3A7XA 2ZGJA 3LT3A 1PPHE 1QY6A 1OYTH 1WTGH 1L4ZA 1HAIH 2KAIB 1NPMA 1BHXB 1THPB 2Y5HA 1DS2E 2M2AA 1D4PB 3JZ2B 1SGYE 1GBTA 3MU0A 4GHQA 1BRCE 3HGNA 1W7XH 1GPZA 1C5WB 5T6GA 1AZ8A 1AKSA 1ESTA 1H8IH 4O9VA 1WBGB 2A31A 1MU6B 1NZQH 1K1NA 2ZFFH 3ZVBA 2OP9A 2LP6A 3BTQE 2GMTB 1ZMNA 3P70B 4MNWA 1ELTA 2C90B 1TNJA 1GHWH 2O8MA 2O8UA 2BQWB 1OXGA 2XBWA 2PR3A 4NFFA 4ZKNU 2PLXA 4JYTA 1XUHA 1FMGA 1EAIA 2GP9B 1GI0A 1AGJA 1EASA 1ZRBA 3KQBA 2P94A 1COWD 1OPHB 2ZDNA 4D76A 2WV9A 1PPBH 4WJG2 4LK4A 2HNTE 4GUXA 5CHBA 1P09A 2OLGA 2HLCA 5TCAA 1H8HD 2PWXA 3T62A 3KQEA 4Y7BA 2O9QA 5JDUB 2VIPA 4UDWH 2WPHS 1GDUA 3V13A 1JIMA 1FY1A 2HLDD 3SV8A 6GCHG 2PHBA 1BMNH 1TIOA 4I8LA 4M7GA 2Z9IA 2Z7FE 2Q6FA 2ZWLH 4O3TA 1FZZA 1E1RD 1FI8A 3GY8A 1V2TT 5KEDA 1E34B 2VH6A 3UTUH 3SJOA 2ZU1A 3ATWA 3NWUA 3QN7A 1C4V2 1DITH 3RXIA 3RLYH 4CRCA 1O2VA 3M7QA 1SGQE 2ZPRA 1P05A 2A45B 1HFDA 3A7TA 5GCHF 4Q7XA 2RA3A 3S69A 4JZEH 1O31A 1TBZH 1FIZA 1SQRA 2ZCLP 2QF5A 5CHAB 3SNEA 3URCA 3KHVA 1GBAA 1T8NA 1EJAA 1UVSH 2VGCB 1KLIH 3R3GB 2GTBA 2WPKS 1K28D 3D49H 1S81A 1XX9A 1MTNB 3SV9A 1O3PB 5A8ZA 2OQUA 1IQGA 4AFZA 4E7NA 2IPHA 1ZRKA 1GMHF 1MD8A 1C4Y2 1KXBA 1Z8JB 2QXGA 4BOHA 4Q63A 3U8OH 1CQQA 3F9GA 4J2YB 4UFGH 2H9TH 2ZDAH 3F3BA 2PW8H 1WQVH 4LZ4B 8KME2 3CENA 4XBCA 5E0GA 1H8ED 1VJAU 2BY6X 5EXLA 1MKXK 1FUJA 1SKYE 4P00A 1F0TA 4NWLA 2ANMH 4ZUHA 4Q7YA 2Z9LA 4B75A 1GBKA 1SBWA 1MAYA 1SGFG 4BTUB 1S6LA 2SGFE 1MKWK 4KELA 1GWAA 1O3BA 1BRBE 1QR3E 1BMLA 4BANB 1SLXB 2H6MA 1ZHRA 5EPYA 3S0NA 4FUDA 2BD7A 2Z3DA 4DT4A 1GBHA 3A89A 1WU1A 5J4SA 1SFIA 1P2KA 1SFQB 2D26C 1GMHG 4YLQH 4ZXXH 1C5NH 4UEHH 3SU4A 2J98B 5C5NA 1W2KH 4YZUA 3ZV9A 4ZKRU 3AK5A 4IN2A 1SOZA 3W95A 3CNRA 3BTTE 1IQLA 1SGEE 7LPRA 4CRAA 2OUAA 3MU4A 5DPAA 1O34A 1W7GH 3ZV8A 4AB9A 2GZ8A 2ALPA 1W0YH 4LZ1H 1BTUA 2ZTZA 1LKBA 2J94A 3GY2A 1C2IA 1GHBG 1QB1A 4ZXYH 2HVXA 4ZHLU 1IQEA 3DT0H 4MTBA 1ELCA 1BB0B 3AW0A 1AIXH 2ANYA 3ESTA 3ZZCA 5A8XA 1ZPCA 4OS5A 3JZ1B 3FAOA 3RXOA 1OWJA 4ABJA 1VGCC 1QA7A 4X8UH 4Y0YE 2CF9H 1S83A 1Y5BT 3SI4H 1DY8A 3B9FH 1MBMA 5GWZA 2GV7A 7KMEH 3U28C 1YCPM 1GHVH 3O8RA 1BQYA 1O3MA 1AFQB 1OWDA 1A1RA 1RTKA 1WQSA 2NU0E 4RT0A 2BD2A 1HAXB 2Y82A 5EXNA 2Y7XA 1LQEA 2YMSC 1KDQB 2V35A 5DJ7A 2G5NA 2HOBA 2I6QA 3K65B 1YCPH 2QV1A 3IWMA 3MHWU 2VVUA 3GCOA 4AX9H 4Y8XA 1T7CA 1LQDB 1DWBH 2FZZA 3I29A 3SQHE 2GZ9A 1PQ7A 2XWAA 4D9QA 2TIOA 1UCYE 4Y10E 5EW1H 1PFXC 3L6PA 3UIRA 1Z8RA 3BTEE 1O36A 2PP6A 1J14A 4K60A 3A86A 4NIVA 3ZZ4A 5F6MA 1XMNB 1O30A 2W3IA 2PKSB 1GJ9B 2P3TB 1ELVA 5EPNA 3M3VA 1X7AC 2BVSH 1TNIA 2NWNA 4DOQA 2ZC9H 1KLTA 1NFUA 1RIWC 4YXWD 2WPMS 1GL1A 1A3EH 1YPEH 1BITA 4HZHA 1V2RT 4I7YH 1Q2WA 1GI3A 2BVXH 4NCYA 1UVUH 2AMQA 4FUCA 1WTHD 3LH1A 3LJOA 1MTVA 2GDEH 1TA6A 3MO6A 3OEHD 1TX7A 5F8XA 2PTCE 5GNDA 3SHCH 2J9NA 1QL7A 3E6PH 5A09A 5EODA 5HXFA 3F6UH 3F0PA 2ZHDA 4FUJA 1PPCE 5C2ZA 2GT8A 3FZDA 4VGCC 2GCHG 2ZHQH 1UTJA 2ZDLA 2WUBA 1ZMLA 2AH4X 2BZAA 2FX4A 4KGAA 3VGCC 1O2YA 1T8OA 3FP7E 3RXTA 4MG3A 3A8DA 4FOUC 1K22H 1TALA 1RGQA 2CN0H 5TCCA 3EA7A 2OINA 4QT8C 3UNSA 1G32B 1TRYA 4TPYA 1D6RA 3VB5A 2ZO3H 3ZZ7A 5FHTA 3U8RH 1G37A 3A80A 2R2MB 2PGQB 4ABGA 1W12U 1E38B 4IS5A 4TSFD 4FUGA 1HAYB 4X8SH 5DP6A 1T31A 3CP7A 4XBBA 2BDYA 4CHAC 1E79D 3F9EA 1ETRH 1N6YA 2V3OH 2XCNA 1ESBA 1S0QA 4FU9A 5EG4A 1QRXA 3ZVFA 1TBRH 3F9HA 5GIBA 3VB3A 1UTLM 3RXGA 1QQ4A 2W7UA 1TWXB 2QGRA 3EE7A 2G55A 1IQJA 2GJGA 5EU8A 2TGPZ 2GCHF 3DCLA 5AHGH 3M3SA 3FVFB 1ZYOA 1QJ6B 5DP7A 1AFQC 1BIOA 2XCFA 3KQCA 1SQAA 2WINI 5JBTA 2LPRA 3VPKA 4BNRA 1BTHH 1XVOA 1C2MA 3QO6A 2ZHFH 4Q7ZA 1YPHE 1WDIA 3AVZA 3DUXH 4M9FA 1XKAC 4BAQB 4OGXA 2K8IA 1O3DA 1AVXA 1YPKH 1NFWA 1O5EH 2KR7A 2W3KA 4CRGA 4B76A 2ZECA 4FVDA 3PMJA 4XE4A 1SGIB 1F92A 2BDHA 1O3KA 3L33A 1BRAA 3RXQA 1RD3B 3MTYA 3PTBA 1UW7A 1NC6A 2VU8E 3GY3A 2KCAA 1EPTC 1D6WA 1QRZA 1P3EA 2A4QA 3SUEA 3LDXH 3K6YA 1TMUH 2XC0A 1P9UA 2ZHEH 4BAHB 1FPCH 1C2LA 4I8GA 1AU8A 2YMSB 4NZQA 4TWWA 5PTPA 1SG8B 3SJ9A 5IK2D 1QQUA 2AGIX 3F0OA 3H7TA 1C1NA 1SGTA 3SNAA 1PQ8A 2BX4A 3FOAA 2B9LA 1GCDA 4Y11E 4RKOB 4TWYA 1YBWA 2ZGCA 3A8AA 1SVPA 2UWLA 2BQ7B 4XRNA 1OWKA 4CHAB 3RXCA 1O39A 3SGAE 3SYJA 1WUNH 2C8YB 1C5TA 1G36A 2BDGA 1UTOA 3V3MA 3MNCA 5GJ4B 4HFPB 4D7GA 3GY6A 2HPQH 4Y8ZA 4YESB 2ALVA 2FM2A 4I8HA 1H9IE 2HNTC 1O3EA 2A1DB 1QRWA 1H9HE 1NBME 4YLUA 2ZTYA 1C1SA 1MD7A 4Z0KA 1ETSH 3ZVCA 1FNIA 1YCPK 1KSNA 1C5ZB 3AAUA 1QA0A 1GHBF 1NFYA 1AMHA 4K3JA 7GCHF 3ENSB 2ZDVH 4I32A 2G52A 2XNDD 3SOSA 2ZU5A 2ZCHP 2RG3A 1V2OT 2KCPA 2FOCA 5HKKD 1QBOA 2Z94A 2SGDE 1MTSA 1A7SA 1HDTH 1MTUA 2A5KA 2CJIA 3BSQA 3ZVEA 1QNJA 1N8OB 2OCVB 2YMSD 3P8FA 1C5RA 1P2QA 2J98A 4YT7H 2FMJA 3SUFA 1ZTLA 1ABIH 3PM3A 3SI3H 3BV9B 3E3TA 4F49A 1LHGH 4H4FA 4FUIA 1OP0A 1BJVA 4ESTE 1GHZA 3KEEA 5FPTA 1TMTH 1D3DB 3NPSA 4NIXA 1FLEE 2BD8A 5IDKA 2ODQA 2W5EA 4A92A 1BBRE 1GI6A 2WSSD 3GDVA 1FXYA 1TGCA 1CGIE 5KECA 3MH6A 4MNVA 2QXIA 2EI6A 1LVOA 1AWFH 3RXEA 1T4VH 1DXPA 1G3EA 3E16B 1VITH 1WV7H 1BTWA 1O3AA 1SQOA 3SQEE 4K8BA 1OWHA 3UR6A 4UFDH 2K1QA 4XSKU 1BRUP 3LGTA 3GOVB 4CR9A 1HIAB 2JJ1D 1O2PA 1O3IA 3LGWA 4JZDH 2ZFPH 5LGOA 1C5MD 2HVYB 3RUOA 4MNYA 2GMTC 2GD4B 2P59A 2AHME 3GDSA 1JMOH 1YPJH 1B0FA 2ZU2A 3U98H 2XYAA 1C1PA 3FP8E 2BXUH 1N1LA 1O32A 2DE8A 2ZHWH 1W13U 3KF2A 5DN6D 1TYNA 3ZZAA 3B23B 3BTHE 1GJ7B 1V2WT 3E8LA 1LPZB 4ABBA 3BTDE 1CE5A 5JPMH 1C9PA 2TRMA 2XRCA 4X6NA 1FJSA 1QHRB 2Y81A 4X1NU 1Y3UA 1BTXA 2BY9X 4ZCNA 3URDA 3MFJA 1INCA 2DUCA 3KNXA 2IOTA 1LPGB 1RTFB 3KQDA 3ATKA 1Z71A 5E2PA 1O2ZA 5DP4A 1O3GA 1V2KT 2CHAB 4HG6A 5EQRA 4B74A 1BOQA 4CH8B 5ABWA 1OYQA 3ZZ3A 1GBMA 1FN6A 1EOLA 3UQOA 6GCHF 1PPGE 1VCPA 1ZSKA 2AIPA 5E2OA 3TH3H 4X8VH 1GDNA 1CHOF 2ANWA 1MMJN 4B6FA 3PV5A 2SGPE 2OTVA 3GICB 1O2LA 2XBXA 2BX3A 1JWTA 2LNCA 3N99A 1SB1H 1GGDB 2TBSA 1ZSJA 1BZXE 1EAWA 1O2HA 1NU7B 5DGJA 2ZZUH 1W10U 2JJ2D 3PRBA 1K1MA 1KLJH 1PPEE 4X2YA 4ZHMU 3UNRA 1QJ1B 2D8WA 1ETTH 3ZZBA 1L0ZA 1NRSH 1ZSLA 5EXMA 3SV7A 5EJ1A 2OD3B 1GHXH 3VG8A 7ESTE 3MOCA 2ZU3A 3UWIA 1CO7E 3IITA 2C8XB 4JMYA 4DG4A 4NA9H 3RDZA 4AGKA 3KYGA 2NU2E 1UHBB 2FOEA 2XNIA 3RM2H 3SW2B 4HGCA 3FKSD 2FESH 1B5GH 1EZUC 1YLNA 3SZEA 2KAIA 4E7RG 3A84A 1LKAA 1AWHB 1ZTJA 1IQFA 1ZHMA 1C5YB 5FBEA 1E35B 3SUGA 1TX6A 1O3NA 3ZZ9A 5SGAE 2SGAA 4DGJA 2GX4A 3QUMP 2Z9KA 4KKDA 1SOTA 5H4IB 2JDID 1C1TA 1CU1A 1LDTT 2CMYA 4YT6H 3P8OA 2OBQA 2C8ZB 2FWWA 3HATH 4WMFA 4DVAU 1P03A 2CHAC 5C3NA 1UJ1A 1EATA 1XM1A 3T5FH 1ZR0A 1EX3A 2FX6A 1GCTC 1LVMA 1KXEA 4HI3A 2Y5GA 4CREA 4Y79A 3C1KA 4JK6A 2CK3D 5L2ZH 1H9LB 2O8TA 2UUYA 1ANEA 3I78A 4K1EA 2BDIA 1V2MT 1O2NA 1LVYA 5J4QA 4CRBA 5T6DA 1VR1H 3MH5A 2R3YA 3PLKA 1GMCG 2J2UA 1ZPBA 2HPPH 1D3QB 1P2OA 1OP8A 1O2MA 1SHYA 3G01A 4NA7A 5E0JA 3T2NA 1TGNA 1GBCA 1UMAH 4ISHH 2FS8A 4RSPA 1EP6A 2BD3A 3U1IB 1TE0A 4ABIA 1A5HA 1O3JA 1PQ5A 1C5QA 4NG9H 2FO9A 2ZDKA 1UCYK 1M9UA 2P8OB 3A7ZA 2Z9JA 2FOGA 1EJNA 6CHAC 1CA0B 1EAUA 1QL9A 4JYUH 1Y8TA 1P10A 1Y5UT 2BHGA 4KTCA 1V2LT 1VCWA 1YYY1 2RA0A 1TABE 2F9BH 2Q1JA 5GPIB 4DIIH 3LJJA 2G51A 3MYWA 3HK6B 1KYNA 3GY4A 2QYIA 2GV6A 3DSPA 1YM0A 3BTME 1Y59T 3OTPA 4P02A 1GJ5H 3HKIB 4WXIA 1YGCH 3TK9A 1QURH 4GLYA 1PPZA 3PLPA 1AVGH 2PKAB 3PTNA 3GCTG 1QB6A 1QZ8A 4IC6A 3O8DA 3ZIAD 1UTNA 2L74A 1L2EA 4I86A 5A2MH 1FY4A 1G3DA 2W6ID 1Z1JA 1TOMH 2ASUB 2FI4E 2BLQA 2WV4A 1TONA 1N6XA 2LELA 5FCKA 1J8AA 2L6OA 4O03A 4NGAH 1Y5AT 1HJ8A 1YPGH 5C17A 4X1SU 2J95A 4Y7AA 3EQ0H 1EZXC 4F48B 3MQKC 5EJLA 3P95A 3QTVH 3F9FA 1TBQH 5A8YA 3ZZ8A 2VIVA 1C1UH 3MNXA 4NIYA 1A2CH 1FDPA 1TOCB 4INHA 1AUTC 4MPUA 1ELGA 1JRTA 3GY7A 2GCTC 2Q6GA 1C2KA 3NZIA 4A5TS 1QFKH 3M7TA 3MI4A 1L1GA 3S7HB 2FLBH 1HAOH 3HKJB 1OKXA 1GBBA 3GCNA 4D8NA 1DVAH 4FXGH 2R0KA 4K2YA 1TX8A 2BMGB 1HRTH 4Y6DA 3ATMA 4E05H 2IJD1 1HCGA 2VH0A 2XW9A 3D62A 3MWIU 5FL7D 1YPHC 5GDSH 1CT2E 4D7FA 3O8CA 1SLVB 2OK5A 1O0DH 2D1JA 8GCHF 3TJUA 1O2GH 1SGNE 2UWPA 4O97A 4ABDA 2VGCC 2M5TA 1S6FA 4Y71A 4NSVA 1P3CA 4YTAA 5C0UA 3MNBA 1HAVB 2F9NA 1P12E 4VGCB 3RXLA 3E0PB 1U6QA 1HAVA 1UVPA 1AZZA 1ANBA 2Y6TA 4A1VA 4INLA 3RC4A 3DHKH 3QWCH 2K0QA 3OY6U 3PMAB 3TNTA 1A3BH 3OU0A 3TH4H 5AVDA 4O3UA 1P06A 3AAVA 4ISNA 2VIWA 1SC8U 2KFWA 5HYOA 2A7HA 4IC5A 1JIRA 2ULLA 1BCUH 1G9IE 2B0FA 1PPFE 4ASHA 1DWEH 3UREA 2I6SA 2ZEBA 1W3CA 1KMHB 3OYPA 3U8TH 2C4FH 2GDDA 5EW2H 1W11U 4YO9A 4TT3D 3TLOA 3BTFE 1BMFD 1THRH 2V3HH 5FX6A 1J16A 3PO1C 1HXFH 3TK6A 4CBNA 2XTTB 1O3HA 4UONA 1V2VT 3S9CA 1FV9A 3QZRA 2BOKA 1OP2A 1YLDA 5TJXA 2OBOA 2B7DH 1HAZB 4DIHH 4ISOA 2AMPA 3LGVA 1HYLA 2WV5A 3A87A 3HPTB 2ZNKH 1HJAC 4Q80A 4SGAE 3UY9A 3RXBA 1TPSA 4J1YA 2V0BA 5DP8A 3AASA 1VCQA 2WZQA 1B7XB 5GXPA 1ACBE 1HJ9A 1A5GH 3NK8A 1TGTA 2QAAA 3GCHC 1IQNA 3RU4T 1DANH 1Z8GA 3SJKA 1O3LA 4DT7B 1V6DA 4GCHG 1K1PA 1YKTA 1KY9A 1YC0A 3QK1A 3MNSA 5I46H 1HIAA 1UCYH 3SN8A 1DUAA 1AVWA 2ZU4A 2FODA 3DD2H 5L6NH 3M61U 5JYIA 5ESTE 3SO3A 4JYVH 1V3XA 2ZFQH 2ODPA 3RC5A 1GJCB 3M35A 1QL8A 1AY6H 1EQ9A 1HXEH 4WVPE 1AB9C 1QBNA 3TVJB 1ID5H 4FETA 2VIQA 4X2VA 1DFPA 1ELAA 2FOAA 1GVKB 4I8JA 5FBIA 2A5AA 1EXFA 2FI3E 3WWBA 1GJ6A 6ESTA 2H9EH 1JOUB 1TNGA 3UR9A 4AFSA 1E36B 1NRNH 2B8OH 4RKJB 1SLWB 4WY3A 5DP9A 4TYDA 1GBLA 4IGDA 5ESBA 1E37B 1YPLH 2EI7A 4X2WA 3RXMA 1HV7A 3WY8A 1T4UH 3BG8A 4Y8YA 1TFXA 4BAOB 2YNAA 1O2IA 2A4OA 5FPYA 1V2QT 4Q4LA 4AOQA 2ZPQA 1H1BA 1YLCA 1FX0B 5GCHG 4FUFA 2AMDA 2ZGHA 5C0TA 3SU3A 2BD9A 4ZMAH 1ZMJA 1D9IA 4NZLA 3UOUA 1V2ST 1GI5A 2OXSA 1WXRA 4FUHA 4OS7A 3PB1E 4TPIZ 1CHOG 2YNBA 2BZ6H 1EPTA 1DPOA 1O2UA 1ELFA 3RU4E 1BBRK 3QLPH 3LKWA 1KTTB 1EFRD 4INKA 4X1QU 2VVVA 3H09A 3KIDU 1GL0E 3ZVAA 3MMGA 4XOJA 2RCEA 1NY22 3MU5A 2BD5A 1DSUA 3A7VA 3AW1A 1C5UA 4Z1MD 2FI5E 4FUBA 1GJDB 1G3CA 3M5NA 1ZJDA 3SJ8A 1YY3A 2IJOB 4JZFH 4Z6AH 1WAYB 4AC9A 4I31A 1UHBA 1RRKA 1P01A 1ZZZA 5DG6A 3GYMA 4WMDA 1P2JA 1F0RA 1TB6H 4B2AA 3EDXB 4K1SA 1Z6JH 1P8VC 3FANA 1HLTH 1MZAA 4MDSA 2XOKD 1ZLRA 3OFND 5FX5A 4B73A 1VJ9U 3HK3B 4B1TA 1C1OA 3PLBA 4X6OA 4E06H 1HBTH 4I8KA 1DY9A 3P8GA 1CHGA 3F68H 1HGTH 1DWCH 1DT2A 1QGFA 4GCHF 3A83A 1F5RA 3MO3A 1PYTD 3M36A 4AZ2B 2HWLB 2FDAA 1DLEA 1F5LA 3BTKE 3ZZ5A 1MBQA 2PTNA 4IMQA 2H1UA 1ZOMA 1HJAB 1GG6B 4NIWA 1MU8B 4R8TB 1SGCA 1FY8E 3E90B 3SU0A 1CT4E 1TGSZ 1AQ7A 3FZZA 3ZVDA 3KGPA 4H6SB 1C1RA 8ESTE 3STJA 3LU9B 1ABJH 3A81A 1FPHH 5T3HA 3T28A 1C5VA 3Q00A 3WW7A 1ZGVA 4KTSA 2PSYA 3TITA 3M5MA 1GJAB 1QTFA 2AERH 3RXDA 1XUJA 2ILNA 1O2JA 2QF3A 1CA8B 3NXPA 3OEED 2ZI2H 1T8MA 9LPRA 2A5IA 1K1LA 3TNSA 2CXVA 4OGYA 2A2XH 1EKBB 1FY5A 1P0SH 3UWJH 3SU2A 4XDEA 3QZQA 1O38A 1ZPZA 3N7DA 1OS8A 1YPMH 1GMDG 1TQ0B 1LTOA 3GCHB 3M37A 1O2TA 1XXDA 3MH4A 7GCHG 3A7WA 1Z7KA 4UFFH 1ANDA 2SFAA 1K9OE 5F03A 4Y76A 1C5OH 3BEIB 4F55A 1O5GH 2TGTA 2W7SA 1CSOE 1LO6A 2PFEA 2ZQ1A 3V12A 1SL3A 2D2DA 3NKKA 1C5LH 3RP2A 4CRDA 1DOJA 2THFB 2F3CE 1T32A 1ELDE 2BVRH 2J92A 1BDAA 2AGEX 2ZIQH 1ZJKA 2TGDA 2SNWA 2ZKSA 4JZ1A 1DUEA 3RMOH 1TRMA 4GSOA 2ESTE 3M5OA 1SQTA 3RMNH 2QCYA 1AFEH 1GGDC 3FO8D 2CF8H 1NRPH 2A7JA 1IOEA 2V3MA 4B6EA 1ANCA 4I33A 1D3PB 1EB1H 1NS3A 2J97A 4AFQA 1KXDA 2Z9GA 1EUFA 1E0FD 3MU1A 1B0EA 4CRFA 1MQ5A 1SGDE 4UD9H 5F53A 3RC6A 2WYGA 1HAHH 1LHEH 2FTMA 2Z3CA 1AN1E 1C2DA 1KXFA 5FAHA 2WPIS 3OTJE 1F2SE 3A88A 5FPSA 4X8TH 2OC8A 4B71A 3Q76A 3A85A 1BMMH 3A82A 4RN6A 4BAMB 1O3CA 2BY5X 2P8OC 1W0JD 2Z6BD 2GKVE 5HIZA 1P2MA 2GVFA 4ABAA 1KDQA 1S85A 1VGCB 1GJ8B 4MLFB 2EEKA 2F9OA 3SU5A 4DW2U 2WUCA 3RXRA 2AGGX 1HB0B 1RIWB 1O5CB 1FAXA 1YP9A 2UUKB 3F2HA 1NO9H 3UPEA 1E1QD 4GAWA 2XC5A 3TJVA 4LOYH 1SGPE 3RXKA 1C5SA 1GHAG 2PUQH 1GJ4H 1VITF 1K1JA 3QGJA 2F9VA 1DWDH 5JB9S 1KXCA 2GT7A 1ELBA 2QXHA 3RXVA 2VINA 5JB8S 3GISB 3V7TA 2BQ6B 1VKYA 3BG4B 3F2GA 4Y0ZE 5KGOA 2KX4A 2F43B 5DP5A 3PV2A 4ISLA 5CMXH 1A4WH 2FYQA 4YOJA 1EZQA 4X6MA 1O2KA 1RFNA 1LMWB 1SPJA 1TGBA 4FU7A 1QCPA 3QTOH 1YWUA 3D65E 1AB9B 2IN2A 3EA9A 1FIWA 2XXLA 2NU3E 2CGAA 4X2XA 1GI1A 3FN8A 1XUFA 1CA0C 5A0BA 2SNVA 1OSSA 4XD7D 4UFEH 3S9BA 3SHAH 3SBKA 1GI8B 1G2LA 1F7ZA 4IN1A 4WH6A 1HPGA 1SHHB 2Y7ZA 5CDFE 3OSYA 4ACBA 3PWCA 1VZQH 2A32A 2VWLA 3QDZB 1NESE 3E0NB 4FU8A 4YOIA 1KTSB 3U9AH 3KCGH 2R0LA 1O33A 2VBCA 4F4OC 4MQAA 4DURA 3RMMH 3BF6H 4NWKA 3M3TA 5AFZH 1GHAF 1TAWA 3PYHA 1EPTB 2ODYB 3K2UA 3T27A 2F91A 3SU6A 3SV2H 3VFEA 2R3UA 5JBBS 1MQ6A 1Z8IB 3C27B 4K69A 2AIQA 2QIQA 1DICA 5E0HA 4TY6A 1P9SA 2EQNA 2JH5D 3RXAA 3M7UA 1NROH 1HUTH 1MKWH 2J5UA 2JETC 2OC7A 3PMHB 4AYVB 3M5LA 1YF4A 3PO1B 2ZCKP 4OS4A 3TK5A 2TPIZ 3ZYEA 1GBDA 1XXFA 1GI2A 1K21H 5LPRA 1BJUA 1OOKB 5HM2A 4ZKSU 1DM4B 1ESAA 4H6TA 5ETXA 2BY8X 2FOFA 2Y80A 4AN7A 4RT1A 2BLVA 4K5ZA 4MPWA 3SNCA 3SNBA 4YOGA 4BTIB 3ODFA 1J15A 4WH8A 1LHFH 3EA8A 2NU4E 3MU8A 2JH0D 5EQQA 2UUFB 5BRRE 4AYYB 2WHXA 2BLOA 1V2NT 3LIWA 1LCYA 1W0ZU 1NBMD 4KTUA 4PROA 4OM9A 3S7KB 1GBJA 1UVOA 4ABHA 1Z6EA 1PYTC 2ZGBH 1UVTH 3ZZ6A 2VWMA 1FQ3A 3SGBE 2FS9A 2HALA 5A0CA 1THSH 3BTWE 3P92A 1OWIA 4AG2A 3PRDA 1C5PA 2VWOA 1P2NA 4ISIH 1GMDF 2AS9A 4U01A 3PROA 2FTLE 3RXHA 2G8TA 4IW4E 1W14U 2UWOA 1AUJA 1QB9A 1V2JT 2B5TB 1UTPA 1MCVA 3E91A 4B2BA 1TLDA 2CV3A 3RXSA 2XBVA 8LPRA 2O8LA 2WPDD 4IBLH 3VXEH 2BY7X 2VIDA 2F4LA 3KL6A 5F8TA 2SGEE 4AG1A 4AFUA 4ZKOU 2Q6DA 1TQ7B 1Y3WA 3VB7A 2BXTH 2FIRH 3VB6A 5JBCS 1C2HA 2AYWA 3ZZDA 1G2MA 1A0LA 3TGIE 1O2RA 2BDCA 1GBEA 1A5IA 4X1RU 1DDJA 1CBWB 3TU7H 2QY0B 1EP5A 1LHCH 1P2IA 1RJXB 1CVWH 1O2WA 2G5VA 4IMZA 1Y3VA 1SR5C 1MKXH 1XVMA 1O5AB 1HNEE 1S84A 2A4RA 4ZAEA 3WWFA 1GI4A 1ARCA 1P04A 3ODDA 1EZSC 3HGPA 5I25A 3W1EA 2F83A 1BTPA 5IYTA 1SGRE 5AFYH 3LONA 1AE8H 3LOXA 3KQ5A 5DKMA 2PV9B 2PGBB 1ZGIA 3GDUA 3OX7U 1OWEA 4AB8A 1O3FA 2ANKH 4BXWA 1F0UA 2YOLA 3RXPA 2BD4A 3A8CA 1UTQA 3LC3A 2IPQX 3Q77A 1AKSB 3GY5A 3RLWH 3QGNB 2ZF0H 4K8YA 4OS2A 2Y5FA 1XUGA 1EB2A 1MH0A 4JCNA 2QF4A 4GPGA 4U2WA 4CR5A 4GVUA 2VB0A 2QE7D 4A1XA 2O8WA 2QC2A 2XBYA 2FEQH 1UTKA 1JRSA 5EIYA 3BIUH 1O2SA 5LPFA 2ZQ2A 1G3BA 3E1XB 1TA2A 3I77A 4ACAA 2ZPSA 1UK4A 2P3FH 1K1IA 2WPJS 2V6NA 1T8LA 2FPZA 2EY4C 2ZP0H 3A7YA 5L30H 1SGFA 1J9CH 2P95A 3EE0B 3TJNA 1TMBH 1WOFA 3SNDA 3UFAA 3CS7A 2VVCA 1A61H 1JBUH 2BDAA 1GDQA 2PKSC 2WPLS 3EGKH 2HRVA 1ARBA 2ZFTA 4BXSA 2W6JD 1XUIA 1AI8H 2EC9H 1RXPA 4B2CA 4XBDA 2H2ZA 3TIUA 4YM9A 1UK3A 4H42U 2UUJB 1TNKA 2VJ1A 3BG4C 2G81E 4ABFA 4DJZB 2BM2A 1MTWA 3TGKE 2FOMB 1NU9A 1KIGH 3LGYA 2BOHB 3SZNA 3UOPA 3CS0A 1SLUB 1F0SA 3BEFB 3IG6B 5LPEA 5HM9A 1NFXA 1C1QA 3ZVGA 2OC0A 1H4WA 1K1OA 2C8WB 3LC5A 3B8JA 1GHYH 3ITIA 3Q3YA 5HIYA 3RXJA 2QN5T 4DCDA 3TGJE 2KZ4A 1TNHA 1V2UT 3UNQA 2J38A 5C1UA 2JKHA 1GBIA 5AF9H 2ZGXH 3BEUA 1AD8H 1O2QA 1V2PT 2AEIH 1C9TA 1XUKA 4JK5A 3VB4A 2ZG0H 1A0HB 1MABB 4LXBH 5EJZA 5EQSA 3H5CB 1NTPA 2P16A 4JZIA 2RFKC 1DLKB 1DE7H 3RXFA
chains in the Genus database with same CATH topology
3EYDA 4ABEA 1QIXB 3RU4D 2A0QB 2XC4A 5C1YA 4D9RA 3A8BA 1ZTKA 1ZHPA 3DA9B 1C1VH 3KN2A 1F5KU 2J4IA 2P3UB 1GVZA 5LH8A 5A0AE 4GHTA 4FVBA 3NCLA 1CGJE 2W26A 5FXLA 1RTLA 5L2YH 1PQAA 1DXWA 1Z1IA 2R2WU 5B6OA 1IQKA 1W8BH 2G4UA 1IHSH 3V0XA 2FYRA 2PKAA 2EA3A 2OC1A 5F8ZA 1P02A 4WXVA 1GI7B 2FXRA 1AHTH 5CE1A 3FFGA 4XFQA 4X1PU 1CT0E 1EAXA 3N7OA 1BTYA 1HAGE 3GYLB 2TGAA 4ZROA 4OS6A 3EAJA 1DSTA 2XWBI 2WYJA 3TPIZ 3SU1A 5HGGA 3SUDA 5EOKA 3LGIA 3VGCB 2H5CA 4NA8A 4AGJA 1RS0A 1GJBB 2FLRH 4FUEA 1BTZA 1IQHA 2VNTA 3R0FA 1PJPA 1C2JA 2H9HA 1IHTH 1GI9B 2ZA5A 9ESTA 2GCTB 4SGBE 1O35A 2C93B 4U32A 3U69H 2GGVB 4BTTB 1TPAE 3L3TA 5C1XA 1BHXF 2P93A 3DFJA 4HTCH 1O3OA 1TRNA 2FOBA 2OQ5A 2QF0A 3SORA 3BIVH 3D23A 5C67A 1O37A 2AFQB 1GVLA 4WF8A 2F9UA 3ATIA 5T6FA 3ATLA 1UK2A 3K6ZA 3FP6E 1IQMA 3T25A 4A1TA 1C2GA 5G4BA 4A7IB 1UTMA 1AO5A 5HMAA 2QA9E 4TY7A 1QBVH 4Q2KA 2DE9A 3SGQE 1O2OA 3VEQB 1KXAA 2JETB 1ORFA 1WYKA 3MO9A 3OY5U 4A6LA 5DK1A 1CGHA 1GG6C 3S9AA 1BBRH 1O5BB 2ZFRH 2NU1E 1O2XA 5JBAS 2BB4A 4UE7H 3RXUA 1G30B 1CBWC 2FOHA 1WCZA 6CHAB 1A46H 1MZDA 2J34A 6LPRA 3F1SB 3DFLA 4KP0A 4DY7B 1HAPH 1S6HA 1IAUA 2G00A 3P6ZB 4AORA 1OX1A 3T29A 3LGUA 3ZYDA 2RDLA 3TH2H 2HNTF 2QXJA 3LPRA 8GCHG 2VWNA 3NUMA 1EJMA 1ELEE 4ZHAA 5K7RA 2A4GA 3SV6A 3ELAH 1FAKH 4NFEA 1WSSH 1C1MA 2BYAX 2VIOA 4X6PA 1IQIA 3VXFH 3LH3A 1NRQH 1NM6A 1QJ7B 2HGTH 1O5DH 3RMLH 2H5DA 1P57B 1L1NA 2ZDMA 2A2QH 1LPKB 3Q3KA 1TPOA 2EI8A 3QX5H 1NT1A 4THNH 4WWYA 2A7CA 4BAKB 3W94A 3H7OA 1XKBC 1C1WH 1C4U2 1JXPA 1DX5M 2FP7B 2GZ7A 1L1JA 4ZH8A 1SMFE 2Z3EA 4MNXA 1S82A 1Y3YA 2PSXA 3PV4A 4U30A 5DP3A 3RM0H 5EGMA 1BMAA 1NRRH 1BT7A 1K2I1 1J17T 3P17H 4MVNA 5FCRA 1C2FA 1H8DH 4CBOA 2JH6D 4R0IA 3BTGE 3U1JB 3GCTF 1UO6A 1LHDH 1N8OC 3Q3XA 5DO4H 1FONA 4MPXA 5C5OA 3STIA 4CH2B 5K0HA 2G4TA 1O5FH 4MPVA 1A0JA 1C5XB 3K9XB 3PWBA 2R9PA 1S0RA 3T26A 2F9PA 1S5SA 1Q3XA 3TJOA 4NSYA 1TNLA 1SSXA 1SI5H 5BPEA 2BTCE 5E8EH 1VITG 1GCTB 2STAE 1EOJA 1BA8B 3UQVA 3MH7A 1BUIA 1NN6A 2C3SA 1Q31A 4K1TA 1MTNC 1MAXA 2STBE 1FY3A 1L4DA 1P11E 2PUXB 1C2EA 1MUEB 1LVBA 1Y3XA 2BLWA 1TPPA 3O8BA 4WMEA 1GMCF 5C20A 2SGQE 1FN8A 1AE5A 2ZTXA 5CHAC 1MCTA 3P8NA 3PMBB 2BDBA 3BN9A 3UUZA 2ZFSA 4X0WU 3SJIA 4OS1A 1GBFA 1D3TB 3A7XA 2ZGJA 3LT3A 1PPHE 1QY6A 1OYTH 1WTGH 1L4ZA 2Y5HA 1HAIH 1NPMA 1BHXB 1THPB 2KAIB 1DS2E 3JZ2B 1D4PB 1SGYE 1GBTA 3MU0A 4GHQA 1BRCE 3HGNA 1W7XH 1GPZA 1C5WB 5T6GA 1AZ8A 1AKSA 1ESTA 1H8IH 4O9VA 1WBGB 2A31A 1MU6B 1NZQH 1K1NA 2ZFFH 3ZVBA 2OP9A 3BTQE 2GMTB 1ZMNA 3P70B 4MNWA 1ELTA 2C90B 1TNJA 1GHWH 2XBWA 2O8MA 2BQWB 1OXGA 2O8UA 2PR3A 4NFFA 4ZKNU 2PLXA 4JYTA 1XUHA 1FMGA 1EAIA 2GP9B 1AGJA 1GI0A 1EASA 1ZRBA 3KQBA 2P94A 1OPHB 2ZDNA 4D76A 1PPBH 4WJG2 4LK4A 2HNTE 4GUXA 1P09A 2OLGA 2HLCA 5TCAA 2PWXA 3T62A 3KQEA 4Y7BA 2O9QA 5JDUB 2VIPA 4UDWH 2WPHS 1GDUA 3V13A 1JIMA 1FY1A 3SV8A 6GCHG 2PHBA 1BMNH 1TIOA 4I8LA 4M7GA 2Z9IA 2Z7FE 2Q6FA 2ZWLH 4O3TA 1FZZA 1FI8A 3GY8A 1V2TT 1E34B 2VH6A 3UTUH 3SJOA 2ZU1A 3ATWA 3NWUA 3QN7A 1C4V2 1DITH 3RXIA 3RLYH 4CRCA 1O2VA 3M7QA 1SGQE 2ZPRA 1P05A 2A45B 1HFDA 3A7TA 5GCHF 4Q7XA 2RA3A 3S69A 4JZEH 1O31A 1TBZH 1FIZA 2ZCLP 5CHAB 3SNEA 3URCA 3KHVA 1GBAA 1T8NA 1EJAA 1UVSH 2VGCB 1KLIH 3R3GB 2GTBA 2WPKS 1K28D 3D49H 1S81A 1XX9A 1MTNB 3SV9A 1O3PB 5A8ZA 2OQUA 1IQGA 4AFZA 4E7NA 2IPHA 1ZRKA 1GMHF 1MD8A 1C4Y2 1KXBA 1Z8JB 2QXGA 4BOHA 3U8OH 1CQQA 3F9GA 4J2YB 4UFGH 2H9TH 2ZDAH 2PW8H 1WQVH 4LZ4B 8KME2 3CENA 4XBCA 5E0GA 1VJAU 2BY6X 5EXLA 1MKXK 1FUJA 1F0TA 4NWLA 2ANMH 4ZUHA 4Q7YA 2Z9LA 4B75A 1GBKA 1SBWA 1MAYA 1SGFG 4BTUB 2SGFE 1MKWK 4KELA 1GWAA 1O3BA 1BRBE 1QR3E 1BMLA 4BANB 1SLXB 2H6MA 1ZHRA 5EPYA 3S0NA 4FUDA 2BD7A 2Z3DA 1GBHA 3A89A 1WU1A 5J4SA 1SFIA 1P2KA 1SFQB 2D26C 1GMHG 4YLQH 4ZXXH 1C5NH 4UEHH 3SU4A 5C5NA 1W2KH 4YZUA 3ZV9A 4ZKRU 4IN2A 1SOZA 3W95A 3BTTE 1IQLA 1SGEE 7LPRA 4CRAA 2OUAA 3MU4A 5DPAA 1O34A 1W7GH 3ZV8A 4AB9A 2GZ8A 2ALPA 1W0YH 4LZ1H 1BTUA 2ZTZA 1LKBA 2J94A 3GY2A 1C2IA 1GHBG 1QB1A 4ZXYH 2HVXA 4ZHLU 1IQEA 3DT0H 4MTBA 1ELCA 1BB0B 3AW0A 1AIXH 2ANYA 3ESTA 3ZZCA 5A8XA 1ZPCA 4OS5A 3JZ1B 3FAOA 3RXOA 1OWJA 4ABJA 1VGCC 1QA7A 4X8UH 4Y0YE 2CF9H 1S83A 1Y5BT 3SI4H 1DY8A 3B9FH 1MBMA 5GWZA 2GV7A 7KMEH 1YCPM 1GHVH 3O8RA 1BQYA 1O3MA 1AFQB 1OWDA 1A1RA 1RTKA 1WQSA 2NU0E 2BD2A 1HAXB 2Y82A 5EXNA 2Y7XA 1LQEA 1KDQB 2V35A 5DJ7A 2G5NA 2HOBA 2I6QA 3K65B 1YCPH 2QV1A 3IWMA 3MHWU 2VVUA 3GCOA 4AX9H 4Y8XA 1T7CA 1LQDB 1DWBH 2FZZA 3I29A 3SQHE 2GZ9A 1PQ7A 2XWAA 4D9QA 2TIOA 1UCYE 4Y10E 5EW1H 1PFXC 3L6PA 3UIRA 1Z8RA 3BTEE 1O36A 1J14A 4K60A 3A86A 4NIVA 3ZZ4A 5F6MA 1XMNB 1O30A 2W3IA 2PKSB 1GJ9B 2P3TB 1ELVA 5EPNA 3M3VA 1X7AC 2BVSH 1TNIA 2NWNA 4DOQA 2ZC9H 1KLTA 1NFUA 1RIWC 2WPMS 1GL1A 1A3EH 1YPEH 1BITA 4HZHA 1V2RT 4I7YH 1Q2WA 1GI3A 2BVXH 4NCYA 1UVUH 2AMQA 4FUCA 1WTHD 3LH1A 3LJOA 1MTVA 2GDEH 1TA6A 3MO6A 1TX7A 5F8XA 2PTCE 3SHCH 2J9NA 1QL7A 3E6PH 5A09A 5EODA 5HXFA 3F6UH 2ZHDA 4FUJA 1PPCE 5C2ZA 2GT8A 3FZDA 4VGCC 2GCHG 2ZHQH 1UTJA 2ZDLA 2WUBA 1ZMLA 2AH4X 2BZAA 2FX4A 4KGAA 3VGCC 1O2YA 1T8OA 3FP7E 3RXTA 4MG3A 3A8DA 1K22H 1TALA 1RGQA 2CN0H 5TCCA 3EA7A 2OINA 4QT8C 3UNSA 1G32B 1TRYA 4TPYA 1D6RA 3VB5A 2ZO3H 3ZZ7A 5FHTA 3U8RH 1G37A 3A80A 2R2MB 2PGQB 4ABGA 1W12U 1E38B 4IS5A 4FUGA 1HAYB 4X8SH 5DP6A 1T31A 3CP7A 4XBBA 2BDYA 4CHAC 3F9EA 1ETRH 1N6YA 2V3OH 2XCNA 1ESBA 1S0QA 4FU9A 5EG4A 1QRXA 3ZVFA 1TBRH 3F9HA 5GIBA 3VB3A 1UTLM 3RXGA 1QQ4A 2W7UA 1TWXB 2QGRA 2G55A 1IQJA 5EU8A 2TGPZ 2GCHF 5AHGH 3M3SA 3FVFB 1ZYOA 1QJ6B 5DP7A 1AFQC 1BIOA 2XCFA 3KQCA 1SQAA 2WINI 5JBTA 2LPRA 3VPKA 4BNRA 1BTHH 1XVOA 1C2MA 3QO6A 2ZHFH 4Q7ZA 1YPHE 3AVZA 3DUXH 1XKAC 4BAQB 4OGXA 1O3DA 1AVXA 1YPKH 1NFWA 1O5EH 2W3KA 4CRGA 4B76A 2ZECA 4FVDA 3PMJA 4XE4A 1SGIB 1F92A 2BDHA 1O3KA 3L33A 1BRAA 3RXQA 1RD3B 3MTYA 3PTBA 1NC6A 2VU8E 3GY3A 1EPTC 1D6WA 1QRZA 1P3EA 2A4QA 3SUEA 3LDXH 3K6YA 1TMUH 2XC0A 1P9UA 2ZHEH 4BAHB 1FPCH 1C2LA 4I8GA 1AU8A 4NZQA 4TWWA 5PTPA 1SG8B 3SJ9A 1QQUA 2AGIX 3H7TA 1C1NA 1SGTA 3SNAA 1PQ8A 2BX4A 2B9LA 1GCDA 4Y11E 4RKOB 4TWYA 1YBWA 2ZGCA 3A8AA 1SVPA 2UWLA 2BQ7B 1OWKA 4CHAB 3RXCA 1O39A 3SGAE 1WUNH 2C8YB 1C5TA 1G36A 2BDGA 1UTOA 3V3MA 3MNCA 5GJ4B 4HFPB 4D7GA 3GY6A 2HPQH 4Y8ZA 4YESB 2ALVA 2FM2A 4I8HA 1H9IE 2HNTC 1O3EA 2A1DB 1QRWA 1H9HE 4YLUA 2ZTYA 1C1SA 1MD7A 4Z0KA 1ETSH 3ZVCA 1FNIA 1YCPK 1KSNA 1C5ZB 3AAUA 1QA0A 1GHBF 1NFYA 1AMHA 4K3JA 7GCHF 3ENSB 2ZDVH 4I32A 2G52A 3SOSA 2ZU5A 2ZCHP 2RG3A 1V2OT 2FOCA 1QBOA 2Z94A 2SGDE 1MTSA 1A7SA 1HDTH 1MTUA 2A5KA 2CJIA 3BSQA 3ZVEA 1QNJA 1N8OB 2OCVB 3P8FA 1C5RA 1P2QA 4YT7H 2FMJA 3SUFA 1ZTLA 1ABIH 3PM3A 3SI3H 3BV9B 3E3TA 4F49A 1LHGH 4H4FA 4FUIA 1OP0A 1BJVA 4ESTE 1GHZA 3KEEA 5FPTA 1TMTH 1D3DB 3NPSA 4NIXA 1FLEE 2BD8A 5IDKA 2ODQA 2W5EA 4A92A 1BBRE 1GI6A 3GDVA 1FXYA 1TGCA 1CGIE 3MH6A 4MNVA 2QXIA 2EI6A 1LVOA 1AWFH 3RXEA 1T4VH 1DXPA 1G3EA 3E16B 1VITH 1WV7H 1BTWA 1O3AA 1SQOA 3SQEE 4K8BA 1OWHA 3UR6A 4UFDH 2K1QA 4XSKU 1BRUP 3LGTA 3GOVB 4CR9A 1HIAB 1O2PA 1O3IA 3LGWA 4JZDH 2ZFPH 5LGOA 1C5MD 3RUOA 4MNYA 2GMTC 2GD4B 2P59A 3GDSA 1JMOH 1YPJH 1B0FA 2ZU2A 3U98H 2XYAA 1C1PA 3FP8E 2BXUH 1N1LA 1O32A 2DE8A 2ZHWH 1W13U 3KF2A 1TYNA 3ZZAA 3B23B 3BTHE 1GJ7B 1V2WT 3E8LA 1LPZB 4ABBA 3BTDE 1CE5A 5JPMH 1C9PA 2TRMA 2XRCA 4X6NA 1FJSA 1QHRB 2Y81A 4X1NU 1Y3UA 1BTXA 2BY9X 3URDA 3MFJA 1INCA 2DUCA 3KNXA 2IOTA 1LPGB 1RTFB 3KQDA 3ATKA 1Z71A 5E2PA 1O2ZA 5DP4A 1O3GA 1V2KT 2CHAB 5EQRA 4B74A 1BOQA 4CH8B 5ABWA 1OYQA 3ZZ3A 1GBMA 1FN6A 1EOLA 3UQOA 6GCHF 1PPGE 1VCPA 1ZSKA 2AIPA 5E2OA 3TH3H 4X8VH 1GDNA 1CHOF 2ANWA 1MMJN 2SGPE 2OTVA 3GICB 1O2LA 2XBXA 2BX3A 1JWTA 2LNCA 1SB1H 1GGDB 2TBSA 1ZSJA 1BZXE 1EAWA 1O2HA 1NU7B 5DGJA 2ZZUH 1W10U 1K1MA 1KLJH 1PPEE 4X2YA 4ZHMU 3UNRA 1QJ1B 2D8WA 1ETTH 3ZZBA 1L0ZA 1NRSH 1ZSLA 5EXMA 3SV7A 2OD3B 1GHXH 7ESTE 3MOCA 2ZU3A 3UWIA 1CO7E 3IITA 2C8XB 4JMYA 4DG4A 4NA9H 3RDZA 4AGKA 2NU2E 1UHBB 2FOEA 2XNIA 3RM2H 3SW2B 4HGCA 2FESH 1B5GH 1EZUC 2KAIA 4E7RG 3A84A 1LKAA 1AWHB 1ZTJA 1IQFA 1ZHMA 1C5YB 5FBEA 1E35B 3SUGA 1TX6A 1O3NA 3ZZ9A 5SGAE 2SGAA 4DGJA 2GX4A 3QUMP 2Z9KA 4KKDA 1SOTA 5H4IB 1C1TA 1CU1A 1LDTT