1O3OA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3oA02
4BAQB 3PYHA 1S5SA 1GBBA 1FIZA 1TGNA 1G3CA 2V3HH 5C1XA 1AN1E 1OYQA 2BD4A 1KLTA 2H1UA 4ZXXH 5HGGA 1WAYB 1O2GH 4FVDA 2H9HA 2HWLB 1TOCB 3D65E 3SV6A 2AIQA 1DM4B 5AHGH 1LQDB 1G2LA 4JZ1A 3SGQE 4ISNA 1PQ5A 2FOHA 2W7UA 4I8GA 2H5CA 1RJXB 1MTNB 1ZHPA 2C8XB 1ELAA 3A8CA 1IQIA 5IDKA 1UTPA 3PWCA 1C5MD 2AEIH 4I8LA 3HATH 4WMEA 5DP5A 1TMUH 1NFUA 1GHAG 3LC3A 3RXEA 1IQGA 1QBNA 1ELBA 1F5RA 4WMDA 2GGVB 2QXIA 4JCNA 3A84A 1KYNA 1TQ0B 1GHXH 1GJ9B 1SSXA 1XX9A 2CF8H 1DT2A 2ZPRA 1SVPA 2J34A 3SU2A 2LNCA 1TRMA 1MKWK 1O2NA 1EB1H 1GJ6A 1ZZZA 2VJ1A 4GHQA 2A1DB 3M5LA 1EB2A 4LK4A 1GWAA 1GBJA 3RMNH 2W3IA 2VH0A 2C4FH 1PQ7A 3BTGE 2BY6X 3EAJA 1GI3A 1K2I1 2Z9IA 2Q1JA 1BB0B 1VITH 1MCTA 1SHYA 2PHBA 1FLEE 1P09A 2XC0A 2OC1A 2SNWA 1GI6A 1TNJA 1JIMA 4YO9A 3SUGA 2ILNA 1UO6A 1BUIA 1YPEH 3T2NA 2PSYA 5HYOA 4THNH 1LVYA 2ZCHP 1NRNH 1PPGE 3VEQB 5C20A 2FYRA 1FPHH 2GCTC 3ZVEA 1A0JA 1FY3A 1TFXA 4Y8YA 2OQ5A 1L4ZA 1DITH 1KIGH 3RLWH 3B23B 2VIQA 5A8YA 1ANEA 2PKAB 1CBWB 3TGJE 4K60A 2NU0E 1EZXC 5J4QA 2Y80A 1SFIA 4NGAH 3GDVA 3SNCA 3F9HA 1D3TB 4ZHLU 1TNIA 7GCHF 4MNXA 5A0BA 2XBWA 2O8LA 3MU4A 1SOZA 2PKAA 2OP9A 1VR1H 2XWBI 1VZQH 1C2MA 3O8BA 1YLDA 1GI8B 2TBSA 1V2JT 1JWTA 1C5UA 2ANMH 3HK6B 1D3PB 1KLJH 1TABE 3M37A 1UTOA 4AFZA 4GCHF 4U01A 1W0YH 3EE0B 1MBQA 4TY6A 1Y3YA 4B2BA 3GCHB 4AG2A 1T8LA 2BDGA 2ZEBA 1G3BA 2OUAA 3TH3H 1L1NA 1A4WH 1M9UA 2YNAA 1FJSA 1GJ7B 2PUQH 1ZHMA 2SNVA 1HJAB 4X6OA 1HAXB 1C1QA 2QXHA 3VFEA 2O8WA 3F6UH 5DP7A 1OPHB 2J92A 3T28A 2J38A 1KXFA 1TYNA 3SHAH 4A1XA 1A0HB 1CGIE 2Z6BD 2P3UB 5ETXA 2R0LA 4K1SA 1YPLH 1Q3XA 3CP7A 3L3TA 1KTSB 2FESH 1KSNA 4X1RU 5FPSA 3MO6A 2NU2E 2G8TA 5G4BA 1AWHB 2OC0A 3SO3A 4I8JA 3ATIA 3ZZDA 1X7AC 2FZZA 1EPTB 1GCTB 3JZ2B 1TONA 2Z94A 3A83A 2BLQA 1GG6C 3E0NB 3K65B 4I8KA 4Y10E 1SQOA 5TCCA 2HNTF 1EKBB 2ZU5A 2UUKB 1XXDA 1OXGA 1RRKA 3PLKA 6GCHG 4X1PU 1FY1A 3ZVAA 2TIOA 1OOKB 2SGQE 2R2WU 3TK9A 4ZROA 1AU8A 1OWIA 1J9CH 2WV4A 2VH6A 3OU0A 4UFFH 4INLA 3URCA 2WINI 3KNXA 4K8BA 4ISOA 4B2AA 5GXPA 2TPIZ 3RXOA 4ABBA 3RP2A 2A5IA 2ZCLP 3QZQA 1CVWH 1SGYE 1YLCA 4CBNA 1SG8B 2G00A 2F9OA 3MYWA 5F6MA 1KXBA 1BCUH 2LPRA 2R0KA 1Z8GA 4NWLA 1RS0A 5I46H 1SHHB 5DO4H 3S7HB 1LPGB 1NRPH 1XMNB 3PMAB 4OS2A 1GPZA 3M7UA 4JMYA 2BDBA 1C5NH 3LDXH 2NWNA 4NG9H 2FYQA 2VU8E 2ZKSA 1AIXH 2F9VA 3BG4C 3M3SA 3P17H 2H6MA 2A7JA 1O3MA 1CHOG 4HTCH 2BLOA 3D23A 2PGQB 1QTFA 4AORA 2ZO3H 5EXLA 3UNSA 3VB3A 1ZR0A 2ZHEH 1BMLA 4YM9A 1TX8A 1V2OT 4X6MA 5EQRA 4HFPB 1C1PA 1GI4A 3RMLH 3F68H 4RN6A 2EI7A 3MO3A 5F03A 3B8JA 1E38B 1EASA 1SR5C 1S81A 1OP8A 1C5OH 3ODFA 1AD8H 4Z0KA 2XCFA 5JBCS 4D7GA 5BPEA 2I6SA 5E0HA 1PYTC 2XBYA 1DXWA 1MQ5A 5FBEA 2J4IA 4F49A 1K1IA 2JH5D 1AKSB 1BHXB 2RA3A 1YPGH 1ZSLA 8KME2 2F3CE 3M5OA 2QF0A 2GD4B 3PB1E 4ZKOU 2HNTC 1UJ1A 1W0ZU 3U8TH 3SBKA 2FOMB 1EAUA 2PV9B 1HAYB 1THRH 1F7ZA 2WUBA 5TCAA 3ZZCA 1LHGH 2Y5FA 1TLDA 4BTTB 2BLVA 1TIOA 3MNSA 2IOTA 3E3TA 2Y82A 1J8AA 3RXDA 2ZGJA 4BOHA 4OS7A 3MU8A 3M5NA 4K1TA 3VGCB 1TNKA 3V7TA 5DP4A 1ETRH 1FN6A 1QR3E 3U1JB 2FOEA 2VVUA 3A85A 2VGCB 1A3BH 3ZZBA 1DDJA 3KQDA 5GJ4B 1ELGA 2FWWA 1QHRB 1VGCC 4X8SH 1SGTA 3QLPH 4KTSA 4H6TA 4ZAEA 4RKOB 4MG3A 2BOHB 5A8ZA 4XE4A 3M61U 2Q6DA 2ZGBH 3TJOA 2ZCKP 4B76A 5TJXA 1TNHA 3DT0H 1YP9A 5L2YH 8GCHF 4NIWA 3UQOA 5JPMH 1C2JA 1LPKB 1W8BH 1EQ9A 1V2ST 1C5QA 5A09A 1XUIA 2ZG0H 3DD2H 1GJDB 4NSVA 1Z71A 5LPFA 4HZHA 1MU6B 5DP3A 2VIPA 1MTUA 1O2ZA 4ZHMU 1NS3A 1NC6A 2ALVA 4WY3A 1O5EH 2HPQH 2V6NA 3NUMA 1V2NT 1AGJA 1GBLA 2PW8H 3SHCH 4K2YA 1KLIH 1O30A 1HAIH 2XNIA 1V3XA 3LPRA 2ZHQH 1PPBH 2GKVE 2RA0A 4I33A 1P9UA 4WMFA 1AVXA 4DG4A 1VJ9U 1HAZB 2FOGA 1HAHH 1TBQH 2GMTC 1HGTH 1O2TA 1FN8A 2BX3A 1V2TT 4UDWH 3EYDA 3P95A 7GCHG 3NPSA 2BOKA 1RIWC 1P05A 3A86A 2ZZUH 2C90B 2PGBB 2M5TA 1WYKA 1O2PA 3SNAA 1K1OA 2ODYB 4DURA 1C9TA 1T31A 3GY3A 3PV4A 3ATLA 3AW1A 1C5ZB 3T27A 2DE8A 4GCHG 2VIWA 2VINA 1MTVA 2Y81A 2PKSC 1IQNA 4U32A 4WH8A 2FX6A 2Y5GA 1O2JA 1C5YB 3PTBA 4CHAC 3UPEA 2TGTA 3E6PH 3V3MA 2KAIB 1TWXB 3FZDA 1AMHA 3GY4A 2QF3A 3LGUA 3PMHB 1D6RA 2BD7A 3GCNA 5EXNA 5EPYA 5FXLA 1O3OA 2HNTE 4ISIH 2H9EH 4TYDA 2BZAA 3A7XA 3TU7H 6LPRA 1RFNA 1SGPE 3PO1B 3BTHE 4AZ2B 4Y8ZA 1SGNE 3K6YA 3QDZB 1EJMA 3RXAA 2NU4E 4A1VA 3RUOA 1JRTA 1O3CA 3MU1A 2ZDMA 3FAOA 5C5OA 2J94A 4DGJA 1LHFH 1TPPA 4K1EA 4MLFB 1IQMA 1UCYH 1O3DA 2WUCA 3P8OA 4DVAU 1QL7A 3F1SB 3N7OA 2ANWA 1F0UA 2IPHA 4ZKSU 1ANCA 3RXQA 3QGJA 3QTVH 1P9SA 1NT1A 1LMWB 1TAWA 1UTLM 1JIRA 1CU1A 4XOJA 3ZYEA 1GVLA 2P8OC 1GJ5H 3BTME 3TH4H 1AB9B 3RU4T 1C4V2 1E34B 2P93A 2VB0A 5LPEA 5BRRE 3H7TA 1EZUC 4JYTA 1O37A 4GUXA 1BBRK 5J4SA 1LVOA 1ZOMA 2F9NA 2AYWA 2UWLA 4Y79A 1O38A 5EU8A 1FY8E 1P10A 1C2DA 3ZZ6A 2F9BH 2ZDVH 1BBRH 3I77A 1QA0A 3S0NA 1OWKA 1H8DH 3M3VA 4WJG2 1RXPA 3S9CA 1DWDH 2OBOA 4XDEA 3NXPA 1WU1A 2HALA 4AYVB 1ARCA 1TPAE 3R0FA 4MNWA 2V35A 3M5MA 3H5CB 2A4QA 5A0AE 3SNBA 3GY5A 1A5IA 3STIA 1C1NA 3VXFH 5C5NA 1MUEB 5FX5A 4FUDA 1C9PA 4HGCA 5E2OA 1NY22 4LOYH 4MPXA 3OYPA 2QY0B 3QX5H 1JBUH 3BEUA 1QQ4A 4BXWA 3BEFB 3PMBB 1MZAA 1LDTT 1V2MT 4PROA 3T62A 2B7DH 3BSQA 1NTPA 1P2OA 2GTBA 1A5GH 3MHWU 4X8VH 1DANH 1OS8A 3LT3A 3RXHA 1O3AA 3KCGH 2CHAB 1O2RA 3M7QA 1V2KT 1XUJA 2VWOA 3SUEA 2EA3A 1HYLA 1O5CB 3FZZA 3MFJA 2HLCA 1PQ8A 3GYMA 3UQVA 3Q3KA 4H4FA 4Z6AH 5JBAS 2HVXA 1O31A 2ZP0H 4X6NA 1QFKH 1UVPA 3BTDE 3MH4A 2B0FA 3ZZ4A 2PWXA 4NIYA 2PR3A 3S69A 3PWBA 4A7IB 3JZ1B 1BA8B 5CHAB 3RDZA 1YPMH 4F4OC 1GVZA 4NZQA 4OGYA 1O3HA 1K1NA 1EATA 1F0SA 1ZSKA 1C5XB 1CGJE 1O2LA 2V0BA 1HJ9A 4IMZA 4Y76A 1QURH 3UIRA 4FUBA 1LKBA 4B2CA 3F9GA 1SGCA 1G32B 1N1LA 2WPKS 3K9XB 4AGKA 5DKMA 1ELFA 1UHBB 2STAE 1JOUB 3T25A 1VJAU 3CS0A 1TNLA 1P3EA 1Y8TA 1TB6H 1YCPK 5F8XA 1CT4E 4Q2KA 1YPKH 2ZPSA 1MTNC 2ZFRH 3ATKA 2A4RA 2CGAA 5A8XA 1BMNH 4CBOA 1YCPH 1K1PA 3A8DA 1Y3UA 2AMPA 1E35B 2BVXH 2GP9B 3VB6A 4Q7YA 2FI5E 1BJVA 1FAXA 4J2YB 1YPHE 1Z1IA 1C1SA 1QRWA 1XUFA 4OGXA 3RMOH 1MKXH 1ANBA 2BVRH 5EQQA 3KGPA 1WTGH 1V2PT 3OY5U 2JH6D 4INHA 2VWNA 1SI5H 4MTBA 1V2VT 1KDQB 1FY4A 2BZ6H 5T3HA 4UFDH 2BY7X 2UWOA 1SL3A 4FUEA 1MD7A 2PUXB 3OX7U 5B6OA 4WXVA 2AGEX 1GDUA 1DSUA 1XM1A 2BXTH 8GCHG 1NFWA 5L6NH 1HIAB 2FM2A 4ABAA 4I32A 2GVFA 3VB7A 1NRRH 4Y71A 2CXVA 3A8BA 5HXFA 1AFQB 4JZEH 3NZIA 1KXAA 2P3FH 2IJOB 3OTJE 4Y0ZE 1DY8A 4AB8A 1UVOA 4MVNA 1BITA 2BD9A 2QAAA 1GDQA 1O36A 1O2WA 4IC6A 1ESBA 2SGFE 2STBE 1RTKA 1MTSA 5EODA 1K1JA 3LH3A 3TLOA 1FAKH 2ZGCA 1ZTLA 2EC9H 2F9UA 1ABJH 1EP5A 4AYYB 1P06A 2UUJB 4FUHA 3ZVDA 1S6HA 5JBBS 1GI7B 3P8FA 1HAVB 1XVMA 1ZYOA 2WYJA 2K1QA 1ZJDA 1NRQH 3QGNB 1CBWC 2BDHA 2XC4A 1C5VA 3RXIA 2ODPA 3TJNA 4AFUA 3T5FH 1W2KH 3TJVA 5E8EH 2GDDA 1FXYA 1UK4A 2VIVA 5F8ZA 1N6YA 2OLGA 3AASA 3PM3A 1HAVA 2VIOA 2RG3A 2XXLA 1QNJA 2EI6A 3BTFE 4BAMB 2NU1E 3MWIU 2ZHDA 4YOJA 2TGDA 1O2HA 4KTCA 1RGQA 1DY9A 1UMAH 2VWLA 3A8AA 3K2UA 2ZTXA 1O3PB 5JDUB 4NZLA 1J16A 2EEKA 1Y3XA 1GI1A 2SGAA 4MNVA 1HFDA 2RDLA 1AVWA 2GCHF 2ZGXH 3SI4H 4NA8A 1DSTA 2R3YA 1DWCH 1CT2E 3GCHC 5HM2A 1SLVB 2CN0H 3ZZ5A 1DXPA 4JZFH 2ZHFH 1F92A 3PMJA 4MDSA 4MPUA 5DGJA 1HJAC 4FU8A 3MTYA 2JETB 2ZFFH 4ABEA 1TGCA 1C2IA 1B7XB 1E36B 4X8TH 1IQKA 1EPTA 3BTTE 3NWUA 1UTNA 2ULLA 4CRGA 2C93B 3SNDA 3VB5A 1XUGA 2ZGHA 3AVZA 5LGOA 1G30B 3ZZ3A 1HNEE 3TNTA 2ZECA 1A2CH 3SORA 1VCPA 3QTOH 2W26A 1AFEH 2V3OH 3DFJA 1SGFA 1BTHH 1L1JA 4DIHH 2Y6TA 1PPHE 4XBDA 1ZRKA 3BG8A 1NROH 1QJ7B 3RXFA 1GGDB 2A0QB 4WH6A 1EPTC 1ETTH 1GCTC 2JH0D 3FANA 1O5BB 1BHXF 1GMDF 2GT7A 4FUFA 1ZGVA 3BV9B 4ZUHA 2OC8A 1DX5M 5GDSH 2Z9KA 1SOTA 2Z9GA 1Z7KA 4BAOB 4INKA 2ZFTA 1SLUB 1P04A 1ELCA 3HKJB 3B9FH 1LPZB 1W10U 4RKJB 3EQ0H 3PTNA 1CA0B 5AVDA 4Q7XA 2SGPE 2W7SA 2CV3A 2ZDKA 2WPMS 2XW9A 3K6ZA 5K7RA 3ODDA 2BYAX 2VVCA 3FVFB 5EQSA 4D8NA 3U9AH 4O3TA 1OWDA 3LC5A 1CHGA 1W7XH 1QJ1B 3RXJA 1YF4A 2W3KA 2ZTZA 4BTUB 1V6DA 5T6GA 1T7CA 1C2FA 3LGVA 5A2MH 3MU5A 4NIXA 3ZVGA 1BDAA 1HRTH 2VNTA 4UFEH 1ELEE 3E16B 1FZZA 4R8TB 1BRAA 1SC8U 2BDYA 3TJUA 4A6LA 1AUTC 1ESTA 3PLBA 4B75A 2OXSA 1N6XA 1WBGB 4GVUA 2FDAA 3F9FA 4X8UH 5F8TA 4CRDA 1A5HA 2HPPH 4ISHH 1GMCF 1FONA 1P2MA 3MH6A 4NIVA 2B9LA 4YLUA 1EOLA 1ID5H 2Z3CA 4A5TS 1OSSA 1TA2A 4CRAA 4JK6A 2J9NA 4GPGA 3LGWA 1P2KA 4NSYA 3Q77A 1WUNH 1GL0E 1IOEA 1T4VH 1WSSH 3CENA 1AKSA 2FTLE 1SMFE 3RXBA 1KTTB 2VWMA 3A82A 4I8HA 2D1JA 3M7TA 1CQQA 1TGTA 4U30A 3UWIA 1N8OB 1GBAA 1DOJA 3HGNA 5EOKA 5JB8S 2C8YB 4AFQA 6CHAB 1MD8A 1O2XA 3HKIB 2ZU3A 5JBTA 5I25A 3UWJH 4DOQA 5AF9H 6ESTA 1BTWA 1QY6A 3GCTF 3A7TA 2AGIX 3GCOA 1P03A 1J14A 1AWFH 1O33A 3A80A 4X2YA 1WQSA 4GAWA 2Z3EA 4K69A 1UTJA 1DICA 1QQUA 4UE7H 4B73A 4K8YA 2DUCA 4Q80A 1ZMNA 4MNYA 8ESTE 1HDTH 1CE5A 3ELAH 1QL9A 1PPEE 3GISB 1MBMA 1XKBC 2QC2A 2XBXA 1CT0E 1KXCA 1K28D 1TE0A 2R2MB 1BRCE 1O5FH 2FIRH 1C2HA 4JYVH 1SBWA 1C1OA 1NO9H 2FXRA 1OWJA 1MTWA 3S9AA 3T29A 3RXGA 1D4PB 1ZPCA 2XTTB 1K21H 5C2ZA 3P92A 1FIWA 3VGCC 2ZA5A 1FY5A 2C8ZB 2VGCC 1ZSJA 3ZVFA 2AMDA 3BTEE 1O35A 3QUMP 3MU0A 1HAPH 3P8NA 2ZDNA 1GMHF 3OSYA 4ABJA 3SU4A 2FLBH 1QL8A 1H4WA 4H42U 1GDNA 5AFZH 2FTMA 2FMJA 4ZKRU 3SV8A 3SUFA 1C5LH 2BM2A 1GHBF 4SGAE 1EJNA 2G52A 2OTVA 2G4TA 1GI5A 2A2XH 3ZZ9A 5ABWA 3TGIE 2PKSB 4AG1A 2ZC9H 5DP8A 1O34A 1OWEA 2FI4E 1FNIA 1TX7A 3DHKH 3A89A 2G5VA 1MH0A 2F91A 3UREA 1GBCA 1OP2A 1TGBA 3LIWA 4Y7BA 3RXPA 1EXFA 3TVJB 4NA9H 1V2LT 4O03A 4AX9H 2Y5HA 3SU1A 1O2SA 1BTYA 1LQEA 4OS6A 1AO5A 1KXDA 1ZMLA 1SGFG 3SU3A 3S7KB 3GDUA 1ARBA 3RXSA 1B5GH 4CREA 1AQ7A 3Q76A 3BF6H 2P59A 1TNGA 1O3EA 2ESTE 3LGIA 4Y7AA 1DWBH 1GJAB 4AGJA 4DY7B 5DP9A 4FU7A 4X2WA 1THSH 2UUFB 2GX4A 1IQJA 1K1MA 2QYIA 3SJKA 1CO7E 1LHCH 5JYIA 1NRSH 2C3SA 3A7WA 3U1IB 1ZRBA 1AHTH 1O3BA 4FUCA 1H9LB 1QBVH 3RU4E 2OINA 5GIBA 2KAIA 3DA9B 3ZV8A 1P57B 1YC0A 1P3CA 2R3UA 1UCYK 2H9TH 2QCYA 3EA9A 3KN2A 3L33A 1GHWH 1UTQA 3ATMA 4UEHH 2A2QH 6GCHF 1P01A 2PTNA 1ELDE 1D9IA 3IG6B 3DUXH 4VGCB 1YPHC 4BAKB 2QXJA 2FPZA 1CGHA 1RD3B 4NCYA 4LZ1H 3UNRA 4E7RG 4IS5A 3TK6A 2ODQA 2BQ7B 3RU4D 2BD5A 4ABDA 2GCHG 1S0RA 2HRVA 3KEEA 4ISLA 1HJ8A 2XRCA 3UR6A 1C1VH 4ESTE 1TALA 1LCYA 1QBOA 1Z1JA 1TMBH 1TPSA 1JXPA 2IN2A 1C1WH 1AI8H 3SGAE 4CH8B 4ZMAH 2FLRH 3LONA 1GJCB 3NCLA 3R3GB 1Y5BT 1QCPA 2GV7A 3A7ZA 2GV6A 4XBCA 1GBHA 1TOMH 3PO1C 4ABHA 3FFGA 3E1XB 3D62A 1WOFA 3RM2H 3STJA 1O2YA 3ESTA 3QWCH 1AY6H 3RM0H 1QB9A 4ZXYH 1O2KA 3SUDA 3RXKA 1W7GH 3C27B 1IHSH 3U8RH 4CH2B 2R9PA 3LJJA 3RMMH 2J95A 1D3QB 1S0QA 1PPCE 1PQAA 1K9OE 1NU7B 5JB9S 1GMDG 1BTXA 4O3UA 4IW4E 3LKWA 1C2KA 1HUTH 3I29A 1EJAA 2GZ8A 1YYY1 1AB9C 1TRYA 2WPIS 4FXGH 5GCHF 1K1LA 2FODA 5H4IB 2A32A 2H5DA 1Z6JH 3P6ZB 1FDPA 3ZZ8A 1T4UH 4E7NA 2GDEH 2G81E 2GT8A 4A1TA 2BLWA 5C1UA 1J15A 3URDA 5C67A 1L2EA 3TNSA 1IQHA 4GLYA 1H9IE 2FOCA 1T8NA 4ABGA 2ZDAH 8LPRA 1O5AB 3U98H 4O9VA 2QGRA 3UNQA 5HM9A 2WPHS 3TPIZ 3SQEE 2OCVB 1DE7H 1ACBE 1GBEA 1GCDA 4Y11E 3EA8A 3M35A 2SGEE 2BD3A 3M3TA 2PSXA 3T26A 3LGTA 1LVMA 1HAOH 1LO6A 2FS9A 2BB4A 3RC4A 2OBQA 2ANKH 2ZF0H 3RXLA 3SU0A 1GBIA 4XBBA 1ZMJA 1NU9A 1A61H 1GMCG 3HPTB 1EAIA 1YBWA 1UVTH 1SFQB 2YNBA 1LTOA 1V2QT 4D9RA 2ZPQA 2G51A 1U6QA 2FOFA 4BAHB 3BTKE 5ESBA 5EPNA 1QGFA 1Z8JB 1T8MA 2CHAC 4Y6DA 2WYGA 2XWAA 4I7YH 3A7VA 2GCTB 3ZVCA 3C1KA 1LHEH 2A4OA 2BY5X 2QIQA 3SV9A 1SLWB 1XVOA 1NFXA 1OX1A 2BVSH 1MKXK 4OS4A 4J1YA 1Z6EA 1IQLA 1UHBA 4X1SU 1QJ6B 2P94A 3UY9A 3Q00A 3Q3YA 1C4U2 3P70B 1MKWH 1BIOA 2THFB 3PROA 1W12U 3LJOA 1OP0A 3SV2H 3SJ8A 3VPKA 1ELTA 1P11E 5CHAC 2BY9X 3V12A 1TBRH 1FI8A 1HXFH 3GCTG 1GI9B 2FS8A 4K5ZA 1XXFA 2YOLA 2ANYA 1BT7A 1YCPM 1CA8B 1W3CA 5IYTA 5EXMA 1SGQE 5EW2H 4OS5A 4SGBE 4K3JA 2O9QA 1S82A 3E0PB 1BZXE 1DWEH 3MH7A 4X1QU 1G37A 4YT7H 2D8WA 3PLPA 2ZWLH 3TITA 1KDQA 1QRXA 3E91A 3RC5A 1W11U 4NFFA 4YZUA 3I78A 3RXRA 2Q6GA 1UVSH 2I6QA 1C1UH 1YGCH 1C5WB 4UD9H 2UUYA 1HIAA 1TGSZ 3RXMA 4ZH8A 3UOPA 1GL1A 4CR9A 2FOBA 1V2UT 3KIDU 2BDAA 4BNRA 1GJBB 1SGDE 3VB4A 1CSOE 3RXUA 1DLKB 2AERH 2FX4A 1GHVH 2AFQB 1GMHG 3F9EA 1TMTH 3O8CA 1JRSA 1VITF 2Y7ZA 3BN9A 2AIPA 1O5DH 3D49H 4NFEA 2CJIA 4X2VA 1A7SA 1G36A 5EGMA 1GHBG 2HOBA 1D3DB 1Y5AT 3A87A 1W14U 3VXEH 3ZZ7A 1O3JA 1P2NA 3KQEA 1AFQC 4A92A 2XYAA 1A3EH 1GG6B 2W5EA 2BDIA 3BTQE 3HK3B 2BQ6B 5ESTE 1JMOH 3V0XA 1G9IE 4BANB 1O2OA 2P16A 4X2XA 1GVKB 1XUHA 1OWHA 3RXVA 1TQ7B 5L30H 5FAHA 5LPRA 1EAWA 3O8DA 2D2DA 4JK5A 5CMXH 1ETSH 1S6FA 4UFGH 1C5PA 1F0RA 2XC5A 3CS7A 2Q6FA 4UONA 3SV7A 2DE9A 1EP6A 3GDSA 5FPYA 3TH2H 1QRZA 2ZI2H 1UK3A 9LPRA 4YT6H 3G01A 1E37B 3MMGA 1T8OA 1C2EA 2P95A 4KGAA 2WPLS 1IAUA 5EG4A 4FVBA 2H2ZA 1HLTH 2BHGA 4AB9A 1AZ8A 4AOQA 3Q3XA 5E2PA 1A1RA 5E0JA 7KMEH 4XFQA 1W13U 1C5TA 1TBZH 1C4Y2 4B74A 1SQTA 2WV5A 1YM0A 3M36A 1GBTA 1OYTH 3SW2B 2XBVA 4DJZB 3L6PA 3BG4B 2B5TB 2FP7B 2QXGA 2AH4X 2F9PA 1C5SA 4RSPA 1INCA 1MCVA 2ZNKH 1UTKA 5EW1H 3MNBA 1T32A 1QB1A 1BTPA 3AAUA 1V2WT 5GWZA 4KELA 3SU5A 1YPJH 4BTIB 2ZFPH 2ALPA 3NKKA 4KTUA 3UOUA 3EGKH 1ZGIA 2JETC 1IHTH 2FO9A 4TPIZ 3A7YA 3LU9B 5DPAA 2A7HA 4ZKNU 1DLEA 1O2MA 4CRFA 4I31A 5C3NA 4LXBH 2QV1A 2Y7XA 1GBFA 3SJOA 4GHTA 3KQCA 1AUJA 1UCYE 4M7GA 1GJ8B 2PTCE 1NESE 1MZDA 1HPGA 4FUIA 2SFAA 3NK8A 4D9QA 4E05H 1S85A 3ZYDA 1C1MA 1BRUP 1H9HE 1GGDC 3WY8A 1NFYA 4QT8C 2BX4A 4JYUH 4YTAA 3DFLA 4NA7A 3GY8A 1P02A 1C2GA 2B8OH 4MPWA 5CE1A 1VCQA 1GI2A 3QO6A 1GHYH 1Y3WA 3MOCA 1MMJN 2OC7A 1P12E 3TGKE 3UFAA 1O3NA 5GCHG 3V13A 1GHZA 3MNCA 4GSOA 4ABFA 1P2QA 4IN1A 3A81A 3P8GA 4X6PA 3TIUA 1BBRE 1BJUA 1CA0C 1DFPA 3U69H 3TK5A 4YLQH 5FCKA 1O3KA 5T6DA 1L4DA 1DPOA 4TPYA 1GHAF 1F5LA 3ENSB 2A31A 1J17T 2ZQ1A 3UTUH 1O3IA 4OS1A 4IMQA 1VGCB 5FCRA 2BTCE 1QA7A 1QB6A 4AN7A 2O8TA 4B1TA 1G3EA 1NZQH 1ZLRA 1DUAA 3EDXB 2A7CA 2ZHWH 1FPCH 3ZVBA 1Y5UT 1NPMA 3SN8A 3MNXA 2VVVA 3SJ9A 1L0ZA 4MPVA 1LKAA 3A88A 4DT7B 4JZIA 2BD8A 1S84A 4ASHA 1Y3VA 3GY2A 3E90B 1BRBE 2A45B 2NU3E 3ITIA 3IWMA 1WTHD 1O2UA 1O2IA 1O2VA 4IBLH 3QK1A 1PPFE 2C8WB 1ZJKA 1ABIH 1V2RT 1P0SH 2A5AA 1C1TA 1EUFA 1DVAH 2ZTYA 1F5KU 3BTWE 1O0DH 3RC6A 1A46H 2WPJS 1A0LA 2A4GA 3FP6E 1O5GH 1Q31A 2OQUA 3RXCA 3BIUH 4Y8XA 2QN5T 1RTFB 1FQ3A 5L2ZH 1N8OC 1P2JA 1UK2A 1MAYA 2BQWB 5K0HA 1AVGH 6CHAC 2Z7FE 1B0FA 1H8IH 2XCNA 3ATWA 2GMTB 2SGDE 3U8OH 3LOXA 4FUJA 3RLYH 4R0IA 3LGYA 3LH1A 2EI8A 1F0TA 1ZTJA 3MI4A 5DK1A 2PFEA 1RIWB 5FPTA 2ZDLA 1XUKA 2ZIQH 4KKDA 1GI0A 2AS9A 4NWKA 4ABIA 4LZ4B 2ZU4A 1YKTA 2FOAA 4DCDA 3QN7A 1HB0B 2GZ9A 3ZV9A 3E8LA 4WF8A 2ZU2A 3BIVH 4X0WU 5FX6A 3H7OA 7ESTE 3KL6A 4Q7ZA 2G5NA 4DW2U 1SB1H 1SQAA 3MH5A 2Z9JA 2CMYA 1C2LA 4CR5A 1HCGA 1O3LA 1AE8H 3AAVA 4CHAB 4XSKU 1SGIB 2F83A 1ZPZA 2HGTH 3HGPA 1SGEE 1DS2E 2BMGB 1KXEA 1MU8B 1O3FA 3SOSA 3SGBE 1ZHRA 5HMAA 1OKXA 5C1YA 4HI3A 2AGGX 1K22H 1PFXC 4FUGA 1THPB 2UWPA 1Z8RA 1HXEH 3SQHE 1S83A 1ZTKA 2BDCA 1BQYA 4IN2A 1VITG 2D26C 4WXIA 5LH8A 2JKHA 3W94A 1LVBA 2RCEA 4X1NU 1FV9A 2TRMA 2CF9H 2O8MA 4YOGA 1WV7H 9ESTA 2TGAA 4CRCA 4O97A 1GBKA 4JZDH 1O39A 1E0FD 3SNEA 5AFYH 3W95A 4IGDA 3AW0A 1QIXB 2Z9LA 2ZU1A 1C1RA 1ESAA 3BEIB 4KP0A 4BXSA 1IQFA 4H6SB 2G55A 1BTZA 2P8OB 2VIDA 5A0CA 1Z8IB 3RXTA 2AMQA 1F2SE 5PTPA 1DUEA 2ASUB 1SGRE 1TRNA 1XKAC 4U2WA 4WWYA 1PYTD 3FP7E 1Q2WA 4MQAA 3FP8E 2QA9E 5GPIB 3UR9A 1G2MA 4AFSA 4D7FA 2GZ7A 1HAGE 3UUZA 3GOVB 3KQBA 3MO9A 3S9BA 3SJIA 1LHDH 1H1BA 1O3GA 1WQVH 5SGAE 5DP6A 1VCWA 4D76A 5E0GA 1EAXA 3SI3H 1ANDA 1TPOA 1GJ4H 3GY7A 1WCZA 1AZZA 1GBDA 1KY9A 2ZFSA 1BOQA 3IITA 4YOIA 4FU9A 1EZQA 1ELVA 1RTLA 1D6WA 1L1GA 2BY8X 4TWYA 1TA6A 1NN6A 1PPZA 4TY7A 4YESB 1P8VC 1EX3A 4Y0YE 2A5KA 1SLXB 5DJ7A 1UTMA 1MAXA 2ZQ2A 4VGCC 1EZSC 1G3DA 3ZZAA 1AE5A 1EOJA 1FMGA 5DG6A 3KHVA 4CRBA 1CHOF 2ZFQH 1BMMH 1ZPBA 2TGPZ 1C5RA 3SU6A 2FI3E 3GICB 1BMAA 1HBTH 2O8UA 3GYLB 1MQ6A 4DIIH 1SPJA 1TX6A 2FEQH 5T6FA 1FUJA 1BTUA 1UVUH 3SZNA 1NM6A 3GY6A 5FHTA 3QZRA 3OY6U 3KF2A 2J2UA 5FBIA 1IQEA 1P2IA 2OD3B 2Z3DA 1GBMA 1ORFA 7LPRA 4IC5A 2PLXA 4E06H 1Y59T 3O8RA 1HV7A 1B0EA 1PJPA 2BD2A 1O2QA 4ZHAA 4TWWA 2P3TB 3EA7A 1O32A 2G4UA 4B71A 2BXUH 4WVPE
chains in the Genus database with same CATH superfamily
4BAQB 3PYHA 1S5SA 1GBBA 1FIZA 3FKSD 4ACAA 1TGNA 1G3CA 2V3HH 5C1XA 1AN1E 1OYQA 2BD4A 1KLTA 2H1UA 4ZXXH 5HGGA 1WAYB 1O2GH 4FVDA 2H9HA 2HWLB 1TOCB 3D65E 3SV6A 2AIQA 1DM4B 5AHGH 1LQDB 1G2LA 4JZ1A 3SGQE 4ISNA 1PQ5A 2FOHA 2W7UA 4I8GA 2H5CA 1RJXB 1MTNB 1ZHPA 2C8XB 2JJ2D 1ELAA 3A8CA 1IQIA 5IDKA 1UTPA 3PWCA 1C5MD 2AEIH 4I8LA 3HATH 4WMEA 5DP5A 1TMUH 1NFUA 1GHAG 3LC3A 3RXEA 1IQGA 1QBNA 1ELBA 1F5RA 4WMDA 2GGVB 2QXIA 4JCNA 3A84A 1KYNA 1TQ0B 1GHXH 1GJ9B 1SSXA 1XX9A 2CF8H 1DT2A 2ZPRA 1SVPA 2J34A 3SU2A 2LNCA 1TRMA 1MKWK 1O2NA 1EB1H 1GJ6A 1ZZZA 2VJ1A 4GHQA 2A1DB 3M5LA 1EB2A 4LK4A 1GWAA 3F2FA 1GBJA 3RMNH 2W3IA 2VH0A 2C4FH 1PQ7A 3BTGE 2BY6X 3EAJA 1GI3A 1K2I1 2Z9IA 2Q1JA 1BB0B 1VITH 1MCTA 1SHYA 2PHBA 1FLEE 1P09A 2XC0A 5EJZA 2IJD1 2OC1A 2SNWA 1GI6A 1TNJA 1JIMA 4YO9A 3SUGA 2ILNA 1UO6A 1BUIA 1YPEH 3T2NA 2PSYA 5HYOA 4THNH 4XD7D 1LVYA 2ZCHP 1NRNH 1PPGE 3VEQB 5C20A 2FYRA 1FPHH 2GCTC 3ZVEA 1A0JA 1FY3A 1TFXA 4Y8YA 2OQ5A 3U28C 1L4ZA 5DN6D 1DITH 1KIGH 3RLWH 3B23B 2VIQA 5A8YA 1ANEA 2PKAB 4F55A 1CBWB 3TGJE 4K60A 2NU0E 1EZXC 5J4QA 2RDEA 2Y80A 1SFIA 4NGAH 3GDVA 3SNCA 3F9HA 1D3TB 4ZHLU 1TNIA 7GCHF 4MNXA 5A0BA 2XBWA 2O8LA 3MU4A 1SOZA 2PKAA 2WHXA 2OP9A 3PRBA 1VR1H 2XWBI 1VZQH 1C2MA 3O8BA 1YLDA 1GI8B 2TBSA 1V2JT 1JWTA 1C5UA 2ANMH 3HK6B 2J98A 1D3PB 2YMSD 1KLJH 1TABE 3M37A 1UTOA 4RI0A 4AFZA 4GCHF 4U01A 1SQRA 2HVYB 1W0YH 3EE0B 1MBQA 4TY6A 1Y3YA 4B2BA 3GCHB 4AG2A 1T8LA 2BDGA 2ZEBA 1G3BA 2OUAA 3TH3H 1L1NA 1A4WH 1M9UA 2YNAA 1FJSA 1GJ7B 5CDFE 2PUQH 1ZHMA 2SNVA 1HJAB 4X6OA 1HAXB 1C1QA 2QXHA 3VFEA 2O8WA 3F6UH 5DP7A 1OPHB 2J92A 3F2GA 2J38A 1KXFA 1TYNA 3SHAH 3T28A 4A1XA 1A0HB 1CGIE 2Z6BD 2P3UB 5ETXA 2R0LA 4K1SA 1YPLH 1S6LA 1Q3XA 3CP7A 3L3TA 1WXRA 1KTSB 2FESH 1KSNA 4X1RU 5FPSA 3MO6A 2NU2E 2G8TA 5G4BA 1AWHB 2OC0A 3SO3A 4I8JA 3ATIA 3ZZDA 1X7AC 3UB0A 2FZZA 1EPTB 1GCTB 3JZ2B 1TONA 2Z94A 3A83A 2BLQA 1GG6C 3E0NB 3K65B 4I8KA 4Y10E 1SQOA 5TCCA 2HNTF 1EKBB 2ZU5A 2UUKB 1XXDA 1OXGA 1RRKA 3PLKA 6GCHG 4X1PU 1FY1A 3ZVAA 3ZIAD 2TIOA 1OOKB 2SGQE 2R2WU 3TK9A 4ZROA 1AU8A 1OWIA 1J9CH 2WV4A 2VH6A 3OU0A 4UFFH 4INLA 3URCA 2LELA 2WINI 3KNXA 4K8BA 4ISOA 4B2AA 5GXPA 2TPIZ 3CNRA 3RXOA 4ABBA 3RP2A 2A5IA 2ZCLP 3SYJA 3QZQA 1CVWH 1SGYE 3FO8D 1YLCA 4CBNA 1SG8B 2G00A 2F9OA 3MYWA 5F6MA 1KXBA 1BCUH 2LPRA 2R0KA 1Z8GA 2M2AA 2JDID 4NWLA 1RS0A 5I46H 1SHHB 5DO4H 3S7HB 1LPGB 2QF5A 1NRPH 1XMNB 2JIZD 3PMAB 4OS2A 1GPZA 3M7UA 4JMYA 2BDBA 1C5NH 3LDXH 2NWNA 4NG9H 2FYQA 2VU8E 2ZKSA 1AIXH 3KYGA 2F9VA 3BG4C 3M3SA 3P17H 2H6MA 2A7JA 1O3MA 1CHOG 4HTCH 2BLOA 3D23A 3DSGA 2PGQB 1QTFA 4AORA 2ZO3H 1UW7A 5EXLA 3UNSA 3VB3A 1SKYE 1COWD 1ZR0A 2ZHEH 1BMLA 4YM9A 1TX8A 1V2OT 4X6MA 5EQRA 4HFPB 5C17A 1C1PA 1GI4A 3RMLH 3F68H 5FL7D 4RN6A 2EI7A 3MO3A 5F03A 3B8JA 1E38B 1EASA 1SR5C 1S81A 1OP8A 1C5OH 3ODFA 1AD8H 4Z0KA 2GJGA 2XCFA 5JBCS 4D7GA 5BPEA 2I6SA 5E0HA 1PYTC 2XBYA 1DXWA 1MQ5A 5FBEA 2J4IA 4F49A 1K1IA 2JH5D 1AKSB 1BHXB 2RA3A 1YPGH 1ZSLA 8KME2 2F3CE 3M5OA 2QF0A 2GD4B 3PB1E 4ZKOU 2HNTC 1UJ1A 1W0ZU 3U8TH 3SBKA 2FOMB 1EAUA 2PV9B 1HAYB 1THRH 1F7ZA 2WUBA 5TCAA 2WZQA 1LHGH 2Y5FA 3ZZCA 3MQKC 1TLDA 4BTTB 2BLVA 1TIOA 3MNSA 2IOTA 3E3TA 2Y82A 1J8AA 3RXDA 2ZGJA 4BOHA 4OS7A 3MU8A 3M5NA 4K1TA 3OFND 3VGCB 1TNKA 3V7TA 5DP4A 1ETRH 1FN6A 1QR3E 3U1JB 2FOEA 2VVUA 3A85A 2VGCB 1A3BH 3ZZBA 1DDJA 3KQDA 5GJ4B 1ELGA 2FWWA 1QHRB 1VGCC 4X8SH 1SGTA 3QLPH 4KTSA 4H6TA 4ZAEA 4RKOB 4MG3A 2BOHB 5A8ZA 4XE4A 3M61U 2Q6DA 2ZGBH 3TJOA 2ZCKP 4B76A 5TJXA 1TNHA 3DT0H 1YP9A 5L2YH 8GCHF 4NIWA 3UQOA 5JPMH 1C2JA 1LPKB 4B6FA 1W8BH 1EQ9A 1V2ST 1C5QA 5A09A 2V7QD 1XUIA 2ZG0H 3DD2H 1GJDB 4NSVA 1Z71A 5LPFA 4HZHA 1MU6B 5DP3A 4DT4A 2VIPA 1MTUA 1O2ZA 4ZHMU 1NS3A 1NC6A 2ALVA 4WY3A 1O5EH 2HPQH 2V6NA 3NUMA 1V2NT 1AGJA 1GBLA 2PW8H 3SHCH 4K2YA 1KLIH 1O30A 1HAIH 2J5UA 2XNIA 1V3XA 3LPRA 3SZEA 1W0JD 2ZHQH 1PPBH 2GKVE 2RA0A 4I33A 1P9UA 4WMFA 1AVXA 4DG4A 1VJ9U 5HIZA 1HAZB 3F0OA 2FOGA 1HAHH 1TBQH 2GMTC 5EJLA 1HGTH 1O2TA 1FN8A 2BX3A 1V2TT 4UDWH 3EYDA 3P95A 7GCHG 3NPSA 2BOKA 1RIWC 1P05A 3A86A 3PV2A 2ZZUH 4B6EA 2KX4A 4ASUD 3GS9A 2C90B 2PGBB 2KCAA 2M5TA 1WYKA 1O2PA 3SNAA 1K1OA 2ODYB 4DURA 1C9TA 1T31A 4Z1MD 3GY3A 3PV4A 5DSFA 3ATLA 3AW1A 1C5ZB 3T27A 2DE8A 4GCHG 2VIWA 2VINA 1MTVA 2Y81A 2PKSC 1IQNA 4U32A 4WH8A 2FX6A 2Y5GA 1O2JA 1C5YB 3PTBA 4CHAC 3UPEA 2TGTA 3E6PH 3V3MA 2KAIB 1TWXB 3FZDA 1AMHA 2KZ4A 3GY4A 2QF3A 3LGUA 3PMHB 1D6RA 2BD7A 3GCNA 5EXNA 5EPYA 5FXLA 5EIYA 2KCYA 1O3OA 2HNTE 4ISIH 2H9EH 4TYDA 2BZAA 3A7XA 3TU7H 6LPRA 1RFNA 1SGPE 3PO1B 3BTHE 4AZ2B 2KM0A 4Y8ZA 1SGNE 3K6YA 3QDZB 1EJMA 3RXAA 2NU4E 4A1VA 3RUOA 1JRTA 1O3CA 3MU1A 2ZDMA 3FAOA 5C5OA 2J94A 4DGJA 1LHFH 1TPPA 4K1EA 4MLFB 1IQMA 1UCYH 1O3DA 2WUCA 3P8OA 4DVAU 1QL7A 3F1SB 3N7OA 2ANWA 1F0UA 2IPHA 4ZKSU 1ANCA 3RXQA 3QGJA 3QTVH 1P9SA 1NT1A 1LMWB 1TAWA 1UTLM 1JIRA 1CU1A 2WSSD 4XOJA 3ZYEA 1EFRD 1GVLA 2P8OC 1GJ5H 3BTME 3TH4H 1AB9B 3RU4T 1C4V2 1E34B 2P93A 2VB0A 5LPEA 5BRRE 3H7TA 1EZUC 4JYTA 1O37A 4GUXA 1BBRK 5J4SA 1LVOA 1ZOMA 2F9NA 4P02A 2AYWA 2UWLA 4Y79A 2YMSC 1O38A 5EU8A 1FY8E 1P10A 1C2DA 3ZZ6A 2F9BH 2ZDVH 1BBRH 3I77A 1QA0A 3S0NA 1OWKA 1H8DH 3M3VA 4RT0A 4WJG2 1RXPA 3S9CA 1DWDH 2OBOA 4XDEA 3NXPA 1WU1A 2HALA 4AYVB 1ARCA 3F3BA 1TPAE 3R0FA 4MNWA 3WW7A 2V35A 3M5MA 3H5CB 2A4QA 5A0AE 3SNBA 3GY5A 1A5IA 3STIA 2W6ID 1C1NA 3VXFH 5C5NA 1MUEB 5FX5A 4FUDA 1C9PA 4HGCA 5E2OA 1NY22 4LOYH 4MPXA 3OYPA 2QY0B 3QX5H 1JBUH 3BEUA 1QQ4A 4BXWA 2K8IA 3BEFB 3PMBB 1MZAA 1LDTT 1V2MT 4PROA 3T62A 2B7DH 3BSQA 1NTPA 1P2OA 2GTBA 1A5GH 3MHWU 4X8VH 1DANH 1OS8A 3LT3A 3RXHA 1O3AA 3KCGH 2CHAB 1O2RA 3M7QA 1V2KT 1XUJA 2VWOA 3SUEA 2EA3A 1HYLA 1O5CB 3FZZA 3MFJA 2HLCA 1PQ8A 3GYMA 3UQVA 3Q3KA 4H4FA 4Z6AH 5JBAS 2HVXA 1O31A 2ZP0H 4X6NA 1E1QD 1QFKH 1UVPA 3BTDE 3MH4A 2B0FA 3ZZ4A 2PWXA 4NIYA 2PR3A 3S69A 3PWBA 4A7IB 3JZ1B 2PP6A 1BA8B 5CHAB 3RDZA 1YPMH 4F4OC 1GVZA 4NZQA 4OGYA 1O3HA 1K1NA 1EATA 1F0SA 1ZSKA 1C5XB 1CGJE 1O2LA 2V0BA 3N7EA 1HJ9A 4IMZA 4Y76A 1QURH 3UIRA 4FUBA 1LKBA 4B2CA 3F9GA 1SGCA 1G32B 1N1LA 2WPKS 3K9XB 4AGKA 5DKMA 1ELFA 1UHBB 2STAE 1JOUB 3T25A 1VJAU 3CS0A 1TNLA 1P3EA 1Y8TA 1TB6H 1YCPK 5F8XA 1CT4E 4Q2KA 1YPKH 2ZPSA 1MTNC 2ZFRH 3ATKA 2A4RA 2CGAA 5A8XA 5KGOA 1BMNH 4CBOA 1YCPH 1K1PA 3A8DA 1Y3UA 2AMPA 1E35B 2BVXH 2GP9B 3VB6A 4Q7YA 2FI5E 1BJVA 1FAXA 4J2YB 1YPHE 1Z1IA 1C1SA 1QRWA 1XUFA 4OGXA 3RMOH 1MKXH 1ANBA 2BVRH 5EQQA 3KGPA 1WTGH 1V2PT 3OY5U 2JH6D 4INHA 2KFWA 2VWNA 1SI5H 4I86A 4MTBA 1V2VT 1KDQB 1FY4A 2BZ6H 5T3HA 4UFDH 2BY7X 2UWOA 3PV5A 1SL3A 4FUEA 1MD7A 2PUXB 3OX7U 5B6OA 4WXVA 2AGEX 1GDUA 1DSUA 4ZCNA 1XM1A 2BXTH 8GCHG 1NFWA 5L6NH 1HIAB 2FM2A 2W6JD 4ABAA 4I32A 2GVFA 4Q63A 3VB7A 1NRRH 4Y71A 2CXVA 3A8BA 5HXFA 1AFQB 5KEDA 4JZEH 1FX0B 3NZIA 1KXAA 2P3FH 2IJOB 3OTJE 4Y0ZE 1DY8A 4AB8A 1UVOA 4MVNA 1BITA 2BD9A 2QAAA 1GDQA 1O36A 1O2WA 4IC6A 1ESBA 2SGFE 2STBE 1RTKA 1MTSA 5EODA 1K1JA 3LH3A 3TLOA 1FAKH 2ZGCA 1ZTLA 2EC9H 2F9UA 1ABJH 2QF4A 1EP5A 4AYYB 1P06A 2UUJB 4FUHA 3ZVDA 1S6HA 5JBBS 1GI7B 3P8FA 1HAVB 1XVMA 1ZYOA 2WYJA 2K1QA 2XNDD 1ZJDA 1NRQH 3QGNB 1CBWC 2BDHA 2XC4A 1C5VA 3PRDA 3RXIA 2ODPA 3TJNA 4AFUA 3T5FH 1W2KH 3TJVA 5E8EH 2GDDA 5C0TA 1FXYA 1UK4A 2VIVA 5F8ZA 1N6YA 2OLGA 3AASA 3PM3A 1HAVA 2VIOA 2RG3A 2XXLA 1QNJA 2EI6A 3BTFE 4BAMB 2NU1E 3MWIU 2ZHDA 4YOJA 2TGDA 1O2HA 4KTCA 1RGQA 1DY9A 1UMAH 2VWLA 3A8AA 3K2UA 2ZTXA 1O3PB 5JDUB 4NZLA 4XRNA 1J16A 2EEKA 1Y3XA 1GI1A 2SGAA 4YXWD 4MNVA 3FN8A 1HFDA 2RDLA 1AVWA 2GCHF 2ZGXH 3SI4H 4NA8A 1DSTA 2R3YA 1DWCH 1CT2E 3GCHC 5HM2A 1SLVB 2CN0H 1H8HD 3ZZ5A 1DXPA 4JZFH 2ZHFH 1F92A 3PMJA 4MDSA 3EE7A 4MPUA 3FOAA 5DGJA 1HJAC 4FU8A 3MTYA 2JETB 2ZFFH 4ABEA 1TGCA 1C2IA 1B7XB 1E36B 4X8TH 1IQKA 1EPTA 3BTTE 3NWUA 1UTNA 4TT3D 2ULLA 4HG6A 4CRGA 2C93B 3SNDA 3VB5A 2L6OA 1XUGA 2ZGHA 3AVZA 5LGOA 1G30B 3ZZ3A 1WDIA 1HNEE 3TNTA 2ZECA 1A2CH 3SORA 1VCPA 3QTOH 2W26A 1AFEH 2V3OH 1OHHD 3DFJA 1SGFA 1BTHH 1L1JA 4DIHH 2Y6TA 1PPHE 4XBDA 1ZRKA 3BG8A 1NROH 1QJ7B 3RXFA 1GGDB 2A0QB 4WH6A 1EPTC 1ETTH 1GCTC 2JH0D 3FANA 4FETA 1O5BB 1BHXF 1GMDF 2GT7A 4FUFA 1ZGVA 3BV9B 4ZUHA 2OC8A 1DX5M 2KR7A 5GDSH 2Z9KA 4M9FA 1SOTA 2Z9GA 1Z7KA 4BAOB 3KYFA 2ZFTA 4INKA 2QE7D 1SLUB 1P04A 1ELCA 3HKJB 3B9FH 1LPZB 1W10U 4RKJB 3EQ0H 3PTNA 1CA0B 5AVDA 4P00A 4Q7XA 2SGPE 2W7SA 2CV3A 2KCPA 2ZDKA 2WPMS 2XW9A 3K6ZA 5K7RA 3ODDA 2BYAX 2VVCA 3FVFB 5EQSA 4D8NA 3U9AH 4O3TA 1OWDA 3LC5A 1CHGA 1W7XH 1QJ1B 3RXJA 1YF4A 2W3KA 2ZTZA 4BTUB 1V6DA 5T6GA 1T7CA 1C2FA 3LGVA 5A2MH 3MU5A 4NIXA 3ZVGA 1BDAA 1HRTH 2VNTA 4UFEH 1ELEE 3E16B 1FZZA 4R8TB 1BRAA 1SC8U 2BDYA 3TJUA 4A6LA 1AUTC 1ESTA 3PLBA 4B75A 2OXSA 1N6XA 1WBGB 4GVUA 2FDAA 3F9FA 4X8UH 5F8TA 4CRDA 1A5HA 2HPPH 4ISHH 1GMCF 1FONA 1P2MA 3MH6A 4NIVA 3F0PA 2B9LA 4YLUA 1EOLA 1ID5H 2Z3CA 4A5TS 1OSSA 1TA2A 4CRAA 4JK6A 2J9NA 4GPGA 3LGWA 1P2KA 4NSYA 3Q77A 1WUNH 1GL0E 1IOEA 1T4VH 1WSSH 3CENA 1AKSA 2FTLE 1SMFE 3WWFA 2F43B 3RXBA 1KTTB 2VWMA 3A82A 4I8HA 2D1JA 3M7TA 1CQQA 1TGTA 4U30A 3UWIA 1N8OB 1GBAA 1DOJA 3HGNA 5EOKA 5JB8S 2C8YB 3OEHD 4AFQA 6CHAB 1MD8A 1O2XA 3HKIB 5CHBA 2ZU3A 5JBTA 5I25A 3UWJH 4DOQA 5AF9H 6ESTA 1BTWA 1QY6A 3GCTF 3A7TA 2AGIX 3GCOA 1P03A 1J14A 1AWFH 1O33A 3A80A 4X2YA 1WQSA 4FOUC 4GAWA 2Z3EA 4K69A 1UTJA 1DICA 1QQUA 4UE7H 4B73A 4K8YA 2J97A 2DUCA 4Q80A 1ZMNA 4MNYA 8ESTE 1HDTH 1CE5A 3ELAH 1QL9A 1PPEE 3GISB 1MBMA 1XKBC 2QC2A 2XBXA 1CT0E 2HLDD 1KXCA 1K28D 1TE0A 2R2MB 1BRCE 1O5FH 2FIRH 1C2HA 4JYVH 1SBWA 1C1OA 1NO9H 2FXRA 1OWJA 1MTWA 3S9AA 3T29A 3RXGA 1D4PB 1ZPCA 2XTTB 1K21H 5C2ZA 3P92A 1FIWA 3VGCC 2ZA5A 3H09A 1FY5A 2C8ZB 2VGCC 1ZSJA 3ZVFA 2AMDA 3BTEE 1O35A 3QUMP 3MU0A 1HAPH 3P8NA 2ZDNA 1GMHF 3OSYA 4ABJA 3SU4A 2AHME 2KCOA 2FLBH 5HIYA 1QL8A 1H4WA 4H42U 1GDNA 5AFZH 2FTMA 2FMJA 4ZKRU 3SV8A 3SUFA 1C5LH 2BM2A 1GHBF 4SGAE 1EJNA 2G52A 2OTVA 2G4TA 1GI5A 2A2XH 3ZZ9A 5ABWA 3TGIE 4RT1A 2PKSB 4AG1A 2ZC9H 5DP8A 1O34A 1OWEA 3W1EA 2FI4E 1FNIA 1TX7A 3DHKH 3A89A 2G5VA 1MH0A 2F91A 3UREA 1GBCA 1OP2A 1TGBA 3LIWA 4Y7BA 3RXPA 1EXFA 3TVJB 4NA9H 1V2LT 4O03A 4AX9H 2Y5HA 3SU1A 1O2SA 1BTYA 1LQEA 3F2HA 4OS6A 1AO5A 5T1VA 1KXDA 1ZMLA 1SGFG 3SU3A 3S7KB 3GDUA 1ARBA 3RXSA 1B5GH 4CREA 1AQ7A 3Q76A 3BF6H 2P59A 1TNGA 1O3EA 2ESTE 3LGIA 4Y7AA 1DWBH 1GJAB 4AGJA 4DY7B 5DP9A 4FU7A 4X2WA 1THSH 2UUFB 2GX4A 1IQJA 1K1MA 2QYIA 3SJKA 1CO7E 1LHCH 5JYIA 1NRSH 2C3SA 3A7WA 3U1IB 1ZRBA 1AHTH 2EY4C 1O3BA 4FUCA 1H9LB 1QBVH 3RU4E 2OINA 5GIBA 2KAIA 3DA9B 3ZV8A 1P57B 1YC0A 1P3CA 2K0QA 2R3UA 1UCYK 2H9TH 2QCYA 3EA9A 3KN2A 3L33A 1GHWH 1UTQA 3ATMA 4UEHH 2A2QH 6GCHF 1P01A 2PTNA 1ELDE 1D9IA 3IG6B 3DUXH 4VGCB 1YPHC 4BAKB 2QXJA 2FPZA 1CGHA 1RD3B 4Q4LA 4NCYA 4LZ1H 3UNRA 4E7RG 4IS5A 3TK6A 2ODQA 2BQ7B 3RU4D 2BD5A 4ABDA 2GCHG 1S0RA 2HRVA 3KEEA 5C94A 4ISLA 1HJ8A 2WPDD 2XRCA 3UR6A 1C1VH 4ESTE 1TALA 1LCYA 1Z1JA 1QBOA 1TMBH 1TPSA 1JXPA 2IN2A 1C1WH 2LP6A 1AI8H 3SGAE 5C0UA 4CH8B 4ZMAH 2FLRH 3LONA 1GJCB 3NCLA 3R3GB 1Y5BT 1QCPA 2GV7A 3A7ZA 2GV6A 4XBCA 1GBHA 1TOMH 3PO1C 4ABHA 3FFGA 3E1XB 3D62A 1WOFA 3RM2H 3STJA 1O2YA 3ESTA 3QWCH 1AY6H 3RM0H 1QB9A 4ZXYH 1O2KA 3SUDA 3RXKA 1W7GH 3C27B 1IHSH 3U8RH 4CH2B 2R9PA 3LJJA 3RMMH 2J95A 1D3QB 1S0QA 1PPCE 1PQAA 1K9OE 1NU7B 5JB9S 1GMDG 1BTXA 4O3UA 4IW4E 3LKWA 1C2KA 1HUTH 3I29A 1EJAA 2GZ8A 1YYY1 1AB9C 1TRYA 2WPIS 4FXGH 5GCHF 1K1LA 2FODA 5H4IB 2A32A 2H5DA 1Z6JH 3P6ZB 1FDPA 3ZZ8A 1T4UH 4E7NA 2GDEH 2G81E 2GT8A 1W0KD 2RFKC 4A1TA 2BLWA 5C1UA 3OE7D 1J15A 3URDA 5C67A 5KECA 1L2EA 3TNSA 1IQHA 4GLYA 1H9IE 2FOCA 1T8NA 4ABGA 2ZDAH 8LPRA 1O5AB 3U98H 4O9VA 2QGRA 3UNQA 5HM9A 2WPHS 3TPIZ 3SQEE 2OCVB 1DE7H 1ACBE 1GBEA 1GCDA 4Y11E 3EA8A 3M35A 2SGEE 2BD3A 3M3TA 2PSXA 3T26A 3LGTA 1LVMA 5GNDA 1HAOH 1LO6A 2FS9A 2BB4A 3RC4A 2OBQA 2ANKH 3KQ5A 2ZF0H 3RXLA 3SU0A 1GBIA 4XBBA 1ZMJA 1NU9A 1A61H 1GMCG 3HPTB 1EAIA 1YBWA 1UVTH 1SFQB 2YNBA 1LTOA 1V2QT 4D9RA 2ZPQA 2G51A 1U6QA 2FOFA 4BAHB 3BTKE 5ESBA 5EPNA 1QGFA 1Z8JB 1T8MA 2CHAC 4Y6DA 2WYGA 2XWAA 4I7YH 3A7VA 2GCTB 3ZVCA 3C1KA 1LHEH 2A4OA 2BY5X 2QIQA 3SV9A 1SLWB 1XVOA 1NFXA 1OX1A 2BVSH 1MKXK 4OS4A 4J1YA 1Z6EA 1IQLA 1UHBA 4X1SU 1QJ6B 2P94A 3UY9A 3Q00A 3Q3YA 1C4U2 3P70B 1MKWH 1BIOA 2THFB 3PROA 1W12U 3LJOA 1OP0A 3SV2H 3SJ8A 3VPKA 1ELTA 1P11E 5CHAC 2BY9X 3V12A 1TBRH 1FI8A 1HXFH 3GCTG 1GI9B 2FS8A 4K5ZA 3OTPA 1XXFA 2YOLA 2ANYA 1BT7A 1YCPM 1CA8B 1W3CA 5IYTA 5EXMA 2JJ1D 1SGQE 5EW2H 4OS5A 4SGBE 4K3JA 1QZ8A 2O9QA 1S82A 3E0PB 1BZXE 1DWEH 3MH7A 4X1QU 1G37A 4YT7H 2CK3D 2D8WA 2VBCA 3PLPA 2ZWLH 3TITA 1KDQA 1QRXA 3E91A 3RC5A 1W11U 4NFFA 4YZUA 3I78A 3RXRA 2Q6GA 1UVSH 2I6QA 1C1UH 1YGCH 1C5WB 4UD9H 2UUYA 1HIAA 3AK5A 1YLNA 1TGSZ 3RXMA 4ZH8A 3UOPA 1GL1A 3DSPA 4CR9A 2FOBA 1V2UT 3KIDU 2BDAA 4BNRA 1GJBB 1SGDE 3VB4A 1CSOE 2J98B 3RXUA 1DLKB 2AERH 2FX4A 1GHVH 4ACBA 2AFQB 1GMHG 3F9EA 1TMTH 3O8CA 1JRSA 1VITF 2Y7ZA 3BN9A 2AIPA 1O5DH 3D49H 4NFEA 2CJIA 4X2VA 1A7SA 1G36A 5EGMA 1GHBG 2HOBA 1D3DB 1Y5AT 3A87A 1W14U 3VXEH 3ZZ7A 1O3JA 1P2NA 3KQEA 5B6LA 1AFQC 4A92A 2XYAA 1A3EH 1GG6B 2W5EA 2BDIA 3BTQE 3HK3B 2BQ6B 5ESTE 1JMOH 5EJ1A 3V0XA 1G9IE 4BANB 1O2OA 2P16A 4X2XA 1GVKB 1XUHA 1OWHA 3RXVA 1TQ7B 5L30H 5FAHA 5LPRA 4OM9A 1EAWA 3O8DA 2D2DA 4JK5A 5CMXH 1ETSH 1S6FA 4UFGH 1C5PA 1E1RD 1F0RA 2XC5A 3CS7A 2Q6FA 4UONA 3SV7A 2DE9A 1EP6A 3GDSA 5FPYA 3TH2H 1QRZA 2ZI2H 1UK3A 9LPRA 4YT6H 3G01A 1E37B 3MMGA 1T8OA 1C2EA 2P95A 4KGAA 2WPLS 1IAUA 5EG4A 4FVBA 2H2ZA 1HLTH 2BHGA 4AB9A 1AZ8A 4AOQA 3Q3XA 5E2PA 1A1RA 5E0JA 7KMEH 4XFQA 1W13U 1C5TA 1TBZH 1C4Y2 4B74A 1SQTA 2WV5A 1YM0A 3M36A 2XOKD 1GBTA 1OYTH 3SW2B 2XBVA 4DJZB 3L6PA 3BG4B 2B5TB 2FP7B 2QXGA 2AH4X 2F9PA 1C5SA 4RSPA 1INCA 5IK2D 1MCVA 1YY3A 2ZNKH 1UTKA 5EW1H 3MNBA 1T32A 1QB1A 1BTPA 3AAUA 1V2WT 5GWZA 4KELA 3SU5A 1YPJH 4BTIB 2ZFPH 2ALPA 3NKKA 4KTUA 3UOUA 3EGKH 1ZGIA 2JETC 1IHTH 2FO9A 4TPIZ 3A7YA 3LU9B 5DPAA 2A7HA 4ZKNU 1DLEA 1O2MA 4CRFA 4I31A 5C3NA 4LXBH 2QV1A 2Y7XA 1GBFA 3SJOA 4GHTA 3KQCA 1AUJA 1UCYE 4M7GA 1GJ8B 2V3MA 2PTCE 1NESE 1MZDA 1HPGA 4FUIA 2SFAA 3NK8A 4D9QA 4E05H 1S85A 3ZYDA 1C1MA 1BRUP 1H9HE 1GGDC 3WY8A 1NFYA 4QT8C 2BX4A 4JYUH 4YTAA 3DFLA 4NA7A 3GY8A 1P02A 1C2GA 2B8OH 4MPWA 5CE1A 3DSOA 1VCQA 1GI2A 3QO6A 1GHYH 1Y3WA 3MOCA 1MMJN 2OC7A 1P12E 3TGKE 3UFAA 1O3NA 5GCHG 3V13A 1GHZA 3MNCA 4GSOA 4ABFA 1P2QA 4IN1A 3A81A 3P8GA 4X6PA 3TIUA 1BBRE 1BJUA 1CA0C 1DFPA 3U69H 3WWBA 3TK5A 4YLQH 5FCKA 1O3KA 5T6DA 1L4DA 1DPOA 1KMHB 4TPYA 1GHAF 1F5LA 3ENSB 2A31A 1J17T 2ZQ1A 3UTUH 1O3IA 3UAIC 4OS1A 4IMQA 1VGCB 5FCRA 2BTCE 1QA7A 1QB6A 4AN7A 2O8TA 4B1TA 1G3EA 1NZQH 1ZLRA 5F53A 1DUAA 3EDXB 2A7CA 2ZHWH 1H8ED 1FPCH 3ZVBA 1Y5UT 1NPMA 3SN8A 3MNXA 2VVVA 3SJ9A 1L0ZA 4MPVA 1LKAA 3A88A 2F4LA 4DT7B 3N7DA 4TSFD 4JZIA 2BD8A 1S84A 4ASHA 1Y3VA 3GY2A 3E90B 2WV9A 1BRBE 2A45B 2NU3E 3ITIA 3IWMA 1WTHD 1O2UA 1O2IA 1O2VA 4IBLH 3QK1A 1PPFE 2C8WB 1ZJKA 1BMFD 1ABIH 1V2RT 1P0SH 2A5AA 1C1TA 1EUFA 1DVAH 2ZTYA 1F5KU 3BTWE 1O0DH 3RC6A 1A46H 2WPJS 1A0LA 1MABB 2A4GA 3FP6E 1O5GH 1Q31A 2OQUA 3RXCA 1K0HA 3BIUH 4Y8XA 2QN5T 1RTFB 1FQ3A 5L2ZH 1N8OC 1P2JA 1UK2A 1MAYA 2BQWB 5K0HA 1AVGH 6CHAC 2Z7FE 1B0FA 1H8IH 2XCNA 3ATWA 2GMTB 2SGDE 3U8OH 3LOXA 4FUJA 3RLYH 4R0IA 3LGYA 3LH1A 2EI8A 1F0TA 1ZTJA 3MI4A 5DK1A 2PFEA 1RIWB 5FPTA 2ZDLA 1XUKA 2ZIQH 4KKDA 1GI0A 2AS9A 4NWKA 4ABIA 4LZ4B 2ZU4A 1YKTA 2FOAA 4DCDA 3QN7A 1HB0B 3OAAD 3OEED 2GZ9A 3ZV9A 3E8LA 4WF8A 2ZU2A 3BIVH 4X0WU 5FX6A 3H7OA 7ESTE 3KL6A 4Q7ZA 2G5NA 4DW2U 1SB1H 1SQAA 3MH5A 2Z9JA 2CMYA 1C2LA 3VG8A 4CR5A 1HCGA 1O3LA 1AE8H 3AAVA 4CHAB 4XSKU 1SGIB 2F83A 1ZPZA 2HGTH 3HGPA 1SGEE 1DS2E 2BMGB 3NRLA 1KXEA 1MU8B 1O3FA 3SOSA 3SGBE 1ZHRA 5HMAA 1OKXA 5C1YA 4HI3A 2AGGX 1K22H 1PFXC 4FUGA 1THPB 2UWPA 1Z8RA 1HXEH 3SQHE 1S83A 1ZTKA 2BDCA 1BQYA 2L74A 4IN2A 1VITG 2D26C 4WXIA 5LH8A 2JKHA 3W94A 1LVBA 2RCEA 4X1NU 1FV9A 2TRMA 2CF9H 2O8MA 4YOGA 1WV7H 9ESTA 2TGAA 4CRCA 4O97A 1GBKA 4JZDH 1O39A 1E0FD 3SNEA 5AFYH 3W95A 3N99A 4IGDA 3AW0A 1QIXB 2Z9LA 2ZU1A 1C1RA 1ESAA 3BEIB 4KP0A 4BXSA 1IQFA 4H6SB 2G55A 3DCLA 1BTZA 2P8OB 2VIDA 1NBME 5A0CA 1Z8IB 3RXTA 2AMQA 1F2SE 5PTPA 1DUEA 2ASUB 1SGRE 1TRNA 1XKAC 4U2WA 4WWYA 1PYTD 2YMSB 3FP7E 1Q2WA 4MQAA 3FP8E 2QA9E 5GPIB 3UR9A 1G2MA 4AFSA 4D7FA 2GZ7A 1HAGE 3UUZA 3GOVB 3KQBA 3MO9A 3S9BA 3SJIA 1LHDH 1H1BA 1NBMD 1O3GA 1WQVH 2OK5A 5SGAE 5DP6A 1VCWA 4D76A 5E0GA 4AC9A 1EAXA 3SI3H 1ANDA 1TPOA 1GJ4H 3GY7A 1WCZA 1AZZA 1GBDA 1KY9A 2ZFSA 1BOQA 3IITA 4YOIA 4FU9A 1EZQA 1ELVA 1RTLA 1D6WA 4F48B 1L1GA 2BY8X 4TWYA 1TA6A 1NN6A 1PPZA 4TY7A 4YESB 1P8VC 1EX3A 4Y0YE 2A5KA 1SLXB 5DJ7A 1UTMA 1VKYA 1MAXA 2ZQ2A 1E79D 4VGCC 1EZSC 1G3DA 3ZZAA 2EQNA 1AE5A 1EOJA 1FMGA 5DG6A 3KHVA 4CRBA 1CHOF 2ZFQH 1BMMH 1ZPBA 2TGPZ 1C5RA 3SU6A 2FI3E 3GICB 1BMAA 1HBTH 2O8UA 3GYLB 1MQ6A 4DIIH 1SPJA 1TX6A 2FEQH 5T6FA 1FUJA 1BTUA 1UVUH 3SZNA 1NM6A 3GY6A 5FHTA 3QZRA 3OY6U 3KF2A 2J2UA 5FBIA 1YWUA 2IPQX 1IQEA 1P2IA 2OD3B 2Z3DA 1GBMA 1ORFA 7LPRA 4IC5A 2PLXA 4E06H 1Y59T 3O8RA 1HV7A 1B0EA 1PJPA 2BD2A 5HKKD 1O2QA 4ZHAA 4TWWA 2P3TB 3EA7A 1O32A 2G4UA 4B71A 2BXUH 4WVPE
chains in the Genus database with same CATH topology
4BAQB 3PYHA 1S5SA 1GBBA 1FIZA 1TGNA 1G3CA 2V3HH 5C1XA 1AN1E 1OYQA 2BD4A 1KLTA 2H1UA 4ZXXH 5HGGA 1WAYB 1O2GH 4FVDA 2H9HA 2HWLB 1TOCB 3D65E 3SV6A 2AIQA 1DM4B 5AHGH 1LQDB 1G2LA 4JZ1A 3SGQE 4ISNA 1PQ5A 2FOHA 2W7UA 4I8GA 2H5CA 1RJXB 1MTNB 1ZHPA 2C8XB 1ELAA 3A8CA 1IQIA 5IDKA 1UTPA 3PWCA 1C5MD 2AEIH 4I8LA 3HATH 4WMEA 5DP5A 1TMUH 1NFUA 1GHAG 3LC3A 3RXEA 1IQGA 1QBNA 1ELBA 1F5RA 4WMDA 2GGVB 2QXIA 4JCNA 3A84A 1KYNA 1TQ0B 1GHXH 1GJ9B 1SSXA 1XX9A 2CF8H 1DT2A 2ZPRA 1SVPA 2J34A 3SU2A 2LNCA 1TRMA 1MKWK 1O2NA 1EB1H 1GJ6A 1ZZZA 2VJ1A 4GHQA 2A1DB 3M5LA 1EB2A 4LK4A 1GWAA 1GBJA 3RMNH 2W3IA 2VH0A 2C4FH 1PQ7A 3BTGE 2BY6X 3EAJA 1GI3A 1K2I1 2Z9IA 2Q1JA 1BB0B 1VITH 1MCTA 1SHYA 2PHBA 1FLEE 1P09A 2XC0A 2OC1A 2SNWA 1GI6A 1TNJA 1JIMA 4YO9A 3SUGA 2ILNA 1UO6A 1BUIA 1YPEH 3T2NA 2PSYA 5HYOA 4THNH 1LVYA 2ZCHP 1NRNH 1PPGE 3VEQB 5C20A 2FYRA 1FPHH 2GCTC 3ZVEA 1A0JA 1FY3A 1TFXA 4Y8YA 2OQ5A 1L4ZA 1DITH 1KIGH 3RLWH 3B23B 2VIQA 5A8YA 1ANEA 2PKAB 1CBWB 3TGJE 4K60A 2NU0E 1EZXC 5J4QA 2Y80A 1SFIA 4NGAH 3GDVA 3SNCA 3F9HA 1D3TB 4ZHLU 1TNIA 7GCHF 4MNXA 5A0BA 2XBWA 2O8LA 3MU4A 1SOZA 2PKAA 2OP9A 1VR1H 2XWBI 1VZQH 1C2MA 3O8BA 1YLDA 1GI8B 2TBSA 1V2JT 1JWTA 1C5UA 2ANMH 3HK6B 1D3PB 1KLJH 1TABE 3M37A 1UTOA 4AFZA 4GCHF 4U01A 1W0YH 3EE0B 1MBQA 4TY6A 1Y3YA 4B2BA 3GCHB 4AG2A 1T8LA 2BDGA 2ZEBA 1G3BA 2OUAA 3TH3H 1L1NA 1A4WH 1M9UA 2YNAA 1FJSA 1GJ7B 2PUQH 1ZHMA 2SNVA 1HJAB 4X6OA 1HAXB 1C1QA 2QXHA 3VFEA 2O8WA 3F6UH 5DP7A 1OPHB 2J92A 3T28A 2J38A 1KXFA 1TYNA 3SHAH 4A1XA 1A0HB 1CGIE 2Z6BD 2P3UB 5ETXA 2R0LA 4K1SA 1YPLH 1Q3XA 3CP7A 3L3TA 1KTSB 2FESH 1KSNA 4X1RU 5FPSA 3MO6A 2NU2E 2G8TA 5G4BA 1AWHB 2OC0A 3SO3A 4I8JA 3ATIA 3ZZDA 1X7AC 2FZZA 1EPTB 1GCTB 3JZ2B 1TONA 2Z94A 3A83A 2BLQA 1GG6C 3E0NB 3K65B 4I8KA 4Y10E 1SQOA 5TCCA 2HNTF 1EKBB 2ZU5A 2UUKB 1XXDA 1OXGA 1RRKA 3PLKA 6GCHG 4X1PU 1FY1A 3ZVAA 2TIOA 1OOKB 2SGQE 2R2WU 3TK9A 4ZROA 1AU8A 1OWIA 1J9CH 2WV4A 2VH6A 3OU0A 4UFFH 4INLA 3URCA 2WINI 3KNXA 4K8BA 4ISOA 4B2AA 5GXPA 2TPIZ 3RXOA 4ABBA 3RP2A 2A5IA 2ZCLP 3QZQA 1CVWH 1SGYE 1YLCA 4CBNA 1SG8B 2G00A 2F9OA 3MYWA 5F6MA 1KXBA 1BCUH 2LPRA 2R0KA 1Z8GA 4NWLA 1RS0A 5I46H 1SHHB 5DO4H 3S7HB 1LPGB 1NRPH 1XMNB 3PMAB 4OS2A 1GPZA 3M7UA 4JMYA 2BDBA 1C5NH 3LDXH 2NWNA 4NG9H 2FYQA 2VU8E 2ZKSA 1AIXH 2F9VA 3BG4C 3M3SA 3P17H 2H6MA 2A7JA 1O3MA 1CHOG 4HTCH 2BLOA 3D23A 2PGQB 1QTFA 4AORA 2ZO3H 5EXLA 3UNSA 3VB3A 1ZR0A 2ZHEH 1BMLA 4YM9A 1TX8A 1V2OT 4X6MA 5EQRA 4HFPB 1C1PA 1GI4A 3RMLH 3F68H 4RN6A 2EI7A 3MO3A 5F03A 3B8JA 1E38B 1EASA 1SR5C 1S81A 1OP8A 1C5OH 3ODFA 1AD8H 4Z0KA 2XCFA 5JBCS 4D7GA 5BPEA 2I6SA 5E0HA 1PYTC 2XBYA 1DXWA 1MQ5A 5FBEA 2J4IA 4F49A 1K1IA 2JH5D 1AKSB 1BHXB 2RA3A 1YPGH 1ZSLA 8KME2 2F3CE 3M5OA 2QF0A 2GD4B 3PB1E 4ZKOU 2HNTC 1UJ1A 1W0ZU 3U8TH 3SBKA 2FOMB 1EAUA 2PV9B 1HAYB 1THRH 1F7ZA 2WUBA 5TCAA 3ZZCA 1LHGH 2Y5FA 1TLDA 4BTTB 2BLVA 1TIOA 3MNSA 2IOTA 3E3TA 2Y82A 1J8AA 3RXDA 2ZGJA 4BOHA 4OS7A 3MU8A 3M5NA 4K1TA 3VGCB 1TNKA 3V7TA 5DP4A 1ETRH 1FN6A 1QR3E 3U1JB 2FOEA 2VVUA 3A85A 2VGCB 1A3BH 3ZZBA 1DDJA 3KQDA 5GJ4B 1ELGA 2FWWA 1QHRB 1VGCC 4X8SH 1SGTA 3QLPH 4KTSA 4H6TA 4ZAEA 4RKOB 4MG3A 2BOHB 5A8ZA 4XE4A 3M61U 2Q6DA 2ZGBH 3TJOA 2ZCKP 4B76A 5TJXA 1TNHA 3DT0H 1YP9A 5L2YH 8GCHF 4NIWA 3UQOA 5JPMH 1C2JA 1LPKB 1W8BH 1EQ9A 1V2ST 1C5QA 5A09A 1XUIA 2ZG0H 3DD2H 1GJDB 4NSVA 1Z71A 5LPFA 4HZHA 1MU6B 5DP3A 2VIPA 1MTUA 1O2ZA 4ZHMU 1NS3A 1NC6A 2ALVA 4WY3A 1O5EH 2HPQH 2V6NA 3NUMA 1V2NT 1AGJA 1GBLA 2PW8H 3SHCH 4K2YA 1KLIH 1O30A 1HAIH 2XNIA 1V3XA 3LPRA 2ZHQH 1PPBH 2GKVE 2RA0A 4I33A 1P9UA 4WMFA 1AVXA 4DG4A 1VJ9U 1HAZB 2FOGA 1HAHH 1TBQH 2GMTC 1HGTH 1O2TA 1FN8A 2BX3A 1V2TT 4UDWH 3EYDA 3P95A 7GCHG 3NPSA 2BOKA 1RIWC 1P05A 3A86A 2ZZUH 2C90B 2PGBB 2M5TA 1WYKA 1O2PA 3SNAA 1K1OA 2ODYB 4DURA 1C9TA 1T31A 3GY3A 3PV4A 3ATLA 3AW1A 1C5ZB 3T27A 2DE8A 4GCHG 2VIWA 2VINA 1MTVA 2Y81A 2PKSC 1IQNA 4U32A 4WH8A 2FX6A 2Y5GA 1O2JA 1C5YB 3PTBA 4CHAC 3UPEA 2TGTA 3E6PH 3V3MA 2KAIB 1TWXB 3FZDA 1AMHA 3GY4A 2QF3A 3LGUA 3PMHB 1D6RA 2BD7A 3GCNA 5EXNA 5EPYA 5FXLA 1O3OA 2HNTE 4ISIH 2H9EH 4TYDA 2BZAA 3A7XA 3TU7H 6LPRA 1RFNA 1SGPE 3PO1B 3BTHE 4AZ2B 4Y8ZA 1SGNE 3K6YA 3QDZB 1EJMA 3RXAA 2NU4E 4A1VA 3RUOA 1JRTA 1O3CA 3MU1A 2ZDMA 3FAOA 5C5OA 2J94A 4DGJA 1LHFH 1TPPA 4K1EA 4MLFB 1IQMA 1UCYH 1O3DA 2WUCA 3P8OA 4DVAU 1QL7A 3F1SB 3N7OA 2ANWA 1F0UA 2IPHA 4ZKSU 1ANCA 3RXQA 3QGJA 3QTVH 1P9SA 1NT1A 1LMWB 1TAWA 1UTLM 1JIRA 1CU1A 4XOJA 3ZYEA 1GVLA 2P8OC 1GJ5H 3BTME 3TH4H 1AB9B 3RU4T 1C4V2 1E34B 2P93A 2VB0A 5LPEA 5BRRE 3H7TA 1EZUC 4JYTA 1O37A 4GUXA 1BBRK 5J4SA 1LVOA 1ZOMA 2F9NA 2AYWA 2UWLA 4Y79A 1O38A 5EU8A 1FY8E 1P10A 1C2DA 3ZZ6A 2F9BH 2ZDVH 1BBRH 3I77A 1QA0A 3S0NA 1OWKA 1H8DH 3M3VA 4WJG2 1RXPA 3S9CA 1DWDH 2OBOA 4XDEA 3NXPA 1WU1A 2HALA 4AYVB 1ARCA 1TPAE 3R0FA 4MNWA 2V35A 3M5MA 3H5CB 2A4QA 5A0AE 3SNBA 3GY5A 1A5IA 3STIA 1C1NA 3VXFH 5C5NA 1MUEB 5FX5A 4FUDA 1C9PA 4HGCA 5E2OA 1NY22 4LOYH 4MPXA 3OYPA 2QY0B 3QX5H 1JBUH 3BEUA 1QQ4A 4BXWA 3BEFB 3PMBB 1MZAA 1LDTT 1V2MT 4PROA 3T62A 2B7DH 3BSQA 1NTPA 1P2OA 2GTBA 1A5GH 3MHWU 4X8VH 1DANH 1OS8A 3LT3A 3RXHA 1O3AA 3KCGH 2CHAB 1O2RA 3M7QA 1V2KT 1XUJA 2VWOA 3SUEA 2EA3A 1HYLA 1O5CB 3FZZA 3MFJA 2HLCA 1PQ8A 3GYMA 3UQVA 3Q3KA 4H4FA 4Z6AH 5JBAS 2HVXA 1O31A 2ZP0H 4X6NA 1QFKH 1UVPA 3BTDE 3MH4A 2B0FA 3ZZ4A 2PWXA 4NIYA 2PR3A 3S69A 3PWBA 4A7IB 3JZ1B 1BA8B 5CHAB 3RDZA 1YPMH 4F4OC 1GVZA 4NZQA 4OGYA 1O3HA 1K1NA 1EATA 1F0SA 1ZSKA 1C5XB 1CGJE 1O2LA 2V0BA 1HJ9A 4IMZA 4Y76A 1QURH 3UIRA 4FUBA 1LKBA 4B2CA 3F9GA 1SGCA 1G32B 1N1LA 2WPKS 3K9XB 4AGKA 5DKMA 1ELFA 1UHBB 2STAE 1JOUB 3T25A 1VJAU 3CS0A 1TNLA 1P3EA 1Y8TA 1TB6H 1YCPK 5F8XA 1CT4E 4Q2KA 1YPKH 2ZPSA 1MTNC 2ZFRH 3ATKA 2A4RA 2CGAA 5A8XA 1BMNH 4CBOA 1YCPH 1K1PA 3A8DA 1Y3UA 2AMPA 1E35B 2BVXH 2GP9B 3VB6A 4Q7YA 2FI5E 1BJVA 1FAXA 4J2YB 1YPHE 1Z1IA 1C1SA 1QRWA 1XUFA 4OGXA 3RMOH 1MKXH 1ANBA 2BVRH 5EQQA 3KGPA 1WTGH 1V2PT 3OY5U 2JH6D 4INHA 2VWNA 1SI5H 4MTBA 1V2VT 1KDQB 1FY4A 2BZ6H 5T3HA 4UFDH 2BY7X 2UWOA 1SL3A 4FUEA 1MD7A 2PUXB 3OX7U 5B6OA 4WXVA 2AGEX 1GDUA 1DSUA 1XM1A 2BXTH 8GCHG 1NFWA 5L6NH 1HIAB 2FM2A 4ABAA 4I32A 2GVFA 3VB7A 1NRRH 4Y71A 2CXVA 3A8BA 5HXFA 1AFQB 4JZEH 3NZIA 1KXAA 2P3FH 2IJOB 3OTJE 4Y0ZE 1DY8A 4AB8A 1UVOA 4MVNA 1BITA 2BD9A 2QAAA 1GDQA 1O36A 1O2WA 4IC6A 1ESBA 2SGFE 2STBE 1RTKA 1MTSA 5EODA 1K1JA 3LH3A 3TLOA 1FAKH 2ZGCA 1ZTLA 2EC9H 2F9UA 1ABJH 1EP5A 4AYYB 1P06A 2UUJB 4FUHA 3ZVDA 1S6HA 5JBBS 1GI7B 3P8FA 1HAVB 1XVMA 1ZYOA 2WYJA 2K1QA 1ZJDA 1NRQH 3QGNB 1CBWC 2BDHA 2XC4A 1C5VA 3RXIA 2ODPA 3TJNA 4AFUA 3T5FH 1W2KH 3TJVA 5E8EH 2GDDA 1FXYA 1UK4A 2VIVA 5F8ZA 1N6YA 2OLGA 3AASA 3PM3A 1HAVA 2VIOA 2RG3A 2XXLA 1QNJA 2EI6A 3BTFE 4BAMB 2NU1E 3MWIU 2ZHDA 4YOJA 2TGDA 1O2HA 4KTCA 1RGQA 1DY9A 1UMAH 2VWLA 3A8AA 3K2UA 2ZTXA 1O3PB 5JDUB 4NZLA 1J16A 2EEKA 1Y3XA 1GI1A 2SGAA 4MNVA 1HFDA 2RDLA 1AVWA 2GCHF 2ZGXH 3SI4H 4NA8A 1DSTA 2R3YA 1DWCH 1CT2E 3GCHC 5HM2A 1SLVB 2CN0H 3ZZ5A 1DXPA 4JZFH 2ZHFH 1F92A 3PMJA 4MDSA 4MPUA 5DGJA 1HJAC 4FU8A 3MTYA 2JETB 2ZFFH 4ABEA 1TGCA 1C2IA 1B7XB 1E36B 4X8TH 1IQKA 1EPTA 3BTTE 3NWUA 1UTNA 2ULLA 4CRGA 2C93B 3SNDA 3VB5A 1XUGA 2ZGHA 3AVZA 5LGOA 1G30B 3ZZ3A 1HNEE 3TNTA 2ZECA 1A2CH 3SORA 1VCPA 3QTOH 2W26A 1AFEH 2V3OH 3DFJA 1SGFA 1BTHH 1L1JA 4DIHH 2Y6TA 1PPHE 4XBDA 1ZRKA 3BG8A 1NROH 1QJ7B 3RXFA 1GGDB 2A0QB 4WH6A 1EPTC 1ETTH 1GCTC 2JH0D 3FANA 1O5BB 1BHXF 1GMDF 2GT7A 4FUFA 1ZGVA 3BV9B 4ZUHA 2OC8A 1DX5M 5GDSH 2Z9KA 1SOTA 2Z9GA 1Z7KA 4BAOB 4INKA 2ZFTA 1SLUB 1P04A 1ELCA 3HKJB 3B9FH 1LPZB 1W10U 4RKJB 3EQ0H 3PTNA 1CA0B 5AVDA 4Q7XA 2SGPE 2W7SA 2CV3A 2ZDKA 2WPMS 2XW9A 3K6ZA 5K7RA 3ODDA 2BYAX 2VVCA 3FVFB 5EQSA 4D8NA 3U9AH 4O3TA 1OWDA 3LC5A 1CHGA 1W7XH 1QJ1B 3RXJA 1YF4A 2W3KA 2ZTZA 4BTUB 1V6DA 5T6GA 1T7CA 1C2FA 3LGVA 5A2MH 3MU5A 4NIXA 3ZVGA 1BDAA 1HRTH 2VNTA 4UFEH 1ELEE 3E16B 1FZZA 4R8TB 1BRAA 1SC8U 2BDYA 3TJUA 4A6LA 1AUTC 1ESTA 3PLBA 4B75A 2OXSA 1N6XA 1WBGB 4GVUA 2FDAA 3F9FA 4X8UH 5F8TA 4CRDA 1A5HA 2HPPH 4ISHH 1GMCF 1FONA 1P2MA 3MH6A 4NIVA 2B9LA 4YLUA 1EOLA 1ID5H 2Z3CA 4A5TS 1OSSA