4ABIA

Co-complex structure of bovine trypsin with a modified bowman-birk inhibitor (pta)sfti-1(1,14), that was 1,4-disubstituted with a 1,2,3- trizol to mimic a trans amide bond
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Braces for the Peptide Backbone: Insights Into Structure-Activity Relation-Ships of Protease Inhibitor Mimics with Locked Amide Conformations
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
molecule keywords CATIONIC TRYPSIN
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abiA02
1IHSH 3UR9A 3PWCA 4ISOA 3FP8E 1MAYA 1HXFH 3OX7U 1T7CA 1NU9A 5JBBS 1SGQE 3BN9A 2A5IA 1LHFH 3FZDA 1HAXB 1TYNA 3A7TA 3MU5A 4ZKSU 3GDVA 5A8YA 2CF8H 1BTHH 1AMHA 1P06A 2UWPA 3Q3XA 4Y8YA 2EC9H 4ZAEA 1A2CH 1GJDB 2BVXH 3SOSA 1HIAA 4WWYA 3E6PH 3RXPA 1UTNA 3LDXH 1BRAA 1BTUA 2Y81A 1ESAA 5DKMA 3KCGH 2P93A 1ETRH 3D65E 3Q77A 1RGQA 5IDKA 3KQDA 4ZXXH 1GHWH 2CMYA 4OGXA 6LPRA 1HCGA 1IOEA 1HGTH 4Y8ZA 1WSSH 1P9SA 1C1NA 1RXPA 4WMEA 1CU1A 1ELCA 4AG1A 1GBAA 5LH8A 3RXKA 1GHZA 5FCKA 1QHRB 4Q7XA 2BY8X 5HM2A 1IAUA 3UNSA 3OYPA 1P02A 2FXRA 4TYDA 3ZZCA 1AUJA 1O3EA 2BQ6B 2K1QA 3U1IB 1HXEH 2ESTE 1JXPA 1C1UH 2AMPA 3HGPA 4HGCA 1FY3A 3TJVA 3KIDU 1HB0B 1TRNA 2VB0A 4I8KA 1YCPK 4Y0YE 3RXMA 4AGJA 4CRGA 1MTNC 3DD2H 5JPMH 1SC8U 3LGUA 2Y5FA 3S69A 1S81A 1ZSLA 4IS5A 4ZKNU 2W26A 1ARCA 1VGCC 3ATWA 5CHAC 1AFEH 1P2OA 4YZUA 3BV9B 2PLXA 1EP6A 1UTOA 3HKJB 1Y3XA 1N6XA 3RDZA 2Y6TA 2R3UA 2UUYA 5DP5A 2PSYA 2PW8H 2TGDA 1YPJH 3QZRA 1AZZA 2WPLS 1MKXH 5DP8A 1EX3A 1CBWB 5JDUB 4GCHG 4DJZB 2EI6A 2P16A 1XX9A 2QY0B 1CT4E 8ESTE 1EUFA 2XNIA 1C5NH 1GHBF 1GBTA 5F8TA 1T8NA 3K6YA 1HAPH 4VGCB 1SGYE 1JIRA 3DFJA 4WMDA 2W7SA 1ELTA 5BPEA 2BLOA 2VIVA 3SV8A 3UQOA 4Y7AA 2GVFA 1XVOA 1FONA 1A0HB 1V2LT 3EDXB 1ELDE 2ZDAH 8LPRA 3OU0A 1O3PB 2UUKB 1QB1A 1O3GA 1NO9H 4B74A 3N7OA 3F6UH 1CGJE 2ZTYA 1GBEA 4CR9A 2AEIH 4CRDA 3A7WA 2C93B 3SU1A 1K9OE 2ZECA 1FDPA 3E8LA 1THPB 1GBKA 3GY6A 4NZQA 2H9TH 1FPCH 3QLPH 5AHGH 4KTSA 3I78A 2BHGA 1FI8A 3P95A 3ZV9A 1P2NA 1UTLM 2C90B 3MO3A 1ESTA 2ZDKA 1Y59T 3T2NA 1RJXB 1VZQH 1F5KU 1GMCF 2ZHDA 1DITH 1QNJA 2ZDVH 2B5TB 1C5SA 1JIMA 4MPVA 2BXTH 1B0FA 1T8MA 4A1TA 3DHKH 1PQ8A 3MNCA 1C9TA 1K1NA 4INHA 1NC6A 1L0ZA 2PHBA 2HOBA 3AW1A 4I31A 1MUEB 4D7FA 1L2EA 1RTFB 2NU3E 3RLYH 4NIWA 2G4TA 4YOGA 1EAIA 2A1DB 4I7YH 1DLKB 1GVLA 1KXAA 1V2UT 1MMJN 1C1RA 1J15A 2FDAA 4KTCA 4H6SB 1VITH 1PQAA 1LPKB 5EW2H 1TRMA 1A1RA 2A4GA 1N8OC 2B9LA 1SOZA 1MU6B 4IGDA 1TALA 5TJXA 1IQMA 1OX1A 2ZP0H 2CJIA 2Z9IA 4RKJB 1RD3B 2Y80A 3A8BA 1P3EA 5EPNA 1A4WH 1BTWA 5LGOA 1P2JA 4ZHLU 3AW0A 3SO3A 3PROA 2B7DH 3SU2A 1O3NA 1GVKB 1G3EA 3ZVEA 3VB6A 2FS9A 2ZGCA 1TIOA 2OINA 3A83A 3GY3A 1QIXB 2DUCA 3BG8A 1HJ9A 2HNTC 3ITIA 1V3XA 2AIPA 4ZHAA 4H42U 2UUJB 1CA0C 2G52A 3TU7H 3MH5A 3LGVA 1LVMA 1NS3A 1N6YA 5J4QA 2FWWA 1GI4A 2PTNA 3TNTA 2RG3A 3MH6A 1ANEA 4FUEA 3M61U 1UK3A 1V2QT 1SLXB 9ESTA 4YESB 2AFQB 4Y0ZE 1DWEH 1OSSA 4ZH8A 1OWIA 3RXGA 4XDEA 2IJOB 5TCCA 4BTTB 1O2OA 2NU0E 2V35A 3BTHE 1BQYA 1HAYB 3SZNA 1HPGA 5FPYA 1CA0B 1GGDB 3U8RH 4ABDA 1O3BA 2ZI2H 5A0BA 3E0PB 4Q7YA 2TGPZ 1TGSZ 2IPHA 1GMHG 1ELEE 3TK9A 2GZ7A 1HUTH 3NXPA 3SNAA 1XMNB 1F5RA 1DWCH 5EGMA 1INCA 3UWJH 4YT6H 2XC5A 3RP2A 1DY8A 1MD8A 1O2MA 1EP5A 1RFNA 3ZVGA 1AFQC 1LDTT 3FAOA 2ASUB 3PWBA 2BY5X 4J1YA 2FX4A 1GGDC 1UK2A 3S7KB 1F2SE 3BG4C 3BIVH 2NU2E 2HALA 2A32A 2QXJA 2W7UA 4WH6A 3QO6A 1E37B 4AZ2B 1DLEA 3B23B 1T31A 1YM0A 4OS1A 1XXFA 4INKA 1W11U 3GDUA 1DE7H 2ZU5A 3F1SB 1P01A 3MH7A 1MTUA 1DVAH 2ULLA 1C2FA 2Z94A 2C8XB 5HM9A 1NM6A 3RXQA 1EOJA 3BTEE 3VB4A 1ABJH 5DGJA 1YPKH 2AYWA 2P3TB 3ATIA 4JZDH 4X6NA 1KXDA 3U9AH 2J34A 1ELAA 2O8LA 3L6PA 3PLBA 2PKSB 4RKOB 5L2YH 2FODA 4YO9A 2ZTXA 2ZIQH 2GP9B 1P10A 2A7HA 4CR5A 2ODQA 1PQ5A 1LHEH 4FUDA 1W14U 4NFEA 5FX5A 1KXEA 3TIUA 1BMLA 2J9NA 3ZZ6A 3P70B 4ZHMU 1CE5A 1UTQA 5DG6A 2QC2A 3GOVB 3BTFE 3LONA 3ZYEA 1XUFA 3TH3H 1QJ1B 4D7GA 2H9HA 3RMNH 3ZYDA 1MQ5A 4JMYA 3TGJE 1D4PB 1DUEA 4YTAA 2TPIZ 2VU8E 3BTTE 1UTPA 3GCTG 5AF9H 2BZAA 3SGAE 1P05A 1O3HA 3K2UA 3M3TA 1UVTH 1O3FA 1OP2A 1W7XH 2FMJA 1AWFH 1TGNA 1QY6A 4U32A 4YOJA 1ZYOA 1A5GH 2OC1A 1PPGE 4MNYA 3LH3A 5FBIA 3TJNA 2BY6X 5E8EH 3M7UA 1S6FA 5EODA 3EGKH 3EA7A 1ESBA 3U8OH 1F0SA 3PMHB 3F9EA 4U2WA 2I6SA 4D8NA 1TNGA 1AVGH 1V6DA 3I77A 3TITA 1HDTH 2O8UA 1QFKH 4JZ1A 1A3BH 1LQDB 1O39A 1NPMA 1ETTH 2ANMH 1DWDH 3ZZDA 3S7HB 1BTZA 1P11E 3Q76A 7KMEH 1LVBA 1NY22 4AFUA 4X1QU 2FO9A 4AFSA 4FUJA 3MO6A 2BVRH 1TPAE 1QL9A 4DY7B 1K1JA 3TH4H 2ZHFH 3M5LA 4B75A 1RRKA 3A85A 2CXVA 4X8UH 3QZQA 2ZFPH 2UWOA 3Q3YA 1YPMH 2YOLA 2BMGB 1O2SA 3KQCA 4O03A 1H8IH 2A5KA 2Z7FE 2FI5E 5T6DA 2H6MA 5IYTA 2J4IA 5T6GA 3SGBE 4CRAA 3LC3A 3ATKA 4XE4A 3SU0A 1ZRKA 2A5AA 5FCRA 3ZZ5A 2STBE 2Y5HA 3SJ9A 3BTWE 3R3GB 1SGDE 3CS0A 3EE0B 3UNRA 4E7RG 4UFGH 3ZVFA 4TPYA 3UTUH 1HRTH 5EQRA 2ZGHA 1ZPBA 1TAWA 1ZMLA 4I8LA 1EB1H 3SJKA 1SGIB 1VR1H 3GY2A 3GCNA 5DJ7A 1C1VH 1HAIH 3UY9A 1O5BB 2Q6FA 3ESTA 1LHDH 2ZHEH 2FOAA 3T25A 3D62A 1EZXC 1DPOA 1QL8A 3S9BA 3MU1A 2FM2A 1TNJA 3VGCC 4B2BA 4HZHA 3TPIZ 2YNAA 1P2IA 2ZDLA 3IITA 2J94A 2SGDE 1C5PA 3LKWA 5I25A 4UDWH 1C5OH 2VJ1A 2GMTC 1P9UA 4WY3A 1K1LA 5E2OA 1VGCB 4ABGA 1CSOE 3E16B 1V2NT 2GZ9A 1O2XA 2CN0H 1K21H 4ZXYH 3ZVDA 1EJMA 4AG2A 1ZMJA 1DUAA 3BSQA 3L3TA 3RXLA 5GCHF 3HK3B 1BT7A 2WPJS 1Z6JH 4X2XA 1UMAH 3RXUA 4UONA 2HPPH 3E1XB 2ZGXH 1D3DB 2BDYA 2HNTF 1AHTH 1KDQA 1F92A 3M5NA 3OSYA 1ANBA 2XCNA 4BTUB 3ODFA 2QN5T 4OS4A 6CHAC 2GX4A 2TGAA 1TB6H 4ABAA 5C1XA 1C4Y2 1O5CB 1D3TB 1ZOMA 1SLUB 3H7TA 4BAOB 2FOGA 1WYKA 1QCPA 4Y79A 5F8XA 1NT1A 1P2MA 4BAHB 4MQAA 3GY5A 2OTVA 4SGBE 1ZPZA 1C2KA 2ZWLH 2FOCA 2CGAA 1U6QA 3BF6H 5FAHA 3E91A 1C1TA 4X1RU 1A0LA 1WV7H 2PUXB 1VITG 2OC7A 1GCDA 2HNTE 1Y5BT 1ZTLA 3PTNA 1S84A 1Z7KA 2GV7A 3EA9A 1LPGB 1BJVA 1YLCA 3SNCA 4NIXA 4K5ZA 3M37A 3GCHB 4XBCA 1CQQA 1GPZA 1QB9A 1LKAA 1UTMA 2BD3A 1ZJDA 2BDAA 1GG6B 1AU8A 1EZSC 2FTLE 1RIWC 1F0TA 2BD4A 2WYJA 1LKBA 2A0QB 2FPZA 2ZEBA 5L6NH 4MNXA 1NFYA 1NRQH 3SU4A 1E0FD 3QUMP 1EZUC 2Z9GA 4IN2A 4PROA 4TY6A 3PM3A 3QGJA 2JH5D 3UOUA 1ZGIA 2F9OA 1GL0E 8GCHG 4KGAA 1C2HA 4CRCA 1FXYA 5EG4A 1A0JA 1WAYB 1WOFA 3SV7A 3HPTB 1SFIA 4KP0A 3SW2B 1G2MA 2WYGA 1FQ3A 3RC6A 1C5LH 1BMNH 1LPZB 4IN1A 1GJ9B 1D3QB 1P2KA 3ELAH 3PMBB 3SV9A 4WH8A 2FOBA 2ZC9H 4GPGA 1NRRH 1ZTJA 3ZZ4A 4GCHF 2AGGX 2GCHF 3IG6B 4R0IA 1ELBA 3U98H 1O2YA 1S0QA 3V7TA 7LPRA 1LVOA 4O9VA 1GHBG 5FPSA 3BEIB 2Y7XA 3UWIA 2J38A 4ZKRU 4H6TA 2VVVA 3O8DA 1AE5A 1O2HA 4XSKU 1WBGB 1YPHC 1ZR0A 3ZZ7A 1VJAU 2PGBB 3BTGE 1GDQA 5J4SA 2V3OH 5BRRE 3ZVAA 1GJCB 4B2CA 1C2DA 3LGIA 1KLTA 4CH8B 3BTQE 4FU9A 3SNDA 2ZHWH 1GBIA 3PO1C 1FMGA 2Z6BD 3SJIA 1IQJA 1Q31A 3PMJA 4NSYA 2AGIX 1SHHB 4MLFB 5EW1H 5A8XA 1EQ9A 1GJ4H 3RXIA 4OGYA 3STJA 3UPEA 4K1SA 1QTFA 5EQQA 1QJ6B 1MTVA 2GD4B 3PLPA 2SGFE 2LPRA 1C5YB 1Y5AT 1OS8A 1RS0A 1LQEA 4OS2A 3T29A 1Z71A 1ZPCA 1GBLA 1GI5A 4ZMAH 2JETB 3LJJA 2SGAA 3MWIU 4J2YB 1K1OA 4LOYH 1ANCA 1QRZA 1H9IE 3HKIB 4A92A 4CBNA 1P2QA 1V2OT 2JH0D 2ZO3H 9LPRA 4OS6A 1G37A 1NFXA 4YOIA 2QF0A 4F4OC 2BYAX 4YLUA 2ANWA 1FY5A 1Z8IB 3RXTA 1BRBE 3OTJE 3P92A 1TABE 3A82A 2ZCKP 3LGWA 1C2LA 3S9AA 1TONA 1O3CA 3MHWU 3G01A 4GSOA 2F3CE 3A7YA 3ZZAA 1GBJA 1C5RA 5FBEA 2D8WA 1TX8A 1FV9A 4O97A 4FU7A 6GCHF 3K9XB 3QDZB 2DE9A 2WUBA 3M7QA 4Z0KA 2Z3DA 1F7ZA 2WUCA 2XCFA 1G36A 4K3JA 1MZAA 2R0KA 2HPQH 2QXGA 4ABJA 3MH4A 3EA8A 1O35A 2GDDA 3R0FA 2BZ6H 2OD3B 2O8WA 1H8DH 4YM9A 4Y76A 2OBQA 1BDAA 1HJ8A 4TPIZ 1GHVH 1QQ4A 2BLQA 1O2IA 3VXEH 1PFXC 1A5HA 2A2XH 3CS7A 3RU4E 1A61H 3SUGA 4JYTA 4A7IB 2NU4E 1GMDF 3MO9A 2C8ZB 1O5DH 4AGKA 3A84A 3NCLA 1BTXA 3KGPA 3T28A 5EOKA 3P8GA 2FP7B 2AMQA 4UD9H 1UVUH 1HFDA 2VIQA 4X0WU 1XUIA 4B71A 2GDEH 2ZFRH 1C2JA 1PPHE 3C27B 1AI8H 4JZEH 1QRXA 4ZKOU 1TGCA 2FOEA 1UCYK 1O36A 3S0NA 1D9IA 2ZGBH 1O33A 1JBUH 1O3KA 1VJ9U 1YGCH 1ACBE 1ELFA 4MDSA 1AGJA 1HAOH 1P12E 2CV3A 2QA9E 1C2GA 1DS2E 1EAWA 1Z8RA 5AFZH 1OP0A 3BEFB 2ZDNA 3BTKE 2Y82A 1K1MA 1DDJA 4D76A 4A5TS 3GCOA 1AUTC 1D6WA 3CP7A 1TMTH 1O0DH 3A8DA 1GMHF 2BDCA 1QBOA 3BEUA 1BBRE 1SG8B 2NWNA 2GT7A 4FUHA 1BCUH 4WVPE 1BA8B 1O3JA 1MKWK 4Y8XA 4KELA 3TK5A 3SNEA 2GKVE 2ZZUH 1TRYA 3ENSB 2P3UB 2A45B 3ODDA 1TPPA 3T62A 3K6ZA 1AVWA 1CHOF 1O5AB 3Q3KA 4OS5A 4JZIA 4JZFH 4ABBA 1BTPA 2WPIS 4H4FA 1O30A 2Q6DA 1TOCB 4ABFA 3TK6A 1BZXE 1CO7E 4X8TH 2BXUH 1IQNA 5T3HA 4ABEA 5K7RA 2A4RA 3GY4A 1JMOH 1ORFA 2BDHA 3SHCH 4BXSA 1C5ZB 3GYMA 1J14A 2JH6D 3RXAA 1TA2A 1YC0A 4BTIB 7GCHF 4K8BA 1BRUP 3RXFA 1NTPA 5PTPA 3PB1E 2ZTZA 1ZRBA 1DY9A 1NN6A 2RA3A 1AN1E 1P04A 1O3AA 2CHAC 3GCHC 4WMFA 2BX4A 4MPWA 1UVSH 1B5GH 1XUKA 1ZZZA 4JK6A 2JETC 1C5WB 4KKDA 1DT2A 1FY1A 2FEQH 2VGCB 2W5EA 4X6PA 4BAQB 1B7XB 1WTGH 2DE8A 5C20A 1VCPA 1KY9A 5EPYA 1C2MA 1FJSA 4E06H 2FI4E 3AASA 2WPHS 3URCA 2VIDA 1GI8B 1P0SH 2A7CA 3F9FA 3GCTF 1SL3A 1IQKA 2ZG0H 2CHAB 3RLWH 2GV6A 4M7GA 1O3MA 1UTJA 1E34B 1VCWA 3EAJA 4Q7ZA 3SQHE 3V12A 1HAHH 1DX5M 1S5SA 3DT0H 4X2YA 2P8OB 5TCAA 3RUOA 2EI8A 4U30A 3RMLH 3GISB 2D2DA 2SNVA 4IMZA 1PJPA 2XBVA 2ALVA 3RXHA 4X1PU 2ODPA 1W7GH 1H9LB 1C9PA 1V2ST 3QX5H 4AN7A 1CT2E 1O2ZA 2IOTA 4BXWA 3AAUA 1W0YH 2ZPSA 3TJUA 4X8SH 2BQ7B 1C5XB 1TBQH 1K28D 2ZKSA 5G4BA 3URDA 3UUZA 1NFUA 1GBDA 4XOJA 1TA6A 5EXLA 3UR6A 1S82A 1GJ7B 2ODYB 2ALPA 2TBSA 4F49A 5GDSH 1ETSH 1GHAF 3SV2H 4IC5A 1XUHA 4BNRA 1O32A 1LMWB 1G3CA 2Q6GA 4ZROA 3MU0A 1FY4A 1GI1A 4DIIH 5DP3A 3RMOH 3SUDA 3RXRA 2AS9A 4DIHH 1GL1A 3F9HA 4NA9H 4O3UA 3VEQB 2ZDMA 3LU9B 1IQLA 1OOKB 3SORA 5EXMA 1A7SA 3RXCA 1H4WA 3MFJA 1A3EH 1Q2WA 2VNTA 1T4UH 1GI9B 2AIQA 1O34A 2R2MB 1SGEE 3RXSA 3FFGA 2WINI 1MU8B 4U01A 3E3TA 3W94A 2AERH 1TOMH 3P17H 4K8YA 4AYYB 2C8YB 2GZ8A 1BUIA 1QQUA 2GCTB 3SU5A 4MPXA 3BTME 3U8TH 2OBOA 4E05H 1MD7A 3A89A 1AD8H 1O2UA 1T4VH 1K2I1 2QXIA 1UO6A 1GI6A 3JZ2B 1LO6A 1SGFG 1TGBA 2GT8A 2EI7A 4BAKB 3SUFA 4GAWA 2Z3CA 1QA0A 2O8MA 3P8OA 1TNLA 3A81A 1IHTH 1MQ6A 1DFPA 5JB8S 3SU3A 1GBMA 1J8AA 4QT8C 2VVUA 1AZ8A 4TWYA 1HAZB 3NPSA 1TFXA 3MYWA 5L30H 1OYQA 2SGEE 4ESTE 3SNBA 4B73A 1B0EA 1N1LA 3VXFH 1BMMH 3TGIE 2H1UA 1AB9B 2G00A 3RXJA 3VGCB 1CGIE 2G5VA 3A7ZA 4X6MA 3GYLB 2ZF0H 3M3SA 5FPTA 4BAMB 1O5FH 2STAE 3SV6A 2G55A 1BBRH 1TNKA 1C5MD 4UFFH 1CT0E 1C5TA 1XKAC 4DGJA 1P8VC 1V2VT 1SGFA 4CHAB 1MCVA 3B9FH 2FS8A 1C1SA 2R9PA 3D23A 1C4V2 1EAUA 4DOQA 2ANYA 1SGCA 3A88A 1C2EA 4LZ4B 4NIYA 1GG6C 1F5LA 3SI3H 1PPFE 1EJNA 5ETXA 4ISHH 3ATMA 3O8RA 2P94A 2J95A 3UNQA 1HAGE 1FN8A 3QTVH 2M5TA 4DVAU 4MPUA 1F0RA 3LGTA 4DCDA 2FESH 3MMGA 1VITF 3MTYA 2WPMS 4NWLA 4Z6AH 4A1XA 2Z9JA 1HJAC 5I46H 2XTTB 1DICA 4FUGA 3RU4D 4FU8A 4INLA 1UJ1A 1BHXB 4DURA 3M35A 1V2PT 1YPEH 1L1NA 2G4UA 3IWMA 5DK1A 4K1EA 1O3DA 3VB3A 1A46H 4NFFA 1JOUB 4FVDA 4DW2U 2EEKA 1QRWA 1MAXA 3T5FH 3UREA 5F6MA 2TIOA 1BTYA 2PV9B 2R0LA 3M5MA 3SHAH 1EPTA 1GBHA 1C4U2 1HAVA 1PQ7A 1E38B 1EOLA 4MVNA 5SGAE 3SJOA 1O2PA 1SSXA 1T32A 4NG9H 2O9QA 2O8TA 3QTOH 3A86A 5JBTA 4LZ1H 1XUJA 1QJ7B 1FUJA 1ZMNA 3F68H 1T8LA 4CHAC 2FYQA 8GCHF 1W10U 5AFYH 2EA3A 4YLQH 1QL7A 1T8OA 2BX3A 1C1QA 2BD9A 4SGAE 1TQ0B 1Z8JB 1AFQB 1KYNA 1HNEE 1ZHPA 5EXNA 3GICB 2A31A 1UCYE 2P3FH 1IQFA 2RA0A 2JKHA 2GCHG 2H5DA 2A4OA 1GWAA 1K22H 2VH0A 1GI3A 3KEEA 2ZU3A 3UQVA 1QR3E 3TJOA 1OPHB 1FNIA 3V13A 2Z9LA 4JYUH 1EATA 3MU4A 4D9RA 2XWBI 5A09A 4Y11E 3A7VA 3PTBA 1GCTB 3C1KA 4AX9H 1A5IA 3U1JB 3A87A 3RC5A 5DPAA 1SGNE 4IC6A 2WV5A 3ZV8A 1EPTB 4CRBA 4CH2B 4K2YA 5CE1A 1L4ZA 2HWLB 1DSTA 1DOJA 1GHXH 1NRPH 1O2KA 3STIA 5B6OA 5DP9A 3AVZA 1L1JA 1QBVH 1GJAB 2PR3A 1GBFA 3O8BA 1EZQA 2GCTC 2FLRH 1OWEA 2AGEX 3B8JA 2HGTH 1O38A 2SGPE 1IQEA 2AMDA 1PPZA 1CGHA 4K60A 2ZQ2A 4UFDH 2VGCC 2C3SA 3RM0H 2XC4A 1DXWA 1E36B 2PFEA 5T6FA 4DT7B 4ZUHA 2VWOA 1IQGA 2UUFB 5C5NA 1IQHA 3I29A 1MBQA 2D1JA 2UWLA 4KTUA 1AY6H 2ZQ1A 2ZGJA 2BY9X 4NCYA 3QN7A 1Y5UT 3U69H 1FLEE 1S0RA 2F9NA 1SB1H 1SQOA 2BDIA 3LH1A 1KLIH 1HV7A 2I6QA 2A7JA 2J92A 4TWWA 5H4IB 1LHGH 1BRCE 4JK5A 1ELVA 4MTBA 3L33A 1ZHMA 2F9BH 1RTKA 1TPOA 4HTCH 2OP9A 2VH6A 3DFLA 4NA7A 4CRFA 1MCTA 4FVBA 3MU8A 3HGNA 3NUMA 1MZDA 2FOHA 4Q2KA 1UHBB 2SNWA 1YCPM 3E0NB 2VINA 6GCHG 1O3OA 1G9IE 2ZNKH 1J9CH 1FAKH 1DM4B 1SPJA 1RTLA 3SJ8A 4DG4A 1XXDA 2XBWA 1G3BA 3NKKA 5AVDA 2FZZA 1UVOA 2F83A 1D6RA 1MKWH 2PKAA 5DP7A 2P95A 3PO1B 1O2GH 1OYTH 2BD7A 2VIPA 5FX6A 3RC4A 4GHQA 3MNXA 2TGTA 2BD2A 3LGYA 4RSPA 1AQ7A 1CA8B 2BB4A 1ID5H 3KQEA 1GI7B 4K1TA 1OXGA 2F9PA 1HJAB 3P8NA 1THSH 5E2PA 3A80A 1WCZA 1GMDG 1AIXH 1DXPA 3S9CA 4GUXA 1F0UA 1L1GA 3ZVBA 5FXLA 1GDUA 1EJAA 1KXFA 4BANB 3MOCA 2V3HH 4O3TA 3V0XA 1KTSB 3RM2H 2YNBA 1J16A 1TX6A 1QA7A 3UIRA 5E0JA 1W8BH 2ZU2A 2BTCE 4X6OA 2B8OH 1PPBH 4CBOA 1EB2A 2GMTB 2R3YA 4AB8A 2XBXA 1V2RT 5LPFA 1YCPH 2PKSC 1GJ8B 4VGCC 4NA8A 1SGRE 3ZZBA 1PPCE 1AVXA 2PSXA 1BJUA 1V2MT 2ZFFH 4X1NU 1GMCG 1NU7B 3MNBA 5GPIB 2BY7X 1D3PB 1GHYH 2QAAA 1ZTKA 2BOHB 5HGGA 5GWZA 1ZLRA 1CBWC 4ISLA 1N8OB 1VCQA 3DUXH 5A2MH 2P59A 3GY8A 1OWKA 5GXPA 2VIOA 4LK4A 1Q3XA 1Y3VA 2FX6A 3VB5A 5F03A 3SN8A 3PMAB 2ZFTA 4I8GA 1EASA 2P8OC 2THFB 1FPHH 1GI0A 1C5QA 1EAXA 1SLVB 1K1IA 5DP6A 3T27A 3AAVA 1KSNA 1GJ5H 1TMUH 4WJG2 3P6ZB 2SGQE 2A4QA 2BM2A 1OP8A 1Z8GA 2OLGA 2XC0A 4FUFA 1CHOG 2BD5A 3LC5A 3BIUH 1O2LA 5ESBA 1PYTD 1MBMA 1FN6A 1AE8H 2HVXA 1G32B 1SVPA 2F9VA 2ZPQA 3LIWA 1AB9C 2FOMB 1OWDA 2XWAA 5GIBA 1O5GH 1G2LA 1FY8E 1W13U 1C1OA 1CVWH 6ESTA 5E0HA 2ILNA 1J17T 3LT3A 2OCVB 1BHXF 5HMAA 3HATH 1JWTA 7GCHG 1UCYH 2HLCA 1ZSKA 4AYVB 1C2IA 3KL6A 2KAIA 3RXDA 3KHVA 2QV1A 3FVFB 5F8ZA 4ABHA 4ASHA 4WXVA 1EXFA 2G51A 3WY8A 3RMMH 1XUGA 1HLTH 3FANA 4ABIA 1TNIA 3UOPA 1FAXA 3M3VA 1O2WA 1SHYA 1C5VA 1ELGA 3UFAA 4E7NA 4B1TA 4A1VA 3NWUA 1NZQH 1W2KH 3EQ0H 3MI4A 2ZHQH 3K65B 2ZU4A 4NZLA 2RCEA 2TRMA 1NESE 2XYAA 2ZCLP 1YPGH 1Z1IA 1BBRK 2OUAA 1WUNH 3DA9B 5ABWA 2FLBH 1UHBA 1G30B 1MTWA 2QF3A 1V2WT 2ZCHP 3KF2A 4XFQA 2H5CA 1RIWB 3BG4B 5K0HA 1HIAB 1TMBH 5JB9S 1GDNA 4HI3A 3P8FA 1IQIA 2BVSH 1QURH 2PKAB 1Y8TA 1YP9A 3RXEA 1QGFA 2ZA5A 1H1BA 1Z1JA 3SI4H 4I8JA 4JCNA 5A0CA 1ZGVA 5A8ZA 4FXGH 1AO5A 1P57B 2B0FA 4YT7H 3PYHA 1AKSA 4Y10E 2ANKH 1ARBA 1BMAA 1GBBA 4AB9A 5E0GA 1KIGH 1GI2A 2R2WU 4MNWA 3TLOA 2F9UA 1OWHA 1ZJKA 4ISIH 1PPEE 2A2QH 5HYOA 1TBZH 1SLWB 1TWXB 3OY5U 1O2NA 1H9HE 1WQVH 2PGQB 4X2WA 3BTDE 2VWMA 1NRNH 2Y5GA 1QBNA 2RDLA 1L4DA 2XW9A 5LPEA 1AKSB 2WV4A 5C67A 3ZZ9A 3W95A 1M9UA 2QCYA 4I8HA 5C5OA 4Q80A 1XVMA 2V0BA 1YLDA 2CF9H 2BQWB 3LJOA 1BOQA 1LHCH 2FTMA 1O37A 1BITA 1XM1A 1KTTB 4LXBH 1GHAG 4UE7H 3H7OA 5DO4H 2QYIA 2Y7ZA 1O2VA 2V6NA 1JRTA 1ZSJA 1O2QA 3F9GA 2H9EH 1YPLH 2LNCA 4AFZA 3NK8A 1KDQB 1TGTA 1OWJA 3A8CA 3ATLA 1AWHB 2IN2A 1Z6EA 3OY6U 3EYDA 3ZZ3A 2C8WB 3KQBA 2BDBA 4MG3A 2OC0A 4WF8A 1NFWA 1LVYA 5CMXH 3VB7A 4GHTA 5GJ4B 1MTSA 3RXBA 5C2ZA 1Y3WA 2SFAA 1GCTC 1Y3UA 3PLKA 4NIVA 2G8TA 4UEHH 4OS7A 4GLYA 2AH4X 3SU6A 4I33A 2FIRH 4IMQA 6CHAB 3M7TA 4NWKA 5L2ZH 1O31A 1WTHD 2KAIB 2QGRA 3GDSA 1ZHRA 3MNSA 1O2RA 3D49H 1GJBB 1XKBC 3FZZA 1X7AC 2Z3EA 1LCYA 2OXSA 2G81E 2XBYA 1THRH 5EQSA 1WU1A 1V2JT 2NU1E 2C4FH 4K69A 1JRSA 2OQ5A 2Z9KA 1MKXK 3TVJB 1S6HA 1CHGA 4NGAH 5C1YA 1P03A 2PTCE 3E90B 2G5NA 1OKXA 3Q00A 1Y3YA 1YF4A 1C1PA 1DWBH 2D26C 1TPSA 1GVZA 1YKTA 4FUIA 1K1PA 1P3CA 1DANH 1UVPA 1V2TT 1FZZA 4TY7A 1C5UA 2HRVA 1MH0A 1W0ZU 1TBRH 1S83A 2GTBA 2VWNA 3LPRA 5CHAB 2XRCA 1E35B 2BD8A 4I32A 3SGQE 1SQTA 5ESTE 2BLVA 2WPKS 3JZ1B 1FIWA 3M36A 1SBWA 1W12U 4HFPB 4Y71A 3PV4A 3A7XA 3H5CB 4FUCA 1EKBB 2H2ZA 1BIOA 1TE0A 4ISNA 1WQSA 1SOTA 1SQAA 1LTOA 4X1SU 2PWXA 4MNVA 2GGVB 3A8AA 1HAVB 1SGTA 1W3CA 3CENA 3FP7E 1P09A 2BDGA 1TQ7B 1O2JA 4Y6DA 1O3LA 2ZPRA 2FYRA 3GY7A 2F91A 4R8TB 2ZFSA 5HXFA 3NZIA 3TNSA 7ESTE 4X8VH 1O3IA 1TX7A 4FUBA 2VVCA 2QIQA 5JYIA 5LPRA 3QWCH 1NROH 3V3MA 1DSUA 1S85A 4B76A 1C1WH 1TLDA 3VPKA 3M5OA 2W3KA 3ZZ8A 2BLWA 1YBWA 3KNXA 4GVUA 4WXIA 4IW4E 5C1UA 1G3DA 5A0AE 1KXBA 5JBCS 3O8CA 3QGNB 4AOQA 5EU8A 4XBBA 8KME2 1TNHA 1O5EH 1SGPE 1EPTC 2BOKA 1GBCA 2OC8A 5C3NA 1ABIH 1BB0B 4NSVA 4BOHA 5FHTA 1QB6A 5JBAS 3VFEA 1GJ6A 1C1MA 2FOFA 4AFQA 3RXVA 4RN6A 1SMFE 1V2KT 1HYLA 4IBLH 3RXOA 3LOXA 2VWLA 1HBTH 2QXHA 1KLJH 4D9QA 3T26A 4AORA 1ANDA 4JYVH 1SR5C 4XBDA 4UFEH 4B2AA 1PYTC 3KN2A 1UK4A 1MTNB 1UTKA 1SI5H 1SFQB 2PUQH 2ZU1A 3QK1A 4A6LA 2OQUA 5DP4A 2XXLA 5GCHG 3TGKE 2W3IA 3FP6E 1YYY1 2VIWA 1NRSH 2J2UA 3RU4T 4X2VA 3SUEA 1YPHE 4THNH 3HK6B 4Y7BA 3SBKA 2Q1JA 4CREA 1O2TA 2ZFQH 1KXCA 3TH2H 1FIZA 3SQEE 2FI3E 3ZVCA
chains in the Genus database with same CATH superfamily
1IHSH 2JJ1D 3UR9A 3PWCA 4ISOA 3FP8E 1MAYA 1HXFH 3OX7U 1T7CA 1NU9A 5JBBS 1SGQE 3BN9A 2A5IA 1LHFH 3FZDA 1HAXB 1TYNA 3A7TA 3MU5A 4ZKSU 3GDVA 5A8YA 2CF8H 1BTHH 1AMHA 1P06A 2UWPA 3Q3XA 4Y8YA 2EC9H 4ZAEA 1A2CH 1GJDB 2BVXH 2YMSC 1HIAA 3SOSA 4WWYA 3E6PH 3RXPA 1UTNA 3LDXH 1BRAA 1BTUA 2Y81A 1ESAA 5DKMA 3KCGH 2P93A 2CK3D 1ETRH 3D65E 3Q77A 1RGQA 5IDKA 3KQDA 3F3BA 4ZXXH 1GHWH 2CMYA 4OGXA 6LPRA 1HCGA 1IOEA 1HGTH 4Y8ZA 1WSSH 1P9SA 1C1NA 1RXPA 4WMEA 1CU1A 1ELCA 4AG1A 1GBAA 5LH8A 3RXKA 1GHZA 5FCKA 1QHRB 4Q7XA 2BY8X 5HM2A 1IAUA 3UNSA 2HLDD 5KEDA 3OYPA 1P02A 2FXRA 4TYDA 3ZZCA 1AUJA 1O3EA 2BQ6B 2K1QA 3U1IB 1HXEH 2ESTE 1JXPA 1C1UH 2AMPA 3HGPA 4HGCA 1FY3A 3TJVA 3KIDU 1HB0B 1TRNA 2VB0A 4I8KA 1YCPK 4Y0YE 3RXMA 4AGJA 4CRGA 1MTNC 2LELA 3DD2H 5JPMH 1SC8U 4F55A 3LGUA 2Y5FA 3S69A 1S81A 1ZSLA 4IS5A 4ZKNU 2W26A 1ARCA 1VGCC 3ATWA 5CHAC 1AFEH 1P2OA 4YZUA 3BV9B 2PLXA 1EP6A 1UTOA 3HKJB 1Y3XA 1COWD 1N6XA 3RDZA 2Y6TA 2R3UA 2UUYA 5DP5A 2PSYA 2PW8H 2TGDA 1YPJH 3QZRA 1AZZA 2WPLS 1MKXH 5DP8A 1EX3A 1CBWB 5JDUB 4GCHG 4DJZB 2EI6A 4ACAA 2P16A 1XX9A 2QY0B 1CT4E 8ESTE 1EUFA 2XNIA 1C5NH 1GHBF 1GBTA 5F8TA 1T8NA 3K6YA 1HAPH 4VGCB 1SGYE 1JIRA 3DFJA 4WMDA 2W7SA 1ELTA 5BPEA 2KM0A 2BLOA 2VIVA 3SV8A 2K0QA 4Y7AA 3UQOA 2GVFA 1XVOA 1FONA 1A0HB 1V2LT 3EDXB 1ELDE 2ZDAH 8LPRA 3OU0A 1O3PB 2UUKB 1QB1A 1O3GA 1NO9H 4B74A 3N7OA 3F6UH 1CGJE 2ZTYA 1GBEA 4CR9A 1YLNA 2AEIH 4CRDA 3A7WA 2C93B 3SU1A 1SKYE 1K9OE 2ZECA 1FDPA 3E8LA 1EFRD 1THPB 1GBKA 3GY6A 4NZQA 2H9TH 1FPCH 3QLPH 5AHGH 4KTSA 3I78A 2BHGA 1FI8A 3P95A 3ZV9A 1P2NA 1UTLM 2C90B 3MO3A 1ESTA 2ZDKA 1Y59T 3T2NA 1RJXB 1VZQH 1F5KU 1GMCF 2ZHDA 1DITH 1QNJA 2ZDVH 2B5TB 2F4LA 1C5SA 1JIMA 4MPVA 2BXTH 1B0FA 1T8MA 4A1TA 3DHKH 1PQ8A 3MNCA 1C9TA 1K1NA 4INHA 1NC6A 1L0ZA 2PHBA 2HOBA 3AW1A 4I31A 1MUEB 4D7FA 1L2EA 1RTFB 2NU3E 3RLYH 4NIWA 2G4TA 4YOGA 1EAIA 2A1DB 4I7YH 1DLKB 1GVLA 1KXAA 1V2UT 1MMJN 1C1RA 1J15A 2FDAA 4KTCA 4H6SB 1VITH 1PQAA 1LPKB 5EW2H 1TRMA 1A1RA 2A4GA 1N8OC 2B9LA 1SOZA 1MU6B 4IGDA 1TALA 5TJXA 1IQMA 1OX1A 2ZP0H 3ZIAD 2CJIA 2Z9IA 4RKJB 1RD3B 2Y80A 3A8BA 1P3EA 5EPNA 1A4WH 3DCLA 1BTWA 5LGOA 1P2JA 4ZHLU 3AW0A 3SO3A 5KECA 1E1QD 3PROA 2B7DH 3PRDA 3SU2A 1O3NA 1GVKB 1G3EA 3ZVEA 3VB6A 2FS9A 2ZGCA 1TIOA 2OINA 3A83A 3GY3A 1QIXB 2DUCA 3BG8A 1HJ9A 2HNTC 4HG6A 3ITIA 1V3XA 2AIPA 4ZHAA 4H42U 2UUJB 1CA0C 2KX4A 2G52A 3TU7H 3MH5A 3LGVA 1LVMA 1NS3A 1N6YA 5J4QA 3F0PA 2FWWA 3OEHD 1GI4A 2PTNA 3TNTA 2RG3A 3MH6A 1ANEA 4FUEA 3M61U 1UK3A 1V2QT 1SLXB 9ESTA 4YESB 2AFQB 4Y0ZE 1DWEH 1OSSA 4ZH8A 1OWIA 3RXGA 4XDEA 2IJOB 5TCCA 4BTTB 1O2OA 2NU0E 2V35A 3BTHE 1BQYA 1HAYB 3SZNA 1HPGA 5FPYA 1CA0B 1GGDB 3U8RH 4ABDA 1O3BA 2ZI2H 3H09A 5A0BA 3E0PB 4Q7YA 2TGPZ 1TGSZ 2IPHA 1GMHG 1ELEE 3TK9A 2EQNA 2GZ7A 1HUTH 3NXPA 3SNAA 1XMNB 1F5RA 1DWCH 5EGMA 1INCA 3DSPA 3UWJH 4YT6H 2XC5A 3RP2A 1DY8A 1MD8A 1O2MA 1EP5A 1RFNA 3ZVGA 1AFQC 1LDTT 3FAOA 2ASUB 3PWBA 2BY5X 4J1YA 2FX4A 1GGDC 1UK2A 3S7KB 1F2SE 3BG4C 3BIVH 2NU2E 2HALA 2A32A 2QXJA 2W7UA 4WH6A 3QO6A 1E37B 4AZ2B 1DLEA 3B23B 3UAIC 1T31A 5C94A 1YM0A 4OS1A 1XXFA 4INKA 1W11U 3GDUA 1DE7H 2ZU5A 3F1SB 1P01A 3MH7A 3PV2A 1MTUA 1DVAH 2ULLA 1C2FA 2Z94A 2C8XB 5HM9A 1NM6A 3RXQA 1EOJA 3BTEE 3F2FA 3VB4A 1ABJH 5DGJA 1YPKH 2AYWA 2P3TB 3ATIA 4JZDH 4X6NA 1KXDA 2KCPA 4XRNA 3U9AH 2J34A 1ELAA 2O8LA 3L6PA 3PLBA 2PKSB 4RKOB 5L2YH 2FODA 4YO9A 2ZTXA 1E79D 2ZIQH 2GP9B 1P10A 2A7HA 4CR5A 2ODQA 4AC9A 1PQ5A 1LHEH 4FUDA 1W14U 4NFEA 5FX5A 1KXEA 3TIUA 1BMLA 2J9NA 3ZZ6A 3P70B 4ZHMU 1CE5A 1UTQA 5DG6A 2QC2A 2J5UA 3GOVB 3BTFE 3LONA 3ZYEA 1XUFA 3TH3H 1QJ1B 4D7GA 2H9HA 3RMNH 3ZYDA 1MQ5A 4JMYA 3TGJE 1D4PB 1DUEA 4YTAA 2TPIZ 2VU8E 3BTTE 1UTPA 3GCTG 5AF9H 2BZAA 3AK5A 3SGAE 1P05A 1O3HA 3K2UA 3M3TA 1UVTH 1O3FA 1OP2A 1W7XH 2FMJA 1AWFH 1TGNA 1QY6A 4U32A 4YOJA 1ZYOA 1A5GH 2OC1A 1PPGE 4MNYA 3LH3A 5FBIA 3TJNA 2BY6X 5E8EH 3M7UA 1S6FA 5EODA 3EGKH 3EA7A 1ESBA 3U8OH 1F0SA 3PMHB 3F9EA 4U2WA 2I6SA 4D8NA 2WZQA 1TNGA 1AVGH 2W6ID 1V6DA 3I77A 3TITA 1HDTH 2O8UA 1QFKH 4JZ1A 1A3BH 1LQDB 1O39A 1NPMA 1ETTH 2ANMH 1DWDH 3ZZDA 3S7HB 1BTZA 1P11E 3Q76A 7KMEH 1LVBA 1NY22 4AFUA 4X1QU 2FO9A 4AFSA 4FUJA 3MO6A 2BVRH 1TPAE 1QL9A 4DY7B 1K1JA 3TH4H 2ZHFH 3M5LA 4B75A 1RRKA 3A85A 2CXVA 4X8UH 3QZQA 2ZFPH 3DSOA 2UWOA 1W0JD 1YPMH 3Q3YA 1NBMD 2YOLA 2BMGB 1O2SA 3KQCA 4O03A 1FX0B 1H8IH 2A5KA 2Z7FE 2FI5E 5T6DA 2H6MA 5IYTA 2J4IA 5T6GA 3SGBE 1QZ8A 4CRAA 3LC3A 3ATKA 4XE4A 3SU0A 1ZRKA 2A5AA 5FCRA 3ZZ5A 2STBE 2Y5HA 3SJ9A 3BTWE 3R3GB 1SGDE 4Z1MD 3CS0A 3EE0B 3UNRA 4E7RG 4UFGH 3ZVFA 4TPYA 3UTUH 1HRTH 5EQRA 2ZGHA 1ZPBA 1TAWA 1ZMLA 4I8LA 1EB1H 3SJKA 1SGIB 1VR1H 3GY2A 5F53A 3GCNA 5DJ7A 1C1VH 1HAIH 3UY9A 1O5BB 2HVYB 2Q6FA 3ESTA 1LHDH 2ZHEH 2FOAA 3T25A 3D62A 1EZXC 1DPOA 1QL8A 3S9BA 3MU1A 2FM2A 1TNJA 1MABB 3VGCC 4B2BA 4HZHA 3TPIZ 2YNAA 1P2IA 2ZDLA 3IITA 2J94A 3OEED 2SGDE 1C5PA 1NBME 3LKWA 5I25A 4UDWH 1C5OH 2VJ1A 2GMTC 1P9UA 4WY3A 1K1LA 5E2OA 1VGCB 4ABGA 1CSOE 3E16B 1V2NT 2GZ9A 1O2XA 2CN0H 1K21H 4ZXYH 3ZVDA 1EJMA 4AG2A 1ZMJA 1DUAA 3BSQA 3L3TA 3RXLA 5GCHF 3HK3B 1BT7A 2WPJS 1Z6JH 4X2XA 2J97A 1UMAH 3RXUA 4UONA 2HPPH 3E1XB 2ZGXH 1D3DB 2BDYA 2HNTF 3N99A 1AHTH 1KDQA 1F92A 3M5NA 3OSYA 1ANBA 2XCNA 4BTUB 3ODFA 2QN5T 4OS4A 6CHAC 2GX4A 3VG8A 2TGAA 1TB6H 4ABAA 3F0OA 5C1XA 1C4Y2 1O5CB 1D3TB 1ZOMA 1SLUB 3H7TA 4BAOB 2FOGA 1WYKA 1QCPA 4Y79A 5F8XA 1NT1A 1P2MA 4BAHB 4MQAA 3GY5A 2OTVA 4SGBE 1ZPZA 1C2KA 2ZWLH 2EY4C 5CDFE 2FOCA 2CGAA 1U6QA 3BF6H 2V7QD 5FAHA 3E91A 5HIYA 1C1TA 4X1RU 1A0LA 1WV7H 2PUXB 1VITG 2OC7A 1GCDA 2HNTE 1Y5BT 2J98B 1ZTLA 3PTNA 1S84A 1Z7KA 2GV7A 3EA9A 1LPGB 1BJVA 1YLCA 3SNCA 4NIXA 4K5ZA 3M37A 3GCHB 4XBCA 1CQQA 1GPZA 1QB9A 1LKAA 1UTMA 2BD3A 1ZJDA 2BDAA 1GG6B 1AU8A 1EZSC 2FTLE 3OE7D 1RIWC 1F0TA 2BD4A 2XOKD 4B6EA 2WYJA 1LKBA 2A0QB 2FPZA 2ZEBA 5L6NH 4MNXA 1NFYA 1NRQH 3SU4A 1E0FD 3QUMP 1EZUC 2Z9GA 4IN2A 4PROA 4TY6A 3PM3A 3QGJA 2JH5D 3UOUA 1ZGIA 2F9OA 1GL0E 8GCHG 4KGAA 1C2HA 4CRCA 1FXYA 5EG4A 1A0JA 1WAYB 1WOFA 3SV7A 3HPTB 1SFIA 4KP0A 3SW2B 1G2MA 2WYGA 1FQ3A 3RC6A 1C5LH 1BMNH 1LPZB 4IN1A 1GJ9B 1D3QB 1P2KA 3ELAH 3PMBB 3SV9A 4WH8A 2FOBA 2ZC9H 4GPGA 1NRRH 1ZTJA 3ZZ4A 5EJ1A 4GCHF 2AGGX 2GCHF 3IG6B 4R0IA 4ZCNA 1ELBA 3U98H 1O2YA 1S0QA 3V7TA 3W1EA 7LPRA 1LVOA 4O9VA 1GHBG 5FPSA 3BEIB 2Y7XA 3UWIA 2J38A 4ZKRU 4H6TA 2VVVA 3O8DA 1AE5A 1O2HA 4XSKU 1WBGB 1YPHC 1ZR0A 3ZZ7A 1VJAU 2PGBB 3BTGE 1GDQA 5J4SA 2V3OH 5BRRE 3ZVAA 1GJCB 4B2CA 1C2DA 3LGIA 1KLTA 4CH8B 3BTQE 4FU9A 3SNDA 2ZHWH 3GS9A 1GBIA 3PO1C 1FMGA 2Z6BD 3SJIA 1IQJA 1Q31A 3PMJA 4NSYA 2AGIX 5EJZA 1SHHB 4MLFB 5EW1H 5A8XA 1EQ9A 1GJ4H 3RXIA 1KMHB 4OGYA 3STJA 3UPEA 4K1SA 1QTFA 5EQQA 1QJ6B 1MTVA 2GD4B 3PLPA 2SGFE 2LPRA 1C5YB 1Y5AT 3SZEA 1OS8A 1RS0A 1LQEA 4OS2A 3T29A 1Z71A 1ZPCA 1GBLA 1GI5A 4ZMAH 2JETB 3LJJA 2SGAA 3MWIU 4M9FA 4J2YB 1K1OA 4LOYH 1ANCA 1QRZA 1H9IE 3HKIB 4A92A 4CBNA 1P2QA 1V2OT 2JH0D 2ZO3H 4B6FA 9LPRA 4OS6A 1G37A 1NFXA 4YOIA 2QF0A 5EJLA 4F4OC 2BYAX 4YLUA 2ANWA 1FY5A 1Z8IB 3RXTA 1WDIA 1BRBE 3OTJE 2YMSD 3P92A 1TABE 3A82A 2ZCKP 3LGWA 1C2LA 4FOUC 3S9AA 2RDEA 1TONA 1O3CA 3MHWU 3G01A 4GSOA 2F3CE 3A7YA 3ZZAA 1GBJA 1C5RA 5FBEA 2D8WA 1TX8A 1FV9A 4O97A 4FU7A 6GCHF 3K9XB 3QDZB 2DE9A 2WUBA 3M7QA 4Z0KA 2Z3DA 1F7ZA 4Q63A 2WUCA 2XCFA 1G36A 4K3JA 1MZAA 2R0KA 2HPQH 2QXGA 4ABJA 3MH4A 3EA8A 1O35A 2GDDA 3R0FA 2OK5A 2BZ6H 2OD3B 2KFWA 2O8WA 1H8DH 4YM9A 4Y76A 2OBQA 1BDAA 1HJ8A 4TPIZ 1GHVH 1QQ4A 2BLQA 1O2IA 3VXEH 1PFXC 1A5HA 2A2XH 3MQKC 3CS7A 3RU4E 1A61H 3SUGA 3SYJA 4JYTA 4A7IB 2NU4E 1GMDF 3MO9A 2C8ZB 1O5DH 4AGKA 3A84A 3NCLA 1BTXA 3KGPA 3T28A 5EOKA 3P8GA 2FP7B 2AMQA 4UD9H 1UVUH 1HFDA 2VIQA 4X0WU 1XUIA 4B71A 2GDEH 2ZFRH 1C2JA 1PPHE 3C27B 1AI8H 4JZEH 1QRXA 4ZKOU 1TGCA 2KCYA 2FOEA 1UCYK 1O36A 3S0NA 1D9IA 2ZGBH 1O33A 1JBUH 1O3KA 1VJ9U 1YGCH 1ACBE 1ELFA 5C0UA 4MDSA 1AGJA 1HAOH 1P12E 2CV3A 2QA9E 1C2GA 1DS2E 1EAWA 1Z8RA 5AFZH 1OP0A 3BEFB 2ZDNA 3BTKE 2Y82A 5HKKD 1K1MA 1DDJA 4D76A 4A5TS 3GCOA 1AUTC 1D6WA 3CP7A 1TMTH 1O0DH 3A8DA 1GMHF 2BDCA 1QBOA 3BEUA 1BBRE 1SG8B 2NWNA 2GT7A 4FUHA 1BCUH 4WVPE 1BA8B 1O3JA 1OHHD 1MKWK 4Y8XA 4KELA 2KCAA 3SNEA 3TK5A 2GKVE 2ZZUH 1TRYA 3ENSB 2P3UB 2A45B 3ODDA 1TPPA 4F48B 3T62A 3K6ZA 1AVWA 1CHOF 1O5AB 3Q3KA 4OS5A 4JZIA 4JZFH 4ABBA 1BTPA 2WPIS 4H4FA 1O30A 2Q6DA 1TOCB 4ABFA 3TK6A 1BZXE 1CO7E 4X8TH 2BXUH 1IQNA 5T3HA 4ABEA 5K7RA 2A4RA 3GY4A 1JMOH 1ORFA 2BDHA 3SHCH 4BXSA 1C5ZB 2VBCA 1J14A 2JH6D 3GYMA 3RXAA 1TA2A 1YC0A 4BTIB 7GCHF 4K8BA 1BRUP 3RXFA 1NTPA 5PTPA 3PB1E 2ZTZA 3FO8D 1ZRBA 1DY9A 1NN6A 2IJD1 2RA3A 1AN1E 4RT1A 1P04A 1O3AA 2CHAC 3GCHC 4WMFA 2BX4A 1BMFD 4MPWA 1UVSH 1B5GH 3FOAA 1XUKA 1ZZZA 4JK6A 2JETC 1C5WB 4KKDA 1DT2A 1FY1A 2FEQH 2VGCB 2W5EA 4X6PA 4BAQB 1B7XB 1WTGH 2DE8A 5C20A 1VCPA 1KY9A 5EPYA 1C2MA 1FJSA 4E06H 2FI4E 3AASA 2WPHS 3URCA 3KQ5A 2VIDA 1GI8B 1P0SH 2A7CA 3F9FA 3GCTF 1SL3A 1IQKA 2ZG0H 2CHAB 3RLWH 2GV6A 4M7GA 1O3MA 1UTJA 1E34B 1VCWA 3FKSD 3EAJA 4Q7ZA 3SQHE 4XD7D 3V12A 1HAHH 1DX5M 1S5SA 3DT0H 4X2YA 2P8OB 5TCAA 3RUOA 2EI8A 4U30A 3RMLH 3GISB 2D2DA 2SNVA 4IMZA 1PJPA 1SQRA 2XBVA 5FL7D 2ALVA 2RFKC 3RXHA 1YWUA 4X1PU 2ODPA 1W7GH 1H9LB 1C9PA 1V2ST 2M2AA 3QX5H 4AN7A 1CT2E 1O2ZA 2IOTA 3PV5A 4BXWA 3AAUA 1W0YH 2L6OA 2ZPSA 3TJUA 4X8SH 2BQ7B 1C5XB 1TBQH 1K28D 2ZKSA 5G4BA 3URDA 3UUZA 1NFUA 5DN6D 1GBDA 4XOJA 1TA6A 5EXLA 3UR6A 1S82A 1GJ7B 2ODYB 2ALPA 2TBSA 4F49A 5GDSH 1ETSH 1GHAF 3SV2H 4IC5A 1XUHA 4BNRA 1O32A 1LMWB 1G3CA 2Q6GA 4ZROA 3MU0A 1FY4A 1GI1A 4DIIH 5DP3A 3RMOH 3SUDA 3RXRA 2AS9A 4DIHH 1GL1A 3F9HA 4NA9H 4O3UA 3VEQB 2ZDMA 3LU9B 1IQLA 1OOKB 3SORA 5EXMA 1A7SA 3RXCA 1H4WA 3MFJA 1A3EH 1Q2WA 2VNTA 1T4UH 1GI9B 2AIQA 1O34A 2R2MB 1SGEE 3RXSA 3CNRA 3FFGA 1VKYA 2WINI 1MU8B 4U01A 3E3TA 3W94A 2AERH 1TOMH 3P17H 4K8YA 4AYYB 2C8YB 2GZ8A 1BUIA 1QQUA 2GCTB 3SU5A 4MPXA 3BTME 3U8TH 2OBOA 4E05H 1MD7A 3A89A 1AD8H 1O2UA 1T4VH 1K2I1 2QXIA 1UO6A 1GI6A 3JZ2B 1LO6A 1SGFG 1TGBA 2GT8A 2EI7A 4BAKB 2WPDD 3SUFA 4GAWA 2Z3CA 1QA0A 2O8MA 3P8OA 1TNLA 3F2HA 3A81A 1IHTH 1MQ6A 1DFPA 5JB8S 3SU3A 1GBMA 4YXWD 5GNDA 1J8AA 4QT8C 2VVUA 1AZ8A 2IPQX 1HAZB 4TWYA 3NPSA 1TFXA 3MYWA 5L30H 4P02A 1OYQA 2SGEE 4ESTE 3SNBA 4B73A 1B0EA 1N1LA 3VXFH 1BMMH 3TGIE 2H1UA 1AB9B 2G00A 3RXJA 3VGCB 1CGIE 3OAAD 2G5VA 3A7ZA 4X6MA 3GYLB 2ZF0H 3M3SA 5FPTA 4BAMB 1O5FH 2STAE 3EE7A 3SV6A 2G55A 1BBRH 1TNKA 1C5MD 4UFFH 1CT0E 1C5TA 1XKAC 4DGJA 1P8VC 1V2VT 1SGFA 4CHAB 1MCVA 3B9FH 2FS8A 1C1SA 2R9PA 3D23A 1C4V2 1EAUA 4DOQA 2ANYA 1SGCA 3A88A 1C2EA 4LZ4B 4NIYA 1GG6C 1F5LA 3SI3H 1PPFE 1EJNA 5ETXA 2W6JD 4ISHH 3ATMA 3O8RA 2P94A 2J95A 3UNQA 1HAGE 1FN8A 3QTVH 2M5TA 4DVAU 4MPUA 1F0RA 3LGTA 5CHBA 4DCDA 2FESH 3MMGA 1VITF 3MTYA 2WPMS 4NWLA 4Z6AH 4A1XA 2Z9JA 1HJAC 5I46H 2XTTB 1DICA 4FUGA 3RU4D 4FU8A 4INLA 1UJ1A 1BHXB 4DURA 3M35A 1V2PT 1YPEH 1L1NA 2G4UA 3IWMA 5DK1A 4K1EA 1O3DA 3VB3A 1A46H 4NFFA 1JOUB 4FVDA 4DW2U 2EEKA 2J98A 1QRWA 1MAXA 3T5FH 2KCOA 3UREA 5F6MA 2TIOA 1BTYA 2PV9B 2R0LA 3M5MA 3SHAH 1EPTA 1GBHA 1C4U2 1HAVA 1PQ7A 1E38B 1EOLA 4MVNA 5SGAE 3SJOA 1O2PA 1SSXA 1T32A 4NG9H 2O9QA 2O8TA 4DT4A 3QTOH 3A86A 5JBTA 4LZ1H 1XUJA 1QJ7B 1FUJA 1ZMNA 3F68H 1T8LA 4CHAC 2FYQA 8GCHF 1W10U 5AFYH 2EA3A 3N7DA 1QL7A 4YLQH 1T8OA 2BX3A 1C1QA 2BD9A 4SGAE 1TQ0B 1Z8JB 1AFQB 1KYNA 3OTPA 1HNEE 1ZHPA 4ACBA 4I86A 5EXNA 3GICB 2A31A 1UCYE 2P3FH 1IQFA 2RA0A 2JKHA 2GCHG 2H5DA 2A4OA 1GWAA 1K22H 2VH0A 1GI3A 3KEEA 2ZU3A 3UQVA 1QR3E 3TJOA 1OPHB 1FNIA 3V13A 2Z9LA 3NRLA 4JYUH 1EATA 3MU4A 4D9RA 2XWBI 5A09A 4Y11E 3A7VA 3PTBA 1GCTB 3C1KA 4AX9H 1A5IA 5DSFA 3U1JB 3A87A 3RC5A 5DPAA 1SGNE 4P00A 4ASUD 4IC6A 2WV5A 2JJ2D 1EPTB 3ZV8A 4CRBA 4CH2B 4K2YA 5CE1A 1L4ZA 2HWLB 2WHXA 1DSTA 1DOJA 1GHXH 1NRPH 1O2KA 3STIA 5B6OA 5DP9A 3AVZA 1L1JA 4OM9A 1QBVH 1GJAB 2PR3A 1GBFA 3O8BA 1EZQA 5B6LA 2GCTC 2FLRH 1OWEA 2AGEX 3B8JA 2HGTH 1O38A 2SGPE 1IQEA 2AMDA 1PPZA 1WXRA 1CGHA 4K60A 2ZQ2A 4UFDH 2VGCC 2C3SA 3RM0H 2XC4A 1DXWA 1E36B 2PFEA 5T6FA 4DT7B 4ZUHA 2VWOA 1IQGA 2UUFB 5C5NA 1IQHA 3I29A 1MBQA 2D1JA 2UWLA 4KTUA 1K0HA 1AY6H 2ZQ1A 2ZGJA 2BY9X 4NCYA 2K8IA 3QN7A 1Y5UT 3U69H 1FLEE 1S0RA 2F9NA 1SB1H 1SQOA 2BDIA 3LH1A 1KLIH 1HV7A 2I6QA 3KYGA 2A7JA 2J92A 4TWWA 5H4IB 1LHGH 1BRCE 4JK5A 1ELVA 4MTBA 2JIZD 3L33A 1ZHMA 2F9BH 4RT0A 1RTKA 1TPOA 4HTCH 2OP9A 2VH6A 3DFLA 4NA7A 4CRFA 1MCTA 4FVBA 3MU8A 3HGNA 3NUMA 1MZDA 2FOHA 4Q2KA 1UHBB 2SNWA 1YCPM 3E0NB 2VINA 6GCHG 1O3OA 1G9IE 2ZNKH 5HIZA 1J9CH 2AHME 1FAKH 1DM4B 1SPJA 1RTLA 3SJ8A 4DG4A 1XXDA 2XBWA 1G3BA 3NKKA 3PRBA 5AVDA 4TSFD 2FZZA 1UVOA 2F83A 1D6RA 1MKWH 2PKAA 5DP7A 2P95A 3PO1B 1O2GH 1OYTH 2BD7A 2VIPA 3UB0A 5FX6A 1YY3A 3RC4A 4GHQA 3MNXA 2TGTA 2BD2A 2L74A 3LGYA 4RSPA 1AQ7A 1CA8B 2BB4A 1ID5H 3KQEA 1GI7B 4K1TA 1OXGA 2F9PA 1HJAB 3P8NA 1THSH 5E2PA 3A80A 1WCZA 1GMDG 1AIXH 1DXPA 3S9CA 4GUXA 1F0UA 1L1GA 3ZVBA 5FXLA 1GDUA 1EJAA 5EIYA 1KXFA 4BANB 3MOCA 2V3HH 4O3TA 5IK2D 3V0XA 1KTSB 3RM2H 2YNBA 1J16A 1TX6A 1QA7A 3UIRA 5E0JA 1W8BH 2JDID 2ZU2A 2BTCE 4X6OA 2B8OH 1PPBH 4CBOA 1EB2A 2GMTB 2R3YA 2QF5A 4AB8A 2XBXA 1V2RT 5LPFA 1YCPH 2PKSC 1GJ8B 4VGCC 4NA8A 1SGRE 3ZZBA 1PPCE 1AVXA 2PSXA 1BJUA 1V2MT 2ZFFH 4X1NU 1GMCG 1NU7B 3MNBA 5GPIB 2BY7X 1D3PB 1GHYH 3DSGA 2QAAA 1ZTKA 2BOHB 5HGGA 5GWZA 1ZLRA 1CBWC 4ISLA 1N8OB 2V3MA 1VCQA 3DUXH 3F2GA 2PP6A 5A2MH 2P59A 3GY8A 1OWKA 5GXPA 2VIOA 4LK4A 1Q3XA 1Y3VA 2FX6A 3VB5A 5F03A 3SN8A 3PMAB 2ZFTA 2QE7D 4I8GA 1EASA 2P8OC 2THFB 1FPHH 1GI0A 1C5QA 1EAXA 1SLVB 1K1IA 5DP6A 3T27A 3AAVA 1KSNA 1GJ5H 1TMUH 4WJG2 3P6ZB 4Q4LA 2SGQE 2A4QA 2BM2A 1OP8A 1Z8GA 2OLGA 2XC0A 4FUFA 1CHOG 2BD5A 3LC5A 3BIUH 1O2LA 5ESBA 1PYTD 1MBMA 1S6LA 1FN6A 1AE8H 2HVXA 1G32B 1SVPA 1E1RD 2F9VA 2ZPQA 3LIWA 1AB9C 2FOMB 1OWDA 2XWAA 5GIBA 1O5GH 1G2LA 1FY8E 1W13U 1C1OA 1CVWH 6ESTA 5E0HA 2ILNA 1J17T 3LT3A 2OCVB 1BHXF 5HMAA 3WW7A 3HATH 1JWTA 7GCHG 1UCYH 2HLCA 1ZSKA 4FETA 1C2IA 3KL6A 4AYVB 2KAIA 3RXDA 3KHVA 2QV1A 3FVFB 5F8ZA 4ABHA 4ASHA 4WXVA 1EXFA 2G51A 3WY8A 3RMMH 1XUGA 1HLTH 3FANA 4ABIA 1TNIA 3UOPA 1FAXA 3M3VA 1O2WA 1SHYA 1C5VA 1ELGA 3UFAA 4E7NA 4B1TA 4A1VA 3NWUA 1NZQH 1W2KH 3EQ0H 3MI4A 2ZHQH 3K65B 2ZU4A 2YMSB 4NZLA 2RCEA 2TRMA 1NESE 2XYAA 2ZCLP 1YPGH 1Z1IA 1BBRK 2OUAA 1WUNH 3DA9B 5ABWA 2FLBH 1UHBA 1G30B 1MTWA 2QF3A 1V2WT 2ZCHP 3KF2A 4XFQA 2H5CA 1RIWB 3BG4B 5K0HA 1HIAB 1TMBH 5JB9S 1GDNA 4HI3A 3P8FA 1IQIA 2BVSH 1QURH 2PKAB 1Y8TA 1YP9A 3RXEA 1QGFA 2ZA5A 1H1BA 1Z1JA 3SI4H 4I8JA 4JCNA 5A0CA 1ZGVA 5A8ZA 4FXGH 1AO5A 1P57B 2B0FA 4YT7H 3U28C 3PYHA 1AKSA 4Y10E 2ANKH 1ARBA 3OFND 1BMAA 1GBBA 4AB9A 5E0GA 1KIGH 1GI2A 2R2WU 4MNWA 3TLOA 2F9UA 1OWHA 1ZJKA 4ISIH 1PPEE 2A2QH 5HYOA 1TBZH 1SLWB 1TWXB 3OY5U 1O2NA 1H9HE 1WQVH 2PGQB 4X2WA 3BTDE 2VWMA 1NRNH 2Y5GA 1QBNA 2RDLA 1L4DA 2XW9A 5LPEA 1AKSB 2WV4A 5C67A 3ZZ9A 3W95A 1M9UA 2QCYA 4I8HA 5C5OA 4Q80A 1XVMA 2V0BA 1YLDA 2CF9H 2BQWB 3LJOA 2KR7A 1BOQA 1LHCH 5T1VA 2FTMA 1O37A 1BITA 1XM1A 1KTTB 4LXBH 1GHAG 4UE7H 3H7OA 5DO4H 2QYIA 2Y7ZA 1O2VA 2V6NA 1JRTA 1ZSJA 1O2QA 3F9GA 2H9EH 1YPLH 2LNCA 4AFZA 3NK8A 1KDQB 2QF4A 1TGTA 1OWJA 3A8CA 1UW7A 3ATLA 1AWHB 2IN2A 1Z6EA 3OY6U 3EYDA 3ZZ3A 2C8WB 3KQBA 2BDBA 4MG3A 2OC0A 4WF8A 1NFWA 1LVYA 5CMXH 3VB7A 4GHTA 5GJ4B 1MTSA 3RXBA 5C2ZA 1Y3WA 2SFAA 1GCTC 1Y3UA 3PLKA 4NIVA 5C0TA 2G8TA 4UEHH 4OS7A 4GLYA 2AH4X 2GJGA 3SU6A 4I33A 2FIRH 4IMQA 6CHAB 3M7TA 4NWKA 5L2ZH 1O31A 1WTHD 2KAIB 2QGRA 3GDSA 1ZHRA 3MNSA 1O2RA 3D49H 4RI0A 1GJBB 1XKBC 3FZZA 1X7AC 2Z3EA 1LCYA 2OXSA 2G81E 2XBYA 1THRH 5EQSA 1WU1A 1V2JT 2NU1E 2C4FH 4K69A 1JRSA 1H8HD 2OQ5A 2Z9KA 3WWBA 1MKXK 3TVJB 1S6HA 1CHGA 5KGOA 4NGAH 5C1YA 1P03A 2PTCE 3E90B 1H8ED 2G5NA 1OKXA 3Q00A 1Y3YA 1YF4A 1C1PA 1DWBH 2D26C 1TPSA 4TT3D 1GVZA 1W0KD 1YKTA 4FUIA 2LP6A 1K1PA 1P3CA 1DANH 1UVPA 1V2TT 1FZZA 4TY7A 1C5UA 2HRVA 1MH0A 1W0ZU 1TBRH 1S83A 2GTBA 2VWNA 3LPRA 5CHAB 2XRCA 1E35B 2BD8A 4I32A 3SGQE 1SQTA 5ESTE 2BLVA 2WPKS 3JZ1B 1FIWA 3M36A 1SBWA 1W12U 4HFPB 4Y71A 3PV4A 3A7XA 3H5CB 3N7EA 1EKBB 4FUCA 2H2ZA 1BIOA 1TE0A 4ISNA 1WQSA 1SOTA 1SQAA 1LTOA 4X1SU 2PWXA 4MNVA 2GGVB 3A8AA 1HAVB 1SGTA 1W3CA 3CENA 3FP7E 1P09A 2BDGA 1TQ7B 1O2JA 4Y6DA 1O3LA 2ZPRA 2FYRA 3GY7A 2F91A 4R8TB 2ZFSA 5HXFA 3NZIA 3TNSA 7ESTE 4X8VH 1O3IA 1TX7A 3WWFA 4FUBA 2VVCA 2QIQA 5JYIA 5LPRA 3QWCH 1NROH 3V3MA 1DSUA 1S85A 4B76A 1C1WH 1TLDA 3VPKA 3M5OA 3FN8A 2W3KA 3ZZ8A 2BLWA 1YBWA 3KNXA 4GVUA 4WXIA 4IW4E 5C1UA 1G3DA 5A0AE 1KXBA 5JBCS 3O8CA 3QGNB 4AOQA 5EU8A 4XBBA 8KME2 2WSSD 1TNHA 1O5EH 1SGPE 1EPTC 2BOKA 1GBCA 2OC8A 5C3NA 1ABIH 1BB0B 4NSVA 4BOHA 5FHTA 1QB6A 5JBAS 3VFEA 1GJ6A 1C1MA 2FOFA 4AFQA 5C17A 3RXVA 4RN6A 1SMFE 1V2KT 1HYLA 4IBLH 3RXOA 3LOXA 2VWLA 1HBTH 2QXHA 1KLJH 4D9QA 3T26A 2F43B 4AORA 2KZ4A 1ANDA 4JYVH 1SR5C 4XBDA 4UFEH 2WV9A 4B2AA 1PYTC 3KN2A 1UK4A 1MTNB 1UTKA 1SI5H 1SFQB 2PUQH 2ZU1A 3QK1A 4A6LA 2OQUA 5DP4A 2XXLA 5GCHG 3TGKE 2XNDD 2W3IA 3FP6E 1YYY1 2VIWA 1NRSH 2J2UA 3RU4T 4X2VA 3SUEA 1YPHE 4THNH 3HK6B 4Y7BA 3SBKA 2Q1JA 3KYFA 4CREA 1O2TA 2ZFQH 1KXCA 3TH2H 1FIZA 3SQEE 2FI3E 3ZVCA
chains in the Genus database with same CATH topology
1IHSH 3UR9A 3PWCA 4ISOA 3FP8E 1MAYA 1HXFH 3OX7U 1T7CA 1NU9A 5JBBS 1SGQE 3BN9A 2A5IA 1LHFH 3FZDA 1HAXB 1TYNA 3A7TA 3MU5A 4ZKSU 3GDVA 5A8YA 2CF8H 1BTHH 1AMHA 1P06A 2UWPA 3Q3XA 4Y8YA 2EC9H 4ZAEA 1A2CH 1GJDB 2BVXH 3SOSA 1HIAA 4WWYA 3E6PH 3RXPA 1UTNA 3LDXH 1BRAA 1BTUA 2Y81A 1ESAA 5DKMA 3KCGH 2P93A 1ETRH 3D65E 3Q77A 1RGQA 5IDKA 3KQDA 4ZXXH 1GHWH 2CMYA 4OGXA 6LPRA 1HCGA 1IOEA 1HGTH 4Y8ZA 1WSSH 1P9SA 1C1NA 1RXPA 4WMEA 1CU1A 1ELCA 4AG1A 1GBAA 5LH8A 3RXKA 1GHZA 5FCKA 1QHRB 4Q7XA 2BY8X 5HM2A 1IAUA 3UNSA 3OYPA 1P02A 2FXRA 4TYDA 3ZZCA 1AUJA 1O3EA 2BQ6B 2K1QA 3U1IB 1HXEH 2ESTE 1JXPA 1C1UH 2AMPA 3HGPA 4HGCA 1FY3A 3TJVA 3KIDU 1HB0B 1TRNA 2VB0A 4I8KA 1YCPK 4Y0YE 3RXMA 4AGJA 4CRGA 1MTNC 3DD2H 5JPMH 1SC8U 3LGUA 2Y5FA 3S69A 1S81A 1ZSLA 4IS5A 4ZKNU 2W26A 1ARCA 1VGCC 3ATWA 5CHAC 1AFEH 1P2OA 4YZUA 3BV9B 2PLXA 1EP6A 1UTOA 3HKJB 1Y3XA 1N6XA 3RDZA 2Y6TA 2R3UA 2UUYA 5DP5A 2PSYA 2PW8H 2TGDA 1YPJH 3QZRA 1AZZA 2WPLS 1MKXH 5DP8A 1EX3A 1CBWB 5JDUB 4GCHG 4DJZB 2EI6A 2P16A 1XX9A 2QY0B 1CT4E 8ESTE 1EUFA 2XNIA 1C5NH 1GHBF 1GBTA 5F8TA 1T8NA 3K6YA 1HAPH 4VGCB 1SGYE 1JIRA 3DFJA 4WMDA 2W7SA 1ELTA 5BPEA 2BLOA 2VIVA 3SV8A 3UQOA 4Y7AA 2GVFA 1XVOA 1FONA 1A0HB 1V2LT 3EDXB 1ELDE 2ZDAH 8LPRA 3OU0A 1O3PB 2UUKB 1QB1A 1O3GA 1NO9H 4B74A 3N7OA 3F6UH 1CGJE 2ZTYA 1GBEA 4CR9A 2AEIH 4CRDA 3A7WA 2C93B 3SU1A 1K9OE 2ZECA 1FDPA 3E8LA 1THPB 1GBKA 3GY6A 4NZQA 2H9TH 1FPCH 3QLPH 5AHGH 4KTSA 3I78A 2BHGA 1FI8A 3P95A 3ZV9A 1P2NA 1UTLM 2C90B 3MO3A 1ESTA 2ZDKA 1Y59T 3T2NA 1RJXB 1VZQH 1F5KU 1GMCF 2ZHDA 1DITH 1QNJA 2ZDVH 2B5TB 1C5SA 1JIMA 4MPVA 2BXTH 1B0FA 1T8MA 4A1TA 3DHKH 1PQ8A 3MNCA 1C9TA 1K1NA 4INHA 1NC6A 1L0ZA 2PHBA 2HOBA 3AW1A 4I31A 1MUEB 4D7FA 1L2EA 1RTFB 2NU3E 3RLYH 4NIWA 2G4TA 4YOGA 1EAIA 2A1DB 4I7YH 1DLKB 1GVLA 1KXAA 1V2UT 1MMJN 1C1RA 1J15A 2FDAA 4KTCA 4H6SB 1VITH 1PQAA 1LPKB 5EW2H 1TRMA 1A1RA 2A4GA 1N8OC 2B9LA 1SOZA 1MU6B 4IGDA 1TALA 5TJXA 1IQMA 1OX1A 2ZP0H 2CJIA 2Z9IA 4RKJB 1RD3B 2Y80A 3A8BA 1P3EA 5EPNA 1A4WH 1BTWA 5LGOA 1P2JA 4ZHLU 3AW0A 3SO3A 3PROA 2B7DH 3SU2A 1O3NA 1GVKB 1G3EA 3ZVEA 3VB6A 2FS9A 2ZGCA 1TIOA 2OINA 3A83A 3GY3A 1QIXB 2DUCA 3BG8A 1HJ9A 2HNTC 3ITIA 1V3XA 2AIPA 4ZHAA 4H42U 2UUJB 1CA0C 2G52A 3TU7H 3MH5A 3LGVA 1LVMA 1NS3A 1N6YA 5J4QA 2FWWA 1GI4A 2PTNA 3TNTA 2RG3A 3MH6A 1ANEA 4FUEA 3M61U 1UK3A 1V2QT 1SLXB 9ESTA 4YESB 2AFQB 4Y0ZE 1DWEH 1OSSA 4ZH8A 1OWIA 3RXGA 4XDEA 2IJOB 5TCCA 4BTTB 1O2OA 2NU0E 2V35A 3BTHE 1BQYA 1HAYB 3SZNA 1HPGA 5FPYA 1CA0B 1GGDB 3U8RH 4ABDA 1O3BA 2ZI2H 5A0BA 3E0PB 4Q7YA 2TGPZ 1TGSZ 2IPHA 1GMHG 1ELEE 3TK9A 2GZ7A 1HUTH 3NXPA 3SNAA 1XMNB 1F5RA 1DWCH 5EGMA 1INCA 3UWJH 4YT6H 2XC5A 3RP2A 1DY8A 1MD8A 1O2MA 1EP5A 1RFNA 3ZVGA 1AFQC 1LDTT 3FAOA 2ASUB 3PWBA 2BY5X 4J1YA 2FX4A 1GGDC 1UK2A 3S7KB 1F2SE 3BG4C 3BIVH 2NU2E 2HALA 2A32A 2QXJA 2W7UA 4WH6A 3QO6A 1E37B 4AZ2B 1DLEA 3B23B 1T31A 1YM0A 4OS1A 1XXFA 4INKA 1W11U 3GDUA 1DE7H 2ZU5A 3F1SB 1P01A 3MH7A 1MTUA 1DVAH 2ULLA 1C2FA 2Z94A 2C8XB 5HM9A 1NM6A 3RXQA 1EOJA 3BTEE 3VB4A 1ABJH 5DGJA 1YPKH 2AYWA 2P3TB 3ATIA 4JZDH 4X6NA 1KXDA 3U9AH 2J34A 1ELAA 2O8LA 3L6PA 3PLBA 2PKSB 4RKOB 5L2YH 2FODA 4YO9A 2ZTXA 2ZIQH 2GP9B 1P10A 2A7HA 4CR5A 2ODQA 1PQ5A 1LHEH 4FUDA 1W14U 4NFEA 5FX5A 1KXEA 3TIUA 1BMLA 2J9NA 3ZZ6A 3P70B 4ZHMU 1CE5A 1UTQA 5DG6A 2QC2A 3GOVB 3BTFE 3LONA 3ZYEA 1XUFA 3TH3H 1QJ1B 4D7GA 2H9HA 3RMNH 3ZYDA 1MQ5A 4JMYA 3TGJE 1D4PB 1DUEA 4YTAA 2TPIZ 2VU8E 3BTTE 1UTPA 3GCTG 5AF9H 2BZAA 3SGAE 1P05A 1O3HA 3K2UA 3M3TA 1UVTH 1O3FA 1OP2A 1W7XH 2FMJA 1AWFH 1TGNA 1QY6A 4U32A 4YOJA 1ZYOA 1A5GH 2OC1A 1PPGE 4MNYA 3LH3A 5FBIA 3TJNA 2BY6X 5E8EH 3M7UA 1S6FA 5EODA 3EGKH 3EA7A 1ESBA 3U8OH 1F0SA 3PMHB 3F9EA 4U2WA 2I6SA 4D8NA 1TNGA 1AVGH 1V6DA 3I77A 3TITA 1HDTH 2O8UA 1QFKH 4JZ1A 1A3BH 1LQDB 1O39A 1NPMA 1ETTH 2ANMH 1DWDH 3ZZDA 3S7HB 1BTZA 1P11E 3Q76A 7KMEH 1LVBA 1NY22 4AFUA 4X1QU 2FO9A 4AFSA 4FUJA 3MO6A 2BVRH 1TPAE 1QL9A 4DY7B 1K1JA 3TH4H 2ZHFH 3M5LA 4B75A 1RRKA 3A85A 2CXVA 4X8UH 3QZQA 2ZFPH 2UWOA 3Q3YA 1YPMH 2YOLA 2BMGB 1O2SA 3KQCA 4O03A 1H8IH 2A5KA 2Z7FE 2FI5E 5T6DA 2H6MA 5IYTA 2J4IA 5T6GA 3SGBE 4CRAA 3LC3A 3ATKA 4XE4A 3SU0A 1ZRKA 2A5AA 5FCRA 3ZZ5A 2STBE 2Y5HA 3SJ9A 3BTWE 3R3GB 1SGDE 3CS0A 3EE0B 3UNRA 4E7RG 4UFGH 3ZVFA 4TPYA 3UTUH 1HRTH 5EQRA 2ZGHA 1ZPBA 1TAWA 1ZMLA 4I8LA 1EB1H 3SJKA 1SGIB 1VR1H 3GY2A 3GCNA 5DJ7A 1C1VH 1HAIH 3UY9A 1O5BB 2Q6FA 3ESTA 1LHDH 2ZHEH 2FOAA 3T25A 3D62A 1EZXC 1DPOA 1QL8A 3S9BA 3MU1A 2FM2A 1TNJA 3VGCC 4B2BA 4HZHA 3TPIZ 2YNAA 1P2IA 2ZDLA 3IITA 2J94A 2SGDE 1C5PA 3LKWA 5I25A 4UDWH 1C5OH 2VJ1A 2GMTC 1P9UA 4WY3A 1K1LA 5E2OA 1VGCB 4ABGA 1CSOE 3E16B 1V2NT 2GZ9A 1O2XA 2CN0H 1K21H 4ZXYH 3ZVDA 1EJMA 4AG2A 1ZMJA 1DUAA 3BSQA 3L3TA 3RXLA 5GCHF 3HK3B 1BT7A 2WPJS 1Z6JH 4X2XA 1UMAH 3RXUA 4UONA 2HPPH 3E1XB 2ZGXH 1D3DB 2BDYA 2HNTF 1AHTH 1KDQA 1F92A 3M5NA 3OSYA 1ANBA 2XCNA 4BTUB 3ODFA 2QN5T 4OS4A 6CHAC 2GX4A 2TGAA 1TB6H 4ABAA 5C1XA 1C4Y2 1O5CB 1D3TB 1ZOMA 1SLUB 3H7TA 4BAOB 2FOGA 1WYKA 1QCPA 4Y79A 5F8XA 1NT1A 1P2MA 4BAHB 4MQAA 3GY5A 2OTVA 4SGBE 1ZPZA 1C2KA 2ZWLH 2FOCA 2CGAA 1U6QA 3BF6H 5FAHA 3E91A 1C1TA 4X1RU 1A0LA 1WV7H 2PUXB 1VITG 2OC7A 1GCDA 2HNTE 1Y5BT 1ZTLA 3PTNA 1S84A 1Z7KA 2GV7A 3EA9A 1LPGB 1BJVA 1YLCA 3SNCA 4NIXA 4K5ZA 3M37A 3GCHB 4XBCA 1CQQA 1GPZA 1QB9A 1LKAA 1UTMA 2BD3A 1ZJDA 2BDAA 1GG6B 1AU8A 1EZSC 2FTLE 1RIWC 1F0TA 2BD4A 2WYJA 1LKBA 2A0QB 2FPZA 2ZEBA 5L6NH 4MNXA 1NFYA 1NRQH 3SU4A 1E0FD 3QUMP 1EZUC 2Z9GA 4IN2A 4PROA 4TY6A 3PM3A 3QGJA 2JH5D 3UOUA 1ZGIA 2F9OA 1GL0E 8GCHG 4KGAA 1C2HA 4CRCA 1FXYA 5EG4A 1A0JA 1WAYB 1WOFA 3SV7A 3HPTB 1SFIA 4KP0A 3SW2B 1G2MA 2WYGA 1FQ3A 3RC6A 1C5LH 1BMNH 1LPZB 4IN1A 1GJ9B 1D3QB 1P2KA 3ELAH 3PMBB 3SV9A 4WH8A 2FOBA 2ZC9H 4GPGA 1NRRH 1ZTJA 3ZZ4A 4GCHF 2AGGX 2GCHF 3IG6B 4R0IA 1ELBA 3U98H 1O2YA 1S0QA 3V7TA 7LPRA 1LVOA 4O9VA 1GHBG 5FPSA 3BEIB 2Y7XA 3UWIA 2J38A 4ZKRU 4H6TA 2VVVA 3O8DA 1AE5A 1O2HA 4XSKU 1WBGB 1YPHC 1ZR0A 3ZZ7A 1VJAU 2PGBB 3BTGE 1GDQA 5J4SA 2V3OH 5BRRE 3ZVAA 1GJCB 4B2CA 1C2DA 3LGIA 1KLTA 4CH8B 3BTQE 4FU9A 3SNDA 2ZHWH 1GBIA 3PO1C 1FMGA 2Z6BD 3SJIA 1IQJA 1Q31A 3PMJA 4NSYA 2AGIX 1SHHB 4MLFB 5EW1H 5A8XA 1EQ9A 1GJ4H 3RXIA 4OGYA 3STJA 3UPEA 4K1SA 1QTFA 5EQQA 1QJ6B 1MTVA 2GD4B 3PLPA 2SGFE 2LPRA 1C5YB 1Y5AT 1OS8A 1RS0A 1LQEA 4OS2A 3T29A 1Z71A 1ZPCA 1GBLA 1GI5A 4ZMAH 2JETB 3LJJA 2SGAA 3MWIU 4J2YB 1K1OA 4LOYH 1ANCA 1QRZA 1H9IE 3HKIB 4A92A 4CBNA 1P2QA 1V2OT 2JH0D 2ZO3H 9LPRA 4OS6A 1G37A 1NFXA 4YOIA 2QF0A 4F4OC 2BYAX 4YLUA 2ANWA 1FY5A 1Z8IB 3RXTA 1BRBE 3OTJE 3P92A 1TABE 3A82A 2ZCKP 3LGWA 1C2LA 3S9AA 1TONA 1O3CA 3MHWU 3G01A 4GSOA 2F3CE 3A7YA 3ZZAA 1GBJA 1C5RA 5FBEA 2D8WA 1TX8A 1FV9A 4O97A 4FU7A 6GCHF 3K9XB 3QDZB 2DE9A 2WUBA 3M7QA 4Z0KA 2Z3DA 1F7ZA 2WUCA 2XCFA 1G36A 4K3JA 1MZAA 2R0KA 2HPQH 2QXGA 4ABJA 3MH4A 3EA8A 1O35A 2GDDA 3R0FA 2BZ6H 2OD3B 2O8WA 1H8DH 4YM9A 4Y76A 2OBQA 1BDAA 1HJ8A 4TPIZ 1GHVH 1QQ4A 2BLQA 1O2IA 3VXEH 1PFXC 1A5HA 2A2XH 3CS7A 3RU4E 1A61H 3SUGA 4JYTA 4A7IB 2NU4E 1GMDF 3MO9A 2C8ZB 1O5DH 4AGKA 3A84A 3NCLA 1BTXA 3KGPA 3T28A 5EOKA 3P8GA 2FP7B 2AMQA 4UD9H 1UVUH 1HFDA 2VIQA 4X0WU 1XUIA 4B71A 2GDEH 2ZFRH 1C2JA 1PPHE 3C27B 1AI8H 4JZEH 1QRXA 4ZKOU 1TGCA 2FOEA 1UCYK 1O36A 3S0NA 1D9IA 2ZGBH 1O33A 1JBUH 1O3KA 1VJ9U 1YGCH 1ACBE 1ELFA 4MDSA 1AGJA 1HAOH 1P12E 2CV3A 2QA9E 1C2GA 1DS2E 1EAWA 1Z8RA 5AFZH 1OP0A 3BEFB 2ZDNA 3BTKE 2Y82A 1K1MA 1DDJA 4D76A 4A5TS 3GCOA 1AUTC 1D6WA 3CP7A 1TMTH 1O0DH 3A8DA 1GMHF 2BDCA 1QBOA 3BEUA 1BBRE 1SG8B 2NWNA 2GT7A 4FUHA 1BCUH 4WVPE 1BA8B 1O3JA 1MKWK 4Y8XA 4KELA 3TK5A 3SNEA 2GKVE 2ZZUH 1TRYA 3ENSB 2P3UB 2A45B 3ODDA 1TPPA 3T62A 3K6ZA 1AVWA 1CHOF 1O5AB 3Q3KA 4OS5A 4JZIA 4JZFH 4ABBA 1BTPA 2WPIS 4H4FA 1O30A 2Q6DA 1TOCB 4ABFA 3TK6A 1BZXE 1CO7E 4X8TH 2BXUH 1IQNA 5T3HA 4ABEA 5K7RA 2A4RA 3GY4A 1JMOH 1ORFA 2BDHA 3SHCH 4BXSA 1C5ZB 3GYMA 1J14A 2JH6D 3RXAA 1TA2A 1YC0A 4BTIB 7GCHF 4K8BA 1BRUP 3RXFA 1NTPA 5PTPA 3PB1E 2ZTZA 1ZRBA 1DY9A 1NN6A 2RA3A 1AN1E 1P04A 1O3AA 2CHAC 3GCHC 4WMFA 2BX4A 4MPWA 1UVSH 1B5GH 1XUKA 1ZZZA 4JK6A 2JETC 1C5WB