4ABIA

Co-complex structure of bovine trypsin with a modified bowman-birk inhibitor (pta)sfti-1(1,14), that was 1,4-disubstituted with a 1,2,3- trizol to mimic a trans amide bond
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Braces for the Peptide Backbone: Insights Into Structure-Activity Relation-Ships of Protease Inhibitor Mimics with Locked Amide Conformations
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abiA02
4O9VA 1DICA 1DWEH 1YPHC 3MNCA 5HMAA 3S7HB 3HGNA 3RXAA 3QN7A 1EUFA 1GBJA 1SMFE 1XUIA 1E34B 4DW2U 3K65B 2BZAA 3I29A 1EASA 3M3VA 2OTVA 4UFFH 3S7KB 4GSOA 5EGMA 1DSTA 4CR5A 4CRGA 1O2SA 4PROA 1BZXE 3SV7A 3RXCA 3TK6A 1TNLA 1JOUB 3SUFA 1GG6C 2BVXH 2OC8A 3H5CB 2ALVA 1BMAA 5T6DA 1C4Y2 4BAMB 3RMNH 1PFXC 1GI0A 5EW1H 1SGQE 3PLKA 1YC0A 4ABAA 3FFGA 1EZUC 2ASUB 3UUZA 1IQNA 1H8DH 4E06H 2GV7A 3BTGE 4R8TB 3RXQA 3F9HA 3SBKA 4NCYA 2ZC9H 4GAWA 3ZV9A 1YPKH 2PGBB 4FU8A 1Z7KA 2NU1E 2VB0A 1GHAF 2O8WA 1QB1A 2TRMA 2Y82A 3GDSA 3TJNA 4GHQA 3RXTA 2HPPH 2XBVA 1SPJA 2I6SA 5DO4H 1NPMA 1TNKA 1DXWA 1HXEH 2G55A 4CRBA 1BRUP 3MYWA 3O8RA 4X1PU 1Y5AT 1TMBH 1SGDE 1CT2E 1GVZA 1FNIA 1J14A 1JWTA 1PQ7A 1OWEA 1EZXC 1LVOA 1BHXB 1C1UH 1AB9B 1AFEH 3ZZ3A 6ESTA 1SHYA 3A8BA 2ESTE 4NWLA 1SC8U 2BY8X 5LPEA 4DIIH 1FY1A 3SZNA 1AO5A 1BT7A 4CHAC 1GMCG 1UTKA 2FESH 3RU4E 5HYOA 4INKA 2IPHA 3RM2H 4Y7BA 3SU5A 2RA0A 1MD7A 2DUCA 3NZIA 1Y5BT 1ZRKA 2A2XH 3RXIA 1WBGB 3NUMA 3SUEA 1QL9A 2GP9B 2ZEBA 3M37A 1E38B 3GCHB 1Q3XA 1E35B 2AFQB 1GBHA 1P3EA 1LHGH 3OY6U 1NZQH 4ISNA 4LZ4B 2XCFA 1CHGA 2BVSH 1KXBA 5J4SA 3M61U 3SJKA 2XXLA 1YCPM 2XW9A 3KF2A 2BD2A 3U8TH 3T62A 1P03A 6CHAB 1EJMA 2TBSA 2CN0H 1GBMA 1RGQA 1SGTA 1MH0A 1MUEB 3AAUA 3ZVBA 4JYUH 1D3DB 2HWLB 1DWCH 2AIQA 3LC3A 1TMTH 4I8HA 1YPMH 1W7XH 4Y79A 3TH4H 3PTBA 5CMXH 1MU8B 2PTCE 4Y0YE 3A7TA 1SGCA 1ESTA 2ZFPH 1FAKH 1G9IE 2SGEE 3HKJB 2UUKB 1XX9A 4GUXA 1GGDB 5LPRA 4MG3A 2BLOA 3E90B 1HLTH 1TGCA 2FOFA 2C93B 1KXEA 2VWLA 1O3JA 2ODPA 3GCNA 3HGPA 2FXRA 1KYNA 1UVOA 3SQHE 1L1GA 5EW2H 4YT6H 1SLUB 2B8OH 2DE8A 2ZCHP 1C2LA 2QN5T 3I77A 1IQLA 2BQ6B 2FPZA 1GCTC 3A89A 1C5XB 2VVCA 1ESAA 4U32A 2Z7FE 2VWNA 5ESTE 4QT8C 3SJOA 4IN1A 5E0HA 5A0BA 1NY22 3ZZDA 1O33A 1V2QT 1OWHA 1O3AA 3TJVA 4JZ1A 4ZHMU 1HNEE 2ALPA 2BY6X 3ZZ8A 4BXSA 2WPJS 1FLEE 1GJ8B 1XMNB 4I8JA 2W7SA 1QR3E 1F2SE 1D3PB 5E0GA 1C1QA 2QCYA 1G3EA 1T4VH 3F68H 2ZDLA 4ABHA 3LKWA 3BEFB 1MTNC 1QL8A 1UCYH 1OX1A 4WY3A 1GJ9B 1KSNA 1LPGB 3W95A 2NU2E 2WINI 3OU0A 3SOSA 1EOJA 5GWZA 3RXHA 1Y3WA 3C27B 1H9LB 1AU8A 4WJG2 4IC6A 4GVUA 1P12E 4ZAEA 1O3PB 3S69A 1TRNA 1MBMA 2P94A 5A8XA 3QO6A 1UCYK 1TRYA 1YCPH 3ATWA 2SGQE 1RRKA 1C1VH 2JH5D 2ZDVH 2EA3A 3E3TA 1HB0B 1C2MA 2GV6A 1C5SA 1BTYA 4OS4A 5EPNA 1GBFA 2PSXA 5LH8A 1HFDA 5C1YA 1NO9H 3P6ZB 4UFEH 4E05H 2GCHF 1GI8B 4JCNA 2BB4A 1BIOA 2OUAA 1RTFB 3BTWE 4KTSA 2C8YB 2IOTA 3PLPA 3GY5A 3RP2A 2CJIA 1C2GA 1BMMH 3OX7U 1VCPA 4F49A 1VITF 3ZVDA 2A7JA 1O2UA 3LDXH 1TOMH 1UK3A 2B5TB 5C67A 1C1WH 4BTUB 1ZHMA 2FS8A 1ABIH 4OS1A 4X6OA 1ZTLA 4XFQA 2C90B 8KME2 2ODYB 3RXRA 3KN2A 3GOVB 3VB7A 5JB8S 1BBRK 1S81A 3NK8A 3K6YA 1HAIH 3KCGH 3K6ZA 5DP7A 2GD4B 1WAYB 5HGGA 2BY5X 1O2OA 1UTLM 3PWCA 4Y11E 3AW1A 3GYLB 3URDA 1FY3A 2TGAA 1W7GH 2YNAA 4K60A 1O3CA 1O0DH 3ATKA 1SSXA 1ETTH 5AF9H 2QXIA 5T3HA 1NRRH 5JBCS 4X0WU 1ANBA 3MOCA 1PYTC 5JDUB 1B0EA 2BLQA 2BDYA 3UFAA 5E0JA 2ZHDA 3BTTE 4X2VA 1W13U 3Q3XA 3PTNA 1ZOMA 5GJ4B 1OWJA 1GHAG 3IWMA 8ESTE 2P3TB 1PPBH 1MKWH 5K7RA 3TGKE 3M5OA 2G5VA 1S6HA 3BG4C 1GJ7B 1HRTH 3UIRA 2ZFTA 2ZWLH 3FZZA 3OY5U 2WUBA 1HCGA 3QGNB 1LCYA 3A81A 4NSYA 1TB6H 1C9PA 1GL1A 4OGXA 2ZU1A 4BAHB 1E37B 3UWJH 4ZHAA 1PQ8A 2R2WU 1ARBA 1SFQB 2ZTYA 2WYJA 3IITA 3DA9B 1ELFA 1ESBA 4X1RU 1FV9A 1F0RA 1GMHF 3TIUA 1MZAA 5F8XA 5DP6A 5GXPA 3K9XB 4OGYA 3QLPH 3MU0A 4VGCC 2FYQA 3BTDE 4KELA 4OS5A 1QGFA 2Z9GA 1W2KH 4J2YB 3LH3A 1A61H 1ZTKA 4FUCA 4WH6A 2BXTH 4U01A 4WXIA 1EXFA 2NWNA 3G01A 3SORA 3ODDA 3A88A 1C5WB 1N8OB 2JETC 1UTOA 1BOQA 3RMMH 4NSVA 2J2UA 2FM2A 2RDLA 4TWWA 1O3NA 2UWOA 1W14U 2BLVA 3F6UH 1A5HA 2BLWA 1ANCA 2LPRA 5G4BA 1P05A 1QRXA 2QF3A 1T8NA 5C2ZA 2ZECA 1OKXA 4ZUHA 4DURA 4LOYH 3SV6A 1ZPCA 4IW4E 4CRCA 3CENA 4H6TA 1P3CA 3FAOA 2PGQB 4D7GA 2A5AA 1QFKH 4WH8A 3UREA 1GI9B 3LJJA 1BCUH 1J8AA 4ASHA 2G4TA 1QL7A 2QGRA 3ZZAA 4CRDA 4O3TA 1GDNA 1BITA 1CT4E 5L6NH 1O2YA 3UQVA 1O3BA 1V2RT 2A0QB 4BTTB 1LHEH 1AUJA 2PKSC 3VB6A 3P95A 3W94A 2H2ZA 3SNAA 2DE9A 1ZZZA 1L4DA 5FCKA 3RC6A 2ZFFH 1P04A 1PQ5A 1B0FA 1HJAB 1K1LA 2VIWA 1SGRE 3ZZ9A 3UNRA 3RXBA 3V7TA 3A8AA 2A5KA 5FCRA 3PO1C 2GGVB 3SGQE 2BYAX 3LU9B 1B5GH 2W7UA 3MH6A 2BY7X 2OC7A 1O5DH 1C5YB 7ESTE 2CHAC 3LGIA 1V2JT 1FN6A 2GDEH 1G3DA 2Z3EA 2F9OA 3Q3KA 2HPQH 2BTCE 5IYTA 2W5EA 4B2AA 3RDZA 3E1XB 2V3OH 3KIDU 5A8YA 1HBTH 4DGJA 4UONA 3VXFH 1C4U2 1HAZB 2GVFA 1LKAA 3KQBA 1BRCE 4AFQA 3ZVCA 1FMGA 1MTSA 4Q7XA 1V2LT 2R0KA 4XDEA 1T32A 1ANDA 3FANA 4E7NA 5JB9S 1TWXB 1AFQB 3V0XA 2G4UA 1E0FD 1HAPH 1L1NA 2FP7B 1NFWA 1O3OA 3PMAB 1K1IA 4A92A 1CHOF 1C5MD 2STBE 1EKBB 3SV9A 2O8TA 4KTUA 1F92A 3QZQA 3RXGA 1V2KT 3T26A 1BTZA 1YP9A 1XVMA 1LQDB 1VGCB 1ZGIA 3QTVH 1TX7A 1AY6H 1P02A 2BDAA 1W8BH 1SL3A 2Y5HA 2G81E 4AOQA 3BTFE 2OC1A 2SNVA 1AWHB 3GY3A 1O3LA 1P2MA 4JYTA 2Y7ZA 1GHYH 3OSYA 3QWCH 2A7CA 3ENSB 3ZZCA 2NU4E 3BTQE 2FTLE 2PKAA 1W12U 2G5NA 5A0AE 4U2WA 4DVAU 2XBWA 3H7OA 2FOGA 1Z8IB 1BTXA 3NKKA 1TYNA 2BMGB 1F5RA 2GCHG 4MNYA 5DP4A 1ZHPA 3F1SB 2ZQ1A 1NTPA 1TONA 1GVLA 2TGDA 1UVPA 3E91A 3UNQA 3RXKA 2FOMB 2PKAB 3ZVFA 2WYGA 3Q77A 2ZDAH 1NRQH 1Z8RA 1FQ3A 1OOKB 2BDBA 1VITG 4OS6A 2ZQ2A 1LHDH 4JK6A 1QBNA 1GDUA 4D7FA 1YF4A 4ABBA 4YTAA 1YBWA 1RFNA 1OP0A 1YLCA 3U9AH 1HXFH 1V2UT 2ZGBH 1O39A 2HNTE 1NRNH 2OP9A 3QK1A 1H1BA 1TMUH 1GG6B 1O2TA 1A3BH 3A8DA 4O03A 1TIOA 2D1JA 1GBTA 5JPMH 1O3IA 1IAUA 4ZKSU 4B73A 1O2IA 2QYIA 4YO9A 3F9GA 4ISIH 1C5OH 5FPSA 1Y8TA 1NRSH 1IQMA 3EA7A 2ZGJA 1AZ8A 2ZPQA 1UCYE 1RD3B 3E8LA 1GI4A 1GHWH 1ZRBA 4HTCH 5DJ7A 3ZZBA 1FIWA 1Y3UA 4I7YH 4B2CA 4H42U 2F9NA 1UVUH 1P11E 1VITH 1IQIA 1GJ5H 1DITH 4AYVB 2PLXA 4IGDA 4B76A 2Q1JA 4RN6A 1BTWA 1Q31A 1FY8E 5J4QA 3RU4T 2UUJB 4ESTE 3MH7A 1JXPA 5SGAE 3RXJA 1AE5A 3VFEA 2AMDA 1MCVA 3QUMP 1LDTT 2UWLA 1TGBA 4JMYA 3EYDA 5FAHA 3R0FA 5DP3A 2F83A 3MU8A 5GCHF 8GCHG 3M3SA 3CS7A 3GY2A 1A0JA 1O2QA 3U8RH 1QRZA 2ZU4A 1GCDA 2ZHFH 1GMHG 3HATH 4KGAA 4YOIA 1W3CA 1GJ4H 5T6GA 1SOZA 1BBRE 1AVGH 1F5LA 2BQWB 3TK9A 3F9EA 3LPRA 1ELDE 1JRSA 3A85A 3LGTA 3KHVA 1CA0C 3BTHE 3O8DA 1XUHA 3DFLA 3OTJE 1FZZA 2IN2A 1ZPBA 3M3TA 1S85A 1AVWA 4BAKB 1GHVH 3VB4A 3HK6B 1PPCE 3ESTA 1O35A 3UQOA 5EODA 1DWDH 5CHAC 1QJ7B 1AVXA 4Y71A 4FUBA 4MQAA 1XUFA 2GKVE 2EC9H 3M5LA 4WVPE 4MNVA 1TQ0B 2V3HH 2Y7XA 2AMQA 2BHGA 4NGAH 1BTHH 1ELAA 1OYTH 4Y10E 2FOCA 1GBIA 1Z1JA 1A5GH 5AFYH 2ZGXH 3VPKA 4D8NA 3ZVGA 3SGAE 3P8FA 1MMJN 1Y3XA 1DUAA 2XWBI 3AW0A 1O3HA 1NFUA 1TGNA 1GBBA 2BX3A 4U30A 1P09A 1LVMA 2QA9E 1EPTC 3KQDA 4D9RA 1AB9C 3E0NB 4INLA 2A45B 1NN6A 1UMAH 3A83A 4YT7H 2O8MA 1P8VC 4CR9A 3UNSA 1SGIB 1TBRH 1QQ4A 3EDXB 1CU1A 1JMOH 1FIZA 1OP8A 1ZYOA 2EI6A 3F9FA 2QXHA 1RTKA 3EQ0H 1IOEA 4BNRA 7LPRA 1Z71A 4NIXA 4RSPA 1GJBB 1SLWB 2BZ6H 2ODQA 4BXWA 2GTBA 3LOXA 1P10A 2D2DA 1DPOA 4K1TA 1TBQH 5FBEA 1QBVH 2A7HA 2FOBA 2R2MB 2ZHWH 1GCTB 1QJ6B 4DY7B 4Y6DA 3URCA 1HAXB 2AGEX 2I6QA 3OYPA 4YESB 1IQKA 2R3YA 2ZFQH 3L6PA 1AUTC 1ZSKA 2VGCB 1AI8H 3BIVH 2GDDA 4ZXYH 4I33A 4IMZA 1V2MT 4ZROA 1DWBH 2VWOA 2FTMA 1D4PB 4H6SB 9ESTA 4WMEA 1G3CA 1VJAU 4MNWA 4LZ1H 2XC0A 4ISOA 2XBYA 2ZF0H 3MU4A 5GPIB 1O5CB 4TPYA 5E8EH 1MQ6A 2AGIX 1CHOG 2BQ7B 4X2WA 1MTNB 2AH4X 4K1SA 1F0UA 2BX4A 1K1JA 4IBLH 2J94A 3TPIZ 2F3CE 1X7AC 1UK4A 1O2KA 1WTHD 5L2ZH 1SFIA 4AG1A 1S82A 1DY8A 1LTOA 4YM9A 1EOLA 1C2HA 3MH5A 1EJNA 4AX9H 2VU8E 1SR5C 2XBXA 2BDIA 1YPGH 1FN8A 1P9SA 4CH2B 2PFEA 3LJOA 1GL0E 2UWPA 3K2UA 2Z9KA 3P70B 1GJAB 1O3EA 5EU8A 1C5VA 1BB0B 2F91A 2YNBA 5H4IB 5K0HA 1N6XA 3BIUH 1YPJH 4HFPB 3TH3H 2BOHB 3SUDA 3ELAH 3FVFB 1P01A 4NFEA 1ARCA 2HOBA 2ZZUH 2OXSA 1O2XA 2FLBH 1ELBA 2FX6A 1C5RA 4NIWA 6GCHF 1QY6A 1V2TT 1KLTA 4GLYA 4Q7ZA 3RXEA 4CH8B 3T5FH 1DANH 3BSQA 1P2KA 2ZA5A 3QDZB 3AVZA 1YM0A 1YCPK 4X6MA 2CF9H 1GPZA 1LPKB 1HAOH 3ZYDA 3L3TA 1FONA 4F4OC 1PPZA 1DT2A 1ZSJA 2QAAA 2WV5A 1C5QA 4AGKA 5A8ZA 1QQUA 4BAQB 1T4UH 1C5PA 2H5DA 4XOJA 4Z6AH 3A7VA 4WF8A 5ESBA 1KDQA 1QCPA 1EQ9A 1UO6A 1C5TA 1KXFA 1GJDB 3S9CA 4O3UA 2C8WB 1F5KU 1C5LH 1WTGH 2FMJA 5EXNA 4BOHA 4INHA 1OWDA 2ZGHA 3SNEA 2GZ9A 2ZP0H 5T6FA 3MMGA 1J17T 1V2PT 1EAWA 2PR3A 2RG3A 6LPRA 4WMDA 5B6OA 1KDQB 3HKIB 4FUHA 1MAXA 2KAIA 1Z6JH 3PMBB 1N6YA 2VNTA 1HJ8A 3SU6A 1K28D 3BG4B 2AS9A 2XNIA 2ANYA 4JYVH 1L4ZA 2FS9A 2Q6DA 2VJ1A 2A5IA 1MTVA 1YKTA 1FDPA 2ZFRH 1TPSA 3AASA 1EZSC 2BDHA 2KAIB 5GCHG 1BJUA 3ATMA 5EQQA 2R0LA 1OWIA 4ABGA 2AYWA 3PWBA 5BPEA 4KTCA 3SO3A 3VGCB 2J34A 2R9PA 2B7DH 1P57B 3KEEA 2F9BH 2SGPE 2WPLS 1BDAA 1THRH 2Z9LA 4UFDH 1QHRB 3LGUA 1O5AB 1ZLRA 4RKJB 1RIWB 1UK2A 4VGCB 4XBDA 3KNXA 5JYIA 1MU6B 1MKWK 4CBNA 1IHSH 1G2LA 4FUEA 1TABE 2XC5A 1SGEE 5FPTA 2XTTB 4NWKA 8GCHF 1GBKA 1KLJH 3SU1A 4UDWH 1QNJA 2F9PA 1GI1A 2ZDMA 4CRFA 1HAVB 4KKDA 1AKSA 5F03A 2H9TH 1A5IA 2SGAA 5A0CA 2Z3CA 1FPHH 3ATIA 1RJXB 3A80A 5EG4A 3LH1A 3VB3A 1LHCH 7GCHG 1SQAA 4XBCA 4FXGH 2J92A 3M5MA 1G3BA 2XCNA 1SVPA 1C1MA 1SBWA 5DPAA 4DT7B 1AKSB 2GX4A 3BF6H 1KTTB 2BD4A 3U1IB 5C1XA 2C3SA 2BD8A 3TVJB 4AN7A 1AQ7A 3KQCA 2EEKA 2A4GA 1NC6A 1T8MA 4Z0KA 1ID5H 4CBOA 4IS5A 2FLRH 1O2VA 2FX4A 3M36A 1EP5A 1TE0A 2J38A 3MFJA 4H4FA 1C1PA 1QURH 3WY8A 5C3NA 2FI5E 4GCHF 1GJCB 1EX3A 5I25A 3S9AA 5TCCA 3QX5H 3QGJA 3ATLA 3RXVA 3ZZ6A 1DM4B 4MPVA 3UWIA 4NG9H 3UOPA 1DXPA 1K1NA 3V3MA 3PMJA 1LPZB 4ISLA 2XWAA 1PPHE 2VINA 1S84A 5EXMA 1N8OC 1AE8H 2ZU3A 4J1YA 4HGCA 4NFFA 5FPYA 3DHKH 1H9HE 2THFB 1CQQA 1NFXA 4A6LA 4FVBA 1TX6A 4M7GA 3SU0A 2P8OC 2ZKSA 1M9UA 1U6QA 5HM2A 1BMNH 1GVKB 1OPHB 1O38A 4IMQA 4O97A 1HPGA 2Y5GA 1S5SA 2OBQA 1G36A 5A2MH 1V2WT 1OXGA 2PV9B 3A7YA 3RXMA 3MU1A 4UD9H 1A4WH 2H9EH 3MO6A 1MZDA 5F8ZA 4HZHA 2HNTF 1NESE 1TNGA 3A8CA 3EA9A 1O2LA 3HK3B 1ZSLA 1F0TA 2GZ8A 3B8JA 2GT7A 2GZ7A 4WXVA 1P2OA 3EA8A 2WUCA 5JBTA 3A82A 3BG8A 2HNTC 3A87A 4TY6A 3SW2B 3T2NA 5I46H 1SGNE 1XUGA 2CF8H 1MKXH 1W0YH 2ZTXA 2BVRH 1CE5A 4B74A 1NU9A 4BAOB 4MPUA 2VWMA 2P3FH 2FIRH 4X6NA 4X8SH 5JBAS 1XUJA 1C4V2 4K2YA 1MBQA 3MH4A 2GT8A 5FX5A 2EI8A 2PHBA 4ZKRU 3SGBE 4ZKOU 4JK5A 1FY4A 2OC0A 2QIQA 1Z1IA 3U98H 3VB5A 3MNBA 1SI5H 4Q2KA 3RM0H 4FU9A 5DG6A 1TNJA 2PSYA 1HUTH 1G2MA 1EAIA 1RXPA 1DVAH 1BA8B 1L0ZA 2J9NA 1O34A 1K21H 3GCTF 3RC5A 4AYYB 1QB9A 6GCHG 1CSOE 2GMTB 5AHGH 1BRBE 3BTME 1AFQC 1NT1A 2GCTC 2ZDKA 1TGTA 1AHTH 3KL6A 5E2PA 1H8IH 4ABIA 4NIYA 1DLKB 3SQEE 3SJ8A 3E0PB 4JZFH 3GY6A 3SN8A 1TNIA 2NU3E 1WYKA 1BMLA 1PQAA 2O9QA 2D8WA 4TWYA 1EZQA 1EP6A 1G32B 3M7UA 3UPEA 1JIRA 1S83A 4I8KA 3SV2H 1MTUA 2STAE 5GDSH 2ZO3H 5C5OA 2ANMH 1P06A 2H6MA 1HYLA 1K22H 3A86A 1ZJDA 3RC4A 4DG4A 2K1QA 1JRTA 3B9FH 2OQ5A 3BTEE 1TPPA 2OCVB 4MLFB 2Q6FA 4NZQA 2RA3A 1LMWB 5E2OA 1UTPA 4HI3A 4BANB 3ZVEA 5AVDA 4YOGA 1SGYE 5FXLA 1AMHA 1KLIH 2JKHA 1AN1E 2RCEA 4I8GA 4SGBE 4I8LA 2F9UA 1QBOA 4A7IB 4B75A 1O2ZA 3RXOA 4DIHH 1UJ1A 2ZG0H 2VIVA 3MHWU 1C2JA 1Z6EA 2PUQH 1YPEH 3RXSA 4X2YA 1MD8A 3B23B 1DOJA 2CV3A 3DUXH 1MQ5A 2P95A 2Z3DA 1PYTD 1CGJE 1CT0E 1GJ6A 1ABJH 2Y81A 1CBWC 3GY7A 2G52A 2H9HA 3A7XA 4MPWA 2H1UA 1K1MA 2ZIQH 4X1SU 1AZZA 1D3TB 2VH6A 1C5ZB 1WQVH 1IQHA 5BRRE 1O2MA 1TGSZ 1SHHB 5GIBA 1O2RA 4LK4A 3D23A 1SGFG 3MNXA 2Q6GA 2BOKA 1K1OA 1MCTA 1O36A 2JH0D 3Q76A 1TRMA 1GHZA 2ZCKP 1CA0B 1CGIE 2C8ZB 5TCAA 1TOCB 1TPAE 2QXJA 1IQEA 3I78A 1V6DA 1ELGA 4E7RG 3VXEH 3SI4H 5FBIA 1P2NA 4CHAB 3N7OA 5CHAB 2QF0A 1JIMA 3LONA 1ANEA 1ZTJA 3LC5A 3SU4A 1V3XA 4CRAA 5ETXA 4FU7A 4ABEA 1EPTA 1YGCH 2ZPSA 3TGIE 2UUYA 4NA8A 1ZHRA 4A1XA 4Q80A 3STJA 4X2XA 1GBDA 2ILNA 3TITA 3JZ2B 1ZPZA 1O37A 1VZQH 1YPHE 2O8LA 2IJOB 1D3QB 1TA6A 1K1PA 2HLCA 3SHAH 1AD8H 2VH0A 7GCHF 5EOKA 1EPTB 1WQSA 3ZV8A 1UTMA 2OLGA 1A2CH 4GCHG 1ZMLA 1ELTA 4K8BA 1BHXF 1WCZA 4FVDA 1TLDA 4NZLA 4AB8A 1WSSH 2FI3E 2HGTH 1LKBA 3ITIA 2WPMS 3SJIA 1C2FA 4K3JA 1QRWA 1O3KA 1UTJA 4XSKU 1C2KA 3EGKH 2AIPA 4FUIA 1NS3A 4D9QA 1O2HA 4R0IA 3H7TA 1W10U 1XKAC 4YZUA 3RXFA 1AWFH 4A1VA 3O8BA 3VEQB 2Z94A 4YLQH 1KXCA 1VR1H 4GPGA 4UFGH 4AZ2B 1FPCH 2B0FA 5LPFA 3GCHC 2J4IA 5L2YH 1NROH 1S6FA 1SLVB 4K5ZA 1O2PA 1GBEA 2A4QA 3TJOA 3TNSA 1SQOA 1QIXB 4ZHLU 1AGJA 1O3GA 1GWAA 2G00A 2WPKS 1HV7A 3GICB 1SLXB 1ZGVA 3P8GA 2ZU2A 1UVSH 1A0LA 6CHAC 2ZDNA 3LGYA 5EPYA 2BY9X 1KTSB 4Q7YA 3U8OH 1O31A 1GBLA 2A2QH 2SGFE 1XKBC 4JZIA 1SQTA 4X8VH 1P2IA 3RLWH 1T7CA 3V12A 1YPLH 1C5UA 1KY9A 1CVWH 4MTBA 1HDTH 2FO9A 1NU7B 2Z9IA 2V35A 4TYDA 5C1UA 1O3DA 4FUGA 1FJSA 2G8TA 2BD9A 1EJAA 3SNCA 1A3EH 1WU1A 3EE0B 3PM3A 5FX6A 2A4OA 4FUDA 2FI4E 3SUGA 1GGDC 1LO6A 1GMDF 3QTOH 1C5NH 2FODA 3GYMA 3RXDA 4AFZA 4ISHH 3O8CA 3DD2H 3NXPA 4ZH8A 1C2DA 3ZZ7A 1GI3A 1O2JA 3E16B 4MVNA 1UTQA 2HRVA 2VGCC 1PJPA 4AORA 5CE1A 1D6RA 1C2EA 2V6NA 3GCTG 1QJ1B 2P3UB 1QA0A 2AERH 3M35A 3PYHA 4Y8XA 2A32A 2OQUA 5DP5A 1OSSA 4DJZB 1PPEE 4TY7A 3AAVA 1HGTH 2FZZA 5DK1A 1C1NA 4SGAE 2ZTZA 3MTYA 4IN2A 2SFAA 3UY9A 4RKOB 1FAXA 2XYAA 1K2I1 2FWWA 1TA2A 4Y0ZE 1EB2A 1N1LA 1O2GH 3Q00A 1AIXH 1C1RA 1YYY1 2BD5A 3STIA 4A5TS 1DUEA 2VIOA 4Y7AA 2W26A 7KMEH 4I31A 2ZNKH 5JBBS 1T8LA 3R3GB 4BTIB 1GHBF 3T28A 4A1TA 1GI6A 2C4FH 1BRAA 1TNHA 4K1EA 1C1TA 1TQ7B 2QY0B 1ORFA 4AG2A 1IQGA 1SG8B 1V2OT 4MNXA 4NIVA 3PMHB 1LVBA 1A1RA 3GY8A 1B7XB 3SNDA 2ANWA 1G30B 1Q2WA 1BBRH 1CO7E 3Q3YA 4WWYA 3FZDA 2FOHA 3RXUA 4I32A 2Z6BD 3FP8E 1K9OE 1KXAA 4K69A 3BV9B 1LQEA 1LHFH 2CGAA 3RU4D 1JBUH 4NA9H 3RUOA 4IC5A 4TPIZ 1UVTH 2VVVA 2WPHS 2ZGCA 4OS2A 1INCA 1BUIA 1P9UA 4DOQA 2CMYA 1SOTA 1Y59T 1DSUA 1TBZH 2O8UA 1SGFA 2W3KA 2Z9JA 4AGJA 4JZEH 2HALA 3RMOH 1HAGE 4AB9A 3ZVAA 2XRCA 2A31A 2ZHEH 1UTNA 2ZCLP 3CS0A 1WOFA 3U1JB 1HAVA 3SU2A 3T25A 4XBBA 2Y5FA 1TAWA 3RMLH 1ELEE 2P93A 3V13A 5DKMA 2A4RA 1KIGH 1ETRH 2FOAA 2VIQA 2FEQH 3E6PH 1WUNH 2ANKH 5F6MA 3MI4A 1DDJA 1SGPE 3PV4A 4UE7H 5AFZH 1Y3VA 3NPSA 1O5FH 3UR9A 1RTLA 2ULLA 3MO3A 1V2NT 1DY9A 1ETSH 4X8TH 2BXUH 3KGPA 1GI2A 2JETB 4X1NU 3DT0H 1OP2A 2ZFSA 5LGOA 3GY4A 2BD3A 1EAXA 2SGDE 3LIWA 2H5CA 3ODFA 2R3UA 4ABFA 2FDAA 1THPB 1C1SA 4Y8YA 1O3FA 3QZRA 3A7WA 3D62A 1ACBE 2VIPA 2W3IA 3VGCC 1OYQA 3T27A 1MAYA 5ABWA 1GI5A 1V2ST 2ZPRA 1D9IA 1RIWC 2AMPA 1O5BB 3EAJA 2WV4A 3GDVA 3GISB 9LPRA 2EI7A 5F8TA 1ELCA 3MU5A 1O5GH 3PLBA 1XXFA 1EB1H 3D49H 2M5TA 4THNH 2BDCA 3L33A 1H4WA 4AFSA 1HJ9A 2QV1A 1P2JA 3SV8A 1V2VT 1KXDA 3PROA 3PB1E 3TNTA 1ZMNA 2C8XB 3SHCH 2FOEA 2PKSB 1MTWA 3P92A 1O30A 1GDQA 3SNBA 4GHTA 3UTUH 4KP0A 3ZYEA 1ELVA 1L2EA 1FXYA 4NA7A 1Z8JB 2P8OB 1GMCF 1RS0A 1THSH 3C1KA 1S0QA 4WMFA 4X8UH 2BD7A 3D65E 2BDGA 3M7TA 4JZDH 5A09A 4UEHH 3BTKE 4ZXXH 1P2QA 3PO1B 4B71A 1DS2E 3FP7E 1XXDA 3GDUA 3TJUA 1C2IA 8LPRA 5L30H 2UUFB 3GCOA 4LXBH 1QTFA 4MPXA 2CHAB 3TU7H 1A46H 2VVUA 1O3MA 4X1QU 2B9LA 1HIAA 1IHTH 1C9TA 1H9IE 1UHBA 1A0HB 2OINA 2CXVA 4XE4A 4B2BA 3UOUA 2V0BA 4X6PA 1DE7H 3SU3A 1LVYA 3ZZ4A 2TPIZ 2PUXB 1BTPA 1J15A 4YLUA 2QC2A 3IG6B 2TGPZ 1GHXH 4OS7A 5C5NA 3TK5A 1O2WA 1HIAB 3P8OA 1UHBB 1FY5A 1ZMJA 2PW8H 4ABDA 5HM9A 1YLDA 3LGVA 3LT3A 1FUJA 1NM6A 2HVXA 5IDKA 4D76A 1VCQA 1Y3YA 4K8YA 2FYRA 2PWXA 1XVOA 1XUKA 1TPOA 2ZHQH 4ABJA 1GBAA 5EXLA 3DFJA 3BEUA 1T31A 2PTNA 1GMDG 2BM2A 3CP7A 1HJAC 1GI7B 3S9BA 1BQYA 3ZZ5A 3KQEA 3P8NA 4FUJA 2Y6TA 4AFUA 3RXLA 3FP6E 1TX8A 1EAUA 5DGJA 4CREA 3MO9A 1PPFE 3TH2H 2AGGX 2J95A 3RLYH 2Y80A 2D26C 1MKXK 3JZ1B 2P16A 1GBCA 1OS8A 4Y8ZA 2GCTB 3MNSA 1O32A 3LGWA 1E36B 3S0NA 3T29A 1A7SA 2G51A 1F0SA 1P0SH 5HXFA 1Y5UT 1FI8A 3MWIU 1WV7H 3U69H 2OBOA 4YOJA 3SI3H 2A1DB 1IQJA 1CGHA 1F7ZA 1O5EH 1TFXA 2AEIH 1QB6A 3BEIB 5TJXA 2NU0E 3M7QA 1J16A 1C1OA 1D6WA 2XC4A 2SNWA 2WPIS 1DX5M 3P17H 4ZMAH 4DCDA 1S0RA 5PTPA 2VIDA 3HPTB 1VJ9U 2OD3B 1PPGE 3TLOA 5DP8A 4B1TA 1XM1A 5C20A 1O2NA 5EQSA 1L1JA 3NWUA 1J9CH 1DLEA 2P59A 1GHBG 2QXGA 3UR6A 2ZI2H 1G37A 2TIOA 3BN9A 3SJ9A 1DFPA 1VGCC 2YOLA 3M5NA 1HAHH 1NFYA 1Z8GA 1HAYB 4Y76A 1VCWA 3TGJE 1BTUA 5DP9A 1QA7A 1SB1H 2TGTA 4ZKNU 1W0ZU 1T8OA 4MDSA 4FUFA 5FHTA 2JH6D 1CA8B 2GMTC 1EATA 5EQRA 3RXPA 1ZJKA 1ZR0A 2LNCA 1W11U 3A7ZA 2ZU5A 1NRPH 1TALA 1BJVA 3A84A 1OWKA 3NCLA 1CBWB 2F9VA 1IQFA
chains in the Genus database with same CATH superfamily
4O9VA 1DICA 1DWEH 1YPHC 3MNCA 5HMAA 3S7HB 3HGNA 3RXAA 3QN7A 1EUFA 1GBJA 1SMFE 1XUIA 1E34B 5HKKD 4DW2U 3K65B 2BZAA 3I29A 1EASA 3M3VA 2OTVA 4UFFH 3S7KB 4GSOA 5EGMA 1DSTA 4CR5A 4CRGA 1O2SA 4PROA 1BZXE 3SV7A 3RXCA 3TK6A 1YY3A 1TNLA 1JOUB 3SUFA 1GG6C 2BVXH 2OC8A 3H5CB 2ALVA 1BMAA 5T6DA 1C4Y2 4BAMB 3RMNH 1PFXC 1GI0A 5EW1H 1SGQE 3PLKA 2XNDD 3F0PA 1YC0A 4ABAA 3FFGA 1EZUC 2ASUB 3UUZA 1IQNA 1H8DH 4E06H 2W6ID 2GV7A 3BTGE 4R8TB 3RXQA 3F9HA 3SBKA 4NCYA 2ZC9H 4GAWA 3ZV9A 2F4LA 4Q4LA 1YPKH 2PGBB 4FU8A 1Z7KA 2NU1E 2VB0A 1GHAF 2O8WA 1QB1A 2TRMA 2Y82A 3GDSA 3TJNA 4GHQA 3RXTA 2HPPH 2XBVA 1SPJA 3CNRA 2I6SA 5DO4H 1NPMA 1TNKA 1DXWA 1HXEH 2G55A 4CRBA 4RT0A 5FL7D 1BRUP 3MYWA 3O8RA 4X1PU 1Y5AT 1TMBH 1SGDE 1CT2E 1GVZA 1FNIA 1J14A 1JWTA 1PQ7A 1OWEA 1EZXC 1LVOA 1BHXB 1C1UH 1AB9B 1AFEH 3ZZ3A 6ESTA 1SHYA 5KGOA 3A8BA 2ESTE 2K0QA 4NWLA 1SC8U 2BY8X 5LPEA 4DIIH 1FY1A 3SZNA 1AO5A 1BT7A 4CHAC 1GMCG 1UTKA 2FESH 3RU4E 5HYOA 4INKA 2IPHA 3RM2H 4Y7BA 3SU5A 2RA0A 1MD7A 2DUCA 3NZIA 1Y5BT 1ZRKA 2A2XH 3RXIA 1WBGB 3NUMA 3SUEA 1QL9A 2GP9B 2ZEBA 3M37A 1E38B 3GCHB 1Q3XA 1E35B 2AFQB 1GBHA 1P3EA 1LHGH 3OY6U 1NZQH 4ISNA 4LZ4B 2XCFA 1CHGA 5CDFE 2BVSH 1KXBA 5J4SA 3M61U 3SJKA 2XXLA 1YCPM 2XW9A 3KF2A 2BD2A 3U8TH 3T62A 1P03A 6CHAB 1EJMA 1SKYE 2TBSA 2CN0H 1GBMA 1RGQA 1SGTA 1YLNA 1MH0A 1MUEB 3AAUA 3FO8D 3ZVBA 4JYUH 1D3DB 2HWLB 1DWCH 2AIQA 3LC3A 1TMTH 4I8HA 3MQKC 1YPMH 1W7XH 4Y79A 3TH4H 3PTBA 5CMXH 1MU8B 2PTCE 1E1QD 4Y0YE 3A7TA 1SGCA 1ESTA 2ZFPH 1FAKH 2XOKD 1G9IE 2SGEE 2RDEA 3HKJB 2UUKB 1XX9A 4GUXA 1GGDB 5LPRA 4MG3A 2BLOA 3E90B 1BMFD 3AK5A 1HLTH 1TGCA 2FOFA 2C93B 1KXEA 2VWLA 1O3JA 2ODPA 3GCNA 3HGPA 2FXRA 1KYNA 1UVOA 4P02A 3PV5A 1L1GA 3SQHE 5EW2H 4YT6H 1SLUB 2B8OH 2DE8A 2ZCHP 1C2LA 2QN5T 3I77A 1IQLA 2BQ6B 2FPZA 1GCTC 3A89A 1C5XB 2VVCA 1ESAA 4U32A 2Z7FE 2VWNA 5ESTE 4QT8C 3SJOA 4IN1A 5E0HA 5A0BA 1NY22 5C0TA 3ZZDA 1O33A 1V2QT 1OWHA 1O3AA 3TJVA 4JZ1A 4ZHMU 1HNEE 2ALPA 2BY6X 3ZZ8A 4BXSA 2WPJS 1FLEE 1GJ8B 1XMNB 4I8JA 2W7SA 1QR3E 1F2SE 1D3PB 5E0GA 1C1QA 2QCYA 1G3EA 1T4VH 3F68H 2ZDLA 4ABHA 3LKWA 3BEFB 1MTNC 1QL8A 1UCYH 1OX1A 4WY3A 1GJ9B 1KSNA 1LPGB 3W95A 2NU2E 2WINI 3OU0A 3SOSA 1EOJA 5GWZA 3RXHA 1Y3WA 3C27B 1H9LB 1AU8A 4WJG2 4IC6A 4GVUA 1P12E 4ZAEA 3WWBA 1O3PB 3S69A 1TRNA 1MBMA 2P94A 5A8XA 3QO6A 1UCYK 1TRYA 1YCPH 3ATWA 2SGQE 1RRKA 1C1VH 2JH5D 2ZDVH 2EA3A 3E3TA 1HB0B 1C2MA 2GV6A 1C5SA 1BTYA 4OS4A 5EPNA 1GBFA 2PSXA 5LH8A 1HFDA 5C1YA 1NO9H 3P6ZB 4UFEH 4E05H 2GCHF 1GI8B 4JCNA 2BB4A 1H8HD 1BIOA 2OUAA 1RTFB 3BTWE 4KTSA 2C8YB 2IOTA 3PLPA 3GY5A 3RP2A 4AC9A 2CJIA 1C2GA 1BMMH 3OX7U 1VCPA 4F49A 1VITF 3ZVDA 2A7JA 1O2UA 3LDXH 1TOMH 1UK3A 2B5TB 5C67A 1C1WH 4BTUB 1ZHMA 2FS8A 2YMSD 1ABIH 4OS1A 4X6OA 1ZTLA 4XFQA 2C90B 8KME2 2ODYB 3RXRA 3KN2A 3GOVB 3VB7A 5JB8S 1BBRK 4F55A 1S81A 3NK8A 3K6YA 1HAIH 3KCGH 5HIZA 3K6ZA 5DP7A 2GD4B 1WAYB 5HGGA 1SQRA 2BY5X 1O2OA 1UTLM 3PWCA 4Y11E 3AW1A 3GYLB 3OE7D 3URDA 1FY3A 2TGAA 1W7GH 2YNAA 4K60A 1O3CA 1O0DH 3ATKA 1SSXA 1ETTH 5AF9H 2QXIA 5T3HA 1NRRH 5JBCS 4X0WU 1ANBA 3OTPA 3MOCA 1PYTC 5JDUB 1B0EA 2BLQA 5DSFA 2BDYA 3UFAA 5E0JA 2ZHDA 3BTTE 4X2VA 1W13U 3Q3XA 3PTNA 1ZOMA 5GJ4B 1OWJA 1GHAG 3IWMA 8ESTE 2P3TB 1PPBH 4OM9A 1MKWH 5K7RA 2EY4C 3TGKE 3M5OA 2G5VA 1S6HA 3BG4C 1GJ7B 1HRTH 3UIRA 2V3MA 2ZFTA 2ZWLH 3FZZA 3OY5U 2WUBA 1HCGA 3QGNB 1LCYA 3A81A 4NSYA 1TB6H 1C9PA 1GL1A 4OGXA 2ZU1A 4BAHB 1E37B 3UWJH 4ZHAA 1PQ8A 2R2WU 1ARBA 1SFQB 2ZTYA 2WYJA 3IITA 3DA9B 1ELFA 1ESBA 4X1RU 1FV9A 1F0RA 1GMHF 3TIUA 1MZAA 5F8XA 5DP6A 5GXPA 3K9XB 4OGYA 3QLPH 3MU0A 4VGCC 2FYQA 3BTDE 4KELA 4OS5A 1QGFA 2Z9GA 1W2KH 5EIYA 4J2YB 3LH3A 5GNDA 2GJGA 1A61H 1ZTKA 4FUCA 4WH6A 2BXTH 4U01A 4WXIA 1EXFA 2NWNA 3G01A 3SORA 3ODDA 3A88A 1C5WB 1N8OB 2JETC 1UTOA 1BOQA 3RMMH 4NSVA 2J2UA 2FM2A 2RDLA 4TWWA 1O3NA 2UWOA 1W14U 2BLVA 1W0KD 3F6UH 1A5HA 2BLWA 1ANCA 2LPRA 5G4BA 1P05A 1QRXA 2QF3A 1T8NA 5C2ZA 2ZECA 1OKXA 4ZUHA 4DURA 2M2AA 4LOYH 3SV6A 1ZPCA 4IW4E 4CRCA 3CENA 4H6TA 1P3CA 3FAOA 1S6LA 2PGQB 2A5AA 4D7GA 1COWD 1QFKH 4WH8A 3UREA 1GI9B 3LJJA 1BCUH 1J8AA 4ASHA 2G4TA 1QL7A 2QGRA 3ZZAA 4CRDA 4O3TA 1GDNA 1BITA 1CT4E 5L6NH 1O2YA 3UQVA 1O3BA 1V2RT 2A0QB 4BTTB 1LHEH 1AUJA 2PKSC 3VB6A 3P95A 3W94A 2H2ZA 3SNAA 3OAAD 3PRBA 2KM0A 2DE9A 1ZZZA 1L4DA 5FCKA 3RC6A 2ZFFH 1P04A 1PQ5A 1B0FA 1HJAB 1K1LA 2VIWA 1SGRE 3ZZ9A 3UNRA 3RXBA 3V7TA 3A8AA 2A5KA 5FCRA 3PO1C 2GGVB 3SGQE 4I86A 2BYAX 3LU9B 1B5GH 4YXWD 2W7UA 3MH6A 2BY7X 2OC7A 1O5DH 2JJ1D 1C5YB 7ESTE 2CHAC 3LGIA 1V2JT 1FN6A 2GDEH 1G3DA 2Z3EA 2F9OA 3Q3KA 2HPQH 2BTCE 5IYTA 2W5EA 4B2AA 3RDZA 3E1XB 2V3OH 3KIDU 3OEED 5A8YA 1HBTH 4DGJA 4UONA 3VXFH 1C4U2 1HAZB 2GVFA 1LKAA 3KQBA 1BRCE 3UB0A 4AFQA 3ZVCA 1FMGA 1MTSA 4Q7XA 1V2LT 2R0KA 4XDEA 1T32A 1ANDA 3FANA 4E7NA 5JB9S 1TWXB 1AFQB 3V0XA 3WW7A 2WSSD 2G4UA 1E0FD 1HAPH 1L1NA 2FP7B 1NFWA 1O3OA 3PMAB 1K1IA 4A92A 1CHOF 1C5MD 2STBE 1EKBB 3SV9A 2O8TA 4KTUA 1F92A 3QZQA 3RXGA 1V2KT 3T26A 4ASUD 1BTZA 1YP9A 1XVMA 1LQDB 1VGCB 1ZGIA 2LP6A 3QTVH 1TX7A 1AY6H 4FETA 1P02A 2BDAA 1W8BH 1SL3A 2Y5HA 2G81E 4AOQA 3BTFE 2OC1A 2SNVA 1AWHB 3GY3A 1O3LA 1P2MA 4JYTA 2Y7ZA 1GHYH 3OSYA 3QWCH 2A7CA 3ENSB 3ZZCA 2KX4A 2NU4E 3BTQE 2FTLE 2PKAA 1W12U 2G5NA 5A0AE 4U2WA 4DVAU 2XBWA 3H7OA 2FOGA 1Z8IB 1BTXA 3NKKA 1TYNA 2BMGB 1F5RA 2GCHG 4MNYA 5DP4A 1ZHPA 4B6EA 3F1SB 2ZQ1A 1NTPA 1TONA 1GVLA 2TGDA 1UVPA 3E91A 2YMSB 3UNQA 3RXKA 2FOMB 2PKAB 3ZVFA 2WYGA 3Q77A 2ZDAH 1NRQH 1Z8RA 1FQ3A 1OOKB 2BDBA 3F0OA 1VITG 4OS6A 2ZQ2A 1LHDH 4JK6A 1QBNA 1GDUA 2WPDD 4D7FA 1YF4A 4ABBA 4YTAA 1YBWA 1RFNA 1OP0A 1YLCA 3U9AH 1HXFH 1V2UT 2ZGBH 1O39A 2HNTE 2V7QD 1NRNH 2OP9A 3QK1A 1H1BA 1TMUH 1GG6B 1O2TA 1A3BH 3A8DA 4O03A 1TIOA 2D1JA 1GBTA 5JPMH 1O3IA 1IAUA 4ZKSU 4B73A 1O2IA 2QYIA 4YO9A 3F9GA 4ISIH 1C5OH 5FPSA 1Y8TA 1NRSH 1IQMA 3EA7A 2ZGJA 1AZ8A 2ZPQA 1UCYE 3PRDA 1RD3B 3E8LA 1GI4A 1GHWH 1ZRBA 4FOUC 4HTCH 5DJ7A 3ZZBA 1FIWA 1Y3UA 4DT4A 4I7YH 4B2CA 4H42U 2F9NA 1UVUH 1P11E 1VITH 1IQIA 1GJ5H 1DITH 4AYVB 2PLXA 4IGDA 4B76A 2Q1JA 4RN6A 1BTWA 1Q31A 1FY8E 5J4QA 3RU4T 2UUJB 4ESTE 3MH7A 1JXPA 5SGAE 3RXJA 1AE5A 2K8IA 3VFEA 2AMDA 1MCVA 3QUMP 1LDTT 2UWLA 1TGBA 4JMYA 3EYDA 5FAHA 3R0FA 5DP3A 2F83A 3MU8A 5GCHF 8GCHG 3M3SA 3CS7A 3GY2A 1A0JA 1O2QA 3U8RH 1QRZA 2ZU4A 1GCDA 2ZHFH 1GMHG 3HATH 4KGAA 4YOIA 1W3CA 1GJ4H 5T6GA 1SOZA 1BBRE 1AVGH 1F5LA 2BQWB 3TK9A 3F9EA 3LPRA 1ELDE 1JRSA 3A85A 3LGTA 3KHVA 1CA0C 3BTHE 2HLDD 1XUHA 3DFLA 3O8DA 1FZZA 3OTJE 3U28C 2IN2A 1ZPBA 3M3TA 1S85A 1AVWA 2LELA 4BAKB 1GHVH 3VB4A 3HK6B 1PPCE 3ESTA 1O35A 3UQOA 5EODA 1DWDH 5CHAC 1QJ7B 1AVXA 4Y71A 4FUBA 4MQAA 1XUFA 2GKVE 2EC9H 3M5LA 4WVPE 4MNVA 1TQ0B 2V3HH 2Y7XA 2AMQA 2BHGA 4NGAH 1BTHH 1ELAA 1OYTH 4Y10E 2FOCA 1GBIA 1Z1JA 1A5GH 5AFYH 2ZGXH 3VPKA 2W6JD 3ZVGA 4D8NA 3SGAE 3P8FA 1MMJN 1Y3XA 1DUAA 2XWBI 3AW0A 1O3HA 1NFUA 1TGNA 1GBBA 2BX3A 3EE7A 4U30A 1P09A 1LVMA 2QA9E 1EPTC 3KQDA 4D9RA 1AB9C 3F2GA 4TSFD 3E0NB 4INLA 2A45B 1NN6A 1UMAH 3A83A 4YT7H 2O8MA 1P8VC 4CR9A 3UNSA 1SGIB 5B6LA 1TBRH 1QQ4A 3EDXB 1CU1A 1JMOH 1FIZA 1OP8A 1ZYOA 2EI6A 3F9FA 2QXHA 1RTKA 3EQ0H 1IOEA 3VG8A 4Q63A 4BNRA 1Z71A 7LPRA 4NIXA 4RSPA 1GJBB 1SLWB 2BZ6H 2J5UA 2ODQA 4BXWA 2GTBA 3LOXA 1P10A 2D2DA 1DPOA 4K1TA 1TBQH 5FBEA 1QBVH 2A7HA 2FOBA 2R2MB 2ZHWH 1GCTB 1QJ6B 4DY7B 4Y6DA 3URCA 1HAXB 2AGEX 2I6QA 3OYPA 4YESB 1IQKA 2R3YA 2ZFQH 3L6PA 1AUTC 1ZSKA 2VGCB 1AI8H 3BIVH 2GDDA 4ZXYH 4I33A 4IMZA 1V2MT 4ZROA 1DWBH 2VWOA 3FN8A 2FTMA 1D4PB 4H6SB 9ESTA 4WMEA 1G3CA 1VJAU 4MNWA 4LZ1H 4P00A 2XC0A 4ISOA 2XBYA 2ZF0H 3MU4A 5GPIB 1O5CB 4TPYA 5E8EH 1MQ6A 2CK3D 2AGIX 1CHOG 2BQ7B 4X2WA 1MTNB 2AH4X 4K1SA 1F0UA 2BX4A 1K1JA 4IBLH 2EQNA 3DSGA 2J94A 5HIYA 2F3CE 3TPIZ 1X7AC 1UK4A 1O2KA 1WTHD 5L2ZH 1SFIA 4AG1A 1S82A 1DY8A 1LTOA 4YM9A 1EOLA 1WDIA 1C2HA 3MH5A 1EJNA 4AX9H 2VU8E 1SR5C 2XBXA 2BDIA 3GS9A 1YPGH 1FN8A 1P9SA 4CH2B 2PFEA 3LJOA 2IJD1 1GL0E 2UWPA 3K2UA 2Z9KA 3P70B 1GJAB 1O3EA 5EU8A 1C5VA 1BB0B 2F91A 2YNBA 5H4IB 5K0HA 1N6XA 3BIUH 1YPJH 4HFPB 3TH3H 2BOHB 3SUDA 3ELAH 3FVFB 1P01A 3H09A 4NFEA 1ARCA 2HOBA 2ZZUH 2OXSA 1O2XA 2FLBH 1ELBA 2FX6A 1C5RA 4NIWA 6GCHF 1QY6A 5C0UA 1V2TT 1KLTA 4GLYA 4Q7ZA 3RXEA 4CH8B 3T5FH 1DANH 3BSQA 1P2KA 2ZA5A 3QDZB 3AVZA 1YM0A 1YCPK 4X6MA 2CF9H 1GPZA 1LPKB 1HAOH 3ZYDA 3L3TA 1FONA 4F4OC 1PPZA 1DT2A 1ZSJA 2JDID 2QAAA 2WV5A 1C5QA 4XD7D 4AGKA 1QQUA 4BAQB 1T4UH 5A8ZA 1C5PA 2H5DA 4XOJA 4Z6AH 3A7VA 4WF8A 5ESBA 1KDQA 5EJ1A 1QCPA 1EQ9A 1UO6A 1C5TA 1KXFA 4ACBA 1GJDB 3S9CA 4O3UA 2C8WB 1F5KU 1C5LH 1WTGH 2FMJA 1NBMD 5EXNA 4BOHA 4INHA 1OWDA 2ZGHA 3SNEA 2GZ9A 2ZP0H 5T6FA 3MMGA 1J17T 1V2PT 1EAWA 2PR3A 2RG3A 6LPRA 4TT3D 4WMDA 5B6OA 1KDQB 3HKIB 4FUHA 1MAXA 2KAIA 1Z6JH 2HVYB 3PMBB 1N6YA 2VNTA 1HJ8A 3SU6A 1K28D 3BG4B 2AS9A 3ZIAD 2XNIA 2ANYA 4JYVH 1E1RD 1L4ZA 2FS9A 2Q6DA 2VJ1A 2A5IA 1MTVA 1YKTA 1FDPA 2ZFRH 1TPSA 3AASA 1EZSC 2BDHA 2KAIB 5GCHG 1BJUA 3DCLA 3ATMA 5EQQA 2R0LA 1OWIA 4ABGA 5F53A 2AYWA 3PWBA 5BPEA 4KTCA 3SO3A 3VGCB 2J34A 2R9PA 2B7DH 1P57B 3KEEA 2F9BH 2SGPE 2WPLS 1BDAA 1THRH 2Z9LA 4UFDH 1QHRB 3LGUA 1O5AB 1ZLRA 4RKJB 1RIWB 1UK2A 4VGCB 4XBDA 3KNXA 5JYIA 1MU6B 1MKWK 4CBNA 1IHSH 1G2LA 4FUEA 1TABE 2XC5A 1SGEE 5FPTA 2XTTB 4NWKA 8GCHF 1GBKA 1OHHD 1KLJH 3SU1A 3F3BA 4UDWH 1QNJA 2F9PA 1GI1A 2ZDMA 4CRFA 1HAVB 1UW7A 4KKDA 1AKSA 5F03A 2H9TH 1A5IA 2SGAA 5A0CA 2Z3CA 1FPHH 1YWUA 3ATIA 4M9FA 1RJXB 3A80A 5EG4A 3LH1A 3SYJA 1LHCH 3VB3A 2PP6A 7GCHG 1SQAA 4XBCA 4FXGH 2J92A 3M5MA 4ZCNA 3N7DA 1G3BA 2XCNA 1SVPA 1C1MA 1SBWA 5DPAA 4DT7B 1AKSB 2GX4A 3BF6H 1KTTB 2BD4A 3U1IB 5C1XA 2C3SA 2WHXA 2BD8A 3TVJB 4AN7A 1AQ7A 3KQCA 2EEKA 2A4GA 1NC6A 1T8MA 4Z0KA 1ID5H 4CBOA 4IS5A 2FLRH 1O2VA 2FX4A 3M36A 1EP5A 1TE0A 2J38A 3MFJA 4H4FA 1C1PA 1QURH 3WY8A 5C3NA 2FI5E 4GCHF 1GJCB 1EX3A 5I25A 3S9AA 5TCCA 3QX5H 3QGJA 2L74A 3ATLA 3RXVA 3ZZ6A 1DM4B 4MPVA 3UWIA 4NG9H 3UOPA 1DXPA 1K1NA 3V3MA 3PMJA 1LPZB 4ISLA 2XWAA 1PPHE 2VINA 1S84A 5EXMA 2KCYA 1N8OC 1AE8H 2ZU3A 4J1YA 4HGCA 2OK5A 4NFFA 5FPYA 3DHKH 1H9HE 2THFB 1CQQA 1NFXA 4A6LA 4FVBA 1TX6A 2IPQX 4M7GA 3SU0A 2P8OC 2ZKSA 1M9UA 1U6QA 5HM2A 1BMNH 1GVKB 1OPHB 1O38A 4IMQA 4O97A 1HPGA 2Y5GA 1S5SA 2OBQA 1G36A 5A2MH 1V2WT 1OXGA 2PV9B 3A7YA 3RXMA 3MU1A 4UD9H 1A4WH 2H9EH 3MO6A 1MZDA 5F8ZA 4HZHA 2HNTF 1NESE 1TNGA 1QZ8A 3A8CA 3EA9A 1O2LA 3HK3B 1ZSLA 1F0TA 2GZ8A 3B8JA 3FKSD 2GT7A 2GZ7A 4WXVA 1P2OA 3EA8A 2WUCA 3F2HA 5JBTA 3A82A 3BG8A 2HNTC 3A87A 4TY6A 3SW2B 3T2NA 5I46H 1SGNE 1XUGA 2CF8H 2KCAA 1MKXH 1W0YH 2ZTXA 2BVRH 1CE5A 4B74A 1NU9A 4BAOB 4MPUA 2VWMA 2P3FH 2FIRH 4X6NA 4X8SH 5JBAS 1XUJA 1C4V2 4K2YA 1MBQA 2WZQA 3MH4A 2GT8A 5FX5A 2VBCA 2EI8A 2PHBA 4ZKRU 3SGBE 4ZKOU 4JK5A 1FY4A 2OC0A 2QIQA 2J97A 1Z1IA 3U98H 3VB5A 3MNBA 1SI5H 4Q2KA 3RM0H 4FU9A 5DG6A 1TNJA 2PSYA 1HUTH 1G2MA 2KZ4A 1EAIA 1RXPA 1DVAH 3KYFA 1BA8B 1L0ZA 2J9NA 1O34A 1K21H 3GCTF 3RC5A 4AYYB 1QB9A 6GCHG 1CSOE 2GMTB 5AHGH 1BRBE 3BTME 1AFQC 1NT1A 2GCTC 5IK2D 2ZDKA 1TGTA 1E79D 1AHTH 3KL6A 5E2PA 1H8IH 4ABIA 4NIYA 1DLKB 4RI0A 3SQEE 3SJ8A 3E0PB 4JZFH 4Z1MD 3GY6A 3SN8A 1TNIA 2NU3E 2KR7A 1WYKA 1BMLA 1PQAA 2O9QA 2D8WA 4TWYA 1EZQA 1EP6A 1G32B 3M7UA 3UPEA 1JIRA 1S83A 4I8KA 3SV2H 1MTUA 2STAE 5GDSH 3F2FA 2ZO3H 5C5OA 2ANMH 1P06A 2H6MA 1W0JD 1HYLA 1K22H 3A86A 1ZJDA 3RC4A 4DG4A 2K1QA 1JRTA 3B9FH 2OQ5A 3BTEE 1TPPA 2OCVB 4MLFB 2Q6FA 4NZQA 2RA3A 1LMWB 5E2OA 1UTPA 4HI3A 4BANB 3ZVEA 5AVDA 4YOGA 1SGYE 5FXLA 1AMHA 1KLIH 2JKHA 1AN1E 2RCEA 4I8GA 4SGBE 2YMSC 3OEHD 4I8LA 2F9UA 1QBOA 4A7IB 4B75A 1O2ZA 3RXOA 4DIHH 1UJ1A 2ZG0H 2VIVA 3MHWU 1C2JA 1Z6EA 2PUQH 1YPEH 1KMHB 3RXSA 4X2YA 1MD8A 3B23B 1DOJA 2CV3A 3DUXH 1MQ5A 2P95A 2Z3DA 1PYTD 1CGJE 1CT0E 1GJ6A 1ABJH 2Y81A 1CBWC 3GY7A 2G52A 2H9HA 3A7XA 4MPWA 2H1UA 1WXRA 1K1MA 2ZIQH 4X1SU 2QF5A 1AZZA 1D3TB 2VH6A 1C5ZB 1WQVH 1IQHA 5BRRE 1O2MA 1TGSZ 1SHHB 5GIBA 1O2RA 4LK4A 3D23A 1SGFG 3MNXA 2Q6GA 2BOKA 1K1OA 1MCTA 1O36A 2JH0D 3Q76A 1TRMA 1GHZA 2ZCKP 1CA0B 1CGIE 2C8ZB 5TCAA 1TOCB 1TPAE 2QXJA 1IQEA 3I78A 1V6DA 1ELGA 4E7RG 3VXEH 3SI4H 5FBIA 1P2NA 4CHAB 3N7OA 5CHAB 2QF0A 1JIMA 3LONA 1ANEA 1ZTJA 3LC5A 3SU4A 1V3XA 4CRAA 5ETXA 4FU7A 4ABEA 1FX0B 1EPTA 1YGCH 2ZPSA 3TGIE 2UUYA 4NA8A 1ZHRA 4A1XA 4Q80A 3STJA 4X2XA 1GBDA 2ILNA 3TITA 3JZ2B 1ZPZA 1O37A 1VZQH 1YPHE 2O8LA 2IJOB 1D3QB 1TA6A 1K1PA 2HLCA 3SHAH 1NBME 1AD8H 2VH0A 7GCHF 5EOKA 1EPTB 1WQSA 3ZV8A 1UTMA 2OLGA 1A2CH 4GCHG 1ZMLA 1ELTA 4K8BA 1BHXF 1WCZA 4FVDA 1TLDA 4NZLA 4AB8A 1WSSH 2FI3E 2HGTH 1LKBA 3ITIA 5EJLA 5DN6D 2WPMS 3SJIA 1C2FA 4K3JA 1QRWA 1O3KA 1UTJA 4XSKU 1C2KA 3EGKH 2AIPA 4FUIA 1NS3A 4D9QA 1O2HA 4R0IA 3H7TA 1W10U 2KCOA 1XKAC 4YZUA 3RXFA 1AWFH 4A1VA 5C17A 3O8BA 3VEQB 2Z94A 4YLQH 1KXCA 1VR1H 4GPGA 4UFGH 4AZ2B 1FPCH 2B0FA 5LPFA 3GCHC 2J4IA 5L2YH 1NROH 1S6FA 1SLVB 4K5ZA 1O2PA 1GBEA 4B6FA 2A4QA 3TJOA 3TNSA 1SQOA 1QIXB 4ZHLU 1AGJA 1O3GA 1GWAA 2G00A 2WPKS 1HV7A 3GICB 1SLXB 1ZGVA 3DSPA 3P8GA 2J98A 2ZU2A 1UVSH 1A0LA 6CHAC 2ZDNA 3LGYA 5EPYA 2BY9X 1KTSB 4Q7YA 3U8OH 1O31A 3KQ5A 1GBLA 2A2QH 2SGFE 1XKBC 4JZIA 1SQTA 4X8VH 1P2IA 3RLWH 1T7CA 3V12A 1YPLH 1C5UA 1KY9A 1CVWH 4MTBA 1HDTH 2FO9A 1NU7B 2J98B 2V35A 2Z9IA 4TYDA 5C1UA 1O3DA 4FUGA 1FJSA 2G8TA 2BD9A 1EJAA 3SNCA 1A3EH 1WU1A 3EE0B 3PM3A 5FX6A 2A4OA 4FUDA 2FI4E 3SUGA 1GGDC 1LO6A 2KFWA 1GMDF 3QTOH 1C5NH 2FODA 3GYMA 3RXDA 4AFZA 4ISHH 3O8CA 3DD2H 3NXPA 4ZH8A 1C2DA 2QE7D 3ZZ7A 1GI3A 1O2JA 3E16B 4MVNA 1UTQA 2HRVA 2VGCC 1PJPA 3DSOA 4AORA 5CE1A 1D6RA 1C2EA 2V6NA 3GCTG 1QJ1B 2P3UB 1QA0A 2AERH 3M35A 3PYHA 4Y8XA 2A32A 2OQUA 5DP5A 1OSSA 4DJZB 1PPEE 4TY7A 3AAVA 5KECA 1HGTH 2FZZA 5DK1A 1C1NA 4SGAE 2ZTZA 3MTYA 4IN2A 2SFAA 3UY9A 4RKOB 1FAXA 2XYAA 1K2I1 3N7EA 2FWWA 1TA2A 4Y0ZE 1EB2A 1N1LA 1O2GH 3Q00A 2JIZD 3KYGA 1AIXH 1C1RA 1YYY1 2BD5A 3STIA 4A5TS 3SZEA 1DUEA 2VIOA 4Y7AA 2W26A 7KMEH 4I31A 2ZNKH 5JBBS 1T8LA 3R3GB 4BTIB 1GHBF 3T28A 4A1TA 1GI6A 2C4FH 1BRAA 1TNHA 4K1EA 1C1TA 1TQ7B 2QY0B 1ORFA 4AG2A 1EFRD 2KCPA 1IQGA 1SG8B 1V2OT 4MNXA 4NIVA 3PMHB 1LVBA 1A1RA 3GY8A 3N99A 1B7XB 3SNDA 4XRNA 2ANWA 1G30B 1Q2WA 1BBRH 1CO7E 3Q3YA 4WWYA 3FZDA 2FOHA 3RXUA 4I32A 2Z6BD 3FP8E 1K9OE 1KXAA 4K69A 3BV9B 1LQEA 1LHFH 2CGAA 3RU4D 1JBUH 4NA9H 2AHME 3RUOA 4IC5A 3WWFA 1H8ED 4TPIZ 1UVTH 2VVVA 2WPHS 2ZGCA 1VKYA 4OS2A 1INCA 1BUIA 1P9UA 4DOQA 2CMYA 1SOTA 1Y59T 1DSUA 1TBZH 2O8UA 1SGFA 2W3KA 2Z9JA 4AGJA 3PV2A 4JZEH 2HALA 3RMOH 1HAGE 4AB9A 3ZVAA 2XRCA 2A31A 2ZHEH 3W1EA 1UTNA 2ZCLP 3CS0A 1WOFA 3U1JB 1HAVA 3SU2A 3T25A 4XBBA 2Y5FA 1TAWA 3RMLH 1ELEE 2P93A 3V13A 5DKMA 2A4RA 1KIGH 1ETRH 2FOAA 2VIQA 2FEQH 3E6PH 1WUNH 2ANKH 5F6MA 3MI4A 1DDJA 1SGPE 3PV4A 4UE7H 5AFZH 1Y3VA 3NPSA 1O5FH 3UR9A 1RTLA 2ULLA 3MO3A 1V2NT 1DY9A 1ETSH 4X8TH 2BXUH 5T1VA 3KGPA 1GI2A 2JETB 4X1NU 3DT0H 1OP2A 2ZFSA 5LGOA 3GY4A 2BD3A 1EAXA 2SGDE 3LIWA 2H5CA 3ODFA 2R3UA 4ABFA 2FDAA 1THPB 1C1SA 4Y8YA 1O3FA 3QZRA 4HG6A 3A7WA 3D62A 1ACBE 2VIPA 2W3IA 3VGCC 1OYQA 3T27A 1MAYA 5ABWA 1GI5A 1V2ST 2ZPRA 1D9IA 1RIWC 2AMPA 1O5BB 3EAJA 2WV4A 3GDVA 3GISB 9LPRA 2EI7A 5F8TA 1ELCA 3MU5A 1O5GH 3PLBA 1XXFA 1EB1H 3D49H 2M5TA 4THNH 2BDCA 3L33A 1H4WA 4AFSA 1HJ9A 2QV1A 1P2JA 3SV8A 1V2VT 1KXDA 3PROA 3PB1E 3TNTA 1ZMNA 2C8XB 3SHCH 2FOEA 2PKSB 1MTWA 3P92A 1O30A 1GDQA 3SNBA 4GHTA 3UTUH 4KP0A 3ZYEA 1ELVA 1L2EA 1FXYA 4NA7A 2F43B 2L6OA 1Z8JB 2P8OB 1GMCF 1RS0A 1THSH 3C1KA 1S0QA 4WMFA 4X8UH 2BD7A 3D65E 2BDGA 3M7TA 4JZDH 5A09A 2WV9A 3BTKE 4UEHH 1P2QA 3PO1B 4ZXXH 4B71A 1DS2E 3FP7E 1XXDA 3GDUA 3TJUA 1C2IA 8LPRA 3UAIC 5KEDA 5L30H 2UUFB 3GCOA 4LXBH 1QTFA 4MPXA 2CHAB 3TU7H 1A46H 2VVUA 4ACAA 1O3MA 4X1QU 2B9LA 3FOAA 1HIAA 1IHTH 1C9TA 1H9IE 1UHBA 1A0HB 2OINA 2CXVA 4XE4A 4B2BA 3UOUA 2V0BA 4X6PA 1DE7H 3SU3A 1LVYA 3ZZ4A 2TPIZ 2JJ2D 1BTPA 1J15A 2PUXB 4YLUA 2QC2A 3IG6B 2TGPZ 1GHXH 4OS7A 2RFKC 5C5NA 3TK5A 1O2WA 1HIAB 3P8OA 1UHBB 1FY5A 1ZMJA 2PW8H 4ABDA 5HM9A 1YLDA 3LGVA 3LT3A 1FUJA 1NM6A 2HVXA 5IDKA 4D76A 1VCQA 1Y3YA 4K8YA 2FYRA 2PWXA 1XVOA 1XUKA 1TPOA 2ZHQH 4RT1A 4ABJA 1GBAA 5EXLA 3DFJA 3BEUA 3NRLA 1T31A 2PTNA 1GMDG 2BM2A 3CP7A 1HJAC 1GI7B 3S9BA 1BQYA 3ZZ5A 3KQEA 3P8NA 4FUJA 2Y6TA 4AFUA 3RXLA 3FP6E 1TX8A 1EAUA 1MABB 5DGJA 4CREA 3MO9A 1PPFE 3TH2H 2AGGX 2J95A 3RLYH 2Y80A 2D26C 1MKXK 3JZ1B 2P16A 1GBCA 1OS8A 4Y8ZA 2GCTB 3MNSA 1O32A 3LGWA 1E36B 3S0NA 3T29A 1A7SA 2G51A 1F0SA 5EJZA 1P0SH 5HXFA 1Y5UT 1FI8A 3MWIU 1WV7H 3U69H 2OBOA 4YOJA 3SI3H 2A1DB 1IQJA 1CGHA 1F7ZA 1O5EH 1TFXA 2AEIH 1QB6A 3BEIB 5TJXA 2NU0E 3M7QA 1J16A 1C1OA 1D6WA 2XC4A 2SNWA 2WPIS 1DX5M 3P17H 4F48B 4ZMAH 4DCDA 1S0RA 5PTPA 2VIDA 3HPTB 1VJ9U 2OD3B 1PPGE 3TLOA 5DP8A 4B1TA 1XM1A 5C20A 2QF4A 1O2NA 5EQSA 1L1JA 3NWUA 1J9CH 1DLEA 2P59A 1GHBG 2QXGA 3UR6A 2ZI2H 5C94A 1G37A 2TIOA 3BN9A 3SJ9A 1DFPA 1VGCC 2YOLA 3M5NA 1HAHH 1NFYA 1Z8GA 1HAYB 4Y76A 1VCWA 3TGJE 1BTUA 5DP9A 1K0HA 1QA7A 1SB1H 2TGTA 4ZKNU 1W0ZU 1T8OA 4MDSA 4FUFA 5FHTA 2JH6D 1CA8B 2GMTC 1EATA 5EQRA 3RXPA 1ZJKA 1ZR0A 2LNCA 3OFND 1W11U 3A7ZA 2ZU5A 1NRPH 1TALA 1BJVA 3A84A 5CHBA 1OWKA 3NCLA 1CBWB 2F9VA 1IQFA
chains in the Genus database with same CATH topology
4O9VA 1DICA 1DWEH 1YPHC 3MNCA 5HMAA 3S7HB 3HGNA 3RXAA 3QN7A 1EUFA 1GBJA 1SMFE 1XUIA 1E34B 4DW2U 3K65B 2BZAA 3I29A 1EASA 3M3VA 2OTVA 4UFFH 3S7KB 4GSOA 5EGMA 1DSTA 4CR5A 4CRGA 1O2SA 4PROA 1BZXE 3SV7A 3RXCA 3TK6A 1TNLA 1JOUB 3SUFA 1GG6C 2BVXH 2OC8A 3H5CB 2ALVA 1BMAA 5T6DA 1C4Y2 4BAMB 3RMNH 1PFXC 1GI0A 5EW1H 1SGQE 3PLKA 1YC0A 4ABAA 3FFGA 1EZUC 2ASUB 3UUZA 1IQNA 1H8DH 4E06H 2GV7A 3BTGE 4R8TB 3RXQA 3F9HA 3SBKA 4NCYA 2ZC9H 4GAWA 3ZV9A 1YPKH 2PGBB 4FU8A 1Z7KA 2NU1E 2VB0A 1GHAF 2O8WA 1QB1A 2TRMA 2Y82A 3GDSA 3TJNA 4GHQA 3RXTA 2HPPH 2XBVA 1SPJA 2I6SA 5DO4H 1NPMA 1TNKA 1DXWA 1HXEH 2G55A 4CRBA 1BRUP 3MYWA 3O8RA 4X1PU 1Y5AT 1TMBH 1SGDE 1CT2E 1GVZA 1FNIA 1J14A 1JWTA 1PQ7A 1OWEA 1EZXC 1LVOA 1BHXB 1C1UH 1AB9B 1AFEH 3ZZ3A 6ESTA 1SHYA 3A8BA 2ESTE 4NWLA 1SC8U 2BY8X 5LPEA 4DIIH 1FY1A 3SZNA 1AO5A 1BT7A 4CHAC 1GMCG 1UTKA 2FESH 3RU4E 5HYOA 4INKA 2IPHA 3RM2H 4Y7BA 3SU5A 2RA0A 1MD7A 2DUCA 3NZIA 1Y5BT 1ZRKA 2A2XH 3RXIA 1WBGB 3NUMA 3SUEA 1QL9A 2GP9B 2ZEBA 3M37A 1E38B 3GCHB 1Q3XA 1E35B 2AFQB 1GBHA 1P3EA 1LHGH 3OY6U 1NZQH 4ISNA 4LZ4B 2XCFA 1CHGA 2BVSH 1KXBA 5J4SA 3M61U 3SJKA 2XXLA 1YCPM 2XW9A 3KF2A 2BD2A 3U8TH 3T62A 1P03A 6CHAB 1EJMA 2TBSA 2CN0H 1GBMA 1RGQA 1SGTA 1MH0A 1MUEB 3AAUA 3ZVBA 4JYUH 1D3DB 2HWLB 1DWCH 2AIQA 3LC3A 1TMTH 4I8HA 1YPMH 1W7XH 4Y79A 3TH4H 3PTBA 5CMXH 1MU8B 2PTCE 4Y0YE 3A7TA 1SGCA 1ESTA 2ZFPH 1FAKH 1G9IE 2SGEE 3HKJB 2UUKB 1XX9A 4GUXA 1GGDB 5LPRA 4MG3A 2BLOA 3E90B 1HLTH 1TGCA 2FOFA 2C93B 1KXEA 2VWLA 1O3JA 2ODPA 3GCNA 3HGPA 2FXRA 1KYNA 1UVOA 3SQHE 1L1GA 5EW2H 4YT6H 1SLUB 2B8OH 2DE8A 2ZCHP 1C2LA 2QN5T 3I77A 1IQLA 2BQ6B 2FPZA 1GCTC 3A89A 1C5XB 2VVCA 1ESAA 4U32A 2Z7FE 2VWNA 5ESTE 4QT8C 3SJOA 4IN1A 5E0HA 5A0BA 1NY22 3ZZDA 1O33A 1V2QT 1OWHA 1O3AA 3TJVA 4JZ1A 4ZHMU 1HNEE 2ALPA 2BY6X 3ZZ8A 4BXSA 2WPJS 1FLEE 1GJ8B 1XMNB 4I8JA 2W7SA 1QR3E 1F2SE 1D3PB 5E0GA 1C1QA 2QCYA 1G3EA 1T4VH 3F68H 2ZDLA 4ABHA 3LKWA 3BEFB 1MTNC 1QL8A 1UCYH 1OX1A 4WY3A 1GJ9B 1KSNA 1LPGB 3W95A 2NU2E 2WINI 3OU0A 3SOSA 1EOJA 5GWZA 3RXHA 1Y3WA 3C27B 1H9LB 1AU8A 4WJG2 4IC6A 4GVUA 1P12E 4ZAEA 1O3PB 3S69A 1TRNA 1MBMA 2P94A 5A8XA 3QO6A 1UCYK 1TRYA 1YCPH 3ATWA 2SGQE 1RRKA 1C1VH 2JH5D 2ZDVH 2EA3A 3E3TA 1HB0B 1C2MA 2GV6A 1C5SA 1BTYA 4OS4A 5EPNA 1GBFA 2PSXA 5LH8A 1HFDA 5C1YA 1NO9H 3P6ZB 4UFEH 4E05H 2GCHF 1GI8B 4JCNA 2BB4A 1BIOA 2OUAA 1RTFB 3BTWE 4KTSA 2C8YB 2IOTA 3PLPA 3GY5A 3RP2A 2CJIA 1C2GA 1BMMH 3OX7U 1VCPA 4F49A 1VITF 3ZVDA 2A7JA 1O2UA 3LDXH 1TOMH 1UK3A 2B5TB 5C67A 1C1WH 4BTUB 1ZHMA 2FS8A 1ABIH 4OS1A 4X6OA 1ZTLA 4XFQA 2C90B 8KME2 2ODYB 3RXRA 3KN2A 3GOVB 3VB7A 5JB8S 1BBRK 1S81A 3NK8A 3K6YA 1HAIH 3KCGH 3K6ZA 5DP7A 2GD4B 1WAYB 5HGGA 2BY5X 1O2OA 1UTLM 3PWCA 4Y11E 3AW1A 3GYLB 3URDA 1FY3A 2TGAA 1W7GH 2YNAA 4K60A 1O3CA 1O0DH 3ATKA 1SSXA 1ETTH 5AF9H 2QXIA 5T3HA 1NRRH 5JBCS 4X0WU 1ANBA 3MOCA 1PYTC 5JDUB 1B0EA 2BLQA 2BDYA 3UFAA 5E0JA 2ZHDA 3BTTE 4X2VA 1W13U 3Q3XA 3PTNA 1ZOMA 5GJ4B 1OWJA 1GHAG 3IWMA 8ESTE 2P3TB 1PPBH 1MKWH 5K7RA 3TGKE 3M5OA 2G5VA 1S6HA 3BG4C 1GJ7B 1HRTH 3UIRA 2ZFTA 2ZWLH 3FZZA 3OY5U 2WUBA 1HCGA 3QGNB 1LCYA 3A81A 4NSYA 1TB6H 1C9PA 1GL1A 4OGXA 2ZU1A 4BAHB 1E37B 3UWJH 4ZHAA 1PQ8A 2R2WU 1ARBA 1SFQB 2ZTYA 2WYJA 3IITA 3DA9B 1ELFA 1ESBA 4X1RU 1FV9A 1F0RA 1GMHF 3TIUA 1MZAA 5F8XA 5DP6A 5GXPA 3K9XB 4OGYA 3QLPH 3MU0A 4VGCC 2FYQA 3BTDE 4KELA 4OS5A 1QGFA 2Z9GA 1W2KH 4J2YB 3LH3A 1A61H 1ZTKA 4FUCA 4WH6A 2BXTH 4U01A 4WXIA 1EXFA 2NWNA 3G01A 3SORA 3ODDA 3A88A 1C5WB 1N8OB 2JETC 1UTOA 1BOQA 3RMMH 4NSVA 2J2UA 2FM2A 2RDLA 4TWWA 1O3NA 2UWOA 1W14U 2BLVA 3F6UH 1A5HA 2BLWA 1ANCA 2LPRA 5G4BA 1P05A 1QRXA 2QF3A 1T8NA 5C2ZA 2ZECA 1OKXA 4ZUHA 4DURA 4LOYH 3SV6A 1ZPCA 4IW4E 4CRCA 3CENA 4H6TA 1P3CA 3FAOA 2PGQB 4D7GA 2A5AA 1QFKH 4WH8A 3UREA 1GI9B 3LJJA 1BCUH 1J8AA 4ASHA 2G4TA 1QL7A 2QGRA 3ZZAA 4CRDA 4O3TA 1GDNA 1BITA 1CT4E 5L6NH 1O2YA 3UQVA 1O3BA 1V2RT 2A0QB 4BTTB 1LHEH 1AUJA 2PKSC 3VB6A 3P95A 3W94A 2H2ZA 3SNAA 2DE9A 1ZZZA 1L4DA 5FCKA 3RC6A 2ZFFH 1P04A 1PQ5A 1B0FA 1HJAB 1K1LA 2VIWA 1SGRE 3ZZ9A 3UNRA 3RXBA 3V7TA 3A8AA 2A5KA 5FCRA 3PO1C 2GGVB 3SGQE 2BYAX 3LU9B 1B5GH 2W7UA 3MH6A 2BY7X 2OC7A 1O5DH 1C5YB 7ESTE 2CHAC 3LGIA 1V2JT 1FN6A 2GDEH 1G3DA 2Z3EA 2F9OA 3Q3KA 2HPQH 2BTCE 5IYTA 2W5EA 4B2AA 3RDZA 3E1XB 2V3OH 3KIDU 5A8YA 1HBTH 4DGJA 4UONA 3VXFH 1C4U2 1HAZB 2GVFA 1LKAA 3KQBA 1BRCE 4AFQA 3ZVCA 1FMGA 1MTSA 4Q7XA 1V2LT 2R0KA 4XDEA 1T32A 1ANDA 3FANA 4E7NA 5JB9S 1TWXB 1AFQB 3V0XA 2G4UA 1E0FD 1HAPH 1L1NA 2FP7B 1NFWA 1O3OA 3PMAB 1K1IA 4A92A 1CHOF 1C5MD 2STBE 1EKBB 3SV9A 2O8TA 4KTUA 1F92A 3QZQA 3RXGA 1V2KT 3T26A 1BTZA 1YP9A 1XVMA 1LQDB 1VGCB 1ZGIA 3QTVH 1TX7A 1AY6H 1P02A 2BDAA 1W8BH 1SL3A 2Y5HA 2G81E 4AOQA 3BTFE 2OC1A 2SNVA 1AWHB 3GY3A 1O3LA 1P2MA 4JYTA 2Y7ZA 1GHYH 3OSYA 3QWCH 2A7CA 3ENSB 3ZZCA 2NU4E 3BTQE 2FTLE 2PKAA 1W12U 2G5NA 5A0AE 4U2WA 4DVAU 2XBWA 3H7OA 2FOGA 1Z8IB 1BTXA 3NKKA 1TYNA 2BMGB 1F5RA 2GCHG 4MNYA 5DP4A 1ZHPA 3F1SB 2ZQ1A 1NTPA 1TONA 1GVLA 2TGDA 1UVPA 3E91A 3UNQA 3RXKA 2FOMB 2PKAB 3ZVFA 2WYGA 3Q77A 2ZDAH 1NRQH 1Z8RA 1FQ3A 1OOKB 2BDBA 1VITG 4OS6A 2ZQ2A 1LHDH 4JK6A 1QBNA 1GDUA 4D7FA 1YF4A 4ABBA 4YTAA 1YBWA 1RFNA 1OP0A 1YLCA 3U9AH 1HXFH 1V2UT 2ZGBH 1O39A 2HNTE 1NRNH 2OP9A 3QK1A 1H1BA 1TMUH 1GG6B 1O2TA 1A3BH 3A8DA 4O03A 1TIOA 2D1JA 1GBTA 5JPMH 1O3IA 1IAUA 4ZKSU 4B73A 1O2IA 2QYIA 4YO9A 3F9GA 4ISIH 1C5OH 5FPSA 1Y8TA 1NRSH 1IQMA 3EA7A 2ZGJA 1AZ8A 2ZPQA 1UCYE 1RD3B 3E8LA 1GI4A 1GHWH 1ZRBA 4HTCH 5DJ7A 3ZZBA 1FIWA 1Y3UA 4I7YH 4B2CA 4H42U 2F9NA 1UVUH 1P11E 1VITH 1IQIA 1GJ5H 1DITH 4AYVB 2PLXA 4IGDA 4B76A 2Q1JA 4RN6A 1BTWA 1Q31A 1FY8E 5J4QA 3RU4T 2UUJB 4ESTE 3MH7A 1JXPA 5SGAE 3RXJA 1AE5A 3VFEA 2AMDA 1MCVA 3QUMP 1LDTT 2UWLA 1TGBA 4JMYA 3EYDA 5FAHA 3R0FA 5DP3A 2F83A 3MU8A 5GCHF 8GCHG 3M3SA 3CS7A 3GY2A 1A0JA 1O2QA 3U8RH 1QRZA 2ZU4A 1GCDA 2ZHFH 1GMHG 3HATH 4KGAA 4YOIA 1W3CA 1GJ4H 5T6GA 1SOZA 1BBRE 1AVGH 1F5LA 2BQWB 3TK9A 3F9EA 3LPRA 1ELDE 1JRSA 3A85A 3LGTA 3KHVA 1CA0C 3BTHE 3O8DA 1XUHA 3DFLA 3OTJE 1FZZA 2IN2A 1ZPBA 3M3TA 1S85A 1AVWA 4BAKB 1GHVH 3VB4A 3HK6B 1PPCE 3ESTA 1O35A 3UQOA 5EODA 1DWDH 5CHAC 1QJ7B 1AVXA 4Y71A 4FUBA 4MQAA 1XUFA 2GKVE 2EC9H 3M5LA 4WVPE 4MNVA 1TQ0B 2V3HH 2Y7XA 2AMQA 2BHGA 4NGAH 1BTHH 1ELAA 1OYTH 4Y10E 2FOCA 1GBIA 1Z1JA 1A5GH 5AFYH 2ZGXH 3VPKA 4D8NA 3ZVGA 3SGAE 3P8FA 1MMJN 1Y3XA 1DUAA 2XWBI 3AW0A 1O3HA 1NFUA 1TGNA 1GBBA 2BX3A 4U30A 1P09A 1LVMA 2QA9E 1EPTC 3KQDA 4D9RA 1AB9C 3E0NB 4INLA 2A45B 1NN6A 1UMAH 3A83A 4YT7H 2O8MA 1P8VC 4CR9A 3UNSA 1SGIB 1TBRH 1QQ4A 3EDXB 1CU1A 1JMOH 1FIZA 1OP8A 1ZYOA 2EI6A 3F9FA 2QXHA 1RTKA 3EQ0H 1IOEA 4BNRA 7LPRA 1Z71A 4NIXA 4RSPA 1GJBB 1SLWB 2BZ6H 2ODQA 4BXWA 2GTBA 3LOXA 1P10A 2D2DA 1DPOA 4K1TA 1TBQH 5FBEA 1QBVH 2A7HA 2FOBA 2R2MB 2ZHWH 1GCTB 1QJ6B 4DY7B 4Y6DA 3URCA 1HAXB 2AGEX 2I6QA 3OYPA 4YESB 1IQKA 2R3YA 2ZFQH 3L6PA 1AUTC 1ZSKA 2VGCB 1AI8H 3BIVH 2GDDA 4ZXYH 4I33A 4IMZA 1V2MT 4ZROA 1DWBH 2VWOA 2FTMA 1D4PB 4H6SB 9ESTA 4WMEA 1G3CA 1VJAU 4MNWA 4LZ1H 2XC0A 4ISOA 2XBYA 2ZF0H 3MU4A 5GPIB 1O5CB 4TPYA 5E8EH 1MQ6A 2AGIX 1CHOG 2BQ7B 4X2WA 1MTNB 2AH4X 4K1SA 1F0UA 2BX4A 1K1JA 4IBLH 2J94A 3TPIZ 2F3CE 1X7AC 1UK4A 1O2KA 1WTHD 5L2ZH 1SFIA 4AG1A 1S82A 1DY8A 1LTOA 4YM9A 1EOLA 1C2HA 3MH5A 1EJNA 4AX9H 2VU8E 1SR5C 2XBXA 2BDIA 1YPGH 1FN8A 1P9SA 4CH2B 2PFEA 3LJOA 1GL0E 2UWPA 3K2UA 2Z9KA 3P70B 1GJAB 1O3EA 5EU8A 1C5VA 1BB0B 2F91A 2YNBA 5H4IB 5K0HA 1N6XA 3BIUH 1YPJH 4HFPB 3TH3H 2BOHB 3SUDA 3ELAH 3FVFB 1P01A 4NFEA 1ARCA 2HOBA 2ZZUH 2OXSA 1O2XA 2FLBH 1ELBA 2FX6A 1C5RA 4NIWA 6GCHF 1QY6A 1V2TT 1KLTA 4GLYA 4Q7ZA 3RXEA 4CH8B 3T5FH 1DANH 3BSQA 1P2KA 2ZA5A 3QDZB 3AVZA 1YM0A 1YCPK 4X6MA 2CF9H 1GPZA 1LPKB 1HAOH 3ZYDA 3L3TA 1FONA 4F4OC 1PPZA 1DT2A 1ZSJA 2QAAA 2WV5A 1C5QA 4AGKA 5A8ZA 1QQUA 4BAQB 1T4UH 1C5PA 2H5DA 4XOJA 4Z6AH 3A7VA 4WF8A 5ESBA 1KDQA 1QCPA 1EQ9A 1UO6A 1C5TA 1KXFA 1GJDB 3S9CA 4O3UA 2C8WB 1F5KU 1C5LH 1WTGH 2FMJA 5EXNA 4BOHA 4INHA 1OWDA 2ZGHA 3SNEA 2GZ9A 2ZP0H 5T6FA 3MMGA 1J17T 1V2PT 1EAWA 2PR3A 2RG3A 6LPRA 4WMDA 5B6OA 1KDQB 3HKIB 4FUHA 1MAXA