4ABIA

Co-complex structure of bovine trypsin with a modified bowman-birk inhibitor (pta)sfti-1(1,14), that was 1,4-disubstituted with a 1,2,3- trizol to mimic a trans amide bond
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Braces for the Peptide Backbone: Insights Into Structure-Activity Relation-Ships of Protease Inhibitor Mimics with Locked Amide Conformations
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abiA02
1D9IA 3PROA 1YPJH 1VJAU 3DUXH 4CRAA 1WBGB 1V2OT 2Z9KA 2V3OH 1TNIA 2C8XB 1BOQA 1FN8A 3SNEA 3RM0H 3MMGA 2HLCA 1Z1IA 4IS5A 1BTWA 1CQQA 1AMHA 3MNBA 1GVZA 1O5AB 1JIMA 1V2JT 3TH2H 1F5RA 4ZMAH 3PWBA 1DUAA 3A7YA 3P8GA 3BEUA 2BD5A 3VFEA 2Z9LA 3M7UA 1BT7A 1O3PB 2BDAA 3TJUA 4FU9A 1J9CH 4B2AA 1ZMNA 3M7TA 1PPFE 3GISB 4CRDA 2CN0H 1UTNA 3BEFB 4UE7H 3HGNA 1DWCH 2FZZA 3K65B 3LH3A 1K21H 3E3TA 3LU9B 3W94A 2QV1A 1G36A 1GI2A 1EXFA 3GCOA 2AGGX 4X6NA 3M5OA 3SHAH 2BVXH 2ZHEH 3BG4C 1WQVH 1SGEE 2TGPZ 2GCHF 2ZU2A 3AASA 2BVSH 1RTKA 5DG6A 2G5VA 3V0XA 3K6YA 1GBIA 1J8AA 1H9IE 1LO6A 1GHZA 4AORA 2ZGJA 1XKBC 1CSOE 1K1OA 3RXFA 2ZQ1A 2OQ5A 1YP9A 1GVLA 1XXFA 3S7HB 1AFEH 2FWWA 1WAYB 4D7GA 1FI8A 2ZTXA 1AE5A 3KIDU 4X0WU 2FMJA 4CRFA 1MCTA 4J2YB 6GCHG 1OPHB 1A5GH 4ZKOU 2STAE 1ELTA 2BZ6H 1AB9B 4CHAC 1IHSH 5LGOA 4YESB 5T6DA 1IQEA 2IJOB 3DD2H 1AFQC 1C2FA 3NPSA 5FPTA 1GHBG 4DIIH 2GCTB 3RXEA 1V2UT 3Q3KA 3UREA 3ZYEA 1UJ1A 2BDBA 2ZPQA 2OBOA 1HIAB 4AZ2B 1E0FD 1EJNA 2CHAC 1HIAA 3A8AA 4AFQA 1H8IH 1AHTH 2FO9A 1MKXK 4AYVB 1RGQA 3EQ0H 1SQOA 2G4TA 3PO1B 3BTME 7GCHG 5DP7A 3KGPA 3RU4T 2HNTE 4ZAEA 5G4BA 1C1PA 4I32A 5DPAA 1QGFA 1C9PA 3RC6A 4NSVA 1F2SE 1FLEE 3BTHE 4B2BA 1UTKA 1YGCH 3RDZA 1HAZB 1MZDA 4SGAE 2OUAA 2M5TA 1GG6B 1KXDA 5LH8A 2XNIA 2BQ7B 1FN6A 3ZVEA 1GI8B 1F5LA 3QWCH 3I77A 2V0BA 3VB7A 1UCYK 3KHVA 4GCHF 1HGTH 2O8MA 4I7YH 3HK6B 2VB0A 1C2JA 1FPCH 3PMJA 3SOSA 2FOHA 3MNCA 1O2XA 1GBFA 2STBE 2BY8X 1BIOA 3KN2A 3SNAA 1MAYA 1CHGA 1TMUH 3NXPA 2P3TB 2FI4E 1NN6A 5DP3A 3K6ZA 4FU8A 1C2KA 1KLIH 1AN1E 1K1LA 1QRXA 3QGNB 3TLOA 4Y8ZA 5DJ7A 2P59A 3MI4A 2ZU5A 3EA9A 5CHAB 1LKAA 1M9UA 1K9OE 3VB5A 3L33A 1W8BH 1SGPE 1KXCA 1IQLA 1EZSC 1QURH 1C1QA 2BOKA 1P01A 1NROH 2ZGXH 3ZZCA 2HPPH 2BB4A 3GYLB 3F9HA 1QQUA 4DOQA 2XBYA 2GMTB 4MDSA 3T62A 4ZHMU 2WPKS 3FZZA 1EAWA 1MU8B 3VB4A 1KXEA 5FBEA 5HGGA 2BLWA 4THNH 4CBOA 1JOUB 2BXUH 1LMWB 3VB3A 4WVPE 4K3JA 2ZKSA 5HYOA 2BDYA 3TGJE 2Z6BD 1Y3WA 2F9PA 5DGJA 1T8OA 3ESTA 3ZZ7A 2SGEE 3HATH 3U8TH 2BD7A 2P95A 2R3YA 2G51A 3LOXA 4X1QU 3EGKH 8LPRA 1Z8IB 3MO6A 1P57B 4NGAH 2TGTA 1O5BB 3PTBA 5C1YA 1YCPK 1V2RT 3A8CA 2GVFA 1GDUA 3Q76A 4MQAA 3ZZDA 1FY8E 2DE9A 3QGJA 4WJG2 4CRCA 3MTYA 3MNXA 1G2MA 1A46H 1FIZA 2ZGBH 1C2GA 3KNXA 3LC5A 1EKBB 1ZGVA 1BITA 4INKA 1TX6A 2LNCA 2NU4E 1SGDE 1FIWA 3Q00A 1GCDA 5C5OA 3LJOA 1EOJA 3BTQE 2ZCHP 4NZQA 3W95A 1FAXA 1AU8A 4IMZA 1ELAA 4RKJB 3F9GA 1OWJA 1K1IA 2BTCE 3MFJA 4J1YA 3ZVGA 4A1XA 1YBWA 1GI6A 2ZCLP 5A8ZA 4RKOB 1C5SA 4UFGH 1EJAA 1C1UH 1WTGH 3E6PH 4K60A 4KTSA 1Q31A 2BYAX 1O3LA 1ZSJA 2HPQH 3UR9A 2O8WA 2W7UA 4INHA 3SORA 3MO9A 1LPKB 3MU4A 1MKWH 4YZUA 1DT2A 2R0KA 1ZSKA 2ZQ2A 1RRKA 1OP8A 2D26C 2PHBA 1TMBH 3QZRA 3OX7U 4H6SB 1RXPA 2TBSA 5EXLA 4CH8B 3ZVBA 4MNVA 4Y79A 4XFQA 2Y81A 1S0RA 5AHGH 3GY4A 1JRSA 1QJ1B 2F9OA 2EEKA 1PQ7A 2VVVA 3ZZ5A 1C5PA 5E2OA 4ZKNU 3UUZA 1O3MA 1TBZH 2HRVA 3ODFA 1TRYA 2CF9H 1VZQH 1HAYB 4CRBA 2FS8A 1THRH 2FX6A 2RCEA 3F6UH 1H1BA 2ALPA 1TBRH 2J2UA 3SBKA 1OX1A 1BMAA 4NSYA 1B7XB 2FOAA 3QO6A 1TNGA 2FOCA 1N8OB 1GMHF 3HGPA 3ATMA 4R8TB 4NIYA 1OOKB 2OD3B 3RMOH 1NO9H 4LZ1H 2EI8A 2QXHA 3TH3H 2BLQA 3NZIA 4DG4A 3B8JA 1QTFA 3F9EA 4E7RG 4MLFB 3NK8A 3PM3A 1DITH 3QUMP 1OWEA 1EASA 1HNEE 1S84A 2ZDMA 3SI3H 2QA9E 4RSPA 5F8TA 1C2IA 1NRRH 3QTOH 3MWIU 5T6FA 2BD3A 1BZXE 3A89A 5DP6A 1DDJA 4RN6A 4CHAB 1C1SA 7GCHF 5DKMA 1TBQH 3RXCA 3GCNA 3VGCC 1AI8H 1SMFE 3BV9B 3T5FH 5CE1A 3A85A 1AFQB 4ZKSU 3SQEE 1NU7B 4TY7A 3RXVA 1ORFA 1O35A 1O32A 3V3MA 1HAGE 1FY1A 4ABDA 2ZPSA 1LHCH 1G3CA 1Z7KA 1VCWA 1C2EA 3NUMA 2B8OH 3FAOA 3AAUA 1FJSA 2H2ZA 4MVNA 1EAXA 1HJAC 1XM1A 3GCHB 4ISIH 2G5NA 3KL6A 2ODQA 1UK4A 1PPCE 2G00A 5JYIA 4MNYA 2YOLA 4WF8A 3LGTA 1IAUA 3E90B 4Z6AH 1T8NA 4YT7H 1W0ZU 1ETRH 3P95A 2C8ZB 3NCLA 4BXSA 1AWHB 2ANKH 1GI1A 2A7CA 2A0QB 2A45B 2C93B 3P8FA 4ZROA 5C1UA 4Y8XA 2IPHA 2FODA 4JZFH 5A8YA 3T26A 3KEEA 5AVDA 1T31A 1FONA 1ELDE 5ETXA 2Y80A 1EQ9A 2V35A 1N6XA 3URCA 4NA9H 2QCYA 1FY5A 1DUEA 4JZDH 3RLWH 5DP5A 3RM2H 3UOUA 1ELBA 4IC6A 2R2WU 3QX5H 1TX7A 3SGAE 2QYIA 3M3VA 1Z8GA 1WOFA 1A0LA 1GDQA 3EA7A 3UPEA 2AGEX 3SV2H 4ABIA 1OKXA 2FLBH 1TQ0B 1ANBA 1QY6A 4UDWH 1GHWH 3LGUA 1OXGA 2XCFA 1CT4E 1GJ5H 1WQSA 2VINA 2H9EH 3DFLA 1C4Y2 3PLPA 4FXGH 4WH8A 1ELVA 1P2JA 3OYPA 1WYKA 2V6NA 3AW0A 3GCTG 1S5SA 1O3KA 3RXBA 2FX4A 1O2OA 3MH7A 1HAOH 4OS2A 1HCGA 1KXBA 1O2MA 2SGQE 1DS2E 2ZCKP 5H4IB 1QJ7B 4A6LA 1C1OA 1PPGE 4IN2A 3ATIA 3GDSA 3RMMH 4E06H 2GV7A 2ZZUH 1DLEA 1SR5C 1NT1A 1L4ZA 2J4IA 1GJCB 1ARCA 4I8HA 1G30B 1P02A 2PR3A 2ZU4A 5DK1A 1HRTH 1O5EH 1J17T 5EQQA 4ABHA 5C20A 5JDUB 5LPFA 1UK3A 3GY7A 3LT3A 2QGRA 1NESE 3MHWU 2ZWLH 3ZVCA 3H7OA 3B23B 3LC3A 1V2NT 2GKVE 2LPRA 3UWJH 2FP7B 2O8LA 3T29A 1TGBA 3A7ZA 1RTLA 5FBIA 3A81A 2BDGA 4AB8A 1Y3VA 1INCA 1V2LT 1Y5UT 2G55A 3M61U 3S9AA 1BBRK 2BLOA 1XMNB 1UVPA 2FIRH 3A7VA 1F0UA 2Z9IA 3BTTE 5A09A 1OYQA 3AAVA 2A4RA 1BMNH 1MUEB 1S82A 3O8BA 5AFYH 2ODPA 4Y11E 3Q3YA 2GV6A 1MQ6A 3RXOA 3ZYDA 4ASHA 2A2XH 5E0JA 2A4QA 3ZV8A 2SGAA 2AIQA 4X2WA 3PTNA 1GJ8B 3RXJA 5HM9A 3QZQA 5AFZH 1E38B 2ZU1A 1TABE 3PMHB 4TWYA 1ZOMA 1G3BA 2HOBA 5TCAA 4ABGA 5F6MA 1SSXA 1TONA 1TRNA 3TNTA 1SGTA 3MYWA 3ZZBA 2OC8A 2VWMA 4E7NA 1IQGA 2ZC9H 1LHFH 4AB9A 4JMYA 4BANB 2Q6DA 4XBBA 1FXYA 1QRWA 2OC1A 1IOEA 2ZPRA 2EC9H 3VXEH 5C5NA 1RS0A 1SFIA 4X1SU 1NC6A 2VIPA 1EB2A 3M5MA 1HAHH 2QF0A 4MNXA 1T8LA 4MNWA 2FTLE 1HBTH 6CHAC 1TE0A 3ZZAA 1A61H 4FUIA 2R3UA 3P6ZB 1C5UA 1NS3A 1ETTH 1P05A 3RC4A 1SLUB 5GDSH 1O3OA 1SGIB 4ISOA 2FYRA 3ZZ9A 4K1TA 5HMAA 1UO6A 2PWXA 1GJ9B 1NFWA 1VITH 2PUXB 1CBWC 2VGCC 2XWAA 2FM2A 2ZO3H 2YNBA 1LVYA 1QR3E 3A83A 2ZFTA 2XCNA 2B5TB 2ZFQH 1H4WA 1DM4B 1GBEA 1O3JA 4UONA 2FYQA 1UVTH 3U1IB 1ANDA 5A2MH 5BRRE 2AS9A 2ULLA 1ABIH 2A31A 2J95A 5A0AE 1AVGH 3A8DA 3OSYA 1GCTC 3A87A 1GBTA 4BAKB 1EOLA 3KQDA 3S69A 3K9XB 1O2HA 1SG8B 2J94A 3UWIA 1OS8A 2A5IA 1WSSH 4DURA 4X8TH 4B74A 1AE8H 5DP9A 1SLXB 4CRGA 1TOCB 1MU6B 5DO4H 1O2JA 3PB1E 3TGIE 4VGCC 4XSKU 4INLA 1Q3XA 4FUJA 5K0HA 3RXAA 1O2PA 2IN2A 1GI7B 1GMHG 1ZTKA 1SFQB 1K1PA 5EODA 4AN7A 2P3UB 3TJOA 1W12U 1GBBA 1K22H 1YM0A 3RXPA 1GJ4H 1YPGH 3SU2A 3SI4H 3A82A 1GPZA 3UQVA 1SGQE 5EXMA 5L2YH 3V12A 3U8OH 4JZ1A 4FUFA 2PGBB 2V3HH 3P17H 5L2ZH 2Z7FE 1FUJA 1W7GH 3SGQE 1O30A 2WPHS 5JBBS 2P93A 1KDQB 5F8ZA 4NZLA 4LK4A 3BTKE 5GWZA 1Y5AT 1D6RA 4MTBA 1DXPA 1KDQA 3UFAA 1ZGIA 2FOEA 2QXJA 3EE0B 2ZFFH 1TNJA 4Y7AA 1C4U2 4DVAU 4NFFA 2QF3A 1CT0E 2BY7X 2WPJS 3F68H 5BPEA 2PSYA 3LKWA 2O9QA 4H6TA 1V3XA 1YF4A 4NCYA 1LVBA 2WINI 2BX3A 4ISNA 3PLKA 1W10U 2HNTC 1GI4A 1GDNA 2A2QH 2ZHFH 3M3TA 4Y6DA 1AUJA 4GPGA 3AW1A 3UR6A 1TNKA 2VVUA 2ZDLA 3GCTF 3STJA 4U32A 1TRMA 4KTCA 1PYTC 1LHDH 1THSH 2DUCA 1TNHA 4BNRA 1GI9B 1QB1A 3LONA 3SJIA 4E05H 3P70B 1E34B 5EQSA 1SQTA 4NWKA 5E2PA 3RMNH 7LPRA 1O2RA 5C67A 1RJXB 2ILNA 4X1NU 1EX3A 2UUFB 2ZA5A 2AIPA 5EOKA 2JETC 2WPIS 3CS0A 1GWAA 1O34A 1UTJA 2UUJB 1XUIA 1TGSZ 3BTDE 3SJKA 4XBCA 3MH4A 2XBWA 1A3EH 4F49A 4FVBA 4ESTE 1NM6A 3S7KB 1P3CA 3SQHE 4CREA 2Q6GA 4FUCA 1NFXA 1P06A 3TITA 3KF2A 3PLBA 1PPEE 4GHTA 3H7TA 1LKBA 3EDXB 5EU8A 2I6QA 1YLCA 2PKSC 2VNTA 5GCHG 3RU4D 1BMMH 2D1JA 1Z6JH 4X2YA 1SHYA 3RXSA 4OGYA 3C27B 6ESTA 1LHGH 2ZTZA 1PQ5A 1C5XB 4IW4E 1RD3B 4FU7A 4BAQB 3DFJA 1WTHD 4TYDA 2QC2A 3TIUA 3TNSA 4ZH8A 3TK9A 1G37A 1Y3UA 5FCKA 2BD9A 1SGNE 1P12E 1ZJKA 2SGDE 1UVSH 4JZIA 3S9BA 2B9LA 5E8EH 1SGFA 4IN1A 2XWBI 3T2NA 3GICB 4Q7XA 1FPHH 1NRQH 1KY9A 1IQNA 1XUHA 1ELCA 1T4VH 2ZDNA 4D9RA 3LIWA 1C1MA 4BAOB 1GHAG 1SI5H 1XKAC 1DE7H 1CA0C 1GVKB 1Z71A 4K8BA 1G3EA 3U69H 1EP5A 4OS7A 1F0TA 3SZNA 1C2LA 2OC0A 2XTTB 1HLTH 2VIVA 1P0SH 1ID5H 5C3NA 3IWMA 3RP2A 2ZU3A 4DT7B 5HXFA 1TPAE 1KXAA 2VWOA 2PSXA 2ZFRH 2FI3E 4ISLA 1MKXH 3IITA 2PW8H 2BXTH 2THFB 2W7SA 1V2WT 2OTVA 3SUEA 4LOYH 1TIOA 2SFAA 1SC8U 2TIOA 2VWLA 1EPTB 4BAMB 1C5ZB 2P16A 1EPTA 4HZHA 2P8OC 1AZ8A 2BLVA 4Y10E 3ZZ3A 1C5LH 1UVOA 1TA6A 4XBDA 3LGWA 1EATA 3F9FA 1ZJDA 1C5QA 1BQYA 4O97A 4YTAA 1CBWB 1UCYH 2VGCB 2G52A 2O8TA 5EG4A 4HFPB 2QIQA 2NU0E 4TPIZ 5FPYA 5J4SA 1EUFA 4NA7A 3SUFA 4H42U 1ACBE 4A1VA 1W11U 3BTFE 3M35A 1NTPA 4TPYA 2FTMA 2ZTYA 1VITG 1AD8H 1OWIA 4X8UH 3L6PA 1HAVB 1IQHA 4X6PA 3ZV9A 1HAVA 2XRCA 2C8YB 2P3FH 1DOJA 1ZPZA 2UUKB 3BG4B 3UTUH 1S6HA 1EP6A 1Y8TA 3TVJB 1SHHB 4DGJA 1GHVH 2P94A 4ZHLU 5FPSA 3U9AH 2F9VA 4H4FA 2Z3EA 1C1RA 4AFUA 1O2ZA 3TPIZ 3MOCA 2R0LA 3FANA 1O2VA 2BMGB 4WMDA 4QT8C 5EXNA 1BJVA 5GXPA 1MH0A 1BJUA 1DSTA 3ODDA 1LHEH 2WYJA 1P2OA 5B6OA 1EZQA 2VIDA 1XUJA 3M3SA 2VU8E 1MTUA 1O31A 2GDDA 1PPBH 3MH6A 1YPEH 4IC5A 1IQFA 4SGBE 3V7TA 2CHAB 1ETSH 4GUXA 3ATWA 1KLTA 1QBOA 1WU1A 2G8TA 2Z3DA 2PLXA 1GBLA 2F9NA 2VVCA 5JB8S 1YCPH 3QDZB 1IQMA 3K2UA 1O2TA 2RA0A 4O9VA 1GHYH 1A0HB 3I78A 1CU1A 1NFUA 2DE8A 3SJ8A 4BOHA 3SO3A 3RXUA 1NPMA 2W26A 1QRZA 1P10A 7ESTE 4OS5A 5I25A 3ATKA 1C2DA 2HVXA 2WPLS 1AB9C 2ZGCA 3HKIB 1HPGA 4JYVH 4I31A 1TFXA 1Z8JB 3MH5A 1BRCE 1O3FA 3G01A 4IGDA 5K7RA 3D65E 1NFYA 4FVDA 3SU6A 3QLPH 4NWLA 1Q2WA 1V2TT 3GDUA 4K8YA 2Z94A 4X6MA 4ZUHA 1QB6A 2ZI2H 1LDTT 1O37A 6LPRA 2J92A 3BTWE 1DY8A 1ZR0A 3PO1C 4ABFA 1T4UH 2QY0B 2I6SA 2BDCA 2WUCA 1NU9A 4Y76A 1XXDA 3TK5A 2FPZA 1E35B 3RXTA 3RXMA 1C4V2 1TA2A 5GCHF 2JETB 1TX8A 1HFDA 2BY9X 3ZZ4A 5LPRA 1MD8A 1UTPA 4FUDA 4AX9H 1YPHE 4D8NA 1GG6C 1DX5M 1AKSB 1D3QB 2TPIZ 3EYDA 4AGKA 1AKSA 1QBNA 4OS4A 5SGAE 3T27A 2FS9A 2FEQH 3F1SB 4XOJA 2W3IA 4I8GA 4AYYB 3LGVA 1FDPA 1YPHC 4A1TA 1TNLA 2Y7XA 1O2QA 1TALA 2BD2A 1DWBH 1GI0A 4B1TA 1C5OH 2ZNKH 3DT0H 2ZFSA 1O3CA 1P11E 4AG1A 3SV6A 1FMGA 1O2WA 1H8DH 1TPOA 1G3DA 2AEIH 4UFDH 1DSUA 4X8SH 1GHAF 1BB0B 1A5IA 5CHAC 4Z0KA 1HV7A 1TPPA 5LPEA 1UTLM 1GGDC 2ZDVH 2BM2A 1L1NA 1O3IA 5GJ4B 4KELA 8KME2 2XC4A 1EAIA 1FAKH 3RXKA 1P8VC 1OSSA 2FOFA 1C5YB 1MBMA 1O33A 1ABJH 2CXVA 2Z3CA 2G4UA 1XVMA 3BF6H 1QL7A 4MPXA 5EW1H 1GL0E 2GMTC 3IG6B 1AWFH 2CJIA 2AMPA 2VH0A 4Q7YA 4KP0A 2Y6TA 3A7XA 2R9PA 1CA0B 4FUGA 1HAXB 4DY7B 3UNSA 1JBUH 3KQCA 3LGYA 4MPWA 3OY6U 2ZGHA 3RXIA 2D8WA 3E0PB 1LQDB 1UMAH 2GGVB 4DIHH 5FX5A 2GZ8A 3UOPA 2PUQH 3GDVA 4DW2U 5E0GA 2F83A 3UQOA 2Y5HA 2F9UA 3SU0A 3OY5U 1A1RA 3A86A 3QN7A 4HI3A 4ZHAA 1Y5BT 2ANWA 3O8CA 2Y7ZA 2A1DB 2WYGA 1Y59T 1MBQA 1P03A 3MU8A 5ABWA 1VR1H 2ZEBA 2NU2E 2CF8H 1QNJA 5A0BA 1QIXB 3EAJA 3O8DA 1GBJA 5FAHA 1KTSB 2ANYA 2FESH 2BY5X 3A80A 4O3UA 1QB9A 1VITF 2RDLA 1NRSH 2AMDA 2ZFPH 2BOHB 1W2KH 1GBAA 2XC0A 2JH6D 1BA8B 4Y71A 2FOBA 1ARBA 3D23A 1O2SA 1DWDH 1HAPH 3SUDA 1GJ7B 2GZ7A 8GCHG 3TJVA 1UVUH 1AZZA 2PFEA 2FXRA 2OQUA 2HWLB 2F9BH 1A3BH 4YOGA 2C8WB 4MPUA 2OC7A 4O03A 2WUBA 1O3AA 1ANEA 3VEQB 5TCCA 2JH0D 1BTUA 5A8XA 3CENA 1SGFG 3C1KA 5C1XA 1YPMH 3MU0A 3SU3A 1OP2A 5I46H 3S9CA 5EW2H 3RU4E 1F0RA 2OLGA 1BDAA 1V2QT 4X1PU 2GT8A 1ZRKA 1UTMA 4TY6A 1P2MA 4UFFH 1WV7H 3BTGE 3FP6E 3V13A 1VJ9U 1C5WB 4GVUA 4I8JA 4JYTA 3SV8A 2H5DA 2J34A 1G32B 3MU1A 1ZRBA 1BTXA 1EAUA 3VGCB 3I29A 3NKKA 1K1MA 4A92A 1QA0A 3D49H 1O2UA 1CA8B 1AUTC 1DICA 1HJ9A 1O2KA 1YPLH 2UWLA 1RIWC 2Q6FA 3H5CB 3M7QA 5GPIB 4B76A 4OGXA 3SNDA 5J4QA 3PYHA 1N8OC 1OP0A 3BIVH 4WH6A 5DP8A 2F91A 1D3TB 2ZHQH 1P04A 2ZP0H 1CVWH 5E0HA 1HJAB 1ZPBA 3A7WA 2AGIX 2Y82A 1ESBA 5ESBA 1TPSA 2ZF0H 1C5VA 3A84A 1GBDA 3ZVFA 5IYTA 1AGJA 1PPZA 1KLJH 2FI5E 1LPZB 4TWWA 1C1VH 2VIWA 3M5LA 1L4DA 1QJ6B 4K5ZA 1Y3YA 1GBHA 1BBRH 1CGHA 3RXRA 2C3SA 4AOQA 2W5EA 4Y8YA 4ZXXH 2WPMS 4AGJA 1P9UA 4IMQA 3CP7A 1IHTH 9LPRA 1QHRB 1C1TA 1AQ7A 1MTNC 4WY3A 2RA3A 4X8VH 3RLYH 4GAWA 3FVFB 5DP4A 5L30H 1J15A 2BD8A 1LCYA 1EB1H 2HALA 3E1XB 3OTJE 5ESTE 1N6YA 1B0EA 2BDHA 4I8LA 1SBWA 3GCHC 4B71A 1TQ7B 1DVAH 1D4PB 4CH2B 1C5RA 1F92A 1P3EA 3BSQA 1AY6H 3GY6A 3RUOA 1CE5A 1GJ6A 1MKWK 2FDAA 3QK1A 1MCVA 2FOGA 1O5GH 1ZTLA 3NWUA 2FOMB 3A88A 1HB0B 1ELFA 1MTWA 4ABBA 5IDKA 1C5MD 4JYUH 4AFSA 1N1LA 3LPRA 1O3DA 3MO3A 2AH4X 1O2GH 2BDIA 1C2HA 1GBCA 1JXPA 1VGCC 1Y3XA 4JK6A 1O2IA 5FCRA 1X7AC 1O5DH 1QL9A 4LZ4B 1ZPCA 1JWTA 1E36B 1O2NA 3SN8A 1S81A 1SQAA 3RXQA 4ABJA 1NZQH 1FQ3A 1MTSA 3MNSA 3RXHA 3SNBA 1ZMJA 4DCDA 3GY3A 1LPGB 2C90B 3SV7A 2OINA 3VPKA 2QN5T 4X1RU 1B5GH 4B75A 5T3HA 2PGQB 3RXLA 2EI7A 4YLQH 1O3GA 4X2XA 1K1NA 4CBNA 2OP9A 1O3NA 2ALVA 1BTHH 3T28A 1S6FA 2NWNA 4GLYA 3T25A 1TB6H 1O39A 3SGBE 2OXSA 4BTUB 3E8LA 2PKAB 1IQKA 2F3CE 2A4OA 1VCPA 1GGDB 5FHTA 2PKAA 3ZZ6A 1V2MT 1HJ8A 1SGRE 2H1UA 4LXBH 3SJ9A 9ESTA 4YLUA 3MU5A 2PV9B 2YNAA 1ANCA 1P09A 1TGNA 2IOTA 5JBTA 5JBAS 5L6NH 1AO5A 5FXLA 3Q77A 1D3PB 3ENSB 4K69A 1TWXB 5EPYA 1QL8A 2B7DH 3BIUH 3UNRA 1GMDG 4WXIA 2AYWA 2TGDA 4YOIA 2ZG0H 2H9HA 1SGYE 2D2DA 3BTEE 5EGMA 2AERH 5GIBA 2A7HA 4KTUA 4U2WA 1PFXC 1ZHMA 4UEHH 4D9QA 3P92A 1G2LA 2XBVA 4O3TA 3LH1A 1QBVH 1XUFA 1Z8RA 3M36A 1YLDA 2A5KA 2VH6A 1THPB 2SNWA 4M7GA 1YC0A 1F5KU 3SHCH 1NRNH 2O8UA 4KGAA 1K1JA 4Q7ZA 1T32A 1FNIA 4U30A 5EPNA 2GT7A 3WY8A 2QXGA 8GCHF 3ZVAA 1BCUH 1DANH 2A4GA 5JPMH 3KCGH 3URDA 5AF9H 4JZEH 2ESTE 2UUYA 3JZ2B 3UY9A 1MTVA 1CGJE 1XVOA 3PV4A 4X2VA 1H9LB 4NIWA 6CHAB 1A7SA 1HXFH 2GDEH 1A2CH 3R0FA 4R0IA 3ZVDA 1D3DB 2BZAA 1TGCA 1ZSLA 3JZ1B 4IBLH 4WXVA 2XBXA 2KAIB 1XUGA 1O3HA 2ZIQH 4NA8A 4X6OA 4NG9H 3RXDA 1FY4A 2KAIA 1NY22 1CHOG 1F7ZA 2GZ9A 1MZAA 3BG8A 1P2QA 1PYTD 1KSNA 2QXIA 1QA7A 1V2VT 1PPHE 2A7JA 4GHQA 4WWYA 1NRPH 1TGTA 4UD9H 2J38A 1YCPM 4XE4A 1FZZA 3PMAB 4YO9A 4Y0YE 1TLDA 1IQJA 1GCTB 4FUBA 1BBRE 1MQ5A 2RG3A 1GMCG 1P2KA 3GY5A 3LGIA 3L3TA 3PWCA 2JKHA 1SLVB 1O2LA 1GBMA 1KYNA 1UHBB 1A0JA 1UHBA 4F4OC 5C2ZA 1LVOA 3S0NA 1DFPA 5TJXA 1O0DH 1GJDB 3ELAH 3FP8E 3BN9A 1PJPA 2BY6X 1V2KT 1C1NA 1FY3A 2GX4A 1RIWB 4VGCB 1YYY1 1OWHA 4PROA 3OU0A 3SU1A 1DLKB 6GCHF 4U01A 3BEIB 3SV9A 1A5HA 2CMYA 1SB1H 2QAAA 5EQRA 1BRUP 2NU1E 1OWDA 1RTFB 1F0SA 2H6MA 2SGPE 3SW2B 3A8BA 2UWPA 1BMLA 3D62A 1GHBF 1O3BA 3SUGA 1LVMA 1ZYOA 4JCNA 2WV5A 1GBKA 5HM2A 1C5TA 1TOMH 1C5NH 1PQAA 3P8OA 2SGFE 1W3CA 2BQWB 2GTBA 4BTTB 2VJ1A 2HGTH 1JMOH 4D76A 1HYLA 4B73A 1W0YH 5FX6A 3M5NA 4ABEA 4D7FA 4K2YA 2OBQA 1LQEA 1C9TA 1SLWB 2CGAA 1TMTH 1TYNA 1C1WH 1HDTH 1MMJN 1C2MA 3SJOA 2R2MB 1MTNB 1YPKH 4FUEA 2TRMA 3SNCA 2ZHDA 4NIVA 3U98H 1KXFA 1GJBB 1P2NA 1BTZA 1KTTB 1OYTH 1W7XH 5F8XA 2J9NA 2VIQA 3TK6A 2GCHG 3KQBA 1BRAA 4A5TS 5JBCS 4ZXYH 3SU4A 3TJNA 1ESTA 1V2ST 2NU3E 2Y5GA 1K2I1 1JRTA 2GCTC 3E91A 3LDXH 5F03A 3TGKE 3ITIA 4CR5A 2PTNA 1ZHPA 1CGIE 2H9TH 2ZECA 2Q1JA 3SU5A 3TH4H 2H5CA 2WV4A 1LTOA 1S0QA 1AVWA 3CS7A 1O3EA 4NIXA 1VGCB 3HKJB 3LJJA 1BTYA 3U1JB 1EZXC 1ELEE 4K1SA 1YKTA 2GD4B 2BD4A 1Z6EA 1L2EA 1RFNA 1QCPA 3U8RH 2ZDAH 1SOTA 1J16A 2W3KA 4YOJA 2TGAA 3A7TA 4KKDA 3ZZ8A 1SPJA 8ESTE 4BXWA 2Y5FA 1ZTJA 1OWKA 3RC5A 2K1QA 2HNTF 4XDEA 7KMEH 1W13U 4ABAA 2Z9GA 1GL1A 1ELGA 2PKSB 1XX9A 4CR9A 2Z9JA 1UTOA 1KIGH 2B0FA 1QQ4A 2BQ6B 1UTQA 3P8NA 1AIXH 4ISHH 1U6QA 3KQEA 4GSOA 1GMDF 3PMBB 3GYMA 1ZHRA 1GHXH 3Q3XA 1SL3A 1O5CB 1O36A 1ZLRA 2VWNA 1HXEH 4GCHG 1ZMLA 1MAXA 4OS6A 4YM9A 2CV3A 2A5AA 2OCVB 4I33A 5JB9S 2ZDKA 2SNVA 2XC5A 1ZZZA 3AVZA 3VXFH 3TU7H 1EJMA 1BUIA 1O38A 1JIRA 4Y0ZE 1GJAB 3UIRA 5A0CA 2GP9B 2BVRH 1D6WA 4Q80A 3B9FH 3DHKH 4Q2KA 2JH5D 3N7OA 1Z1JA 3HK3B 3FFGA 4DJZB 1SGCA 3M37A 1H9HE 2A32A 3E16B 3ATLA 1ESAA 1WUNH 1UCYE 1P9SA 1T8MA 4AFZA 1AVXA 4Y7BA 1S85A 4B2CA 2ODYB 1S83A 2EA3A 1GI3A 1UK2A 1P2IA 4WMEA 3O8RA 1O2YA 3GY2A 2XXLA 1SOZA 1QFKH 1BHXB 3R3GB 1A4WH 4OS1A 3E0NB 1W14U 4JK5A 4YT6H 1V6DA 4AG2A 1EZUC 2AMQA 1MD7A 3GY8A 1DY9A 1CHOF 3RXGA 4HGCA 1B0FA 2AFQB 4ZKRU 4MPVA 1L1GA 1G9IE 4NFEA 1VCQA 3QTVH 4K1EA 2P8OB 3EA8A 1BTPA 2ASUB 1T7CA 3DA9B 3HPTB 2VIOA 4BAHB 3FP7E 2C4FH 4BTIB 4I8KA 4HTCH 1K28D 2G81E 2ANMH 1J14A 1SVPA 4FUHA 1BRBE 2BHGA 1E37B 1CT2E 3STIA 1GMCF 2XYAA 1L0ZA 5T6GA 3UNQA 1PQ8A 1WCZA 2EI6A 1CO7E 3GOVB 1L1JA 4A7IB 3RMLH 2PTCE 1FV9A 1BHXF 5CMXH 1IQIA 2UWOA 2FLRH 1TAWA 1DPOA 1V2PT 2BX4A 2XW9A 1DXWA 2ZHWH 1O5FH 3VB6A 4UFEH 3FZDA 5PTPA 1GI5A 1EPTC 4MG3A 1HUTH 1HAIH 4WMFA 1XUKA 1DWEH
chains in the Genus database with same CATH superfamily
1D9IA 3PROA 1YPJH 1VJAU 3DUXH 4CRAA 1WBGB 1V2OT 2Z9KA 1YY3A 2V3OH 1TNIA 2C8XB 1BOQA 1FN8A 3SNEA 3RM0H 3MMGA 2HLCA 1Z1IA 4IS5A 1BTWA 1CQQA 2F43B 1AMHA 3MNBA 1GVZA 1O5AB 1JIMA 1V2JT 3TH2H 1F5RA 4ZMAH 3PWBA 1DUAA 3A7YA 5B6LA 3P8GA 3BEUA 2BD5A 3VFEA 2Z9LA 3M7UA 1BT7A 1O3PB 2BDAA 3TJUA 4FU9A 1J9CH 4B2AA 1ZMNA 3M7TA 1PPFE 3GISB 4CRDA 2CN0H 1UTNA 3BEFB 4UE7H 3HGNA 4XRNA 1DWCH 2FZZA 3K65B 3LH3A 1K21H 3E3TA 3LU9B 3W94A 2QV1A 1G36A 4TT3D 1GI2A 1EXFA 3GCOA 2AGGX 4X6NA 3WW7A 3M5OA 3SHAH 2BVXH 2ZHEH 3BG4C 1WQVH 1SGEE 2TGPZ 2GCHF 2ZU2A 3AASA 2BVSH 1RTKA 5DG6A 2G5VA 3V0XA 3K6YA 1GBIA 1J8AA 1H9IE 1LO6A 1GHZA 4AORA 2ZGJA 1XKBC 1CSOE 1K1OA 3RXFA 2ZQ1A 2OQ5A 1YP9A 1GVLA 1XXFA 3S7HB 1NBME 1AFEH 2FWWA 1WAYB 4D7GA 1FI8A 2ZTXA 1AE5A 3KIDU 4X0WU 2FMJA 4CRFA 1MCTA 3PRDA 4J2YB 6GCHG 1OPHB 1A5GH 4ZKOU 2STAE 1ELTA 2BZ6H 1AB9B 4CHAC 1IHSH 5LGOA 4YESB 5T6DA 1IQEA 2IJOB 3DD2H 1AFQC 1C2FA 3NPSA 5FPTA 1GHBG 2YMSB 4DIIH 2GCTB 3RXEA 1V2UT 3Q3KA 3UREA 3ZYEA 1UJ1A 2BDBA 2ZPQA 2OBOA 1HIAB 4AZ2B 1E0FD 1EJNA 2CHAC 1HIAA 3A8AA 4AFQA 1H8IH 1AHTH 2FO9A 1MKXK 4AYVB 1RGQA 3EQ0H 1SQOA 2G4TA 3PO1B 3BTME 3OEHD 7GCHG 5DP7A 3KGPA 3RU4T 2HNTE 4ZAEA 5G4BA 1C1PA 3UB0A 4I32A 5DPAA 1QGFA 1C9PA 3RC6A 4NSVA 1F2SE 1FLEE 3BTHE 4B2BA 1UTKA 5HIYA 1YGCH 3RDZA 1HAZB 1MZDA 4SGAE 2OUAA 2M5TA 1GG6B 1KXDA 3NRLA 5LH8A 2XNIA 2BQ7B 1FN6A 3ZVEA 1GI8B 1F5LA 3QWCH 3I77A 2V0BA 3VB7A 1UCYK 3KHVA 4GCHF 1HGTH 2O8MA 4I7YH 3HK6B 2VB0A 1C2JA 1FPCH 3PMJA 3SOSA 2FOHA 3MNCA 1O2XA 1GBFA 2STBE 2BY8X 1BIOA 3KN2A 3SNAA 1MAYA 1CHGA 1TMUH 3NXPA 2IPQX 2P3TB 2FI4E 1NN6A 5DP3A 3K6ZA 5C0UA 4FU8A 1C2KA 1KLIH 1AN1E 1K1LA 1QRXA 3QGNB 3TLOA 4Y8ZA 5DJ7A 2P59A 3MI4A 2ZU5A 3EA9A 5CHAB 1LKAA 1M9UA 1K9OE 3VB5A 3F0PA 3L33A 5DN6D 1W8BH 1SGPE 1KXCA 1IQLA 1EZSC 1QURH 1C1QA 2BOKA 1P01A 1NROH 2ZGXH 3ZZCA 2HPPH 2BB4A 3GYLB 3F9HA 1QQUA 5T1VA 4DT4A 4DOQA 2XBYA 2GMTB 4MDSA 3T62A 4ZHMU 2WPKS 3FZZA 1EAWA 1MU8B 3VB4A 1KXEA 5FBEA 5HGGA 2BLWA 4THNH 4CBOA 1JOUB 2BXUH 1LMWB 3VB3A 4WVPE 4K3JA 1YWUA 2ZKSA 5HYOA 2BDYA 3TGJE 2Z6BD 2W6ID 1Y3WA 2F9PA 5DGJA 1T8OA 3ESTA 3ZZ7A 2SGEE 3HATH 3U8TH 4F48B 2BD7A 2P95A 2R3YA 2G51A 3LOXA 4X1QU 3EGKH 8LPRA 1Z8IB 3MO6A 1P57B 2JJ2D 4NGAH 2TGTA 1O5BB 3PTBA 5C1YA 1YCPK 1V2RT 3A8CA 2GVFA 1GDUA 3Q76A 4MQAA 3ZZDA 1FY8E 2DE9A 3QGJA 4WJG2 4CRCA 3MTYA 3MNXA 1G2MA 1A46H 1FIZA 2ZGBH 1C2GA 3KNXA 3LC5A 1EKBB 1ZGVA 1BITA 4INKA 1TX6A 2LNCA 2NU4E 1SGDE 1FIWA 3Q00A 1GCDA 5C5OA 3LJOA 1EOJA 3BTQE 2ZCHP 4NZQA 3W95A 1FAXA 1AU8A 4IMZA 1ELAA 4RKJB 3F9GA 1OWJA 1K1IA 2BTCE 3MFJA 4J1YA 3ZVGA 4A1XA 1YBWA 1GI6A 2ZCLP 5A8ZA 4RKOB 1C5SA 4UFGH 1EJAA 1C1UH 1WTGH 3E6PH 4K60A 4KTSA 1Q31A 1WXRA 2BYAX 1O3LA 1ZSJA 2HPQH 3UR9A 2O8WA 2W7UA 4INHA 3SORA 3MO9A 1LPKB 3MU4A 1MKWH 4YZUA 1DT2A 2K0QA 1ZSKA 2R0KA 2ZQ2A 1RRKA 1OP8A 2D26C 2PHBA 1TMBH 3QZRA 3DSOA 3OX7U 4H6SB 1RXPA 2TBSA 5EXLA 4CH8B 3F3BA 3ZVBA 4MNVA 4Y79A 4XFQA 2Y81A 1S0RA 5AHGH 3GY4A 1JRSA 1QJ1B 2F9OA 2EEKA 2RFKC 1PQ7A 2VVVA 3ZZ5A 1C5PA 3OE7D 5E2OA 4ZKNU 3UUZA 1O3MA 1TBZH 2HRVA 3ODFA 1TRYA 2CF9H 1VZQH 1HAYB 1COWD 4CRBA 2FS8A 2KCYA 1THRH 2FX6A 2RCEA 3F6UH 1H1BA 5EJLA 2ALPA 1TBRH 2J2UA 2LP6A 3SBKA 1OX1A 1BMAA 2L74A 4NSYA 1B7XB 2FOAA 3QO6A 1TNGA 2FOCA 5DSFA 1N8OB 2HLDD 1GMHF 3HGPA 3ATMA 4R8TB 4NIYA 1OOKB 2OD3B 3RMOH 1NO9H 4LZ1H 2EI8A 2QXHA 3TH3H 4AC9A 2BLQA 3NZIA 4DG4A 3B8JA 1QTFA 3F9EA 4E7RG 4MLFB 3NK8A 3PM3A 1DITH 3QUMP 1OWEA 1EASA 1HNEE 1S84A 2ZDMA 3SI3H 2QA9E 4RSPA 5F8TA 1C2IA 1NRRH 3QTOH 3MWIU 5T6FA 2BD3A 1BZXE 3A89A 5DP6A 1DDJA 4RN6A 4CHAB 1C1SA 7GCHF 5DKMA 1TBQH 3RXCA 3GCNA 3VGCC 1AI8H 1SMFE 3BV9B 3T5FH 5CE1A 3A85A 1AFQB 4ZKSU 3SQEE 1NU7B 4TY7A 3RXVA 1ORFA 1O35A 1O32A 3V3MA 1HAGE 1FY1A 4ABDA 4ASUD 2ZPSA 1LHCH 1G3CA 3MQKC 1Z7KA 1VCWA 1C2EA 3NUMA 2B8OH 3FAOA 2KM0A 3AAUA 1FJSA 2H2ZA 4MVNA 1EAXA 1HJAC 1XM1A 3GCHB 4ISIH 2G5NA 3KL6A 2ODQA 1UK4A 1PPCE 2G00A 5JYIA 4MNYA 2YOLA 4WF8A 3LGTA 1EFRD 1IAUA 3E90B 4Z6AH 5KGOA 1T8NA 4YT7H 1W0ZU 1ETRH 3P95A 2C8ZB 3NCLA 4BXSA 1AWHB 2ANKH 1GI1A 2A7CA 2A0QB 1H8ED 2A45B 3FO8D 3FKSD 2C93B 3P8FA 4ZROA 5C1UA 4TSFD 4Y8XA 2IPHA 2FODA 4JZFH 5A8YA 3T26A 5IK2D 3KEEA 5AVDA 1T31A 1FONA 1ELDE 5ETXA 2Y80A 1EQ9A 2V35A 1N6XA 3URCA 4NA9H 2QCYA 1FY5A 1YLNA 1DUEA 4JZDH 3RLWH 4RI0A 2J97A 5DP5A 3RM2H 3UOUA 1ELBA 4IC6A 1K0HA 2R2WU 3QX5H 1TX7A 3SGAE 2QYIA 1W0KD 3M3VA 1Z8GA 1WOFA 1A0LA 1GDQA 3EA7A 3UPEA 2AGEX 3SV2H 4ABIA 1OKXA 2FLBH 1TQ0B 1ANBA 1QY6A 4UDWH 1GHWH 3LGUA 1OXGA 2XCFA 1CT4E 1GJ5H 2J98A 1WQSA 2VINA 2H9EH 3DFLA 1C4Y2 3PLPA 4FXGH 4WH8A 1ELVA 1P2JA 3KYFA 3OYPA 4YXWD 1WYKA 2V6NA 1FX0B 3AW0A 3GCTG 1S5SA 1O3KA 3RXBA 2FX4A 1O2OA 3MH7A 1HAOH 4OS2A 1HCGA 1KXBA 4ACBA 3PV2A 1O2MA 2SGQE 1DS2E 2ZCKP 5H4IB 1QJ7B 4A6LA 1C1OA 1PPGE 4IN2A 3ATIA 3GDSA 3RMMH 4E06H 2GV7A 3W1EA 2ZZUH 1DLEA 1SR5C 1NT1A 1L4ZA 2J4IA 1GJCB 1ARCA 4I8HA 1G30B 2RDEA 1P02A 2PR3A 2GJGA 2ZU4A 5DK1A 1HRTH 1O5EH 1J17T 5EQQA 4ABHA 5C20A 5JDUB 5LPFA 1UK3A 3GY7A 3LT3A 2QGRA 1NESE 3MHWU 2ZWLH 3ZVCA 3H7OA 2KZ4A 3B23B 3LC3A 1V2NT 2GKVE 2LPRA 3UWJH 2FP7B 2O8LA 3T29A 1TGBA 3A7ZA 1RTLA 1VKYA 5FBIA 3A81A 2BDGA 4AB8A 1Y3VA 1INCA 1V2LT 1Y5UT 2G55A 3M61U 3S9AA 1BBRK 2BLOA 1XMNB 1UVPA 2FIRH 3A7VA 1F0UA 2Z9IA 3F2HA 3BTTE 5A09A 1OYQA 3AAVA 2A4RA 1BMNH 1MUEB 1S82A 3O8BA 5AFYH 2ODPA 4Y11E 3Q3YA 2GV6A 1MQ6A 3RXOA 3ZYDA 4ASHA 2A2XH 5E0JA 2A4QA 3ZV8A 2SGAA 2AIQA 4X2WA 3PTNA 1GJ8B 3RXJA 5HM9A 3QZQA 5AFZH 1E38B 2ZU1A 1TABE 3PMHB 4TWYA 5KEDA 1ZOMA 1G3BA 2HOBA 5TCAA 4ABGA 5F6MA 1SSXA 1TONA 1TRNA 3TNTA 1SGTA 3MYWA 3ZZBA 2OC8A 2VWMA 4E7NA 1IQGA 2ZC9H 1LHFH 4AB9A 5C94A 4JMYA 4BANB 2Q6DA 4XBBA 1FXYA 1QRWA 2OC1A 1IOEA 2ZPRA 2EC9H 3VXEH 5C5NA 1RS0A 1SFIA 4X1SU 1NC6A 2VIPA 1EB2A 3M5MA 1HAHH 2QF0A 4MNXA 1T8LA 4MNWA 2FTLE 1HBTH 3FN8A 1TE0A 6CHAC 3ZZAA 1A61H 4FUIA 2R3UA 2V3MA 3P6ZB 1C5UA 1NS3A 1ETTH 1P05A 3RC4A 1SLUB 5GDSH 1O3OA 1SGIB 4ISOA 2FYRA 3ZZ9A 4K1TA 5CHBA 5HMAA 1UO6A 2PWXA 1GJ9B 1NFWA 1VITH 2PUXB 1CBWC 2VGCC 2XWAA 2FM2A 2ZO3H 2YNBA 1LVYA 2KCPA 2QE7D 1QR3E 5KECA 3A83A 2ZFTA 2XCNA 1S6LA 2B5TB 2ZFQH 1H4WA 1DM4B 1GBEA 1O3JA 4UONA 2FYQA 1UVTH 3U1IB 1ANDA 5A2MH 5BRRE 2AS9A 2ULLA 1ABIH 2A31A 2J95A 5A0AE 1AVGH 3A8DA 3OSYA 1GCTC 3A87A 1GBTA 4BAKB 1EOLA 3KQDA 3S69A 3K9XB 1O2HA 1SG8B 2J94A 3UWIA 1OS8A 2XOKD 2A5IA 1WSSH 4DURA 4X8TH 4B74A 1AE8H 5DP9A 1SLXB 4CRGA 1TOCB 1MU6B 5DO4H 1O2JA 3PB1E 3TGIE 4VGCC 4XSKU 4INLA 1Q3XA 4FUJA 5K0HA 3RXAA 1O2PA 2IN2A 1GI7B 1GMHG 1ZTKA 1SFQB 5GNDA 1K1PA 5EODA 4AN7A 2P3UB 3TJOA 1W12U 1GBBA 1K22H 1YM0A 3RXPA 1GJ4H 1YPGH 3SU2A 3SI4H 3UAIC 3A82A 1GPZA 3UQVA 1SGQE 5EXMA 5L2YH 3V12A 3U8OH 4JZ1A 4FUFA 2PGBB 2V3HH 3P17H 5L2ZH 2Z7FE 1FUJA 1W7GH 3SGQE 1O30A 2WPHS 5JBBS 5HKKD 2P93A 1KDQB 1E1RD 5F8ZA 4NZLA 4LK4A 3BTKE 5GWZA 1Y5AT 1D6RA 4MTBA 1DXPA 1KDQA 3UFAA 1ZGIA 2FOEA 2QXJA 3EE0B 2ZFFH 1TNJA 4Y7AA 1C4U2 4DVAU 4NFFA 2QF3A 1CT0E 2BY7X 2WPJS 3F68H 5BPEA 2PSYA 3LKWA 2O9QA 4H6TA 1V3XA 1YF4A 4NCYA 1LVBA 2WINI 2BX3A 4ISNA 3PLKA 1W10U 2HNTC 1GI4A 1GDNA 2A2QH 2ZHFH 3DCLA 3M3TA 4Y6DA 1AUJA 4GPGA 3AW1A 3UR6A 1TNKA 2VVUA 2ZDLA 3GCTF 3STJA 4U32A 1TRMA 4KTCA 1PYTC 1LHDH 1THSH 2DUCA 1TNHA 4BNRA 1GI9B 1QB1A 3LONA 3SJIA 4E05H 3P70B 1E34B 5EQSA 1SQTA 4NWKA 5E2PA 3RMNH 7LPRA 1O2RA 5C67A 3N99A 1RJXB 2ILNA 4X1NU 1EX3A 2UUFB 2ZA5A 2AIPA 5EOKA 2JETC 2WPIS 3CS0A 1GWAA 1O34A 1UTJA 2UUJB 1XUIA 1TGSZ 3BTDE 3SJKA 4XBCA 3MH4A 2XBWA 1A3EH 4F49A 4FVBA 4ESTE 1NM6A 3S7KB 1P3CA 3SQHE 4CREA 2Q6GA 4FUCA 1NFXA 1P06A 3TITA 3KF2A 3PLBA 3U28C 1PPEE 4GHTA 3H7TA 1LKBA 3DSGA 3EDXB 5EU8A 2I6QA 1YLCA 2PKSC 2VNTA 5GCHG 3RU4D 1BMMH 2D1JA 1Z6JH 2AHME 4X2YA 1SHYA 3RXSA 4OGYA 3C27B 6ESTA 5EIYA 2L6OA 5HIZA 4F55A 1LHGH 2ZTZA 1PQ5A 1C5XB 4IW4E 1E1QD 1RD3B 4FU7A 4BAQB 3DFJA 1WTHD 4TYDA 2QC2A 3TIUA 3N7EA 3TNSA 4ZH8A 3TK9A 1G37A 1Y3UA 5FCKA 2BD9A 1SGNE 1P12E 1ZJKA 2SGDE 2WZQA 1UVSH 4JZIA 3S9BA 2B9LA 5E8EH 1SGFA 4IN1A 2XWBI 3KYGA 3T2NA 3GICB 4Q7XA 1FPHH 1NRQH 1KY9A 1IQNA 1XUHA 1ELCA 1T4VH 2ZDNA 4D9RA 3LIWA 1C1MA 4BAOB 1GHAG 1SI5H 1XKAC 1DE7H 1CA0C 1GVKB 1Z71A 4K8BA 1G3EA 3U69H 1EP5A 4OS7A 1F0TA 3SZNA 1C2LA 2OC0A 2XTTB 1HLTH 3F2FA 2VIVA 1P0SH 1ID5H 5C3NA 3IWMA 3RP2A 2ZU3A 4DT7B 5HXFA 1TPAE 1KXAA 2VWOA 2PSXA 2ZFRH 2FI3E 4ISLA 1MKXH 3IITA 2PW8H 2BXTH 2THFB 2W7SA 1V2WT 2OTVA 5FL7D 3SUEA 4LOYH 1TIOA 2SFAA 1SC8U 2TIOA 2VWLA 1EPTB 4BAMB 1C5ZB 2P16A 1EPTA 4HZHA 2P8OC 1AZ8A 3CNRA 2BLVA 4Y10E 3ZZ3A 1C5LH 1UVOA 1TA6A 4XBDA 3LGWA 1EATA 3F9FA 1ZJDA 1C5QA 4Q63A 1BQYA 4O97A 1W0JD 4YTAA 1CBWB 1UCYH 2VGCB 2G52A 3N7DA 3VG8A 2O8TA 5EG4A 4HFPB 2QIQA 2NU0E 4TPIZ 5FPYA 5J4SA 1EUFA 4NA7A 3SUFA 4H42U 1ACBE 4A1VA 1W11U 2WPDD 3BTFE 1NTPA 3M35A 2FTMA 2ZTYA 4TPYA 1VITG 1AD8H 1OWIA 4X8UH 3L6PA 1HAVB 1IQHA 4X6PA 3ZV9A 1HAVA 2XRCA 2C8YB 2P3FH 1DOJA 1ZPZA 2UUKB 3BG4B 3UTUH 1S6HA 1EP6A 1Y8TA 3TVJB 1SHHB 4DGJA 1GHVH 2P94A 4ZHLU 5FPSA 2LELA 3U9AH 2F9VA 4H4FA 2Z3EA 1C1RA 4AFUA 1O2ZA 3TPIZ 3MOCA 2R0LA 3FANA 1O2VA 2BMGB 4WMDA 4HG6A 4QT8C 5EXNA 1BJVA 2PP6A 5GXPA 1MH0A 1BJUA 1DSTA 3ODDA 1LHEH 2IJD1 2WYJA 1P2OA 5B6OA 1EZQA 2VIDA 1XUJA 3M3SA 2VU8E 1MTUA 4RT1A 1O31A 2GDDA 1PPBH 3MH6A 1YPEH 4IC5A 1IQFA 2QF5A 4SGBE 3V7TA 2CHAB 1ETSH 4GUXA 3ATWA 1KLTA 1QBOA 2XNDD 1WU1A 2G8TA 1QZ8A 2PLXA 2Z3DA 1GBLA 2F9NA 2VVCA 5JB8S 1YCPH 3QDZB 1IQMA 3K2UA 1O2TA 2RA0A 4O9VA 1GHYH 1A0HB 3I78A 1CU1A 1NFUA 2DE8A 3SJ8A 4BOHA 3SO3A 3RXUA 1NPMA 2W26A 1QRZA 1P10A 7ESTE 4OS5A 5I25A 3PRBA 3ATKA 1C2DA 2HVXA 2WPLS 1AB9C 2ZGCA 3HKIB 1HPGA 4JYVH 5C0TA 4I31A 1TFXA 1Z8JB 3MH5A 1BRCE 1O3FA 3G01A 2YMSC 4IGDA 5K7RA 3D65E 1NFYA 4FVDA 3SU6A 3QLPH 4NWLA 1Q2WA 1V2TT 3GDUA 4K8YA 2Z94A 4X6MA 4ZUHA 1QB6A 2ZI2H 1LDTT 1O37A 6LPRA 2J92A 3BTWE 1DY8A 1ZR0A 3PO1C 4ABFA 1T4UH 2QY0B 2I6SA 2BDCA 2WUCA 1NU9A 4Y76A 1XXDA 3TK5A 2FPZA 1E35B 3RXTA 3RXMA 1C4V2 1TA2A 5GCHF 2JETB 1TX8A 1HFDA 2BY9X 3ZZ4A 5LPRA 1MD8A 1UTPA 4FUDA 4AX9H 1YPHE 4D8NA 1GG6C 1DX5M 1AKSB 2J98B 1D3QB 2TPIZ 3EYDA 4AGKA 1AKSA 4P02A 1SQRA 1QBNA 4OS4A 5SGAE 3T27A 2FS9A 2FEQH 3F1SB 4XOJA 2W3IA 4I8GA 1E79D 4AYYB 2W6JD 5EJZA 3LGVA 1FDPA 1YPHC 4A1TA 4RT0A 1TNLA 2Y7XA 1O2QA 1TALA 2BD2A 1DWBH 1GI0A 4B1TA 1C5OH 2ZNKH 3DT0H 2ZFSA 1O3CA 1P11E 3OEED 4AG1A 2J5UA 3SV6A 1FMGA 1O2WA 1H8DH 1TPOA 1G3DA 2AEIH 4UFDH 1DSUA 4X8SH 1GHAF 1BB0B 3OTPA 1A5IA 5CHAC 4Z0KA 1HV7A 1TPPA 5LPEA 1UTLM 2WV9A 1GGDC 2ZDVH 2BM2A 1L1NA 1O3IA 5GJ4B 4ACAA 4KELA 8KME2 2XC4A 1EAIA 1FAKH 3RXKA 2CK3D 1P8VC 1OSSA 2FOFA 1C5YB 1MBMA 1O33A 1ABJH 2CXVA 2Z3CA 1WDIA 2G4UA 1XVMA 3BF6H 1QL7A 4MPXA 5EW1H 1GL0E 2GMTC 3IG6B 1AWFH 2CJIA 2AMPA 2VH0A 2HVYB 4Q7YA 4KP0A 2Y6TA 3A7XA 2R9PA 1CA0B 4FUGA 2KX4A 1HAXB 4DY7B 3UNSA 1JBUH 3KQCA 3LGYA 4MPWA 3OY6U 4I86A 2ZGHA 3RXIA 2D8WA 3E0PB 1LQDB 2KCAA 1UMAH 2GGVB 1BMFD 4DIHH 5FX5A 2GZ8A 3UOPA 2PUQH 3GDVA 4DW2U 5E0GA 2F83A 3UQOA 2Y5HA 2F9UA 3SU0A 3OY5U 1A1RA 3A86A 3QN7A 4HI3A 4ZHAA 1Y5BT 2ANWA 3O8CA 2Y7ZA 2A1DB 2WYGA 1Y59T 1MBQA 1P03A 3MU8A 5ABWA 1VR1H 2ZEBA 2NU2E 2CF8H 1QNJA 5A0BA 1QIXB 3EAJA 3O8DA 1GBJA 5FAHA 1KTSB 2ANYA 2FESH 2BY5X 3A80A 4O3UA 3DSPA 5C17A 1QB9A 1VITF 2RDLA 1NRSH 2AMDA 2ZFPH 2BOHB 1W2KH 1GBAA 2XC0A 2JH6D 1BA8B 4Y71A 2FOBA 1ARBA 3D23A 1O2SA 1DWDH 1HAPH 3SUDA 1GJ7B 2GZ7A 8GCHG 3TJVA 1UW7A 1UVUH 1AZZA 2PFEA 2FXRA 2OQUA 2HWLB 2F9BH 1A3BH 4YOGA 2C8WB 2EQNA 4MPUA 2OC7A 4O03A 2WUBA 1O3AA 4Z1MD 1ANEA 3VEQB 5TCCA 2JH0D 1BTUA 5A8XA 3CENA 1SGFG 3C1KA 5C1XA 1YPMH 3MU0A 3SU3A 1OP2A 5I46H 3S9CA 4M9FA 5EW2H 2WHXA 3RU4E 1F0RA 2OLGA 1BDAA 1V2QT 4X1PU 2GT8A 1ZRKA 1UTMA 4B6EA 4TY6A 1P2MA 4UFFH 1WV7H 3BTGE 3FP6E 2KFWA 3V13A 1VJ9U 1C5WB 3EE7A 2QF4A 4GVUA 4I8JA 4JYTA 3SV8A 2H5DA 2J34A 1G32B 3MU1A 1ZRBA 1BTXA 1EAUA 3VGCB 3I29A 3NKKA 1K1MA 4A92A 4B6FA 1QA0A 3D49H 1O2UA 1CA8B 1AUTC 1DICA 1HJ9A 1O2KA 1YPLH 2UWLA 1RIWC 2Q6FA 3H5CB 3M7QA 5GPIB 4B76A 4OGXA 3SNDA 5CDFE 5J4QA 3PYHA 1N8OC 1OP0A 3BIVH 4WH6A 5DP8A 2F91A 1D3TB 2ZHQH 1P04A 5F53A 2ZP0H 1CVWH 5E0HA 1HJAB 1ZPBA 3A7WA 2AGIX 2Y82A 1ESBA 5ESBA 1TPSA 2ZF0H 1C5VA 3A84A 1GBDA 3ZVFA 5IYTA 1AGJA 1PPZA 1KLJH 2FI5E 1LPZB 4TWWA 1C1VH 4P00A 2VIWA 3M5LA 1L4DA 1QJ6B 2KR7A 1Y3YA 4K5ZA 1GBHA 1BBRH 1CGHA 3RXRA 2C3SA 4AOQA 2W5EA 4Y8YA 4ZXXH 2WPMS 4AGJA 1P9UA 3SZEA 4IMQA 3CP7A 1IHTH 9LPRA 1QHRB 4Q4LA 1C1TA 1AQ7A 1MTNC 4WY3A 2RA3A 4X8VH 3RLYH 4GAWA 3FVFB 5DP4A 3WWBA 5L30H 1J15A 2BD8A 1LCYA 1EB1H 2HALA 3E1XB 3OTJE 5ESTE 1N6YA 1B0EA 2BDHA 4I8LA 1SBWA 3GCHC 4B71A 1TQ7B 1DVAH 1D4PB 4CH2B 1C5RA 1F92A 1P3EA 3BSQA 1AY6H 3GY6A 3RUOA 1CE5A 1GJ6A 1MKWK 2FDAA 3QK1A 1MCVA 2FOGA 1O5GH 1ZTLA 3NWUA 2FOMB 3A88A 1HB0B 1ELFA 1MTWA 4ABBA 5IDKA 1C5MD 4JYUH 2OK5A 4AFSA 1N1LA 3LPRA 1O3DA 3MO3A 2AH4X 1O2GH 2BDIA 1C2HA 1GBCA 1JXPA 1VGCC 1Y3XA 4JK6A 1O2IA 5FCRA 1X7AC 1O5DH 1QL9A 4LZ4B 1ZPCA 1JWTA 1E36B 1O2NA 3SN8A 1S81A 1SQAA 3RXQA 4ABJA 1NZQH 1FQ3A 1MTSA 3MNSA 3RXHA 3SNBA 1ZMJA 4DCDA 3GY3A 1LPGB 2C90B 3SV7A 2OINA 3VPKA 2QN5T 4X1RU 1B5GH 4B75A 5T3HA 2PGQB 3SYJA 3RXLA 2EI7A 4YLQH 1O3GA 4X2XA 1K1NA 4CBNA 2OP9A 1O3NA 2ALVA 1BTHH 3T28A 1S6FA 2NWNA 4GLYA 3T25A 1TB6H 1O39A 3SGBE 2OXSA 4BTUB 3E8LA 2PKAB 1IQKA 2F3CE 2A4OA 1VCPA 1GGDB 5FHTA 2PKAA 3ZZ6A 1V2MT 1HJ8A 1SGRE 2H1UA 4LXBH 3SJ9A 9ESTA 4YLUA 3MU5A 2PV9B 2JDID 2YNAA 1ANCA 1P09A 1TGNA 2IOTA 5JBTA 5JBAS 5L6NH 1AO5A 5FXLA 3Q77A 1D3PB 3ENSB 4K69A 1TWXB 5EPYA 1QL8A 2B7DH 3BIUH 3UNRA 1GMDG 4WXIA 2AYWA 2TGDA 4YOIA 2ZG0H 2H9HA 1SGYE 2D2DA 3BTEE 5EGMA 2AERH 5GIBA 2A7HA 4KTUA 4U2WA 1PFXC 1ZHMA 4UEHH 4D9QA 3P92A 1G2LA 2V7QD 2XBVA 3LH1A 4O3TA 1QBVH 1XUFA 1Z8RA 1NBMD 3M36A 1YLDA 2A5KA 2VH6A 1THPB 2SNWA 4M7GA 1YC0A 1F5KU 3SHCH 1NRNH 2VBCA 2O8UA 3GS9A 4KGAA 1K1JA 2M2AA 4Q7ZA 1T32A 1FNIA 4U30A 5EPNA 2GT7A 3WY8A 2QXGA 8GCHF 3WWFA 1BCUH 4OM9A 3ZVAA 1DANH 2A4GA 5JPMH 3KCGH 3URDA 5AF9H 4JZEH 2ESTE 2UUYA 3JZ2B 2WSSD 3UY9A 1MTVA 1CGJE 1XVOA 3PV4A 4X2VA 1H9LB 4NIWA 6CHAB 1A7SA 1HXFH 2GDEH 1A2CH 3R0FA 4R0IA 3ZVDA 1D3DB 2BZAA 1TGCA 1ZSLA 3JZ1B 4IBLH 4WXVA 2XBXA 2KAIB 1XUGA 1O3HA 2ZIQH 4NA8A 4X6OA 4NG9H 3RXDA 1FY4A 2KAIA 1NY22 1CHOG 1F7ZA 2GZ9A 1MZAA 3BG8A 1P2QA 3KQ5A 1PYTD 1KSNA 2QXIA 1QA7A 1V2VT 1PPHE 2A7JA 4GHQA 4WWYA 1NRPH 1TGTA 4UD9H 1MABB 2J38A 1SKYE 1YCPM 4XE4A 1FZZA 3PMAB 4YO9A 4Y0YE 1TLDA 1IQJA 1GCTB 4FUBA 1BBRE 1MQ5A 2RG3A 1GMCG 1P2KA 3GY5A 3LGIA 3L3TA 3PWCA 2JKHA 1SLVB 1O2LA 1GBMA 1KYNA 1UHBB 1A0JA 1UHBA 4F4OC 5C2ZA 3OFND 1LVOA 3S0NA 1DFPA 5TJXA 1O0DH 1GJDB 3ELAH 3FP8E 3BN9A 1PJPA 2BY6X 1V2KT 1C1NA 1FY3A 2GX4A 1RIWB 4VGCB 1YYY1 1OWHA 4PROA 3OU0A 3SU1A 1DLKB 6GCHF 4U01A 3BEIB 3SV9A 1A5HA 2CMYA 1SB1H 2QAAA 5EQRA 1BRUP 2NU1E 1OWDA 1RTFB 1F0SA 2H6MA 2SGPE 3SW2B 3A8BA 2UWPA 1BMLA 3D62A 1GHBF 1O3BA 3SUGA 1LVMA 1ZYOA 4JCNA 2WV5A 1GBKA 5HM2A 1C5TA 3FOAA 1TOMH 1C5NH 1PQAA 3P8OA 2SGFE 1W3CA 2BQWB 2GTBA 4BTTB 2VJ1A 2HGTH 1JMOH 4D76A 1HYLA 4B73A 1W0YH 4XD7D 3PV5A 5FX6A 3M5NA 4ABEA 4D7FA 4K2YA 2OBQA 1LQEA 1C9TA 1SLWB 2CGAA 1TMTH 1TYNA 1C1WH 1HDTH 1MMJN 1C2MA 3SJOA 2R2MB 1MTNB 1YPKH 4FUEA 2TRMA 3SNCA 2ZHDA 4NIVA 3U98H 1KXFA 1GJBB 1P2NA 1BTZA 1KTTB 1OYTH 1W7XH 5F8XA 2J9NA 2VIQA 1OHHD 3TK6A 2GCHG 3KQBA 1BRAA 4A5TS 5JBCS 4ZXYH 3SU4A 3TJNA 1ESTA 1V2ST 2NU3E 2Y5GA 1K2I1 1JRTA 2GCTC 3E91A 3LDXH 5F03A 3TGKE 3ITIA 4CR5A 2PTNA 1ZHPA 1CGIE 2H9TH 2ZECA 2Q1JA 3SU5A 3TH4H 2H5CA 2WV4A 1LTOA 1S0QA 1AVWA 3CS7A 1O3EA 4NIXA 1VGCB 3HKJB 3LJJA 1BTYA 3U1JB 1EZXC 1ELEE 4K1SA 1YKTA 2GD4B 2JIZD 2BD4A 1Z6EA 1L2EA 1RFNA 1QCPA 4ZCNA 3U8RH 2ZDAH 1SOTA 1J16A 2W3KA 4YOJA 2TGAA 3A7TA 4KKDA 3ZZ8A 1SPJA 8ESTE 4BXWA 2Y5FA 1ZTJA 4FOUC 1OWKA 3RC5A 2K1QA 2HNTF 4XDEA 7KMEH 3AK5A 1W13U 4ABAA 2Z9GA 1GL1A 1ELGA 2PKSB 1XX9A 4CR9A 2Z9JA 1UTOA 1KIGH 2B0FA 1QQ4A 2BQ6B 1UTQA 3P8NA 1AIXH 4ISHH 1U6QA 3KQEA 4GSOA 1GMDF 3PMBB 3GYMA 1ZHRA 1GHXH 3Q3XA 1SL3A 2JJ1D 3H09A 1O5CB 1O36A 1ZLRA 2VWNA 1HXEH 4GCHG 1ZMLA 1MAXA 4OS6A 4YM9A 2CV3A 2A5AA 2OCVB 4I33A 5JB9S 2ZDKA 2SNVA 2XC5A 1ZZZA 3AVZA 3VXFH 3TU7H 1EJMA 1BUIA 1O38A 2K8IA 1JIRA 4Y0ZE 1GJAB 3UIRA 1H8HD 5A0CA 2GP9B 2BVRH 1D6WA 4Q80A 3B9FH 3DHKH 4Q2KA 1KMHB 2JH5D 3N7OA 1Z1JA 3HK3B 3FFGA 4DJZB 1SGCA 2KCOA 3M37A 3F2GA 1H9HE 2A32A 3E16B 3ATLA 1ESAA 1WUNH 1UCYE 1P9SA 1T8MA 4AFZA 1AVXA 4Y7BA 1S85A 4B2CA 2ODYB 1S83A 2EA3A 1GI3A 1UK2A 1P2IA 4WMEA 3O8RA 3OAAD 1O2YA 3GY2A 2XXLA 1SOZA 1QFKH 1BHXB 3R3GB 1A4WH 4OS1A 3E0NB 1W14U 4JK5A 4YT6H 1V6DA 4AG2A 1EZUC 2AMQA 1MD7A 3GY8A 1DY9A 1CHOF 3RXGA 4HGCA 1B0FA 2AFQB 4ZKRU 4MPVA 1L1GA 1G9IE 2F4LA 4NFEA 5EJ1A 1VCQA 3QTVH 4FETA 2P8OB 4K1EA 3EA8A 1BTPA 2ASUB 1T7CA 3DA9B 3HPTB 2VIOA 3F0OA 3FP7E 4BAHB 2YMSD 2C4FH 4BTIB 4I8KA 4HTCH 1K28D 2G81E 2ANMH 1J14A 1SVPA 4FUHA 1BRBE 2BHGA 1E37B 1CT2E 3STIA 1GMCF 2XYAA 1L0ZA 5T6GA 3UNQA 1PQ8A 1WCZA 2EI6A 1CO7E 3GOVB 1L1JA 4A7IB 2EY4C 3RMLH 2PTCE 1FV9A 1BHXF 3ZIAD 5CMXH 1IQIA 2UWOA 2FLRH 1TAWA 1DPOA 1V2PT 2BX4A 2XW9A 1DXWA 2ZHWH 1O5FH 3VB6A 4UFEH 3FZDA 5PTPA 1GI5A 1EPTC 4MG3A 1HUTH 1HAIH 4WMFA 1XUKA 1DWEH
chains in the Genus database with same CATH topology
1D9IA 3PROA 1YPJH 1VJAU 3DUXH 4CRAA 1WBGB 1V2OT 2Z9KA 2V3OH 1TNIA 2C8XB 1BOQA 1FN8A 3SNEA 3RM0H 3MMGA 2HLCA 1Z1IA 4IS5A 1BTWA 1CQQA 1AMHA 3MNBA 1GVZA 1O5AB 1JIMA 1V2JT 3TH2H 1F5RA 4ZMAH 3PWBA 1DUAA 3A7YA 3P8GA 3BEUA 2BD5A 3VFEA 2Z9LA 3M7UA 1BT7A 1O3PB 2BDAA 3TJUA 4FU9A 1J9CH 4B2AA 1ZMNA 3M7TA 1PPFE 3GISB 4CRDA 2CN0H 1UTNA 3BEFB 4UE7H 3HGNA 1DWCH 2FZZA 3K65B 3LH3A 1K21H 3E3TA 3LU9B 3W94A 2QV1A 1G36A 1GI2A 1EXFA 3GCOA 2AGGX 4X6NA 3M5OA 3SHAH 2BVXH 2ZHEH 3BG4C 1WQVH 1SGEE 2TGPZ 2GCHF 2ZU2A 3AASA 2BVSH 1RTKA 5DG6A 2G5VA 3V0XA 3K6YA 1GBIA 1J8AA 1H9IE 1LO6A 1GHZA 4AORA 2ZGJA 1XKBC 1CSOE 1K1OA 3RXFA 2ZQ1A 2OQ5A 1YP9A 1GVLA 1XXFA 3S7HB 1AFEH 2FWWA 1WAYB 4D7GA 1FI8A 2ZTXA 1AE5A 3KIDU 4X0WU 2FMJA 4CRFA 1MCTA 4J2YB 6GCHG 1OPHB 1A5GH 4ZKOU 2STAE 1ELTA 2BZ6H 1AB9B 4CHAC 1IHSH 5LGOA 4YESB 5T6DA 1IQEA 2IJOB 3DD2H 1AFQC 1C2FA 3NPSA 5FPTA 1GHBG 4DIIH 2GCTB 3RXEA 1V2UT 3Q3KA 3UREA 3ZYEA 1UJ1A 2BDBA 2ZPQA 2OBOA 1HIAB 4AZ2B 1E0FD 1EJNA 2CHAC 1HIAA 3A8AA 4AFQA 1H8IH 1AHTH 2FO9A 1MKXK 4AYVB 1RGQA 3EQ0H 1SQOA 2G4TA 3PO1B 3BTME 7GCHG 5DP7A 3KGPA 3RU4T 2HNTE 4ZAEA 5G4BA 1C1PA 4I32A 5DPAA 1QGFA 1C9PA 3RC6A 4NSVA 1F2SE 1FLEE 3BTHE 4B2BA 1UTKA 1YGCH 3RDZA 1HAZB 1MZDA 4SGAE 2OUAA 2M5TA 1GG6B 1KXDA 5LH8A 2XNIA 2BQ7B 1FN6A 3ZVEA 1GI8B 1F5LA 3QWCH 3I77A 2V0BA 3VB7A 1UCYK 3KHVA 4GCHF 1HGTH 2O8MA 4I7YH 3HK6B 2VB0A 1C2JA 1FPCH 3PMJA 3SOSA 2FOHA 3MNCA 1O2XA 1GBFA 2STBE 2BY8X 1BIOA 3KN2A 3SNAA 1MAYA 1CHGA 1TMUH 3NXPA 2P3TB 2FI4E 1NN6A 5DP3A 3K6ZA 4FU8A 1C2KA 1KLIH 1AN1E 1K1LA 1QRXA 3QGNB 3TLOA 4Y8ZA 5DJ7A 2P59A 3MI4A 2ZU5A 3EA9A 5CHAB 1LKAA 1M9UA 1K9OE 3VB5A 3L33A 1W8BH 1SGPE 1KXCA 1IQLA 1EZSC 1QURH 1C1QA 2BOKA 1P01A 1NROH 2ZGXH 3ZZCA 2HPPH 2BB4A 3GYLB 3F9HA 1QQUA 4DOQA 2XBYA 2GMTB 4MDSA 3T62A 4ZHMU 2WPKS 3FZZA 1EAWA 1MU8B 3VB4A 1KXEA 5FBEA 5HGGA 2BLWA 4THNH 4CBOA 1JOUB 2BXUH 1LMWB 3VB3A 4WVPE 4K3JA 2ZKSA 5HYOA 2BDYA 3TGJE 2Z6BD 1Y3WA 2F9PA 5DGJA 1T8OA 3ESTA 3ZZ7A 2SGEE 3HATH 3U8TH 2BD7A 2P95A 2R3YA 2G51A 3LOXA 4X1QU 3EGKH 8LPRA 1Z8IB 3MO6A 1P57B 4NGAH 2TGTA 1O5BB 3PTBA 5C1YA 1YCPK 1V2RT 3A8CA 2GVFA 1GDUA 3Q76A 4MQAA 3ZZDA 1FY8E 2DE9A 3QGJA 4WJG2 4CRCA 3MTYA 3MNXA 1G2MA 1A46H 1FIZA 2ZGBH 1C2GA 3KNXA 3LC5A 1EKBB 1ZGVA 1BITA 4INKA 1TX6A 2LNCA 2NU4E 1SGDE 1FIWA 3Q00A 1GCDA 5C5OA 3LJOA 1EOJA 3BTQE 2ZCHP 4NZQA 3W95A 1FAXA 1AU8A 4IMZA 1ELAA 4RKJB 3F9GA 1OWJA 1K1IA 2BTCE 3MFJA 4J1YA 3ZVGA 4A1XA 1YBWA 1GI6A 2ZCLP 5A8ZA 4RKOB 1C5SA 4UFGH 1EJAA 1C1UH 1WTGH 3E6PH 4K60A 4KTSA 1Q31A 2BYAX 1O3LA 1ZSJA 2HPQH 3UR9A 2O8WA 2W7UA 4INHA 3SORA 3MO9A 1LPKB 3MU4A 1MKWH 4YZUA 1DT2A 2R0KA 1ZSKA 2ZQ2A 1RRKA 1OP8A 2D26C 2PHBA 1TMBH 3QZRA 3OX7U 4H6SB 1RXPA 2TBSA 5EXLA 4CH8B 3ZVBA 4MNVA 4Y79A 4XFQA 2Y81A 1S0RA 5AHGH 3GY4A 1JRSA 1QJ1B 2F9OA 2EEKA 1PQ7A 2VVVA 3ZZ5A 1C5PA 5E2OA 4ZKNU 3UUZA 1O3MA 1TBZH 2HRVA 3ODFA 1TRYA 2CF9H 1VZQH 1HAYB 4CRBA 2FS8A 1THRH 2FX6A 2RCEA 3F6UH 1H1BA 2ALPA 1TBRH 2J2UA 3SBKA 1OX1A 1BMAA 4NSYA 1B7XB 2FOAA 3QO6A 1TNGA 2FOCA 1N8OB 1GMHF 3HGPA 3ATMA 4R8TB 4NIYA 1OOKB 2OD3B 3RMOH 1NO9H 4LZ1H 2EI8A 2QXHA 3TH3H 2BLQA 3NZIA 4DG4A 3B8JA 1QTFA 3F9EA 4E7RG 4MLFB 3NK8A 3PM3A 1DITH 3QUMP 1OWEA 1EASA 1HNEE 1S84A 2ZDMA 3SI3H 2QA9E 4RSPA 5F8TA 1C2IA 1NRRH 3QTOH 3MWIU 5T6FA 2BD3A 1BZXE 3A89A 5DP6A 1DDJA 4RN6A 4CHAB 1C1SA 7GCHF 5DKMA 1TBQH 3RXCA 3GCNA 3VGCC 1AI8H 1SMFE 3BV9B 3T5FH 5CE1A 3A85A 1AFQB 4ZKSU 3SQEE 1NU7B 4TY7A 3RXVA 1ORFA 1O35A 1O32A 3V3MA 1HAGE 1FY1A 4ABDA 2ZPSA 1LHCH 1G3CA 1Z7KA 1VCWA 1C2EA 3NUMA 2B8OH 3FAOA 3AAUA 1FJSA 2H2ZA 4MVNA 1EAXA 1HJAC 1XM1A 3GCHB 4ISIH 2G5NA 3KL6A 2ODQA 1UK4A 1PPCE 2G00A 5JYIA 4MNYA 2YOLA 4WF8A 3LGTA 1IAUA 3E90B 4Z6AH 1T8NA 4YT7H 1W0ZU 1ETRH 3P95A 2C8ZB 3NCLA 4BXSA 1AWHB 2ANKH 1GI1A 2A7CA 2A0QB 2A45B 2C93B 3P8FA 4ZROA 5C1UA 4Y8XA 2IPHA 2FODA 4JZFH 5A8YA 3T26A 3KEEA 5AVDA 1T31A 1FONA 1ELDE 5ETXA 2Y80A 1EQ9A 2V35A 1N6XA 3URCA 4NA9H 2QCYA 1FY5A 1DUEA 4JZDH 3RLWH 5DP5A 3RM2H 3UOUA 1ELBA 4IC6A 2R2WU 3QX5H 1TX7A 3SGAE 2QYIA 3M3VA 1Z8GA 1WOFA 1A0LA 1GDQA 3EA7A 3UPEA 2AGEX 3SV2H 4ABIA 1OKXA 2FLBH 1TQ0B 1ANBA 1QY6A 4UDWH 1GHWH 3LGUA 1OXGA 2XCFA 1CT4E 1GJ5H 1WQSA 2VINA 2H9EH 3DFLA 1C4Y2 3PLPA 4FXGH 4WH8A 1ELVA 1P2JA 3OYPA 1WYKA 2V6NA 3AW0A 3GCTG 1S5SA 1O3KA 3RXBA 2FX4A 1O2OA 3MH7A 1HAOH 4OS2A 1HCGA 1KXBA 1O2MA 2SGQE 1DS2E 2ZCKP 5H4IB 1QJ7B 4A6LA 1C1OA 1PPGE 4IN2A 3ATIA 3GDSA 3RMMH 4E06H 2GV7A 2ZZUH 1DLEA 1SR5C 1NT1A 1L4ZA 2J4IA 1GJCB 1ARCA 4I8HA 1G30B 1P02A 2PR3A 2ZU4A 5DK1A 1HRTH 1O5EH 1J17T 5EQQA 4ABHA 5C20A 5JDUB 5LPFA 1UK3A 3GY7A 3LT3A 2QGRA 1NESE 3MHWU 2ZWLH 3ZVCA 3H7OA 3B23B 3LC3A 1V2NT 2GKVE 2LPRA 3UWJH 2FP7B 2O8LA 3T29A 1TGBA 3A7ZA 1RTLA 5FBIA 3A81A 2BDGA 4AB8A 1Y3VA 1INCA 1V2LT 1Y5UT 2G55A 3M61U 3S9AA 1BBRK 2BLOA 1XMNB 1UVPA 2FIRH 3A7VA 1F0UA 2Z9IA 3BTTE 5A09A 1OYQA 3AAVA 2A4RA 1BMNH 1MUEB 1S82A 3O8BA 5AFYH 2ODPA 4Y11E 3Q3YA 2GV6A 1MQ6A 3RXOA 3ZYDA 4ASHA 2A2XH 5E0JA 2A4QA 3ZV8A 2SGAA 2AIQA 4X2WA 3PTNA 1GJ8B 3RXJA 5HM9A 3QZQA 5AFZH 1E38B 2ZU1A 1TABE 3PMHB 4TWYA 1ZOMA 1G3BA 2HOBA 5TCAA 4ABGA 5F6MA 1SSXA 1TONA 1TRNA 3TNTA 1SGTA 3MYWA 3ZZBA 2OC8A 2VWMA 4E7NA 1IQGA 2ZC9H 1LHFH 4AB9A 4JMYA 4BANB 2Q6DA 4XBBA 1FXYA 1QRWA 2OC1A 1IOEA 2ZPRA 2EC9H 3VXEH 5C5NA 1RS0A 1SFIA 4X1SU 1NC6A 2VIPA 1EB2A 3M5MA 1HAHH 2QF0A 4MNXA 1T8LA 4MNWA 2FTLE 1HBTH 6CHAC 1TE0A 3ZZAA 1A61H 4FUIA 2R3UA 3P6ZB 1C5UA 1NS3A 1ETTH 1P05A 3RC4A 1SLUB 5GDSH 1O3OA 1SGIB 4ISOA 2FYRA 3ZZ9A 4K1TA 5HMAA 1UO6A 2PWXA 1GJ9B 1NFWA 1VITH 2PUXB 1CBWC 2VGCC 2XWAA 2FM2A 2ZO3H 2YNBA 1LVYA 1QR3E 3A83A 2ZFTA 2XCNA 2B5TB 2ZFQH 1H4WA 1DM4B 1GBEA 1O3JA 4UONA 2FYQA 1UVTH 3U1IB 1ANDA 5A2MH 5BRRE 2AS9A 2ULLA 1ABIH 2A31A 2J95A 5A0AE 1AVGH 3A8DA 3OSYA 1GCTC 3A87A 1GBTA 4BAKB 1EOLA 3KQDA 3S69A 3K9XB 1O2HA 1SG8B 2J94A 3UWIA 1OS8A 2A5IA 1WSSH 4DURA 4X8TH 4B74A 1AE8H 5DP9A 1SLXB 4CRGA 1TOCB 1MU6B 5DO4H 1O2JA 3PB1E 3TGIE 4VGCC 4XSKU 4INLA 1Q3XA 4FUJA 5K0HA 3RXAA 1O2PA 2IN2A 1GI7B 1GMHG 1ZTKA 1SFQB 1K1PA 5EODA 4AN7A 2P3UB 3TJOA 1W12U 1GBBA 1K22H 1YM0A 3RXPA 1GJ4H 1YPGH 3SU2A 3SI4H 3A82A 1GPZA 3UQVA 1SGQE 5EXMA 5L2YH 3V12A 3U8OH 4JZ1A 4FUFA 2PGBB 2V3HH 3P17H 5L2ZH 2Z7FE 1FUJA 1W7GH 3SGQE 1O30A 2WPHS 5JBBS 2P93A 1KDQB 5F8ZA 4NZLA 4LK4A 3BTKE 5GWZA 1Y5AT 1D6RA 4MTBA 1DXPA 1KDQA 3UFAA 1ZGIA 2FOEA 2QXJA 3EE0B 2ZFFH 1TNJA 4Y7AA 1C4U2 4DVAU 4NFFA 2QF3A 1CT0E 2BY7X 2WPJS 3F68H 5BPEA 2PSYA 3LKWA 2O9QA 4H6TA 1V3XA 1YF4A 4NCYA 1LVBA 2WINI 2BX3A 4ISNA 3PLKA 1W10U 2HNTC 1GI4A 1GDNA 2A2QH 2ZHFH 3M3TA 4Y6DA 1AUJA 4GPGA 3AW1A 3UR6A 1TNKA 2VVUA 2ZDLA 3GCTF 3STJA 4U32A 1TRMA 4KTCA 1PYTC 1LHDH 1THSH 2DUCA 1TNHA 4BNRA 1GI9B 1QB1A 3LONA 3SJIA 4E05H 3P70B 1E34B 5EQSA 1SQTA 4NWKA 5E2PA 3RMNH 7LPRA 1O2RA 5C67A 1RJXB 2ILNA 4X1NU 1EX3A 2UUFB 2ZA5A 2AIPA 5EOKA 2JETC 2WPIS 3CS0A 1GWAA 1O34A 1UTJA 2UUJB 1XUIA 1TGSZ 3BTDE 3SJKA 4XBCA 3MH4A 2XBWA 1A3EH 4F49A 4FVBA 4ESTE 1NM6A 3S7KB 1P3CA 3SQHE 4CREA 2Q6GA 4FUCA 1NFXA 1P06A 3TITA 3KF2A 3PLBA 1PPEE 4GHTA 3H7TA 1LKBA 3EDXB 5EU8A 2I6QA 1YLCA 2PKSC 2VNTA 5GCHG 3RU4D 1BMMH 2D1JA 1Z6JH 4X2YA 1SHYA 3RXSA 4OGYA 3C27B 6ESTA 1LHGH 2ZTZA 1PQ5A 1C5XB 4IW4E 1RD3B 4FU7A 4BAQB 3DFJA 1WTHD 4TYDA 2QC2A 3TIUA 3TNSA 4ZH8A 3TK9A 1G37A 1Y3UA 5FCKA 2BD9A 1SGNE 1P12E 1ZJKA 2SGDE 1UVSH 4JZIA 3S9BA 2B9LA 5E8EH 1SGFA 4IN1A 2XWBI 3T2NA 3GICB 4Q7XA 1FPHH 1NRQH 1KY9A 1IQNA 1XUHA 1ELCA 1T4VH 2ZDNA 4D9RA 3LIWA 1C1MA 4BAOB 1GHAG 1SI5H 1XKAC 1DE7H 1CA0C 1GVKB 1Z71A 4K8BA 1G3EA 3U69H 1EP5A 4OS7A 1F0TA 3SZNA 1C2LA 2OC0A 2XTTB 1HLTH 2VIVA 1P0SH 1ID5H 5C3NA 3IWMA 3RP2A 2ZU3A 4DT7B 5HXFA 1TPAE 1KXAA 2VWOA 2PSXA 2ZFRH 2FI3E 4ISLA 1MKXH 3IITA 2PW8H 2BXTH 2THFB 2W7SA 1V2WT 2OTVA 3SUEA 4LOYH 1TIOA 2SFAA 1SC8U 2TIOA 2VWLA 1EPTB 4BAMB 1C5ZB 2P16A 1EPTA 4HZHA 2P8OC 1AZ8A 2BLVA 4Y10E 3ZZ3A 1C5LH 1UVOA 1TA6A 4XBDA 3LGWA 1EATA 3F9FA 1ZJDA 1C5QA 1BQYA 4O97A 4YTAA 1CBWB 1UCYH 2VGCB 2G52A 2O8TA 5EG4A 4HFPB 2QIQA 2NU0E 4TPIZ 5FPYA 5J4SA 1EUFA 4NA7A 3SUFA 4H42U 1ACBE 4A1VA 1W11U 3BTFE