4O3TA

Zymogen hgf-beta/met with zymogen activator peptide zap.14
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
NIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/growth factor
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3tA01
3N7OA 1UO6A 2F91A 2OC1A 1C2EA 5EODA 4ZHMU 3GDVA 5T6GA 1OYTH 1TQ7B 2FOFA 3SOSA 2GCTC 1DWEH 1LKBA 1PPFE 3F1SB 4BXSA 1YPMH 5TCCA 2ZECA 3EA7A 3SJ9A 4B71A 1TMUH 1BTPA 4WXIA 4CBOA 4ABJA 2AMDA 3RXMA 1OYQA 1ZOMA 4UDWH 1UCYE 2PFEA 1TX7A 4CREA 3FAOA 3GCTF 3U1IB 2GDEH 3RC6A 1DUEA 1P06A 1TGCA 5JDUB 1P57B 3ZZ5A 5AVDA 3URDA 1HLTH 5HGGA 3QK1A 2OTVA 1O3HA 5GDSH 4YT7H 4ABIA 1P2KA 2BD8A 4MNYA 4I7YH 5EXNA 3ITIA 1LTOA 2A2QH 2PWXA 1LVMA 3SGQE 1EZUC 2FI5E 3MNBA 1O2ZA 1YLCA 1HV7A 3V0XA 3ZZ3A 1FJSA 1TALA 1W11U 3AVZA 4DJZB 1O5AB 1O2VA 1C5MD 4X8SH 3GCTG 3B9FH 4ABEA 1GHZA 1P11E 2XWAA 2HNTF 1CBWC 5DJ7A 4WH8A 2PTCE 1SGYE 1V2QT 2XBXA 3V7TA 4GSOA 2VIOA 3QTVH 4Y10E 5FBEA 1AVXA 1XXDA 3M5OA 3VXEH 2XC0A 3GY5A 5A8XA 1EZQA 4CH8B 1YCPH 4A5TS 5E8EH 4WMEA 2ASUB 4O03A 3M36A 3D62A 3HKJB 3UQVA 1AFEH 3E91A 2TIOA 1C5RA 1C5PA 5F8ZA 1SLVB 2BHGA 2Z9GA 1IHSH 3MU1A 2EI8A 5K7RA 3GICB 4ZKRU 4D7GA 1GJBB 2O8TA 2BQWB 1JMOH 3K6ZA 4ABHA 4JYTA 2OCVB 2WPMS 3LOXA 1CA8B 3U8TH 1QRZA 1CGIE 3SU1A 1BZXE 4DIHH 2PKAB 1XUGA 1P01A 3SU6A 2FS9A 1FAXA 1B7XB 3GDSA 1GBMA 5FXLA 1ZSLA 1G2LA 1FY3A 4ISHH 3V3MA 2C8XB 4MLFB 1J8AA 1DPOA 3NKKA 2H2ZA 1EPTC 3CENA 2BM2A 2J94A 5C5NA 4WY3A 4HZHA 4A1VA 3TH4H 1HAPH 4X1NU 2H1UA 5DP7A 1QY6A 3KQCA 5AHGH 1PQ5A 1BJUA 4NIYA 4K69A 4XBBA 8ESTE 3TK9A 1QFKH 1BHXF 3SU4A 4AORA 1UVTH 1RIWC 3HK6B 4ZKSU 3PMJA 1C1TA 1BRBE 1O2GH 1ZLRA 4ZHAA 3SU2A 2G5NA 1ZMJA 1C4U2 2JH6D 5J4QA 1B0FA 4SGBE 2A7CA 1MQ6A 2FOHA 1C2LA 1K28D 1SGDE 1ESAA 1XUJA 5GWZA 5DKMA 3V12A 1SSXA 1VR1H 5L6NH 5HMAA 1H8DH 1HJAB 2Z94A 2BD4A 2OBOA 4ESTE 1UTLM 4WMFA 4ISOA 4X6PA 2C8ZB 1T8NA 1JBUH 5EQQA 1UK2A 2KAIA 5CMXH 2STAE 2WPJS 1XUFA 3G01A 2QXGA 1GHWH 4NSYA 3U8RH 1P02A 1GDNA 4GHQA 4AB8A 1EAWA 3DFLA 2R3UA 4ABFA 2WPKS 4YZUA 4JZFH 1TBRH 2Z9JA 1ZMNA 1L4DA 3SW2B 3MNSA 1QRWA 3QO6A 1DFPA 2QA9E 3RXQA 1AFQC 1D6RA 4OS6A 4LOYH 2VIPA 3BIVH 4OS4A 4UD9H 1IQGA 3SUEA 7KMEH 1V2MT 3IWMA 4NA8A 1AY6H 1XX9A 3PMHB 1A2CH 3TPIZ 1JIRA 1G2MA 1NM6A 2ULLA 2O8LA 2H5CA 2SGDE 4R0IA 4THNH 1P09A 2ZHQH 3RXCA 1DY8A 1SGNE 1HUTH 5ESTE 3JZ2B 5TCAA 2FI4E 3BG4C 2A4RA 4IMZA 1BJVA 4ISNA 3QGNB 5A09A 1MH0A 1IQHA 1HJ9A 2Y7XA 2A4QA 3LH1A 1OOKB 3A8DA 2ODPA 2ZGCA 3ODFA 1QNJA 3EAJA 1WCZA 1AZ8A 1PPEE 3VPKA 1S0QA 5I25A 3QZRA 3TH3H 6CHAC 1BA8B 2WPHS 3E0PB 1H8IH 4YOIA 3D23A 1SB1H 5LPRA 2C93B 4ABAA 4ZMAH 2PHBA 4NCYA 4FU7A 1T8OA 1GGDB 4NFEA 1QQ4A 2ZC9H 4DW2U 1ELAA 2F9BH 1L4ZA 1O3LA 1AB9C 1DWCH 2V35A 4B75A 4NSVA 2LNCA 2QF3A 2FIRH 4WWYA 2A4OA 2BDGA 1GBIA 1GBFA 5F03A 2PKAA 1Z8JB 2ZFPH 4KGAA 3RXBA 1Y3UA 3O8DA 1Y8TA 2GMTC 2Q6FA 5SGAE 1THSH 4JZEH 2PR3A 1DANH 1OKXA 1P2QA 3C27B 3BEIB 1HYLA 1TWXB 1GJ6A 2QYIA 3A89A 4HGCA 4INHA 2UWPA 3LONA 2ZQ1A 2SGAA 5B6OA 3SU3A 1A7SA 1VJ9U 3TITA 4U30A 1C5VA 1HAXB 1W8BH 1LKAA 2P8OB 3M5NA 1T8MA 1AO5A 2EC9H 2B0FA 2AMQA 3MU4A 4XBDA 3UFAA 4B1TA 5T6DA 5GPIB 1K9OE 1NRNH 2WPLS 1O2YA 1XMNB 3ATWA 1P2NA 3RXEA 1NU7B 1WBGB 1THPB 2XCNA 1CBWB 4GVUA 1V2JT 3H7OA 3ZVFA 2ALVA 2J38A 4BAOB 5E0JA 2BDYA 1BRAA 4JZDH 3P17H 3OU0A 2QXHA 3KN2A 2JKHA 1ZRBA 1C1SA 1MCTA 1NESE 1QQUA 4ZH8A 1BMAA 1DITH 1P9UA 2M5TA 2AGIX 2Z9LA 1QRXA 4LZ4B 1V2TT 1L0ZA 2Y5GA 2YOLA 3VXFH 1GI2A 1VZQH 1C5UA 3S7HB 2WV4A 2XYAA 1TX8A 1F92A 2F9UA 1C1RA 3TLOA 1U6QA 2H9TH 4HFPB 1TIOA 4YESB 3TK5A 5C67A 1FI8A 2PGQB 1ZGVA 3RXVA 1SGPE 4JK5A 1XUIA 1K1LA 5J4SA 4MPUA 3ELAH 4U32A 1ETRH 2O8WA 2P3UB 1S83A 4BAHB 2EI6A 3DUXH 1E36B 1O2KA 2FEQH 3VB4A 1SG8B 3P8OA 3A86A 1EPTB 1BDAA 1Y5UT 4XSKU 1S84A 2CHAB 3GY7A 4X2WA 4HTCH 5LH8A 1TGNA 3VB5A 1EB1H 2ZGXH 3HK3B 5F6MA 4NZLA 1E37B 3P6ZB 1LHCH 2BLOA 1GI1A 3A85A 1BB0B 2BDHA 3RXLA 1GBDA 1L1JA 3GYMA 1NRPH 4NA7A 4OGXA 1C1UH 3BTTE 2D8WA 2WUCA 5F8XA 2A4GA 2ZU2A 4WF8A 3RXSA 4IS5A 2UUJB 3BN9A 1D3PB 1NN6A 1OP0A 2ZKSA 3BSQA 3A8CA 2XBVA 5FX5A 4GHTA 1DSUA 2W7SA 3H5CB 4NG9H 2ZF0H 3E8LA 1EUFA 2BD2A 2VVVA 2C3SA 4Y76A 4ISIH 1UHBB 4K1EA 3MYWA 1RJXB 1BT7A 1NFYA 2RG3A 1GBAA 1ABIH 1W13U 3OY6U 1V2PT 3RP2A 2CV3A 5C2ZA 4NFFA 3U69H 4H6TA 2A2XH 5EXMA 2ZDAH 2HALA 3RMNH 3P8NA 1BITA 3LT3A 4AFSA 2Y5HA 3TJNA 4I8GA 2FO9A 1DOJA 3T25A 5A8ZA 2A7HA 2J92A 3A80A 1D6WA 2PSYA 5L2ZH 1NTPA 5E0GA 1GBCA 4KP0A 3A84A 4Y8YA 1HAIH 4WMDA 3NXPA 5T6FA 1VGCC 1QGFA 2B7DH 4YOJA 2VU8E 5JBBS 1BCUH 4H42U 5EOKA 1WOFA 1FQ3A 1ELBA 3PTBA 3MO9A 5JPMH 3A83A 3UNQA 2XRCA 1ZSJA 1O3OA 4AZ2B 1G9IE 5AF9H 4Z0KA 3LJOA 3L33A 1TNHA 4AX9H 3RMOH 2BD7A 1HJAC 1J16A 1K22H 3CS0A 1KYNA 2AIPA 2R2MB 1QBOA 2CGAA 1EXFA 1NC6A 1ZJDA 2Z9IA 3NZIA 2W26A 3E16B 1PPHE 1ZPCA 3M3SA 2FOCA 4D9RA 1HGTH 1ORFA 3RXAA 3ZZ9A 3QLPH 2OC7A 2FTLE 1C4Y2 3KGPA 3E0NB 1TFXA 1NRRH 8LPRA 1TBQH 1O5FH 3F9FA 1J17T 5G4BA 1NFWA 4UONA 4H6SB 1ELVA 1S5SA 4FUJA 3I29A 3Q3KA 3DT0H 3UUZA 1J15A 1PPGE 2VJ1A 1NRSH 1ACBE 4BTUB 3RC4A 1UTJA 3GOVB 3SBKA 1QJ1B 2Y6TA 3BEUA 4UFDH 2H6MA 1GHAF 1C2GA 1OWDA 1MTVA 2FI3E 3AW0A 1TE0A 1WUNH 1P10A 3ZVBA 3ZZ8A 5A8YA 5L30H 2QIQA 4ZXXH 1KSNA 4Q7ZA 4I8KA 2NWNA 1KTTB 1SBWA 3NWUA 1EPTA 5EGMA 3SORA 1SLUB 5DO4H 1TYNA 3ZV9A 1D3TB 4MDSA 3WY8A 3FP7E 1YPLH 3RU4D 2PUQH 3AW1A 4IC5A 1SR5C 1GBHA 5JYIA 4MNWA 1GJ8B 1QA0A 1BQYA 1GHAG 1AUJA 3PLPA 1GBJA 2HGTH 1UTQA 2FDAA 4GCHF 3KQEA 1E34B 1OWEA 2KAIB 1LHDH 4IN1A 1FDPA 1TPSA 1C5YB 1P8VC 3RXDA 1FN8A 1GHXH 1DDJA 2C8WB 4K8YA 4YLQH 1GGDC 2XXLA 3MU5A 1TLDA 2D2DA 2WUBA 2BOKA 3SNCA 3A8AA 1XUKA 4Y7AA 2ZFTA 3MH7A 2ZDNA 1YPHE 3NUMA 4Q80A 2FMJA 1UHBA 1WV7H 2FX4A 3MNCA 5EXLA 4KKDA 3LIWA 1O0DH 1GWAA 2GP9B 1FN6A 1V3XA 1K1MA 3F9HA 3T29A 3PM3A 1EOLA 1P04A 1IHTH 3UPEA 1Y5BT 1KIGH 1XVOA 1DSTA 2F9NA 4FUDA 4GCHG 1FAKH 4FVDA 3ZZ4A 1XM1A 2FOAA 2BB4A 4Z6AH 4RSPA 3A7YA 1BUIA 1BBRH 1LVYA 3LKWA 2P8OC 2RDLA 4WH6A 4CRGA 4DCDA 1O2TA 4UEHH 1T8LA 3SI3H 2XC4A 9LPRA 1TOMH 2HNTE 2H5DA 2ZGJA 1WQVH 1TQ0B 4QT8C 1CVWH 3RMMH 3TNTA 2FLRH 2WV5A 1ELFA 1UTKA 1ELDE 2G00A 1K1JA 1QBVH 1V6DA 1FUJA 2AGGX 1E38B 2QGRA 3U1JB 1P2MA 3U8OH 1KLJH 1LQDB 2TGDA 4K1SA 4X1SU 3ZZBA 1LQEA 4Q2KA 2QCYA 1IQMA 1J14A 3SQEE 1Q2WA 1FMGA 4CRFA 3OX7U 3RXTA 4K2YA 3MI4A 1DY9A 2QXJA 4FUEA 2D26C 1K1NA 1Y3VA 3TGKE 1CT4E 3M5LA 1SI5H 1BIOA 1HAOH 3S69A 3BEFB 5A0CA 3KCGH 1AKSB 7LPRA 1P03A 3BTQE 1C5NH 2I6SA 1PYTC 4IC6A 2GV7A 3BTEE 1YPJH 2FOMB 3TU7H 4MNVA 3MMGA 3UWIA 2C8YB 4X0WU 3NK8A 1AHTH 1FIWA 2GT8A 2VH0A 2A45B 4GPGA 3F9GA 3VB3A 4VGCB 3S9BA 1DVAH 1SL3A 2XCFA 1LHGH 1ESTA 1VITH 2R2WU 4X2YA 4BTIB 3F68H 1MKXH 1FIZA 1YC0A 2CHAC 1C1MA 1KXBA 3M3VA 1RD3B 1SC8U 3A8BA 3BTME 3MH6A 1ID5H 1GCDA 2RA3A 1GVZA 4NA9H 3OYPA 1F5LA 2VINA 4OS5A 1VGCB 3VB7A 1SPJA 4WXVA 3ZZCA 3NCLA 1LPGB 1YPKH 1NS3A 1O30A 1JXPA 3RXPA 3SUFA 2XWBI 4JCNA 3PYHA 1MTSA 4MPVA 5EPNA 2SNVA 5JBAS 1C1WH 1PPZA 1TPPA 2B9LA 2NU2E 1ZSKA 2Q6DA 4FUIA 4D7FA 1W2KH 1HJ8A 3UTUH 1EZXC 4YOGA 2PTNA 3M3TA 2GCHF 3ZVAA 3HATH 3RLWH 1GBEA 1K1IA 1GG6C 3FZZA 3MO6A 3FP8E 2ZGHA 1SGFA 4NZQA 2BDBA 4X2VA 1DM4B 5EQRA 1WTHD 4DVAU 1MBMA 3A7VA 1TABE 4FUFA 5HM9A 3KL6A 2TPIZ 1MU8B 2QF0A 2BY5X 4XFQA 2BQ7B 2BLVA 3R0FA 1BTHH 3ZZDA 4AFQA 1WSSH 1GI5A 3T27A 5A2MH 3K9XB 4ZROA 1EB2A 2GCHG 1BTXA 2HLCA 3RXOA 1QB9A 1C2MA 1AZZA 1L1GA 1LPKB 4MPWA 4X8UH 4J2YB 4KTCA 1BMLA 4D9QA 5DGJA 3S7KB 3BV9B 3M5MA 1Z6EA 5C1YA 3BF6H 2VIQA 2B8OH 4YT6H 3UIRA 5FAHA 3SN8A 1GCTB 1V2UT 3S9AA 3M61U 4INKA 4ABDA 5EU8A 1F2SE 3LGIA 2OC0A 1OWHA 1O3AA 1BMMH 2Q1JA 2R9PA 1MBQA 4X8TH 1OP8A 5FPYA 1JWTA 1YM0A 4JZIA 1TNLA 1A46H 3O8RA 1SHHB 4B76A 5JBTA 2A32A 2C4FH 3NPSA 3ZVEA 1C2IA 1QIXB 5DP5A 6ESTA 1AE8H 2BX4A 4BTTB 1A4WH 2ZCLP 2Z3CA 1T7CA 3EA8A 1SFQB 5ETXA 2XBYA 1BTZA 1LO6A 2CJIA 2BTCE 4AYVB 1UMAH 2ILNA 1GI8B 2BD3A 3TK6A 2JH0D 2O8MA 1F0UA 3M7QA 1NO9H 1SLWB 4TY6A 3TGIE 1GMHF 2A7JA 1SGRE 3GDUA 2AIQA 1OSSA 1IAUA 2AH4X 2BDCA 3ENSB 1C5XB 1TRNA 3RXUA 2SGQE 1CO7E 2F9VA 4U01A 1SGQE 5GJ4B 1AKSA 1O3EA 8KME2 1SGIB 1TBZH 3RXFA 2ANMH 4X6MA 3V13A 5E2OA 1AWFH 1UK3A 2OC8A 3RXJA 4RKJB 2P93A 1GVLA 4I8JA 4A1XA 2G55A 4Y8XA 2ZDKA 9ESTA 4PROA 3P95A 2HPQH 4FU9A 1OX1A 1O2IA 1UVSH 1ARCA 3HGNA 1ZPBA 2VGCB 1W10U 3Q3XA 3R3GB 5DP4A 1GMHG 1F7ZA 4X2XA 4O3TA 2QY0B 2FOEA 1QL7A 2SGFE 4OS7A 2ZWLH 2FTMA 3QGJA 1V2NT 2ZP0H 3PO1B 4TPIZ 1BRCE 5PTPA 3VB6A 1V2ST 2ANKH 1MZDA 1NRQH 2BDAA 2AMPA 1OWKA 2K1QA 1O2XA 1QA7A 3LU9B 1IQEA 2DE9A 4I31A 4I8HA 3OY5U 4O97A 1XXFA 1PPBH 2ZHWH 1GBKA 1L1NA 1HCGA 3UQOA 4CR9A 1SGEE 1AD8H 1A3BH 1C5SA 1W7XH 5ESBA 4TWWA 1C1OA 5FCKA 4ZUHA 1NFUA 5IYTA 3KQDA 4K8BA 1W0YH 2G51A 1HAGE 1S6FA 2EI7A 5HXFA 1DICA 1CE5A 2AGEX 1IQNA 3BTHE 3ESTA 2AERH 5DK1A 4Q7YA 3GCHB 1P9SA 2ZTZA 1ELCA 1IOEA 1Z8RA 1VCQA 3DHKH 1TB6H 2VNTA 1TMBH 1H9LB 2FP7B 3L3TA 4B2CA 4E7NA 4LK4A 4NGAH 3SUGA 1N6YA 1RFNA 1K21H 4KELA 1ETTH 1HAVB 1VITF 1GI9B 4MVNA 4YM9A 1D9IA 1RTLA 3T2NA 1AVGH 1A0JA 4IBLH 1GVKB 1GMCF 3URCA 2F83A 1S82A 1O5BB 4A1TA 3BIUH 3MOCA 2ZDVH 2XC5A 4UFFH 1ANBA 1O3PB 1RTFB 1FY8E 2J2UA 2A5IA 3MNXA 4GAWA 1TX6A 4CRCA 2VWNA 3QTOH 1A0HB 1CGJE 2P3TB 1F5RA 5JB8S 1ANCA 2IJOB 3T5FH 1VITG 1PQ8A 1S81A 1EOJA 1ZRKA 1GMCG 1KXAA 2GTBA 2FWWA 3EGKH 2ZFSA 1DWBH 5K0HA 4Y0ZE 1ZHRA 2J4IA 3F6UH 4CRAA 1O39A 2BD5A 4Q7XA 3SNDA 2VIWA 4DGJA 4A92A 3VEQB 2ZPQA 6LPRA 2DUCA 4ABGA 1LDTT 1Z6JH 2FX6A 3ODDA 4A6LA 5CE1A 4ASHA 2QN5T 2ZHEH 2AFQB 1LPZB 1GG6B 1C5QA 1FXYA 3GYLB 1ZPZA 1C5ZB 2BLWA 5DP3A 1A5HA 1G30B 1Y3XA 2EEKA 1TAWA 2CXVA 4BNRA 5IDKA 3LC5A 2ZU1A 4VGCC 1C9TA 5F8TA 3S9CA 1YPEH 1DUAA 4FUGA 2CF9H 4MTBA 2BXUH 1EATA 3FFGA 4YLUA 5GIBA 1AVWA 3ATKA 2B5TB 2P95A 1JOUB 1Z8IB 2EA3A 2THFB 1TGBA 4NWKA 5C1UA 4YTAA 1P0SH 1RGQA 1GHBF 1O3KA 4CBNA 2JH5D 2I6QA 5DP9A 1W3CA 1ELEE 2ZU5A 1V2WT 1GI3A 4NWLA 2XNIA 4B2AA 2GZ9A 1J9CH 3E90B 1BBRK 4ISLA 1BTWA 4AYYB 3KEEA 3LPRA 1C2FA 4DG4A 3QX5H 1IQJA 5DPAA 4Y7BA 1TRMA 1H9HE 2QAAA 1GDQA 1RXPA 2A31A 2BY8X 2SGPE 4X6NA 1TNKA 1GPZA 1SGTA 1SMFE 3P8FA 5DP8A 4KTUA 3TH2H 3GY3A 4NIWA 1AUTC 1GHBG 3BTKE 2F3CE 1OWJA 5GXPA 2ANWA 1IQLA 3F9EA 2R3YA 5AFYH 5FHTA 1WAYB 3QZQA 1SFIA 2OXSA 4E7RG 3SQHE 2VIVA 1SOZA 4Y6DA 1O3FA 5BRRE 1SGCA 1O2JA 1KXDA 2H9HA 1EKBB 2LPRA 1XKAC 1Q3XA 3UREA 1AQ7A 1AI8H 3LH3A 3LC3A 1YKTA 3STJA 2BX3A 1CT2E 1Y5AT 2BLQA 1GI0A 1TNJA 3UR6A 1ETSH 2FZZA 2OBQA 3A88A 1FY5A 2FXRA 3L6PA 2V3HH 1O2QA 2BY7X 1UTMA 5FCRA 3ZVDA 1SHYA 1HAVA 1EAUA 1GJ4H 2ZNKH 2FYRA 1V2VT 4BAKB 3A82A 3RDZA 3ZYEA 5EQSA 1GCTC 1WQSA 1AIXH 3D49H 1MKXK 5HYOA 1O2MA 1UVPA 5TJXA 3A7WA 1KLIH 2G4TA 4TY7A 4AOQA 4IMQA 3ATLA 1BTUA 2IN2A 1ZR0A 4I33A 5H4IB 3PMBB 4MPXA 1C9PA 1QJ7B 2BOHB 1PQAA 2CF8H 4O3UA 3BTWE 3SV6A 4IN2A 4AG2A 2OP9A 1PJPA 1UTNA 1NROH 2ZPSA 2ANYA 2HRVA 1DXPA 2V0BA 2WINI 1ABJH 2GD4B 3K2UA 2V3OH 2O9QA 3EQ0H 4OS2A 1G37A 3O8CA 1NT1A 2ZFFH 3SU0A 1EJAA 5DP6A 3UOPA 4K1TA 3S0NA 2VIDA 1HRTH 3PWCA 1O2HA 1MD8A 4WJG2 4U2WA 3FANA 4IGDA 1CT0E 5EPYA 4CRBA 3EE0B 2W5EA 2ZGBH 2FM2A 1PPCE 4B73A 2FESH 1XVMA 4HI3A 1PYTD 1C5TA 2A5KA 2ZO3H 1EP5A 2ZHFH 3FP6E 3SU5A 5EG4A 2BVXH 1N8OB 3LJJA 3QUMP 4LXBH 3U9AH 1LVBA 2OLGA 1A61H 1P2OA 1YCPM 1S0RA 3RU4E 4AGKA 1MKWK 1Q31A 1TA2A 4FUBA 2GZ7A 4BAMB 1S6HA 2VGCC 3RMLH 2HVXA 4FUCA 5LPEA 4AN7A 1B0EA 2AS9A 1GHVH 1OS8A 1EZSC 3GY2A 1G3DA 1HNEE 1VCWA 4Y79A 2ZFRH 2J34A 1AU8A 3K6YA 4BXWA 3VGCC 2AEIH 1O2WA 4I8LA 1O2UA 3E3TA 1Y59T 1DX5M 1OPHB 1C1NA 4RN6A 1O2SA 1O3GA 2TGAA 3P92A 1CU1A 4ZKNU 1C2HA 1A3EH 2NU0E 3PO1C 4TPYA 3Q77A 1XKBC 3PV4A 3A7XA 1DS2E 3UWJH 3A81A 3W94A 4CRDA 5FX6A 1T32A 5L2YH 1BRUP 3KHVA 2OINA 2BVSH 1F0RA 4CH2B 1INCA 3RU4T 3DD2H 1D3QB 4FU8A 3Q00A 1AMHA 1T4VH 3KIDU 1YPHC 3I77A 4O9VA 2Y7ZA 2Z3EA 3B23B 3UNSA 1NFXA 1V2LT 3SJ8A 1ZTJA 2TRMA 1HPGA 3AASA 3ATMA 3GCHC 4OGYA 3DA9B 5AFZH 2UWLA 4ZAEA 4FVBA 2VVCA 1O37A 3M7UA 3MU8A 3MU0A 2VWOA 1MTNB 1EAIA 1A5IA 2R0LA 1VJAU 1HDTH 1WU1A 2VH6A 5DG6A 1PFXC 2G4UA 2ZFQH 1G3EA 1F5KU 1DWDH 2Y80A 3LDXH 1FZZA 2HNTC 3AAVA 1LHEH 2VWMA 2A0QB 4ZHLU 5GCHF 4NIXA 4INLA 3GY6A 1ELGA 1AN1E 1FLEE 3M35A 5CHAB 1N6XA 2TGTA 4YO9A 4B2BA 1QHRB 1Y3YA 3RC5A 3SV2H 3UNRA 4JYVH 3ZV8A 2Z7FE 1O38A 3ATIA 1BOQA 2GZ8A 1O3IA 3MO3A 4JMYA 2P16A 4XOJA 1C4V2 1EJNA 1O3JA 3SNAA 2Z3DA 3B8JA 2BMGB 1C1PA 2STBE 4CHAB 3HGPA 3BTGE 4AGJA 1MU6B 4NIVA 1O2NA 1GDUA 1GMDF 3A7TA 1V2RT 5GCHG 5C20A 2G81E 1ANEA 1KXFA 1O5GH 1O33A 2ZCHP 1YLDA 4KTSA 3Q3YA 1EP6A 1A1RA 1P05A 2ZEBA 2PV9B 2W7UA 1NU9A 2YNBA 4J1YA 2PSXA 2GV6A 3RXIA 1SQTA 1L2EA 1YGCH 3FZDA 5A0BA 1MUEB 1ZJKA 3QDZB 4FUHA 1SQOA 1UVOA 4WVPE 2HOBA 1O2RA 1W14U 1O2OA 4R8TB 2ZZUH 1MKWH 5LGOA 1MQ5A 7ESTE 1TNIA 1EX3A 2UUFB 1MCVA 1GMDG 3UY9A 1G3BA 2XW9A 1FPHH 2ZG0H 1O34A 1DE7H 2ZIQH 7GCHF 4AB9A 5EW1H 1KDQB 3RXRA 1G36A 1SVPA 2G5VA 3MH4A 1RRKA 1CSOE 1KXEA 3RXHA 3HKIB 2J9NA 8GCHF 3LGWA 4A7IB 1EASA 3A7ZA 3RUOA 1QURH 2BZ6H 2SGEE 2PKSC 3TJVA 4DY7B 1N1LA 4SGAE 1UVUH 1MMJN 2F9PA 4X1PU 2ZDMA 3UR9A 2TGPZ 1ZHMA 2TBSA 7GCHG 2GDDA 2WPIS 2YNAA 1UCYK 2BZAA 1BMNH 1GI4A 2ZQ2A 2JETB 1D3DB 3AAUA 1P3CA 1MZAA 1OP2A 2OQUA 3E1XB 4JYUH 8GCHG 2BXTH 4D76A 1QJ6B 1Z1JA 3SJKA 3BTDE 3TNSA 1YYY1 1X7AC 1QB6A 1TGSZ 1GHYH 2GT7A 3PLKA 1G32B 4Y8ZA 4E05H 2UWOA 3T26A 2VB0A 5I46H 4Y0YE 3RXGA 1D4PB 5C1XA 2AYWA 4I32A 4B74A 2BD9A 1TA6A 2BY9X 1GJCB 2QV1A 4FXGH 1BBRE 5FPSA 2RA0A 3VFEA 1T31A 1O35A 2BYAX 3PMAB 3TJOA 3P8GA 3GY4A 3K65B 1CA0C 2HPPH 2QC2A 3MFJA 2VWLA 1TOCB 2Y81A 1YF4A 1DT2A 2C90B 2FPZA 2GCTB 2SFAA 1NPMA 4X1RU 4D8NA 4DT7B 1C2DA 3SZNA 2ESTE 1A5GH 2P59A 3T28A 1E35B 4Y11E 2VVUA 3Q76A 1Z8GA 2F9OA 3KQBA 3VGCB 3STIA 2ZPRA 3LGYA 1ARBA 2D1JA 1LHFH 1FNIA 1C5LH 2ZTXA 4K60A 1CGHA 4OS1A 3TIUA 3H7TA 1S85A 1P2IA 1GJDB 3C1KA 1KY9A 2NU4E 1Z1IA 3TJUA 1BTYA 1ZYOA 3GCOA 1B5GH 1HFDA 2FODA 2FOBA 1SGFG 2P94A 1GJ5H 5BPEA 4K5ZA 1FY1A 3GY8A 1P3EA 2SNWA 1P2JA 1RS0A 3SNBA 3HPTB 1V2KT 1YP9A 1CQQA 1O36A 1N8OC 1HBTH 2Y5FA 3PROA 4ZKOU 1NY22 1O31A 1EAXA 3KF2A 1MD7A 1C1VH 1GBTA 5A0AE 1QBNA 5FBIA 5E0HA 2ZU4A 1G3CA 1Z71A 2NU3E 3EA9A 3ZZ6A 1ELTA 1O32A 2DE8A 1O5DH 1UTOA 2ALPA 1HAZB 1K2I1 1W7GH 1O3DA 1ANDA 3MWIU 1ZMLA 3LGVA 3RM2H 2Z9KA 1GI7B 1CHOF 1MTWA 1H1BA 1GJ9B 2BQ6B 3RLYH 2HWLB 1KDQA 3SHAH 3PWBA 2FYQA 1ZZZA 2W3KA 5T3HA 2ZTYA 3SV9A 4AFUA 1EJMA 1UJ1A 3RM0H 1A0LA 2OD3B 1NZQH 3SJIA 2WYJA 5HM2A 2NU1E 1HB0B 2CMYA 3EYDA 1DXWA 1GL0E 2UUYA 2GKVE 2ZDLA 1O2PA 1FONA 4GLYA 2J95A 1QL8A 1ZHPA 1UCYH 4AG1A 1PQ7A 1OXGA 1UK4A 4JZ1A 1CHOG 1Y3WA 1HIAB 1C5OH 2W3IA 3TGJE 4XDEA 1YPGH 3GCNA 1C1QA 3JZ1B 3OSYA 3CP7A 3SHCH 3A87A 1RIWB 3I78A 3SV7A 1ZGIA 1JRSA 4IW4E 1MTNC 2OQ5A 4AFZA 4X1QU 1K1OA 1WTGH 2H9EH 3PTNA 3ZVCA 3IG6B 4UFEH 3EDXB 2XBWA 2IPHA 3ZZ7A 1YBWA 1O5EH 1P12E 1TONA 1TPOA 3SO3A 1BHXB 4CR5A 4DOQA 2XTTB 1F0TA 1OWIA 2WYGA 4DURA 3GISB 1HAYB 2PGBB 1O5CB 3QWCH 1KTSB 1W0ZU 2PUXB 2ZI2H 4RKOB 4MG3A 2Y82A 5E2PA 3PLBA 1HXEH 1TRYA 5CHAC 3MTYA 1IQKA 2R0KA 3OTJE 1TNGA 1QCPA 2A5AA 2PW8H 3PB1E 1THRH 3UOUA 1O3BA 3KNXA 1IQIA 4TWYA 1C5WB 1DLEA 2QXIA 1XUHA 1EQ9A 1AFQB 5C5OA 1Z7KA 1MAXA 1KXCA 2PKSB 4F4OC 4CHAC 3W95A 4ABBA 2BDIA 1QB1A 2IOTA 4K3JA 2O8UA 3IITA 4BAQB 3SGAE 1C2JA 2GX4A 1TMTH 6GCHF 1JRTA 2RCEA 4X6OA 1RTKA 1LVOA 3LGTA 3BTFE 1KLTA 1O3CA 4TYDA 3U98H 1GBLA 2ODQA 2ZHDA 2G52A 2UUKB 1FY4A 3FVFB 5FPTA 3E6PH 1QL9A 1K1PA 3BG4B 3O8BA 2PLXA 1W12U 2BY6X 2GVFA 3TVJB 1O2LA 1YCPK 1SLXB 1QR3E 4XBCA 1H9IE 1MTUA 5EW2H 1GL1A 2BVRH 6GCHG 5JB9S 1AE5A 1TPAE 3D65E 2CN0H 1V2OT 1GI6A 1HXFH 4H4FA 3RXKA 6CHAB 3CS7A 4BOHA 1AGJA 1ZTLA 1O3MA 4M7GA 3SUDA 4UE7H 4LZ1H 1GBBA 1CA0B 1VCPA 3BG8A 4DIIH 5JBCS 4JK6A 1O3NA 4GUXA 4X8VH 1F0SA 1CHGA 2OUAA 2FLBH 3ZZAA 5C3NA 4UFGH 1AB9B 1LMWB 3QN7A 1DLKB 1WYKA 2V6NA 1GJ7B 3M7TA 1TGTA 1FV9A 4MNXA 3P70B 2Z6BD 4E06H 2GMTB 3MH5A 1QTFA 1FPCH 4F49A 1E0FD 4MQAA 2Q6GA 4BANB 1IQFA 2FS8A 2JETC 3DFJA 3SJOA 3SGBE 2ZU3A 5LPFA 2ZCKP 3SNEA 3ZVGA 4Y71A 1T4UH 1JIMA 1MAYA 1C2KA 1SOTA 2ZA5A 1HAHH 2ODYB 1ESBA 1HIAA 2FOGA 1LCYA 2P3FH 3T62A 3ZYDA 1ZTKA 1SQAA 1UTPA 2A1DB 1AWHB 1M9UA 4ZXYH 3SV8A 2GGVB 5ABWA 1H4WA 1GJAB 4XE4A 3MHWU 3LGUA 3M37A 2G8TA 3SI4H
chains in the Genus database with same CATH superfamily
3N7OA 1UO6A 2F91A 2OC1A 4ASUD 1C2EA 5KEDA 5EODA 4ZHMU 3GDVA 5T6GA 1OYTH 1TQ7B 2FOFA 3SOSA 2GCTC 1DWEH 1LKBA 1PPFE 3F1SB 4BXSA 1YPMH 5TCCA 2ZECA 3EA7A 3SJ9A 4B71A 1TMUH 1BTPA 4WXIA 4CBOA 4ABJA 2AMDA 3RXMA 1OYQA 1ZOMA 4UDWH 1UCYE 2PFEA 1TX7A 4CREA 3FAOA 3GCTF 3U1IB 2GDEH 3RC6A 1DUEA 5DN6D 1P06A 1TGCA 5JDUB 1P57B 3ZZ5A 5AVDA 3URDA 1HLTH 5HGGA 3QK1A 2OTVA 1O3HA 5GDSH 4YT7H 4ABIA 1P2KA 2BD8A 4MNYA 4I7YH 5EXNA 3ITIA 1LTOA 2A2QH 2PWXA 1LVMA 3SGQE 1EZUC 2FI5E 3MNBA 1O2ZA 1YLCA 1HV7A 3V0XA 3ZZ3A 1FJSA 1TALA 1W11U 3AVZA 4DJZB 1O5AB 1O2VA 1C5MD 4X8SH 3GCTG 3B9FH 4ABEA 1GHZA 1P11E 2XWAA 2HNTF 1CBWC 5DJ7A 4WH8A 2PTCE 1SGYE 1V2QT 2XBXA 3V7TA 1WDIA 4GSOA 2VIOA 3QTVH 4Y10E 5FBEA 1AVXA 1XXDA 3M5OA 3VXEH 2XC0A 3GY5A 5A8XA 1EZQA 4CH8B 1YCPH 4A5TS 5E8EH 4WMEA 2ASUB 4O03A 3M36A 3D62A 3HKJB 3UQVA 1AFEH 3E91A 2TIOA 1C5RA 1C5PA 5F8ZA 1SLVB 2BHGA 2Z9GA 1IHSH 3MU1A 2EI8A 5K7RA 3GICB 4ZKRU 4D7GA 1GJBB 2O8TA 2BQWB 1JMOH 3K6ZA 4ABHA 4JYTA 2OCVB 2WPMS 3LOXA 1CA8B 3U8TH 1QRZA 1CGIE 3SU1A 1BZXE 4DIHH 2PKAB 1XUGA 1P01A 3SU6A 2FS9A 1FAXA 1B7XB 3GDSA 1GBMA 5FXLA 1ZSLA 1G2LA 1FY3A 4ISHH 3V3MA 2C8XB 4MLFB 1J8AA 1DPOA 4RT1A 3NKKA 2H2ZA 1EPTC 3CENA 2BM2A 2J94A 5C5NA 3OEED 4HZHA 4WY3A 4A1VA 3TH4H 1HAPH 4X1NU 2H1UA 5DP7A 1QY6A 3KQCA 5AHGH 1PQ5A 1BJUA 4NIYA 4K69A 4XBBA 8ESTE 4F55A 3TK9A 1QFKH 1BHXF 3SU4A 4AORA 1UVTH 1SKYE 1RIWC 3HK6B 4ZKSU 3PMJA 1C1TA 1BRBE 1O2GH 1ZLRA 4ZHAA 3SU2A 2G5NA 2L6OA 1ZMJA 1MABB 1C4U2 2JH6D 5J4QA 1B0FA 4SGBE 2A7CA 1MQ6A 2FOHA 1C2LA 1K28D 1SGDE 1ESAA 1XUJA 5GWZA 5DKMA 3V12A 1SSXA 1VR1H 5L6NH 5HMAA 1H8DH 1HJAB 2Z94A 2BD4A 2OBOA 4ESTE 1UTLM 4WMFA 4ISOA 4X6PA 2C8ZB 1T8NA 1JBUH 5EQQA 1UK2A 2KCAA 2KAIA 5CMXH 2STAE 2WPJS 1XUFA 3G01A 2QXGA 1GHWH 4NSYA 3U8RH 1P02A 1GDNA 4GHQA 4AB8A 1EAWA 3N99A 3DFLA 2R3UA 4ABFA 2WPKS 3FOAA 4YZUA 4JZFH 1TBRH 2Z9JA 1ZMNA 1L4DA 3SW2B 3MNSA 1W0KD 1QRWA 3QO6A 1DFPA 2QA9E 3RXQA 1AFQC 1D6RA 4OS6A 4LOYH 2VIPA 3BIVH 4OS4A 4UD9H 1IQGA 3SUEA 7KMEH 1V2MT 3IWMA 4NA8A 1AY6H 1XX9A 3PMHB 1A2CH 3TPIZ 1JIRA 1G2MA 1NM6A 2ULLA 2O8LA 2H5CA 2SGDE 4R0IA 4THNH 1P09A 2WSSD 2ZHQH 3RXCA 1DY8A 1SGNE 5C94A 1HUTH 5ESTE 3JZ2B 5TCAA 2FI4E 3BG4C 2A4RA 4IMZA 1BJVA 4ISNA 3QGNB 5A09A 1MH0A 1IQHA 1HJ9A 4FETA 2Y7XA 2A4QA 3LH1A 1OOKB 3A8DA 2ODPA 2ZGCA 3ODFA 1H8ED 1QNJA 3EAJA 1WCZA 1AZ8A 1PPEE 3VPKA 1S0QA 5I25A 2EQNA 3QZRA 3TH3H 6CHAC 1BA8B 2WPHS 3E0PB 1H8IH 2AHME 3D23A 1SB1H 4YOIA 5LPRA 2C93B 4ABAA 4ZMAH 2PHBA 4NCYA 4FU7A 1T8OA 1GGDB 4NFEA 1QQ4A 2ZC9H 5GNDA 4DW2U 1ELAA 2F9BH 1L4ZA 1O3LA 1AB9C 1DWCH 2V35A 4B75A 4NSVA 2LNCA 2QF3A 2FIRH 4WWYA 2A4OA 2BDGA 1GBIA 1GBFA 5EIYA 5F03A 2PKAA 1Z8JB 2ZFPH 4KGAA 3RXBA 1Y3UA 3O8DA 1Y8TA 2GMTC 2Q6FA 5SGAE 1THSH 4JZEH 2PR3A 1DANH 1OKXA 1P2QA 3C27B 3BEIB 1HYLA 1TWXB 1GJ6A 2QYIA 3A89A 3DSPA 4HGCA 4INHA 2UWPA 3LONA 2ZQ1A 2SGAA 5B6OA 3OAAD 3SU3A 1A7SA 1VJ9U 3TITA 4U30A 1C5VA 1HAXB 1W8BH 1LKAA 2P8OB 3M5NA 1T8MA 1AO5A 2EC9H 2B0FA 2AMQA 3MU4A 4XBDA 3UFAA 4B1TA 5T6DA 5GPIB 1K9OE 1NRNH 2WPLS 1O2YA 1XMNB 3ATWA 1P2NA 1W0JD 3RXEA 1NU7B 1WBGB 1THPB 2XCNA 1CBWB 1YLNA 4GVUA 1V2JT 3H7OA 3ZVFA 2ALVA 2J38A 4BAOB 5E0JA 2BDYA 1BRAA 4JZDH 3P17H 3OU0A 2QXHA 3N7EA 2QE7D 3KN2A 2JKHA 1ZRBA 5HKKD 1C1SA 1MCTA 1NESE 1QQUA 4ZH8A 1BMAA 1DITH 1P9UA 2M5TA 2AGIX 2Z9LA 1QRXA 4LZ4B 1V2TT 1L0ZA 2Y5GA 2YOLA 3VXFH 5CHBA 1GI2A 1VZQH 1C5UA 3S7HB 2WV4A 2XYAA 1TX8A 1F92A 2F9UA 1C1RA 3TLOA 1U6QA 2H9TH 4HFPB 1TIOA 4YESB 3TK5A 4XD7D 5C67A 1FI8A 2PGQB 1ZGVA 3RXVA 2IPQX 5EJZA 1SGPE 4JK5A 1XUIA 1K1LA 5J4SA 4MPUA 3ELAH 4U32A 2HLDD 1ETRH 2O8WA 2P3UB 1S83A 4BAHB 2EI6A 3DUXH 1E36B 1O2KA 2FEQH 3VB4A 1SG8B 3P8OA 3A86A 1EPTB 1BDAA 1Y5UT 4XSKU 1S84A 2CHAB 3GY7A 4X2WA 4HTCH 5LH8A 1TGNA 3VB5A 2KX4A 3CNRA 1EB1H 2ZGXH 3HK3B 5F6MA 4NZLA 1E37B 3P6ZB 1LHCH 2BLOA 1GI1A 3A85A 1BB0B 2BDHA 3RXLA 4AC9A 1GBDA 1L1JA 3GYMA 1NRPH 4NA7A 4OGXA 1C1UH 3BTTE 2D8WA 2WUCA 5F8XA 2A4GA 2ZU2A 4WF8A 3RXSA 4IS5A 2UUJB 3BN9A 1D3PB 1NN6A 1OP0A 2ZKSA 3BSQA 3A8CA 2XBVA 5FX5A 4GHTA 1DSUA 2W7SA 3H5CB 4NG9H 2ZF0H 3E8LA 1EUFA 2BD2A 2VVVA 2C3SA 4Y76A 4ISIH 1UHBB 3WWFA 4K1EA 3MYWA 1RJXB 1BT7A 1NFYA 2RG3A 1GBAA 1ABIH 1W13U 3OY6U 1V2PT 3RP2A 2CV3A 5C2ZA 4NFFA 3U69H 4H6TA 3WW7A 2V3MA 2A2XH 5EXMA 2ZDAH 2HALA 3RMNH 3P8NA 1BITA 3LT3A 4AFSA 2Y5HA 3TJNA 4I8GA 2FO9A 1DOJA 2YMSD 3T25A 5A8ZA 2A7HA 2J92A 3A80A 1D6WA 2PSYA 5L2ZH 1NTPA 5E0GA 1GBCA 3PV5A 4KP0A 3A84A 4Y8YA 1HAIH 4WMDA 3NXPA 5T6FA 1VGCC 1QGFA 2B7DH 4YOJA 2PP6A 2VU8E 5JBBS 1BCUH 4H42U 5EOKA 1WOFA 1FQ3A 1ELBA 3PTBA 3MO9A 5JPMH 3A83A 3UNQA 2XRCA 1ZSJA 1O3OA 4M9FA 4AZ2B 1G9IE 5AF9H 4Z0KA 3LJOA 3L33A 3SYJA 1TNHA 4AX9H 3RMOH 2BD7A 1HJAC 1J16A 1K22H 3CS0A 1KYNA 2AIPA 2R2MB 1QBOA 2CGAA 1EXFA 1NC6A 1ZJDA 2Z9IA 3NZIA 2W26A 3E16B 1PPHE 1ZPCA 3M3SA 2FOCA 4D9RA 1HGTH 3F2FA 1ORFA 3RXAA 3ZZ9A 3QLPH 2OC7A 2FTLE 1C4Y2 3KGPA 3E0NB 1TFXA 1NRRH 8LPRA 1TBQH 1O5FH 3F9FA 1J17T 5G4BA 5HIZA 1NFWA 4UONA 4H6SB 1ELVA 1S5SA 4FUJA 3I29A 3Q3KA 3DT0H 3UUZA 1J15A 1PPGE 2VJ1A 1NRSH 1ACBE 4BTUB 3RC4A 1UTJA 3GOVB 3SBKA 1QJ1B 2Y6TA 3BEUA 4UFDH 2H6MA 1GHAF 1C2GA 1OWDA 1MTVA 2FI3E 3AW0A 1TE0A 1WUNH 1P10A 3ZVBA 3ZZ8A 5A8YA 5L30H 2QIQA 4ZXXH 1KSNA 3KYFA 4Q7ZA 4I8KA 3F2HA 2NWNA 1KTTB 1SBWA 3NWUA 1EPTA 5EGMA 3SORA 1SLUB 5DO4H 1TYNA 3ZV9A 1D3TB 2WHXA 4MDSA 3WY8A 3FP7E 1YPLH 3RU4D 2PUQH 3AW1A 4IC5A 1SR5C 1GBHA 5JYIA 4MNWA 1GJ8B 1QA0A 1BQYA 1GHAG 1AUJA 3PLPA 1GBJA 2HGTH 1UTQA 2FDAA 4GCHF 3KQEA 1E34B 1OWEA 2KAIB 1LHDH 4IN1A 1FDPA 1TPSA 1C5YB 1P8VC 3RXDA 1FN8A 1GHXH 1DDJA 2C8WB 4K8YA 4YLQH 1GGDC 2XXLA 3MU5A 1TLDA 2D2DA 2WUBA 2BOKA 3SNCA 3A8AA 1XUKA 4Y7AA 2ZFTA 3MH7A 2ZDNA 1YPHE 1QZ8A 3NUMA 2FMJA 4Q4LA 1UHBA 1WV7H 2FX4A 3MNCA 4Q80A 5EXLA 4KKDA 3LIWA 1O0DH 1GWAA 2GP9B 1FN6A 1V3XA 5EJ1A 1K1MA 3F9HA 3T29A 3PM3A 1EOLA 1P04A 1IHTH 3UPEA 1Y5BT 1KIGH 1XVOA 1DSTA 2F9NA 4FUDA 4GCHG 1FAKH 4FVDA 3ZZ4A 1XM1A 4Z1MD 2FOAA 2BB4A 5F53A 2K8IA 4Z6AH 4RSPA 3PV2A 3A7YA 1BUIA 1E79D 1BBRH 1LVYA 3LKWA 2P8OC 2RDLA 4WH6A 4CRGA 4DCDA 1O2TA 4UEHH 1T8LA 3SI3H 2XC4A 9LPRA 1TOMH 2HNTE 2H5DA 2ZGJA 1WQVH 1TQ0B 4QT8C 2IJD1 1CVWH 3RMMH 3TNTA 2FLRH 2WV5A 1ELFA 1UTKA 1ELDE 2G00A 1K1JA 1QBVH 1V6DA 1FUJA 2AGGX 1E38B 2QGRA 3U1JB 1P2MA 3U8OH 1KLJH 1LQDB 2TGDA 4K1SA 4X1SU 3ZZBA 1LQEA 2W6ID 4Q2KA 2QCYA 1IQMA 1J14A 3SQEE 1Q2WA 1FMGA 4CRFA 3OX7U 3RXTA 4K2YA 2LP6A 3MI4A 1DY9A 2QXJA 4FUEA 2D26C 1K1NA 1Y3VA 3TGKE 1CT4E 3M5LA 1SI5H 1BIOA 1HAOH 3S69A 3BEFB 5A0CA 3KCGH 1AKSB 1E1QD 7LPRA 1P03A 3BTQE 1C5NH 2I6SA 1PYTC 4IC6A 2GV7A 3BTEE 1YPJH 2FOMB 3TU7H 4MNVA 3MMGA 3UWIA 2C8YB 4X0WU 3NK8A 1AHTH 1FIWA 2GT8A 2VH0A 2A45B 4GPGA 3F9GA 3VB3A 4VGCB 3S9BA 1DVAH 1SL3A 2XCFA 1LHGH 1ESTA 5CDFE 1VITH 2R2WU 4X2YA 4BTIB 3F68H 1MKXH 1FIZA 1YC0A 2CHAC 1C1MA 1KXBA 3M3VA 1RD3B 1SC8U 3A8BA 5B6LA 3BTME 3MH6A 2KCOA 1ID5H 1GCDA 2RA3A 1GVZA 4NA9H 3OYPA 1F5LA 2VINA 4OS5A 1VGCB 3VB7A 1SPJA 4WXVA 3ZZCA 3NCLA 1LPGB 1YPKH 4FOUC 1NS3A 4OM9A 1O30A 1JXPA 3RXPA 3SUFA 2XWBI 3VG8A 4JCNA 3PYHA 1MTSA 4MPVA 5EPNA 2SNVA 4XRNA 5JBAS 1C1WH 1PPZA 1TPPA 2B9LA 2NU2E 1ZSKA 2Q6DA 4FUIA 4D7FA 1W2KH 1HJ8A 3UTUH 1EZXC 4YOGA 2PTNA 3M3TA 2GCHF 2WV9A 3ZVAA 3HATH 3RLWH 1GBEA 1K1IA 1GG6C 2KR7A 2JDID 3FZZA 3MO6A 3FP8E 3PRBA 2ZGHA 1SGFA 4NZQA 2BDBA 4X2VA 1DM4B 5EQRA 1WTHD 4DVAU 1MBMA 3A7VA 1TABE 4FUFA 5HM9A 3KL6A 2TPIZ 1MU8B 2QF0A 2BY5X 4XFQA 2BQ7B 2BLVA 3R0FA 3KYGA 1BTHH 1FX0B 3ZZDA 4AFQA 1WSSH 1K0HA 1GI5A 3T27A 5A2MH 3K9XB 4ZROA 1EB2A 2GCHG 1BTXA 2HLCA 3RXOA 1QB9A 1C2MA 1AZZA 1L1GA 1LPKB 4MPWA 4X8UH 4J2YB 4KTCA 1BMLA 4F48B 4D9QA 5DGJA 3S7KB 3BV9B 3M5MA 4I86A 1Z6EA 5C1YA 3BF6H 2VIQA 2B8OH 4YT6H 3UIRA 5FAHA 3SN8A 1GCTB 1V2UT 3S9AA 3M61U 4INKA 4ABDA 5EU8A 1F2SE 3LGIA 2OC0A 1OWHA 2K0QA 1O3AA 1BMMH 2Q1JA 5C17A 2R9PA 1MBQA 4X8TH 1OP8A 5FPYA 1JWTA 1YM0A 4JZIA 1TNLA 1A46H 3O8RA 1SHHB 4B76A 5JBTA 2A32A 2C4FH 3NPSA 3ZVEA 1C2IA 1QIXB 5DP5A 6ESTA 5C0TA 1AE8H 2BX4A 4BTTB 1A4WH 2ZCLP 2Z3CA 1T7CA 3EA8A 1SFQB 5ETXA 3UB0A 2XBYA 1BTZA 1LO6A 2CJIA 2XOKD 2BTCE 4AYVB 1UMAH 2ILNA 1GI8B 2BD3A 3TK6A 2JH0D 2O8MA 1F0UA 3M7QA 1NO9H 1SLWB 4TY6A 3TGIE 1GMHF 2A7JA 1SGRE 2F4LA 2WZQA 3GDUA 2AIQA 1OSSA 1IAUA 2AH4X 2BDCA 3ENSB 1C5XB 1TRNA 3RXUA 2SGQE 1CO7E 2F9VA 4U01A 1SGQE 5GJ4B 1AKSA 1O3EA 8KME2 1SGIB 1TBZH 3RXFA 2ANMH 2W6JD 4X6MA 3V13A 5E2OA 1AWFH 1UK3A 2OC8A 3RXJA 4RKJB 2P93A 1GVLA 4I8JA 4A1XA 2G55A 4Y8XA 2ZDKA 9ESTA 4PROA 3P95A 2HPQH 4FU9A 1OX1A 1O2IA 1UVSH 1ARCA 4HG6A 3HGNA 1ZPBA 2VGCB 2F43B 1W10U 3Q3XA 3R3GB 5DP4A 1GMHG 1F7ZA 3FKSD 4X2XA 4O3TA 2HVYB 2QY0B 2FOEA 1QL7A 2SGFE 4OS7A 2ZWLH 2FTMA 3QGJA 1OHHD 1V2NT 2ZP0H 3PO1B 4TPIZ 1BRCE 5PTPA 3VB6A 1V2ST 2ANKH 1MZDA 1NRQH 4RI0A 2BDAA 2AMPA 1OWKA 2K1QA 1O2XA 1QA7A 3LU9B 1IQEA 2DE9A 4I31A 4I8HA 3OY5U 4O97A 1XXFA 1PPBH 2ZHWH 1GBKA 1L1NA 1HCGA 3UQOA 4CR9A 1SGEE 1AD8H 1A3BH 1C5SA 1W7XH 5ESBA 4TWWA 1C1OA 5FCKA 4ZUHA 1NFUA 5DSFA 5IYTA 3KQDA 4K8BA 1W0YH 1EFRD 2G51A 2J98B 1HAGE 1S6FA 2EI7A 5HXFA 1DICA 1BMFD 1CE5A 2AGEX 1IQNA 3BTHE 3ESTA 2AERH 2KZ4A 5DK1A 4Q7YA 3GCHB 1P9SA 2ZTZA 1ELCA 1IOEA 1Z8RA 1VCQA 3DHKH 1TB6H 2VNTA 1TMBH 1H9LB 2FP7B 3L3TA 4B2CA 4E7NA 4LK4A 4NGAH 3SUGA 1N6YA 2RDEA 2JIZD 1RFNA 1K21H 4KELA 3UAIC 1ETTH 1HAVB 1VITF 1GI9B 2QF5A 4MVNA 4YM9A 1D9IA 1RTLA 3T2NA 1AVGH 1A0JA 4IBLH 1GVKB 1GMCF 3URCA 2F83A 1S82A 1O5BB 4A1TA 3BIUH 3MOCA 2ZDVH 2XC5A 4UFFH 1ANBA 1O3PB 1RTFB 1FY8E 2J2UA 2A5IA 3MNXA 4GAWA 1TX6A 4CRCA 2VWNA 3QTOH 1A0HB 1CGJE 2P3TB 1F5RA 5JB8S 1ANCA 2IJOB 1YWUA 3T5FH 1VITG 1PQ8A 1S81A 1EOJA 1ZRKA 1GMCG 1KXAA 2GTBA 2FWWA 3EGKH 2ZFSA 1DWBH 5K0HA 4Y0ZE 1ZHRA 2J4IA 3F6UH 4CRAA 1O39A 2BD5A 4Q7XA 3SNDA 2VIWA 4DGJA 4A92A 3VEQB 2ZPQA 6LPRA 2DUCA 4ABGA 1LDTT 1Z6JH 2FX6A 3ODDA 4A6LA 5CE1A 4ASHA 2QN5T 2ZHEH 2AFQB 1LPZB 3WWBA 1GG6B 1C5QA 1FXYA 3GYLB 1ZPZA 1C5ZB 2BLWA 5DP3A 1A5HA 1G30B 1Y3XA 2EEKA 1TAWA 2CXVA 4BNRA 5FL7D 5IDKA 3LC5A 2ZU1A 4VGCC 1C9TA 5F8TA 3S9CA 1YPEH 1DUAA 4FUGA 2CF9H 4MTBA 2BXUH 1EATA 4DT4A 3FFGA 4YLUA 5GIBA 1AVWA 3ATKA 2B5TB 2P95A 1JOUB 1Z8IB 2EA3A 2THFB 1TGBA 4NWKA 5C1UA 4YTAA 1P0SH 1RGQA 1GHBF 1O3KA 4CBNA 2JH5D 2I6QA 5DP9A 1W3CA 1ELEE 2ZU5A 1V2WT 1GI3A 1COWD 4NWLA 2XNIA 4B2AA 2GZ9A 1J9CH 3E90B 1BBRK 4ISLA 1BTWA 4AYYB 3KEEA 3LPRA 1C2FA 4DG4A 3QX5H 3AK5A 1IQJA 5DPAA 4Y7BA 1TRMA 2XNDD 1YY3A 1H9HE 2QAAA 1GDQA 1RXPA 2A31A 2BY8X 2SGPE 4X6NA 1TNKA 1GPZA 1SGTA 1SMFE 3P8FA 5DP8A 4KTUA 3TH2H 3GY3A 4NIWA 1AUTC 1GHBG 3BTKE 2F3CE 1OWJA 5GXPA 2ANWA 1IQLA 3NRLA 3F9EA 2R3YA 5AFYH 5FHTA 1WAYB 3QZQA 1SFIA 2OXSA 3OFND 4E7RG 3SQHE 2VIVA 1SOZA 4Y6DA 1O3FA 5BRRE 1SGCA 1O2JA 1KXDA 2H9HA 1EKBB 2LPRA 2J98A 1XKAC 1Q3XA 3UREA 1AQ7A 1AI8H 3LH3A 3LC3A 1YKTA 3STJA 2BX3A 1CT2E 1Y5AT 2BLQA 1GI0A 1TNJA 3UR6A 1ETSH 2FZZA 2OBQA 3DSGA 3A88A 1FY5A 2FXRA 3L6PA 2J97A 2V3HH 1O2QA 2BY7X 1NBMD 1UTMA 5FCRA 3ZVDA 1SHYA 1HAVA 1EAUA 1GJ4H 2ZNKH 2FYRA 1V2VT 4BAKB 3A82A 3RDZA 3ZYEA 5EQSA 1GCTC 1WQSA 1AIXH 3D49H 1MKXK 5HYOA 1O2MA 1UVPA 5TJXA 3A7WA 1KLIH 2G4TA 4TY7A 4AOQA 4IMQA 3ATLA 1BTUA 2IN2A 1ZR0A 4I33A 5H4IB 3PMBB 4MPXA 1C9PA 1QJ7B 2BOHB 1PQAA 2CF8H 4O3UA 3BTWE 3SV6A 4IN2A 4AG2A 2OP9A 1PJPA 1UTNA 4Q63A 1NROH 2ZPSA 3MQKC 2ANYA 2HRVA 1DXPA 2V0BA 2WINI 1ABJH 2GD4B 5HIYA 3K2UA 2V3OH 2O9QA 3EQ0H 4OS2A 1G37A 3O8CA 1NBME 1NT1A 2ZFFH 3SU0A 1EJAA 5DP6A 3OEHD 3UOPA 4K1TA 3S0NA 2VIDA 4TSFD 1HRTH 3PWCA 1O2HA 1MD8A 4WJG2 4U2WA 3FANA 4IGDA 1CT0E 5EPYA 4CRBA 3EE0B 2W5EA 2ZGBH 2FM2A 1PPCE 4B73A 2FESH 1XVMA 4TT3D 4HI3A 1PYTD 1C5TA 3OE7D 2A5KA 1S6LA 2KCPA 1EP5A 2ZHFH 2ZO3H 3FP6E 3SU5A 5EG4A 2BVXH 1N8OB 3LJJA 3QUMP 4LXBH 3U9AH 1LVBA 2OLGA 1A61H 1P2OA 1YCPM 1S0RA 3RU4E 4AGKA 1MKWK 1Q31A 1TA2A 4FUBA 2GZ7A 4BAMB 1S6HA 2VGCC 3RMLH 2HVXA 4FUCA 5LPEA 4AN7A 1B0EA 2AS9A 1GHVH 1OS8A 1EZSC 3GY2A 1G3DA 1HNEE 1VCWA 4Y79A 2ZFRH 2J34A 1AU8A 3K6YA 4BXWA 3VGCC 2AEIH 1O2WA 4I8LA 1O2UA 3E3TA 1Y59T 1DX5M 1OPHB 1C1NA 4RN6A 1O2SA 1O3GA 2TGAA 3P92A 1CU1A 4ZKNU 1C2HA 1A3EH 2NU0E 3PO1C 4TPYA 3Q77A 1XKBC 3PV4A 3ZIAD 3A7XA 1DS2E 3UWJH 3A81A 3W94A 4CRDA 5C0UA 5FX6A 1T32A 5L2YH 1BRUP 3KHVA 2OINA 2BVSH 1F0RA 4CH2B 1INCA 3RU4T 3DD2H 1D3QB 4FU8A 3Q00A 1AMHA 1T4VH 3KIDU 1YPHC 3I77A 4O9VA 2Y7ZA 2Z3EA 3B23B 3UNSA 1NFXA 1V2LT 3SJ8A 1ZTJA 5T1VA 2TRMA 1HPGA 3AASA 3ATMA 3GCHC 4OGYA 3DA9B 5AFZH 2UWLA 2L74A 4ZAEA 4FVBA 2VVCA 1O37A 3M7UA 3MU8A 3MU0A 2VWOA 1MTNB 1EAIA 1A5IA 2R0LA 1VJAU 1HDTH 1WU1A 2VH6A 5DG6A 1PFXC 2G4UA 2ZFQH 1G3EA 1F5KU 1DWDH 2Y80A 3LDXH 1FZZA 1WXRA 2HNTC 3AAVA 3FN8A 1LHEH 2VWMA 2A0QB 5KGOA 4ZHLU 5GCHF 4NIXA 4INLA 3GY6A 1ELGA 1AN1E 1FLEE 3M35A 5CHAB 1N6XA 2TGTA 4YO9A 3F0OA 2KCYA 4B2BA 1QHRB 1Y3YA 3RC5A 3SV2H 3UNRA 4JYVH 3ZV8A 2Z7FE 1O38A 3ATIA 1BOQA 2GZ8A 1O3IA 3MO3A 4JMYA 2P16A 4XOJA 1C4V2 1EJNA 1O3JA 3SNAA 2Z3DA 3F3BA 3B8JA 2BMGB 1C1PA 2STBE 4CHAB 3HGPA 2QF4A 3BTGE 4AGJA 1MU6B 4NIVA 1O2NA 1GDUA 1GMDF 3A7TA 1V2RT 5GCHG 5C20A 2G81E 1ANEA 1KXFA 1O5GH 1O33A 2ZCHP 1YLDA 4KTSA 3Q3YA 1EP6A 1A1RA 1P05A 2LELA 2ZEBA 2PV9B 3KQ5A 2W7UA 1NU9A 2YNBA 4J1YA 2PSXA 2GV6A 2KFWA 3RXIA 1SQTA 1L2EA 1YGCH 3FZDA 5A0BA 1MUEB 2JJ1D 1ZJKA 3QDZB 4FUHA 1SQOA 1UVOA 2V7QD 4WVPE 2HOBA 1O2RA 1W14U 1O2OA 4R8TB 2ZZUH 1MKWH 5LGOA 1MQ5A 7ESTE 1TNIA 1EX3A 2UUFB 1MCVA 1GMDG 3UY9A 1G3BA 2XW9A 1FPHH 2ZG0H 1H8HD 1O34A 1DE7H 4P02A 2ZIQH 7GCHF 4AB9A 5EW1H 1KDQB 3RXRA 1G36A 1SVPA 2G5VA 3MH4A 1RRKA 1CSOE 1KXEA 3RXHA 3HKIB 2J9NA 8GCHF 3LGWA 4A7IB 1EASA 3A7ZA 3RUOA 1QURH 2BZ6H 2SGEE 2PKSC 3TJVA 4DY7B 1N1LA 4SGAE 1UVUH 2YMSB 1MMJN 2F9PA 4X1PU 2ZDMA 3UR9A 2TGPZ 1ZHMA 2TBSA 4P00A 7GCHG 2GDDA 2WPIS 2YNAA 1UCYK 2M2AA 2BZAA 1BMNH 1GI4A 2ZQ2A 2JETB 1D3DB 3AAUA 1P3CA 1MZAA 1OP2A 2OQUA 3E1XB 4JYUH 8GCHG 2BXTH 4D76A 1QJ6B 1Z1JA 3OTPA 3BTDE 3SJKA 3TNSA 1YYY1 1X7AC 1QB6A 1TGSZ 1GHYH 2GT7A 4ACAA 3PLKA 1G32B 4Y8ZA 4E05H 2UWOA 3T26A 2VB0A 5I46H 4Y0YE 3RXGA 1D4PB 5C1XA 2AYWA 4I32A 4B74A 2BD9A 1TA6A 3H09A 3GS9A 2BY9X 1GJCB 2QV1A 4FXGH 1BBRE 5FPSA 2RA0A 2GJGA 3VFEA 1T31A 1O35A 2BYAX 3PMAB 3TJOA 3P8GA 3GY4A 3K65B 1CA0C 2HPPH 2QC2A 3MFJA 2VWLA 1TOCB 2Y81A 1YF4A 1DT2A 2C90B 1VKYA 2FPZA 2GCTB 2SFAA 1NPMA 4X1RU 4D8NA 4DT7B 1C2DA 2KM0A 3SZNA 2ESTE 1A5GH 2P59A 3T28A 5IK2D 1E35B 4Y11E 3SZEA 2VVUA 3Q76A 4B6FA 1Z8GA 2F9OA 1E1RD 3KQBA 3VGCB 3DCLA 3STIA 2ZPRA 3LGYA 1ARBA 2D1JA 1LHFH 1FNIA 1C5LH 2ZTXA 4K60A 1CGHA 4OS1A 3TIUA 3H7TA 1S85A 1P2IA 1GJDB 3C1KA 1KY9A 2NU4E 1Z1IA 3TJUA 1BTYA 1ZYOA 3GCOA 1B5GH 1HFDA 2FODA 2FOBA 1SGFG 2P94A 1GJ5H 5BPEA 4K5ZA 4ACBA 1FY1A 3GY8A 1P3EA 2SNWA 1P2JA 1RS0A 3SNBA 3HPTB 1V2KT 1YP9A 1CQQA 3U28C 1O36A 1N8OC 1HBTH 2Y5FA 3PROA 4ZKOU 1NY22 1O31A 4ZCNA 1EAXA 3KF2A 1MD7A 1C1VH 1GBTA 5A0AE 1QBNA 5FBIA 5E0HA 2ZU4A 1G3CA 1Z71A 2NU3E 3EA9A 3ZZ6A 1ELTA 1O32A 2DE8A 1O5DH 1UTOA 2ALPA 1HAZB 1K2I1 1W7GH 1O3DA 1ANDA 3MWIU 2OK5A 1ZMLA 3LGVA 3RM2H 2Z9KA 1GI7B 1CHOF 1MTWA 3W1EA 1H1BA 1GJ9B 2BQ6B 3RLYH 2HWLB 1KDQA 3SHAH 3PWBA 2FYQA 1ZZZA 2W3KA 5T3HA 2ZTYA 3SV9A 2JJ2D 4AFUA 1EJMA 1UJ1A 3RM0H 1A0LA 2OD3B 1NZQH 3SJIA 2WYJA 5HM2A 2NU1E 3PRDA 1HB0B 2CMYA 3EYDA 1DXWA 1GL0E 2UUYA 2GKVE 2ZDLA 1O2PA 1FONA 4GLYA 4RT0A 2J95A 1QL8A 1ZHPA 1UCYH 4AG1A 1PQ7A 1OXGA 1UK4A 4JZ1A 1CHOG 1Y3WA 1HIAB 1C5OH 2W3IA 3TGJE 4XDEA 1YPGH 3GCNA 1C1QA 3JZ1B 3OSYA 3CP7A 3SHCH 3A87A 1RIWB 3I78A 3SV7A 1ZGIA 1JRSA 4IW4E 1MTNC 2OQ5A 4AFZA 4X1QU 1K1OA 1WTGH 2H9EH 3PTNA 3ZVCA 3IG6B 4UFEH 3EDXB 2XBWA 2IPHA 3ZZ7A 1YBWA 1O5EH 1P12E 2J5UA 1TONA 1TPOA 3SO3A 1BHXB 1KMHB 4CR5A 3F0PA 2WPDD 2XTTB 4DOQA 1F0TA 1OWIA 2WYGA 3N7DA 4DURA 3GISB 1HAYB 2PGBB 1O5CB 3QWCH 1KTSB 1W0ZU 2PUXB 2ZI2H 4RKOB 4MG3A 2Y82A 5E2PA 3PLBA 1HXEH 1TRYA 5CHAC 3MTYA 1IQKA 2R0KA 3OTJE 1TNGA 1QCPA 2A5AA 2PW8H 4YXWD 3PB1E 1THRH 3UOUA 1O3BA 3KNXA 1IQIA 4TWYA 1C5WB 1DLEA 2QXIA 1XUHA 1EQ9A 1AFQB 5C5OA 1Z7KA 1MAXA 1KXCA 2PKSB 4F4OC 4CHAC 4B6EA 3W95A 4ABBA 2BDIA 1QB1A 2IOTA 4K3JA 2O8UA 3IITA 4BAQB 2VBCA 3SGAE 1C2JA 1UW7A 2GX4A 1TMTH 6GCHF 1JRTA 2RCEA 4X6OA 1RTKA 1LVOA 3LGTA 3BTFE 1KLTA 1O3CA 3DSOA 4TYDA 3U98H 1GBLA 2ODQA 3EE7A 2ZHDA 2G52A 2UUKB 1FY4A 3FVFB 5FPTA 3E6PH 1QL9A 1K1PA 3BG4B 3O8BA 2RFKC 2PLXA 1W12U 2BY6X 2GVFA 3TVJB 1O2LA 1YCPK 2EY4C 1SLXB 1QR3E 4XBCA 1H9IE 1MTUA 3FO8D 5EW2H 1GL1A 2BVRH 2CK3D 6GCHG 5JB9S 1AE5A 1TPAE 3D65E 2CN0H 1V2OT 1GI6A 1HXFH 4H4FA 1SQRA 3RXKA 3CS7A 4BOHA 1AGJA 1ZTLA 6CHAB 1O3MA 4M7GA 3SUDA 4UE7H 4LZ1H 1GBBA 1CA0B 1VCPA 3BG8A 4DIIH 5JBCS 4JK6A 1O3NA 4GUXA 4X8VH 1F0SA 1CHGA 2OUAA 2FLBH 3ZZAA 5C3NA 4UFGH 1AB9B 1LMWB 3QN7A 1DLKB 1WYKA 2V6NA 1GJ7B 2YMSC 3M7TA 3F2GA 1TGTA 1FV9A 4MNXA 3P70B 2Z6BD 4E06H 2GMTB 3MH5A 1QTFA 1FPCH 4F49A 1E0FD 4MQAA 2Q6GA 4BANB 1IQFA 2FS8A 2JETC 3DFJA 5EJLA 3SJOA 3SGBE 2ZU3A 5LPFA 2ZCKP 3SNEA 3ZVGA 4Y71A 1T4UH 1JIMA 1MAYA 1C2KA 1SOTA 2ZA5A 1HAHH 5KECA 2ODYB 1ESBA 1HIAA 2FOGA 1LCYA 2P3FH 3T62A 3ZYDA 1ZTKA 1SQAA 1UTPA 2A1DB 1AWHB 1M9UA 4ZXYH 3SV8A 2GGVB 5ABWA 1H4WA 1GJAB 4XE4A 3MHWU 3LGUA 3M37A 2G8TA 3SI4H
chains in the Genus database with same CATH topology
3N7OA 1UO6A 2F91A 2OC1A 1C2EA 5EODA 4ZHMU 3GDVA 5T6GA 1OYTH 1TQ7B 2FOFA 3SOSA 2GCTC 1DWEH 1LKBA 1PPFE 3F1SB 4BXSA 1YPMH 5TCCA 2ZECA 3EA7A 3SJ9A 4B71A 1TMUH 1BTPA 4WXIA 4CBOA 4ABJA 2AMDA 3RXMA 1OYQA 1ZOMA 4UDWH 1UCYE 2PFEA 1TX7A 4CREA 3FAOA 3GCTF 3U1IB 2GDEH 3RC6A 1DUEA 1P06A 1TGCA 5JDUB 1P57B 3ZZ5A 5AVDA 3URDA 1HLTH 5HGGA 3QK1A 2OTVA 1O3HA 5GDSH 4YT7H 4ABIA 1P2KA 2BD8A 4MNYA 4I7YH 5EXNA 3ITIA 1LTOA 2A2QH 2PWXA 1LVMA 3SGQE 1EZUC 2FI5E 3MNBA 1O2ZA 1YLCA 1HV7A 3V0XA 3ZZ3A 1FJSA 1TALA 1W11U 3AVZA 4DJZB 1O5AB 1O2VA 1C5MD 4X8SH 3GCTG 3B9FH 4ABEA 1GHZA 1P11E 2XWAA 2HNTF 1CBWC 5DJ7A 4WH8A 2PTCE 1SGYE 1V2QT 2XBXA 3V7TA 4GSOA 2VIOA 3QTVH 4Y10E 5FBEA 1AVXA 1XXDA 3M5OA 3VXEH 2XC0A 3GY5A 5A8XA 1EZQA 4CH8B 1YCPH 4A5TS 5E8EH 4WMEA 2ASUB 4O03A 3M36A 3D62A 3HKJB 3UQVA 1AFEH 3E91A 2TIOA 1C5RA 1C5PA 5F8ZA 1SLVB 2BHGA 2Z9GA 1IHSH 3MU1A 2EI8A 5K7RA 3GICB 4ZKRU 4D7GA 1GJBB 2O8TA 2BQWB 1JMOH 3K6ZA 4ABHA 4JYTA 2OCVB 2WPMS 3LOXA 1CA8B 3U8TH 1QRZA 1CGIE 3SU1A 1BZXE 4DIHH 2PKAB 1XUGA 1P01A 3SU6A 2FS9A 1FAXA 1B7XB 3GDSA 1GBMA 5FXLA 1ZSLA 1G2LA 1FY3A 4ISHH 3V3MA 2C8XB 4MLFB 1J8AA 1DPOA 3NKKA 2H2ZA 1EPTC 3CENA 2BM2A 2J94A 5C5NA 4WY3A 4HZHA 4A1VA 3TH4H 1HAPH 4X1NU 2H1UA 5DP7A 1QY6A 3KQCA 5AHGH 1PQ5A 1BJUA 4NIYA 4K69A 4XBBA 8ESTE 3TK9A 1QFKH 1BHXF 3SU4A 4AORA 1UVTH 1RIWC 3HK6B 4ZKSU 3PMJA 1C1TA 1BRBE 1O2GH 1ZLRA 4ZHAA 3SU2A 2G5NA 1ZMJA 1C4U2 2JH6D 5J4QA 1B0FA 4SGBE 2A7CA 1MQ6A 2FOHA 1C2LA 1K28D 1SGDE 1ESAA 1XUJA 5GWZA 5DKMA 3V12A 1SSXA 1VR1H 5L6NH 5HMAA 1H8DH 1HJAB 2Z94A 2BD4A 2OBOA 4ESTE 1UTLM 4WMFA 4ISOA 4X6PA 2C8ZB 1T8NA 1JBUH 5EQQA 1UK2A 2KAIA 5CMXH 2STAE 2WPJS 1XUFA 3G01A 2QXGA 1GHWH 4NSYA 3U8RH 1P02A 1GDNA 4GHQA 4AB8A 1EAWA 3DFLA 2R3UA 4ABFA 2WPKS 4YZUA 4JZFH 1TBRH 2Z9JA 1ZMNA 1L4DA 3SW2B 3MNSA 1QRWA 3QO6A 1DFPA 2QA9E 3RXQA 1AFQC 1D6RA 4OS6A 4LOYH 2VIPA 3BIVH 4OS4A 4UD9H 1IQGA 3SUEA 7KMEH 1V2MT 3IWMA 4NA8A 1AY6H 1XX9A 3PMHB 1A2CH 3TPIZ 1JIRA 1G2MA 1NM6A 2ULLA 2O8LA 2H5CA 2SGDE 4R0IA 4THNH 1P09A 2ZHQH 3RXCA 1DY8A 1SGNE 1HUTH 5ESTE 3JZ2B 5TCAA 2FI4E 3BG4C 2A4RA 4IMZA 1BJVA 4ISNA 3QGNB 5A09A 1MH0A 1IQHA 1HJ9A 2Y7XA 2A4QA 3LH1A 1OOKB 3A8DA 2ODPA 2ZGCA 3ODFA 1QNJA 3EAJA 1WCZA 1AZ8A 1PPEE 3VPKA 1S0QA 5I25A 3QZRA 3TH3H 6CHAC 1BA8B 2WPHS 3E0PB 1H8IH 4YOIA 3D23A 1SB1H 5LPRA 2C93B 4ABAA 4ZMAH 2PHBA 4NCYA 4FU7A 1T8OA 1GGDB 4NFEA 1QQ4A 2ZC9H 4DW2U 1ELAA 2F9BH 1L4ZA 1O3LA 1AB9C 1DWCH 2V35A 4B75A 4NSVA 2LNCA 2QF3A 2FIRH 4WWYA 2A4OA 2BDGA 1GBIA 1GBFA 5F03A 2PKAA 1Z8JB 2ZFPH 4KGAA 3RXBA 1Y3UA 3O8DA 1Y8TA 2GMTC 2Q6FA 5SGAE 1THSH 4JZEH 2PR3A 1DANH 1OKXA 1P2QA 3C27B 3BEIB 1HYLA 1TWXB 1GJ6A 2QYIA 3A89A 4HGCA 4INHA 2UWPA 3LONA 2ZQ1A 2SGAA 5B6OA 3SU3A 1A7SA 1VJ9U 3TITA 4U30A 1C5VA 1HAXB 1W8BH 1LKAA 2P8OB 3M5NA 1T8MA 1AO5A 2EC9H 2B0FA 2AMQA 3MU4A 4XBDA 3UFAA 4B1TA 5T6DA 5GPIB 1K9OE 1NRNH 2WPLS 1O2YA 1XMNB 3ATWA 1P2NA 3RXEA 1NU7B 1WBGB 1THPB 2XCNA 1CBWB 4GVUA 1V2JT 3H7OA 3ZVFA 2ALVA 2J38A 4BAOB 5E0JA 2BDYA 1BRAA 4JZDH 3P17H 3OU0A 2QXHA 3KN2A 2JKHA 1ZRBA 1C1SA 1MCTA 1NESE 1QQUA 4ZH8A 1BMAA 1DITH 1P9UA 2M5TA 2AGIX 2Z9LA 1QRXA 4LZ4B 1V2TT 1L0ZA 2Y5GA 2YOLA 3VXFH 1GI2A 1VZQH 1C5UA 3S7HB 2WV4A 2XYAA 1TX8A 1F92A 2F9UA 1C1RA 3TLOA 1U6QA 2H9TH 4HFPB 1TIOA 4YESB 3TK5A 5C67A 1FI8A 2PGQB 1ZGVA 3RXVA 1SGPE 4JK5A 1XUIA 1K1LA 5J4SA 4MPUA 3ELAH 4U32A 1ETRH 2O8WA 2P3UB 1S83A 4BAHB 2EI6A 3DUXH 1E36B 1O2KA 2FEQH 3VB4A 1SG8B 3P8OA 3A86A 1EPTB 1BDAA 1Y5UT 4XSKU 1S84A 2CHAB 3GY7A 4X2WA 4HTCH 5LH8A 1TGNA 3VB5A 1EB1H 2ZGXH 3HK3B 5F6MA 4NZLA 1E37B 3P6ZB 1LHCH 2BLOA 1GI1A 3A85A 1BB0B 2BDHA 3RXLA 1GBDA 1L1JA 3GYMA 1NRPH 4NA7A 4OGXA 1C1UH 3BTTE 2D8WA 2WUCA 5F8XA 2A4GA 2ZU2A 4WF8A 3RXSA 4IS5A 2UUJB 3BN9A 1D3PB 1NN6A 1OP0A 2ZKSA 3BSQA 3A8CA 2XBVA 5FX5A 4GHTA 1DSUA 2W7SA 3H5CB 4NG9H 2ZF0H 3E8LA 1EUFA 2BD2A 2VVVA 2C3SA 4Y76A 4ISIH 1UHBB 4K1EA 3MYWA 1RJXB 1BT7A 1NFYA 2RG3A 1GBAA 1ABIH 1W13U 3OY6U 1V2PT 3RP2A 2CV3A 5C2ZA 4NFFA 3U69H 4H6TA 2A2XH 5EXMA 2ZDAH 2HALA 3RMNH 3P8NA 1BITA 3LT3A 4AFSA 2Y5HA 3TJNA 4I8GA 2FO9A 1DOJA 3T25A 5A8ZA 2A7HA 2J92A 3A80A 1D6WA 2PSYA 5L2ZH 1NTPA 5E0GA 1GBCA 4KP0A 3A84A 4Y8YA 1HAIH 4WMDA 3NXPA 5T6FA 1VGCC 1QGFA 2B7DH 4YOJA 2VU8E 5JBBS 1BCUH 4H42U 5EOKA 1WOFA 1FQ3A 1ELBA 3PTBA 3MO9A 5JPMH 3A83A 3UNQA 2XRCA 1ZSJA 1O3OA 4AZ2B 1G9IE 5AF9H 4Z0KA 3LJOA 3L33A 1TNHA 4AX9H 3RMOH 2BD7A 1HJAC 1J16A 1K22H 3CS0A 1KYNA 2AIPA 2R2MB 1QBOA 2CGAA 1EXFA 1NC6A 1ZJDA 2Z9IA 3NZIA 2W26A 3E16B 1PPHE 1ZPCA 3M3SA 2FOCA 4D9RA 1HGTH 1ORFA 3RXAA 3ZZ9A 3QLPH 2OC7A 2FTLE 1C4Y2 3KGPA 3E0NB 1TFXA 1NRRH 8LPRA 1TBQH 1O5FH 3F9FA 1J17T 5G4BA 1NFWA 4UONA 4H6SB 1ELVA 1S5SA 4FUJA 3I29A 3Q3KA 3DT0H 3UUZA 1J15A 1PPGE 2VJ1A 1NRSH 1ACBE 4BTUB 3RC4A 1UTJA 3GOVB 3SBKA 1QJ1B 2Y6TA 3BEUA 4UFDH 2H6MA 1GHAF 1C2GA 1OWDA 1MTVA 2FI3E 3AW0A 1TE0A 1WUNH 1P10A 3ZVBA 3ZZ8A 5A8YA 5L30H 2QIQA 4ZXXH 1KSNA 4Q7ZA 4I8KA 2NWNA 1KTTB 1SBWA 3NWUA 1EPTA 5EGMA 3SORA 1SLUB 5DO4H 1TYNA 3ZV9A 1D3TB 4MDSA 3WY8A 3FP7E 1YPLH 3RU4D 2PUQH 3AW1A 4IC5A 1SR5C 1GBHA 5JYIA 4MNWA 1GJ8B 1QA0A 1BQYA 1GHAG 1AUJA 3PLPA 1GBJA 2HGTH 1UTQA 2FDAA 4GCHF 3KQEA 1E34B 1OWEA 2KAIB 1LHDH 4IN1A 1FDPA 1TPSA 1C5YB 1P8VC 3RXDA 1FN8A 1GHXH 1DDJA 2C8WB 4K8YA 4YLQH 1GGDC 2XXLA 3MU5A 1TLDA 2D2DA 2WUBA 2BOKA 3SNCA 3A8AA 1XUKA 4Y7AA 2ZFTA 3MH7A 2ZDNA 1YPHE 3NUMA 4Q80A 2FMJA 1UHBA 1WV7H 2FX4A 3MNCA 5EXLA 4KKDA 3LIWA 1O0DH 1GWAA 2GP9B 1FN6A 1V3XA 1K1MA 3F9HA 3T29A 3PM3A 1EOLA 1P04A 1IHTH 3UPEA 1Y5BT 1KIGH 1XVOA 1DSTA 2F9NA 4FUDA 4GCHG 1FAKH 4FVDA 3ZZ4A 1XM1A 2FOAA 2BB4A 4Z6AH 4RSPA 3A7YA 1BUIA 1BBRH 1LVYA 3LKWA 2P8OC 2RDLA 4WH6A 4CRGA 4DCDA 1O2TA 4UEHH 1T8LA 3SI3H 2XC4A 9LPRA 1TOMH 2HNTE 2H5DA 2ZGJA 1WQVH 1TQ0B 4QT8C 1CVWH 3RMMH 3TNTA 2FLRH 2WV5A 1ELFA 1UTKA 1ELDE 2G00A 1K1JA 1QBVH 1V6DA 1FUJA 2AGGX 1E38B 2QGRA 3U1JB 1P2MA 3U8OH 1KLJH 1LQDB 2TGDA 4K1SA 4X1SU 3ZZBA 1LQEA 4Q2KA 2QCYA 1IQMA 1J14A 3SQEE 1Q2WA 1FMGA 4CRFA 3OX7U 3RXTA 4K2YA 3MI4A 1DY9A 2QXJA 4FUEA 2D26C 1K1NA 1Y3VA 3TGKE 1CT4E 3M5LA 1SI5H 1BIOA 1HAOH 3S69A 3BEFB 5A0CA 3KCGH 1AKSB 7LPRA 1P03A 3BTQE 1C5NH 2I6SA 1PYTC 4IC6A 2GV7A 3BTEE 1YPJH 2FOMB 3TU7H 4MNVA 3MMGA 3UWIA 2C8YB 4X0WU 3NK8A 1AHTH 1FIWA 2GT8A 2VH0A 2A45B 4GPGA 3F9GA 3VB3A 4VGCB 3S9BA 1DVAH 1SL3A 2XCFA 1LHGH 1ESTA 1VITH 2R2WU 4X2YA 4BTIB 3F68H 1MKXH 1FIZA 1YC0A 2CHAC 1C1MA 1KXBA 3M3VA 1RD3B 1SC8U 3A8BA 3BTME 3MH6A 1ID5H 1GCDA 2RA3A 1GVZA 4NA9H 3OYPA 1F5LA 2VINA 4OS5A 1VGCB 3VB7A 1SPJA 4WXVA 3ZZCA 3NCLA 1LPGB 1YPKH 1NS3A 1O30A 1JXPA 3RXPA 3SUFA 2XWBI 4JCNA 3PYHA 1MTSA 4MPVA 5EPNA 2SNVA 5JBAS 1C1WH 1PPZA 1TPPA 2B9LA 2NU2E 1ZSKA 2Q6DA 4FUIA 4D7FA 1W2KH 1HJ8A 3UTUH 1EZXC 4YOGA 2PTNA 3M3TA 2GCHF 3ZVAA 3HATH 3RLWH 1GBEA 1K1IA 1GG6C 3FZZA 3MO6A 3FP8E 2ZGHA 1SGFA 4NZQA 2BDBA 4X2VA 1DM4B 5EQRA 1WTHD 4DVAU 1MBMA 3A7VA 1TABE 4FUFA 5HM9A 3KL6A 2TPIZ 1MU8B 2QF0A 2BY5X 4XFQA 2BQ7B 2BLVA 3R0FA 1BTHH 3ZZDA 4AFQA 1WSSH 1GI5A 3T27A 5A2MH 3K9XB 4ZROA 1EB2A 2GCHG 1BTXA 2HLCA 3RXOA 1QB9A 1C2MA 1AZZA 1L1GA 1LPKB 4MPWA 4X8UH 4J2YB 4KTCA 1BMLA 4D9QA 5DGJA 3S7KB 3BV9B 3M5MA 1Z6EA 5C1YA 3BF6H 2VIQA 2B8OH 4YT6H 3UIRA 5FAHA 3SN8A 1GCTB 1V2UT 3S9AA 3M61U 4INKA 4ABDA 5EU8A 1F2SE 3LGIA 2OC0A 1OWHA 1O3AA 1BMMH 2Q1JA 2R9PA 1MBQA 4X8TH 1OP8A 5FPYA 1JWTA 1YM0A 4JZIA 1TNLA 1A46H 3O8RA 1SHHB 4B76A 5JBTA 2A32A 2C4FH 3NPSA 3ZVEA 1C2IA 1QIXB 5DP5A 6ESTA 1AE8H 2BX4A 4BTTB 1A4WH 2ZCLP 2Z3CA 1T7CA 3EA8A 1SFQB 5ETXA 2XBYA 1BTZA 1LO6A 2CJIA 2BTCE 4AYVB 1UMAH 2ILNA 1GI8B 2BD3A 3TK6A 2JH0D 2O8MA 1F0UA 3M7QA 1NO9H 1SLWB 4TY6A 3TGIE 1GMHF 2A7JA 1SGRE 3GDUA 2AIQA 1OSSA 1IAUA 2AH4X 2BDCA 3ENSB 1C5XB 1TRNA 3RXUA 2SGQE 1CO7E 2F9VA 4U01A 1SGQE 5GJ4B 1AKSA 1O3EA 8KME2 1SGIB 1TBZH 3RXFA 2ANMH 4X6MA 3V13A 5E2OA 1AWFH 1UK3A 2OC8A 3RXJA 4RKJB 2P93A 1GVLA 4I8JA 4A1XA 2G55A 4Y8XA 2ZDKA 9ESTA 4PROA 3P95A 2HPQH 4FU9A 1OX1A 1O2IA 1UVSH 1ARCA 3HGNA 1ZPBA 2VGCB 1W10U 3Q3XA 3R3GB 5DP4A 1GMHG 1F7ZA 4X2XA 4O3TA 2QY0B 2FOEA 1QL7A 2SGFE 4OS7A 2ZWLH 2FTMA 3QGJA 1V2NT 2ZP0H