4ABIA

Co-complex structure of bovine trypsin with a modified bowman-birk inhibitor (pta)sfti-1(1,14), that was 1,4-disubstituted with a 1,2,3- trizol to mimic a trans amide bond
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords CATIONIC TRYPSIN
publication title Braces for the Peptide Backbone: Insights Into Structure-Activity Relation-Ships of Protease Inhibitor Mimics with Locked Amide Conformations
pubmed doi rcsb
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abiA02
2C8YB 1EPTA 1P9SA 3SZNA 1SGYE 2BLQA 1QFKH 3SU5A 1P57B 2G55A 1UJ1A 2BY5X 3PWCA 3KIDU 1YPKH 3KEEA 4X2YA 1UTPA 2XC4A 4AGJA 1C1OA 4MQAA 1A3BH 3LGTA 3KHVA 4RSPA 3U1JB 4NWLA 2JH6D 1ZJDA 1EZSC 6LPRA 1FZZA 3EA8A 3GISB 1VCWA 1TGBA 1MKXK 2ZHWH 3MFJA 1MCVA 2FX4A 2FOBA 3SU2A 1ZR0A 3VB3A 4Y10E 2C4FH 1BMNH 1S85A 2ALVA 3ENSB 3MU5A 3T62A 1LVOA 1YF4A 5F6MA 1O2IA 3TJVA 1ZPBA 4TPIZ 1NU9A 2BQ7B 1ZTKA 2STBE 3LDXH 2SFAA 1QA7A 1JRSA 1UCYH 4BXWA 5DP3A 2B0FA 1THPB 1J14A 1LMWB 1D6WA 2ULLA 4JZIA 1LHGH 3AAUA 1BTYA 2WPHS 1XUHA 1P2JA 3W94A 1NU7B 1AE8H 2P8OC 4THNH 1IQHA 1GBKA 2OD3B 1XKAC 2XRCA 1TGCA 2QXHA 1O32A 2ANKH 2VIDA 3ATWA 1NRSH 2NU4E 3ESTA 5E0HA 2VWNA 1RIWB 1O2XA 4FVDA 3QDZB 1AVXA 1SGCA 4JMYA 2EA3A 8GCHF 1BBRH 2BOHB 3GYMA 3UTUH 2G81E 1HXEH 3MTYA 1W3CA 3TGIE 2A7CA 2XC0A 1O2SA 1IQEA 1O3DA 3SHCH 1XVOA 1YPHE 1MCTA 1C1PA 4CBNA 2Q6DA 5LH8A 1O2RA 1GI6A 5EXMA 4X6MA 1PFXC 2ZDLA 5L2ZH 1FI8A 3OY6U 2OC7A 1P06A 5C5OA 4AB9A 1A61H 1VITG 1TABE 4Y8XA 4OS1A 7GCHF 1GMCG 2QXJA 4ABDA 5C1XA 2BVXH 5C20A 4YO9A 4Z6AH 3KQDA 3E8LA 1D4PB 2ZKSA 2Y5FA 1C9TA 1GMDF 2BDIA 2F3CE 1O2MA 1XUJA 1PPBH 3RC5A 1A0HB 3MH6A 3SGAE 2OLGA 3I78A 1ZMNA 2SGDE 2ZU1A 2A5AA 1V2TT 1C2MA 2UWLA 2F9NA 3M3VA 4AFSA 1AVGH 1NROH 2Z9LA 1CHGA 3QN7A 3T28A 2FZZA 2QYIA 1EP6A 1SQAA 1Y59T 2ILNA 2WPJS 1QQ4A 3E3TA 2OUAA 1JBUH 2JKHA 2ZFPH 1UTKA 4X0WU 1GI1A 5FX5A 2JETC 2CV3A 2VVUA 1ZSLA 3RXQA 1A2CH 3TH3H 1IQIA 1AO5A 4J1YA 3S69A 5DGJA 1NRNH 5FPTA 1GBJA 3RXSA 3G01A 1SI5H 9ESTA 4AN7A 5FBIA 4ISIH 1L1JA 1ZTLA 2PTNA 4ZMAH 3TJNA 2JH5D 3VEQB 3ZZAA 2I6SA 4INKA 4MTBA 4CRAA 1EOLA 3QUMP 1HFDA 4MLFB 1DITH 1ETRH 4NA8A 4A5TS 5A8ZA 3MH4A 2K1QA 2ZFFH 2OBQA 1FV9A 4WMEA 4DW2U 2BLOA 1FDPA 1SHHB 3LGWA 2ZGXH 4NIXA 4X6PA 1PQAA 1AZ8A 1ARCA 2AIPA 2FDAA 4JZFH 3RXEA 3F9FA 1O34A 3U98H 1YLDA 1ZLRA 2ZCLP 4MNYA 5L30H 3LT3A 1C2KA 1S6HA 2C3SA 3BTTE 2PUXB 3ZV8A 4A92A 1MTVA 4Y7BA 1C2EA 1FJSA 1GI2A 2ZCKP 3D49H 3E0NB 4NSVA 1E37B 4YOIA 1TPOA 3LH3A 2AERH 4GHTA 1O0DH 2D8WA 4X6OA 1K22H 1DWBH 4WF8A 2FS9A 3ZVFA 1O3LA 1GI5A 4IC5A 3A7YA 1C5RA 1TNGA 1G36A 1SGEE 3ZV9A 1XUGA 2ZHFH 5I46H 1QB9A 5BRRE 4IMZA 4KGAA 1EB2A 2OC1A 1O36A 1XVMA 1LVYA 3EDXB 4NIYA 2BDAA 1DWDH 2J94A 3BG4B 1BITA 5DP9A 1ZSJA 2VH6A 4XFQA 3GY4A 2P95A 1XM1A 4HGCA 4D9RA 1S0QA 1LKBA 4JYUH 1C5UA 2A0QB 1C5WB 4CBOA 1K28D 1KY9A 2CXVA 3RXDA 2G00A 1O31A 2GCHF 3EE0B 2VWMA 4K8YA 5A8YA 1S82A 3MNCA 3MO6A 1B7XB 3MNSA 1G3EA 4O03A 3LJOA 2CHAB 3HK6B 2A4GA 1K1PA 1DSTA 4WY3A 4X1NU 3MNBA 4MVNA 1KXDA 3RLYH 1DOJA 1YCPM 5LPFA 3A7VA 1N8OB 4OS7A 4K8BA 3UUZA 1OWEA 3UPEA 3BF6H 1V2OT 1W2KH 5AVDA 1FY4A 1Y3XA 1SPJA 6CHAB 4NSYA 4Y8YA 1LCYA 1BRUP 2FWWA 4X1QU 1MAXA 3VB6A 1T8NA 1KXAA 1G9IE 2EEKA 3W95A 1ZGVA 2H6MA 2AGIX 1W12U 3M3SA 3RXGA 1PPHE 1V2VT 2G5VA 3LC3A 1O2TA 4KELA 1TOCB 5GCHF 2FLBH 2ZGCA 4X2XA 2EI8A 3BEIB 4A1TA 3SJKA 4MPUA 4IS5A 1AUTC 1O3KA 5ETXA 5F8TA 2SNVA 1GHAG 1CE5A 1UVUH 1AFQC 1O2ZA 4D76A 4DGJA 2P3TB 4X8VH 1YBWA 3BSQA 3GCOA 1GJ9B 2ZQ2A 2GMTB 2FM2A 4Q80A 1VR1H 1E36B 1BTXA 1CBWB 1HRTH 1P2OA 1DPOA 4NZLA 3RXCA 1AQ7A 3TU7H 3E0PB 1PPZA 3BN9A 3TK5A 1O5BB 1EASA 4MPVA 2BLWA 3UR6A 3MU1A 3BTHE 1SQOA 2ZPSA 3M61U 2AMDA 2IOTA 3ZZ9A 4HFPB 1B0FA 1GJ4H 1TBZH 4Q7XA 2Q6GA 4H6SB 3MO9A 1SR5C 5DK1A 1WYKA 2G51A 1HJ8A 4ZKSU 5EPNA 3A7ZA 2R3YA 2W7SA 3TK9A 2BOKA 4E05H 2GGVB 1NS3A 1FAKH 1P2QA 4IN1A 1HJAC 1RXPA 3LJJA 3MMGA 3PTNA 3GCTF 1QB6A 1C2DA 1LTOA 1EJNA 1C4V2 2QA9E 1DM4B 2TGPZ 8LPRA 2WPMS 1KDQB 3P8GA 2ZU3A 1EZUC 1P01A 1QJ6B 1Y3UA 2Y5HA 1Z8JB 4TY7A 2TIOA 4XBDA 3RXKA 3UQOA 4B71A 4YOJA 3RMLH 5A8XA 3A7TA 4YZUA 1TQ0B 1INCA 1IQGA 4UFGH 1BOQA 1OP0A 1BTPA 2J2UA 1MD8A 4GPGA 1JWTA 2TGTA 2FOCA 2THFB 3PLPA 1MH0A 5JYIA 3ZVEA 3RXFA 2G5NA 1TMTH 2UUKB 2AIQA 1J16A 1YPGH 3QTOH 1O3BA 2BD5A 1CSOE 1G32B 1QURH 1OWHA 3STJA 7LPRA 1YGCH 2EI7A 1GJ7B 2CF9H 1FY5A 1N6YA 2OC0A 1O2YA 5DP5A 5TCAA 1P3EA 3P8NA 4I8LA 3S0NA 2FI5E 1XXDA 3EA9A 4GCHF 2DUCA 1O30A 3O8RA 2P16A 4HZHA 3M7UA 3RU4D 1C5VA 3K65B 4NIVA 1ZHRA 1DE7H 1SGRE 3RM2H 3E16B 7ESTE 2UUYA 4LOYH 3A89A 5F8XA 2AGGX 3BTGE 2F83A 1QRWA 1QBOA 2PSYA 3BTFE 2YOLA 1M9UA 2A7JA 1YPLH 2OTVA 1BBRE 1BJUA 1YP9A 2GT7A 3RXIA 3QTVH 2GKVE 1L0ZA 1FIWA 3RXVA 2HNTC 1JXPA 4K60A 2PKAA 1VJAU 1XUFA 1AD8H 1C5NH 3M37A 4WMFA 1AB9C 1DICA 1D6RA 5B6OA 2W5EA 4CH8B 1EJMA 1ORFA 1UHBA 3U8RH 1FY8E 1WTHD 2H2ZA 2VIWA 1RTKA 3HKJB 1NT1A 4CREA 2C90B 2SGQE 3ZVCA 3V0XA 3D65E 1NZQH 3SJ9A 1V2PT 5CE1A 2BYAX 4AYVB 1VCPA 4JCNA 4MNXA 5FBEA 1E35B 3A7WA 1ETTH 1EAWA 2VB0A 2BD3A 4U01A 3EAJA 3KN2A 2WUCA 1GI7B 2HPPH 1O3CA 1UVTH 1GG6B 2ZG0H 4X8SH 1QCPA 1HYLA 2PGQB 2QIQA 1LHEH 3P95A 3SO3A 1T8LA 3MWIU 1FN8A 1RTFB 3Q3KA 1FPHH 3ZZ5A 2AYWA 1LVBA 5JBBS 1NESE 3M3TA 4YLQH 3GY5A 1ZZZA 3PLBA 2FOFA 1H4WA 1PPEE 2XW9A 4X1RU 2B5TB 3NCLA 2BDHA 3BIUH 4AFZA 4BAOB 4JK5A 1GHVH 3GCNA 2WV5A 1S0RA 3PO1C 1DLEA 2A4OA 1MTNC 1QB1A 1ABIH 3Q00A 1CHOG 2FMJA 5FCKA 1P05A 2F9UA 1UTNA 5A2MH 2V0BA 4DIIH 1UK4A 1CU1A 3I77A 1LQEA 2FOMB 2ZIQH 1RGQA 2FOHA 1YLCA 1TMBH 2BX4A 4ABBA 7KMEH 1C5XB 4NCYA 2ZZUH 3TJUA 1TNHA 3KQEA 5DP7A 3KF2A 2GZ7A 3EYDA 3L3TA 3PMJA 1FONA 4X1SU 3HK3B 1GDNA 3NK8A 3NUMA 1GCDA 4FUJA 1E38B 1SMFE 2JETB 3QZQA 1L1NA 1TONA 1IQMA 2VH0A 3B23B 4WXVA 1AI8H 3ZVGA 5DO4H 1EAXA 4B74A 4VGCB 2VNTA 3SHAH 1Z8RA 2STAE 1HIAB 1AKSA 3CS7A 3D62A 1WBGB 3S9AA 2BZ6H 1GGDC 5ESBA 1L4ZA 3F9EA 3V12A 2A2QH 2HNTF 2ODYB 3UREA 4YM9A 1K2I1 2OBOA 1O3GA 1KXCA 2BY6X 2QXIA 3A87A 3FAOA 2O8LA 3ZVAA 2RG3A 2TRMA 3URCA 1K1IA 2BQ6B 1ZSKA 5J4SA 1GBTA 1BMLA 1KLTA 1TNJA 2C8ZB 1DLKB 3UIRA 3PV4A 1EB1H 1Y3VA 3VB4A 1GVKB 4UFDH 2TGDA 1O2OA 2WYJA 2SGEE 1A5IA 2IJOB 4A6LA 3ZZ7A 5C1YA 1JMOH 1ZJKA 1BTZA 1KLIH 1ELBA 5E0JA 1KXFA 3T5FH 3BTQE 2FI4E 1P2IA 2J38A 2RA3A 4ABFA 4CR9A 1C1QA 4I31A 4XDEA 4KTCA 2BD9A 3NKKA 3VFEA 1TMUH 4AX9H 1WOFA 1GJAB 3L33A 3U1IB 1BTHH 3B8JA 1A0JA 1Y5BT 1PQ5A 2EI6A 2F9BH 1HXFH 1BMMH 2Z3DA 4YLUA 1XMNB 3ELAH 2ZDMA 4IC6A 1QHRB 2BY9X 2ZFSA 3MU0A 1P12E 1EAUA 4ZXYH 5LPRA 1GHBG 3NPSA 1ACBE 1UVOA 1GDQA 3NWUA 2H1UA 1AVWA 1O2LA 4BOHA 2HRVA 1GJDB 2ZHEH 3SNAA 1SHYA 1SL3A 2BLVA 3K2UA 3UY9A 2VGCB 4X1PU 3NXPA 2VWOA 3SQEE 1Q2WA 1NN6A 1SGDE 3TNTA 1BA8B 1O3NA 4K1TA 4FUGA 3RXPA 1ZHMA 4BTUB 9LPRA 3KGPA 3RXHA 1K9OE 3H5CB 1GHZA 1GMCF 3MU4A 3ZZCA 1O2WA 3RXOA 4AG2A 2V35A 3BV9B 2ALPA 1C5PA 1AU8A 1KTSB 1A5GH 1EAIA 3ZZ3A 3RUOA 1MUEB 2WPLS 5JB9S 2J9NA 1A0LA 1JOUB 2ZDNA 2A45B 3SNCA 2Z9KA 1LKAA 4CRBA 1DWEH 2ZI2H 1GMDG 1FPCH 4D8NA 2R2MB 2QC2A 3VPKA 1O3AA 5C5NA 1V2KT 3FVFB 4NG9H 1AWFH 1MKWK 2BDBA 1P2MA 1F5KU 1X7AC 1F5LA 1Z6JH 4BAQB 2ZTXA 2XCFA 3BEFB 1SOTA 5L6NH 1TQ7B 1AFQB 3L6PA 4B75A 1BB0B 5EOKA 4CR5A 2FODA 1HBTH 1BTUA 1MZAA 1YPMH 4Y79A 3TNSA 3C27B 3O8CA 1CT2E 4FUIA 3A83A 1LHDH 2HOBA 4Y0YE 5DP8A 2P94A 1QL9A 3GY6A 4LXBH 4JZ1A 2IN2A 2G4UA 1UK2A 2OC8A 3ZZ4A 1S83A 2BD8A 1ARBA 1MU6B 1W8BH 2AFQB 2ZHQH 1EPTB 4ZKRU 1ELCA 2RCEA 1V2NT 1DXWA 3RM0H 1YKTA 3JZ1B 3RXMA 3SUGA 3LGUA 1GHXH 1T7CA 4X8UH 1G3DA 1HAVA 4LK4A 2SNWA 3QO6A 3MHWU 1C1NA 4I8JA 4ABGA 4BAHB 1HJAB 4AYYB 3E91A 1W7XH 4AFQA 1FLEE 2IPHA 2H5CA 4I7YH 1H9LB 3Q3YA 1GBBA 4I33A 3RU4T 2QF0A 4ZKNU 1GBCA 3PLKA 3OTJE 1RJXB 3F6UH 1EP5A 3T29A 3RXLA 3HATH 4X8TH 2GCTC 8ESTE 3VB7A 2W3IA 1E0FD 1C4U2 2B7DH 5HMAA 1SGQE 3PMHB 4TY6A 3LIWA 1SGFG 1TNKA 3SV8A 1C1TA 4OS6A 1K1MA 1P9UA 1WTGH 2D26C 3A85A 3RMMH 1NRQH 6GCHF 4RKOB 4A1XA 1THSH 3SI4H 1GJ8B 2P59A 1NC6A 1GWAA 3FP6E 1MKXH 1Q3XA 1UTQA 1ZYOA 3ZVDA 2CJIA 1G3BA 3RP2A 1SSXA 1G2LA 2YNAA 1TBQH 2ZGJA 3FANA 1O2JA 2VIOA 4NFEA 1N1LA 1C5OH 1IQKA 1QRXA 1NFYA 1TAWA 3O8BA 3P17H 2PWXA 4FUCA 1OWJA 4MPXA 3UOPA 1ZPCA 5EXLA 2ZF0H 4Y6DA 5C67A 4HI3A 2GCHG 2Y82A 4Q7ZA 4UFEH 2PV9B 3A8CA 3A80A 1HJ9A 1ELVA 3SU6A 2VIQA 4B73A 1AY6H 5FAHA 1ZMJA 3GCHB 2XBXA 4GUXA 3RC4A 1GHYH 1MTSA 2KAIA 4ASHA 1L4DA 5DP4A 2OCVB 1Z1JA 1Y3WA 4X6NA 2GX4A 1F2SE 1IHSH 1Y5AT 1TE0A 1FNIA 3RXBA 5ABWA 4U30A 1Z7KA 1K1OA 1SC8U 2YNBA 3LOXA 4DG4A 1KXEA 2FESH 2TPIZ 1H9IE 3MH5A 3SUDA 2H9HA 1T31A 1DUEA 3TH4H 2JH0D 4TWWA 1YPJH 3FZDA 1LO6A 1ZPZA 1C1RA 2GV7A 1CQQA 1FUJA 4DURA 3KQCA 1TIOA 3SW2B 3SUEA 3VGCB 3MO3A 1GHAF 1GI0A 4AB8A 1ESBA 3PTBA 1HGTH 1GPZA 4INHA 5GCHG 1O5GH 1H9HE 3VXFH 1BHXF 1B0EA 4INLA 3RXUA 1TA2A 2HPQH 5DG6A 3P8FA 2ESTE 2QGRA 3DFLA 4ZHLU 3MH7A 3QGJA 3R3GB 2SGFE 3RXRA 2PSXA 1GCTB 3OY5U 3Q76A 1C5QA 1TRMA 3OX7U 3M35A 4I8KA 1WUNH 3MNXA 1ZRBA 2BX3A 4DY7B 3OSYA 3PO1B 3M7QA 3PROA 1MTNB 2O8WA 1QR3E 2Z94A 1O2QA 1GBIA 2WV4A 2W26A 3UWJH 1GMHF 1V2ST 1O2UA 1W0ZU 1BCUH 3ATLA 1MMJN 1NFUA 3A86A 3CS0A 1YM0A 2ANYA 1SLWB 3UNQA 1F0RA 1QIXB 1EZQA 1YYY1 1HAHH 3SJOA 1MKWH 1GVZA 1AHTH 4R8TB 2Z3EA 1C5YB 4IGDA 5K0HA 1GI8B 2BXUH 3GY7A 4GSOA 3SJIA 3SN8A 4ISHH 2CMYA 2FEQH 2NU0E 3IITA 1FMGA 5F8ZA 3K6YA 4FU7A 1W7GH 1PJPA 4E06H 4Y76A 1XX9A 4GAWA 1O3JA 1SLUB 2F91A 2VJ1A 1C1WH 5L2YH 5J4QA 1K1JA 4LZ4B 3ITIA 2TBSA 2ZHDA 1NY22 2ZGBH 4UE7H 1HLTH 2J95A 3B9FH 1UCYE 1Z1IA 2O8UA 1BIOA 5HXFA 1TPSA 4X2VA 2B8OH 2HVXA 1LPGB 1PPCE 1NFXA 1TGNA 1BTWA 2BB4A 3OYPA 3LGVA 4ZHAA 2G4TA 2D1JA 1C5MD 2NU3E 4ZXXH 3TPIZ 2XBWA 1A7SA 4I8GA 2A4RA 2BDGA 4FUEA 6ESTA 4J2YB 1TOMH 4AGKA 1P11E 4UD9H 3U9AH 3LPRA 1WQVH 4D7GA 4CRGA 1V2RT 4ZAEA 4CH2B 2J4IA 2WINI 1BRAA 2FPZA 2GZ8A 1U6QA 5ESTE 5GPIB 3QX5H 4WJG2 5EXNA 1QTFA 4FUDA 2P8OB 1V3XA 5E2PA 5HM2A 5JBCS 5K7RA 1SB1H 1D3DB 2FYQA 3UWIA 4BAMB 3UFAA 1A46H 3R0FA 1N8OC 2OINA 3PMAB 1CVWH 3S9CA 1WAYB 3HKIB 1EQ9A 1YC0A 2BVSH 4BNRA 4HTCH 2BDCA 2WYGA 2ZNKH 3LGIA 4E7RG 1TRYA 3F9HA 1GI3A 1TNLA 3BIVH 6CHAC 1TBRH 1QBVH 4YTAA 2AS9A 3E1XB 2FOGA 3KL6A 2FTLE 1CT0E 4FU8A 1OWKA 5JBAS 2BD2A 2ZFQH 1QL7A 2QN5T 3V3MA 1O3PB 3T2NA 5HYOA 1CA0C 1F5RA 3HGPA 1H1BA 5AHGH 1KLJH 2VVVA 1IQNA 3U69H 5FPSA 4OS4A 1G30B 1BRBE 3MYWA 3SGBE 5EQRA 3TITA 2F9PA 2G52A 2FLRH 1ELEE 3SNDA 4CHAC 3UNRA 4JYTA 1GI4A 3QK1A 2GMTC 1MTWA 1TYNA 1AIXH 1O3HA 5SGAE 1SQTA 3QLPH 1T32A 3GYLB 3RXJA 3QGNB 3ATMA 1IHTH 4Z0KA 3SV7A 4IW4E 1L1GA 1SLXB 3SGQE 2ZA5A 3DUXH 3RU4E 5EQQA 2PKSC 5GIBA 4KP0A 1O5FH 2ZGHA 1AWHB 3N7OA 1TB6H 3SUFA 4UEHH 2FS8A 5DKMA 2Z6BD 1EOJA 2BTCE 2H9EH 1VITH 4H6TA 1NPMA 1ANEA 3UR9A 3V7TA 4Q7YA 2O8TA 1HPGA 1S84A 4DT7B 2GT8A 1GBHA 1XXFA 2ZC9H 1D9IA 2CN0H 1GL1A 3LKWA 3GOVB 4XBCA 1QRZA 1TRNA 2F9OA 5HGGA 4UONA 1Z8IB 1C2FA 1GJ5H 1GJCB 4WH8A 1P2NA 3EGKH 4K1EA 4WXIA 1ABJH 2P3UB 1BT7A 2QY0B 1GDUA 5AFYH 1DWCH 2ODQA 1F0TA 3UNSA 4BTTB 2PW8H 4BXSA 4ABJA 5GJ4B 3BTKE 5FX6A 5A0AE 1HUTH 1BQYA 3T26A 1UTLM 4MNWA 1DXPA 2ANMH 2V6NA 1W13U 1DSUA 1GBFA 3A84A 2ASUB 2FP7B 1ANBA 1OX1A 1GBEA 4K3JA 1ANDA 3M5LA 1OS8A 4ZKOU 2PLXA 4XBBA 1K21H 1OWIA 4WWYA 4IN2A 1P0SH 3TLOA 4E7NA 3GDVA 4ABIA 1LDTT 4DIHH 1IQLA 4Y8ZA 4IBLH 2Y7XA 2DE8A 3VB5A 4YESB 2M5TA 1ELDE 4K69A 4B2AA 5TJXA 1T8MA 3SV2H 1RTLA 1W14U 2GDEH 2H5DA 2LNCA 1VGCC 2Y80A 3BTEE 1F92A 1V2QT 2ZU5A 1GL0E 1JRTA 4YT7H 1C5LH 2GVFA 1BHXB 5FCRA 1TWXB 1D3TB 2GCTB 3GY8A 3Q3XA 5H4IB 1LPZB 3SBKA 3SU4A 1O39A 2VIVA 1G2MA 4XSKU 3MOCA 1DFPA 4U2WA 2H9TH 1PQ7A 4UFFH 2R3UA 1GHBF 2P93A 1D3PB 2Y5GA 1KYNA 3H7OA 2QAAA 3BTDE 3QZRA 4JZEH 1UVPA 3EQ0H 1YCPK 5CMXH 3E6PH 1TPAE 2A31A 1RFNA 4M7GA 2ZECA 2GZ9A 3GY3A 1SVPA 3ZZ6A 8GCHG 3C1KA 2FX6A 2PKAB 4Y11E 4FUBA 1UTOA 1V2LT 2SGAA 2XWBI 3AAVA 5DP6A 1VITF 2UUFB 3LU9B 4B76A 1O3OA 1QA0A 1UHBB 1OP2A 2ZFTA 4MG3A 4F49A 1ELAA 1CA8B 1SGNE 1AUJA 4JZDH 2ZU4A 1ANCA 1F0SA 4Q2KA 3JZ2B 8KME2 3U8OH 1P2KA 1GG6C 1MQ5A 4ISOA 1RS0A 1OYQA 7GCHG 4O97A 2UWOA 1A5HA 2C93B 1NTPA 1OXGA 1HAZB 4TPYA 2VIPA 5DJ7A 1FXYA 1C1UH 1OWDA 3IG6B 3S9BA 5CHAC 3A8AA 1P10A 1DX5M 1GI9B 1O38A 1XUKA 2GP9B 3PYHA 2CGAA 2GTBA 4GVUA 1NM6A 4ISLA 1EJAA 5C1UA 2XXLA 2XWAA 3T27A 3GY2A 3NZIA 4B2CA 1AN1E 1ZHPA 1VCQA 1G3CA 1O33A 4FUHA 5EG4A 1TNIA 1T4VH 1EXFA 4I32A 1HAGE 3TJOA 5IYTA 5LGOA 1GBDA 1OPHB 3RMNH 3S7KB 1CT4E 1C9PA 1MQ6A 1NO9H 4AFUA 1OOKB 1O3EA 3SQHE 4ABEA 1QNJA 1TGSZ 2FOAA 3P70B 5LPEA 4DJZB 1CGHA 5BPEA 1TPPA 1ZMLA 5FHTA 2A5KA 2OQ5A 1BJVA 4UDWH 4YT6H 5A0CA 1JIMA 2BM2A 4VGCC 3M5NA 4XOJA 1FQ3A 2BD4A 4FVBA 2WPKS 3RMOH 2BMGB 5T3HA 4NA7A 1TX8A 2BDYA 1UO6A 1VJ9U 2Z7FE 3AASA 5EW1H 1OP8A 1C5SA 1O2NA 1OSSA 1DT2A 2VWLA 1ZTJA 1FY1A 1CGJE 2GV6A 4QT8C 2Z9JA 2ZDKA 2ZQ1A 1C2LA 4O3UA 3ODDA 5E0GA 1AKSB 2J92A 1EKBB 5EW2H 1T4UH 4MDSA 2AMQA 1BDAA 1C1MA 1C2JA 3Q77A 1K1LA 1P02A 4F4OC 1HAYB 1MAYA 4DOQA 1QY6A 3TGJE 1KDQA 4FUFA 3RXTA 1MZDA 2BXTH 1MBQA 2BY7X 4WH6A 5JDUB 1V6DA 1AE5A 1DDJA 2B9LA 3M5OA 2XC5A 3DT0H 2PR3A 5AF9H 3AW0A 2TGAA 3EA7A 2A2XH 2UWPA 1Y8TA 3A82A 3SOSA 3K9XB 3TVJB 3H7TA 1TX6A 3BTWE 1P09A 4ZUHA 2OQUA 4DVAU 1HAOH 1C1VH 3A88A 3SI3H 4NA9H 2ZTZA 1ZRKA 2UUJB 1K1NA 1P8VC 2BZAA 4MNVA 2HLCA 2XBYA 3ZZBA 1Z8GA 4GHQA 3FZZA 5FPYA 1IAUA 1RIWC 2NU1E 5FXLA 1EZXC 1HB0B 4SGAE 5A0BA 3F9GA 1IQJA 2HWLB 1H8IH 1WSSH 2A1DB 1IQFA 1C2IA 1W0YH 3KNXA 3WY8A 6GCHG 1DS2E 1Z71A 5AFZH 1L2EA 2PFEA 3PMBB 4U32A 3BEUA 1TLDA 3M36A 1ESTA 1HAXB 1CGIE 2F9VA 2Q6FA 1ESAA 2R9PA 2VGCC 3UOUA 1QL8A 1E34B 1WCZA 2HNTE 5EU8A 4ABAA 1OYTH 1KIGH 3PB1E 1O2KA 4Y7AA 1PYTC 2GDDA 4A7IB 1O2VA 1S5SA 2ZTYA 1EATA 1DUAA 2C8WB 1O3FA 3I29A 2CF8H 3A8DA 1IOEA 4D7FA 1SG8B 3F1SB 3LC5A 2Z9GA 1YPHC 1O2GH 4O3TA 3A8BA 2FIRH 3K6ZA 1O3IA 3RLWH 1HAIH 3UQVA 1F7ZA 3CP7A 2Y81A 3P8OA 5C2ZA 2ZWLH 1QQUA 2QXGA 3KCGH 1MU8B 3SJ8A 5I25A 1H8DH 1AB9B 2LPRA 2XTTB 1J15A 1P3CA 3ATKA 1PPFE 1C1SA 4X2WA 3RDZA 2A4QA 1JIRA 1FY3A 2BVRH 3SU0A 1YCPH 4AG1A 3S7HB 3SU3A 3FP8E 1AFEH 5EODA 4IMQA 1SFIA 4I8HA 1YPEH 4TWYA 4XE4A 1A3EH 1GBAA 1XKBC 1SGFA 1P03A 4OS2A 2J34A 1C2GA 1FIZA 2NU2E 2A32A 2RDLA 1HCGA 3URDA 1J9CH 1CA0B 1DY8A 1V2WT 2XYAA 1GBLA 4BTIB 3PM3A 2R0LA 1SGIB 3ZZ8A 1D3QB 2QCYA 2AH4X 4ZH8A 1THRH 3A81A 1HV7A 1TX7A 1DANH 2HALA 4H4FA 1ZGIA 2C8XB 3F68H 3ZVBA 4CHAB 1SLVB 3FFGA 5EQSA 1UVSH 2WUBA 4LZ1H 2OP9A 2RA0A 2Q1JA 1UK3A 4TYDA 3TGKE 2AGEX 2PUQH 1SOZA 4OGXA 2FYRA 2ZDAH 2ZEBA 3TK6A 3U8TH 4JK6A 2DE9A 2PHBA 4KKDA 4A1VA 2SGPE 3FP7E 1AGJA 2PKSB 4Y71A 5JBTA 3VXEH 5T6DA 1UMAH 4H42U 4NWKA 1EPTC 2ZFRH 1QBNA 4MPWA 1BMAA 1TALA 3KQBA 2A7HA 1CO7E 1S6FA 4PROA 3RC6A 5JPMH 2W3KA 1J17T 1KXBA 2ZDVH 1MD7A 1NFWA 1Y5UT 1GMHG 4SGBE 1QGFA 2ZU2A 1BUIA 4GLYA 3SORA 1NRPH 3T25A 1HDTH 1ELTA 3AW1A 3DFJA 3E90B 3GICB 4D9QA 1UCYK 2I6QA 2Y6TA 1W10U 1HIAA 3GCTG 4RN6A 1HAVB 1TA6A 1RD3B 3TH2H 2V3HH 2HGTH 1ZOMA 1LPKB 5E8EH 1RRKA 2BY8X 2BD7A 1MTUA 2OXSA 2R0KA 1UTMA 1TFXA 1GJ6A 4RKJB 1O5CB 4Y0ZE 1DY9A 2Z9IA 3AVZA 4WVPE 1GGDB 1F0UA 1C4Y2 3P92A 3LH1A 5G4BA 3O8DA 5DPAA 1O3MA 2R2WU 1MBMA 1O2PA 1LHFH 3SNEA 4OS5A 4NIWA 3BG4C 2QV1A 3A7XA 1BBRK 1WQSA 5IDKA 1TGTA 1V2JT 1O35A 1O5DH 4O9VA 1Q31A 3RXAA 1VZQH 5HM9A 2QF3A 5EGMA 2FXRA 2PTCE 4K5ZA 1UTJA 2FI3E 4R0IA 4NZQA 4YOGA 1ETSH 1HNEE 1B5GH 3ZZDA 3V13A 1BRCE 2CHAC 2AEIH 1GHWH 1VGCB 1V2MT 2W7UA 1O5AB 1AMHA 1ID5H 1C2HA 3HPTB 4GCHG 2XNIA 4ABHA 2PGBB 1Y3YA 4NFFA 1N6XA 2EC9H 3TIUA 2G8TA 1T8OA 1S81A 1DVAH 2ODPA 2ZPRA 4AORA 3M5MA 3GCHC 5A09A 1A1RA 1BZXE 3D23A 4JYVH 3SV9A 1LQDB 3GDUA 1SGTA 1ELFA 3BG8A 4AZ2B 5EPYA 1Z6EA 1W11U 2ZO3H 1O2HA 2KAIB 3ODFA 1WU1A 2O8MA 3DD2H 1SFQB 1PQ8A 3QWCH 5GXPA 1GVLA 5C3NA 2VINA 2V3OH 2GD4B 4CRDA 4AOQA 2XCNA 5F03A 3ZYEA 1ELGA 2FTMA 2BHGA 2A5IA 3VGCC 5T6FA 1HAPH 4KTSA 1EX3A 1QJ1B 1SGPE 5T6GA 4FU9A 1G37A 1WV7H 4K2YA 1FN6A 3GDSA 5GDSH 1O5EH 2VVCA 4NGAH 1CBWC 4OGYA 2AMPA 1CHOF 4DCDA 1EUFA 5E2OA 2ZPQA 1KTTB 1GCTC 4ZHMU 4CRCA 3DA9B 1GJBB 1V2UT 2XBVA 2WPIS 3SV6A 2BQWB 5CHAB 3M7TA 2FO9A 4BANB 5JB8S 2O9QA 1P04A 2NWNA 1C5ZB 1OKXA 1AZZA 3MI4A 3ZYDA 3PWBA 2D2DA 3IWMA 4ESTE 3LONA 1J8AA 5PTPA 1XUIA 1NRRH 3STIA 1PPGE 3DHKH 1A4WH 2ANWA 1LVMA 1GBMA 2ZP0H 4CRFA 4B2BA 1LHCH 3BTME 3P6ZB 2Y7ZA 4ISNA 3SU1A 1FAXA 1C5TA 1QJ7B 2P3FH 3ATIA 4FXGH 2ZCHP 4K1SA 4ZROA 5TCCA 4WMDA 3CENA 4B1TA 1KSNA 3LGYA 3MU8A 3SNBA 1PYTD 2Z3CA 2VU8E 5GWZA 2FOEA 3HGNA 4KTUA 4BAKB 3OU0A 1O37A 1SBWA
chains in the Genus database with same CATH superfamily
3OE7D 2C8YB 1EPTA 1P9SA 3SZNA 1SGYE 2BLQA 1QFKH 3SU5A 1P57B 2G55A 1UJ1A 2BY5X 4FOUC 3PWCA 3KIDU 1YPKH 3KEEA 4X2YA 1UTPA 2XC4A 3AK5A 4AGJA 1C1OA 4MQAA 1A3BH 3LGTA 3KHVA 4RSPA 3U1JB 4NWLA 2JH6D 1ZJDA 1EZSC 6LPRA 1FZZA 3EA8A 3GISB 1VCWA 1TGBA 1MKXK 2ZHWH 3MFJA 1MCVA 2FX4A 2FOBA 3SU2A 1ZR0A 3VB3A 4Y10E 2C4FH 1BMNH 1S85A 3PV2A 2ALVA 3ENSB 3MU5A 3T62A 1LVOA 1YF4A 5F6MA 1O2IA 3TJVA 1ZPBA 4TPIZ 1NU9A 2BQ7B 1ZTKA 2STBE 3LDXH 2PP6A 2SFAA 1QA7A 1JRSA 1UCYH 4BXWA 5DP3A 2B0FA 1THPB 1J14A 1LMWB 1D6WA 2ULLA 4JZIA 1LHGH 3AAUA 1BTYA 2WPHS 1XUHA 1P2JA 3W94A 1NU7B 1AE8H 2P8OC 4THNH 1IQHA 1GBKA 2OD3B 1XKAC 2XRCA 1TGCA 2QXHA 1O32A 2ANKH 2VIDA 3ATWA 1NRSH 2NU4E 3ESTA 5E0HA 2VWNA 1RIWB 1O2XA 4FVDA 3QDZB 1AVXA 1SGCA 4JMYA 1YY3A 2EA3A 8GCHF 1BBRH 2BOHB 3GYMA 3UTUH 2G81E 1HXEH 3MTYA 1W3CA 3TGIE 2A7CA 2XC0A 4HG6A 1O2SA 1IQEA 1O3DA 3SHCH 1XVOA 1YPHE 1MCTA 1C1PA 4CBNA 2Q6DA 5LH8A 1O2RA 1GI6A 5EXMA 4X6MA 1PFXC 2ZDLA 5L2ZH 1FI8A 3OY6U 2OC7A 1P06A 5C5OA 4AB9A 1NBMD 1A61H 1VITG 1TABE 5CDFE 4Y8XA 4OS1A 3KYGA 7GCHF 3F2HA 1GMCG 2QXJA 3RMOH 4ABDA 5C1XA 2AHME 2BVXH 5C20A 4YO9A 4Z6AH 3KQDA 3E8LA 1D4PB 2ZKSA 2Y5FA 1C9TA 1GMDF 2BDIA 1WDIA 2F3CE 1O2MA 1XUJA 1PPBH 2XOKD 3RC5A 1A0HB 3MH6A 3SGAE 1SQRA 2OLGA 3I78A 1ZMNA 2SGDE 2ZU1A 2A5AA 1V2TT 1C2MA 2UWLA 2F9NA 3M3VA 4AFSA 1AVGH 1NROH 2Z9LA 1CHGA 3QN7A 3T28A 2FZZA 2QYIA 3OFND 1EP6A 1SQAA 1Y59T 2ILNA 2WPJS 4B6FA 1QQ4A 3E3TA 2OUAA 1JBUH 2WSSD 2JKHA 2ZFPH 1UTKA 1MABB 1GI1A 4X0WU 5FX5A 2JETC 2CV3A 2VVUA 1ZSLA 3RXQA 1A2CH 3TH3H 1IQIA 1AO5A 4J1YA 3S69A 5DGJA 1NRNH 5FPTA 1BMFD 1GBJA 3RXSA 3F0OA 3G01A 1SI5H 9ESTA 4AN7A 5FBIA 4ISIH 1L1JA 1ZTLA 2PTNA 4ZMAH 3TJNA 2JH5D 3VEQB 3ZZAA 2I6SA 4INKA 4MTBA 4CRAA 1EOLA 3QUMP 1HFDA 4MLFB 1DITH 1ETRH 4NA8A 1NBME 4A5TS 5A8ZA 3MH4A 2K1QA 2ZFFH 2OBQA 1FV9A 4WMEA 5T1VA 4DW2U 2BLOA 1FDPA 1SHHB 3LGWA 2ZGXH 2L6OA 4NIXA 4X6PA 1PQAA 1AZ8A 1ARCA 2AIPA 2FDAA 4JZFH 3RXEA 3F9FA 1O34A 3U98H 1YLDA 1ZLRA 2ZCLP 4MNYA 5L30H 3LT3A 1C2KA 1S6HA 2C3SA 3BTTE 2PUXB 3ZV8A 4A92A 1MTVA 4XD7D 4Y7BA 1C2EA 1FJSA 1GI2A 2ZCKP 3D49H 3E0NB 4NSVA 1E37B 4YOIA 1TPOA 3U28C 3LH3A 2AERH 4GHTA 1O0DH 2D8WA 4X6OA 1K22H 1DWBH 4WF8A 2FS9A 3ZVFA 1O3LA 1GI5A 4IC5A 3A7YA 1C5RA 1TNGA 1G36A 1SGEE 3ZV9A 1XUGA 2ZHFH 5I46H 1QB9A 5BRRE 4IMZA 4KGAA 1EB2A 1E1QD 2OC1A 1O36A 1XVMA 1LVYA 3EDXB 4NIYA 2BDAA 1DWDH 2J94A 3BG4B 1BITA 5DP9A 1ZSJA 2VH6A 4XFQA 3GY4A 2P95A 1XM1A 4HGCA 4D9RA 1S0QA 1LKBA 4JYUH 1C5UA 2A0QB 1C5WB 4CBOA 1K28D 1KY9A 2CXVA 3RXDA 2G00A 1O31A 2GCHF 3EE0B 2VWMA 4K8YA 5A8YA 1S82A 3MNCA 3MO6A 1B7XB 3MNSA 1G3EA 4AC9A 4O03A 3LJOA 2CHAB 3HK6B 2A4GA 1K1PA 1DSTA 4WY3A 4X1NU 3MNBA 3DSPA 4MVNA 1KXDA 3RLYH 1DOJA 1YCPM 5LPFA 3A7VA 1N8OB 4OS7A 4K8BA 3UUZA 1OWEA 3UPEA 3BF6H 1V2OT 1W2KH 5AVDA 1FY4A 5DSFA 1Y3XA 1SPJA 6CHAB 4NSYA 4Y8YA 1LCYA 1BRUP 2FWWA 4X1QU 1MAXA 3VB6A 1T8NA 1KXAA 1G9IE 2EEKA 3W95A 1ZGVA 2H6MA 2AGIX 1W12U 3M3SA 3RXGA 1PPHE 1V2VT 2G5VA 3LC3A 1O2TA 2LELA 4M9FA 4KELA 1TOCB 5GCHF 2FLBH 2ZGCA 4X2XA 2EI8A 3BEIB 4A1TA 3SJKA 4MPUA 4IS5A 1AUTC 1O3KA 5ETXA 5F8TA 4RT0A 2SNVA 1GHAG 1CE5A 1UVUH 1AFQC 1O2ZA 4D76A 4DGJA 2P3TB 4X8VH 1YBWA 3BSQA 3GCOA 1GJ9B 2ZQ2A 2GMTB 2FM2A 4Q80A 1VR1H 1E36B 1BTXA 1CBWB 1HRTH 1P2OA 1DPOA 4NZLA 3RXCA 1AQ7A 3TU7H 3E0PB 1PPZA 3BN9A 3TK5A 1O5BB 1EASA 4MPVA 2BLWA 3UR6A 2RFKC 3MU1A 3BTHE 1SQOA 2ZPSA 3M61U 4Z1MD 2AMDA 2IOTA 3ZZ9A 4HFPB 5C0UA 1B0FA 1GJ4H 1TBZH 4Q7XA 2Q6GA 4H6SB 3MO9A 1SR5C 5DK1A 1WYKA 2G51A 1HJ8A 4ZKSU 5EPNA 3A7ZA 2R3YA 2W7SA 3TK9A 2BOKA 4E05H 2GGVB 1NS3A 1FAKH 1P2QA 4IN1A 1HJAC 1RXPA 3LJJA 3MMGA 4ACBA 3PTNA 3GCTF 1QB6A 1C2DA 1LTOA 1EJNA 1C4V2 5IK2D 2QA9E 1DM4B 2TGPZ 8LPRA 2WPMS 1KDQB 3P8GA 2ZU3A 1EZUC 1P01A 1QJ6B 1Y3UA 2Y5HA 1Z8JB 4TY7A 2TIOA 4XBDA 3RXKA 3UQOA 4B71A 4YOJA 3RMLH 2K0QA 5A8XA 3A7TA 4YZUA 1TQ0B 1INCA 1IQGA 4UFGH 5FL7D 1BOQA 1OP0A 2KCPA 1BTPA 2J2UA 1MD8A 4GPGA 1JWTA 2TGTA 5KEDA 2FOCA 2THFB 3PLPA 1MH0A 5JYIA 3ZVEA 3F3BA 3RXFA 2G5NA 1TMTH 2UUKB 2AIQA 1J16A 1YPGH 3QTOH 1O3BA 4YXWD 5GNDA 2BD5A 1CSOE 1G32B 1QURH 1OWHA 3STJA 7LPRA 1YGCH 2EI7A 1GJ7B 2CF9H 1FY5A 1N6YA 2OC0A 1O2YA 5DP5A 2V3MA 1P3EA 2W6ID 3P8NA 4I8LA 5TCAA 2FI5E 3S0NA 1XXDA 3EA9A 4GCHF 2DUCA 1O30A 3O8RA 2P16A 4HZHA 3M7UA 3RU4D 1C5VA 3K65B 4NIVA 1ZHRA 1DE7H 1SGRE 3RM2H 3E16B 7ESTE 2UUYA 4LOYH 3A89A 5F8XA 2AGGX 3BTGE 2F83A 1QRWA 3DCLA 1QBOA 2PSYA 3BTFE 2YOLA 2EQNA 1M9UA 2A7JA 1YPLH 2OTVA 1BBRE 1BJUA 1YP9A 2GT7A 3RXIA 3QTVH 2GKVE 1L0ZA 1FIWA 3RXVA 2HNTC 1JXPA 4K60A 2PKAA 1VJAU 1XUFA 1AD8H 1C5NH 3M37A 4WMFA 1AB9C 1DICA 1D6RA 5B6OA 2W5EA 4CH8B 1EJMA 1ORFA 1UHBA 3F2FA 3U8RH 1FY8E 1WTHD 2H2ZA 2VIWA 1RTKA 3HKJB 1NT1A 4CREA 2C90B 2SGQE 3ZVCA 2WPDD 3V0XA 3D65E 1NZQH 3SJ9A 1V2PT 5CE1A 2BYAX 4AYVB 1VCPA 4JCNA 4MNXA 5FBEA 1E35B 3A7WA 1ETTH 1KMHB 1EAWA 2VB0A 2BD3A 4U01A 3EAJA 3KN2A 5EIYA 2WUCA 1GI7B 2HPPH 2XNDD 1O3CA 1UVTH 1GG6B 2ZG0H 4X8SH 1QCPA 1HYLA 2PGQB 2QIQA 1LHEH 3P95A 3SO3A 1T8LA 3MQKC 1K0HA 3MWIU 1FN8A 1RTFB 3Q3KA 1FPHH 3ZZ5A 2AYWA 1LVBA 5JBBS 1NESE 3M3TA 4YLQH 3GY5A 1ZZZA 3PLBA 2FOFA 1H4WA 1PPEE 2XW9A 4X1RU 2B5TB 3NCLA 2BDHA 3BIUH 4AFZA 4BAOB 4JK5A 1GHVH 3GCNA 2WV5A 1S0RA 3PO1C 1DLEA 2A4OA 1MTNC 1QB1A 1ABIH 3Q00A 1CHOG 2FMJA 5FCKA 1P05A 2F9UA 1UTNA 5A2MH 2V0BA 4DIIH 1UK4A 1CU1A 3I77A 3H09A 1LQEA 2FOMB 2ZIQH 1RGQA 2FOHA 1YLCA 1TMBH 2BX4A 4ABBA 7KMEH 1C5XB 4NCYA 2ZZUH 3TJUA 1TNHA 3KQEA 5DP7A 3KF2A 2GZ7A 3EYDA 3L3TA 3PMJA 1FONA 4X1SU 3HK3B 1GDNA 3NK8A 3NUMA 1GCDA 4FUJA 1E38B 4P02A 1SMFE 2JETB 3QZQA 1L1NA 1TONA 2J98A 1IQMA 2KCOA 2VH0A 3B23B 4WXVA 1AI8H 3ZVGA 5DO4H 1EAXA 4B74A 4VGCB 2VNTA 3SHAH 1Z8RA 3PRBA 2STAE 1HIAB 1AKSA 3CS7A 3D62A 1WBGB 3S9AA 2BZ6H 1GGDC 5ESBA 1L4ZA 3F9EA 3V12A 2A2QH 2HNTF 2ODYB 3UREA 4YM9A 1K2I1 2OBOA 1O3GA 1KXCA 2BY6X 2QF4A 2QXIA 3A87A 3FAOA 2O8LA 3ZVAA 2RG3A 2TRMA 3URCA 1K1IA 2BQ6B 1ZSKA 5J4SA 1GBTA 1BMLA 1KLTA 1TNJA 2C8ZB 1DLKB 3UIRA 3PV4A 1EB1H 1Y3VA 3VB4A 1GVKB 4UFDH 2TGDA 1O2OA 2WYJA 2SGEE 4I86A 1A5IA 2IJOB 4A6LA 3ZZ7A 5C1YA 1JMOH 1ZJKA 1BTZA 1KLIH 1ELBA 5E0JA 1KXFA 3T5FH 1YLNA 3BTQE 2FI4E 1P2IA 2J38A 2RA3A 4ABFA 4CR9A 1C1QA 4I31A 4XDEA 4KTCA 2BD9A 3NKKA 3VFEA 1TMUH 4AX9H 1WOFA 1GJAB 3L33A 3U1IB 1BTHH 3B8JA 2F43B 1A0JA 1Y5BT 1PQ5A 2EI6A 2F9BH 1HXFH 1BMMH 2Z3DA 4YLUA 1XMNB 3ELAH 2ZDMA 4IC6A 1QHRB 2BY9X 2EY4C 2ZFSA 3MU0A 1P12E 1EAUA 4ZXYH 5LPRA 1GHBG 3NPSA 1ACBE 1UVOA 1GDQA 2YMSC 3NWUA 2H1UA 1AVWA 1O2LA 4BOHA 2HRVA 1GJDB 2ZHEH 3SNAA 1SHYA 1SL3A 2BLVA 3K2UA 3UY9A 2VGCB 4OM9A 4X1PU 3NXPA 2VWOA 3SQEE 1Q2WA 1NN6A 1SGDE 3TNTA 1BA8B 1O3NA 4K1TA 4FUGA 3RXPA 1ZHMA 4BTUB 9LPRA 3KGPA 3RXHA 1K9OE 3H5CB 1GHZA 1GMCF 3MU4A 2KX4A 3ZZCA 1O2WA 3RXOA 4AG2A 2V35A 5C94A 3BV9B 3FN8A 2ALPA 1C5PA 1AU8A 1KTSB 1A5GH 1H8HD 1EAIA 3ZZ3A 3RUOA 1MUEB 4RT1A 2WPLS 5EJ1A 5JB9S 2J9NA 1A0LA 1JOUB 2ZDNA 2A45B 3SNCA 2Z9KA 1LKAA 4CRBA 1DWEH 2ZI2H 1GMDG 1FPCH 4D8NA 2R2MB 2QC2A 3VPKA 1O3AA 5C5NA 1V2KT 3FVFB 4NG9H 1AWFH 1MKWK 2BDBA 2V7QD 1P2MA 1F5KU 1X7AC 1F5LA 1Z6JH 4BAQB 2ZTXA 2XCFA 3BEFB 1SOTA 5L6NH 1TQ7B 1AFQB 3L6PA 4B75A 1BB0B 5EOKA 4CR5A 2FODA 1HBTH 1BTUA 1MZAA 1YPMH 4F55A 4Y79A 3TNSA 3C27B 3O8CA 1CT2E 4FUIA 3A83A 1LHDH 2HOBA 4Y0YE 5DP8A 2P94A 1QL9A 3GY6A 4LXBH 4JZ1A 2IN2A 2G4UA 1UK2A 2OC8A 3ZZ4A 1S83A 2BD8A 1ARBA 1MU6B 1W8BH 2AFQB 3F2GA 2ZHQH 1EPTB 4ZKRU 1ELCA 2RCEA 1V2NT 1DXWA 3RM0H 1YKTA 3JZ1B 3RXMA 3SUGA 3LGUA 1GHXH 1T7CA 4X8UH 1G3DA 1HAVA 4LK4A 2SNWA 3QO6A 3MHWU 1C1NA 4I8JA 4ABGA 4BAHB 1HJAB 4AYYB 3E91A 1W7XH 4AFQA 1FLEE 2HVYB 2IPHA 2H5CA 4I7YH 1H9LB 3Q3YA 1GBBA 4I33A 3RU4T 2QF0A 4ZKNU 1GBCA 3PLKA 3OTJE 1RJXB 3F6UH 1FX0B 1EP5A 3T29A 3RXLA 3HATH 4X8TH 2GCTC 8ESTE 3VB7A 2W3IA 1E0FD 1C4U2 2B7DH 5HMAA 1SGQE 3PMHB 4TY6A 3LIWA 1SGFG 1TNKA 3SV8A 1C1TA 5HKKD 4OS6A 1K1MA 1P9UA 1WTGH 2D26C 3A85A 3RMMH 1NRQH 6GCHF 4RKOB 4A1XA 1THSH 3SI4H 1GJ8B 2P59A 1NC6A 1GWAA 3FP6E 1MKXH 1Q3XA 1UTQA 1ZYOA 3ZVDA 2CJIA 1G3BA 3RP2A 1SSXA 1G2LA 2YNAA 1TBQH 2ZGJA 3FANA 1O2JA 2VIOA 4NFEA 1N1LA 1C5OH 1IQKA 1QRXA 1NFYA 1TAWA 3O8BA 3P17H 2PWXA 4FUCA 1OWJA 4MPXA 3UOPA 1ZPCA 5EXLA 2ZF0H 2F4LA 4Y6DA 5C67A 4HI3A 2GCHG 2Y82A 4Q7ZA 4UFEH 2PV9B 3A8CA 3A80A 4F48B 1HJ9A 1ELVA 3SU6A 2VIQA 4B73A 1AY6H 5FAHA 1ZMJA 3GCHB 3WWFA 2XBXA 4GUXA 3RC4A 1GHYH 1MTSA 4FETA 2KAIA 4ASHA 1L4DA 5DP4A 2OCVB 1Z1JA 3FOAA 1Y3WA 4X6NA 2GX4A 1F2SE 1IHSH 1Y5AT 1TE0A 1FNIA 3DSGA 3RXBA 5ABWA 4U30A 1Z7KA 1K1OA 1SC8U 2YNBA 3LOXA 3VG8A 4DG4A 1KXEA 2FESH 2TPIZ 1H9IE 3MH5A 3SUDA 2H9HA 1T31A 1DUEA 3TH4H 2JH0D 4TWWA 1YPJH 3FZDA 1LO6A 1ZPZA 1C1RA 2GV7A 1CQQA 1FUJA 4DURA 3KQCA 4DT4A 1TIOA 3SW2B 3SUEA 3VGCB 3MO3A 1GHAF 1GI0A 4AB8A 1ESBA 3PTBA 1HGTH 5DN6D 1GPZA 4INHA 5GCHG 2GJGA 1O5GH 1H9HE 3VXFH 1BHXF 1B0EA 4INLA 3RXUA 1TA2A 2HPQH 5DG6A 3P8FA 2JJ1D 2ESTE 2QGRA 3DFLA 4ZHLU 3MH7A 3QGJA 3R3GB 2SGFE 3RXRA 2PSXA 1GCTB 2WZQA 3OY5U 3Q76A 1C5QA 1TRMA 3OX7U 3M35A 4I8KA 1WUNH 3MNXA 1ZRBA 2BX3A 4DY7B 3OSYA 3PO1B 3M7QA 3PROA 1MTNB 2O8WA 1QR3E 2Z94A 1O2QA 1GBIA 2WV4A 2W26A 3UWJH 2YMSD 1GMHF 1V2ST 1O2UA 1W0ZU 1BCUH 3ATLA 1MMJN 1NFUA 3A86A 3CS0A 3OAAD 1YM0A 2ANYA 1SLWB 3UNQA 1F0RA 1QIXB 1EZQA 1YYY1 1HAHH 3SJOA 1MKWH 1GVZA 1AHTH 4R8TB 2Z3EA 5F53A 1C5YB 4IGDA 5K0HA 1GI8B 2BXUH 3GY7A 4GSOA 2QF5A 3SJIA 3SN8A 4ISHH 2CMYA 2FEQH 2NU0E 1W0KD 3IITA 1FMGA 5F8ZA 3K6YA 4FU7A 1W7GH 1PJPA 4E06H 4Y76A 1XX9A 4GAWA 2HLDD 1O3JA 1SLUB 2F91A 2VJ1A 1C1WH 5L2YH 5J4QA 1K1JA 4LZ4B 3ITIA 2TBSA 2ZHDA 1NY22 2ZGBH 4UE7H 1HLTH 2J95A 2M2AA 3B9FH 1UCYE 1Z1IA 2O8UA 1BIOA 5HXFA 1TPSA 4X2VA 2B8OH 2HVXA 1LPGB 1PPCE 1NFXA 1S6LA 1TGNA 1BTWA 2BB4A 3OYPA 3LGVA 4ZHAA 2G4TA 2D1JA 1C5MD 2NU3E 4ZXXH 3TPIZ 2XBWA 1A7SA 4I8GA 2A4RA 2BDGA 4FUEA 6ESTA 4J2YB 1TOMH 4AGKA 1P11E 4UD9H 3U9AH 3LPRA 1WQVH 4D7GA 4CRGA 1V2RT 4ZAEA 4CH2B 2J4IA 2WINI 1BRAA 2FPZA 2GZ8A 1U6QA 5ESTE 5GPIB 3QX5H 4WJG2 3WW7A 5EXNA 1QTFA 4FUDA 2P8OB 1V3XA 5E2PA 5HM2A 5JBCS 5K7RA 1SB1H 1D3DB 2FYQA 3UWIA 4BAMB 3UFAA 1A46H 3R0FA 1N8OC 2OINA 3PMAB 1CVWH 3S9CA 1WAYB 3HKIB 1EQ9A 1YC0A 2BVSH 4B6EA 4BNRA 4HTCH 2BDCA 2IJD1 2WYGA 2ZNKH 3LGIA 4E7RG 1TRYA 3F9HA 1GI3A 1TNLA 3BIVH 6CHAC 2YMSB 1TBRH 2KCAA 1QBVH 4YTAA 2AS9A 3E1XB 2FOGA 3KL6A 2FTLE 1CT0E 4FU8A 1OWKA 5JBAS 2BD2A 4RI0A 2RDEA 2ZFQH 2JJ2D 1QL7A 2QN5T 3V3MA 1O3PB 2WV9A 3T2NA 5HYOA 1CA0C 1F5RA 3HGPA 1H1BA 5AHGH 1KLJH 2VVVA 1IQNA 3U69H 5FPSA 4OS4A 1G30B 3KYFA 1BRBE 3MYWA 3SGBE 5EQRA 3TITA 2F9PA 2G52A 2FLRH 1ELEE 3SNDA 4CHAC 3UNRA 4JYTA 1GI4A 3N7EA 3QK1A 2GMTC 1MTWA 1TYNA 1AIXH 1O3HA 5SGAE 1SQTA 3QLPH 1EFRD 1T32A 3GYLB 3RXJA 3QGNB 3ATMA 1IHTH 4Z0KA 3SV7A 4IW4E 1L1GA 1SLXB 3SGQE 2ZA5A 3DUXH 3RU4E 5EQQA 2PKSC 5GIBA 4KP0A 1O5FH 2VBCA 2ZGHA 1AWHB 3N7OA 1TB6H 3SUFA 4UEHH 2FS8A 2OK5A 5DKMA 2Z6BD 1EOJA 2BTCE 4XRNA 2H9EH 2JDID 1VITH 4H6TA 2L74A 1NPMA 1ANEA 3UR9A 3V7TA 4Q7YA 2O8TA 1HPGA 1S84A 4DT7B 2GT8A 1GBHA 1XXFA 2ZC9H 1D9IA 2CN0H 1H8ED 1GL1A 3LKWA 3GOVB 4XBCA 1QRZA 1TRNA 2F9OA 5HGGA 4UONA 1Z8IB 1C2FA 1GJ5H 1GJCB 4WH8A 1P2NA 3EGKH 5C0TA 4K1EA 4WXIA 1ABJH 2P3UB 1BT7A 2J97A 2QY0B 1GDUA 5AFYH 4ACAA 1DWCH 2ODQA 1F0TA 3UNSA 4BTTB 2PW8H 4BXSA 3DSOA 4ABJA 5GJ4B 3BTKE 5FX6A 5A0AE 1HUTH 1BQYA 3T26A 1UTLM 4MNWA 1W0JD 1DXPA 2ANMH 2V6NA 1W13U 1DSUA 1GBFA 3A84A 2ASUB 2FP7B 1ANBA 1OX1A 1GBEA 4K3JA 1ANDA 3M5LA 1OS8A 4ZKOU 2PLXA 4XBBA 1K21H 1OWIA 4WWYA 4IN2A 1P0SH 3TLOA 4E7NA 3GDVA 4ABIA 1LDTT 4DIHH 1IQLA 4Y8ZA 4IBLH 2Y7XA 2DE8A 3VB5A 4YESB 2M5TA 1ELDE 4K69A 4B2AA 5TJXA 1T8MA 3SV2H 1RTLA 1W14U 2GDEH 2H5DA 2LNCA 1VGCC 2Y80A 3BTEE 4ZCNA 3PRDA 1F92A 1V2QT 2ZU5A 1GL0E 1JRTA 4YT7H 1C5LH 2GVFA 1BHXB 5FCRA 1TWXB 1D3TB 2GCTB 3GY8A 3Q3XA 5H4IB 1LPZB 3SBKA 3SU4A 1O39A 1SKYE 2VIVA 5C17A 1G2MA 4XSKU 3MOCA 1DFPA 4U2WA 2H9TH 1PQ7A 5KECA 4UFFH 2R3UA 1GHBF 2P93A 1D3PB 2Y5GA 1KYNA 3H7OA 2QAAA 3BTDE 3QZRA 4JZEH 1UVPA 3EQ0H 1YCPK 5CMXH 3E6PH 1TPAE 2A31A 1RFNA 5KGOA 4M7GA 2LP6A 5HIZA 2ZECA 2GZ9A 3GY3A 1SVPA 3ZZ6A 8GCHG 3C1KA 2FX6A 2PKAB 5CHBA 2CK3D 4Y11E 4FUBA 1UTOA 1V2LT 2SGAA 2XWBI 3AAVA 5DP6A 1VITF 2UUFB 3LU9B 4B76A 1O3OA 1QA0A 1UHBB 2KR7A 1OP2A 2ZFTA 4MG3A 4F49A 1ELAA 3SYJA 1CA8B 1SGNE 1AUJA 4JZDH 2ZU4A 1ANCA 1F0SA 4Q2KA 3JZ2B 8KME2 3U8OH 1P2KA 1GG6C 4ASUD 1MQ5A 4ISOA 1RS0A 1OYQA 7GCHG 3OEED 4O97A 1VKYA 2UWOA 1A5HA 2C93B 1NTPA 1OXGA 1HAZB 4TPYA 2VIPA 5DJ7A 1FXYA 1C1UH 1OWDA 3IG6B 3S9BA 5CHAC 3A8AA 1P10A 1DX5M 1GI9B 1O38A 1XUKA 2GP9B 3PYHA 2CGAA 2GTBA 4GVUA 1NM6A 4ISLA 1EJAA 5C1UA 2XXLA 2XWAA 3N7DA 3T27A 3GY2A 4P00A 2IPQX 3NZIA 4B2CA 1AN1E 1ZHPA 1VCQA 1G3CA 1O33A 4FUHA 5EG4A 1TNIA 1T4VH 1EXFA 4I32A 1HAGE 3TJOA 3EE7A 1YWUA 5IYTA 5LGOA 1GBDA 1OPHB 3RMNH 3S7KB 1CT4E 1C9PA 1MQ6A 1NO9H 4AFUA 1OOKB 2W6JD 1O3EA 3SQHE 4ABEA 1QNJA 1TGSZ 2FOAA 3P70B 5LPEA 4DJZB 1CGHA 5BPEA 1TPPA 1ZMLA 5FHTA 2A5KA 2OQ5A 1BJVA 4UDWH 4YT6H 5A0CA 1OHHD 1JIMA 2BM2A 4VGCC 3M5NA 4XOJA 1FQ3A 2BD4A 4FVBA 2WPKS 2KM0A 2BMGB 5T3HA 4NA7A 1TX8A 2J98B 2BDYA 1UO6A 1VJ9U 2Z7FE 3AASA 5EW1H 1OP8A 1C5SA 1O2NA 1OSSA 1DT2A 2VWLA 1ZTJA 1FY1A 1CGJE 2GV6A 4QT8C 2Z9JA 2ZDKA 2ZQ1A 1C2LA 4O3UA 3ODDA 5E0GA 1AKSB 2J92A 1EKBB 5EW2H 1T4UH 4MDSA 2AMQA 1BDAA 1C1MA 1C2JA 3Q77A 1K1LA 1P02A 4F4OC 1HAYB 1MAYA 4DOQA 1QY6A 3TGJE 1KDQA 4FUFA 3GS9A 3RXTA 1MZDA 2BXTH 1MBQA 2BY7X 4WH6A 5JDUB 1V6DA 1AE5A 1DDJA 2B9LA 3M5OA 2XC5A 3DT0H 2PR3A 5AF9H 3AW0A 2TGAA 3EA7A 2A2XH 2UWPA 3W1EA 1Y8TA 3A82A 3SOSA 3K9XB 3TVJB 4TT3D 3H7TA 1TX6A 3BTWE 1P09A 4ZUHA 2OQUA 5EJLA 4DVAU 1HAOH 1C1VH 3A88A 3SI3H 4NA9H 2ZTZA 1ZRKA 2UUJB 1K1NA 1P8VC 2BZAA 4MNVA 2HLCA 2XBYA 3ZZBA 1Z8GA 4GHQA 3FZZA 5FPYA 1IAUA 1RIWC 2NU1E 5FXLA 1EZXC 1HB0B 4SGAE 5A0BA 3F9GA 1IQJA 2HWLB 1H8IH 1WSSH 2A1DB 1IQFA 1C2IA 1W0YH 3KNXA 3WY8A 6GCHG 1DS2E 1Z71A 5AFZH 1L2EA 2PFEA 3PMBB 4U32A 3BEUA 1TLDA 3M36A 1ESTA 1HAXB 1CGIE 2F9VA 2Q6FA 1ESAA 2R9PA 2VGCC 3UOUA 1QL8A 1E34B 1WCZA 2HNTE 5EU8A 4ABAA 1OYTH 1KIGH 3PB1E 1O2KA 4Y7AA 1PYTC 5EJZA 2GDDA 4A7IB 1O2VA 1S5SA 2ZTYA 1EATA 1DUAA 2C8WB 1O3FA 3I29A 2CF8H 3A8DA 1IOEA 4D7FA 1SG8B 3F1SB 3LC5A 2Z9GA 1YPHC 1O2GH 4O3TA 3A8BA 2FIRH 3K6ZA 5HIYA 1O3IA 3RLWH 1HAIH 3UQVA 1F7ZA 3CP7A 2Y81A 3P8OA 5C2ZA 3CNRA 2ZWLH 1QQUA 2QXGA 3SZEA 3KCGH 1MU8B 3SJ8A 5I25A 1H8DH 1AB9B 2LPRA 2XTTB 1J15A 1P3CA 3ATKA 1PPFE 1C1SA 4X2WA 3RDZA 2A4QA 1JIRA 1FY3A 2BVRH 3SU0A 1YCPH 4AG1A 3S7HB 3SU3A 3FP8E 1AFEH 5EODA 3OTPA 4IMQA 1SFIA 4I8HA 1YPEH 4TWYA 4XE4A 1A3EH 1GBAA 1XKBC 1SGFA 2QE7D 1P03A 5B6LA 4OS2A 2J34A 1C2GA 1FIZA 2NU2E 2A32A 2RDLA 1HCGA 3URDA 1J9CH 1CA0B 1E79D 1DY8A 1V2WT 2XYAA 1GBLA 4BTIB 3PM3A 2R0LA 1SGIB 3ZZ8A 1D3QB 2QCYA 2AH4X 4ZH8A 2K8IA 1THRH 3A81A 1HV7A 1TX7A 1DANH 2HALA 4H4FA 1ZGIA 3NRLA 2C8XB 3F68H 3ZVBA 1E1RD 4CHAB 1SLVB 3FFGA 5EQSA 1UVSH 2WUBA 4LZ1H 2OP9A 2RA0A 2Q1JA 1UK3A 4Q63A 4TYDA 3TGKE 2AGEX 2PUQH 1SOZA 4OGXA 4TSFD 2FYRA 2ZDAH 2ZEBA 3F0PA 3TK6A 4JK6A 3U8TH 2DE9A 2PHBA 4KKDA 3WWBA 2SGPE 3FP7E 4A1VA 1AGJA 2JIZD 2PKSB 4Y71A 5JBTA 3VXEH 5T6DA 1UMAH 4H42U 4NWKA 1EPTC 2ZFRH 1QBNA 4MPWA 1BMAA 1TALA 3KQBA 2A7HA 1CO7E 1S6FA 2KCYA 4PROA 3RC6A 5JPMH 2W3KA 1J17T 1KXBA 2ZDVH 1MD7A 1NFWA 1Y5UT 1GMHG 4SGBE 1QGFA 2ZU2A 1BUIA 4GLYA 3SORA 1NRPH 3T25A 1HDTH 1ELTA 3AW1A 3DFJA 3E90B 3GICB 4D9QA 1UCYK 2I6QA 2Y6TA 1W10U 1HIAA 3GCTG 4RN6A 1HAVB 1TA6A 1RD3B 3TH2H 2V3HH 2HGTH 1ZOMA 1LPKB 5E8EH 1RRKA 2BY8X 3UAIC 2BD7A 1MTUA 2OXSA 2R0KA 1UTMA 1WXRA 1TFXA 1GJ6A 4RKJB 1O5CB 4Y0ZE 1DY9A 2Z9IA 3AVZA 4WVPE 1GGDB 3UB0A 1F0UA 1C4Y2 3P92A 3LH1A 5G4BA 3O8DA 5DPAA 1O3MA 2R2WU 1MBMA 3KQ5A 1O2PA 1LHFH 3SNEA 4OS5A 4NIWA 3BG4C 2QV1A 3A7XA 1BBRK 1WQSA 5IDKA 4Q4LA 1TGTA 1V2JT 1O35A 1O5DH 4O9VA 1Q31A 3RXAA 1VZQH 5HM9A 2QF3A 5EGMA 2FXRA 2PTCE 3ZIAD 4K5ZA 1UTJA 2FI3E 1COWD 4NZQA 4R0IA 1ETSH 4YOGA 1HNEE 1B5GH 3ZZDA 3V13A 1BRCE 2CHAC 2AEIH 1GHWH 1VGCB 1V2MT 3FKSD 3N99A 2W7UA 1O5AB 1AMHA 1ID5H 1C2HA 3HPTB 4GCHG 2XNIA 4ABHA 2PGBB 1Y3YA 4NFFA 1N6XA 2EC9H 3TIUA 2G8TA 1T8OA 1S81A 1DVAH 2ODPA 2KFWA 2ZPRA 4AORA 3M5MA 3GCHC 5A09A 1A1RA 1BZXE 3D23A 4JYVH 3SV9A 1LQDB 3GDUA 1SGTA 1ELFA 3BG8A 4AZ2B 5EPYA 1Z6EA 3FO8D 1W11U 2ZO3H 1O2HA 2KAIB 3ODFA 1WU1A 2O8MA 3DD2H 1SFQB 1PQ8A 3QWCH 5GXPA 1GVLA 5C3NA 2VINA 2V3OH 2GD4B 4CRDA 4AOQA 2XCNA 5F03A 3ZYEA 1ELGA 2FTMA 2BHGA 2A5IA 3VGCC 5T6FA 1HAPH 4KTSA 1EX3A 1QJ1B 1SGPE 5T6GA 4FU9A 1G37A 1WV7H 4K2YA 1FN6A 3GDSA 5GDSH 1O5EH 2VVCA 4NGAH 2WHXA 1CBWC 4OGYA 2AMPA 1CHOF 4DCDA 1EUFA 5E2OA 2ZPQA 1KTTB 1GCTC 4ZHMU 4CRCA 3DA9B 1GJBB 3OEHD 1V2UT 2XBVA 2WPIS 3SV6A 2BQWB 5CHAB 3M7TA 2FO9A 4BANB 5JB8S 2O9QA 1P04A 2NWNA 1C5ZB 1UW7A 1OKXA 1AZZA 3MI4A 3ZYDA 3PWBA 2D2DA 3IWMA 4ESTE 3LONA 1J8AA 5PTPA 1XUIA 1NRRH 3STIA 1PPGE 1QZ8A 3DHKH 1A4WH 2ANWA 1LVMA 1GBMA 2ZP0H 4CRFA 4B2BA 1LHCH 3BTME 3P6ZB 2Y7ZA 4ISNA 3SU1A 1FAXA 1C5TA 1QJ7B 2P3FH 3ATIA 4FXGH 2ZCHP 4K1SA 3PV5A 4ZROA 5TCCA 4WMDA 2KZ4A 3CENA 4B1TA 1KSNA 3LGYA 3MU8A 3SNBA 1PYTD 2Z3CA 2VU8E 5GWZA 2FOEA 3HGNA 4KTUA 4BAKB 3OU0A 1O37A 1SBWA 2J5UA
chains in the Genus database with same CATH topology
2C8YB 1EPTA 1P9SA 3SZNA 1SGYE 2BLQA 1QFKH 3SU5A 1P57B 2G55A 1UJ1A 2BY5X 3PWCA 3KIDU 1YPKH 3KEEA 4X2YA 1UTPA 2XC4A 4AGJA 1C1OA 4MQAA 1A3BH 3LGTA 3KHVA 4RSPA 3U1JB 4NWLA 2JH6D 1ZJDA 1EZSC 6LPRA 1FZZA 3EA8A 3GISB 1VCWA 1TGBA 1MKXK 2ZHWH 3MFJA 1MCVA 2FX4A 2FOBA 3SU2A 1ZR0A 3VB3A 4Y10E 2C4FH 1BMNH 1S85A 2ALVA 3ENSB 3MU5A 3T62A 1LVOA 1YF4A 5F6MA 1O2IA 3TJVA 1ZPBA 4TPIZ 1NU9A 2BQ7B 1ZTKA 2STBE 3LDXH 2SFAA 1QA7A 1JRSA 1UCYH 4BXWA 5DP3A 2B0FA 1THPB 1J14A 1LMWB 1D6WA 2ULLA 4JZIA 1LHGH 3AAUA 1BTYA 2WPHS 1XUHA 1P2JA 3W94A 1NU7B 1AE8H 2P8OC 4THNH 1IQHA 1GBKA 2OD3B 1XKAC 2XRCA 1TGCA 2QXHA 1O32A 2ANKH 2VIDA 3ATWA 1NRSH 2NU4E 3ESTA 5E0HA 2VWNA 1RIWB 1O2XA 4FVDA 3QDZB 1AVXA 1SGCA 4JMYA 2EA3A 8GCHF 1BBRH 2BOHB 3GYMA 3UTUH 2G81E 1HXEH 3MTYA 1W3CA 3TGIE 2A7CA 2XC0A 1O2SA 1IQEA 1O3DA 3SHCH 1XVOA 1YPHE 1MCTA 1C1PA 4CBNA 2Q6DA 5LH8A 1O2RA 1GI6A 5EXMA 4X6MA 1PFXC 2ZDLA 5L2ZH 1FI8A 3OY6U 2OC7A 1P06A 5C5OA 4AB9A 1A61H 1VITG 1TABE 4Y8XA 4OS1A 7GCHF 1GMCG 2QXJA 4ABDA 5C1XA 2BVXH 5C20A 4YO9A 4Z6AH 3KQDA 3E8LA 1D4PB 2ZKSA 2Y5FA 1C9TA 1GMDF 2BDIA 2F3CE 1O2MA 1XUJA 1PPBH 3RC5A 1A0HB 3MH6A 3SGAE 2OLGA 3I78A 1ZMNA 2SGDE 2ZU1A 2A5AA 1V2TT 1C2MA 2UWLA 2F9NA 3M3VA 4AFSA 1AVGH 1NROH 2Z9LA 1CHGA 3QN7A 3T28A 2FZZA 2QYIA 1EP6A 1SQAA 1Y59T 2ILNA 2WPJS 1QQ4A 3E3TA 2OUAA 1JBUH 2JKHA 2ZFPH 1UTKA 4X0WU 1GI1A 5FX5A 2JETC 2CV3A 2VVUA 1ZSLA 3RXQA 1A2CH 3TH3H 1IQIA 1AO5A 4J1YA 3S69A 5DGJA 1NRNH 5FPTA 1GBJA 3RXSA 3G01A 1SI5H 9ESTA 4AN7A 5FBIA 4ISIH 1L1JA 1ZTLA 2PTNA 4ZMAH 3TJNA 2JH5D 3VEQB 3ZZAA 2I6SA 4INKA 4MTBA 4CRAA 1EOLA 3QUMP 1HFDA 4MLFB 1DITH 1ETRH 4NA8A 4A5TS 5A8ZA 3MH4A 2K1QA 2ZFFH 2OBQA 1FV9A 4WMEA 4DW2U 2BLOA 1FDPA 1SHHB 3LGWA 2ZGXH 4NIXA 4X6PA 1PQAA 1AZ8A 1ARCA 2AIPA 2FDAA 4JZFH 3RXEA 3F9FA 1O34A 3U98H 1YLDA 1ZLRA 2ZCLP 4MNYA 5L30H 3LT3A 1C2KA 1S6HA 2C3SA 3BTTE 2PUXB 3ZV8A 4A92A 1MTVA 4Y7BA 1C2EA 1FJSA 1GI2A 2ZCKP 3D49H 3E0NB 4NSVA 1E37B 4YOIA 1TPOA 3LH3A 2AERH 4GHTA 1O0DH 2D8WA 4X6OA 1K22H 1DWBH 4WF8A 2FS9A 3ZVFA 1O3LA 1GI5A 4IC5A 3A7YA 1C5RA 1TNGA 1G36A 1SGEE 3ZV9A 1XUGA 2ZHFH 5I46H 1QB9A 5BRRE 4IMZA 4KGAA 1EB2A 2OC1A 1O36A 1XVMA 1LVYA 3EDXB 4NIYA 2BDAA 1DWDH 2J94A 3BG4B 1BITA 5DP9A 1ZSJA 2VH6A 4XFQA 3GY4A 2P95A 1XM1A 4HGCA 4D9RA 1S0QA 1LKBA 4JYUH 1C5UA 2A0QB 1C5WB 4CBOA 1K28D 1KY9A 2CXVA 3RXDA 2G00A 1O31A 2GCHF 3EE0B 2VWMA 4K8YA 5A8YA 1S82A 3MNCA 3MO6A 1B7XB 3MNSA 1G3EA 4O03A 3LJOA 2CHAB 3HK6B 2A4GA 1K1PA 1DSTA 4WY3A 4X1NU 3MNBA 4MVNA 1KXDA 3RLYH 1DOJA 1YCPM 5LPFA 3A7VA 1N8OB 4OS7A 4K8BA 3UUZA 1OWEA 3UPEA 3BF6H 1V2OT 1W2KH 5AVDA 1FY4A 1Y3XA 1SPJA 6CHAB 4NSYA 4Y8YA 1LCYA 1BRUP 2FWWA 4X1QU 1MAXA 3VB6A 1T8NA 1KXAA 1G9IE 2EEKA 3W95A 1ZGVA 2H6MA 2AGIX 1W12U 3M3SA 3RXGA 1PPHE 1V2VT 2G5VA 3LC3A 1O2TA 4KELA 1TOCB 5GCHF 2FLBH 2ZGCA 4X2XA 2EI8A 3BEIB 4A1TA 3SJKA 4MPUA 4IS5A 1AUTC 1O3KA 5ETXA 5F8TA 2SNVA 1GHAG 1CE5A 1UVUH 1AFQC 1O2ZA 4D76A 4DGJA 2P3TB 4X8VH 1YBWA 3BSQA 3GCOA 1GJ9B 2ZQ2A 2GMTB 2FM2A 4Q80A 1VR1H 1E36B 1BTXA 1CBWB 1HRTH 1P2OA 1DPOA 4NZLA 3RXCA 1AQ7A 3TU7H 3E0PB 1PPZA 3BN9A 3TK5A 1O5BB 1EASA 4MPVA 2BLWA 3UR6A 3MU1A 3BTHE 1SQOA 2ZPSA 3M61U 2AMDA 2IOTA 3ZZ9A 4HFPB 1B0FA 1GJ4H 1TBZH 4Q7XA 2Q6GA 4H6SB 3MO9A 1SR5C 5DK1A 1WYKA 2G51A 1HJ8A 4ZKSU 5EPNA 3A7ZA 2R3YA 2W7SA 3TK9A 2BOKA 4E05H 2GGVB 1NS3A 1FAKH 1P2QA 4IN1A 1HJAC 1RXPA 3LJJA 3MMGA 3PTNA 3GCTF 1QB6A 1C2DA 1LTOA 1EJNA 1C4V2 2QA9E 1DM4B 2TGPZ 8LPRA 2WPMS 1KDQB 3P8GA 2ZU3A 1EZUC 1P01A 1QJ6B 1Y3UA 2Y5HA 1Z8JB 4TY7A 2TIOA 4XBDA 3RXKA 3UQOA 4B71A 4YOJA 3RMLH 5A8XA 3A7TA 4YZUA 1TQ0B 1INCA 1IQGA 4UFGH 1BOQA 1OP0A 1BTPA 2J2UA 1MD8A 4GPGA 1JWTA 2TGTA 2FOCA 2THFB 3PLPA 1MH0A 5JYIA 3ZVEA 3RXFA 2G5NA 1TMTH 2UUKB 2AIQA 1J16A 1YPGH 3QTOH 1O3BA 2BD5A 1CSOE 1G32B 1QURH 1OWHA 3STJA 7LPRA 1YGCH 2EI7A 1GJ7B 2CF9H 1FY5A 1N6YA 2OC0A 1O2YA 5DP5A 5TCAA 1P3EA 3P8NA 4I8LA 3S0NA 2FI5E 1XXDA 3EA9A 4GCHF 2DUCA 1O30A 3O8RA 2P16A 4HZHA 3M7UA 3RU4D 1C5VA 3K65B 4NIVA 1ZHRA 1DE7H 1SGRE 3RM2H 3E16B 7ESTE 2UUYA 4LOYH 3A89A 5F8XA 2AGGX 3BTGE 2F83A 1QRWA 1QBOA 2PSYA 3BTFE 2YOLA 1M9UA 2A7JA 1YPLH 2OTVA 1BBRE 1BJUA 1YP9A 2GT7A 3RXIA 3QTVH 2GKVE 1L0ZA 1FIWA 3RXVA 2HNTC 1JXPA 4K60A 2PKAA 1VJAU 1XUFA 1AD8H 1C5NH 3M37A 4WMFA 1AB9C 1DICA 1D6RA 5B6OA 2W5EA 4CH8B 1EJMA 1ORFA 1UHBA 3U8RH 1FY8E 1WTHD 2H2ZA 2VIWA 1RTKA 3HKJB 1NT1A 4CREA 2C90B 2SGQE 3ZVCA 3V0XA 3D65E 1NZQH 3SJ9A 1V2PT 5CE1A 2BYAX 4AYVB 1VCPA 4JCNA 4MNXA 5FBEA 1E35B 3A7WA 1ETTH 1EAWA 2VB0A 2BD3A 4U01A 3EAJA 3KN2A 2WUCA 1GI7B 2HPPH 1O3CA 1UVTH 1GG6B 2ZG0H 4X8SH 1QCPA 1HYLA 2PGQB 2QIQA 1LHEH 3P95A 3SO3A 1T8LA 3MWIU 1FN8A 1RTFB 3Q3KA 1FPHH 3ZZ5A 2AYWA 1LVBA 5JBBS 1NESE 3M3TA 4YLQH 3GY5A 1ZZZA 3PLBA 2FOFA 1H4WA 1PPEE 2XW9A 4X1RU 2B5TB 3NCLA 2BDHA 3BIUH 4AFZA 4BAOB 4JK5A 1GHVH 3GCNA 2WV5A 1S0RA 3PO1C 1DLEA 2A4OA 1MTNC 1QB1A 1ABIH 3Q00A 1CHOG 2FMJA 5FCKA 1P05A 2F9UA 1UTNA 5A2MH 2V0BA 4DIIH 1UK4A 1CU1A 3I77A 1LQEA 2FOMB 2ZIQH 1RGQA 2FOHA 1YLCA 1TMBH 2BX4A 4ABBA 7KMEH 1C5XB 4NCYA 2ZZUH 3TJUA 1TNHA 3KQEA 5DP7A 3KF2A 2GZ7A 3EYDA 3L3TA 3PMJA 1FONA 4X1SU 3HK3B 1GDNA 3NK8A 3NUMA 1GCDA 4FUJA 1E38B 1SMFE 2JETB 3QZQA 1L1NA 1TONA 1IQMA 2VH0A 3B23B 4WXVA 1AI8H 3ZVGA 5DO4H 1EAXA 4B74A 4VGCB 2VNTA 3SHAH 1Z8RA 2STAE 1HIAB 1AKSA 3CS7A 3D62A 1WBGB 3S9AA 2BZ6H 1GGDC 5ESBA 1L4ZA 3F9EA 3V12A 2A2QH 2HNTF 2ODYB 3UREA 4YM9A 1K2I1 2OBOA 1O3GA 1KXCA 2BY6X 2QXIA 3A87A 3FAOA 2O8LA 3ZVAA 2RG3A 2TRMA 3URCA 1K1IA 2BQ6B 1ZSKA 5J4SA 1GBTA 1BMLA 1KLTA 1TNJA 2C8ZB 1DLKB 3UIRA 3PV4A 1EB1H 1Y3VA 3VB4A 1GVKB 4UFDH 2TGDA 1O2OA 2WYJA 2SGEE 1A5IA 2IJOB 4A6LA 3ZZ7A 5C1YA 1JMOH 1ZJKA 1BTZA 1KLIH 1ELBA 5E0JA 1KXFA 3T5FH 3BTQE 2FI4E 1P2IA 2J38A 2RA3A 4ABFA 4CR9A 1C1QA 4I31A 4XDEA 4KTCA 2BD9A 3NKKA 3VFEA 1TMUH 4AX9H 1WOFA 1GJAB 3L33A 3U1IB 1BTHH 3B8JA 1A0JA 1Y5BT 1PQ5A 2EI6A 2F9BH 1HXFH 1BMMH 2Z3DA 4YLUA 1XMNB 3ELAH 2ZDMA 4IC6A 1QHRB 2BY9X 2ZFSA 3MU0A 1P12E 1EAUA 4ZXYH 5LPRA 1GHBG 3NPSA 1ACBE 1UVOA 1GDQA 3NWUA 2H1UA 1AVWA 1O2LA 4BOHA 2HRVA 1GJDB 2ZHEH 3SNAA 1SHYA 1SL3A 2BLVA 3K2UA 3UY9A 2VGCB 4X1PU 3NXPA 2VWOA 3SQEE 1Q2WA 1NN6A 1SGDE 3TNTA 1BA8B 1O3NA 4K1TA 4FUGA 3RXPA 1ZHMA 4BTUB 9LPRA 3KGPA 3RXHA 1K9OE 3H5CB 1GHZA 1GMCF 3MU4A 3ZZCA 1O2WA 3RXOA 4AG2A 2V35A 3BV9B 2ALPA 1C5PA 1AU8A 1KTSB 1A5GH 1EAIA 3ZZ3A 3RUOA 1MUEB 2WPLS 5JB9S 2J9NA 1A0LA 1JOUB 2ZDNA 2A45B 3SNCA 2Z9KA 1LKAA 4CRBA 1DWEH 2ZI2H 1GMDG 1FPCH 4D8NA 2R2MB 2QC2A 3VPKA 1O3AA 5C5NA 1V2KT 3FVFB 4NG9H 1AWFH 1MKWK 2BDBA 1P2MA 1F5KU 1X7AC 1F5LA 1Z6JH 4BAQB 2ZTXA 2XCFA 3BEFB 1SOTA 5L6NH 1TQ7B 1AFQB 3L6PA 4B75A 1BB0B 5EOKA 4CR5A 2FODA 1HBTH 1BTUA 1MZAA 1YPMH 4Y79A 3TNSA 3C27B 3O8CA 1CT2E 4FUIA 3A83A 1LHDH 2HOBA 4Y0YE 5DP8A 2P94A 1QL9A 3GY6A 4LXBH 4JZ1A 2IN2A 2G4UA 1UK2A 2OC8A 3ZZ4A 1S83A 2BD8A 1ARBA 1MU6B 1W8BH 2AFQB 2ZHQH 1EPTB 4ZKRU 1ELCA 2RCEA 1V2NT 1DXWA 3RM0H 1YKTA 3JZ1B 3RXMA 3SUGA 3LGUA 1GHXH 1T7CA 4X8UH 1G3DA 1HAVA 4LK4A 2SNWA 3QO6A 3MHWU 1C1NA 4I8JA 4ABGA 4BAHB 1HJAB 4AYYB 3E91A 1W7XH 4AFQA 1FLEE 2IPHA 2H5CA 4I7YH 1H9LB 3Q3YA 1GBBA 4I33A 3RU4T 2QF0A 4ZKNU 1GBCA 3PLKA 3OTJE 1RJXB 3F6UH 1EP5A 3T29A 3RXLA 3HATH 4X8TH 2GCTC 8ESTE 3VB7A 2W3IA 1E0FD 1C4U2 2B7DH 5HMAA 1SGQE 3PMHB 4TY6A 3LIWA 1SGFG 1TNKA 3SV8A 1C1TA 4OS6A 1K1MA 1P9UA 1WTGH 2D26C 3A85A 3RMMH 1NRQH 6GCHF 4RKOB 4A1XA 1THSH 3SI4H 1GJ8B 2P59A 1NC6A 1GWAA 3FP6E 1MKXH 1Q3XA 1UTQA 1ZYOA 3ZVDA 2CJIA 1G3BA 3RP2A 1SSXA 1G2LA 2YNAA 1TBQH 2ZGJA 3FANA 1O2JA 2VIOA 4NFEA 1N1LA 1C5OH 1IQKA 1QRXA 1NFYA 1TAWA 3O8BA 3P17H 2PWXA 4FUCA 1OWJA 4MPXA 3UOPA 1ZPCA 5EXLA 2ZF0H 4Y6DA 5C67A 4HI3A 2GCHG 2Y82A 4Q7ZA 4UFEH 2PV9B 3A8CA 3A80A 1HJ9A 1ELVA 3SU6A 2VIQA 4B73A 1AY6H 5FAHA 1ZMJA 3GCHB 2XBXA 4GUXA 3RC4A 1GHYH 1MTSA 2KAIA 4ASHA 1L4DA 5DP4A 2OCVB 1Z1JA 1Y3WA 4X6NA 2GX4A 1F2SE 1IHSH 1Y5AT 1TE0A 1FNIA 3RXBA 5ABWA 4U30A 1Z7KA 1K1OA 1SC8U 2YNBA 3LOXA 4DG4A 1KXEA 2FESH 2TPIZ 1H9IE 3MH5A 3SUDA 2H9HA 1T31A 1DUEA 3TH4H 2JH0D 4TWWA 1YPJH 3FZDA 1LO6A 1ZPZA 1C1RA 2GV7A 1CQQA 1FUJA 4DURA 3KQCA