4O3TA

Zymogen hgf-beta/met with zymogen activator peptide zap.14
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
NIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/growth factor
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3tA01
1Q31A 1RIWC 1YLDA 2KAIA 4D76A 3RXCA 1CU1A 1UVTH 1BTXA 1PPBH 3ZV8A 3TVJB 4Y76A 2FOEA 3M3SA 4NIYA 4ESTE 4FUIA 4ABJA 2NU3E 1DT2A 2W26A 1AVXA 3STIA 3MU0A 1JRTA 1ELAA 2ZQ1A 3MU8A 4NWKA 4A7IB 1VGCC 2J92A 3CP7A 1ESTA 3RU4E 4MNWA 1EP5A 3MI4A 5K0HA 3RU4T 1V2NT 4CRBA 3I77A 1BBRK 2BD9A 2A7HA 4GAWA 4R0IA 3UQOA 3KL6A 1C1TA 3E91A 2HRVA 2CJIA 1O32A 1O2IA 1C5LH 1TGTA 3P8OA 3KNXA 4X1SU 2ZG0H 1GI3A 4HI3A 2AEIH 1GHBG 3Q3KA 3RXTA 3UTUH 2C3SA 1A61H 1JBUH 1V3XA 4X2YA 5JB8S 1ACBE 3QZQA 4WMDA 4ISNA 1NESE 1AI8H 3OX7U 1S6HA 2ZGHA 5EQRA 1K1LA 2C90B 1XUGA 4IN2A 3UOUA 3BTHE 4IMZA 1FIZA 4MNVA 4XBDA 4BOHA 2Z9KA 2J9NA 3MU1A 4ZKSU 1HAYB 4IMQA 4ZH8A 1NRQH 2FYQA 1C9TA 1Y5UT 3KQEA 2A4OA 3ZVEA 1V2ST 2HLCA 1TALA 5EXMA 1NRSH 2UWLA 1FIWA 1DITH 1IAUA 3DD2H 4LK4A 3BN9A 4I8GA 4KTUA 1ELBA 1C2IA 3K6YA 2ZDVH 2XRCA 1G3EA 1L1GA 3RM0H 6ESTA 1WQVH 5DKMA 2OINA 1QL9A 2BLWA 2VIVA 2QC2A 1VR1H 2OP9A 4WH8A 4OGYA 3A7YA 4JK5A 2W3IA 1CQQA 1YPGH 1RFNA 2FP7B 1GHXH 1UTPA 3MNSA 1JOUB 1ARBA 2TIOA 3RC5A 1BTZA 1EOJA 3HK6B 4JYUH 3U8OH 3SU5A 1SGIB 2OD3B 2P16A 2BDHA 2GX4A 3E1XB 3UNSA 2VIPA 1MH0A 2Q1JA 4FUGA 1ZR0A 1IQEA 5EW2H 3SV7A 1T4UH 3KCGH 3DT0H 3TITA 1QB1A 1SL3A 3ZZ4A 5AVDA 1FMGA 1OWJA 1TBRH 5E0GA 1YKTA 1LPZB 3HGPA 1DE7H 5SGAE 5E0HA 1BIOA 3OYPA 3PWBA 1O3DA 1RS0A 2PKSC 3K9XB 1O5CB 4ZROA 3ZZCA 2H9EH 4JZEH 3FP8E 4R8TB 1ANCA 1H8DH 4INLA 1RGQA 2V6NA 1BTHH 4FXGH 1GGDB 2ANYA 2QV1A 2BY5X 2TGDA 3M35A 1UCYK 1ELGA 2PGQB 1AN1E 4TY6A 2VIQA 3EQ0H 4AX9H 4AYYB 1K21H 2WPIS 3QO6A 1EP6A 4F49A 1G3CA 3GY4A 3A8BA 4MTBA 3ZZ9A 4CHAB 1HJAB 2BB4A 1TOCB 1OYTH 2V3OH 5HMAA 3FP6E 3KGPA 3SU4A 1QBNA 4FU9A 4U01A 4ABIA 1O2UA 1FI8A 1BMLA 1GJ8B 1LHGH 1ARCA 4Y6DA 1AKSB 2BY9X 1O35A 1EZXC 2AIQA 1QY6A 4I8HA 1K1NA 4NZLA 3SNBA 1L0ZA 1O2JA 1Z6JH 2BD3A 3O8BA 2UWOA 2A2XH 2XWBI 1GBLA 1F0RA 3SJIA 2EEKA 1BB0B 4FUEA 1F5LA 3E90B 2J94A 3P6ZB 1VITH 1GI1A 1EAWA 1PFXC 1MBQA 4WH6A 4AFQA 3GCHB 3QGJA 5JDUB 1CGIE 1AMHA 1SHHB 1TRNA 1GCDA 2VWOA 4TYDA 4O9VA 1GJCB 2EI8A 4MG3A 1F92A 4M7GA 4H6SB 1O3JA 5GWZA 1TIOA 1AGJA 2ZKSA 5E0JA 2A2QH 5EPNA 3G01A 1H9LB 4NWLA 4YT7H 3QX5H 1E38B 3RM2H 3B8JA 3P95A 2D26C 1OSSA 4INHA 1GBIA 1T32A 4ZHLU 1SBWA 1SGQE 1GBBA 1GL0E 4AYVB 4INKA 1PPEE 1CT2E 1AU8A 1HRTH 5B6OA 1EUFA 1P11E 1QA0A 3TLOA 4TPYA 3RXVA 2XC4A 3PO1C 5LGOA 1QFKH 4X6OA 1MTNB 1TA2A 2OBQA 3A85A 3A7XA 2ULLA 5ABWA 2OC7A 5EQSA 2IJOB 3GISB 5DP9A 1O2XA 1OWIA 4B2AA 2F9BH 4BTIB 3P8GA 1LMWB 3SJKA 3L3TA 1CT0E 1RIWB 4WMFA 4X1RU 2R2MB 2Y6TA 1F0TA 3TU7H 3ITIA 3RLYH 3P70B 1FZZA 4TWYA 2OLGA 5L2ZH 3RXDA 1Q3XA 1SVPA 1YPJH 5H4IB 3UWIA 1W2KH 4JZIA 4BNRA 1C2LA 1TAWA 2WV5A 5IYTA 2DE8A 3UR6A 3U8RH 1O2YA 2ZTXA 1PQ8A 4MPXA 4NIVA 4FVBA 4X6NA 1E34B 2VB0A 1OWEA 3MOCA 2A4GA 2NU1E 3B23B 2CF9H 1O3BA 2GT7A 1TX8A 1ZPBA 1W8BH 2STAE 3ATWA 4F4OC 4BTUB 5EODA 1FLEE 2GZ9A 2VIWA 1TWXB 1KXBA 2BX3A 4TY7A 1Z1IA 1C1QA 5JYIA 1GI6A 4FU8A 1AFEH 1QRZA 2BDYA 2ODPA 1YPKH 2BOKA 1HIAA 1SQOA 4YOGA 4O3UA 1IQHA 2W7UA 4ABEA 4O3TA 4NFFA 3SU3A 4PROA 1DICA 1KYNA 1PPCE 3F6UH 3SO3A 1AKSA 2GV6A 3ODDA 1MBMA 4YLUA 2HNTE 5DP5A 2AGIX 2PLXA 2PKAB 2UUFB 4BAQB 4K5ZA 4BXWA 1HFDA 1Y3YA 2VNTA 1TPSA 2QY0B 4KP0A 2K1QA 3RC4A 3SNCA 2BDCA 2UUKB 4YOIA 4OS5A 1GI9B 4GLYA 3SGBE 1V6DA 3SORA 1SI5H 2OC1A 3LJJA 2ZHFH 1DFPA 3F9GA 3MO6A 4AFSA 2ZHDA 1L2EA 1TMTH 2BM2A 1T8NA 1TMBH 1KIGH 1N6YA 4ABGA 3ZZBA 1AWFH 3A7WA 1SOZA 3HATH 1ANDA 2QF3A 1B7XB 2P8OB 5LPRA 1RTFB 2A5IA 5T6DA 3TJUA 1C2HA 1O3AA 3P17H 4NA9H 2GCTB 3BIVH 4WXVA 3W95A 1EB1H 2V35A 2YNBA 1TFXA 1L1NA 1A2CH 3A82A 3BIUH 1V2TT 1NFUA 4JCNA 2ZDMA 1Y3UA 4GUXA 3R3GB 1ELDE 1IQKA 1HAPH 2D8WA 1SFIA 2ZU4A 4WMEA 1XUIA 2OTVA 3RXMA 1GMCF 3A7ZA 1UJ1A 3TGIE 1SSXA 4GVUA 5A8XA 1P2MA 3ZZDA 2G5VA 3LGUA 3BTKE 1KLIH 4X6PA 2B5TB 1BRAA 4AGKA 5DP3A 4ZHAA 1O0DH 1TNJA 3PB1E 3MU5A 1V2UT 1C5UA 3ESTA 3UR9A 2BDAA 3V3MA 3S7KB 4XSKU 1V2VT 1EXFA 1GBCA 4YZUA 2P94A 2J34A 4TWWA 2OC0A 1SGTA 1T4VH 1OS8A 3UQVA 2GKVE 1ELCA 5CHAB 5C1UA 3DA9B 3OY5U 4OGXA 3GICB 1S85A 1ETRH 2XBXA 2ZFTA 1VITG 3TK9A 4UE7H 7ESTE 1WV7H 1WUNH 1G9IE 1P3EA 2HWLB 3N7OA 3PLPA 1O3GA 1QJ1B 1GJAB 1IHSH 2ZFSA 1YGCH 4VGCC 2G4TA 2BD7A 2NWNA 3NK8A 1AWHB 3DFJA 1PYTD 3AAUA 4UFDH 1VJAU 3M37A 9LPRA 2PGBB 3PMAB 3VB4A 3RXKA 1IQJA 1BT7A 2IPHA 3A88A 3GYMA 2Q6GA 4NCYA 2CHAC 4X1QU 3LIWA 2ZCHP 2FTMA 2FYRA 1HDTH 1LCYA 3W94A 2A1DB 4U30A 3KQBA 2FEQH 5EXNA 2ZGXH 2C8ZB 2GMTC 3IWMA 1X7AC 4DY7B 2O8MA 7LPRA 2F9OA 1UK2A 3GY8A 4BANB 3BG4C 1ORFA 2BXTH 5DPAA 1O2NA 1XUFA 2FTLE 2VWNA 2YOLA 4CRGA 1WAYB 1TE0A 2ZFPH 1TBZH 1NROH 2ZFRH 3PMHB 3GOVB 1J9CH 4KTSA 1GBAA 2PKAA 3AASA 3U98H 1Z7KA 4Q2KA 2A32A 2CGAA 1K22H 2FI3E 4I31A 4B73A 1BA8B 2PV9B 3EA7A 1ZHMA 2M5TA 4OS4A 1WYKA 2TPIZ 4O03A 3H7OA 3E6PH 2D2DA 3Q77A 2P93A 3UY9A 1JIMA 1S84A 2OC8A 4Q7YA 2JH0D 1L4ZA 3A86A 1MAXA 2ZF0H 4OS1A 1GJBB 2ZTYA 1EPTC 1XVMA 2ZU3A 1HLTH 1TMUH 1WTHD 2SGDE 2AMQA 5C20A 1ZRBA 4NGAH 1P2QA 4ABFA 5DJ7A 1AQ7A 3M36A 4X6MA 1XXDA 1HAIH 5F6MA 1GCTB 3PLBA 1PPZA 4XE4A 2BD5A 2FS9A 3NPSA 1K1PA 1JXPA 1NFXA 1NPMA 3ATIA 2UUYA 1TGBA 4JZDH 3LU9B 3LGVA 1TNIA 1P09A 4A92A 1E35B 1S82A 2ZQ2A 1A0JA 2CN0H 2FMJA 1J14A 2Y5GA 5A0BA 2FOAA 1MD7A 1MUEB 1ZPCA 4DURA 2FWWA 1BJUA 3EE0B 1GBKA 1GHAG 1SGYE 3ATLA 1CGHA 1HAXB 3LOXA 1GMHF 4IW4E 3M61U 4CREA 8LPRA 1O2LA 2TGPZ 1GBHA 2Z94A 1C1VH 1GDNA 1O3NA 3CS0A 3STJA 3O8CA 2ZECA 3A8CA 4FUCA 3SZNA 3SI3H 1EJNA 2PTNA 2ZPQA 5FX6A 4X8UH 1GMDG 1TGSZ 5GXPA 2VVUA 1LQDB 2NU4E 4AG2A 2ZO3H 1LVOA 4FUHA 5PTPA 1MKWK 1YCPK 4Z0KA 3LGTA 1UTNA 2ZTZA 1TQ0B 2JKHA 4AB8A 1GJ6A 2CMYA 3GDVA 3LH3A 1C9PA 1W7GH 4I33A 2BVSH 3BTDE 1EASA 1FY5A 3LGIA 2XBWA 3RP2A 1A1RA 3VGCB 3EA9A 4DCDA 1SGFG 4D9QA 4JZ1A 1MTSA 1NM6A 1AD8H 3JZ2B 1JMOH 3LC3A 1YPHE 4ISIH 4D7FA 3GY6A 2HGTH 1C5YB 3CENA 3MU4A 5G4BA 1QBVH 4AORA 3M3TA 1VJ9U 4E06H 1ELEE 1SLXB 4DT7B 3LONA 2QCYA 2GT8A 3UFAA 1TGNA 1DSUA 2XWAA 5IDKA 2Y5HA 1C1PA 1BBRH 1J16A 1O2OA 1Y5AT 2R0KA 1DXWA 2HVXA 2XC5A 2BD2A 1ZMJA 3FZZA 2H6MA 1AB9B 1O3CA 1TPAE 1HUTH 1N8OB 1NRNH 1C1MA 4X8SH 1Z1JA 4ZMAH 1ABJH 2GGVB 1MKWH 3SNEA 3D23A 1BRCE 2DUCA 3F68H 4UEHH 1C2DA 1O3PB 1ZMNA 1HNEE 3PROA 2BY6X 1QJ6B 4HGCA 4ZKNU 3M7TA 3V12A 1DLEA 4NIXA 3SN8A 3TK5A 2B0FA 1BCUH 2Y81A 2ZIQH 1MU8B 3PYHA 1KTSB 4Q7XA 1EX3A 1P02A 5HYOA 1V2KT 1LVYA 4MNYA 2QN5T 1C2KA 4XDEA 3IITA 4B2CA 2IOTA 4JZFH 1QBOA 5DP4A 2HOBA 4D8NA 1QNJA 1IQNA 1SB1H 2G5NA 4AFZA 1CGJE 3SGAE 3CS7A 1OPHB 1V2QT 4Y0ZE 1BQYA 2ZU2A 3TNTA 1GHAF 2H9HA 1J15A 1SLUB 2CXVA 4X8TH 4IBLH 1A5IA 2JETC 1HIAB 2UWPA 2O8LA 1C5RA 1EJMA 4VGCB 3SW2B 3TPIZ 2RA0A 3LJOA 2VGCC 2IN2A 1GHBF 4K3JA 2A5AA 4ZHMU 2OBOA 1O2QA 1QRXA 1JRSA 3FZDA 3RMOH 4X2VA 2A7CA 1WTGH 3S9AA 1UVPA 2CHAB 1IQIA 6GCHG 4CBOA 2Y80A 2EI7A 1O2PA 3MO9A 2JH6D 2HNTC 2G81E 2PHBA 4CBNA 1C2JA 5EG4A 2QGRA 1YPLH 1FAXA 5EU8A 1UMAH 4K69A 1GJ5H 1Y5BT 3D49H 1JIRA 3T62A 3BTME 3VEQB 1S6FA 3WY8A 3VFEA 3HKJB 1ZSJA 1FAKH 1HBTH 1UCYH 4I8KA 1UTQA 2A5KA 1FV9A 5DO4H 1SQTA 5E8EH 1YPMH 1DWEH 5I25A 1YCPM 3HPTB 2FLBH 2ZGBH 4X8VH 4I8LA 3KIDU 5T6GA 1L4DA 1KDQB 1TYNA 2Z6BD 2FLRH 1D3TB 1CA0C 2B7DH 1O2RA 3BTGE 3TJOA 4ISOA 1F5RA 3LKWA 4ISHH 1GG6C 3BTEE 1NS3A 4A5TS 4OS2A 4B75A 1KXDA 1WQSA 2QYIA 1PPFE 2RDLA 2ZEBA 1KXAA 2SGFE 1TNGA 2ZHEH 3U9AH 1QB9A 3ZVCA 4DJZB 1ZJKA 5TJXA 1BDAA 4ZUHA 1P8VC 2P3UB 1UTMA 1C5OH 5TCCA 1MTUA 1ZZZA 3OTJE 3RMMH 1BRUP 1M9UA 4Y11E 2BQWB 4WJG2 2W7SA 2THFB 3I78A 1SGCA 1H9HE 1LVBA 3UOPA 1NTPA 1DX5M 4B71A 5GIBA 4E05H 1AFQC 2ZI2H 1H4WA 3K6ZA 2VH6A 1SPJA 5FCRA 5C2ZA 5ESTE 1VGCB 3RMLH 3BF6H 4XBCA 2J38A 4NG9H 2ZU1A 3TGKE 1XM1A 4NA8A 1D9IA 1G37A 3ZVDA 2GCHG 3SQEE 3TH2H 1AVWA 2R0LA 3TH4H 4AGJA 2WUBA 4D7GA 3DHKH 2I6SA 2BHGA 3MYWA 5C5NA 1BTWA 3AAVA 3T27A 2Z9LA 1HXEH 4B76A 1O5DH 1O2TA 4HTCH 1EQ9A 4FU7A 3SU0A 2H9TH 3M3VA 1EAIA 1KXCA 1O3EA 2Q6DA 2VWLA 5AFZH 2XC0A 3FAOA 1K1JA 4BAHB 3LC5A 3MO3A 4KELA 4H6TA 1W12U 2WPHS 1BBRE 1CO7E 3E0NB 1S0QA 3B9FH 3OU0A 3M7QA 2BQ6B 3H5CB 4GCHG 1K1IA 2I6QA 3FVFB 1SMFE 3RXHA 1HV7A 2TGTA 4Z6AH 4Q80A 1FY8E 1SLVB 3ZZAA 2ESTE 1MMJN 1P57B 1TRMA 1SGDE 1GVLA 2G4UA 2A0QB 5JPMH 1K9OE 2EI6A 1H9IE 1EAUA 2VINA 1V2PT 1P12E 2ANKH 5T3HA 4DOQA 1O38A 1ZMLA 5A0CA 1QL7A 4JYVH 1Z8GA 3RXEA 1O5AB 3MH4A 2F91A 1LHFH 1OWKA 4X2WA 2AH4X 2FOFA 4YTAA 4YT6H 2VJ1A 1O3LA 3KN2A 2BDGA 4CRAA 3E3TA 5F03A 2AMDA 1MZAA 2Y7XA 4RKJB 1XUJA 5LPEA 1GJ9B 2Y7ZA 3ZVAA 2FXRA 4JMYA 3KHVA 3ZZ7A 1Y3VA 2P59A 2AGGX 1C5WB 3RLWH 2VWMA 3UUZA 2R3YA 3SV9A 1V2WT 2AS9A 3SU1A 3QLPH 1YYY1 3LDXH 2ZCLP 1LPKB 3HKIB 3RMNH 1CBWC 4IC6A 5LPFA 3UREA 2BLOA 1O30A 1TLDA 5A2MH 3MNCA 1RRKA 2AMPA 2FOHA 1DWDH 4LXBH 1WCZA 4ZXYH 5A8ZA 3URDA 5EQQA 2PKSB 1GHZA 1KDQA 2VH0A 4AN7A 3FFGA 3EDXB 2XBYA 3GCTG 2BVXH 1GVZA 2Z3DA 1OX1A 2Z9JA 1O3FA 1D3PB 1W7XH 3PTNA 5AHGH 2ODYB 1PPGE 3S7HB 1P2NA 2BY8X 1AE8H 3U1JB 1D3DB 2QIQA 2TBSA 2ZDLA 4DW2U 1PJPA 2ZC9H 2FOCA 1NZQH 1K2I1 2SFAA 1BOQA 1G3BA 8GCHG 1G30B 3D65E 4A1TA 3OY6U 5C5OA 1QTFA 2A4QA 1UCYE 4K2YA 3NKKA 4NZQA 1C4V2 3PMJA 2Z9IA 1ZTKA 3SNDA 2O9QA 1C5ZB 1RD3B 3ENSB 1N6XA 1NO9H 4X1PU 3SBKA 3SGQE 1S81A 5C3NA 3QZRA 2BXUH 1MU6B 1YP9A 1U6QA 1DOJA 3KF2A 2V3HH 1O39A 2XCFA 4GCHF 1Z8RA 3EGKH 4CR5A 3F9FA 3R0FA 4X2XA 1UTLM 3MTYA 1O2KA 3SJ8A 3ZZ3A 1ZSKA 2TRMA 2WYGA 1LQEA 2PWXA 4Q7ZA 3GCNA 3RXLA 1C2GA 1HAOH 1C5XB 3GY3A 2D1JA 2ZDKA 1GGDC 1C2MA 1O5EH 2TGAA 3LPRA 3C1KA 2Q6FA 5GJ4B 3ATKA 1HYLA 3GY2A 2WPKS 4YOJA 3A80A 1QR3E 4BAKB 1THRH 4HZHA 3ZV9A 1MZDA 3ZYEA 1YPHC 1QURH 1FJSA 1C1UH 1P9UA 4ZKRU 4CHAC 1HJAC 2OUAA 2VIDA 2FPZA 1PQ5A 2ZFFH 4AB9A 1P03A 1O2WA 4NSYA 1O31A 2GDDA 1BMMH 4IN1A 2ZP0H 1JWTA 3DFLA 1CA0B 3M5MA 3MH5A 4U2WA 2F9UA 1BTPA 4D9RA 1WBGB 1W0ZU 4YO9A 1HB0B 3SU2A 4RN6A 1BUIA 1YPEH 1E0FD 2BZAA 3BSQA 2ZA5A 1G2MA 1MCVA 1MKXK 4WXIA 1TBQH 3PO1B 3M7UA 3EYDA 5J4SA 1PYTC 3PMBB 8KME2 1FONA 1OWDA 1ABIH 1ELTA 2AIPA 3U8TH 3M5NA 1T7CA 1GI2A 1DUEA 3MH6A 2ZDNA 4Y8YA 2ZZUH 2R3UA 9ESTA 2HNTF 4A6LA 1A0HB 1HAZB 1P01A 2CF8H 2WINI 2SNVA 5DP6A 2AERH 3LH1A 1LKBA 3GCTF 4ABHA 1EB2A 1AFQB 3BTWE 4H4FA 1P3CA 3SU6A 5T6FA 1QHRB 2PUQH 2G00A 2ZGCA 1AVGH 1C5TA 1Z6EA 2EC9H 1ZOMA 2FI4E 1HCGA 1VCPA 3RC6A 4RSPA 5FPTA 1HGTH 4ABAA 8GCHF 2CV3A 1DVAH 1BTYA 2PW8H 4QT8C 1J17T 1EAXA 1NN6A 1F0UA 1BTUA 3OSYA 3P92A 4WVPE 1C1OA 5L2YH 1HPGA 5EXLA 3TH3H 3RXPA 1XXFA 2Z7FE 2QA9E 1MTNC 1KXFA 1SGRE 3Q3XA 4KGAA 1S0RA 3SV8A 1MTVA 1UTKA 1O2SA 3Q76A 2OXSA 3U1IB 1IQLA 1ZJDA 3FP7E 4WY3A 1GHVH 4Y7BA 1RXPA 1NRRH 5C1XA 3NZIA 2LNCA 1IQGA 2SGEE 5C1YA 4LZ4B 2QAAA 4JK6A 1DUAA 3A8DA 1AUTC 1VITF 2ZHWH 1LO6A 1DY8A 1HJ9A 1CE5A 1FUJA 1YLCA 2OQUA 3QN7A 4ISLA 2ZU5A 3AW0A 5AFYH 4FVDA 3P8NA 5DG6A 4E7NA 4KKDA 1FDPA 2A45B 1DS2E 2GD4B 2RCEA 4THNH 1SGNE 2G51A 1ANBA 1O3HA 1P06A 5FPYA 1OP8A 1TGCA 4X0WU 4K8BA 5EPYA 1FNIA 1OKXA 1QL8A 1AHTH 4O97A 1NT1A 1GBTA 2C4FH 4IS5A 2A4RA 4K1EA 3RUOA 4BXSA 1C5NH 4UDWH 2BTCE 3BTFE 5F8ZA 1TNKA 1KLTA 2F9PA 1AY6H 3UWJH 1GWAA 3O8RA 1Q2WA 2SGPE 3RDZA 1UTOA 1W10U 2XCNA 2ZHQH 1S5SA 3SNAA 2RG3A 4Y0YE 2HALA 1DWCH 1KTTB 4AZ2B 5FXLA 3NUMA 2XXLA 1MQ6A 3BEFB 1O2VA 3BTQE 3A8AA 1OP0A 2ALVA 3LGWA 4WF8A 4XBBA 2F9VA 3U69H 4DVAU 1CBWB 4B74A 2P95A 3A7TA 3SV2H 3P8FA 3ZVFA 2HPQH 2ZFQH 1CT4E 4LOYH 1G2LA 1MCTA 4BAMB 1ZTJA 2VU8E 5JBTA 1T31A 3V13A 1EATA 4Y10E 5FBIA 4CR9A 5DK1A 2QXIA 3QTOH 3NCLA 2OCVB 3Q00A 3QTVH 2O8WA 1XKBC 1O37A 2J2UA 3LT3A 4MPVA 3SUEA 3SUFA 4X1NU 1UTJA 4GSOA 1YCPH 1ZRKA 3RXJA 1TRYA 1LTOA 3ZVBA 3A89A 3SUDA 1Y3WA 2BMGB 3HGNA 4A1VA 2QXHA 3ATMA 1BJVA 3BV9B 3SUGA 2GDEH 4OS6A 6LPRA 1DM4B 1QA7A 3ZYDA 4E7RG 1EZQA 1IQFA 5J4QA 1C5SA 1A3BH 1FQ3A 3RXGA 4GHQA 7GCHG 1O2HA 1O3MA 1THSH 2P8OC 1C1WH 1MQ5A 2SGAA 3I29A 3VXEH 4DIIH 1G32B 1A0LA 3PTBA 2FOBA 5TCAA 2BD8A 1UVSH 2FM2A 3T25A 1XKAC 1GI7B 1IHTH 2O8UA 2GCTC 1GBEA 1GDQA 1QIXB 1DSTA 1C2EA 1INCA 2BLVA 1QB6A 1CSOE 1LHCH 1TPPA 1NU7B 2NU0E 3VB3A 2Z3CA 4Y71A 4IGDA 4UD9H 3SV6A 1RTLA 1QJ7B 1TX6A 1YF4A 2FI5E 1O34A 1C5PA 1GVKB 2ZCKP 2G52A 1LPGB 1BITA 1DLKB 1TB6H 1XUKA 1GMDF 1YC0A 1UK3A 4CRDA 1GBFA 1NU9A 1W0YH 4K60A 1J8AA 2FOMB 1DY9A 1O5BB 1V2MT 1Y8TA 1O3IA 4K8YA 1TPOA 7KMEH 1SOTA 2F83A 5JBCS 1E37B 3F9HA 3L33A 4MLFB 3AW1A 5E2OA 1A7SA 1BMAA 3S9CA 4UFEH 1XX9A 3EAJA 4MPWA 1D4PB 4Y79A 1QCPA 1OOKB 1TOMH 4J1YA 2ASUB 1CA8B 2H2ZA 2P3FH 2GMTB 2ZPRA 3BG8A 4YM9A 1V2LT 3SOSA 3BG4B 1EOLA 3GYLB 5AF9H 3PWCA 5CHAC 2C8XB 4K1SA 2F3CE 5EOKA 1N1LA 1CHOG 1CVWH 3M5LA 5FAHA 1ANEA 5HM9A 3URCA 1G3DA 5L30H 5BPEA 1F2SE 3LGYA 4I32A 1YBWA 5HM2A 3TGJE 1T8MA 1FN8A 1ZPZA 5CMXH 1AZ8A 8ESTE 3ZZ8A 1ZLRA 5FPSA 1HAVB 4XFQA 4RKOB 2XNIA 4MVNA 2C93B 1BHXB 1QRWA 4FUJA 3A83A 2BOHB 1ELFA 2ODQA 5I46H 1EPTB 2A7JA 1D3QB 1SG8B 2EA3A 1NC6A 1C4U2 2HPPH 1SHYA 5GDSH 1QGFA 2WPMS 1UHBB 1C1SA 1PQAA 3BEUA 1ZTLA 2C8YB 4Y7AA 1TABE 1DWBH 1A3EH 1OYQA 4AOQA 3BEIB 1HAGE 1UK4A 2SNWA 1F0SA 1W13U 4ZKOU 2BX4A 5BRRE 1GJ7B 1NFYA 5DGJA 2BLQA 3SJ9A 1SC8U 1LHEH 3MH7A 3TK6A 2PTCE 2GV7A 7GCHF 4YESB 4CRFA 2ANWA 1Z8IB 1OXGA 1VZQH 1B0FA 2PR3A 1OP2A 1LVMA 1TNLA 1F7ZA 1XMNB 3VB5A 4TPIZ 5F8XA 2GZ8A 1TNHA 2FZZA 1PQ7A 1WOFA 4MNXA 5EGMA 1GDUA 1O5GH 3VB7A 5GCHG 2FDAA 4YLQH 3T26A 2G55A 6CHAC 2G8TA 1SGFA 4BTTB 1O2ZA 1TX7A 3D62A 4SGBE 3T5FH 4GHTA 3MFJA 1FPHH 3RXUA 5A09A 1GMCG 4UFGH 1GI5A 2WPJS 1BHXF 3MMGA 2FOGA 3QK1A 1MTWA 1VCWA 4J2YB 1P05A 3QDZB 3V0XA 5ETXA 1IOEA 1HXFH 5HXFA 3TJVA 1AO5A 6GCHF 3RXAA 2BDIA 1O36A 2WYJA 4LZ1H 1GCTC 2W3KA 5K7RA 1TA6A 4NSVA 3TJNA 3ZVGA 2GTBA 2ZGJA 3SHAH 2H5DA 2VVCA 4CRCA 1V2RT 4AG1A 5FHTA 2B9LA 5E2PA 2FX6A 1GPZA 2R2WU 4UONA 4BAOB 2ZWLH 4FUBA 5ESBA 4OS7A 4ZXXH 2ALPA 3VXFH 1CHOF 1O5FH 1D6WA 4SGAE 5FX5A 3A87A 2C8WB 2PFEA 3RXIA 1P2KA 2ZPSA 1UO6A 1EKBB 2GVFA 2XW9A 1ZGVA 2NU2E 1XVOA 1LKAA 1GI8B 1VCQA 1A5HA 1V2OT 1GBMA 2BYAX 1A4WH 1GL1A 3A84A 2BD4A 3E8LA 3T29A 1EJAA 4HFPB 4MDSA 1FY3A 1P0SH 1FY4A 1P2IA 1BRBE 1GI4A 1D6RA 2WPLS 1PPHE 3GY7A 3KEEA 4H42U 1FXYA 1MAYA 2AGEX 3F9EA 3AVZA 2PSXA 4ABDA 3VGCC 1K1OA 2STBE 2PSYA 1BMNH 4ZAEA 4Y8ZA 1UVUH 1Y59T 1V2JT 1ZYOA 5HGGA 1GJDB 3EA8A 3ZZ6A 2O8TA 1CHGA 3RXSA 1L1JA 3ELAH 5F8TA 1H1BA 2PUXB 1P10A 3MWIU 4NIWA 3VB6A 4DG4A 3A81A 1HAVA 2XBVA 1C5MD 2QF0A 5C67A 2A31A 2BQ7B 2DE9A 3DUXH 2FX4A 4IC5A 4UFFH 2AFQB 1EPTA 3RU4D 3SHCH 1K28D 1DPOA 2KAIB 2J95A 3JZ1B 5FBEA 1P2OA 2GCHF 1O3OA 1SGPE 1LHDH 1LDTT 1UHBA 1ZHPA 4AFUA 1WSSH 2FO9A 4Y8XA 5GCHF 2WUCA 3UNQA 3GY5A 4CH2B 2Y5FA 4DIHH 5CE1A 2JETB 1AB9C 5DP7A 1NFWA 2YNAA 1N8OC 3S9BA 1A46H 1XUHA 1TONA 1Y3XA 1NY22 3NWUA 4DGJA 1RTKA 1FY1A 3E0PB 2VGCB 1RJXB 3HK3B 5DP8A 1Z8JB 3BTTE 3T28A 1FPCH 1ESBA 1GJ4H 2Z9GA 1P04A 1FN6A 1ZGIA 3S69A 3RXRA 2F9NA 1ZSLA 4A1XA 1SR5C 1W11U 3L6PA 2J4IA 1KLJH 3KQDA 1KSNA 3ODFA 2BZ6H 3SI4H 3UNRA 3MNBA 1SGEE 1T8OA 3FANA 1GBJA 2Z3EA 1UVOA 1HJ8A 1YM0A 4GPGA 4ABBA 1KY9A 1B5GH 1GBDA 1TQ7B 2FIRH 2WV4A 2ZDAH 3TNSA 3C27B 4WWYA 3O8DA 5JB9S 3H7TA 4K1TA 1DANH 1GMHG 1Z71A 1S83A 2Y82A 3MNXA 1ZHRA 2FESH 1SFQB 1WU1A 3F1SB 3UPEA 4FUDA 2JH5D 1ELVA 3PV4A 4I8JA 2V0BA 3RXFA 1ETSH 2H5CA 5FCKA 1BZXE 3QWCH 3K2UA 5JBAS 1DDJA 1GG6B 1QQ4A 2R9PA 3VPKA 1GHWH 5JBBS 2BY7X 1THPB 2QXGA 4B1TA 2OQ5A 1C5VA 1SLWB 4MQAA 1ETTH 4NFEA 2GZ7A 2XTTB 3S0NA 5EW1H 2ZNKH 2BDBA 1IQMA 2QXJA 1AUJA 5L6NH 5GPIB 4ASHA 1K1MA 3GCHC 4I7YH 4B2BA 3E16B 1C2FA 2RA3A 4U32A 2ILNA 2H1UA 3GDSA 3SQHE 2W5EA 4JYTA 5A8YA 2FODA 1AE5A 3T2NA 1O2MA 2VVVA 3GCOA 3M5OA 1P9SA 3MHWU 1AZZA 1ESAA 3V7TA 1DXPA 3UIRA 3RXBA 4NA7A 3Q3YA 2LPRA 3PLKA 3KQCA 1ID5H 1AIXH 2VIOA 3QGNB 1EZSC 1G36A 1HAHH 1H8IH 1W14U 3TIUA 2FS8A 1GI0A 1SQAA 2BVRH 1OWHA 3PM3A 2P3TB 4MPUA 3IG6B 2UUJB 1NRPH 6CHAB 1O33A 2XYAA 1GHYH 2B8OH 5A0AE 3QUMP 1C5QA 1C4Y2 3K65B 3SJOA 3GDUA 1C1NA 4XOJA 3RXOA 2ANMH 2GP9B 1KXEA 2SGQE 1E36B 1MKXH 1MD8A 1O3KA 1C1RA 4CH8B 1F5KU 1QQUA 1T8LA 3ZZ5A 1A5GH 3A7VA 5LH8A 3RXQA 1B0EA 2AYWA 1P2JA 4KTCA 1O2GH 4FUFA 3NXPA 1EZUC 1W3CA
chains in the Genus database with same CATH superfamily
1Q31A 1RIWC 1YLDA 2KAIA 2KCPA 4D76A 3RXCA 1CU1A 1NBMD 1UVTH 4RI0A 1BTXA 1PPBH 3ZV8A 3TVJB 4Y76A 2FOEA 3M3SA 4NIYA 4ESTE 4FUIA 4ABJA 2NU3E 1DT2A 2W26A 1AVXA 3STIA 3MU0A 1JRTA 1ELAA 2ZQ1A 3MU8A 4NWKA 4A7IB 1VGCC 2J92A 3CP7A 1ESTA 3RU4E 4MNWA 1EP5A 3MI4A 5K0HA 3RU4T 1V2NT 4CRBA 3I77A 1BBRK 2BD9A 2A7HA 4GAWA 4R0IA 3UQOA 3KL6A 1C1TA 2WV9A 3E91A 2HRVA 2CJIA 1O32A 1O2IA 1C5LH 1TGTA 3P8OA 4Q4LA 3KNXA 4X1SU 2ZG0H 1GI3A 4HI3A 2AEIH 1GHBG 3Q3KA 3RXTA 3UTUH 2C3SA 1W0KD 1A61H 1JBUH 1V3XA 4X2YA 5JB8S 1ACBE 3QZQA 4WMDA 4ISNA 1NESE 1AI8H 3OX7U 1S6HA 2ZGHA 5EQRA 1K1LA 2C90B 1BMFD 1XUGA 4IN2A 3UOUA 3BTHE 4IMZA 1FIZA 4MNVA 4XBDA 4BOHA 2Z9KA 2J9NA 3MU1A 4ZKSU 1HAYB 4IMQA 4ZH8A 1NRQH 2FYQA 1C9TA 1Y5UT 3KQEA 2A4OA 3ZVEA 1V2ST 2HLCA 1TALA 5EXMA 1NRSH 2UWLA 1FIWA 1DITH 1IAUA 3DD2H 4LK4A 3BN9A 4I8GA 4KTUA 1ELBA 1C2IA 3K6YA 2ZDVH 2XRCA 1G3EA 1L1GA 3RM0H 6ESTA 1WQVH 5DKMA 3OE7D 2OINA 1FX0B 1QL9A 2BLWA 2VIVA 2QC2A 1VR1H 2OP9A 2V3MA 4WH8A 4OGYA 3A7YA 4JK5A 2W3IA 1CQQA 1YPGH 1RFNA 2FP7B 1GHXH 1UTPA 3MNSA 1JOUB 1ARBA 2TIOA 3RC5A 1BTZA 1EOJA 3HK6B 4JYUH 3U8OH 3SU5A 2JDID 1SGIB 2OD3B 2P16A 2BDHA 2GX4A 3E1XB 3UNSA 2VIPA 1MH0A 2Q1JA 4FUGA 1ZR0A 1IQEA 5EW2H 3SV7A 1T4UH 3KCGH 3DT0H 3TITA 1QB1A 1SL3A 3ZZ4A 5AVDA 1FMGA 1OWJA 1TBRH 5E0GA 1YKTA 1LPZB 3HGPA 1DE7H 5SGAE 5E0HA 1BIOA 3OYPA 3PWBA 1O3DA 1RS0A 2PKSC 3K9XB 4M9FA 1O5CB 4ZROA 3ZZCA 2H9EH 4JZEH 1COWD 3FP8E 4R8TB 1ANCA 1H8DH 3SYJA 4INLA 1RGQA 2V6NA 1BTHH 4FXGH 1GGDB 2ANYA 2QV1A 2BY5X 2TGDA 3M35A 1UCYK 1ELGA 2PGQB 1AN1E 4TY6A 2VIQA 3EQ0H 4AX9H 4AYYB 1K21H 2WPIS 3QO6A 1EP6A 4F49A 1G3CA 3GY4A 3A8BA 4MTBA 3ZZ9A 1E1RD 4CHAB 1HJAB 5C17A 2BB4A 1TOCB 1OYTH 2V3OH 3F2GA 3FP6E 3KGPA 5HMAA 1QBNA 3SU4A 4FU9A 4U01A 4ABIA 1O2UA 1FI8A 3MQKC 1BMLA 1GJ8B 1LHGH 1ARCA 4Y6DA 1AKSB 2BY9X 1E79D 1O35A 1EZXC 2AIQA 1OHHD 1QY6A 3WWBA 4I8HA 1K1NA 4NZLA 3SNBA 1L0ZA 1O2JA 1Z6JH 2BD3A 3O8BA 2UWOA 2A2XH 2XWBI 1GBLA 1F0RA 3SJIA 2EEKA 5T1VA 4B6FA 1MABB 1BB0B 4FUEA 1F5LA 3E90B 2J94A 3P6ZB 1VITH 1GI1A 1EAWA 1PFXC 1MBQA 4WH6A 4AFQA 3GCHB 3QGJA 5JDUB 1CGIE 1AMHA 1SHHB 1TRNA 1GCDA 2VWOA 4TYDA 4O9VA 1GJCB 2EI8A 4MG3A 1F92A 4M7GA 4H6SB 1O3JA 5GWZA 1TIOA 1AGJA 2ZKSA 5E0JA 2A2QH 5EPNA 3G01A 1H9LB 4NWLA 4YT7H 3QX5H 1YWUA 1E38B 3RM2H 3OAAD 3B8JA 3P95A 2D26C 1OSSA 4INHA 1GBIA 1T32A 4ZHLU 1SBWA 1SGQE 1GBBA 1GL0E 4AYVB 4INKA 1PPEE 1CT2E 1AU8A 2V7QD 1HRTH 5B6OA 5KEDA 1EUFA 1P11E 1QA0A 3TLOA 4TPYA 3RXVA 5FL7D 2XC4A 3PO1C 5LGOA 1QFKH 3OEHD 4X6OA 1MTNB 1TA2A 2OBQA 3A85A 3A7XA 2ULLA 5ABWA 2OC7A 5EQSA 2IJOB 3GISB 5DP9A 1O2XA 1OWIA 4B2AA 2F9BH 4BTIB 3P8GA 1LMWB 3SJKA 3L3TA 1CT0E 1RIWB 4WMFA 4X1RU 2R2MB 2Y6TA 1F0TA 3TU7H 3ITIA 3RLYH 3P70B 2LP6A 1FZZA 4TWYA 2OLGA 5KGOA 5L2ZH 3RXDA 1Q3XA 1SVPA 1YPJH 5H4IB 3UWIA 1W2KH 4JZIA 4BNRA 1C2LA 1TAWA 2WV5A 5IYTA 2DE8A 3UR6A 3U8RH 1O2YA 2ZTXA 1PQ8A 4MPXA 4NIVA 4FVBA 4X6NA 1E34B 2VB0A 1OWEA 3MOCA 2A4GA 2NU1E 3B23B 2CF9H 1O3BA 2GT7A 1UW7A 1TX8A 1ZPBA 1W8BH 2STAE 3ATWA 4F4OC 4BTUB 5EODA 1FLEE 2GZ9A 2VIWA 1TWXB 1KXBA 2BX3A 4YXWD 4TY7A 1Z1IA 1C1QA 4I86A 5JYIA 1GI6A 4FU8A 1AFEH 3GS9A 1QRZA 2BDYA 2ODPA 1YPKH 2BOKA 1HIAA 1SQOA 4YOGA 4O3UA 1IQHA 2W7UA 4ABEA 4O3TA 4NFFA 3SU3A 4PROA 5CHBA 1DICA 1KYNA 1PPCE 3F6UH 3SO3A 1AKSA 2GV6A 3ODDA 1MBMA 4YLUA 2HNTE 5DP5A 2AGIX 2PLXA 2PKAB 2UUFB 4BAQB 4K5ZA 4BXWA 1HFDA 1Y3YA 2QF4A 2VNTA 1TPSA 2QY0B 4KP0A 2K1QA 3RC4A 3SNCA 2BDCA 2UUKB 4YOIA 4OS5A 1GI9B 4GLYA 3SGBE 1V6DA 3SORA 1SI5H 2OC1A 3LJJA 2ZHFH 1DFPA 3F9GA 3MO6A 4AFSA 2ZHDA 1L2EA 1TMTH 2BM2A 1T8NA 1TMBH 1KIGH 1N6YA 4ABGA 3ZZBA 1AWFH 3A7WA 1SOZA 3HATH 1ANDA 2QF3A 1B7XB 2P8OB 3FOAA 5LPRA 1RTFB 2A5IA 5T6DA 3TJUA 1C2HA 1O3AA 3P17H 4NA9H 2GCTB 3BIVH 4WXVA 3W95A 1EB1H 2V35A 2YNBA 1TFXA 1L1NA 1A2CH 4TSFD 3A82A 3BIUH 1V2TT 1NFUA 4JCNA 2ZDMA 1Y3UA 4GUXA 3R3GB 1ELDE 1IQKA 1HAPH 2D8WA 1SFIA 2ZU4A 4WMEA 1XUIA 2OTVA 3RXMA 1GMCF 3A7ZA 1UJ1A 3TGIE 1SSXA 4GVUA 5A8XA 4AC9A 1P2MA 3ZZDA 2G5VA 3LGUA 3BTKE 1KLIH 4X6PA 2B5TB 1BRAA 4AGKA 5DP3A 4ZHAA 1O0DH 2JJ1D 1TNJA 3PB1E 3MU5A 1V2UT 1C5UA 3ESTA 3UR9A 2BDAA 3V3MA 3S7KB 4XSKU 1V2VT 1EXFA 1GBCA 4YZUA 2P94A 2J34A 4TWWA 2OC0A 1SGTA 1T4VH 1OS8A 3UQVA 2GKVE 1ELCA 5CHAB 5C1UA 3DA9B 3OY5U 4OGXA 3GICB 1S85A 1ETRH 2XBXA 2ZFTA 3FN8A 1VITG 3TK9A 4UE7H 7ESTE 1WV7H 1WUNH 1G9IE 1P3EA 2HWLB 3N7OA 3PLPA 1O3GA 1QJ1B 1GJAB 1IHSH 2ZFSA 1YGCH 4VGCC 2G4TA 2BD7A 2NWNA 3NK8A 1AWHB 3DFJA 1PYTD 3AAUA 4UFDH 1VJAU 3M37A 9LPRA 2PGBB 3PMAB 3VB4A 3RXKA 1IQJA 1BT7A 3OTPA 2IPHA 2WPDD 3A88A 3GYMA 2Q6GA 4NCYA 2CHAC 4X1QU 3LIWA 2ZCHP 2FTMA 2FYRA 1HDTH 1LCYA 3W94A 2A1DB 4U30A 3KQBA 2FEQH 5EXNA 2ZGXH 4P02A 2C8ZB 2GMTC 3IWMA 1X7AC 4DY7B 2O8MA 7LPRA 2F9OA 1UK2A 3GY8A 4BANB 3BG4C 1ORFA 2BXTH 5DPAA 1O2NA 1XUFA 4ASUD 2FTLE 2VWNA 2YOLA 4CRGA 1WAYB 1TE0A 2ZFPH 1TBZH 1NROH 2ZFRH 3PMHB 2EQNA 3GOVB 1J9CH 3UAIC 4KTSA 1GBAA 2PKAA 3AASA 3U98H 1Z7KA 4Q2KA 2A32A 2CGAA 1K22H 2FI3E 4I31A 4B73A 1BA8B 2PV9B 3EA7A 1ZHMA 2M5TA 4OS4A 1WYKA 2TPIZ 4O03A 3H7OA 3E6PH 2D2DA 3Q77A 2JJ2D 2P93A 3UY9A 1JIMA 1S84A 2KR7A 2OC8A 4Q7YA 2JH0D 1L4ZA 3A86A 4XD7D 1MAXA 2ZF0H 4OS1A 1GJBB 2ZTYA 1EPTC 1XVMA 2ZU3A 1HLTH 1TMUH 1WTHD 2SGDE 2AMQA 5C0TA 5C20A 1ZRBA 4NGAH 1P2QA 4ABFA 5IK2D 5DJ7A 1AQ7A 3M36A 4X6MA 1XXDA 1HAIH 2KX4A 5F6MA 1GCTB 3PLBA 1PPZA 4XE4A 2BD5A 2FS9A 3NPSA 1K1PA 1WDIA 1JXPA 1NFXA 1NPMA 3ATIA 2UUYA 1TGBA 4JZDH 3LU9B 3LGVA 1TNIA 1P09A 4A92A 1E35B 1S82A 2ZQ2A 1A0JA 2CN0H 2FMJA 1J14A 5KECA 2Y5GA 5A0BA 2FOAA 1MD7A 1MUEB 1ZPCA 4DURA 2FWWA 1BJUA 3EE0B 1GBKA 1GHAG 1SGYE 3ATLA 1CGHA 1HAXB 3LOXA 1GMHF 5C94A 4IW4E 3M61U 4CREA 8LPRA 1O2LA 2TGPZ 1GBHA 2Z94A 1C1VH 1GDNA 1O3NA 3CS0A 3STJA 3O8CA 2ZECA 2YMSD 3A8CA 4FUCA 3SZNA 3SI3H 1EJNA 2PTNA 2ZPQA 5FX6A 4X8UH 1GMDG 1TGSZ 5GXPA 2VVUA 1LQDB 1KMHB 2NU4E 3FKSD 4AG2A 2ZO3H 1LVOA 4FUHA 5PTPA 1MKWK 1YCPK 4Z0KA 3LGTA 1UTNA 2ZTZA 1TQ0B 2JKHA 4AB8A 1GJ6A 2CMYA 3GDVA 3LH3A 1C9PA 1W7GH 4I33A 2BVSH 3BTDE 1EASA 1FY5A 3LGIA 2XBWA 3RP2A 1A1RA 3VGCB 3EA9A 3WW7A 3SZEA 4DCDA 1SGFG 4D9QA 4JZ1A 1MTSA 1NM6A 1AD8H 3JZ2B 1JMOH 3LC3A 1YPHE 4ISIH 4D7FA 3GY6A 2HGTH 1C5YB 3CENA 3MU4A 5G4BA 3DSOA 1QBVH 2F4LA 4AORA 3M3TA 1VJ9U 4E06H 1ELEE 1SLXB 4DT7B 3LONA 2QCYA 2GT8A 3UFAA 1TGNA 1DSUA 2XWAA 5IDKA 2Y5HA 1C1PA 1BBRH 1J16A 1O2OA 5C0UA 1Y5AT 2R0KA 1DXWA 2HVXA 2XC5A 2BD2A 1ZMJA 3FZZA 2H6MA 1AB9B 1O3CA 1TPAE 1HUTH 1N8OB 1NRNH 1C1MA 4X8SH 1Z1JA 4ZMAH 1ABJH 2GGVB 1MKWH 3SNEA 3D23A 1BRCE 2DUCA 3F68H 4UEHH 1C2DA 1O3PB 1ZMNA 1HNEE 3PROA 2BY6X 1QJ6B 4HGCA 4ZKNU 3M7TA 3V12A 3FO8D 1DLEA 4NIXA 3SN8A 3TK5A 2B0FA 1BCUH 2Y81A 2ZIQH 1MU8B 3PYHA 1KTSB 4Q7XA 1EX3A 1P02A 5HYOA 1V2KT 1LVYA 4MNYA 2QN5T 1C2KA 4XDEA 3IITA 4B2CA 2IOTA 4JZFH 2J5UA 1QBOA 5DP4A 2HOBA 4D8NA 1QNJA 1IQNA 1SB1H 3WWFA 2G5NA 4AFZA 1CGJE 3SGAE 3CS7A 1OPHB 1V2QT 4Y0ZE 1BQYA 2ZU2A 3TNTA 1GHAF 2H9HA 1J15A 2GJGA 1SLUB 2CXVA 4X8TH 4IBLH 1A5IA 2WZQA 2JETC 1HIAB 2UWPA 2O8LA 1C5RA 1EJMA 3NRLA 4VGCB 3SW2B 3TPIZ 3F0OA 2RA0A 3LJOA 2VGCC 2IN2A 1GHBF 4K3JA 2A5AA 4ZHMU 2OBOA 1O2QA 1QRXA 1JRSA 3FZDA 3RMOH 4X2VA 2A7CA 1WTGH 3S9AA 1UVPA 2CHAB 1IQIA 6GCHG 4CBOA 2Y80A 2EI7A 1O2PA 3MO9A 5EJZA 2JH6D 2HNTC 2G81E 2PHBA 4CBNA 1C2JA 5EG4A 1NBME 2QGRA 1YPLH 1FAXA 5EU8A 1UMAH 4K69A 1GJ5H 1Y5BT 3D49H 1JIRA 3T62A 3BTME 3VEQB 1S6FA 3WY8A 3VFEA 3HKJB 3PV2A 1ZSJA 1FAKH 1HBTH 1UCYH 4I8KA 1UTQA 2A5KA 1FV9A 5DO4H 1SQTA 5E8EH 1YPMH 1DWEH 5I25A 1YCPM 3HPTB 2FLBH 2ZGBH 4X8VH 4I8LA 3KIDU 5T6GA 1L4DA 1KDQB 5EIYA 1TYNA 2Z6BD 2FLRH 1D3TB 1CA0C 2B7DH 1O2RA 3BTGE 3TJOA 4ISOA 1F5RA 5DN6D 3LKWA 4ISHH 1GG6C 3BTEE 1NS3A 4A5TS 3N7DA 4OS2A 4B75A 1KXDA 1WQSA 2QYIA 1PPFE 2RDLA 2ZEBA 1KXAA 2SGFE 3UB0A 1TNGA 2ZHEH 3U9AH 1QB9A 3F2HA 3ZVCA 4DJZB 1ZJKA 1K0HA 5TJXA 1BDAA 4ZUHA 1P8VC 2P3UB 1UTMA 1C5OH 5TCCA 1MTUA 1ZZZA 3OTJE 3RMMH 1BRUP 1M9UA 4RT1A 4Y11E 2BQWB 4WJG2 2W7SA 2THFB 3I78A 1SGCA 1H9HE 1LVBA 3UOPA 1NTPA 1DX5M 4B71A 5GIBA 4E05H 2IPQX 1AFQC 2ZI2H 1H4WA 3K6ZA 2VH6A 1SPJA 5FCRA 5C2ZA 5ESTE 1VGCB 3RMLH 3BF6H 4XBCA 2KM0A 2J38A 4NG9H 2ZU1A 3TGKE 1XM1A 4NA8A 1D9IA 1G37A 3ZVDA 2GCHG 3SQEE 3TH2H 1AVWA 1YLNA 2R0LA 3TH4H 4AGJA 2WUBA 4D7GA 3DHKH 2I6SA 2BHGA 3MYWA 5C5NA 1BTWA 3AAVA 3AK5A 3T27A 2Z9LA 1HXEH 4B76A 1EFRD 1O2TA 1O5DH 4HTCH 1EQ9A 4FU7A 3SU0A 2H9TH 3M3VA 1EAIA 1KXCA 1O3EA 2Q6DA 2VWLA 5AFZH 2XC0A 3FAOA 1K1JA 4BAHB 3LC5A 3MO3A 4KELA 4H6TA 1W12U 2WPHS 1BBRE 1CO7E 3E0NB 1S0QA 3B9FH 3OU0A 3M7QA 4Q63A 2BQ6B 3H5CB 4GCHG 1K1IA 2I6QA 3FVFB 1SMFE 3RXHA 1HV7A 2TGTA 4Z6AH 4Q80A 1FY8E 1SLVB 3ZZAA 2ESTE 1MMJN 3F3BA 1P57B 1TRMA 1SGDE 1GVLA 3OEED 2G4UA 2A0QB 5JPMH 1K9OE 2EI6A 1H9IE 1EAUA 2VINA 1V2PT 1P12E 2ANKH 5T3HA 4DOQA 1O38A 2W6ID 1ZMLA 5A0CA 1QL7A 4JYVH 1Z8GA 3RXEA 1O5AB 3MH4A 2F91A 1LHFH 1OWKA 3KYFA 4X2WA 2AH4X 2FOFA 4YTAA 4YT6H 2VJ1A 1O3LA 3KN2A 2BDGA 4CRAA 3E3TA 2HLDD 2AMDA 1MZAA 5F03A 2Y7XA 4RKJB 1XUJA 5LPEA 1GJ9B 2Y7ZA 3ZVAA 2FXRA 4JMYA 3KHVA 3ZZ7A 1Y3VA 2P59A 2AGGX 1C5WB 3RLWH 2VWMA 3UUZA 2R3YA 3SV9A 1V2WT 2KCYA 2AS9A 3SU1A 3QLPH 1YYY1 3LDXH 2ZCLP 1LPKB 3HKIB 3RMNH 1CBWC 4IC6A 5LPFA 3UREA 2BLOA 1O30A 1TLDA 5A2MH 3MNCA 1RRKA 2AMPA 2L6OA 2FOHA 1DWDH 4LXBH 1WCZA 4ZXYH 5A8ZA 3URDA 5EQQA 2PKSB 1GHZA 5EJ1A 1KDQA 2VH0A 4AN7A 3FFGA 3EDXB 2XBYA 3GCTG 2BVXH 1GVZA 2Z3DA 1OX1A 2Z9JA 1O3FA 1D3PB 1W7XH 3PTNA 5AHGH 2ODYB 1PPGE 3S7HB 1P2NA 2BY8X 1AE8H 3U1JB 1D3DB 2QIQA 2TBSA 3VG8A 2ZDLA 4DW2U 1PJPA 2RDEA 2ZC9H 2FOCA 1NZQH 1K2I1 2SFAA 1BOQA 1G3BA 8GCHG 1G30B 3D65E 4A1TA 3OY6U 5C5OA 1QTFA 2A4QA 1UCYE 4K2YA 3NKKA 4NZQA 1C4V2 3PMJA 2Z9IA 1ZTKA 3SNDA 2O9QA 1C5ZB 1RD3B 3ENSB 1N6XA 1NO9H 4X1PU 3SBKA 3SGQE 1S81A 5C3NA 3QZRA 2BXUH 1MU6B 1YP9A 1U6QA 1DOJA 3KF2A 2V3HH 4B6EA 1O39A 2XCFA 4GCHF 1Z8RA 3EGKH 4CR5A 3F9FA 2L74A 3R0FA 4X2XA 1UTLM 3MTYA 1O2KA 3SJ8A 3ZZ3A 4ZCNA 1ZSKA 2TRMA 2WYGA 1LQEA 2PWXA 4Q7ZA 3GCNA 3RXLA 1C2GA 1HAOH 1C5XB 3GY3A 2D1JA 2ZDKA 1GGDC 1C2MA 1O5EH 2TGAA 3LPRA 3C1KA 2Q6FA 5GJ4B 3ATKA 1HYLA 3GY2A 2WPKS 5HKKD 4YOJA 3A80A 1QR3E 4BAKB 1THRH 4HZHA 3ZV9A 1MZDA 3ZYEA 1YPHC 1QURH 1FJSA 1C1UH 1P9UA 4ZKRU 4CHAC 1HJAC 2OUAA 2VIDA 2FPZA 1PQ5A 2ZFFH 1YY3A 4AB9A 1P03A 1O2WA 4NSYA 1O31A 2GDDA 1BMMH 1S6LA 4IN1A 2ZP0H 1JWTA 3DFLA 1CA0B 3M5MA 3MH5A 4U2WA 2F9UA 5B6LA 1BTPA 4D9RA 1WBGB 1W0ZU 4YO9A 1HB0B 3SU2A 4RN6A 1BUIA 1YPEH 1E0FD 2BZAA 3BSQA 4OM9A 2ZA5A 2J97A 1G2MA 1MCVA 1MKXK 4WXIA 1TBQH 3PO1B 3M7UA 3EYDA 5J4SA 1PYTC 3PMBB 2J98B 8KME2 1FONA 1OWDA 4RT0A 2KCAA 1ABIH 1ELTA 2AIPA 3U8TH 3M5NA 1T7CA 1GI2A 1DUEA 3MH6A 2ZDNA 4Y8YA 2ZZUH 2R3UA 9ESTA 2HNTF 4A6LA 1A0HB 1HAZB 1P01A 2CF8H 2WINI 2SNVA 5DP6A 2AERH 3LH1A 1LKBA 3GCTF 4ABHA 1EB2A 1AFQB 3BTWE 4H4FA 1P3CA 3SU6A 5T6FA 1QHRB 2PUQH 2G00A 5HIZA 2ZGCA 1AVGH 1C5TA 1Z6EA 2EC9H 1ZOMA 2FI4E 1HCGA 1VCPA 3RC6A 4RSPA 5FPTA 1HGTH 4ABAA 8GCHF 2CV3A 1DVAH 1BTYA 2PW8H 4QT8C 1J17T 1EAXA 1NN6A 1F0UA 1BTUA 3OSYA 3P92A 4WVPE 1C1OA 5L2YH 1HPGA 5EXLA 3TH3H 3RXPA 1XXFA 2Z7FE 2QA9E 1MTNC 1KXFA 5GNDA 1SGRE 3Q3XA 4KGAA 1S0RA 3SV8A 1MTVA 1UTKA 1O2SA 3Q76A 2OXSA 3U1IB 1IQLA 1ZJDA 3FP7E 4WY3A 1GHVH 4Y7BA 1RXPA 1NRRH 5DSFA 5C1XA 3NZIA 2LNCA 1IQGA 1QZ8A 2SGEE 5C1YA 4LZ4B 2QAAA 4JK6A 1DUAA 3A8DA 1AUTC 1VITF 2ZHWH 1LO6A 1DY8A 1HJ9A 1CE5A 1FUJA 1YLCA 2OQUA 3QN7A 4ISLA 2ZU5A 3AW0A 5AFYH 4FVDA 3P8NA 5DG6A 4E7NA 4KKDA 1FDPA 2A45B 1DS2E 2GD4B 2RCEA 4THNH 1SGNE 2G51A 1ANBA 1O3HA 1P06A 5FPYA 1OP8A 1TGCA 4X0WU 4K8BA 5EPYA 1FNIA 1OKXA 1QL8A 1AHTH 4O97A 4P00A 1NT1A 1GBTA 2C4FH 4IS5A 2A4RA 4K1EA 3RUOA 4BXSA 1C5NH 4UDWH 2BTCE 3BTFE 5F8ZA 1TNKA 1KLTA 2F9PA 1AY6H 3UWJH 1GWAA 3O8RA 1Q2WA 2SGPE 3RDZA 1UTOA 1W10U 2XCNA 2ZHQH 1S5SA 3SNAA 2RG3A 4Y0YE 2HALA 1DWCH 1KTTB 4AZ2B 5FXLA 2KFWA 3NUMA 2XXLA 1MQ6A 2YMSC 1O2VA 3BEFB 3BTQE 3DSGA 3A8AA 1OP0A 2ALVA 3LGWA 4WF8A 4XBBA 2F9VA 3U69H 4DVAU 1CBWB 4B74A 2P95A 3A7TA 3SV2H 3P8FA 3ZVFA 2HPQH 2ZFQH 1CT4E 4LOYH 1G2LA 1MCTA 2VBCA 4BAMB 1ZTJA 2VU8E 5JBTA 1T31A 3V13A 1EATA 4Y10E 5FBIA 4CR9A 5EJLA 3N7EA 5DK1A 2QXIA 3QTOH 3NCLA 2OCVB 3Q00A 3QTVH 2O8WA 2XNDD 1XKBC 1O37A 2J2UA 3LT3A 4MPVA 3DCLA 3SUEA 3SUFA 4X1NU 1UTJA 4GSOA 1YCPH 1ZRKA 3RXJA 1TRYA 1LTOA 3ZVBA 3N99A 3A89A 2J98A 3SUDA 1Y3WA 2BMGB 3HGNA 4A1VA 2QXHA 3ATMA 1BJVA 3BV9B 4XRNA 3SUGA 2GDEH 4OS6A 2QE7D 6LPRA 1DM4B 1QA7A 3ZYDA 4E7RG 2XOKD 1EZQA 1IQFA 5J4QA 1VKYA 1C5SA 1A3BH 1FQ3A 3RXGA 4GHQA 7GCHG 1O2HA 1O3MA 1E1QD 1THSH 1C1WH 1MQ5A 2P8OC 2SGAA 3I29A 3PRDA 3VXEH 4DIIH 1G32B 1A0LA 3PTBA 2FOBA 5TCAA 2BD8A 1UVSH 2FM2A 3T25A 1XKAC 1GI7B 1IHTH 2O8UA 2GCTC 1GBEA 1GDQA 1QIXB 1DSTA 1C2EA 1INCA 2BLVA 1QB6A 1CSOE 2EY4C 1LHCH 1TPPA 1NU7B 2NU0E 3VB3A 2Z3CA 4Y71A 4IGDA 4UD9H 3SV6A 1RTLA 1QJ7B 1TX6A 1YF4A 3EE7A 2FI5E 3ZIAD 1O34A 1C5PA 2K8IA 1GVKB 2ZCKP 2G52A 1LPGB 1BITA 1DLKB 1TB6H 1XUKA 1GMDF 1YC0A 1UK3A 4CRDA 1GBFA 1NU9A 1W0YH 4K60A 2LELA 1J8AA 2FOMB 1DY9A 1O5BB 1V2MT 1Y8TA 1O3IA 4K8YA 1TPOA 3OFND 1SOTA 7KMEH 2F83A 5JBCS 1E37B 3F9HA 3L33A 4MLFB 3AW1A 5E2OA 1A7SA 1BMAA 3S9CA 4UFEH 1XX9A 3EAJA 4MPWA 1D4PB 2WHXA 4Y79A 1QCPA 1OOKB 1TOMH 4J1YA 2ASUB 1CA8B 2H2ZA 2P3FH 2GMTB 2ZPRA 3BG8A 4YM9A 1V2LT 3SOSA 3BG4B 1EOLA 3GYLB 5AF9H 3PWCA 5CHAC 2C8XB 4K1SA 2F3CE 4ACAA 5EOKA 1N1LA 1CHOG 1CVWH 3M5LA 5FAHA 1ANEA 5HM9A 3URCA 1G3DA 5L30H 2KZ4A 5BPEA 1F2SE 3LGYA 4FETA 4I32A 1YBWA 5HM2A 3TGJE 1T8MA 4F48B 1FN8A 1ZPZA 5CMXH 1AZ8A 8ESTE 5CDFE 3ZZ8A 1ZLRA 5FPSA 1HAVB 4XFQA 4RKOB 2XNIA 4MVNA 2C93B 1BHXB 1QRWA 4FUJA 1SQRA 3A83A 2BOHB 1ELFA 2ODQA 5I46H 1EPTB 2A7JA 1D3QB 1SG8B 2EA3A 1NC6A 1C4U2 2HPPH 1SHYA 5GDSH 2PP6A 1QGFA 2WPMS 1UHBB 1C1SA 1PQAA 3BEUA 1ZTLA 2C8YB 1SKYE 4Y7AA 1TABE 1DWBH 1A3EH 3F0PA 1OYQA 4AOQA 3BEIB 1HAGE 1UK4A 2SNWA 1F0SA 1W13U 4ZKOU 2BX4A 5BRRE 1GJ7B 1NFYA 5DGJA 2BLQA 3W1EA 3SJ9A 1SC8U 1LHEH 3MH7A 3TK6A 2PTCE 2GV7A 7GCHF 4YESB 4CRFA 2ANWA 1Z8IB 1OXGA 1VZQH 1B0FA 4DT4A 2PR3A 1OP2A 1LVMA 1TNLA 1F7ZA 1XMNB 3VB5A 4TPIZ 1H8ED 5F8XA 2GZ8A 1TNHA 2FZZA 1PQ7A 1WOFA 4MNXA 5EGMA 1GDUA 1O5GH 3VB7A 5GCHG 2FDAA 4YLQH 3T26A 2G55A 6CHAC 2G8TA 1SGFA 4BTTB 1O2ZA 1TX7A 3D62A 4SGBE 3T5FH 4GHTA 3MFJA 1FPHH 3RXUA 5A09A 1GMCG 4UFGH 1GI5A 2WPJS 1BHXF 3MMGA 2FOGA 3QK1A 1MTWA 1VCWA 2IJD1 1P05A 3KYGA 4J2YB 3QDZB 3V0XA 5ETXA 1IOEA 1HXFH 5HXFA 3CNRA 3TJVA 1AO5A 6GCHF 3RXAA 2BDIA 1O36A 2WYJA 4LZ1H 1GCTC 2W3KA 5K7RA 1TA6A 2M2AA 4NSVA 3TJNA 3ZVGA 4F55A 2CK3D 2GTBA 2ZGJA 3SHAH 2H5DA 2F43B 2VVCA 4CRCA 1V2RT 3F2FA 4AG1A 5FHTA 2B9LA 5E2PA 2YMSB 2FX6A 1GPZA 2R2WU 4UONA 4BAOB 2ZWLH 4FUBA 5ESBA 4OS7A 4ZXXH 1WXRA 2ALPA 3VXFH 1CHOF 1O5FH 1D6WA 4SGAE 5FX5A 3A87A 2C8WB 2PFEA 3RXIA 1P2KA 2ZPSA 1UO6A 1EKBB 2GVFA 2XW9A 1ZGVA 2NU2E 1XVOA 2JIZD 1LKAA 1GI8B 1VCQA 1A5HA 1V2OT 1GBMA 2BYAX 5F53A 1A4WH 2K0QA 1GL1A 3A84A 2BD4A 3E8LA 3T29A 1EJAA 4HFPB 4MDSA 1FY3A 1P0SH 1FY4A 1P2IA 1BRBE 1GI4A 3H09A 1D6RA 2WPLS 1PPHE 3GY7A 3KEEA 4H42U 1FXYA 1MAYA 4TT3D 2AGEX 3F9EA 3AVZA 2PSXA 4ABDA 3VGCC 1K1OA 2STBE 2PSYA 1BMNH 4ZAEA 4Y8ZA 1UVUH 1Y59T 1V2JT 1ZYOA 5HGGA 1GJDB 3EA8A 3ZZ6A 2O8TA 1CHGA 3RXSA 1L1JA 3ELAH 5F8TA 1H1BA 2PUXB 1P10A 3MWIU 4NIWA 3VB6A 4DG4A 3A81A 1HAVA 2XBVA 1C5MD 2QF0A 5C67A 2A31A 2BQ7B 2DE9A 3DUXH 2FX4A 4IC5A 2AHME 2AFQB 1EPTA 4UFFH 3RU4D 3SHCH 1K28D 1DPOA 2KAIB 2J95A 3JZ1B 5FBEA 1P2OA 2GCHF 1O3OA 1SGPE 1LHDH 1LDTT 1UHBA 1ZHPA 4AFUA 1WSSH 2FO9A 4Y8XA 5GCHF 2WUCA 3UNQA 3GY5A 4CH2B 2Y5FA 4DIHH 5CE1A 2JETB 1AB9C 5DP7A 1NFWA 2YNAA 2WSSD 1N8OC 3S9BA 1A46H 1XUHA 2KCOA 1TONA 1Y3XA 1NY22 3NWUA 4DGJA 1RTKA 1FY1A 3E0PB 2VGCB 1RJXB 3HK3B 5DP8A 1Z8JB 3BTTE 3T28A 1FPCH 1ESBA 1GJ4H 2Z9GA 1P04A 1FN6A 1ZGIA 3S69A 3RXRA 2F9NA 1ZSLA 4A1XA 1SR5C 1W11U 3L6PA 2J4IA 1KLJH 3KQDA 1KSNA 3ODFA 2BZ6H 3SI4H 3UNRA 1H8HD 3MNBA 1SGEE 1T8OA 3FANA 1GBJA 2Z3EA 1UVOA 1HJ8A 1YM0A 4GPGA 4ABBA 1KY9A 2RFKC 1B5GH 1GBDA 1TQ7B 2FIRH 2WV4A 2ZDAH 4HG6A 3C27B 4WWYA 3TNSA 3O8DA 5JB9S 3H7TA 4K1TA 1DANH 3U28C 1GMHG 1Z71A 1S83A 2Y82A 3MNXA 1ZHRA 2FESH 1SFQB 1WU1A 3F1SB 3UPEA 4FUDA 2JH5D 1ELVA 3PV4A 4I8JA 2QF5A 2V0BA 3RXFA 1ETSH 2H5CA 5FCKA 1BZXE 3QWCH 3K2UA 5JBAS 1DDJA 1GG6B 1QQ4A 2R9PA 5HIYA 3VPKA 1GHWH 3PRBA 5JBBS 2BY7X 1THPB 2QXGA 4B1TA 2OQ5A 1C5VA 1SLWB 4MQAA 1ETTH 4NFEA 2GZ7A 2XTTB 3S0NA 5EW1H 2ZNKH 2BDBA 1IQMA 2QXJA 1AUJA 5L6NH 5GPIB 4Z1MD 4ASHA 1K1MA 3GCHC 4I7YH 3PV5A 4B2BA 3E16B 1C2FA 3KQ5A 2RA3A 2W6JD 4U32A 2ILNA 2H1UA 3GDSA 3SQHE 2W5EA 4JYTA 5A8YA 2FODA 1AE5A 3T2NA 1O2MA 2VVVA 3GCOA 3M5OA 1P9SA 3MHWU 1AZZA 1ESAA 3V7TA 1DXPA 3UIRA 3RXBA 4NA7A 3Q3YA 2LPRA 3PLKA 4ACBA 3KQCA 1ID5H 1AIXH 2VIOA 3QGNB 1EZSC 1G36A 1HAHH 1H8IH 1W14U 4FOUC 3TIUA 2FS8A 1GI0A 1SQAA 2BVRH 1OWHA 3PM3A 2P3TB 4MPUA 3IG6B 2UUJB 1NRPH 6CHAB 1O33A 2XYAA 1GHYH 2B8OH 3DSPA 5A0AE 3QUMP 2OK5A 1C5QA 1C4Y2 3K65B 3SJOA 3GDUA 1C1NA 4XOJA 3RXOA 2ANMH 2GP9B 1KXEA 2SGQE 1E36B 1MKXH 1MD8A 1W0JD 1O3KA 1C1RA 4CH8B 1F5KU 1QQUA 1T8LA 3ZZ5A 1A5GH 3A7VA 5LH8A 3RXQA 1B0EA 2AYWA 1P2JA 4KTCA 2HVYB 1O2GH 4FUFA 3NXPA 1EZUC 1W3CA
chains in the Genus database with same CATH topology
1Q31A 1RIWC 1YLDA 2KAIA 4D76A 3RXCA 1CU1A 1UVTH 1BTXA 1PPBH 3ZV8A 3TVJB 4Y76A 2FOEA 3M3SA 4NIYA 4ESTE 4FUIA 4ABJA 2NU3E 1DT2A 2W26A 1AVXA 3STIA 3MU0A 1JRTA 1ELAA 2ZQ1A 3MU8A 4NWKA 4A7IB 1VGCC 2J92A 3CP7A 1ESTA 3RU4E 4MNWA 1EP5A 3MI4A 5K0HA 3RU4T 1V2NT 4CRBA 3I77A 1BBRK 2BD9A 2A7HA 4GAWA 4R0IA 3UQOA 3KL6A 1C1TA 3E91A 2HRVA 2CJIA 1O32A 1O2IA 1C5LH 1TGTA 3P8OA 3KNXA 4X1SU 2ZG0H 1GI3A 4HI3A 2AEIH 1GHBG 3Q3KA 3RXTA 3UTUH 2C3SA 1A61H 1JBUH 1V3XA 4X2YA 5JB8S 1ACBE 3QZQA 4WMDA 4ISNA 1NESE 1AI8H 3OX7U 1S6HA 2ZGHA 5EQRA 1K1LA 2C90B 1XUGA 4IN2A 3UOUA 3BTHE 4IMZA 1FIZA 4MNVA 4XBDA 4BOHA 2Z9KA 2J9NA 3MU1A 4ZKSU 1HAYB 4IMQA 4ZH8A 1NRQH 2FYQA 1C9TA 1Y5UT 3KQEA 2A4OA 3ZVEA 1V2ST 2HLCA 1TALA 5EXMA 1NRSH 2UWLA 1FIWA 1DITH 1IAUA 3DD2H 4LK4A 3BN9A 4I8GA 4KTUA 1ELBA 1C2IA 3K6YA 2ZDVH 2XRCA 1G3EA 1L1GA 3RM0H 6ESTA 1WQVH 5DKMA 2OINA 1QL9A 2BLWA 2VIVA 2QC2A 1VR1H 2OP9A 4WH8A 4OGYA 3A7YA 4JK5A 2W3IA 1CQQA 1YPGH 1RFNA 2FP7B 1GHXH 1UTPA 3MNSA 1JOUB 1ARBA 2TIOA 3RC5A 1BTZA 1EOJA 3HK6B 4JYUH 3U8OH 3SU5A 1SGIB 2OD3B 2P16A 2BDHA 2GX4A 3E1XB 3UNSA 2VIPA 1MH0A 2Q1JA 4FUGA 1ZR0A 1IQEA 5EW2H 3SV7A 1T4UH 3KCGH 3DT0H 3TITA 1QB1A 1SL3A 3ZZ4A 5AVDA 1FMGA 1OWJA 1TBRH 5E0GA 1YKTA 1LPZB 3HGPA 1DE7H 5SGAE 5E0HA 1BIOA 3OYPA 3PWBA 1O3DA 1RS0A 2PKSC 3K9XB 1O5CB 4ZROA 3ZZCA 2H9EH 4JZEH 3FP8E 4R8TB 1ANCA 1H8DH 4INLA 1RGQA 2V6NA 1BTHH 4FXGH 1GGDB 2ANYA 2QV1A 2BY5X 2TGDA 3M35A 1UCYK 1ELGA 2PGQB 1AN1E 4TY6A 2VIQA 3EQ0H 4AX9H 4AYYB 1K21H 2WPIS 3QO6A 1EP6A 4F49A 1G3CA 3GY4A 3A8BA 4MTBA 3ZZ9A 4CHAB 1HJAB 2BB4A 1TOCB 1OYTH 2V3OH 5HMAA 3FP6E 3KGPA 3SU4A 1QBNA 4FU9A 4U01A 4ABIA 1O2UA 1FI8A 1BMLA 1GJ8B 1LHGH 1ARCA 4Y6DA 1AKSB 2BY9X 1O35A 1EZXC 2AIQA 1QY6A 4I8HA 1K1NA 4NZLA 3SNBA 1L0ZA 1O2JA 1Z6JH 2BD3A 3O8BA 2UWOA 2A2XH 2XWBI 1GBLA 1F0RA 3SJIA 2EEKA 1BB0B 4FUEA 1F5LA 3E90B 2J94A 3P6ZB 1VITH 1GI1A 1EAWA 1PFXC 1MBQA 4WH6A 4AFQA 3GCHB 3QGJA 5JDUB 1CGIE 1AMHA 1SHHB 1TRNA 1GCDA 2VWOA 4TYDA 4O9VA 1GJCB 2EI8A 4MG3A 1F92A 4M7GA 4H6SB 1O3JA 5GWZA 1TIOA 1AGJA 2ZKSA 5E0JA 2A2QH 5EPNA 3G01A 1H9LB 4NWLA 4YT7H 3QX5H 1E38B 3RM2H 3B8JA 3P95A 2D26C 1OSSA 4INHA 1GBIA 1T32A 4ZHLU 1SBWA 1SGQE 1GBBA 1GL0E 4AYVB 4INKA 1PPEE 1CT2E 1AU8A 1HRTH 5B6OA 1EUFA 1P11E 1QA0A 3TLOA 4TPYA 3RXVA 2XC4A 3PO1C 5LGOA 1QFKH 4X6OA 1MTNB 1TA2A 2OBQA 3A85A 3A7XA 2ULLA 5ABWA 2OC7A 5EQSA 2IJOB 3GISB 5DP9A 1O2XA 1OWIA 4B2AA 2F9BH 4BTIB 3P8GA 1LMWB 3SJKA 3L3TA 1CT0E 1RIWB 4WMFA 4X1RU 2R2MB 2Y6TA 1F0TA 3TU7H 3ITIA 3RLYH 3P70B 1FZZA 4TWYA 2OLGA 5L2ZH 3RXDA 1Q3XA 1SVPA 1YPJH 5H4IB 3UWIA 1W2KH 4JZIA 4BNRA 1C2LA 1TAWA 2WV5A 5IYTA 2DE8A 3UR6A 3U8RH 1O2YA 2ZTXA 1PQ8A 4MPXA 4NIVA 4FVBA 4X6NA 1E34B 2VB0A 1OWEA 3MOCA 2A4GA 2NU1E 3B23B 2CF9H 1O3BA 2GT7A 1TX8A 1ZPBA 1W8BH 2STAE 3ATWA 4F4OC 4BTUB 5EODA 1FLEE 2GZ9A 2VIWA 1TWXB 1KXBA 2BX3A 4TY7A 1Z1IA 1C1QA 5JYIA 1GI6A 4FU8A 1AFEH 1QRZA 2BDYA 2ODPA 1YPKH 2BOKA 1HIAA 1SQOA 4YOGA 4O3UA 1IQHA 2W7UA 4ABEA 4O3TA 4NFFA 3SU3A 4PROA 1DICA 1KYNA 1PPCE 3F6UH 3SO3A 1AKSA 2GV6A 3ODDA 1MBMA 4YLUA 2HNTE 5DP5A 2AGIX 2PLXA 2PKAB 2UUFB 4BAQB 4K5ZA 4BXWA 1HFDA 1Y3YA 2VNTA 1TPSA 2QY0B 4KP0A 2K1QA 3RC4A 3SNCA 2BDCA 2UUKB 4YOIA 4OS5A 1GI9B 4GLYA 3SGBE 1V6DA 3SORA 1SI5H 2OC1A 3LJJA 2ZHFH 1DFPA 3F9GA 3MO6A 4AFSA 2ZHDA 1L2EA 1TMTH 2BM2A 1T8NA 1TMBH 1KIGH 1N6YA 4ABGA 3ZZBA 1AWFH 3A7WA 1SOZA 3HATH 1ANDA 2QF3A 1B7XB 2P8OB 5LPRA 1RTFB 2A5IA 5T6DA 3TJUA 1C2HA 1O3AA 3P17H 4NA9H 2GCTB 3BIVH 4WXVA 3W95A 1EB1H 2V35A 2YNBA 1TFXA 1L1NA 1A2CH 3A82A 3BIUH 1V2TT 1NFUA 4JCNA 2ZDMA 1Y3UA 4GUXA 3R3GB 1ELDE 1IQKA 1HAPH 2D8WA 1SFIA 2ZU4A 4WMEA 1XUIA 2OTVA 3RXMA 1GMCF 3A7ZA 1UJ1A 3TGIE 1SSXA 4GVUA 5A8XA 1P2MA 3ZZDA 2G5VA 3LGUA 3BTKE 1KLIH 4X6PA 2B5TB 1BRAA 4AGKA 5DP3A 4ZHAA 1O0DH 1TNJA 3PB1E 3MU5A 1V2UT 1C5UA 3ESTA 3UR9A 2BDAA 3V3MA 3S7KB 4XSKU 1V2VT 1EXFA 1GBCA 4YZUA 2P94A 2J34A 4TWWA 2OC0A 1SGTA 1T4VH 1OS8A 3UQVA 2GKVE 1ELCA 5CHAB 5C1UA 3DA9B 3OY5U 4OGXA 3GICB 1S85A 1ETRH 2XBXA 2ZFTA 1VITG 3TK9A 4UE7H 7ESTE 1WV7H 1WUNH 1G9IE 1P3EA 2HWLB 3N7OA 3PLPA 1O3GA 1QJ1B 1GJAB 1IHSH 2ZFSA 1YGCH 4VGCC 2G4TA 2BD7A 2NWNA 3NK8A 1AWHB 3DFJA 1PYTD 3AAUA 4UFDH 1VJAU 3M37A 9LPRA 2PGBB 3PMAB 3VB4A 3RXKA 1IQJA 1BT7A 2IPHA 3A88A 3GYMA 2Q6GA 4NCYA 2CHAC 4X1QU 3LIWA 2ZCHP 2FTMA 2FYRA 1HDTH 1LCYA 3W94A 2A1DB 4U30A 3KQBA 2FEQH 5EXNA 2ZGXH 2C8ZB 2GMTC 3IWMA 1X7AC 4DY7B 2O8MA 7LPRA 2F9OA 1UK2A 3GY8A 4BANB 3BG4C 1ORFA 2BXTH 5DPAA 1O2NA 1XUFA 2FTLE 2VWNA 2YOLA 4CRGA 1WAYB 1TE0A 2ZFPH 1TBZH 1NROH 2ZFRH 3PMHB 3GOVB 1J9CH 4KTSA 1GBAA 2PKAA 3AASA 3U98H 1Z7KA 4Q2KA 2A32A 2CGAA 1K22H 2FI3E 4I31A 4B73A 1BA8B 2PV9B 3EA7A 1ZHMA 2M5TA 4OS4A 1WYKA 2TPIZ 4O03A 3H7OA 3E6PH 2D2DA 3Q77A 2P93A 3UY9A 1JIMA 1S84A 2OC8A 4Q7YA 2JH0D 1L4ZA 3A86A 1MAXA 2ZF0H 4OS1A 1GJBB 2ZTYA 1EPTC 1XVMA 2ZU3A 1HLTH 1TMUH 1WTHD 2SGDE 2AMQA 5C20A 1ZRBA 4NGAH 1P2QA 4ABFA 5DJ7A 1AQ7A 3M36A 4X6MA 1XXDA 1HAIH 5F6MA 1GCTB 3PLBA 1PPZA 4XE4A 2BD5A 2FS9A 3NPSA 1K1PA 1JXPA 1NFXA 1NPMA 3ATIA 2UUYA 1TGBA 4JZDH 3LU9B 3LGVA 1TNIA 1P09A 4A92A 1E35B 1S82A 2ZQ2A 1A0JA 2CN0H 2FMJA 1J14A 2Y5GA 5A0BA 2FOAA 1MD7A 1MUEB 1ZPCA 4DURA 2FWWA 1BJUA 3EE0B 1GBKA 1GHAG 1SGYE 3ATLA 1CGHA 1HAXB 3LOXA 1GMHF 4IW4E 3M61U 4CREA 8LPRA 1O2LA 2TGPZ 1GBHA 2Z94A 1C1VH 1GDNA 1O3NA 3CS0A 3STJA 3O8CA 2ZECA 3A8CA 4FUCA 3SZNA 3SI3H 1EJNA 2PTNA 2ZPQA 5FX6A 4X8UH 1GMDG 1TGSZ 5GXPA 2VVUA 1LQDB 2NU4E 4AG2A 2ZO3H 1LVOA 4FUHA 5PTPA 1MKWK 1YCPK 4Z0KA 3LGTA 1UTNA 2ZTZA 1TQ0B 2JKHA 4AB8A 1GJ6A 2CMYA 3GDVA 3LH3A 1C9PA 1W7GH 4I33A 2BVSH 3BTDE 1EASA 1FY5A 3LGIA 2XBWA 3RP2A 1A1RA 3VGCB 3EA9A 4DCDA 1SGFG 4D9QA 4JZ1A 1MTSA 1NM6A 1AD8H 3JZ2B 1JMOH 3LC3A 1YPHE 4ISIH 4D7FA 3GY6A 2HGTH 1C5YB 3CENA 3MU4A 5G4BA 1QBVH 4AORA 3M3TA 1VJ9U 4E06H 1ELEE 1SLXB 4DT7B 3LONA 2QCYA 2GT8A 3UFAA 1TGNA 1DSUA 2XWAA 5IDKA 2Y5HA 1C1PA 1BBRH 1J16A 1O2OA 1Y5AT 2R0KA 1DXWA 2HVXA 2XC5A 2BD2A 1ZMJA 3FZZA 2H6MA 1AB9B 1O3CA 1TPAE 1HUTH 1N8OB 1NRNH 1C1MA 4X8SH 1Z1JA 4ZMAH 1ABJH 2GGVB 1MKWH 3SNEA 3D23A 1BRCE 2DUCA 3F68H 4UEHH 1C2DA 1O3PB 1ZMNA 1HNEE 3PROA 2BY6X 1QJ6B 4HGCA 4ZKNU 3M7TA 3V12A 1DLEA 4NIXA 3SN8A 3TK5A 2B0FA 1BCUH 2Y81A 2ZIQH 1MU8B 3PYHA 1KTSB 4Q7XA 1EX3A 1P02A 5HYOA 1V2KT 1LVYA 4MNYA 2QN5T 1C2KA 4XDEA 3IITA 4B2CA 2IOTA 4JZFH 1QBOA 5DP4A 2HOBA 4D8NA 1QNJA 1IQNA 1SB1H 2G5NA 4AFZA 1CGJE 3SGAE 3CS7A 1OPHB 1V2QT 4Y0ZE 1BQYA 2ZU2A 3TNTA 1GHAF 2H9HA 1J15A 1SLUB 2CXVA 4X8TH 4IBLH 1A5IA 2JETC 1HIAB 2UWPA 2O8LA 1C5RA 1EJMA 4VGCB 3SW2B 3TPIZ 2RA0A 3LJOA 2VGCC 2IN2A 1GHBF 4K3JA 2A5AA 4ZHMU 2OBOA 1O2QA 1QRXA 1JRSA 3FZDA 3RMOH 4X2VA 2A7CA 1WTGH 3S9AA 1UVPA 2CHAB 1IQIA 6GCHG 4CBOA 2Y80A 2EI7A 1O2PA 3MO9A 2JH6D 2HNTC 2G81E 2PHBA 4CBNA 1C2JA 5EG4A 2QGRA 1YPLH 1FAXA 5EU8A 1UMAH 4K69A 1GJ5H 1Y5BT 3D49H 1JIRA 3T62A 3BTME 3VEQB 1S6FA 3WY8A 3VFEA 3HKJB 1ZSJA 1FAKH 1HBTH 1UCYH 4I8KA 1UTQA 2A5KA 1FV9A 5DO4H 1SQTA 5E8EH 1YPMH 1DWEH 5I25A 1YCPM 3HPTB 2FLBH 2ZGBH 4X8VH 4I8LA 3KIDU 5T6GA 1L4DA 1KDQB 1TYNA 2Z6BD 2FLRH 1D3TB 1CA0C 2B7DH 1O2RA 3BTGE 3TJOA 4ISOA 1F5RA 3LKWA 4ISHH 1GG6C 3BTEE 1NS3A 4A5TS 4OS2A 4B75A 1KXDA 1WQSA 2QYIA 1PPFE 2RDLA 2ZEBA 1KXAA 2SGFE 1TNGA 2ZHEH 3U9AH 1QB9A 3ZVCA 4DJZB 1ZJKA 5TJXA 1BDAA 4ZUHA 1P8VC 2P3UB 1UTMA 1C5OH 5TCCA 1MTUA 1ZZZA 3OTJE 3RMMH 1BRUP 1M9UA 4Y11E 2BQWB 4WJG2 2W7SA 2THFB 3I78A 1SGCA 1H9HE 1LVBA 3UOPA 1NTPA 1DX5M 4B71A 5GIBA 4E05H 1AFQC 2ZI2H 1H4WA 3K6ZA 2VH6A 1SPJA 5FCRA 5C2ZA 5ESTE 1VGCB 3RMLH 3BF6H 4XBCA 2J38A 4NG9H 2ZU1A 3TGKE 1XM1A 4NA8A 1D9IA 1G37A 3ZVDA 2GCHG 3SQEE 3TH2H 1AVWA 2R0LA 3TH4H 4AGJA 2WUBA 4D7GA 3DHKH 2I6SA 2BHGA 3MYWA 5C5NA 1BTWA 3AAVA 3T27A 2Z9LA 1HXEH 4B76A 1O5DH 1O2TA 4HTCH 1EQ9A 4FU7A 3SU0A 2H9TH 3M3VA 1EAIA 1KXCA 1O3EA 2Q6DA 2VWLA 5AFZH 2XC0A 3FAOA 1K1JA 4BAHB 3LC5A 3MO3A 4KELA 4H6TA 1W12U 2WPHS 1BBRE 1CO7E 3E0NB 1S0QA 3B9FH 3OU0A 3M7QA 2BQ6B 3H5CB 4GCHG 1K1IA 2I6QA 3FVFB 1SMFE 3RXHA 1HV7A 2TGTA 4Z6AH 4Q80A 1FY8E 1SLVB 3ZZAA 2ESTE 1MMJN 1P57B 1TRMA 1SGDE 1GVLA 2G4UA 2A0QB 5JPMH 1K9OE