4O3TA

Zymogen hgf-beta/met with zymogen activator peptide zap.14
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
NIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/growth factor
molecule keywords Hepatocyte growth factor
publication title An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3tA01
2H6MA 1V2OT 1Y3UA 1C2LA 1KTTB 1IQHA 1CSOE 1MUEB 1SFIA 5DP4A 2QC2A 4INLA 2TPIZ 3BG4B 3LIWA 1WQSA 1GJ8B 1VGCC 3D49H 5A0CA 1TA2A 4UFGH 2ZDAH 1O36A 1F7ZA 1O2UA 1UJ1A 1WBGB 2CHAB 3KGPA 4GAWA 5A0BA 1AZ8A 1OYTH 2Y7ZA 4Y79A 1O3LA 1TBRH 1AVGH 1GBKA 2R9PA 3ZZBA 1PFXC 1RIWB 1GI1A 1C1MA 1O39A 4Y8XA 3BTHE 4NA9H 1HAHH 1MD8A 1KXEA 3JZ2B 1A3EH 5SGAE 2FOGA 3QK1A 1TFXA 2SGEE 2J4IA 2Z9JA 5E2OA 3RUOA 1O3GA 2P8OB 1Q3XA 2J38A 3BV9B 2FEQH 1G3CA 2ALPA 3M5NA 1QGFA 4DW2U 1XKAC 3HK6B 1C2FA 1FZZA 1YCPK 4J1YA 2F91A 3T5FH 3U8RH 5ESBA 1TNLA 4DCDA 1UK4A 1EKBB 1FI8A 2GCTB 1NRPH 1TOCB 1NRQH 5DP9A 1GHAF 2JH5D 4Y10E 1CVWH 1O2XA 3T27A 1PPGE 3SJ9A 4YOIA 4WVPE 4DVAU 1SOTA 1F2SE 1T4VH 3SQHE 2GVFA 5TCCA 4AB9A 3LDXH 1TLDA 1AO5A 1FJSA 1AVWA 3T26A 1S6HA 1GJ6A 1PPFE 1QY6A 1V2WT 3G01A 3OYPA 3TJVA 1SOZA 3FP6E 3QTVH 1O3EA 1DUEA 4R8TB 2ZO3H 2BD7A 1YPJH 3VPKA 2JH0D 3SV8A 2DE8A 4JCNA 4WWYA 1ZMJA 4KELA 2FOHA 3ODDA 4GPGA 4ISIH 1KSNA 1V2NT 3H7OA 3PYHA 1N1LA 3LT3A 4MQAA 4NIWA 3UR9A 3UQVA 3A7VA 5HXFA 2Z9IA 3AAVA 1CO7E 2W26A 4OS1A 1VCWA 1FLEE 1D3QB 1KYNA 1O32A 1FIZA 2XWAA 3ATWA 4MG3A 3CP7A 4BAKB 1ELGA 1FMGA 3ESTA 3UIRA 1JRSA 1ELFA 2ZFPH 4ABHA 4X6NA 1YBWA 1ZPZA 2FYQA 3SU6A 2TIOA 2R0LA 1FUJA 4M7GA 1ZYOA 1QBNA 1ESAA 2WPLS 1C5UA 2BVSH 3F9EA 2D2DA 1DSUA 1QL7A 2XWBI 2PGQB 3TJOA 2ZGJA 1C5WB 1GHZA 1MU8B 3O8BA 4R0IA 3RMLH 1SR5C 4DG4A 1ELCA 2GMTC 2IN2A 2VINA 5GIBA 1YPMH 1GHYH 2J9NA 1MU6B 1ZPCA 2J95A 3MU4A 1S84A 1RS0A 3M7TA 1IQLA 4D76A 1LMWB 2OBQA 3O8RA 3PMJA 1QB6A 1C2GA 1O3JA 2ZGXH 5DP7A 3UPEA 1V2TT 1WQVH 3HPTB 1O31A 4AFUA 3TU7H 3QZRA 3HATH 2VNTA 4DGJA 1AVXA 1O5FH 3RC4A 1BIOA 1C1SA 2GDDA 3PB1E 4CR5A 1QFKH 4UFEH 1TGSZ 4FUHA 1O3AA 1SGCA 6CHAC 1MTNC 1RJXB 3TH3H 1A0JA 1Y3WA 3PM3A 2XC4A 1P2JA 1K1OA 4I8LA 1OYQA 2P93A 1MMJN 3LOXA 4ISOA 4ZH8A 3VGCC 5EW1H 3K6YA 4SGBE 5HMAA 3GY2A 1H1BA 4ZKNU 2STAE 3A8DA 4NA8A 1J9CH 1Y8TA 1AB9C 1UHBA 1KXCA 1UK3A 3BTWE 1VJAU 1FIWA 4GCHG 5DO4H 2ZFFH 1ELVA 3FAOA 1V6DA 3MNXA 3MYWA 1MAXA 2H2ZA 2ZA5A 2F9BH 2OQ5A 1MCTA 2JETC 2GCHF 2AGGX 4K8BA 3U1IB 2OCVB 4CR9A 2FM2A 1XVOA 1CT0E 1W13U 4JZIA 2BB4A 4AG1A 3S9CA 3M3SA 1B0EA 3PWBA 3UTUH 1GBFA 1T31A 3RXQA 1C5PA 1DOJA 1SGPE 1O3DA 1UTQA 4GVUA 3R0FA 2ESTE 3U8OH 4K60A 2OBOA 1BTYA 1EAWA 3SHCH 4IW4E 1HUTH 3A7TA 2Y5HA 3VB6A 4NIVA 1W0ZU 2FI3E 3A7YA 2EI7A 5TJXA 2H5CA 3M7UA 3GYLB 2VVCA 2R3YA 3RXKA 1BTPA 3ZZ9A 2Q6DA 4HI3A 3UQOA 2XCNA 3MU0A 2FOCA 1S85A 3PMAB 2W7UA 4D8NA 4IS5A 2H5DA 1W10U 2AMQA 1GHWH 3PLKA 3EA9A 3W94A 1BTZA 5PTPA 4X1NU 1NFWA 4E7RG 1P10A 4ZHMU 3RXTA 3A83A 1TGBA 2YNAA 1C2HA 1SGQE 2ODQA 1Z6EA 4IC6A 3OU0A 2G5NA 1C5XB 1ORFA 5C5NA 1DM4B 2PFEA 4H6SB 3O8CA 5CHAB 2J94A 3RXAA 2G81E 3SI3H 2YOLA 2VWOA 1C1WH 1TGTA 3SQEE 1MKWH 1G2MA 1G3BA 3NPSA 1YPEH 3M7QA 5GCHF 2WPKS 2FTLE 1D6RA 3RP2A 3ATLA 3F9GA 2HOBA 1B5GH 2C93B 5DJ7A 3HK3B 1ZHPA 5GPIB 2BYAX 4AOQA 5GWZA 3RXVA 4OS5A 2XXLA 1TX7A 3ODFA 1VCPA 2BD9A 3SO3A 3VB3A 1A5HA 1BJUA 4B75A 1ZTJA 1C2JA 3VXFH 3TPIZ 1O2GH 3FZZA 2V6NA 1HCGA 4CRDA 1EOLA 1W0YH 1IAUA 4JZEH 1Z8RA 5L6NH 4PROA 1G32B 4I31A 4Q2KA 4FU7A 5DK1A 2ZHEH 2IJOB 4Q7YA 1C9PA 2TRMA 3OY6U 1C2EA 4D9RA 4MPVA 4OGYA 3SNDA 4A1VA 1P3EA 2UUJB 4TY7A 3ZVGA 5A2MH 2SGPE 4IMQA 4RN6A 1TNKA 2GCHG 1V2ST 1AUJA 1QR3E 1HJAB 4X8VH 1OPHB 2ZP0H 3SNBA 1TNJA 3EAJA 2GGVB 1O2IA 1O5CB 2CF8H 1O2TA 4AN7A 1PQ5A 1BA8B 4THNH 1CHGA 5A8YA 2OLGA 1XM1A 5FX5A 1DWBH 3F9HA 4CRGA 1GBDA 5FBEA 1GBAA 1LO6A 2A31A 4ZROA 1PQ8A 3VXEH 1NRSH 2P3UB 4NIXA 1DWEH 3F68H 4TWYA 4Z6AH 4UONA 3SV6A 3MTYA 1D4PB 2ALVA 4BAHB 2A4GA 2PUXB 4X1PU 1AHTH 1LVBA 1T8OA 2ZPQA 4NZQA 4KTCA 5AFZH 1WTGH 5DP5A 3LGTA 4ZXYH 1N8OC 5LPFA 1MD7A 5JBBS 3ZYEA 3SUGA 1QTFA 2WPIS 3MFJA 3TK9A 1EZUC 1TX8A 3SUFA 4XFQA 3URCA 1V2MT 5BRRE 2P3FH 3QLPH 1TNHA 1T8MA 1C5QA 1K1PA 4FUIA 3RMMH 4F4OC 3A86A 1A5IA 4KTUA 3KN2A 1D3TB 2P16A 4XBBA 1JOUB 3NK8A 4Y0YE 2XBYA 3T25A 1GGDB 1L4ZA 1MKXK 2ZHWH 6GCHG 1HRTH 2G55A 5EG4A 2DE9A 4U30A 3HGNA 1AUTC 2ZECA 4FUDA 2PGBB 2EI8A 1TIOA 2WUCA 1BBRH 2BLWA 1SGFA 3TIUA 2B5TB 1MAYA 3TVJB 2CV3A 1EAUA 1WTHD 2R3UA 1GJ5H 3M5MA 2A45B 2BQ6B 1IQNA 3AVZA 3ATKA 1UTOA 2XBVA 3I78A 1AWHB 1EPTB 3LJOA 4QT8C 3ZZ6A 4DOQA 3ENSB 5EPYA 1LKAA 2BD8A 2WV5A 1THPB 2WYGA 3GDSA 1CGJE 3S7KB 3A7XA 2FODA 1YKTA 2RCEA 1O0DH 2PSYA 2F9NA 3DA9B 4X1QU 1YPKH 3V13A 5L30H 3A8AA 1OOKB 1QA7A 2FPZA 1SG8B 2C8YB 4F49A 1QBVH 3UOPA 1C1TA 3PO1C 3BTKE 1UVTH 4LZ1H 4X8TH 1SGYE 1KY9A 1TBQH 2SNVA 1QL9A 1MKWK 1GDQA 1QRXA 3ZVBA 1O34A 3LJJA 4I8JA 1O3PB 1THRH 3RXMA 1D9IA 1V2UT 2C8WB 3SGAE 2P3TB 1YM0A 1C5MD 3BEUA 4BANB 2VWMA 3NCLA 1OWEA 5EXMA 1F5LA 2PKAA 2VWLA 4VGCB 2EA3A 1W11U 5E8EH 1VGCB 4J2YB 4ABIA 2RDLA 1TX6A 2SGQE 2ZPRA 3MU5A 1PYTD 1L1JA 4OGXA 1DS2E 4WJG2 4B2CA 1UVSH 1WU1A 3P8GA 1O2HA 1ZJDA 2ZCKP 1O3OA 4I8KA 1KXAA 1Z8GA 3LC5A 5C5OA 4XOJA 5EXLA 3PROA 4ZUHA 1AZZA 4BTUB 4CHAB 4XE4A 1BTUA 1FAXA 1GI9B 1C1QA 4JZ1A 1PPHE 3ZZDA 1ZTLA 4HGCA 1BMLA 1JBUH 4CBNA 3FANA 3RC6A 3TGIE 1BUIA 2GT7A 2PV9B 4UEHH 2UWPA 4D9QA 2IPHA 4AGJA 3TGJE 1RTKA 3OX7U 3ZV8A 1O2QA 3RXIA 1FPHH 4H6TA 5A09A 1GJBB 2QYIA 5L2YH 1BTXA 1GI0A 3LGIA 5LPRA 3SV7A 5DPAA 3PMHB 2QXGA 2ZIQH 1SQTA 4LXBH 4X2VA 1F0SA 1GJ4H 1LHDH 1O3IA 4GUXA 1Z1IA 4AYVB 2ZTXA 3F9FA 2Z9KA 4WMEA 3P8NA 4HZHA 1EAXA 2VU8E 5JBAS 4WMDA 1NFXA 1JMOH 3U8TH 2JKHA 4U01A 1FY5A 3RXRA 1A3BH 1P8VC 1AFEH 3Q77A 1C1UH 1O3MA 5K0HA 1DLEA 4FXGH 4H42U 2QY0B 4I32A 4E7NA 1ZRBA 3VB5A 3RXFA 2K1QA 4KTSA 4Y8ZA 3DFJA 1LKBA 2ZKSA 1N6YA 3GDUA 4YESB 1ID5H 5FCRA 3GY6A 1TB6H 1C2IA 2QF0A 5E0HA 4CRAA 1ELBA 5A8XA 2BHGA 3K65B 1RTFB 1O2LA 4XBDA 1C2DA 2YNBA 3GISB 3VEQB 2Q6FA 3UUZA 1E37B 3HKJB 3MNBA 1Y5AT 2GKVE 2A0QB 5J4QA 4MNXA 8LPRA 1UTNA 3H7TA 3RXPA 1OP0A 2FP7B 2J92A 1BBRK 2WPMS 1BMMH 3S69A 1ZGVA 2W3KA 4OS2A 3U1JB 2TGTA 1TPSA 3BIVH 4K2YA 3ELAH 4INKA 3BSQA 1FN8A 1FPCH 9LPRA 1L1NA 1ARBA 1UTLM 2GMTB 5HYOA 1SBWA 3QTOH 1C5LH 2OUAA 4ZMAH 1KIGH 3MH7A 3ZYDA 3LPRA 2Z3EA 1C5OH 2D1JA 2ZU1A 1Z7KA 1QL8A 2BX4A 1HPGA 2R2MB 1GMDF 4A7IB 3O8DA 1EASA 4RKJB 2QIQA 5GDSH 2VIDA 1ELAA 1HIAB 1YGCH 3BG4C 1FV9A 2A4RA 1P57B 2NU4E 1D6WA 1BRBE 2DUCA 3RXUA 1P06A 3T2NA 4JZFH 2KAIA 2CN0H 3W95A 1QJ7B 1OWDA 5AFYH 1MBQA 5EW2H 2ANWA 1W8BH 5AF9H 2IOTA 2Z9LA 3UOUA 6CHAB 1MTNB 4TY6A 2QGRA 3QX5H 3VB7A 4BAMB 3QZQA 4ZHLU 2F83A 4FVDA 3RXOA 1NRRH 1TYNA 1O2KA 1NZQH 2LNCA 3CS0A 3VGCB 1QNJA 3E91A 1NM6A 1OWKA 3S7HB 1BHXF 3MH4A 3E6PH 2ZWLH 1AB9B 3D65E 1P12E 5DP6A 3GY5A 1P0SH 3LGVA 3SV2H 4I7YH 4K5ZA 3RLWH 1S81A 2AMPA 2FXRA 4YO9A 2JETB 3OTJE 3MO6A 1IQEA 5C2ZA 2ZPSA 1ELTA 1F0UA 3KCGH 1OWHA 4YOJA 3KF2A 4CREA 3TH4H 1HJ9A 5C3NA 2ZTZA 3TLOA 5EOKA 1NTPA 1EJAA 1XKBC 3PTNA 1KXFA 2XTTB 3URDA 1EATA 1GMCF 1GJAB 1JRTA 3M36A 1KLTA 1O2JA 3V7TA 4BTTB 2V35A 3NUMA 1K1NA 2ZGBH 2UWOA 5ABWA 1GBEA 2D8WA 1G3EA 1ZZZA 2FYRA 4X2XA 1GHAG 3Q3YA 2BY8X 5GXPA 4WH8A 1ABJH 1O2YA 3JZ1B 1KXDA 1SMFE 2RA3A 9ESTA 2QCYA 5HM9A 3KEEA 1E34B 3RLYH 4KGAA 3SORA 2FIRH 4Y76A 1HAPH 1S0RA 1BHXB 1TNGA 3SGQE 2HNTF 4ISLA 4NCYA 5JPMH 4CRFA 5CE1A 1EP6A 1O2OA 1OX1A 5EQRA 1K1IA 3MNSA 1YYY1 2AERH 3SU0A 2CJIA 4Y11E 2C4FH 3E16B 1UCYH 4NA7A 2V0BA 1F5KU 3ZVFA 3TJNA 3SU1A 1ZOMA 1O5BB 2BDGA 1GMDG 3SN8A 1K22H 2ANYA 1VZQH 1LDTT 3EGKH 3SW2B 8ESTE 1IQMA 1P9UA 2P59A 1C4V2 4DY7B 2VWNA 5TCAA 1G3DA 3Q76A 2C3SA 3SJKA 1LQEA 2OXSA 1ESTA 2WINI 5JDUB 2OD3B 1GBIA 2B8OH 1GJ7B 1RFNA 4IMZA 1QJ6B 1A0LA 1UTJA 1Z1JA 5HM2A 3GCHC 3EQ0H 4ESTE 5FXLA 2A5KA 2H1UA 4GSOA 2ANMH 3BN9A 1DDJA 1H8DH 3S9AA 2A5AA 3RXDA 1L2EA 1YCPM 3MOCA 4ISNA 1ZJKA 3MHWU 1YPHE 1O2PA 1ANDA 1L1GA 1OKXA 1FDPA 4JYUH 1O2NA 2FLRH 3SV9A 3HGPA 5JB8S 1AU8A 2FX6A 4UFFH 5DGJA 3UR6A 1O3BA 1TMUH 2HPPH 1BQYA 5E2PA 1HXEH 3EYDA 2CGAA 4INHA 1OP2A 5DP8A 4CH2B 2AGIX 2V3HH 2FLBH 2Z9GA 2FESH 1MTSA 1KDQA 1DY9A 1NFYA 1ESBA 1EAIA 3E1XB 4X1SU 3TK5A 1MZAA 3M5OA 2BDCA 5ESTE 1W14U 3U69H 1AMHA 7KMEH 4NWKA 1TOMH 2SGFE 1J16A 1G2LA 1SGEE 1HB0B 2QA9E 1GMCG 1GI8B 2BQ7B 3EE0B 1LCYA 2A4OA 1F92A 1KLIH 1QHRB 2BDIA 2BM2A 4FU9A 1HYLA 1Z71A 2Y5GA 5IDKA 1XUFA 2ILNA 3A88A 5F8TA 3BTQE 4U32A 4NFEA 1EP5A 4ABFA 1AD8H 4WH6A 2C8ZB 4E05H 5DKMA 2A2XH 2BD4A 8GCHF 3UWJH 2XC5A 2VJ1A 1G37A 2HRVA 3TGKE 2PTCE 1S0QA 4YOGA 2OC7A 1NROH 1HAGE 1MQ6A 4A1XA 1N8OB 1VITH 1CU1A 4CH8B 1C5ZB 5C1UA 2PR3A 4MTBA 1NESE 1HAOH 2AEIH 1D3DB 2Q6GA 2ZU2A 2HNTC 2ODPA 1IHSH 2PWXA 1F0TA 5C1XA 3RXEA 1S6FA 2UUKB 2ZGCA 1C1OA 3UWIA 1DT2A 1AKSA 2ZF0H 1P04A 3AASA 2BTCE 4K1SA 4U2WA 1TAWA 5T6DA 1XUGA 1VR1H 1HAYB 2QXJA 4JK5A 3ZVAA 3STJA 3MU1A 2VVVA 3M3VA 3RMOH 3ZZ7A 2FX4A 1ABIH 2BY6X 5EU8A 3QUMP 1H9LB 1ETRH 1DPOA 1OWJA 1C5YB 1UVPA 1RRKA 2EI6A 2OINA 5EODA 2ZFSA 1O3HA 2OP9A 3UNRA 3V3MA 1Z8IB 1TE0A 3ZVCA 3BTFE 3BTDE 3N7OA 3RXGA 2A7HA 1RD3B 3CS7A 1K1LA 5FHTA 1MQ5A 1QURH 3SI4H 2VIQA 1O5EH 1O5GH 2GD4B 1EZSC 2PKSC 3KL6A 4IC5A 4MDSA 3NWUA 1Q2WA 4K1EA 1UCYK 1EJNA 3BTGE 3ATIA 5L2ZH 1PJPA 3ITIA 4AFZA 1W12U 4IGDA 3HKIB 1HAVA 2W3IA 5IYTA 2P94A 2BZAA 4X6PA 1WYKA 2TGPZ 1YPGH 1GI3A 1AWFH 2VH0A 2XCFA 5GCHG 5J4SA 1EB1H 4ABBA 2XBXA 3MMGA 3SHAH 4A92A 1ACBE 1G30B 4WXVA 3MH6A 1BRUP 2GZ7A 1EPTA 2A5IA 4WY3A 1TALA 1HJAC 2ZFTA 1F5RA 4HTCH 1C9TA 1EZQA 1PPCE 1SB1H 2ZI2H 1MTWA 8KME2 1TMBH 1SHHB 1YCPH 8GCHG 3EA7A 4GHTA 1XUJA 2QN5T 3NXPA 5EPNA 1SL3A 2VB0A 1FY4A 2BY5X 1TGCA 1O3NA 2FOFA 3LKWA 2VIVA 1LPGB 2BXTH 2RG3A 1O5AB 2FI5E 1SQAA 1WCZA 3KNXA 1FN6A 3BEFB 1GHBF 2XBWA 4Q7XA 2F9UA 2O8UA 4X6MA 4OS4A 4WMFA 5AVDA 1VITF 5H4IB 4Q80A 4UE7H 1YLCA 1GG6C 4UD9H 1GBHA 2ZU3A 1P2IA 2Z3CA 2ZHFH 5DP3A 2AS9A 1SHYA 4B73A 1DX5M 1UTKA 1EQ9A 1TONA 3EDXB 4DURA 1DITH 1NY22 3LONA 1P2QA 3ZZAA 3MWIU 1GHXH 2AIQA 2A7CA 2BDAA 4B71A 1C1NA 4GHQA 2GV6A 2I6SA 4H4FA 3B9FH 4B2BA 3A85A 2NU1E 4IBLH 4O03A 2G5VA 2FWWA 3P70B 1C1VH 1SLUB 3DT0H 4UDWH 5F6MA 2ASUB 1P2NA 1H4WA 2JH6D 2BXUH 3ZZCA 1UK2A 4NGAH 2B7DH 4LK4A 2BOHB 1MZDA 1IQIA 3SNAA 3MNCA 3P6ZB 1DANH 1LHFH 2M5TA 2GP9B 1YLDA 4JK6A 3RDZA 5LGOA 1LHEH 3F6UH 1O35A 1INCA 1XUIA 4YLUA 4ABAA 2F3CE 1AFQC 1HNEE 4TPIZ 1UO6A 2Z3DA 2Y82A 4O3UA 1SGFG 3IWMA 2ODYB 2BDHA 2O8WA 1MTUA 2PTNA 2ZTYA 1QQUA 2GZ8A 1XX9A 2PLXA 3U98H 4MVNA 1NN6A 2PKAB 4CBOA 1O2VA 5EGMA 1SSXA 3V12A 3KQEA 1T32A 1XXFA 5C1YA 1J14A 1O2RA 4Z0KA 3ZZ5A 4AYYB 1BJVA 2GX4A 5F8XA 2NU0E 2QAAA 5JBTA 5C67A 1O2WA 1LVOA 2SFAA 2NWNA 2ZDNA 4X2YA 5EQSA 2OC0A 1BMNH 1O2ZA 1GCDA 1OS8A 2BVXH 2WV4A 1DE7H 4I33A 3TNTA 4A6LA 3I77A 1BB0B 1SLWB 6LPRA 4XDEA 1GI4A 2OQUA 4AZ2B 4ABEA 4X8SH 1P11E 4FUCA 3RXBA 1LVYA 4X6OA 1DLKB 1V3XA 1PQ7A 1GHBG 4KP0A 3ZVEA 1CA8B 3SBKA 1NT1A 1VITG 2VGCC 1QRWA 1CA0C 1GBBA 5C20A 4RSPA 1O5DH 4VGCC 1OSSA 1A1RA 4NIYA 3KIDU 3D23A 1LPZB 4K3JA 2GT8A 1DICA 1TWXB 3GCTF 2V3OH 1BOQA 3M61U 1LHGH 5JB9S 1TPOA 2FOEA 1GCTC 1GJ9B 4B74A 2VIWA 3NKKA 4ISHH 1PPZA 4NSYA 1Q31A 1J15A 1UMAH 1MBMA 4B2AA 3KHVA 1GMHF 2J34A 3M37A 4CHAC 1TA6A 1Z6JH 1A5GH 1AE5A 1C5RA 1BMAA 1RXPA 1XVMA 2QF3A 4AFQA 2P95A 2CF9H 1K1MA 3SZNA 1GJCB 2G00A 3K6ZA 4JYVH 2NU2E 2XNIA 4X0WU 2HALA 4TWWA 5T6GA 1OP8A 2SNWA 3LGUA 1QRZA 1HIAA 1GI2A 1O33A 2B0FA 3L33A 3TITA 1C2KA 1H9HE 1L4DA 1OXGA 1CBWC 3QWCH 4I8HA 5A8ZA 4YLQH 3LC3A 3A89A 2UUFB 1CT4E 1CT2E 3PLBA 2ZDKA 1YPLH 1X7AC 4HFPB 1ZHRA 1LVMA 2QXHA 4ABJA 4K8YA 1NS3A 2BDBA 2Y6TA 3E8LA 2BQWB 1TBZH 3SUDA 5E0GA 1CGIE 3VFEA 3LH1A 4GCHF 2BDYA 1GL0E 1DWCH 1WV7H 1ANEA 3RMNH 1P2OA 1TGNA 1ZMNA 2CHAC 1QA0A 1MH0A 4K69A 3MH5A 1P2KA 2ANKH 3BF6H 1K21H 1ZRKA 2GV7A 1RIWC 1IQJA 3FZDA 4LZ4B 2WPJS 2O9QA 1C5VA 4BXWA 2EC9H 4Y8YA 1NFUA 1V2VT 2FOMB 2W5EA 4FUJA 4X1RU 3UY9A 2P8OC 1EXFA 2SGAA 3E0PB 3SNCA 4YT7H 3RM0H 3ZZ8A 3CENA 1RTLA 4O3TA 1V2RT 2H9TH 2Y81A 1W7GH 3SU2A 1YC0A 2FMJA 1TNIA 3UREA 1AY6H 1J17T 3T28A 1GDNA 1PPBH 1SGDE 3Q3KA 3ATMA 1ELEE 1EJMA 2C90B 2KAIB 1HAXB 5ETXA 2GCTC 1BCUH 4MLFB 2PSXA 1QJ1B 4DIIH 3L3TA 1LPKB 2ZNKH 4DT7B 3A7WA 1NO9H 3STIA 1O2SA 4B1TA 2FS8A 3A82A 1CE5A 1BRCE 3GCTG 5BPEA 5LH8A 3U9AH 2UWLA 2BD3A 1K1JA 1FAKH 1GPZA 1O3KA 1P9SA 1HDTH 1UVOA 4FUFA 2GZ9A 3KQCA 4MNWA 1P3CA 2Y7XA 3GCHB 4YZUA 4Y7AA 1H8IH 2NU3E 3DUXH 4D7GA 3UNSA 1K9OE 3RXSA 1ZLRA 2STBE 2WUBA 1SI5H 1Z8JB 2ZDMA 4NZLA 4TPYA 2VH6A 4AG2A 1GMHG 3GDVA 5LPEA 5A0AE 1EOJA 3RU4T 2G8TA 1GVKB 1ZPBA 2ZQ2A 1YP9A 2AMDA 3P17H 3P92A 3LGYA 5B6OA 2TGDA 1TMTH 2ZU4A 3B23B 3DFLA 2FOBA 1FQ3A 3RXCA 1RGQA 3A87A 1BBRE 3PMBB 2B9LA 4YM9A 4JZDH 3OSYA 2BOKA 3QGJA 1KXBA 1JIMA 1HLTH 1BTWA 1ZTKA 2F9OA 3D62A 4MNYA 5K7RA 1SLVB 3C1KA 2BX3A 3M35A 1XMNB 2J2UA 3LU9B 3A8BA 2HPQH 4WF8A 1TRMA 1GL1A 1DUAA 1TQ0B 1YPHC 1D3PB 2F9VA 2ZC9H 4NWLA 2ZHDA 3SU3A 5E0JA 1IOEA 1B0FA 1CHOF 2SGDE 1GVLA 1EZXC 3H5CB 2ZFRH 1AE8H 2ZG0H 3IG6B 1Y5UT 1QBOA 1UVUH 4ABDA 5FPTA 5GJ4B 2Y80A 2TGAA 1C5TA 1L0ZA 2AYWA 3UNQA 4ZHAA 3M5LA 1K2I1 1GBLA 1UHBB 2W7SA 4ZKOU 3ZVDA 1B7XB 3DD2H 2ZDLA 1AGJA 2Y5FA 1K28D 1G9IE 1MKXH 1U6QA 5FAHA 1ZSLA 1ANCA 1V2LT 3AAUA 1JXPA 1Y3VA 3F1SB 2AH4X 2AFQB 3MU8A 3K9XB 3NZIA 2AIPA 1CQQA 1SFQB 4MPXA 1A61H 1IQFA 1SGTA 1S5SA 1E36B 1BRAA 1SC8U 4ABGA 1MCVA 3S9BA 1QB9A 4B76A 4K1TA 1HV7A 1LTOA 1NU9A 1TRNA 3SUEA 1ANBA 4JMYA 2ZDVH 4ZKRU 2G51A 1NPMA 1QIXB 1T4UH 5JYIA 1O30A 2HLCA 1GDUA 4Y0ZE 1PYTC 3LH3A 3Q00A 2FS9A 1GBJA 2GDEH 1WSSH 4TYDA 1FY1A 5G4BA 4AGKA 2HGTH 4UFDH 3SGBE 3GOVB 7LPRA 4A1TA 3FP7E 1KTSB 4WXIA 2FTMA 2O8MA 5FPYA 1AN1E 1OWIA 2FDAA 1P05A 2THFB 5FX6A 4AFSA 3SU4A 1P2MA 4CRCA 2ZQ1A 4IN2A 1QCPA 2ZZUH 1T8LA 1GI5A 1E0FD 2LPRA 3Q3XA 1P01A 3DHKH 1BTHH 3A7ZA 1IQGA 6GCHF 3FFGA 1KDQB 4KKDA 3ZZ4A 3RC5A 4MPWA 2A4QA 1V2PT 2FZZA 3I29A 4YT6H 1GVZA 1W3CA 4BOHA 1DY8A 4X8UH 4I8GA 1FONA 2Z94A 1AI8H 2PKSB 3BTEE 3RU4E 1W7XH 2ZHQH 4BAOB 1GBTA 1FY8E 1QQ4A 1SGRE 2A7JA 2OC1A 3AW1A 1Y5BT 1UTMA 2VIPA 1C2MA 3GY3A 3QDZB 4OS6A 4Y6DA 2BVRH 4FUEA 1O2MA 4ZAEA 2OTVA 3PWCA 2H9HA 2ZU5A 1FXYA 5EQQA 1ETTH 5HGGA 1TQ7B 2BD5A 1A7SA 1TRYA 4FU8A 4Y71A 4XSKU 1P09A 1CHOG 2PW8H 2TBSA 1VJ9U 4FUGA 1ZMLA 1P03A 2A1DB 2UUYA 1G36A 1Y3XA 4IN1A 4A5TS 4OS7A 2AGEX 1J8AA 1BZXE 1NC6A 2BMGB 1KLJH 1LQDB 1ZSJA 1FY3A 1E38B 1M9UA 3C27B 1BT7A 3GICB 5F8ZA 2A2QH 4Y7BA 5CHAC 2XC0A 3PLPA 1BITA 1C4Y2 3WY8A 5JBCS 1C5SA 3SOSA 4Q7ZA 2GTBA 1PPEE 3BTME 3RM2H 3SJ8A 1N6XA 5T3HA 2RA0A 3OY5U 2R2WU 1Y59T 1AKSB 1HBTH 2R0KA 2CXVA 1AQ7A 3PTBA 2HNTE 1GG6B 2C8XB 4O97A 1VCQA 3ZV9A 2XYAA 3PO1B 2ZGHA 1GWAA 4ASHA 4MPUA 3EA8A 5CMXH 2WPHS 1JIRA 3ZZ3A 2FO9A 5T6FA 2D26C 2G52A 1HFDA 3TNSA 1HXFH 1TPAE 3RXLA 1DXPA 3UFAA 2BY9X 3MI4A 1O38A 1C4U2 3SJIA 1WOFA 3E90B 1GJDB 1FNIA 1CGHA 3GCOA 1SPJA 5FCKA 3AW0A 1DXWA 2OC8A 3A81A 4AX9H 2CMYA 3E0NB 3P95A 1WUNH 4X2WA 1GBMA 2PHBA 1HJ8A 4NSVA 1P02A 1S83A 2Z7FE 1XUKA 1ZR0A 2ZCLP 3R3GB 1QB1A 3GY4A 4DJZB 1HAVB 2FOAA 1IQKA 2FI4E 4NFFA 1UTPA 4JYTA 7GCHF 3L6PA 1AFQB 1EUFA 1GHVH 1PQAA 1V2JT 1XXDA 4BAQB 4DIHH 1SQOA 4ZKSU 1ZGIA 2Z6BD 1SGNE 7ESTE 4MNVA 2PUQH 5FPSA 4XBCA 1AIXH 3RXHA 1MTVA 3MO9A 2O8LA 1HGTH 1GI7B 2XW9A 4E06H 2VVUA 5F03A 1O37A 3BIUH 2BLQA 5FBIA 2ZEBA 3BG8A 1T8NA 3K2UA 3LGWA 4ZXXH 3S0NA 3PV4A 2BZ6H 1T7CA 2XRCA 3B8JA 1ZHMA 1O3FA 3P8FA 2G4UA 1O3CA 2BLVA 3T29A 2QV1A 1ZSKA 3FVFB 3VB4A 2ZFQH 4YTAA 3TH2H 2HWLB 5EXNA 3E3TA 3SNEA 1JWTA 2WYJA 1Y3YA 3MO3A 4BNRA 4D7FA 2QXIA 2G4TA 3T62A 1GGDC 1E35B 3FP8E 1GBCA 3M3TA 1IHTH 4FVBA 1WAYB 5AHGH 1DVAH 2VIOA 4GLYA 3P8OA 1V2KT 2Q1JA 2F9PA 3BEIB 2ZCHP 2VGCB 1CA0B 1ARCA 1BDAA 3QGNB 6ESTA 1SGIB 1DFPA 1V2QT 1NRNH 1HAZB 1DWDH 3KQBA 3SJOA 1THSH 2H9EH 3RU4D 3BTTE 1C1RA 3GY7A 1C5NH 5DG6A 1GCTB 1UCYE 2I6QA 2O8TA 3GYMA 3KQDA 1EPTC 1ETSH 1A0HB 3A8CA 4NG9H 1A46H 3A84A 1W2KH 4AB8A 3IITA 1HAIH 4BXSA 1EX3A 1F0RA 2BY7X 1ELDE 1LHCH 2ULLA 1NU7B 1C1PA 1S82A 1A2CH 3V0XA 4BTIB 3A80A 4CRBA 5I46H 1GI6A 4SGAE 4RKOB 2BD2A 4FUBA 1TABE 2BLOA 4LOYH 1H9IE 3TK6A 2EEKA 4O9VA 3GY8A 1SLXB 1YF4A 1A4WH 3SU5A 3GCNA 4AORA 3TJUA 1XUHA 3QN7A 5I25A 1TPPA 1DSTA 7GCHG 1CBWB 3QO6A 1EB2A 3RXJA 2A32A 2HVXA 1SVPA
chains in the Genus database with same CATH superfamily
2H6MA 1S6LA 1V2OT 1Y3UA 1C2LA 1KTTB 3UB0A 2CK3D 1IQHA 1CSOE 1MUEB 1SFIA 5DP4A 2QC2A 4INLA 2TPIZ 3BG4B 3LIWA 1WQSA 1GJ8B 1VGCC 3D49H 3F0PA 5A0CA 1TA2A 4UFGH 2ZDAH 1O36A 1F7ZA 1O2UA 1UJ1A 1WBGB 2CHAB 3KGPA 4GAWA 5A0BA 1AZ8A 5DN6D 1OYTH 2Y7ZA 4Y79A 1O3LA 1TBRH 1AVGH 1GBKA 2R9PA 3ZZBA 1PFXC 1RIWB 1GI1A 1C1MA 1O39A 4Y8XA 3BTHE 4NA9H 1HAHH 1MD8A 1KXEA 3JZ2B 1A3EH 5SGAE 2FOGA 3QK1A 1TFXA 2SGEE 2J4IA 2Z9JA 5E2OA 2L74A 3RUOA 1O3GA 2P8OB 1Q3XA 2J38A 3BV9B 2FEQH 1G3CA 2ALPA 3M5NA 1QGFA 2J98A 4DW2U 1XKAC 3HK6B 1C2FA 1FZZA 1YCPK 4J1YA 2F91A 3T5FH 3U8RH 5ESBA 1TNLA 4DCDA 1UK4A 5C94A 1EKBB 1FI8A 2GCTB 1NRPH 1TOCB 1NRQH 5DP9A 1GHAF 2JH5D 4Y10E 1CVWH 1O2XA 3N7EA 1PPGE 3T27A 1YWUA 3SJ9A 4YOIA 4WVPE 4DVAU 1SOTA 1F2SE 1T4VH 2KCYA 3SQHE 2GVFA 5TCCA 4AB9A 3LDXH 1TLDA 1AO5A 1FJSA 1AVWA 3T26A 1S6HA 5T1VA 1GJ6A 1PPFE 1QY6A 1V2WT 3G01A 3OYPA 3TJVA 1SOZA 3FP6E 3QTVH 1O3EA 1DUEA 4R8TB 2ZO3H 3F2HA 2BD7A 1YPJH 3VPKA 2JH0D 3SV8A 2DE8A 4JCNA 4WWYA 1ZMJA 4KELA 1E79D 2FOHA 3ODDA 2WSSD 4GPGA 4ISIH 1KSNA 2AHME 1V2NT 3H7OA 3PYHA 1N1LA 3LT3A 4MQAA 4NIWA 3UR9A 3UQVA 3A7VA 5HXFA 2Z9IA 1H8HD 3AAVA 2QF4A 1CO7E 2W26A 4OS1A 1VCWA 1FLEE 1D3QB 1KYNA 1O32A 1FIZA 2XWAA 3ATWA 4MG3A 3CP7A 4BAKB 1ELGA 1FMGA 3ESTA 3UIRA 1JRSA 1ELFA 2ZFPH 4ABHA 4X6NA 1YBWA 1ZPZA 2FYQA 3SU6A 2TIOA 2R0LA 1FUJA 4M7GA 2KM0A 1ZYOA 1QBNA 1ESAA 2WPLS 1C5UA 3H09A 2BVSH 3F9EA 2D2DA 1DSUA 1QL7A 2XWBI 2PGQB 3TJOA 2ZGJA 1C5WB 5C0TA 1GHZA 1MU8B 3O8BA 4R0IA 3RMLH 1SR5C 4DG4A 1ELCA 2GMTC 2IN2A 2VINA 5GIBA 1YPMH 1GHYH 2J9NA 1MU6B 1ZPCA 2J95A 3MU4A 1S84A 1RS0A 3M7TA 1IQLA 4D76A 1LMWB 2OBQA 3O8RA 3PMJA 1QB6A 4Q4LA 1C2GA 1O3JA 2ZGXH 5DP7A 3UPEA 1V2TT 1WQVH 3HPTB 1O31A 4AFUA 3TU7H 3QZRA 3HATH 2VNTA 4DGJA 1AVXA 1O5FH 2V7QD 3RC4A 1BIOA 1C1SA 2GDDA 3PB1E 4CR5A 1QFKH 4UFEH 1TGSZ 4FUHA 1O3AA 1SGCA 6CHAC 1MTNC 1RJXB 3TH3H 1A0JA 1Y3WA 3FKSD 3PM3A 2XC4A 1P2JA 1K1OA 4I8LA 1OYQA 2P93A 1MMJN 3LOXA 4ISOA 4ZH8A 3VGCC 5EW1H 3K6YA 4SGBE 5HMAA 1QZ8A 3GY2A 1H1BA 4ZKNU 2STAE 3A8DA 4NA8A 1J9CH 1Y8TA 1AB9C 1UHBA 1KXCA 1UK3A 3BTWE 1VJAU 4HG6A 1FIWA 4GCHG 5DO4H 2ZFFH 1ELVA 3FAOA 1V6DA 3MNXA 3MYWA 1MAXA 2H2ZA 2ZA5A 2F9BH 2OQ5A 1MCTA 2JETC 2GCHF 2AGGX 4K8BA 3U1IB 2OCVB 3PRBA 4CR9A 2FM2A 1XVOA 2KCPA 5GNDA 1CT0E 1W13U 4JZIA 2BB4A 4AG1A 5FL7D 3S9CA 3M3SA 1B0EA 3PWBA 3UTUH 1GBFA 1T31A 3RXQA 1C5PA 1DOJA 1SGPE 1O3DA 1UTQA 4GVUA 3R0FA 2ESTE 3U8OH 4K60A 2OBOA 1BTYA 1EAWA 3SHCH 4IW4E 1HUTH 3A7TA 2Y5HA 3VB6A 4NIVA 1W0ZU 2FI3E 3A7YA 2EI7A 5TJXA 2H5CA 3M7UA 3GYLB 2VVCA 2LP6A 2R3YA 3RXKA 1BTPA 3ZZ9A 2Q6DA 4HI3A 3UQOA 2XCNA 3MU0A 2FOCA 4RI0A 1S85A 4P00A 3PMAB 2W7UA 4D8NA 4IS5A 2H5DA 1W10U 2M2AA 2AMQA 1GHWH 3PLKA 3EA9A 3W94A 1BTZA 5PTPA 4X1NU 1NFWA 4E7RG 1P10A 4ZHMU 3RXTA 3A83A 1TGBA 2YNAA 1C2HA 1SGQE 2ODQA 1Z6EA 4IC6A 3OU0A 2G5NA 1C5XB 1ORFA 5C5NA 1DM4B 2PFEA 3OTPA 4H6SB 3O8CA 5CHAB 2J94A 3RXAA 2G81E 3SI3H 2YOLA 2VWOA 1C1WH 1TGTA 3SQEE 1MKWH 1G2MA 1G3BA 3NPSA 1YPEH 3M7QA 5GCHF 2WPKS 2FTLE 1D6RA 2RFKC 3RP2A 3ATLA 3F9GA 5EJLA 2HOBA 1B5GH 2C93B 5DJ7A 2YMSC 3HK3B 1ZHPA 5GPIB 2BYAX 4AOQA 5GWZA 3RXVA 4OS5A 2XXLA 1TX7A 3ODFA 1VCPA 2BD9A 3SO3A 3VB3A 1A5HA 1BJUA 4B75A 1ZTJA 1C2JA 3VXFH 3TPIZ 1O2GH 3FZZA 2V6NA 1HCGA 4B6EA 4CRDA 1EOLA 1W0YH 1IAUA 4JZEH 1Z8RA 5L6NH 4PROA 1G32B 4I31A 2XNDD 4Q2KA 4FU7A 5DK1A 2ZHEH 2IJOB 4Q7YA 1C9PA 2TRMA 3OY6U 1C2EA 4D9RA 4MPVA 4OGYA 3SNDA 4A1VA 1P3EA 2UUJB 4TY7A 3ZVGA 5A2MH 2SGPE 4IMQA 4RN6A 1TNKA 2GCHG 1V2ST 1AUJA 1QR3E 1HJAB 4X8VH 1OPHB 2ZP0H 3SNBA 1TNJA 3EAJA 2GGVB 1O2IA 1O5CB 2VBCA 2CF8H 1O2TA 4AN7A 1PQ5A 1BA8B 4THNH 1CHGA 5A8YA 2OLGA 1XM1A 5FX5A 1DWBH 3F9HA 3DSPA 4CRGA 1GBDA 5FBEA 1GBAA 1LO6A 2A31A 4ZROA 1PQ8A 3VXEH 1NRSH 2P3UB 4NIXA 1DWEH 3F68H 1OHHD 4TWYA 4Z6AH 4UONA 3SV6A 3MTYA 1D4PB 2ALVA 4BAHB 2A4GA 2PUXB 4X1PU 1AHTH 1LVBA 1T8OA 2ZPQA 4NZQA 4KTCA 5AFZH 1WTGH 5DP5A 3LGTA 4ZXYH 1N8OC 5LPFA 1MD7A 5JBBS 3ZYEA 3SUGA 1QTFA 2WPIS 3MFJA 3TK9A 1EZUC 1TX8A 3SUFA 4XFQA 2IPQX 3URCA 1V2MT 5BRRE 2P3FH 3QLPH 1TNHA 1T8MA 1C5QA 1K1PA 4FUIA 3RMMH 5KECA 4F4OC 3A86A 1A5IA 4KTUA 3KN2A 1D3TB 2P16A 4XBBA 1JOUB 3NK8A 4Y0YE 2XBYA 3T25A 1GGDB 1L4ZA 1MKXK 2ZHWH 1WXRA 6GCHG 1HRTH 2G55A 1SQRA 4XRNA 5EG4A 2DE9A 4U30A 3HGNA 1AUTC 2ZECA 4FUDA 2PGBB 2EI8A 1TIOA 2WUCA 4F48B 1BBRH 2KFWA 2BLWA 1SGFA 3TIUA 2B5TB 1MAYA 3TVJB 2CV3A 1EAUA 1WTHD 2R3UA 1GJ5H 3M5MA 2A45B 2BQ6B 1IQNA 3AVZA 3ATKA 1UTOA 2XBVA 3I78A 1AWHB 1EPTB 3LJOA 4QT8C 3ZZ6A 4DOQA 3ENSB 5EPYA 1LKAA 2BD8A 2WV5A 1THPB 2WYGA 3GDSA 1CGJE 3S7KB 3A7XA 2FODA 5HKKD 1YKTA 2RCEA 1O0DH 2PSYA 2F9NA 3DA9B 4X1QU 1YPKH 3V13A 5L30H 3A8AA 1OOKB 1QA7A 2FPZA 1SG8B 2C8YB 4F49A 1QBVH 2OK5A 1C1TA 3PO1C 3UOPA 3BTKE 1UVTH 4LZ1H 4X8TH 1SGYE 1KY9A 1TBQH 3W1EA 2SNVA 4ACBA 5CDFE 1QL9A 1MKWK 1GDQA 1QRXA 3ZVBA 1O34A 3LJJA 4I8JA 1O3PB 1THRH 3RXMA 1D9IA 1V2UT 2C8WB 3SGAE 2P3TB 1YM0A 1C5MD 3BEUA 4BANB 2VWMA 3NCLA 1OWEA 5EXMA 1F5LA 2PKAA 2VWLA 4VGCB 2EA3A 1W11U 5E8EH 1VGCB 4J2YB 4ABIA 2RDLA 1TX6A 2SGQE 2ZPRA 3MU5A 1PYTD 1L1JA 4OGXA 1DS2E 4WJG2 4B2CA 4OM9A 1UVSH 1WU1A 3P8GA 1O2HA 1ZJDA 2ZCKP 1O3OA 4I8KA 1KXAA 1Z8GA 3LC5A 3FOAA 5C5OA 4XOJA 5EXLA 3PROA 4ZUHA 1AZZA 4BTUB 4CHAB 4XE4A 1BTUA 1FAXA 1GI9B 1C1QA 5EIYA 4JZ1A 1PPHE 3ZZDA 1ZTLA 4HGCA 1BMLA 1JBUH 4CBNA 3FANA 3RC6A 3TGIE 1BUIA 2GT7A 2PV9B 4UEHH 2UWPA 4D9QA 2IPHA 4AGJA 3TGJE 1RTKA 3OX7U 3ZV8A 1O2QA 3RXIA 1FPHH 5KEDA 4H6TA 5C0UA 5A09A 1GJBB 2QYIA 5L2YH 1BTXA 1GI0A 3LGIA 5LPRA 3SV7A 5DPAA 3PMHB 2QXGA 2ZIQH 1SQTA 4LXBH 4X2VA 1F0SA 1GJ4H 2EY4C 1LHDH 1O3IA 4GUXA 1Z1IA 4AYVB 2ZTXA 3F9FA 2Z9KA 4WMEA 3P8NA 4HZHA 1EAXA 2VU8E 5JBAS 4WMDA 1NFXA 1JMOH 3U8TH 2JKHA 4U01A 1FY5A 3RXRA 1A3BH 1P8VC 1AFEH 3Q77A 1C1UH 1O3MA 5K0HA 1DLEA 4FXGH 4H42U 2QY0B 4I32A 4E7NA 2GJGA 1ZRBA 3VB5A 3RXFA 2K1QA 4KTSA 4Y8ZA 3DFJA 1LKBA 2ZKSA 1N6YA 3GDUA 2WV9A 4YESB 1ID5H 1NBME 5FCRA 3GY6A 1TB6H 1C2IA 2QF0A 5E0HA 4CRAA 1ELBA 3FN8A 5A8XA 2BHGA 3K65B 1RTFB 1O2LA 4XBDA 1C2DA 2YNBA 3GISB 3VEQB 2Q6FA 3UUZA 1E37B 3HKJB 2WPDD 3MNBA 1Y5AT 2GKVE 2A0QB 3DSOA 5J4QA 4MNXA 8LPRA 1UTNA 3H7TA 3RXPA 1OP0A 2FP7B 2J92A 1BBRK 2WPMS 2HVYB 1BMMH 3S69A 1ZGVA 2W3KA 4OS2A 5F53A 3U1JB 2TGTA 1TPSA 3BIVH 4K2YA 1H8ED 3ELAH 4INKA 3BSQA 1FN8A 1FPCH 9LPRA 1L1NA 1SKYE 1ARBA 1UTLM 2GMTB 5HYOA 1SBWA 2QE7D 3QTOH 1C5LH 2OUAA 4ZMAH 1KIGH 3CNRA 3MH7A 3N7DA 3ZYDA 3LPRA 2Z3EA 1C5OH 2D1JA 2ZU1A 1Z7KA 1QL8A 2BX4A 1HPGA 2R2MB 1GMDF 4A7IB 3O8DA 1EASA 4RKJB 2QIQA 5GDSH 2VIDA 1ELAA 2JDID 1HIAB 1YGCH 3BG4C 1FV9A 2A4RA 1P57B 2NU4E 1D6WA 1BRBE 2DUCA 3RXUA 1P06A 3T2NA 4JZFH 2KAIA 2CN0H 3W95A 1QJ7B 1OWDA 5AFYH 1MBQA 5EW2H 2ANWA 1W8BH 5AF9H 2IOTA 2Z9LA 3UOUA 6CHAB 1MTNB 4TY6A 2QGRA 2KX4A 3QX5H 3KYGA 3VB7A 4BAMB 3QZQA 4ZHLU 2F83A 4FVDA 3RXOA 1NRRH 1TYNA 1O2KA 1NZQH 2LNCA 3CS0A 3VGCB 1QNJA 3E91A 1NM6A 1OWKA 3S7HB 1BHXF 1W0KD 3MH4A 3E6PH 2ZWLH 1AB9B 3D65E 1P12E 5DP6A 3GY5A 1P0SH 3LGVA 3SV2H 4I7YH 4K5ZA 3F2FA 3RLWH 1S81A 2AMPA 4I86A 2FXRA 4YO9A 2JETB 3OTJE 3MO6A 1IQEA 5C2ZA 2ZPSA 1ELTA 1F0UA 2L6OA 3KCGH 3FO8D 1OWHA 4YOJA 2W6JD 3KF2A 4CREA 3TH4H 1HJ9A 5C3NA 2ZTZA 2EQNA 3TLOA 5EOKA 1NTPA 1EJAA 1XKBC 3PTNA 1KXFA 2XTTB 3URDA 1EATA 1MABB 2WHXA 1GMCF 1GJAB 1JRTA 5KGOA 3M36A 1KLTA 1O2JA 3V7TA 4BTTB 2V35A 3NUMA 1K1NA 2ZGBH 2UWOA 5ABWA 1GBEA 2D8WA 1G3EA 1ZZZA 2FYRA 4X2XA 1GHAG 3Q3YA 2BY8X 5GXPA 4WH8A 1ABJH 1O2YA 3JZ1B 1KXDA 1SMFE 2RA3A 9ESTA 2QCYA 5HM9A 3KEEA 2JIZD 1E34B 3RLYH 4KGAA 3SORA 2FIRH 4Y76A 1HAPH 1S0RA 1BHXB 4DT4A 1TNGA 3SGQE 3MQKC 2HNTF 4ISLA 4NCYA 5JPMH 4CRFA 5CE1A 1EP6A 1O2OA 1OX1A 5EQRA 1K1IA 3MNSA 1YYY1 2AERH 2JJ1D 3SU0A 2CJIA 4Y11E 2C4FH 3E16B 1UCYH 4NA7A 2V0BA 1F5KU 3ZVFA 3TJNA 3SU1A 1ZOMA 1O5BB 2BDGA 1GMDG 3SN8A 1K22H 2ANYA 1VZQH 1LDTT 3EGKH 3SW2B 8ESTE 1IQMA 1P9UA 2P59A 1C4V2 4DY7B 2VWNA 5TCAA 1G3DA 3Q76A 2C3SA 3SJKA 1LQEA 2OXSA 1ESTA 2WINI 5JDUB 2YMSB 2OD3B 1GBIA 2B8OH 1GJ7B 1RFNA 4IMZA 1QJ6B 1A0LA 1UTJA 4RT1A 1K0HA 1Z1JA 5HM2A 3GCHC 3EQ0H 4ESTE 5FXLA 2A5KA 3KYFA 2H1UA 4B6FA 4GSOA 1NBMD 2ANMH 3BN9A 1DDJA 1H8DH 3S9AA 2A5AA 3RXDA 1L2EA 2F43B 1YCPM 3MOCA 4ISNA 1ZJKA 3MHWU 1YPHE 1O2PA 1ANDA 1L1GA 1OKXA 1FDPA 4JYUH 1O2NA 2FLRH 3SV9A 3HGPA 5JB8S 1AU8A 2FX6A 4UFFH 5DGJA 3UR6A 1O3BA 1TMUH 2HPPH 1BQYA 5E2PA 1HXEH 3EYDA 2CGAA 4INHA 1OP2A 5DP8A 4CH2B 2AGIX 2V3HH 2FLBH 2Z9GA 2FESH 1MTSA 1KDQA 1DY9A 2KCOA 1NFYA 1ESBA 1EAIA 3E1XB 4X1SU 3TK5A 1MZAA 3M5OA 2BDCA 5ESTE 1W14U 3U69H 1AMHA 7KMEH 4NWKA 1TOMH 2SGFE 1J16A 1G2LA 1SGEE 1HB0B 2J97A 2QA9E 1GMCG 3DSGA 3OE7D 1GI8B 2BQ7B 3EE0B 1LCYA 2A4OA 1F92A 1KLIH 1QHRB 2BDIA 2BM2A 4FU9A 1HYLA 1Z71A 2Y5GA 5IDKA 1XUFA 2ILNA 3A88A 5F8TA 3BTQE 4U32A 4NFEA 1EP5A 4ABFA 1AD8H 4WH6A 4Z1MD 2C8ZB 4E05H 5DKMA 2A2XH 2BD4A 8GCHF 3UWJH 2XC5A 2VJ1A 1G37A 2HRVA 3TGKE 4FETA 2PTCE 1S0QA 1YY3A 4YOGA 2OC7A 3ZIAD 1NROH 1HAGE 1MQ6A 3AK5A 4A1XA 1N8OB 1VITH 1CU1A 4CH8B 1C5ZB 5C1UA 3VG8A 2PR3A 4MTBA 1NESE 3PRDA 2AEIH 1HAOH 1D3DB 2Q6GA 2ZU2A 2HNTC 2ODPA 1IHSH 2PWXA 1F0TA 5C1XA 3RXEA 1S6FA 2UUKB 2ZGCA 1C1OA 3UWIA 1DT2A 1AKSA 2ZF0H 1P04A 3AASA 2BTCE 4K1SA 4U2WA 1TAWA 2V3MA 5T6DA 1XUGA 1VR1H 3OEHD 1HAYB 2QXJA 4JK5A 3ZVAA 1UW7A 3STJA 3MU1A 2VVVA 3M3VA 3RMOH 3ZZ7A 2FX4A 1ABIH 2BY6X 5EU8A 3QUMP 1H9LB 1ETRH 1DPOA 1OWJA 1C5YB 1BMFD 1UVPA 1RRKA 2EI6A 3EE7A 2OINA 5EODA 2ZFSA 1O3HA 2OP9A 3UNRA 3V3MA 1Z8IB 1TE0A 3ZVCA 3BTFE 3BTDE 3N7OA 3RXGA 2A7HA 1RD3B 3CS7A 1K1LA 5FHTA 1MQ5A 1QURH 3SI4H 5IK2D 2VIQA 1O5EH 1O5GH 2GD4B 1EZSC 2PKSC 3KL6A 4IC5A 4MDSA 3NWUA 1Q2WA 4K1EA 1UCYK 1EJNA 3BTGE 3ATIA 5L2ZH 1PJPA 3ITIA 4AFZA 1W12U 4IGDA 3HKIB 1HAVA 2W3IA 5IYTA 2P94A 2BZAA 1COWD 4X6PA 1WYKA 2TGPZ 1YPGH 1GI3A 2F4LA 1AWFH 2VH0A 2XCFA 5GCHG 5J4SA 1EB1H 4ABBA 2XBXA 3MMGA 3SHAH 4A92A 1ACBE 1G30B 4WXVA 3MH6A 1BRUP 2GZ7A 1EPTA 2A5IA 4WY3A 1TALA 1HJAC 2ZFTA 1F5RA 4HTCH 1C9TA 1EZQA 1PPCE 1SB1H 2ZI2H 1MTWA 8KME2 1TMBH 1SHHB 1YCPH 8GCHG 3EA7A 4GHTA 1XUJA 2QN5T 3NXPA 5EPNA 1SL3A 2VB0A 1FY4A 2BY5X 1TGCA 1O3NA 2FOFA 3LKWA 1VKYA 2VIVA 1LPGB 2BXTH 2RG3A 1O5AB 2FI5E 1SQAA 1WCZA 3KNXA 1FN6A 3BEFB 1GHBF 2XBWA 4Q7XA 2F9UA 2O8UA 4X6MA 4OS4A 4WMFA 5AVDA 1VITF 5H4IB 4Q80A 4UE7H 4XD7D 1YLCA 1GG6C 4UD9H 1GBHA 2JJ2D 2ZU3A 3KQ5A 2K0QA 1P2IA 2Z3CA 2ZHFH 4M9FA 2AS9A 5DP3A 1SHYA 4B73A 1DX5M 1UTKA 1EQ9A 1TONA 3EDXB 4DURA 1DITH 1NY22 3LONA 1P2QA 3ZZAA 3MWIU 4YXWD 1GHXH 2AIQA 2A7CA 2BDAA 4B71A 1C1NA 4GHQA 2GV6A 2I6SA 4H4FA 3F0OA 3B9FH 4B2BA 3A85A 2NU1E 4IBLH 4O03A 2G5VA 2FWWA 3P70B 1C1VH 1SLUB 3DT0H 2IJD1 4UDWH 5F6MA 2ASUB 1P2NA 1H4WA 2JH6D 2BXUH 3ZZCA 1UK2A 4NGAH 2B7DH 4LK4A 2BOHB 1MZDA 1IQIA 3SNAA 3MNCA 3P6ZB 1DANH 1LHFH 2M5TA 2GP9B 1YLDA 4JK6A 3RDZA 5LGOA 1LHEH 3F6UH 1O35A 1INCA 1XUIA 4YLUA 4ABAA 2F3CE 1AFQC 1HNEE 4TPIZ 1UO6A 2Z3DA 2Y82A 4O3UA 1SGFG 3IWMA 2ODYB 2BDHA 2O8WA 1MTUA 2PTNA 2ZTYA 1QQUA 2GZ8A 1XX9A 2PLXA 1W0JD 4MVNA 3U98H 1NN6A 2PKAB 4CBOA 1O2VA 5EGMA 1SSXA 5HIYA 3V12A 3KQEA 1T32A 1XXFA 5C1YA 1J14A 1O2RA 4Z0KA 3ZZ5A 4AYYB 1BJVA 2GX4A 5F8XA 1WDIA 2NU0E 2QAAA 5JBTA 5C67A 2YMSD 1O2WA 1LVOA 2SFAA 2NWNA 2ZDNA 4X2YA 5EQSA 2OC0A 1BMNH 1O2ZA 1GCDA 1OS8A 2BVXH 2WV4A 1DE7H 4I33A 3TNTA 4ZCNA 4A6LA 3I77A 1BB0B 1SLWB 6LPRA 4XDEA 1GI4A 2OQUA 4AZ2B 4ABEA 4X8SH 1P11E 4FUCA 3RXBA 1LVYA 4X6OA 1DLKB 1V3XA 1PQ7A 1GHBG 4KP0A 3ZVEA 1CA8B 3SBKA 1NT1A 1VITG 2VGCC 1QRWA 1CA0C 3WW7A 1GBBA 5C20A 4RSPA 1O5DH 4VGCC 1OSSA 1A1RA 2W6ID 4NIYA 4ASUD 3KIDU 3D23A 1LPZB 4K3JA 2GT8A 1DICA 1TWXB 3GCTF 2V3OH 1BOQA 3M61U 1LHGH 5JB9S 1TPOA 2FOEA 3WWFA 1GCTC 1GJ9B 4B74A 2VIWA 3NKKA 4ISHH 1PPZA 4NSYA 1Q31A 1J15A 1UMAH 1MBMA 4B2AA 3KHVA 1GMHF 2J34A 3M37A 4CHAC 4TT3D 1TA6A 1Z6JH 1A5GH 1AE5A 1C5RA 1BMAA 1KMHB 1RXPA 1XVMA 2QF3A 3F2GA 4AFQA 2P95A 2CF9H 1K1MA 2J5UA 3SZNA 1GJCB 2G00A 3K6ZA 4JYVH 2NU2E 2XNIA 4X0WU 2HALA 4TWWA 5T6GA 1OP8A 2SNWA 3LGUA 1QRZA 1HIAA 1GI2A 1O33A 2B0FA 3L33A 3TITA 1C2KA 1H9HE 1L4DA 1OXGA 1CBWC 2J98B 3QWCH 4I8HA 5A8ZA 4YLQH 3LC3A 3A89A 2UUFB 1CT4E 1CT2E 3PLBA 2ZDKA 1YPLH 1X7AC 1YLNA 4HFPB 1ZHRA 5EJZA 1LVMA 2QXHA 4ABJA 4K8YA 1NS3A 2BDBA 2Y6TA 3E8LA 2BQWB 1TBZH 3SUDA 5E0GA 1CGIE 3VFEA 3LH1A 4GCHF 2BDYA 1GL0E 1DWCH 1WV7H 1ANEA 3RMNH 1P2OA 1TGNA 1ZMNA 2CHAC 1QA0A 1MH0A 4K69A 3MH5A 1P2KA 2ANKH 3BF6H 1K21H 1ZRKA 2GV7A 1RIWC 1IQJA 3FZDA 5CHBA 4LZ4B 2WPJS 2O9QA 1C5VA 4BXWA 2EC9H 4Y8YA 1NFUA 1V2VT 2FOMB 2W5EA 4FUJA 4X1RU 3UY9A 2P8OC 1EXFA 2SGAA 3E0PB 3SNCA 4YT7H 3RM0H 3ZZ8A 3CENA 1RTLA 1E1QD 4O3TA 1V2RT 2H9TH 2Y81A 1W7GH 3SU2A 1YC0A 2FMJA 1TNIA 3UREA 1AY6H 1J17T 1E1RD 3T28A 1GDNA 1PPBH 1SGDE 3Q3KA 3ATMA 1ELEE 1EJMA 2C90B 2KAIB 4AC9A 1HAXB 5ETXA 2GCTC 1BCUH 4MLFB 2PSXA 1QJ1B 4DIIH 3L3TA 1LPKB 2ZNKH 4DT7B 3A7WA 2PP6A 1NO9H 3STIA 1O2SA 4B1TA 2FS8A 3A82A 1CE5A 1BRCE 3GCTG 5BPEA 5LH8A 3U9AH 2UWLA 2BD3A 1K1JA 1FAKH 1GPZA 1O3KA 1P9SA 1HDTH 1UVOA 4FUFA 2GZ9A 3KQCA 4MNWA 1P3CA 2Y7XA 3GCHB 4YZUA 4Y7AA 1H8IH 2NU3E 3DUXH 4D7GA 3UNSA 1K9OE 3RXSA 1ZLRA 2STBE 2WUBA 1SI5H 1Z8JB 2ZDMA 4TSFD 4NZLA 4TPYA 2VH6A 4AG2A 1GMHG 3GDVA 5LPEA 5A0AE 1EOJA 3RU4T 2G8TA 1GVKB 1ZPBA 2ZQ2A 1YP9A 2AMDA 3P17H 3P92A 3LGYA 5B6OA 2TGDA 1TMTH 2ZU4A 5HIZA 3B23B 3DFLA 3SYJA 2FOBA 1FQ3A 3RXCA 1RGQA 3A87A 1BBRE 3PMBB 2B9LA 4YM9A 4JZDH 3OSYA 2BOKA 3QGJA 1KXBA 1JIMA 1HLTH 1BTWA 1ZTKA 2F9OA 3D62A 2RDEA 4MNYA 5K7RA 1SLVB 3C1KA 3WWBA 3U28C 2BX3A 3M35A 1XMNB 2J2UA 3LU9B 3A8BA 2HPQH 4WF8A 1TRMA 1GL1A 1DUAA 1TQ0B 1YPHC 1D3PB 2F9VA 2ZC9H 4NWLA 2ZHDA 3SU3A 5E0JA 1IOEA 1B0FA 1CHOF 2SGDE 1GVLA 1EZXC 3H5CB 2ZFRH 1AE8H 2ZG0H 3IG6B 1Y5UT 4P02A 1QBOA 1UVUH 4ABDA 5FPTA 5GJ4B 2Y80A 2TGAA 1C5TA 1L0ZA 2AYWA 3UNQA 4ZHAA 3M5LA 1K2I1 1GBLA 1UHBB 2W7SA 4ZKOU 3ZVDA 1B7XB 3DD2H 2ZDLA 1AGJA 2Y5FA 1K28D 1G9IE 1MKXH 1U6QA 5FAHA 1ZSLA 1ANCA 1V2LT 3AAUA 1JXPA 1Y3VA 3F1SB 2AH4X 2AFQB 5EJ1A 3MU8A 3K9XB 3NZIA 2AIPA 1CQQA 1SFQB 4MPXA 1A61H 1IQFA 1SGTA 1S5SA 1E36B 1BRAA 1SC8U 4ABGA 1MCVA 3S9BA 1QB9A 4B76A 4K1TA 1HV7A 1LTOA 1NU9A 1TRNA 3SUEA 1ANBA 4JMYA 2ZDVH 4ZKRU 2G51A 1NPMA 1QIXB 1T4UH 5JYIA 1O30A 2HLCA 1GDUA 3OFND 4Y0ZE 1PYTC 3LH3A 3Q00A 2FS9A 1FX0B 1GBJA 2GDEH 1WSSH 4TYDA 1FY1A 5G4BA 4AGKA 2HGTH 4UFDH 3SGBE 3GOVB 5C17A 4A1TA 7LPRA 3FP7E 1KTSB 4WXIA 2FTMA 2O8MA 5FPYA 1AN1E 1OWIA 2FDAA 1P05A 2THFB 5FX6A 4AFSA 3SU4A 1P2MA 4CRCA 2ZQ1A 4IN2A 3F3BA 1QCPA 2ZZUH 1T8LA 1GI5A 1E0FD 2LPRA 3Q3XA 1P01A 3DHKH 1BTHH 3A7ZA 1IQGA 6GCHF 3FFGA 1KDQB 4KKDA 3ZZ4A 3RC5A 4MPWA 2A4QA 1V2PT 2FZZA 3I29A 4YT6H 1GVZA 1W3CA 4BOHA 1DY8A 4X8UH 4I8GA 1FONA 2Z94A 1AI8H 2PKSB 3BTEE 3RU4E 1W7XH 2ZHQH 2K8IA 4BAOB 1GBTA 1FY8E 1QQ4A 1SGRE 2A7JA 2OC1A 3AW1A 1Y5BT 1UTMA 2VIPA 1C2MA 3GY3A 3QDZB 4OS6A 4Y6DA 2BVRH 4FUEA 1O2MA 4ZAEA 2OTVA 3PWCA 2H9HA 2ZU5A 3UAIC 1FXYA 5EQQA 1ETTH 2HLDD 5HGGA 1TQ7B 2BD5A 1A7SA 1TRYA 4FU8A 4Y71A 4XSKU 1P09A 1CHOG 2PW8H 2TBSA 1VJ9U 4FUGA 1ZMLA 1P03A 2A1DB 2UUYA 1G36A 1Y3XA 4IN1A 4A5TS 4OS7A 2AGEX 1J8AA 1BZXE 1NC6A 2BMGB 1KLJH 1LQDB 1ZSJA 1FY3A 1E38B 1M9UA 3C27B 1BT7A 3PV5A 3GICB 5F8ZA 2A2QH 4Y7BA 5CHAC 2XC0A 3PLPA 1BITA 1C4Y2 3WY8A 5JBCS 5B6LA 1C5SA 2KR7A 3SOSA 4Q7ZA 2GTBA 1PPEE 3BTME 3RM2H 3SJ8A 1N6XA 5T3HA 2RA0A 3OY5U 2R2WU 1Y59T 1AKSB 1HBTH 2R0KA 2CXVA 4FOUC 1AQ7A 3PTBA 2HNTE 1GG6B 2C8XB 4O97A 2XOKD 1VCQA 3ZV9A 2XYAA 3PO1B 3NRLA 2ZGHA 1GWAA 4ASHA 4MPUA 3EA8A 4RT0A 5CMXH 2WPHS 1JIRA 3ZZ3A 2FO9A 5T6FA 2D26C 2G52A 1HFDA 3TNSA 1HXFH 1TPAE 3RXLA 1DXPA 3UFAA 2BY9X 2KZ4A 1O38A 1C4U2 3MI4A 3SJIA 1WOFA 3E90B 1GJDB 1FNIA 1CGHA 3GCOA 1SPJA 5FCKA 3AW0A 1DXWA 2OC8A 3A81A 4AX9H 2CMYA 3E0NB 3P95A 1WUNH 4X2WA 1GBMA 2PHBA 1HJ8A 4NSVA 1P02A 1S83A 2WZQA 2Z7FE 1XUKA 1ZR0A 2ZCLP 4ACAA 3R3GB 1QB1A 3GY4A 4DJZB 1HAVB 2FOAA 1IQKA 2FI4E 4NFFA 1UTPA 4JYTA 7GCHF 3L6PA 1EFRD 1AFQB 1EUFA 1GHVH 1PQAA 1V2JT 1XXDA 4BAQB 4DIHH 1SQOA 4ZKSU 1ZGIA 2KCAA 2Z6BD 1SGNE 7ESTE 4MNVA 3SZEA 2PUQH 5FPSA 4XBCA 1AIXH 3RXHA 1MTVA 3MO9A 2O8LA 1HGTH 1GI7B 2XW9A 4E06H 2VVUA 5F03A 1O37A 3BIUH 2BLQA 5FBIA 2ZEBA 3BG8A 1T8NA 3K2UA 3LGWA 4ZXXH 3S0NA 3PV4A 2BZ6H 1T7CA 2XRCA 3B8JA 1ZHMA 1O3FA 3P8FA 2G4UA 1O3CA 2BLVA 4F55A 3DCLA 3T29A 2QV1A 1ZSKA 3FVFB 3VB4A 2ZFQH 4YTAA 3TH2H 2HWLB 5EXNA 3E3TA 3N99A 3SNEA 1JWTA 2WYJA 1Y3YA 3MO3A 4BNRA 4D7FA 2QXIA 2G4TA 3T62A 1GGDC 1E35B 3FP8E 1GBCA 3M3TA 1IHTH 4FVBA 1WAYB 5AHGH 1DVAH 2VIOA 4GLYA 3P8OA 1V2KT 2Q1JA 2F9PA 3BEIB 2QF5A 2ZCHP 2VGCB 1CA0B 1ARCA 5DSFA 1BDAA 3QGNB 6ESTA 1SGIB 1DFPA 1V2QT 1NRNH 1HAZB 1DWDH 3KQBA 3SJOA 1THSH 3PV2A 2H9EH 3RU4D 3BTTE 1C1RA 3GY7A 1C5NH 5DG6A 1GCTB 1UCYE 2I6QA 2O8TA 3GYMA 3KQDA 1EPTC 1ETSH 1A0HB 3A8CA 4NG9H 1A46H 3A84A 1W2KH 4AB8A 3IITA 1HAIH 4BXSA 1EX3A 2LELA 1F0RA 2BY7X 1ELDE 1LHCH 2ULLA 1NU7B 1C1PA 3OAAD 1S82A 1A2CH 3V0XA 4BTIB 3A80A 4CRBA 5I46H 1GI6A 4SGAE 4RKOB 2BD2A 4FUBA 1TABE 2BLOA 4LOYH 1H9IE 3TK6A 2EEKA 3OEED 4O9VA 3GY8A 1SLXB 1YF4A 1A4WH 3SU5A 3GS9A 3GCNA 4AORA 3TJUA 1XUHA 3QN7A 5I25A 1TPPA 1DSTA 7GCHG 1CBWB 3QO6A 1EB2A 3RXJA 2A32A 2HVXA 1SVPA 4Q63A
chains in the Genus database with same CATH topology
2H6MA 1V2OT 1Y3UA 1C2LA 1KTTB 1IQHA 1CSOE 1MUEB 1SFIA 5DP4A 2QC2A 4INLA 2TPIZ 3BG4B 3LIWA 1WQSA 1GJ8B 1VGCC 3D49H 5A0CA 1TA2A 4UFGH 2ZDAH 1O36A 1F7ZA 1O2UA 1UJ1A 1WBGB 2CHAB 3KGPA 4GAWA 5A0BA 1AZ8A 1OYTH 2Y7ZA 4Y79A 1O3LA 1TBRH 1AVGH 1GBKA 2R9PA 3ZZBA 1PFXC 1RIWB 1GI1A 1C1MA 1O39A 4Y8XA 3BTHE 4NA9H 1HAHH 1MD8A 1KXEA 3JZ2B 1A3EH 5SGAE 2FOGA 3QK1A 1TFXA 2SGEE 2J4IA 2Z9JA 5E2OA 3RUOA 1O3GA 2P8OB 1Q3XA 2J38A 3BV9B 2FEQH 1G3CA 2ALPA 3M5NA 1QGFA 4DW2U 1XKAC 3HK6B 1C2FA 1FZZA 1YCPK 4J1YA 2F91A 3T5FH 3U8RH 5ESBA 1TNLA 4DCDA 1UK4A 1EKBB 1FI8A 2GCTB 1NRPH 1TOCB 1NRQH 5DP9A 1GHAF 2JH5D 4Y10E 1CVWH 1O2XA 3T27A 1PPGE 3SJ9A 4YOIA 4WVPE 4DVAU 1SOTA 1F2SE 1T4VH 3SQHE 2GVFA 5TCCA 4AB9A 3LDXH 1TLDA 1AO5A 1FJSA 1AVWA 3T26A 1S6HA 1GJ6A 1PPFE 1QY6A 1V2WT 3G01A 3OYPA 3TJVA 1SOZA 3FP6E 3QTVH 1O3EA 1DUEA 4R8TB 2ZO3H 2BD7A 1YPJH 3VPKA 2JH0D 3SV8A 2DE8A 4JCNA 4WWYA 1ZMJA 4KELA 2FOHA 3ODDA 4GPGA 4ISIH 1KSNA 1V2NT 3H7OA 3PYHA 1N1LA 3LT3A 4MQAA 4NIWA 3UR9A 3UQVA 3A7VA 5HXFA 2Z9IA 3AAVA 1CO7E 2W26A 4OS1A 1VCWA 1FLEE 1D3QB 1KYNA 1O32A 1FIZA 2XWAA 3ATWA 4MG3A 3CP7A 4BAKB 1ELGA 1FMGA 3ESTA 3UIRA 1JRSA 1ELFA 2ZFPH 4ABHA 4X6NA 1YBWA 1ZPZA 2FYQA 3SU6A 2TIOA 2R0LA 1FUJA 4M7GA 1ZYOA 1QBNA 1ESAA 2WPLS 1C5UA 2BVSH 3F9EA 2D2DA 1DSUA 1QL7A 2XWBI 2PGQB 3TJOA 2ZGJA 1C5WB 1GHZA 1MU8B 3O8BA 4R0IA 3RMLH 1SR5C 4DG4A 1ELCA 2GMTC 2IN2A 2VINA 5GIBA 1YPMH 1GHYH 2J9NA 1MU6B 1ZPCA 2J95A 3MU4A 1S84A 1RS0A 3M7TA 1IQLA 4D76A 1LMWB 2OBQA 3O8RA 3PMJA 1QB6A 1C2GA 1O3JA 2ZGXH 5DP7A 3UPEA 1V2TT 1WQVH 3HPTB 1O31A 4AFUA 3TU7H 3QZRA 3HATH 2VNTA 4DGJA 1AVXA 1O5FH 3RC4A 1BIOA 1C1SA 2GDDA 3PB1E 4CR5A 1QFKH 4UFEH 1TGSZ 4FUHA 1O3AA 1SGCA 6CHAC 1MTNC 1RJXB 3TH3H 1A0JA 1Y3WA 3PM3A 2XC4A 1P2JA 1K1OA 4I8LA 1OYQA 2P93A 1MMJN 3LOXA 4ISOA 4ZH8A 3VGCC 5EW1H 3K6YA 4SGBE 5HMAA 3GY2A 1H1BA 4ZKNU 2STAE 3A8DA 4NA8A 1J9CH 1Y8TA 1AB9C 1UHBA 1KXCA 1UK3A 3BTWE 1VJAU 1FIWA 4GCHG 5DO4H 2ZFFH 1ELVA 3FAOA 1V6DA 3MNXA 3MYWA 1MAXA 2H2ZA 2ZA5A 2F9BH 2OQ5A 1MCTA 2JETC 2GCHF 2AGGX 4K8BA 3U1IB 2OCVB 4CR9A 2FM2A 1XVOA 1CT0E 1W13U 4JZIA 2BB4A 4AG1A 3S9CA 3M3SA 1B0EA 3PWBA 3UTUH 1GBFA 1T31A 3RXQA 1C5PA 1DOJA 1SGPE 1O3DA 1UTQA 4GVUA 3R0FA 2ESTE 3U8OH 4K60A 2OBOA 1BTYA 1EAWA 3SHCH 4IW4E 1HUTH 3A7TA 2Y5HA 3VB6A 4NIVA 1W0ZU 2FI3E 3A7YA 2EI7A 5TJXA 2H5CA 3M7UA 3GYLB 2VVCA 2R3YA 3RXKA 1BTPA 3ZZ9A 2Q6DA 4HI3A 3UQOA 2XCNA 3MU0A 2FOCA 1S85A 3PMAB 2W7UA 4D8NA 4IS5A 2H5DA 1W10U 2AMQA 1GHWH 3PLKA 3EA9A 3W94A 1BTZA 5PTPA 4X1NU 1NFWA 4E7RG 1P10A 4ZHMU 3RXTA 3A83A 1TGBA 2YNAA 1C2HA 1SGQE 2ODQA 1Z6EA 4IC6A 3OU0A 2G5NA 1C5XB 1ORFA 5C5NA 1DM4B 2PFEA 4H6SB 3O8CA 5CHAB 2J94A 3RXAA 2G81E 3SI3H 2YOLA 2VWOA 1C1WH 1TGTA 3SQEE 1MKWH 1G2MA 1G3BA 3NPSA 1YPEH 3M7QA 5GCHF 2WPKS 2FTLE 1D6RA 3RP2A 3ATLA 3F9GA 2HOBA 1B5GH 2C93B 5DJ7A 3HK3B 1ZHPA 5GPIB 2BYAX 4AOQA 5GWZA 3RXVA 4OS5A 2XXLA 1TX7A 3ODFA 1VCPA 2BD9A 3SO3A 3VB3A 1A5HA 1BJUA 4B75A 1ZTJA 1C2JA 3VXFH 3TPIZ 1O2GH 3FZZA 2V6NA 1HCGA 4CRDA 1EOLA 1W0YH 1IAUA 4JZEH 1Z8RA 5L6NH 4PROA 1G32B 4I31A 4Q2KA 4FU7A 5DK1A 2ZHEH 2IJOB 4Q7YA 1C9PA 2TRMA 3OY6U 1C2EA 4D9RA 4MPVA 4OGYA 3SNDA 4A1VA 1P3EA 2UUJB 4TY7A 3ZVGA 5A2MH 2SGPE 4IMQA 4RN6A 1TNKA 2GCHG 1V2ST 1AUJA 1QR3E 1HJAB 4X8VH 1OPHB 2ZP0H 3SNBA 1TNJA 3EAJA 2GGVB 1O2IA 1O5CB 2CF8H 1O2TA 4AN7A 1PQ5A 1BA8B 4THNH 1CHGA 5A8YA 2OLGA 1XM1A 5FX5A 1DWBH 3F9HA 4CRGA 1GBDA 5FBEA 1GBAA 1LO6A 2A31A 4ZROA 1PQ8A 3VXEH 1NRSH 2P3UB 4NIXA 1DWEH 3F68H 4TWYA 4Z6AH 4UONA 3SV6A 3MTYA 1D4PB 2ALVA 4BAHB 2A4GA 2PUXB 4X1PU 1AHTH 1LVBA 1T8OA 2ZPQA 4NZQA 4KTCA 5AFZH 1WTGH 5DP5A 3LGTA 4ZXYH 1N8OC 5LPFA 1MD7A 5JBBS 3ZYEA 3SUGA 1QTFA 2WPIS 3MFJA 3TK9A 1EZUC 1TX8A 3SUFA 4XFQA 3URCA 1V2MT 5BRRE 2P3FH 3QLPH 1TNHA 1T8MA 1C5QA 1K1PA 4FUIA 3RMMH 4F4OC 3A86A 1A5IA 4KTUA 3KN2A 1D3TB 2P16A 4XBBA 1JOUB 3NK8A 4Y0YE 2XBYA 3T25A 1GGDB 1L4ZA 1MKXK 2ZHWH 6GCHG 1HRTH 2G55A 5EG4A 2DE9A 4U30A 3HGNA 1AUTC 2ZECA 4FUDA 2PGBB 2EI8A 1TIOA 2WUCA 1BBRH 2BLWA 1SGFA 3TIUA 2B5TB 1MAYA 3TVJB 2CV3A 1EAUA 1WTHD 2R3UA 1GJ5H 3M5MA 2A45B 2BQ6B 1IQNA 3AVZA 3ATKA 1UTOA 2XBVA 3I78A 1AWHB 1EPTB 3LJOA 4QT8C 3ZZ6A 4DOQA 3ENSB 5EPYA 1LKAA 2BD8A 2WV5A 1THPB 2WYGA 3GDSA 1CGJE 3S7KB 3A7XA 2FODA 1YKTA 2RCEA 1O0DH 2PSYA 2F9NA 3DA9B 4X1QU 1YPKH 3V13A 5L30H 3A8AA 1OOKB 1QA7A 2FPZA 1SG8B 2C8YB 4F49A 1QBVH 3UOPA 1C1TA 3PO1C 3BTKE 1UVTH 4LZ1H 4X8TH 1SGYE 1KY9A 1TBQH 2SNVA 1QL9A 1MKWK 1GDQA 1QRXA 3ZVBA 1O34A 3LJJA 4I8JA 1O3PB 1THRH 3RXMA 1D9IA 1V2UT 2C8WB 3SGAE 2P3TB 1YM0A 1C5MD 3BEUA 4BANB 2VWMA 3NCLA 1OWEA 5EXMA 1F5LA 2PKAA 2VWLA 4VGCB 2EA3A 1W11U 5E8EH 1VGCB 4J2YB 4ABIA 2RDLA 1TX6A 2SGQE 2ZPRA 3MU5A 1PYTD 1L1JA 4OGXA 1DS2E 4WJG2 4B2CA 1UVSH 1WU1A 3P8GA 1O2HA 1ZJDA 2ZCKP 1O3OA 4I8KA 1KXAA 1Z8GA 3LC5A 5C5OA 4XOJA 5EXLA 3PROA 4ZUHA 1AZZA 4BTUB 4CHAB 4XE4A 1BTUA 1FAXA 1GI9B 1C1QA 4JZ1A 1PPHE 3ZZDA 1ZTLA 4HGCA 1BMLA 1JBUH 4CBNA 3FANA 3RC6A 3TGIE 1BUIA 2GT7A 2PV9B 4UEHH 2UWPA 4D9QA 2IPHA 4AGJA 3TGJE 1RTKA 3OX7U 3ZV8A 1O2QA 3RXIA 1FPHH 4H6TA 5A09A 1GJBB 2QYIA 5L2YH 1BTXA 1GI0A 3LGIA 5LPRA 3SV7A 5DPAA 3PMHB 2QXGA 2ZIQH 1SQTA 4LXBH 4X2VA 1F0SA 1GJ4H 1LHDH 1O3IA 4GUXA 1Z1IA 4AYVB 2ZTXA 3F9FA 2Z9KA 4WMEA 3P8NA 4HZHA 1EAXA 2VU8E 5JBAS 4WMDA 1NFXA 1JMOH 3U8TH 2JKHA 4U01A 1FY5A 3RXRA 1A3BH 1P8VC 1AFEH 3Q77A 1C1UH 1O3MA 5K0HA 1DLEA 4FXGH 4H42U 2QY0B 4I32A 4E7NA 1ZRBA 3VB5A 3RXFA 2K1QA 4KTSA 4Y8ZA 3DFJA 1LKBA 2ZKSA 1N6YA 3GDUA 4YESB 1ID5H 5FCRA 3GY6A 1TB6H 1C2IA 2QF0A 5E0HA 4CRAA 1ELBA 5A8XA 2BHGA 3K65B 1RTFB 1O2LA 4XBDA 1C2DA 2YNBA 3GISB 3VEQB 2Q6FA 3UUZA 1E37B 3HKJB 3MNBA 1Y5AT 2GKVE 2A0QB 5J4QA 4MNXA 8LPRA 1UTNA 3H7TA 3RXPA 1OP0A 2FP7B 2J92A 1BBRK 2WPMS 1BMMH 3S69A 1ZGVA 2W3KA 4OS2A 3U1JB 2TGTA 1TPSA 3BIVH 4K2YA 3ELAH 4INKA 3BSQA 1FN8A 1FPCH 9LPRA 1L1NA 1ARBA 1UTLM 2GMTB 5HYOA 1SBWA 3QTOH 1C5LH 2OUAA 4ZMAH 1KIGH 3MH7A 3ZYDA 3LPRA 2Z3EA 1C5OH 2D1JA 2ZU1A 1Z7KA 1QL8A 2BX4A 1HPGA 2R2MB 1GMDF 4A7IB 3O8DA 1EASA 4RKJB 2QIQA 5GDSH 2VIDA 1ELAA 1HIAB 1YGCH 3BG4C 1FV9A 2A4RA 1P57B 2NU4E 1D6WA 1BRBE 2DUCA 3RXUA 1P06A 3T2NA 4JZFH 2KAIA 2CN0H 3W95A 1QJ7B 1OWDA 5AFYH 1MBQA 5EW2H 2ANWA 1W8BH 5AF9H 2IOTA 2Z9LA 3UOUA 6CHAB 1MTNB 4TY6A 2QGRA 3QX5H 3VB7A 4BAMB 3QZQA 4ZHLU 2F83A 4FVDA 3RXOA 1NRRH 1TYNA 1O2KA 1NZQH 2LNCA 3CS0A 3VGCB 1QNJA 3E91A 1NM6A 1OWKA 3S7HB 1BHXF 3MH4A 3E6PH 2ZWLH 1AB9B 3D65E 1P12E 5DP6A 3GY5A 1P0SH 3LGVA 3SV2H 4I7YH 4K5ZA 3RLWH 1S81A 2AMPA 2FXRA 4YO9A 2JETB 3OTJE 3MO6A 1IQEA 5C2ZA 2ZPSA 1ELTA 1F0UA 3KCGH 1OWHA 4YOJA 3KF2A 4CREA 3TH4H 1HJ9A 5C3NA 2ZTZA 3TLOA 5EOKA 1NTPA 1EJAA 1XKBC 3PTNA 1KXFA 2XTTB 3URDA 1EATA 1GMCF 1GJAB 1JRTA 3M36A 1KLTA 1O2JA 3V7TA 4BTTB 2V35A 3NUMA 1K1NA 2ZGBH 2UWOA 5ABWA 1GBEA 2D8WA 1G3EA 1ZZZA 2FYRA 4X2XA 1GHAG 3Q3YA 2BY8X 5GXPA 4WH8A 1ABJH 1O2YA 3JZ1B 1KXDA 1SMFE 2RA3A 9ESTA 2QCYA 5HM9A 3KEEA 1E34B 3RLYH 4KGAA 3SORA 2FIRH 4Y76A 1HAPH 1S0RA 1BHXB 1TNGA 3SGQE 2HNTF 4ISLA 4NCYA 5JPMH 4CRFA 5CE1A 1EP6A 1O2OA 1OX1A 5EQRA 1K1IA 3MNSA 1YYY1 2AERH 3SU0A 2CJIA 4Y11E 2C4FH 3E16B 1UCYH 4NA7A 2V0BA 1F5KU 3ZVFA 3TJNA 3SU1A 1ZOMA 1O5BB 2BDGA 1GMDG 3SN8A 1K22H 2ANYA 1VZQH 1LDTT 3EGKH 3SW2B 8ESTE 1IQMA 1P9UA 2P59A 1C4V2 4DY7B 2VWNA 5TCAA 1G3DA 3Q76A 2C3SA 3SJKA 1LQEA 2OXSA 1ESTA 2WINI 5JDUB 2OD3B 1GBIA 2B8OH 1GJ7B 1RFNA 4IMZA 1QJ6B 1A0LA 1UTJA 1Z1JA 5HM2A 3GCHC 3EQ0H 4ESTE 5FXLA 2A5KA 2H1UA 4GSOA 2ANMH 3BN9A 1DDJA 1H8DH 3S9AA 2A5AA 3RXDA 1L2EA 1YCPM 3MOCA 4ISNA 1ZJKA 3MHWU 1YPHE 1O2PA 1ANDA 1L1GA 1OKXA 1FDPA 4JYUH 1O2NA 2FLRH 3SV9A 3HGPA 5JB8S 1AU8A 2FX6A 4UFFH 5DGJA 3UR6A 1O3BA 1TMUH 2HPPH 1BQYA 5E2PA 1HXEH 3EYDA 2CGAA 4INHA 1OP2A 5DP8A 4CH2B 2AGIX 2V3HH 2FLBH 2Z9GA 2FESH 1MTSA 1KDQA 1DY9A 1NFYA 1ESBA 1EAIA 3E1XB 4X1SU 3TK5A 1MZAA 3M5OA 2BDCA 5ESTE 1W14U 3U69H 1AMHA 7KMEH 4NWKA 1TOMH 2SGFE 1J16A 1G2LA 1SGEE 1HB0B 2QA9E 1GMCG 1GI8B 2BQ7B 3EE0B 1LCYA 2A4OA 1F92A 1KLIH 1QHRB 2BDIA 2BM2A 4FU9A 1HYLA 1Z71A 2Y5GA 5IDKA 1XUFA 2ILNA 3A88A 5F8TA 3BTQE 4U32A 4NFEA 1EP5A 4ABFA 1AD8H