4O3TA

Zymogen hgf-beta/met with zymogen activator peptide zap.14
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
NIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/growth factor
molecule keywords Hepatocyte growth factor
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3tA01
1YPHC 1QR3E 1HBTH 2ZU5A 3DFLA 5I25A 1AB9C 3TH4H 2XW9A 3E1XB 1IHSH 4H42U 1C1SA 3PLPA 2OINA 1NRRH 2Q1JA 1C1UH 1GJ4H 4K8YA 3E91A 5EOKA 1LVYA 3STIA 1CA0B 1GI8B 3ZV9A 1HAPH 5E2OA 1HJ9A 1QJ1B 4BXSA 4OS7A 2XBVA 2ZGHA 1C5PA 1QHRB 2FX6A 2HLCA 3BG4C 2BHGA 2O8WA 3TJOA 3A7XA 2SGAA 2ZDAH 1OYQA 2A45B 1TX7A 1UMAH 1BMMH 4Z0KA 1VCWA 1CO7E 1JXPA 2TGDA 1QRXA 1BJUA 4I8LA 1PYTD 3M36A 3UY9A 1MAXA 2HOBA 3VB5A 5DP6A 3A7TA 3LDXH 4A6LA 4ZMAH 1SHHB 2CMYA 4IS5A 1QL8A 5C67A 2VINA 1K1IA 1HNEE 2XBWA 1HB0B 1W11U 4Q7ZA 3BTDE 4JCNA 1SGEE 4OGXA 1GJ8B 3VPKA 4A7IB 1MKXH 3TVJB 4AFUA 2F9OA 4ABBA 4NIVA 3QTVH 1J17T 1RTFB 1T8OA 3RXPA 1MKXK 1ARCA 2A31A 1FN6A 4DT7B 4AOQA 3AW0A 1O2IA 1E38B 1GJ6A 4FU8A 1SGFA 3RXCA 1MTVA 2PKAA 2Y7XA 3VGCB 2ZDKA 2Y80A 1TGTA 2Z3CA 3RXGA 4X8VH 1ZHMA 1N6YA 1BCUH 1V2RT 2ANMH 3PO1C 1HYLA 1TNKA 2VIWA 4CHAC 4Y0ZE 1S84A 4DCDA 3GICB 4UEHH 2F83A 1YGCH 4X1QU 5AVDA 1W12U 3RXAA 4FUGA 4FUFA 2VVUA 2QY0B 5DP4A 2Y5HA 3URDA 1UTJA 2VIVA 1GBTA 1P2JA 1BTUA 1W0ZU 5JBTA 4KTSA 1TPAE 4Y71A 1GJ9B 3OX7U 4JMYA 3STJA 1O39A 2H9EH 1AO5A 4CRCA 1C5RA 4IW4E 1SI5H 3BSQA 3RMNH 1ZLRA 3U9AH 2OQ5A 2DE9A 1XXDA 5LPFA 1P9UA 2GDEH 2ZU1A 4JZFH 1A5GH 1UK3A 1ZHRA 1QA0A 1TRYA 2QXIA 1C4U2 1LKAA 4JYUH 1BBRH 1KLTA 1MKWH 1HIAB 1AKSB 1PPZA 2BOHB 1GMCG 2BQ7B 3RMMH 1GI2A 2Y82A 1O2QA 4E06H 1AE5A 2CF8H 2R3UA 1GJDB 4F49A 3IG6B 1ETSH 1M9UA 1SOZA 2AIQA 3UOPA 2VIPA 4HGCA 4ZKRU 4NIXA 5AHGH 1QA7A 3F6UH 2VVVA 2FO9A 2DE8A 1GI9B 3KF2A 4AZ2B 3N7OA 2ODPA 4RN6A 1ELVA 3AAUA 4JYTA 1O2JA 2FESH 2NWNA 3R3GB 3ZVGA 3SI3H 3UWJH 4GCHG 1SLVB 3G01A 1O2VA 2A5AA 1EJAA 2FOBA 2FWWA 3D62A 2RCEA 2A4GA 1BITA 1QQUA 1MQ6A 3NXPA 2I6QA 3GDVA 2B9LA 1VCQA 1MH0A 2QF0A 1TPPA 1PPBH 2ZFQH 1HXFH 3NPSA 3RLWH 4XE4A 3TGKE 4MPUA 3SGAE 1ETTH 6CHAB 4KP0A 3ZVFA 1FJSA 1GBJA 3SNCA 1NM6A 7GCHF 2O8UA 1WQSA 3MH4A 1F5RA 4ZAEA 2J94A 3KQBA 2CJIA 3HKJB 3AVZA 1TBQH 1KLJH 9ESTA 3SHAH 2V3OH 3ATIA 1T4UH 4AN7A 1C1QA 1OWKA 4SGAE 3TNSA 2NU3E 1C5WB 4ABEA 3A7YA 2Z6BD 4X6OA 5A0BA 1JRTA 4LZ1H 3S7HB 1GBHA 1AU8A 1ELDE 1O38A 1NRNH 1W2KH 2B7DH 5L2YH 2Z9KA 5L2ZH 1GDQA 1T32A 2A4OA 3AASA 4CREA 2GMTB 1Z8JB 2OC0A 1Y5UT 1YKTA 4X2XA 3HGNA 1JIMA 1BTZA 5L30H 1MUEB 1XVOA 1NPMA 3K6YA 2GDDA 2WPLS 1P2KA 1FXYA 2P3FH 5B6OA 2I6SA 4IN2A 2EA3A 1C2LA 3PLBA 1K1OA 4I32A 5DP5A 2RG3A 2D26C 4FVDA 4YT6H 1H1BA 3QTOH 1O2TA 1FONA 1Y3WA 2YNAA 3R0FA 3LGUA 2W3IA 1C2IA 2PUQH 3SQHE 4DJZB 2OP9A 4J2YB 4WY3A 4MPWA 5EXNA 3E16B 3PWCA 2V3HH 1UHBB 3PMAB 1PQ7A 1Y3UA 3S9AA 1SR5C 5CMXH 1MU6B 1NTPA 1SBWA 2VB0A 1O5EH 2ZWLH 2QYIA 3MO6A 3C27B 1A1RA 3FZZA 3CP7A 2OD3B 2ANKH 3VFEA 4K60A 4JZ1A 5E0HA 3SQEE 4MPXA 1O5CB 2G5NA 2D8WA 1O2HA 2F9PA 1PJPA 3F9EA 3P8NA 1D3DB 1G32B 3ZYDA 2Y5GA 3GCOA 3LJOA 1AKSA 1BBRE 1DSUA 1JMOH 5F6MA 2FODA 1AMHA 4R0IA 3JZ2B 1RTLA 2B8OH 1O2MA 1LVOA 4NCYA 1DLEA 1HJAC 1GWAA 1LO6A 2VWLA 2SGPE 1XUKA 1O3DA 1RXPA 5A8XA 4DY7B 5A8ZA 1HRTH 2ZCHP 1E37B 1UTQA 2J92A 2ZDMA 4I7YH 1E0FD 1C5NH 1Y5AT 1BUIA 1K22H 4YLQH 1EP5A 2BLWA 2FI4E 2F9UA 2STBE 3D49H 2H5DA 3A84A 1AVGH 1RIWC 4MNWA 1IQFA 4VGCC 2UUFB 3T27A 1V2WT 2OC8A 4X1PU 2CV3A 1TGNA 1LCYA 1TQ7B 1GI4A 2BTCE 1O31A 2ZHQH 2BMGB 1ZSLA 1C5MD 3LGTA 4B1TA 4D8NA 1NFXA 5H4IB 1TGSZ 1V2LT 5FX6A 1G36A 1MZDA 2ZFRH 4RKOB 4Y11E 1P3EA 2BM2A 1QB6A 1QL7A 3LGIA 4K5ZA 2C90B 1O3KA 4Y79A 1AWHB 1Y3XA 2C4FH 2BD5A 1OWJA 4UE7H 3A82A 3A85A 4A1TA 4TPIZ 1O3PB 1DUAA 1FIWA 1L1JA 4ISIH 2BDGA 1JRSA 2CXVA 2ESTE 1A46H 1YCPH 1UVUH 4K1TA 1GCDA 4HTCH 1BIOA 2FOMB 1EAXA 3ZZ8A 5DG6A 2ZPQA 4GUXA 1QJ7B 1KYNA 4GSOA 1BTPA 3QK1A 3D65E 1GBIA 4Q80A 1AFQB 1HAHH 5FXLA 4TPYA 4Y10E 3VEQB 3S7KB 4MQAA 4NIYA 1INCA 1D6RA 2WPMS 3QLPH 5GWZA 1N8OB 1S6HA 3GCTG 5JPMH 6ESTA 3QX5H 3ESTA 1FMGA 1W13U 2KAIA 1O30A 3M3TA 4WWYA 3URCA 1XUJA 1S85A 1EUFA 3WY8A 3PO1B 4K8BA 2STAE 1YLDA 1KTSB 3E0NB 1D3QB 1W3CA 1WTHD 2ZFPH 1GJBB 1Z1JA 4R8TB 1OX1A 2LNCA 1K28D 1HAXB 1OWEA 2IN2A 2CHAC 1P10A 3SUGA 3U8TH 2A5IA 4LOYH 4CR9A 3RM0H 1O3AA 1S0RA 2EI8A 3A7ZA 3QZRA 3DFJA 2ZZUH 2A7CA 2ZGXH 2Z3DA 3TK6A 2WV4A 1C5SA 1BB0B 4K1EA 1RD3B 2ZHFH 3QDZB 2FI3E 2XCNA 5C5NA 3RC5A 4HFPB 4MTBA 3HKIB 1V2JT 4AYVB 2HWLB 2ZP0H 5EPNA 3LIWA 4U2WA 3KL6A 1ZGVA 3BTME 4GAWA 4BAKB 3ZZCA 4KTUA 3ATMA 3F9FA 1P2IA 1GMCF 1O35A 1YM0A 4K3JA 1C9PA 4MLFB 1GMDG 1LMWB 8ESTE 2BX4A 5FHTA 3A86A 4Q7XA 1CT0E 3SZNA 4AGKA 2WYGA 1F0SA 4NWLA 2R0LA 2FTMA 3SNDA 2OTVA 1DXWA 1MMJN 2FTLE 1C5XB 2BZAA 1K21H 1SOTA 1ZTLA 4X0WU 1BMNH 3MNBA 1BZXE 1HAIH 2HALA 1SVPA 6GCHF 3E6PH 4NZQA 1BQYA 3EQ0H 2THFB 4I8JA 1E36B 8KME2 1WAYB 4UFDH 1CSOE 1G2LA 1OWHA 3MH6A 1Y59T 2AGEX 5PTPA 1GHXH 4BOHA 2RA3A 1VITH 4WH8A 1EP6A 5JBAS 1IQNA 1UTLM 4X1NU 2AGIX 1S0QA 3P6ZB 4K1SA 1CA0C 1V2KT 2G52A 1QBNA 3MOCA 4I33A 2GV6A 3RXBA 3S69A 1SGRE 1EPTA 3BTEE 1S5SA 1NO9H 2PFEA 2Q6GA 3CS7A 5F8XA 1A0JA 1L2EA 1P2NA 1O5BB 2BXTH 1ABJH 1YLCA 3UWIA 4ZH8A 1O5AB 1W0YH 3LOXA 1KIGH 1O2UA 2A7HA 2F9VA 4RSPA 4TYDA 4D9RA 1P3CA 3DHKH 1QFKH 1EB2A 2XRCA 1OPHB 2GCHF 1CGHA 1K1NA 2ZTZA 1UTMA 2A1DB 3UUZA 3P8FA 4YOGA 1P02A 1FN8A 1MD7A 2GD4B 3E3TA 2BLQA 4X8UH 3UREA 1Y3VA 2ALVA 5JBBS 3UFAA 3BTWE 1LVBA 1UCYK 1C5UA 2BXUH 4FUEA 3FP6E 2H2ZA 2ZKSA 2P94A 5JB9S 1YPGH 2AEIH 4VGCB 1TB6H 2K1QA 1ZRBA 3ZVCA 1O36A 2C8WB 3A8DA 1JBUH 4CH2B 3EE0B 2G51A 3PMJA 1NRPH 5DGJA 4GPGA 2AMQA 3M7UA 1QGFA 4MNYA 1GJCB 1BA8B 4ABAA 4AGJA 4X1SU 1YYY1 3MU0A 2AYWA 1O2RA 3RXFA 3M5NA 1SPJA 1V2NT 2TIOA 1T8MA 4ISHH 2VWNA 3RXMA 1X7AC 1ANEA 1UVTH 2ZF0H 3SNBA 1FUJA 1YP9A 2ZI2H 1QCPA 1SQTA 1QQ4A 2A0QB 3UQOA 1SGYE 2GX4A 2ANWA 1XUHA 2BDAA 3F68H 3A87A 4BAOB 4NZLA 1KXAA 1C9TA 1ZMJA 1C2KA 2FLBH 5ABWA 1W7GH 5JYIA 2GT7A 3U8OH 1J14A 3BTKE 2OC1A 2J9NA 4LK4A 2XC0A 3T2NA 1C1RA 1EATA 4Y6DA 1YBWA 3NCLA 2HNTE 4Y7AA 1EJMA 3MU5A 3M7QA 2PTNA 2VIQA 2BD7A 1LHDH 4WJG2 3A8AA 1BT7A 2W3KA 3OTJE 1O37A 3O8CA 3E8LA 3GCNA 3NWUA 2NU4E 2HRVA 1ZJKA 2JETC 2ASUB 1DFPA 1L4ZA 3BV9B 3GY8A 1DLKB 4K69A 1V2VT 1QB1A 1S83A 2WPHS 1P2OA 3TJNA 4XBCA 2ZDVH 4THNH 3SNEA 2AFQB 1HAGE 3BTQE 4RKJB 5TCCA 2ULLA 1HPGA 2B0FA 3ATWA 2V6NA 2ANYA 1QBVH 2ZA5A 5HXFA 2A7JA 1GI0A 3BN9A 4CH8B 1SC8U 2OLGA 1TA2A 4XDEA 3RXEA 4ABFA 1ELGA 2O9QA 1GJ7B 1WU1A 4NFFA 4JZIA 2ZDNA 1UVSH 1GMHG 1SB1H 4OGYA 1NFYA 1AFEH 2BD9A 1O5GH 1GBLA 2GVFA 2CGAA 2FZZA 5C20A 1C5ZB 2R9PA 3UNSA 3SJIA 5GPIB 1DWEH 3V7TA 1BDAA 1VJAU 3HPTB 3BTFE 4NSVA 2P3UB 5LH8A 3SOSA 3SV2H 1H9HE 1HFDA 3U8RH 3B23B 4I8GA 3SUEA 3PLKA 4OS1A 3RXLA 3TJVA 1EX3A 1O5FH 1QJ6B 3TH3H 4CBNA 4Z6AH 2SNVA 3QO6A 1YF4A 1A3EH 3A89A 1SGNE 2JKHA 2GZ8A 2VH0A 5HYOA 1O2LA 2GT8A 1SQAA 1O0DH 1YCPK 1HV7A 1B0EA 2ZIQH 1UO6A 1EPTC 2BLVA 2XBYA 3QWCH 3SBKA 3RXIA 1T4VH 1UVOA 1AWFH 4NGAH 5C2ZA 3SW2B 1THPB 4FUBA 4LXBH 3SUDA 3SI4H 1FY4A 3OY6U 1LVMA 2PKSB 4ABJA 1Q31A 2D2DA 2V35A 2C8XB 1TGCA 4MVNA 1ZGIA 3IITA 1TNJA 3SNAA 3ENSB 4YOIA 1P0SH 4WVPE 3FP7E 3RXRA 2GP9B 4KKDA 1ELFA 3V3MA 1GHBG 1TPOA 3P8OA 1GHBF 3RUOA 4I31A 3RXHA 1TA6A 2H5CA 5JB8S 3FANA 2BDYA 3MWIU 4ISLA 4JK5A 3BG8A 1GVZA 2BYAX 1GCTB 1G37A 4KTCA 3S9CA 1C5VA 2BY6X 3T25A 5EXLA 1QTFA 2HNTC 1ZPZA 4O97A 5EXMA 1ZRKA 1FY1A 1RS0A 5FX5A 1F0RA 2BY5X 1CHOF 3M3VA 4INHA 2AS9A 3LC3A 1AHTH 1Q3XA 3SU3A 4FUCA 4WH6A 1C4V2 2FOEA 2FP7B 1EPTB 2IPHA 1ZMLA 4GHQA 2GZ9A 3DD2H 1HDTH 3MO9A 4U32A 2R0KA 3CENA 1F0TA 1GI5A 1OOKB 1L4DA 3C1KA 4X2VA 3K6ZA 5EU8A 1NS3A 1O2SA 2BQWB 2WPKS 5IYTA 1A2CH 1PYTC 1TQ0B 1WSSH 5A0CA 5EW2H 2G00A 1UVPA 1G2MA 3MMGA 1O3FA 2IJOB 2ZCLP 2BDIA 1E35B 2ALPA 8LPRA 1YC0A 2ZG0H 1A61H 1GBKA 3MNXA 2J4IA 2F91A 1DUEA 2FS8A 2BX3A 2BVRH 1A7SA 2NU0E 1LHFH 4IC5A 1EB1H 2M5TA 3RXTA 3UR9A 1ZSKA 4BAMB 1IQKA 2BDHA 3W95A 6LPRA 1ACBE 2UUKB 1UTNA 5JDUB 3ZZ5A 2AGGX 3FFGA 1AN1E 1AZ8A 4E7NA 2UWLA 2XWAA 1HCGA 3ZZ4A 2BZ6H 3ZZDA 1XVMA 3Q3YA 3T62A 2OBOA 1ZTJA 3A80A 2XCFA 4A92A 2CN0H 5EQSA 4YM9A 3I78A 4O03A 3EYDA 3SUFA 2WPIS 1C1WH 3ZV8A 3ZZBA 2VGCC 4DW2U 2QA9E 5K7RA 3LH3A 1EZQA 2QC2A 3ZVDA 1O2YA 1XMNB 3RC6A 1GBFA 2Z94A 2BY8X 3QZQA 2ODYB 1XXFA 3GDSA 5FBEA 5GDSH 4DURA 5CE1A 3Q3KA 4GLYA 5TJXA 1BHXF 1BTWA 3LH1A 1G3CA 1DITH 1TX6A 1P2QA 1A0LA 2YNBA 1O2GH 3ZZ6A 2GGVB 2J38A 1TWXB 3U1JB 4TY6A 4FUHA 2QV1A 2R2WU 1O3BA 3ZZAA 2Z7FE 5K0HA 5GCHG 3E0PB 3GY6A 7GCHG 1SG8B 3GDUA 3SHCH 5G4BA 2EI6A 2PW8H 2TGAA 2EI7A 5EG4A 5BPEA 2QGRA 1KXDA 1PQAA 1QIXB 2AERH 5E8EH 3TJUA 1MZAA 4IBLH 2Q6DA 2WPJS 1MTSA 4O3TA 5ESTE 3GCTF 3P17H 3GYMA 1LQDB 3AW1A 1C5OH 3I29A 5ETXA 1D9IA 2C8YB 3EGKH 2G4TA 1OWDA 4CRBA 4H6TA 1O2PA 2DUCA 2FX4A 1RRKA 1AZZA 4MNXA 1VZQH 1P05A 2J2UA 2VGCB 1CQQA 4O3UA 1Q2WA 1DDJA 1OKXA 1T7CA 3GYLB 3TU7H 1PPFE 2BVSH 4DVAU 1O3NA 1ZOMA 2ZO3H 5F03A 1FLEE 2IOTA 5J4QA 3F1SB 3NKKA 4B71A 1EAIA 1DS2E 2SGFE 1ZR0A 3OSYA 1Z1IA 1H8DH 1RJXB 1YPEH 3BEFB 2KAIB 1CVWH 3MI4A 3ZVAA 5FPSA 4ZHMU 1AB9B 5E0JA 1TRNA 2SNWA 2FOGA 1RFNA 1UTOA 5DP9A 4WF8A 4MDSA 2ZPRA 4D7FA 2FOAA 1ETRH 1ORFA 1Z71A 1CBWB 2HGTH 4ISOA 1EXFA 2A4RA 5EQRA 2C93B 3Q76A 2G4UA 1CE5A 1F7ZA 5HM2A 1FY3A 2HPPH 3KHVA 1ANDA 1CHOG 1G30B 1NESE 1RTKA 4ZXXH 3SV6A 3TGIE 4Y8YA 1RIWB 1EQ9A 5AFYH 2HNTF 5F8TA 1ZZZA 3RLYH 3AAVA 3P8GA 5I46H 4ABHA 1IHTH 4GVUA 2ZDLA 2P59A 3RMOH 3SU1A 2PUXB 2XC5A 3M61U 3TK9A 1B5GH 1JOUB 1BJVA 1C5LH 1O5DH 3MO3A 1C5YB 1DM4B 3UNRA 1ZMNA 4WMFA 1GHVH 4B76A 3V0XA 5DP3A 1ELAA 3A7WA 2FPZA 1GI7B 4FU9A 1C2DA 1H4WA 1ZSJA 2PHBA 4AFQA 1F2SE 3H5CB 1L1GA 3M5LA 1PPEE 2G81E 1XKAC 5DP7A 1NRSH 2FXRA 4ISNA 3V13A 4U30A 3TNTA 3DUXH 2O8LA 1SFIA 3FP8E 2Z3EA 5FCRA 1EJNA 1Y3YA 2FIRH 2A5KA 1J9CH 2ZGJA 3NK8A 3SV7A 4XFQA 2F9BH 1DWDH 4DG4A 2Y7ZA 3T29A 1YPLH 3U1IB 3GCHC 1GDUA 3Q00A 1OYTH 2ZCKP 3EA9A 3HK3B 1GL1A 1AY6H 4UDWH 5T3HA 2PR3A 1EOLA 4B2BA 1GPZA 1V2OT 1G3BA 2ZPSA 5DP8A 2C8ZB 2R3YA 3RP2A 2PKSC 4O9VA 3E90B 4KELA 3DT0H 4X8SH 4YZUA 1HAOH 2VU8E 3MU1A 2W26A 5SGAE 1O3CA 3GCHB 1DY9A 5GCHF 1Z8GA 2PLXA 1V2QT 1L1NA 1YPHE 3KGPA 1TALA 1V2UT 3SN8A 3ZVBA 1J8AA 1GI3A 1P04A 1CT2E 4AB8A 3MNCA 3PWBA 5A09A 4ZHAA 3GY4A 3MH5A 1KXFA 1KY9A 1MTUA 1A0HB 1TLDA 3HGPA 1C1PA 5EW1H 2TRMA 3PTBA 5EQQA 2C3SA 1Z8RA 2QXHA 2QCYA 1O2WA 1C4Y2 1MCVA 2WINI 4AFSA 1GBMA 2PGQB 1NFUA 2VJ1A 3SV8A 4LZ4B 1FI8A 1GI1A 4ESTE 1W10U 1MCTA 2PV9B 3GY3A 3M37A 3RXDA 1SGTA 3U69H 3RMLH 3ZZ3A 3RU4D 3SJ9A 3T28A 1TNLA 2CF9H 4CRGA 7LPRA 3RXSA 3TGJE 4TY7A 5CHAC 1AVWA 1MTWA 1KSNA 2D1JA 5LGOA 3MFJA 2ZECA 1DVAH 2BLOA 1V2MT 3MU4A 4FUJA 2HVXA 1C2JA 1A3BH 1OXGA 1TBZH 1NU7B 2G8TA 2A32A 1ZYOA 3VGCC 1SGIB 2AH4X 1AFQC 1GGDB 1ID5H 2O8TA 2UUYA 2ZTYA 2VWMA 5FBIA 1W7XH 2PKAB 4B73A 3B8JA 1VITG 1LHEH 4IGDA 3SJKA 1TBRH 1CT4E 1OP2A 6GCHG 1O3JA 2QF3A 1S81A 1FPCH 1XX9A 3TIUA 2GCTC 3UPEA 1IQMA 1GMDF 3UIRA 1EZXC 1HLTH 3PROA 1P2MA 1LPKB 3MH7A 1FQ3A 3ODDA 3M5MA 2H1UA 1G3DA 4X8TH 1GVLA 5T6DA 4NA7A 2JH5D 2NU1E 2UWOA 3LGYA 3ZZ9A 4JYVH 1DX5M 1NFWA 1GBEA 3BIVH 2NU2E 2XTTB 4NSYA 1L0ZA 4BTTB 4ZKSU 1ARBA 1G3EA 4MPVA 2W5EA 1F5KU 2OXSA 4X6MA 2ZFSA 1OP0A 1EZSC 1UCYE 1QRWA 2BQ6B 1KXBA 1QL9A 2A2XH 1LTOA 2ZHEH 3LU9B 2VWOA 1IQGA 1HXEH 3KCGH 3GY5A 5LPRA 4B74A 3FZDA 4IMQA 1CHGA 1K1MA 3BF6H 5C3NA 1GVKB 4BAHB 3UQVA 4PROA 1G9IE 7ESTE 4BXWA 3QN7A 1S6FA 5A2MH 2P8OB 5DO4H 3SO3A 3B9FH 1SQOA 1WQVH 3OYPA 4E7RG 1HJAB 2W7SA 2P16A 1GHAF 3UR6A 2FLRH 1GHAG 1TONA 1SHYA 3GOVB 3ELAH 3JZ1B 1WTGH 1AD8H 2GCHG 5C1XA 3GY2A 4IC6A 1WCZA 1C2GA 3ATKA 4YTAA 1EKBB 1K1JA 3UTUH 2ZGCA 3PM3A 3P95A 1PQ8A 1HAZB 2VIDA 5HMAA 5FPTA 2Y5FA 1OP8A 1LKBA 2GMTC 4B2CA 2AIPA 1OS8A 5F8ZA 1LPZB 1F5LA 2UUJB 1AQ7A 1THSH 2ZGBH 2BB4A 3HK6B 1UJ1A 2Z9IA 3LGWA 4BAQB 1T8NA 3PMHB 1FV9A 3F9GA 2TBSA 4TWYA 1TAWA 3NZIA 4FUIA 1PQ5A 1C1VH 4AX9H 5LPEA 3LPRA 3A8CA 3K65B 3MNSA 2G5VA 1AVXA 4UONA 1NN6A 1ZTKA 2F9NA 1CGJE 2WYJA 1BMLA 1TX8A 1O2NA 3LKWA 1QRZA 2CHAB 1FY5A 5AF9H 1JIRA 1HUTH 2R2MB 5GJ4B 4AFZA 1V6DA 4WXVA 4FXGH 1C1NA 1GBCA 1AUTC 3SV9A 1TIOA 2F3CE 4ABDA 1FDPA 1P01A 4ASHA 4OS4A 1C2EA 4Y7BA 4BANB 1AUJA 1VITF 2XNIA 4OS5A 2B5TB 1DT2A 5FAHA 4JK6A 4UFEH 4MG3A 1E34B 2BDBA 3LJJA 1PPCE 5T6GA 3LC5A 5TCAA 1XKBC 5DKMA 4BTIB 2FEQH 3PB1E 3S0NA 1ELTA 3Q77A 1Y5BT 3L3TA 1T8LA 4J1YA 3A81A 1ESAA 4X6NA 5FPYA 4CRFA 4B2AA 3O8BA 1Y8TA 1SGPE 1UHBA 2FOHA 2VNTA 1ZHPA 1D3PB 1U6QA 1PPHE 2Y6TA 4WMEA 1A4WH 4X2YA 4UD9H 1TPSA 1A5HA 1IOEA 1IQLA 3TPIZ 2ILNA 2ZNKH 1J16A 1H9LB 2BD2A 1OWIA 4QT8C 4Y76A 1ANCA 1LPGB 1O3OA 1BHXB 4B75A 1THRH 3MU8A 2Z9LA 1Z6JH 5L6NH 3EA7A 1SLUB 2BD3A 3T26A 5JBCS 1VGCB 1WYKA 3RXQA 3ATLA 2PTCE 1IQJA 2BY7X 3O8DA 1GMHF 4UFGH 2SGDE 4ZHLU 1TNIA 1YPJH 2P95A 1SLWB 2SGQE 4DGJA 3LONA 3MHWU 1JWTA 2QXJA 3ZZ7A 1O34A 1H9IE 2XC4A 5BRRE 4X2WA 2BD4A 1MBMA 2FDAA 4D7GA 1FY8E 3VB7A 1K2I1 2YOLA 1GG6C 2OCVB 2ODQA 2JETB 5C5OA 4YLUA 3SU5A 5CHAB 1DY8A 1O33A 2ZFTA 1Z8IB 5GXPA 1ELCA 3RU4T 4X6PA 1TOCB 2W7UA 1DPOA 3RXUA 3W94A 2GTBA 1YCPM 4I8KA 4I8HA 5AFZH 3RU4E 3M5OA 1IQEA 1P11E 3FVFB 2FI5E 3BEIB 1QB9A 3L6PA 2FOCA 3KIDU 3VXEH 3SU2A 1IQHA 1XM1A 4NA9H 2Z9JA 3FAOA 1KTTB 1BTYA 1ELBA 3SU4A 1ZPBA 3TH2H 3RC4A 4FU7A 3SJ8A 3MTYA 2Z9GA 2EEKA 3DA9B 5T6FA 1BRCE 3KQCA 1HAVA 1SMFE 3NUMA 1V2TT 9LPRA 4M7GA 1TMUH 4XOJA 1AGJA 3I77A 3SGBE 1P12E 4YOJA 1GHZA 3V12A 2BD8A 1EASA 1KDQA 3KQEA 4DOQA 4ZKOU 3QGJA 2GCTB 1NROH 2Y81A 3BTTE 3H7OA 1GBBA 2RDLA 3VB3A 1TYNA 1KXEA 4D76A 1O3IA 1BRBE 3SJOA 4A5TS 1GG6B 3PTNA 3LGVA 4NG9H 3UOUA 1CBWC 3HATH 1CGIE 3BG4B 4ZKNU 1O2XA 1GHYH 1C1TA 1BRAA 3GISB 2A2QH 2AMPA 3D23A 2J95A 3U98H 2Q6FA 1NRQH 1FPHH 1ZJDA 3P92A 1O2KA 1VCPA 3TK5A 1UTPA 1BOQA 4NFEA 1FIZA 2SGEE 3VB6A 1GL0E 6CHAC 1YPKH 3BTHE 1J15A 1C1MA 1P06A 5A0AE 4CR5A 1NY22 1GJ5H 3O8RA 3KEEA 1GI6A 4KGAA 4H4FA 1BTHH 7KMEH 3A83A 2BY9X 4CRDA 2XYAA 4YT7H 1P57B 2ZU2A 5DPAA 3RDZA 2OUAA 1HAYB 3MYWA 2ZU3A 4OS6A 1D6WA 3ZVEA 2FYRA 1V2PT 4Y0YE 1MTNC 1UTKA 2H9HA 4CRAA 1IAUA 1DWCH 1P9SA 1RGQA 2LPRA 2VVCA 2ZU4A 2ZTXA 4CHAB 2FM2A 4BNRA 2ZFFH 4INLA 1NZQH 2O8MA 3PYHA 4E05H 2TGPZ 3RXVA 1SSXA 2ZHDA 1AIXH 4OS2A 1P8VC 3F9HA 3SORA 1K1PA 4GCHF 1DOJA 4YO9A 5FCKA 2BVXH 4JZDH 2QIQA 3K2UA 2XWBI 3SGQE 1TNHA 1MTNB 3RM2H 3PV4A 1A5IA 2RA0A 2PGBB 1XUIA 1GHWH 4ABGA 1ABIH 1DANH 2BDCA 1C2FA 4GHTA 1D4PB 2ZEBA 3UNQA 1C2HA 2JH6D 1C2MA 1O3LA 1ESTA 4ZROA 1O3EA 1C5QA 1O2OA 2WUCA 1KLIH 4AYYB 1K1LA 1TGBA 4YESB 2A4QA 3CS0A 1PPGE 3TLOA 1EAWA 1TOMH 1CU1A 2P93A 1UK4A 1O2ZA 1SGFG 1B0FA 1N6XA 3P70B 5C1YA 2P3TB 1EOJA 1FNIA 1WV7H 1EAUA 2XBXA 4U01A 4Q7YA 3A88A 1DWBH 4A1VA 1K9OE 4AORA 1FAKH 2PSYA 4Y8ZA 1ELEE 4H6SB 1O3MA 1ZPCA 5EODA 1D3TB 2HPQH 1DSTA 2PWXA 3BIUH 4TWWA 1GCTC 1NU9A 1TMTH 1AE8H 2FYQA 3KN2A 5C1UA 3KQDA 4AG2A 3K9XB 1HGTH 1LQEA 2TPIZ 4XSKU 2OBQA 1H8IH 4X1RU 4XBBA 1GJAB 1LHCH 4XBDA 4BTUB 8GCHG 3IWMA 1BMAA 2J34A 3SU0A 8GCHF 1WUNH 5HM9A 2QN5T 4INKA 2VIOA 1UCYH 1VGCC 4ZUHA 1TE0A 4NA8A 5DJ7A 1S82A 1NC6A 1MAYA 3TITA 3RXJA 1WOFA 1W14U 2QXGA 2OC7A 1C1OA 1BBRK 1WBGB 4FUDA 1B7XB 1F0UA 1DXPA 1HIAA 2ZC9H 5E0GA 1XUGA 2JH0D 5EGMA 2XXLA 1AI8H 1BTXA 1QURH 4NIWA 5IDKA 2VH6A 3A8BA 1QNJA 4AB9A 1GGDC 1Z7KA 1PFXC 4CBOA 4A1XA 1TRMA 3KNXA 2QAAA 1LHGH 1O32A 2BOKA 3H7TA 3S9BA 3ITIA 1IQIA 1QBOA 2FMJA 1ANBA 1FZZA 1LDTT 3LT3A 4Q2KA 3Q3XA 1SGCA 1F92A 5HGGA 3QUMP 2ZHWH 2GKVE 2AMDA 5DK1A 1TABE 4SGBE 1MD8A 4IMZA 4IN1A 3BTGE 1SGDE 3EDXB 3M3SA 2H6MA 1SFQB 2ZQ2A 1N1LA 4D9QA 1SL3A 3OU0A 2H9TH 2OQUA 5E2PA 2V0BA 5ESBA 1GBAA 3EA8A 2GZ7A 3RXOA 1NT1A 4FVBA 3T5FH 1FAXA 4HI3A 1N8OC 3EAJA 3BEUA 3PMBB 1MU8B 3M7TA 2G55A 1UK2A 4NWKA 4HZHA 1MBQA 4MNVA 3A7VA 4F4OC 5GIBA 1MQ5A 5A8YA 3OY5U 1VJ9U 1V3XA 5J4SA 3GY7A 1P09A 1HAVB 1GBDA 2FOFA 5EPYA 1HJ8A 1KDQB 1TFXA 3ZYEA 2WV5A 3M35A 1CA8B 1OSSA 4Y8XA 4UFFH 1BRUP 4K2YA 1GDNA 1ESBA 1V2ST 2PSXA 1O3GA 4ZXYH 3QGNB 1DE7H 1DICA 2UWPA 2TGTA 2WUBA 1VR1H 3SU6A 1XUFA 3ODFA 1O3HA 1KXCA 2EC9H 1SLXB 3RXKA 1EZUC 1QY6A 2FS9A 4DIIH 2GV7A 1C5TA 4DIHH 4WXIA 3VB4A 1W8BH 4WMDA 3VXFH 4ABIA 2SFAA 4JZEH 2P8OC 3L33A 1YPMH 1TMBH 4AG1A 2ZQ1A 1Z6EA 1TNGA 1T31A 1MKWK 1SGQE 1P03A
chains in the Genus database with same CATH superfamily
1YPHC 1QR3E 1HBTH 2ZU5A 2V7QD 3DFLA 5I25A 1AB9C 3TH4H 2XW9A 3E1XB 1IHSH 4H42U 1C1SA 3PLPA 4P00A 2OINA 3F2GA 1NRRH 2Q1JA 1C1UH 1GJ4H 4K8YA 3E91A 5EOKA 1LVYA 3STIA 1CA0B 1GI8B 3ZV9A 1HAPH 5E2OA 1HJ9A 1QJ1B 4BXSA 4OS7A 2XBVA 2ZGHA 1C5PA 1QHRB 2FX6A 2HLCA 3BG4C 2BHGA 2O8WA 3TJOA 3A7XA 2SGAA 2ZDAH 1OYQA 2A45B 1TX7A 1UMAH 1BMMH 4Z0KA 1VCWA 1CO7E 1JXPA 2TGDA 1QRXA 1BJUA 4I8LA 1PYTD 3M36A 3UY9A 1MAXA 2HOBA 3VB5A 5DP6A 3A7TA 3LDXH 4A6LA 4ZMAH 1SHHB 2CMYA 4IS5A 1YWUA 1QL8A 5C67A 2VINA 1K1IA 1HNEE 2XBWA 1HB0B 1W11U 4Q7ZA 3BTDE 4JCNA 1SGEE 4OGXA 1GJ8B 3VPKA 4A7IB 1MKXH 3TVJB 4AFUA 2F9OA 4ABBA 3PV2A 4NIVA 3QTVH 1J17T 1RTFB 1T8OA 3RXPA 1MKXK 1ARCA 2A31A 1FN6A 4DT7B 4AOQA 3AW0A 1O2IA 1E38B 1GJ6A 4FU8A 1SGFA 3RXCA 1MTVA 2PKAA 2Y7XA 3VGCB 2ZDKA 1UW7A 2Y80A 1TGTA 2Z3CA 3RXGA 1E1QD 4X8VH 1ZHMA 1N6YA 1BCUH 1V2RT 2ANMH 3PO1C 1HYLA 1TNKA 2VIWA 4CHAC 4Y0ZE 1S84A 4DCDA 3GICB 4UEHH 2F83A 1YGCH 4X1QU 3GS9A 2EQNA 5AVDA 1W12U 3F3BA 3RXAA 4FUGA 4FUFA 2OK5A 2VVUA 2QY0B 5DP4A 2Y5HA 3URDA 1UTJA 2VIVA 1GBTA 1P2JA 1BTUA 1W0ZU 5JBTA 4KTSA 1TPAE 4Y71A 1GJ9B 3OX7U 4JMYA 3STJA 1O39A 2H9EH 4DT4A 1AO5A 4CRCA 1C5RA 4IW4E 2IPQX 1SI5H 3BSQA 3RMNH 1ZLRA 3U9AH 2OQ5A 4ASUD 2DE9A 1XXDA 5LPFA 1P9UA 2GDEH 2ZU1A 4JZFH 5DN6D 1A5GH 1UK3A 1ZHRA 1QA0A 1TRYA 2QXIA 1C4U2 1LKAA 4JYUH 1BBRH 1KLTA 1MKWH 1HIAB 1AKSB 1PPZA 2BOHB 1GMCG 2BQ7B 3RMMH 5HKKD 1GI2A 2Y82A 1O2QA 4E06H 1AE5A 2CF8H 2R3UA 1GJDB 4F49A 3IG6B 4TSFD 1ETSH 1M9UA 1SOZA 2AIQA 3UOPA 1W0KD 2VIPA 4HGCA 4ZKRU 4NIXA 5AHGH 1QA7A 3F6UH 2VVVA 2FO9A 2DE8A 1GI9B 3KF2A 4AZ2B 3N7OA 2ODPA 4RN6A 1ELVA 3AAUA 4JYTA 1O2JA 2FESH 2NWNA 3R3GB 3ZVGA 3SI3H 3UWJH 4GCHG 1SLVB 3G01A 1O2VA 2A5AA 2V3MA 1EJAA 2FOBA 2FWWA 3D62A 2RCEA 2A4GA 1BITA 1QQUA 4RT1A 1MQ6A 3NXPA 2I6QA 3GDVA 2B9LA 1VCQA 1MH0A 2QF0A 1TPPA 1PPBH 2ZFQH 1HXFH 3NPSA 3RLWH 4XE4A 3TGKE 4MPUA 3SGAE 1ETTH 1FX0B 6CHAB 3WWBA 4KP0A 3ZVFA 1FJSA 1GBJA 3SNCA 1NM6A 7GCHF 2O8UA 1WQSA 3MH4A 1F5RA 4ZAEA 2J94A 3KQBA 2CJIA 3HKJB 3AVZA 1TBQH 1KLJH 9ESTA 3SHAH 2V3OH 3ATIA 1T4UH 4AN7A 1C1QA 1OWKA 4SGAE 3TNSA 2NU3E 1C5WB 4ABEA 4YXWD 3A7YA 2Z6BD 4X6OA 5A0BA 1JRTA 4LZ1H 3S7HB 1GBHA 1AU8A 1ELDE 1O38A 1NRNH 1W2KH 2B7DH 5L2YH 2Z9KA 5L2ZH 1GDQA 1T32A 2A4OA 3AASA 4CREA 2GMTB 1Z8JB 2OC0A 1Y5UT 1YKTA 4X2XA 3HGNA 1JIMA 2QF4A 1BTZA 5L30H 1MUEB 1XVOA 2WPDD 1NPMA 3K6YA 2GDDA 2WPLS 1P2KA 1FXYA 4TT3D 2P3FH 5B6OA 2I6SA 4IN2A 2EA3A 1C2LA 3PLBA 1K1OA 3PRBA 4I32A 5DP5A 2RG3A 2D26C 4FVDA 5EJZA 4YT6H 1H1BA 3QTOH 1O2TA 1FONA 1Y3WA 2YNAA 3R0FA 3LGUA 2W3IA 1C2IA 2PUQH 3SQHE 4DJZB 2OP9A 4J2YB 4WY3A 4MPWA 5EXNA 3E16B 3PWCA 2V3HH 1UHBB 3PMAB 1PQ7A 1Y3UA 3S9AA 1SR5C 5CMXH 1MU6B 1NTPA 1SBWA 2VB0A 1O5EH 2F43B 2ZWLH 2QYIA 3MO6A 3C27B 1A1RA 3FZZA 3CP7A 2OD3B 2ANKH 3VFEA 4K60A 4JZ1A 5E0HA 3SQEE 4MPXA 1O5CB 2G5NA 2D8WA 1O2HA 2F9PA 1PJPA 3F9EA 3P8NA 1D3DB 2YMSC 1G32B 3ZYDA 2Y5GA 3GCOA 3LJOA 1AKSA 1BBRE 1DSUA 1JMOH 5F6MA 2FODA 1AMHA 4R0IA 3JZ2B 1RTLA 2B8OH 1O2MA 1LVOA 4NCYA 1DLEA 1H8HD 1HJAC 1GWAA 1LO6A 2VWLA 2SGPE 1XUKA 1O3DA 1RXPA 5A8XA 4DY7B 5A8ZA 1HRTH 2ZCHP 4F48B 1E37B 1UTQA 2J92A 2ZDMA 4I7YH 1E0FD 1C5NH 1Y5AT 1BUIA 1K22H 2J5UA 3U28C 4YLQH 1EP5A 2BLWA 2FI4E 2F9UA 2STBE 3D49H 2H5DA 3A84A 1AVGH 1RIWC 4MNWA 1IQFA 4VGCC 2UUFB 3T27A 1V2WT 2OC8A 4X1PU 2CV3A 1TGNA 1LCYA 1TQ7B 1GI4A 2BTCE 1O31A 2ZHQH 2BMGB 3H09A 1ZSLA 1C5MD 3LGTA 4B1TA 4D8NA 1NFXA 5H4IB 1TGSZ 1V2LT 2HLDD 5FX6A 1G36A 1MZDA 2ZFRH 4RKOB 4Y11E 1P3EA 2BM2A 1QB6A 1QL7A 3LGIA 4K5ZA 2C90B 1O3KA 4Y79A 1AWHB 1Y3XA 2C4FH 2BD5A 1OWJA 4UE7H 3A82A 3A85A 4A1TA 4TPIZ 1O3PB 1DUAA 1FIWA 1L1JA 4ISIH 2BDGA 1JRSA 1W0JD 2CXVA 2ESTE 1A46H 1YCPH 1UVUH 4K1TA 1GCDA 4HTCH 1BIOA 2FOMB 1EAXA 3ZZ8A 5DG6A 3N99A 2ZPQA 4GUXA 1QJ7B 1KYNA 2XNDD 4GSOA 1BTPA 3QK1A 1E1RD 2KCYA 3D65E 1GBIA 4Q80A 1AFQB 1HAHH 3DCLA 5FXLA 4TPYA 4Y10E 3VEQB 3S7KB 4MQAA 4NIYA 1INCA 1D6RA 2WPMS 3QLPH 5GWZA 4I86A 1N8OB 1S6HA 3GCTG 5JPMH 6ESTA 3QX5H 3ESTA 1FMGA 1W13U 2KAIA 1O30A 3M3TA 4WWYA 3URCA 1XUJA 1S85A 1EUFA 2L6OA 3MQKC 3WY8A 3PO1B 4K8BA 2STAE 1YLDA 1KTSB 3E0NB 1D3QB 1W3CA 1WTHD 2K0QA 2ZFPH 1GJBB 1Z1JA 4R8TB 1OX1A 2LNCA 1K28D 1HAXB 1OWEA 2IN2A 2CHAC 1P10A 3SUGA 3U8TH 2A5IA 4LOYH 4CR9A 3RM0H 1O3AA 1S0RA 2EI8A 3A7ZA 3QZRA 3DFJA 2ZZUH 2A7CA 2ZGXH 3W1EA 2Z3DA 3TK6A 2WV4A 1C5SA 1BB0B 4K1EA 3SZEA 1RD3B 2ZHFH 3QDZB 2FI3E 2XCNA 5C5NA 3RC5A 4HFPB 4MTBA 3HKIB 1V2JT 4AYVB 2HWLB 2ZP0H 5EPNA 3LIWA 4U2WA 3KL6A 1ZGVA 3BTME 4GAWA 4BAKB 3ZZCA 3FN8A 4KTUA 3ATMA 3F9FA 2KR7A 1P2IA 1GMCF 1O35A 1YM0A 2L74A 4K3JA 1C9PA 4MLFB 1GMDG 1LMWB 8ESTE 2BX4A 5FHTA 3A86A 4Q7XA 1CT0E 3SZNA 4AGKA 2WYGA 1F0SA 4NWLA 2R0LA 2FTMA 3SNDA 2OTVA 1DXWA 1MMJN 2FTLE 1C5XB 2BZAA 1K21H 1SOTA 2WV9A 1ZTLA 4X0WU 1BMNH 3MNBA 1BZXE 1HAIH 2HALA 1SVPA 6GCHF 3E6PH 4NZQA 1BQYA 3EQ0H 2THFB 4I8JA 1E36B 8KME2 1WAYB 4UFDH 1CSOE 1G2LA 1OWHA 3MH6A 1Y59T 2AGEX 5PTPA 1GHXH 4BOHA 2RA3A 1VITH 4WH8A 1EP6A 5JBAS 1IQNA 1UTLM 4X1NU 2AGIX 1S0QA 5CDFE 2LP6A 3P6ZB 4K1SA 1CA0C 1V2KT 2G52A 1QBNA 3MOCA 4I33A 2GV6A 3RXBA 3S69A 1SGRE 1EPTA 3BTEE 1S5SA 1NO9H 2PFEA 3KQ5A 3CS7A 5F8XA 2Q6GA 1WDIA 1A0JA 1L2EA 1P2NA 1O5BB 2BXTH 1ABJH 1YLCA 3UWIA 4ZH8A 1O5AB 1W0YH 3LOXA 1KIGH 2M2AA 1O2UA 2A7HA 2F9VA 4RSPA 4TYDA 4D9RA 1P3CA 3DHKH 1QFKH 1EB2A 2XRCA 1OPHB 2GCHF 1CGHA 1K1NA 2ZTZA 1UTMA 2A1DB 3UUZA 2VBCA 3P8FA 4YOGA 1P02A 1FN8A 1MD7A 2GD4B 3E3TA 2BLQA 4X8UH 3UREA 1Y3VA 2ALVA 5JBBS 3KYFA 3UFAA 4B6EA 3BTWE 1LVBA 1UCYK 1C5UA 2BXUH 4FUEA 3FP6E 2H2ZA 2ZKSA 2P94A 5JB9S 1YPGH 2AEIH 4VGCB 1TB6H 2W6ID 2K1QA 1ZRBA 3ZVCA 1O36A 2C8WB 3A8DA 1JBUH 4CH2B 3EE0B 2G51A 4Q4LA 3PMJA 1NRPH 5DGJA 4GPGA 2AMQA 3M7UA 1QGFA 3CNRA 4MNYA 1GJCB 1BA8B 4ABAA 4AGJA 4X1SU 1YYY1 3MU0A 2AYWA 1O2RA 3RXFA 3M5NA 1SPJA 1V2NT 2TIOA 1T8MA 1YLNA 4ISHH 2VWNA 3RXMA 1X7AC 1ANEA 1UVTH 4HG6A 2ZF0H 3SNBA 1FUJA 1YP9A 2ZI2H 1QCPA 1SQTA 1QQ4A 2A0QB 3UQOA 1SGYE 2GX4A 2ANWA 1XUHA 2BDAA 3F68H 3A87A 4BAOB 4NZLA 1KXAA 1C9TA 5KEDA 1ZMJA 1C2KA 2FLBH 5ABWA 1W7GH 5JYIA 2GT7A 3U8OH 1J14A 3BTKE 2OC1A 2J9NA 4LK4A 2XC0A 3T2NA 1C1RA 1EATA 4Y6DA 1YBWA 3NCLA 2HNTE 4Y7AA 1EJMA 3MU5A 3M7QA 2PTNA 2VIQA 2BD7A 1LHDH 4WJG2 3A8AA 1BT7A 2W3KA 3OTJE 1O37A 3O8CA 3E8LA 1S6LA 3GCNA 3NWUA 2NU4E 2HRVA 1ZJKA 2JETC 2ASUB 1DFPA 1L4ZA 3BV9B 3GY8A 1DLKB 4K69A 1V2VT 1QB1A 1S83A 2WPHS 1P2OA 3TJNA 4XBCA 2ZDVH 4THNH 3SNEA 2AFQB 1HAGE 3BTQE 4RKJB 1NBME 5TCCA 3N7DA 2ULLA 1HPGA 2B0FA 3ATWA 2V6NA 2ANYA 1QBVH 2ZA5A 5HXFA 2A7JA 4OM9A 1GI0A 3BN9A 4CH8B 1SC8U 2OLGA 1TA2A 4XDEA 3RXEA 4ABFA 1ELGA 2O9QA 1GJ7B 1WU1A 4NFFA 4JZIA 2ZDNA 1UVSH 2RDEA 1GMHG 1SB1H 4OGYA 1NFYA 5C0UA 1AFEH 2BD9A 1O5GH 1GBLA 3OTPA 2GVFA 2CGAA 2FZZA 5C20A 1C5ZB 2R9PA 3UNSA 3SJIA 5GPIB 1DWEH 3V7TA 1BDAA 3PRDA 1VJAU 3HPTB 3BTFE 4NSVA 2P3UB 5LH8A 3SOSA 3SV2H 1H9HE 1HFDA 3U8RH 3B23B 4I8GA 3SUEA 3PLKA 4OS1A 3RXLA 3TJVA 1EX3A 1O5FH 1QJ6B 3KYGA 3TH3H 4CBNA 4Z6AH 2J98B 2SNVA 3QO6A 1YF4A 1A3EH 3A89A 1SGNE 2JKHA 2GZ8A 2VH0A 5HYOA 1O2LA 2GT8A 1SQAA 1O0DH 1YCPK 1HV7A 1B0EA 2ZIQH 1UO6A 1EPTC 2BLVA 2XBYA 3QWCH 3SBKA 3RXIA 1T4VH 1UVOA 1AWFH 4NGAH 5C2ZA 3SW2B 1THPB 4FUBA 4LXBH 3SUDA 3SI4H 1FY4A 3OY6U 1LVMA 2PKSB 4ABJA 1Q31A 2D2DA 2V35A 2C8XB 1TGCA 4MVNA 1ZGIA 3IITA 1TNJA 4Z1MD 3SNAA 3ENSB 4YOIA 1P0SH 4WVPE 3FP7E 3RXRA 2GP9B 2XOKD 4ZCNA 4KKDA 1ELFA 3V3MA 3DSOA 1GHBG 1TPOA 3P8OA 1GHBF 3RUOA 4I31A 3RXHA 1BMFD 1TA6A 2H5CA 5JB8S 3FANA 2BDYA 3MWIU 4ISLA 4JK5A 3BG8A 1GVZA 2BYAX 1SQRA 1GCTB 1G37A 4KTCA 5C17A 3S9CA 1C5VA 2BY6X 5F53A 5EXLA 3T25A 1QTFA 2HNTC 1ZPZA 4O97A 5EXMA 1ZRKA 1FY1A 1RS0A 5FX5A 1F0RA 2BY5X 1CHOF 3OEED 3M3VA 3DSPA 4INHA 2AS9A 3LC3A 1AHTH 1Q3XA 3SU3A 4FUCA 4WH6A 2KCAA 1C4V2 2FOEA 2FP7B 1EPTB 2IPHA 1ZMLA 4GHQA 2GZ9A 3DD2H 1HDTH 3MO9A 5B6LA 4U32A 2R0KA 3CENA 1F0TA 1GI5A 1OOKB 1L4DA 3C1KA 4X2VA 3K6ZA 5EU8A 1NS3A 1O2SA 2BQWB 2WPKS 5IYTA 1A2CH 1PYTC 1TQ0B 1WSSH 5A0CA 5EW2H 2G00A 1UVPA 1G2MA 3MMGA 1O3FA 2IJOB 2ZCLP 2BDIA 1E35B 2ALPA 8LPRA 1YC0A 2ZG0H 1A61H 1GBKA 3MNXA 2J4IA 2F91A 3WWFA 1DUEA 2FS8A 2BX3A 2BVRH 1A7SA 2NU0E 1LHFH 4IC5A 1EB1H 2M5TA 3RXTA 3UR9A 1ZSKA 4BAMB 1IQKA 2BDHA 3W95A 6LPRA 1ACBE 2UUKB 1UTNA 5JDUB 3ZZ5A 2AGGX 3FFGA 1AN1E 1AZ8A 4E7NA 2UWLA 2XWAA 4RI0A 1HCGA 3ZZ4A 2BZ6H 3ZZDA 1XVMA 3Q3YA 3T62A 2OBOA 1ZTJA 3A80A 2XCFA 4A92A 2CN0H 5EQSA 4YM9A 3I78A 4O03A 3EYDA 3SUFA 2WPIS 1C1WH 3ZV8A 3ZZBA 2VGCC 4DW2U 2QA9E 5K7RA 3LH3A 1EZQA 2QC2A 3ZVDA 1O2YA 1XMNB 3RC6A 1GBFA 2Z94A 2BY8X 3QZQA 2ODYB 1XXFA 3GDSA 5FBEA 5GDSH 4DURA 5CE1A 3Q3KA 4GLYA 5TJXA 1BHXF 1BTWA 3LH1A 1G3CA 1DITH 1TX6A 1P2QA 1A0LA 2YNBA 1O2GH 3ZZ6A 2GGVB 2J38A 1TWXB 3U1JB 4TY6A 4FUHA 2QV1A 2R2WU 1O3BA 3ZZAA 2Z7FE 5K0HA 5GCHG 3E0PB 5EJLA 3GY6A 7GCHG 2JIZD 1SG8B 3GDUA 3SHCH 5EJ1A 3EE7A 3N7EA 5G4BA 2EI6A 2PW8H 2TGAA 2EI7A 5EG4A 1MABB 5BPEA 2QGRA 1KXDA 1PQAA 1QIXB 2AERH 5E8EH 3TJUA 1MZAA 4IBLH 2Q6DA 2WPJS 1MTSA 4O3TA 5ESTE 3GCTF 3P17H 3GYMA 1LQDB 3AW1A 1C5OH 3I29A 5ETXA 1D9IA 2C8YB 3EGKH 2G4TA 1OWDA 4CRBA 4H6TA 1O2PA 2DUCA 2FX4A 1RRKA 1AZZA 4MNXA 1VZQH 1P05A 2J2UA 2VGCB 1CQQA 4O3UA 1Q2WA 1DDJA 1OKXA 1T7CA 2J98A 3GYLB 3TU7H 1PPFE 2BVSH 4DVAU 1O3NA 1ZOMA 2ZO3H 4ACBA 5F03A 1FLEE 2IOTA 5J4QA 3F1SB 3NKKA 4B71A 1EAIA 1DS2E 2SGFE 1ZR0A 3OSYA 1Z1IA 1H8DH 1RJXB 1YPEH 3BEFB 2KAIB 1CVWH 3MI4A 3ZVAA 5FPSA 4ZHMU 1AB9B 5E0JA 1TRNA 2SNWA 2FOGA 1RFNA 1UTOA 5DP9A 2KCPA 4WF8A 4MDSA 2ZPRA 4D7FA 2FOAA 1ETRH 3OAAD 1ORFA 1Z71A 1CBWB 2HGTH 4ISOA 1EXFA 2A4RA 5EQRA 2C93B 3Q76A 2G4UA 1CE5A 1F7ZA 5HM2A 1FY3A 2HPPH 3KHVA 1ANDA 1CHOG 1G30B 1NESE 1RTKA 4ZXXH 3SV6A 3TGIE 4Y8YA 2JDID 1RIWB 2KFWA 1EQ9A 5AFYH 2HNTF 5F8TA 1ZZZA 3RLYH 3AAVA 3P8GA 5I46H 4ABHA 1IHTH 4GVUA 2ZDLA 2P59A 3RMOH 3SU1A 2PUXB 1VKYA 2XC5A 3M61U 3TK9A 1B5GH 1JOUB 1BJVA 1C5LH 1O5DH 3MO3A 1C5YB 1DM4B 3UNRA 1ZMNA 4WMFA 1GHVH 4B76A 3V0XA 5DP3A 1ELAA 3A7WA 2FPZA 1GI7B 4RT0A 4FU9A 1C2DA 5CHBA 1H4WA 1ZSJA 2PHBA 4AFQA 1F2SE 3H5CB 1L1GA 3M5LA 1PPEE 2G81E 1XKAC 5DP7A 5DSFA 1NRSH 2FXRA 4ISNA 3V13A 4U30A 3TNTA 3DUXH 2O8LA 1SFIA 3FP8E 2Z3EA 5FCRA 1EJNA 1Y3YA 2FIRH 2A5KA 1J9CH 2ZGJA 3NK8A 3SV7A 4XFQA 2F9BH 1DWDH 5GNDA 4DG4A 2Y7ZA 3T29A 1YPLH 3F0PA 3U1IB 3GCHC 1GDUA 3Q00A 1OYTH 2ZCKP 3EA9A 3HK3B 1GL1A 1AY6H 4UDWH 5T3HA 2PR3A 1EOLA 4B2BA 1GPZA 1V2OT 1G3BA 2ZPSA 5DP8A 2C8ZB 2R3YA 3RP2A 2PKSC 4O9VA 3E90B 4KELA 3DT0H 4X8SH 4YZUA 1HAOH 2VU8E 3MU1A 2W26A 5SGAE 1O3CA 3GCHB 1DY9A 5GCHF 1Z8GA 2PLXA 1OHHD 1V2QT 1L1NA 1YPHE 3KGPA 1TALA 1V2UT 3SN8A 3ZVBA 1J8AA 1GI3A 1P04A 1CT2E 4AB8A 3MNCA 3PWBA 5A09A 4ZHAA 3GY4A 3MH5A 1KXFA 1KY9A 1MTUA 1A0HB 1TLDA 3HGPA 1C1PA 5EW1H 2TRMA 3PTBA 5EQQA 2C3SA 1Z8RA 2QXHA 2QCYA 1O2WA 1C4Y2 1MCVA 2WINI 4AFSA 1GBMA 2PGQB 1NFUA 2VJ1A 5IK2D 3SV8A 4LZ4B 1FI8A 1GI1A 4ESTE 1W10U 1MCTA 2PV9B 3GY3A 3M37A 3RXDA 1SGTA 2IJD1 3U69H 3RMLH 3ZZ3A 3RU4D 3SJ9A 3T28A 1TNLA 2CF9H 4CRGA 7LPRA 3WW7A 3RXSA 3TGJE 4TY7A 3UB0A 5CHAC 1AVWA 1MTWA 1KSNA 2D1JA 5LGOA 3MFJA 2ZECA 1DVAH 2BLOA 1V2MT 3MU4A 4FUJA 2HVXA 1C2JA 1A3BH 1OXGA 1TBZH 1NU7B 2G8TA 2A32A 1ZYOA 3VGCC 1SGIB 2AH4X 1AFQC 1GGDB 1ID5H 2O8TA 2UUYA 2ZTYA 2VWMA 5FBIA 1W7XH 2PKAB 4B73A 2KM0A 3B8JA 1VITG 1LHEH 4IGDA 3SJKA 1TBRH 1CT4E 1OP2A 6GCHG 1O3JA 2QF3A 1S81A 1FPCH 1XX9A 3TIUA 2GCTC 3F2HA 3UPEA 1IQMA 1GMDF 3UIRA 1EZXC 1HLTH 3PROA 1P2MA 1LPKB 3MH7A 1FQ3A 3ODDA 3M5MA 2H1UA 1G3DA 4X8TH 1GVLA 5T6DA 4NA7A 2JH5D 2NU1E 2UWOA 3LGYA 3ZZ9A 4JYVH 1DX5M 1NFWA 1GBEA 3BIVH 2NU2E 2XTTB 4NSYA 1L0ZA 4BTTB 4ZKSU 1ARBA 1G3EA 4MPVA 2W5EA 1F5KU 2OXSA 4X6MA 2ZFSA 1OP0A 1EZSC 1UCYE 1QRWA 2BQ6B 1KXBA 1QL9A 2A2XH 2LELA 1LTOA 2ZHEH 3LU9B 2VWOA 1IQGA 1HXEH 3KCGH 3GY5A 5LPRA 4B74A 3FZDA 4IMQA 2KCOA 1CHGA 1K1MA 3BF6H 5C3NA 1GVKB 4XRNA 4BAHB 3UQVA 4PROA 1G9IE 7ESTE 4BXWA 3QN7A 1S6FA 5A2MH 2P8OB 5DO4H 3SO3A 3B9FH 1SQOA 1WQVH 3OYPA 4E7RG 1HJAB 2W7SA 2P16A 1GHAF 3UR6A 1K0HA 2FLRH 1GHAG 1TONA 1SHYA 3GOVB 3ELAH 3JZ1B 1WTGH 1AD8H 2GCHG 5C1XA 3GY2A 4IC6A 2WZQA 2K8IA 1WCZA 1C2GA 3ATKA 4YTAA 1EKBB 1K1JA 3UTUH 2ZGCA 3PM3A 3P95A 5HIYA 1PQ8A 1HAZB 2VIDA 5HMAA 5FPTA 2Y5FA 1OP8A 1LKBA 2GMTC 4B2CA 2AIPA 1OS8A 5EIYA 5F8ZA 1LPZB 1F5LA 2UUJB 1AQ7A 1THSH 2ZGBH 2BB4A 3HK6B 2KX4A 3F2FA 1UJ1A 2Z9IA 3LGWA 4BAQB 1T8NA 3PMHB 1FV9A 3F9GA 2TBSA 4TWYA 1TAWA 3NZIA 4FUIA 1PQ5A 1C1VH 4AX9H 5LPEA 3LPRA 3A8CA 3K65B 3MNSA 2G5VA 1AVXA 4UONA 1NN6A 1ZTKA 2F9NA 1CGJE 2WYJA 1BMLA 1TX8A 1O2NA 3LKWA 1QRZA 2CHAB 1FY5A 5AF9H 1JIRA 1HUTH 1KMHB 2R2MB 5GJ4B 4AFZA 1V6DA 4WXVA 4FXGH 1COWD 1C1NA 1GBCA 1AUTC 5HIZA 3SV9A 1TIOA 2F3CE 4ABDA 1FDPA 3PV5A 1P01A 4ASHA 4OS4A 1C2EA 4Y7BA 4BANB 1AUJA 1VITF 2XNIA 4OS5A 2B5TB 1DT2A 5FAHA 4JK6A 4UFEH 4MG3A 1E34B 2BDBA 3LJJA 1PPCE 5T6GA 3LC5A 5TCAA 1XKBC 5DKMA 4BTIB 2FEQH 2EY4C 3PB1E 3S0NA 1ELTA 3Q77A 1Y5BT 3L3TA 1T8LA 4J1YA 3A81A 1ESAA 4X6NA 5FPYA 4CRFA 4B2AA 3O8BA 1Y8TA 1SGPE 1UHBA 2FOHA 2VNTA 1ZHPA 1D3PB 1U6QA 1PPHE 2Y6TA 4WMEA 1A4WH 1EFRD 4X2YA 4UD9H 1TPSA 1A5HA 1IOEA 1IQLA 3TPIZ 2ILNA 2ZNKH 1J16A 1H9LB 2BD2A 1OWIA 3F0OA 4QT8C 4Y76A 1ANCA 2JJ2D 1LPGB 1O3OA 1BHXB 4B75A 1THRH 3MU8A 2Z9LA 1H8ED 1Z6JH 5L6NH 2JJ1D 3EA7A 1SLUB 2BD3A 3T26A 5JBCS 1VGCB 1WYKA 3RXQA 3ATLA 2PTCE 1IQJA 2BY7X 3O8DA 1GMHF 4UFGH 2SGDE 4ZHLU 1TNIA 1YPJH 2P95A 1SLWB 2SGQE 4DGJA 3LONA 3MHWU 1JWTA 2QXJA 3ZZ7A 3FO8D 2CK3D 1O34A 1H9IE 2XC4A 5BRRE 4X2WA 2BD4A 1MBMA 2FDAA 4D7GA 1FY8E 3VG8A 3VB7A 1K2I1 2YOLA 1GG6C 2OCVB 2ODQA 2JETB 5C5OA 4YLUA 3SU5A 5CHAB 1DY8A 1O33A 2ZFTA 4F55A 1Z8IB 5GXPA 2WSSD 1ELCA 3RU4T 1SKYE 1TOCB 2YMSD 4X6PA 2W7UA 1DPOA 3RXUA 3W94A 2GTBA 1YCPM 4I8KA 4I8HA 5AFZH 3RU4E 3M5OA 1IQEA 1P11E 3FVFB 2FI5E 3BEIB 1QB9A 3L6PA 2FOCA 3KIDU 3VXEH 3FKSD 3SU2A 1IQHA 1XM1A 4NA9H 2Z9JA 3FAOA 1KTTB 1BTYA 1ELBA 3SU4A 1ZPBA 3TH2H 3RC4A 4FU7A 3SJ8A 3MTYA 2GJGA 2Z9GA 2EEKA 3DA9B 5T6FA 1BRCE 3KQCA 3FOAA 2RFKC 1HAVA 1SMFE 3NUMA 1V2TT 9LPRA 4M7GA 4FOUC 1TMUH 4XOJA 1AGJA 3DSGA 3I77A 4FETA 3SGBE 5T1VA 1P12E 4YOJA 1GHZA 4P02A 3UAIC 3V12A 2BD8A 1WXRA 1EASA 1KDQA 3KQEA 2QE7D 4DOQA 3QGJA 4ZKOU 2GCTB 1NROH 2Y81A 1YY3A 3BTTE 3H7OA 1GBBA 2RDLA 3VB3A 4ACAA 1TYNA 1KXEA 4D76A 1O3IA 1BRBE 3SJOA 4A5TS 1GG6B 3PTNA 3LGVA 4NG9H 3UOUA 1CBWC 3HATH 1CGIE 3BG4B 4ZKNU 2W6JD 1O2XA 1GHYH 1C1TA 1BRAA 3GISB 2A2QH 2AMPA 3D23A 2J95A 3U98H 2Q6FA 1NRQH 1FPHH 1ZJDA 3P92A 1O2KA 1VCPA 3TK5A 1UTPA 1BOQA 2HVYB 4NFEA 1FIZA 2SGEE 3VB6A 1GL0E 6CHAC 1YPKH 3BTHE 1J15A 1C1MA 1P06A 5A0AE 4CR5A 1NY22 1GJ5H 3O8RA 3KEEA 1GI6A 4KGAA 4H4FA 1BTHH 7KMEH 3A83A 2BY9X 4CRDA 2XYAA 4YT7H 1P57B 2ZU2A 5DPAA 3RDZA 2OUAA 1HAYB 3MYWA 2ZU3A 4OS6A 1D6WA 3ZVEA 2FYRA 1V2PT 4Y0YE 2YMSB 1MTNC 1UTKA 2H9HA 4CRAA 1IAUA 1DWCH 1P9SA 1RGQA 2LPRA 2VVCA 1QZ8A 2ZU4A 2ZTXA 4CHAB 2FM2A 4BNRA 2ZFFH 4INLA 1NZQH 2O8MA 3PYHA 4E05H 2TGPZ 4Q63A 3RXVA 1SSXA 2ZHDA 1AIXH 4OS2A 1P8VC 3F9HA 3SORA 1K1PA 4GCHF 1DOJA 4YO9A 5FCKA 2BVXH 4JZDH 2QIQA 3K2UA 2XWBI 3SGQE 1TNHA 1MTNB 3RM2H 3PV4A 1A5IA 3AK5A 2RA0A 2PGBB 1XUIA 1GHWH 4ABGA 1ABIH 1DANH 2BDCA 1C2FA 5KECA 4GHTA 1D4PB 2ZEBA 3UNQA 4XD7D 1C2HA 2JH6D 1C2MA 1O3LA 1ESTA 4ZROA 1O3EA 1C5QA 1O2OA 2WUCA 1KLIH 4AYYB 1K1LA 1TGBA 4YESB 2A4QA 3CS0A 1PPGE 3TLOA 1EAWA 1TOMH 1CU1A 2P93A 1UK4A 1O2ZA 1SGFG 1B0FA 1N6XA 3P70B 5C1YA 2P3TB 1EOJA 1FNIA 1WV7H 1EAUA 2XBXA 4U01A 4Q7YA 3A88A 1DWBH 4A1VA 1K9OE 4AORA 1FAKH 2PSYA 4Y8ZA 1ELEE 4H6SB 1O3MA 1ZPCA 5EODA 1D3TB 2HPQH 1DSTA 2PWXA 3BIUH 4TWWA 1GCTC 1NU9A 1TMTH 2F4LA 1AE8H 2FYQA 3KN2A 5C1UA 3KQDA 4AG2A 3K9XB 1HGTH 1LQEA 2TPIZ 4XSKU 2OBQA 1NBMD 1H8IH 4X1RU 4XBBA 2WHXA 5C0TA 1GJAB 1LHCH 4XBDA 4BTUB 8GCHG 3IWMA 1BMAA 2J34A 3SU0A 8GCHF 1WUNH 5HM9A 2QN5T 4INKA 2VIOA 2PP6A 1UCYH 1VGCC 4ZUHA 1TE0A 4NA8A 5DJ7A 3NRLA 1S82A 1NC6A 1MAYA 3TITA 3RXJA 4AC9A 5KGOA 1WOFA 1W14U 2QXGA 2OC7A 1C1OA 4B6FA 1BBRK 1WBGB 4FUDA 3ZIAD 1B7XB 1F0UA 1DXPA 1HIAA 2ZC9H 5E0GA 1XUGA 2JH0D 5EGMA 2XXLA 1AI8H 1BTXA 1QURH 4NIWA 5IDKA 2VH6A 3A8BA 1QNJA 4AB9A 1GGDC 1Z7KA 1PFXC 4CBOA 4A1XA 1TRMA 3KNXA 2QAAA 1LHGH 1O32A 2BOKA 3H7TA 3S9BA 3ITIA 1IQIA 1QBOA 2FMJA 1ANBA 1FZZA 1LDTT 3LT3A 4Q2KA 3Q3XA 1SGCA 1F92A 5HGGA 3QUMP 2ZHWH 2GKVE 2AMDA 5DK1A 5C94A 1TABE 4SGBE 1MD8A 1E79D 4IMZA 4IN1A 3BTGE 1SGDE 3EDXB 3M3SA 2H6MA 1SFQB 2ZQ2A 1N1LA 4D9QA 1SL3A 3OU0A 2H9TH 2OQUA 5E2PA 3OEHD 2V0BA 5ESBA 4M9FA 1GBAA 3EA8A 2GZ7A 3RXOA 1NT1A 4FVBA 3T5FH 1FAXA 4HI3A 1N8OC 3EAJA 3BEUA 3PMBB 1MU8B 3M7TA 2G55A 1UK2A 4NWKA 4HZHA 1MBQA 4MNVA 3A7VA 3SYJA 5GIBA 4F4OC 1MQ5A 5A8YA 3OY5U 1VJ9U 1V3XA 5J4SA 3GY7A 1P09A 1HAVB 1GBDA 3OE7D 2FOFA 5EPYA 1HJ8A 1KDQB 1TFXA 3ZYEA 2WV5A 3M35A 3OFND 1CA8B 1OSSA 4Y8XA 4UFFH 1BRUP 4K2YA 1GDNA 1ESBA 1V2ST 2PSXA 1O3GA 4ZXYH 3QGNB 2QF5A 1DE7H 1DICA 2KZ4A 2AHME 2UWPA 5FL7D 2TGTA 2WUBA 1VR1H 3SU6A 1XUFA 3ODFA 1O3HA 1KXCA 2EC9H 1SLXB 2J97A 3RXKA 1EZUC 1QY6A 2FS9A 4DIIH 2GV7A 1C5TA 4DIHH 4WXIA 3VB4A 1W8BH 4WMDA 3VXFH 4ABIA 2SFAA 4JZEH 2P8OC 3L33A 1YPMH 1TMBH 4AG1A 2ZQ1A 1Z6EA 1TNGA 1T31A 1MKWK 1SGQE 1P03A
chains in the Genus database with same CATH topology
1YPHC 1QR3E 1HBTH 2ZU5A 3DFLA 5I25A 1AB9C 3TH4H 2XW9A 3E1XB 1IHSH 4H42U 1C1SA 3PLPA 2OINA 1NRRH 2Q1JA 1C1UH 1GJ4H 4K8YA 3E91A 5EOKA 1LVYA 3STIA 1CA0B 1GI8B 3ZV9A 1HAPH 5E2OA 1HJ9A 1QJ1B 4BXSA 4OS7A 2XBVA 2ZGHA 1C5PA 1QHRB 2FX6A 2HLCA 3BG4C 2BHGA 2O8WA 3TJOA 3A7XA 2SGAA 2ZDAH 1OYQA 2A45B 1TX7A 1UMAH 1BMMH 4Z0KA 1VCWA 1CO7E 1JXPA 2TGDA 1QRXA 1BJUA 4I8LA 1PYTD 3M36A 3UY9A 1MAXA 2HOBA 3VB5A 5DP6A 3A7TA 3LDXH 4A6LA 4ZMAH 1SHHB 2CMYA 4IS5A 1QL8A 5C67A 2VINA 1K1IA 1HNEE 2XBWA 1HB0B 1W11U 4Q7ZA 3BTDE 4JCNA 1SGEE 4OGXA 1GJ8B 3VPKA 4A7IB 1MKXH 3TVJB 4AFUA 2F9OA 4ABBA 4NIVA 3QTVH 1J17T 1RTFB 1T8OA 3RXPA 1MKXK 1ARCA 2A31A 1FN6A 4DT7B 4AOQA 3AW0A 1O2IA 1E38B 1GJ6A 4FU8A 1SGFA 3RXCA 1MTVA 2PKAA 2Y7XA 3VGCB 2ZDKA 2Y80A 1TGTA 2Z3CA 3RXGA 4X8VH 1ZHMA 1N6YA 1BCUH 1V2RT 2ANMH 3PO1C 1HYLA 1TNKA 2VIWA 4CHAC 4Y0ZE 1S84A 4DCDA 3GICB 4UEHH 2F83A 1YGCH 4X1QU 5AVDA 1W12U 3RXAA 4FUGA 4FUFA 2VVUA 2QY0B 5DP4A 2Y5HA 3URDA 1UTJA 2VIVA 1GBTA 1P2JA 1BTUA 1W0ZU 5JBTA 4KTSA 1TPAE 4Y71A 1GJ9B 3OX7U 4JMYA 3STJA 1O39A 2H9EH 1AO5A 4CRCA 1C5RA 4IW4E 1SI5H 3BSQA 3RMNH 1ZLRA 3U9AH 2OQ5A 2DE9A 1XXDA 5LPFA 1P9UA 2GDEH 2ZU1A 4JZFH 1A5GH 1UK3A 1ZHRA 1QA0A 1TRYA 2QXIA 1C4U2 1LKAA 4JYUH 1BBRH 1KLTA 1MKWH 1HIAB 1AKSB 1PPZA 2BOHB 1GMCG 2BQ7B 3RMMH 1GI2A 2Y82A 1O2QA 4E06H 1AE5A 2CF8H 2R3UA 1GJDB 4F49A 3IG6B 1ETSH 1M9UA 1SOZA 2AIQA 3UOPA 2VIPA 4HGCA 4ZKRU 4NIXA 5AHGH 1QA7A 3F6UH 2VVVA 2FO9A 2DE8A 1GI9B 3KF2A 4AZ2B 3N7OA 2ODPA 4RN6A 1ELVA 3AAUA 4JYTA 1O2JA 2FESH 2NWNA 3R3GB 3ZVGA 3SI3H 3UWJH 4GCHG 1SLVB 3G01A 1O2VA 2A5AA 1EJAA 2FOBA 2FWWA 3D62A 2RCEA 2A4GA 1BITA 1QQUA 1MQ6A 3NXPA 2I6QA 3GDVA 2B9LA 1VCQA 1MH0A 2QF0A 1TPPA 1PPBH 2ZFQH 1HXFH 3NPSA 3RLWH 4XE4A 3TGKE 4MPUA 3SGAE 1ETTH 6CHAB 4KP0A 3ZVFA 1FJSA 1GBJA 3SNCA 1NM6A 7GCHF 2O8UA 1WQSA 3MH4A 1F5RA 4ZAEA 2J94A 3KQBA 2CJIA 3HKJB 3AVZA 1TBQH 1KLJH 9ESTA 3SHAH 2V3OH 3ATIA 1T4UH 4AN7A 1C1QA 1OWKA 4SGAE 3TNSA 2NU3E 1C5WB 4ABEA 3A7YA 2Z6BD 4X6OA 5A0BA 1JRTA 4LZ1H 3S7HB 1GBHA 1AU8A 1ELDE 1O38A 1NRNH 1W2KH 2B7DH 5L2YH 2Z9KA 5L2ZH 1GDQA 1T32A 2A4OA 3AASA 4CREA 2GMTB 1Z8JB 2OC0A 1Y5UT 1YKTA 4X2XA 3HGNA 1JIMA 1BTZA 5L30H 1MUEB 1XVOA 1NPMA 3K6YA 2GDDA 2WPLS 1P2KA 1FXYA 2P3FH 5B6OA 2I6SA 4IN2A 2EA3A 1C2LA 3PLBA 1K1OA 4I32A 5DP5A 2RG3A 2D26C 4FVDA 4YT6H 1H1BA 3QTOH 1O2TA 1FONA 1Y3WA 2YNAA 3R0FA 3LGUA 2W3IA 1C2IA 2PUQH 3SQHE 4DJZB 2OP9A 4J2YB 4WY3A 4MPWA 5EXNA 3E16B 3PWCA 2V3HH 1UHBB 3PMAB 1PQ7A 1Y3UA 3S9AA 1SR5C 5CMXH 1MU6B 1NTPA 1SBWA 2VB0A 1O5EH 2ZWLH 2QYIA 3MO6A 3C27B 1A1RA 3FZZA 3CP7A 2OD3B 2ANKH 3VFEA 4K60A 4JZ1A 5E0HA 3SQEE 4MPXA 1O5CB 2G5NA 2D8WA 1O2HA 2F9PA 1PJPA 3F9EA 3P8NA 1D3DB 1G32B 3ZYDA 2Y5GA 3GCOA 3LJOA 1AKSA 1BBRE 1DSUA 1JMOH 5F6MA 2FODA 1AMHA 4R0IA 3JZ2B 1RTLA 2B8OH 1O2MA 1LVOA 4NCYA 1DLEA 1HJAC 1GWAA 1LO6A 2VWLA 2SGPE 1XUKA 1O3DA 1RXPA 5A8XA 4DY7B 5A8ZA 1HRTH 2ZCHP 1E37B 1UTQA 2J92A 2ZDMA 4I7YH 1E0FD 1C5NH 1Y5AT 1BUIA 1K22H 4YLQH 1EP5A 2BLWA 2FI4E 2F9UA 2STBE 3D49H 2H5DA 3A84A 1AVGH 1RIWC 4MNWA 1IQFA 4VGCC 2UUFB 3T27A 1V2WT 2OC8A 4X1PU 2CV3A 1TGNA 1LCYA 1TQ7B 1GI4A 2BTCE 1O31A 2ZHQH 2BMGB 1ZSLA 1C5MD 3LGTA 4B1TA 4D8NA 1NFXA 5H4IB 1TGSZ 1V2LT 5FX6A 1G36A 1MZDA 2ZFRH 4RKOB 4Y11E 1P3EA 2BM2A 1QB6A 1QL7A 3LGIA 4K5ZA 2C90B 1O3KA 4Y79A 1AWHB 1Y3XA 2C4FH 2BD5A 1OWJA 4UE7H 3A82A 3A85A 4A1TA 4TPIZ 1O3PB 1DUAA 1FIWA 1L1JA 4ISIH 2BDGA 1JRSA 2CXVA 2ESTE 1A46H 1YCPH 1UVUH 4K1TA 1GCDA 4HTCH 1BIOA 2FOMB 1EAXA 3ZZ8A 5DG6A 2ZPQA 4GUXA 1QJ7B 1KYNA 4GSOA 1BTPA 3QK1A 3D65E 1GBIA 4Q80A 1AFQB 1HAHH 5FXLA 4TPYA 4Y10E 3VEQB 3S7KB 4MQAA 4NIYA 1INCA 1D6RA 2WPMS 3QLPH 5GWZA 1N8OB 1S6HA 3GCTG 5JPMH 6ESTA 3QX5H 3ESTA 1FMGA 1W13U 2KAIA 1O30A 3M3TA 4WWYA 3URCA 1XUJA 1S85A 1EUFA 3WY8A 3PO1B 4K8BA 2STAE 1YLDA 1KTSB 3E0NB 1D3QB 1W3CA 1WTHD 2ZFPH 1GJBB 1Z1JA 4R8TB 1OX1A 2LNCA 1K28D 1HAXB 1OWEA 2IN2A 2CHAC 1P10A 3SUGA 3U8TH 2A5IA 4LOYH 4CR9A 3RM0H 1O3AA 1S0RA 2EI8A 3A7ZA 3QZRA 3DFJA 2ZZUH 2A7CA 2ZGXH 2Z3DA 3TK6A 2WV4A 1C5SA 1BB0B 4K1EA 1RD3B 2ZHFH 3QDZB 2FI3E 2XCNA 5C5NA 3RC5A 4HFPB 4MTBA 3HKIB 1V2JT 4AYVB 2HWLB 2ZP0H 5EPNA 3LIWA 4U2WA 3KL6A 1ZGVA 3BTME 4GAWA 4BAKB 3ZZCA 4KTUA 3ATMA 3F9FA 1P2IA 1GMCF 1O35A 1YM0A 4K3JA 1C9PA 4MLFB 1GMDG 1LMWB 8ESTE 2BX4A 5FHTA 3A86A 4Q7XA 1CT0E 3SZNA 4AGKA 2WYGA 1F0SA 4NWLA 2R0LA 2FTMA 3SNDA 2OTVA 1DXWA 1MMJN 2FTLE 1C5XB 2BZAA 1K21H 1SOTA 1ZTLA 4X0WU 1BMNH 3MNBA 1BZXE 1HAIH 2HALA 1SVPA 6GCHF 3E6PH 4NZQA 1BQYA 3EQ0H 2THFB 4I8JA 1E36B 8KME2 1WAYB 4UFDH 1CSOE 1G2LA 1OWHA 3MH6A 1Y59T 2AGEX 5PTPA 1GHXH 4BOHA 2RA3A 1VITH 4WH8A 1EP6A 5JBAS 1IQNA 1UTLM 4X1NU 2AGIX 1S0QA 3P6ZB 4K1SA 1CA0C 1V2KT 2G52A 1QBNA 3MOCA 4I33A 2GV6A 3RXBA 3S69A 1SGRE 1EPTA 3BTEE 1S5SA 1NO9H 2PFEA 2Q6GA 3CS7A 5F8XA 1A0JA 1L2EA 1P2NA 1O5BB 2BXTH 1ABJH 1YLCA 3UWIA 4ZH8A 1O5AB 1W0YH 3LOXA 1KIGH 1O2UA 2A7HA 2F9VA 4RSPA 4TYDA 4D9RA 1P3CA 3DHKH 1QFKH 1EB2A 2XRCA 1OPHB 2GCHF 1CGHA 1K1NA 2ZTZA 1UTMA 2A1DB 3UUZA 3P8FA 4YOGA 1P02A 1FN8A 1MD7A 2GD4B 3E3TA 2BLQA 4X8UH 3UREA 1Y3VA 2ALVA 5JBBS 3UFAA 3BTWE 1LVBA 1UCYK 1C5UA 2BXUH 4FUEA 3FP6E 2H2ZA 2ZKSA 2P94A 5JB9S 1YPGH 2AEIH 4VGCB 1TB6H 2K1QA 1ZRBA 3ZVCA 1O36A 2C8WB 3A8DA 1JBUH 4CH2B 3EE0B 2G51A 3PMJA 1NRPH 5DGJA 4GPGA 2AMQA 3M7UA 1QGFA 4MNYA 1GJCB 1BA8B 4ABAA 4AGJA 4X1SU 1YYY1 3MU0A 2AYWA 1O2RA 3RXFA 3M5NA 1SPJA 1V2NT 2TIOA 1T8MA 4ISHH 2VWNA 3RXMA 1X7AC 1ANEA 1UVTH 2ZF0H 3SNBA 1FUJA 1YP9A 2ZI2H 1QCPA 1SQTA 1QQ4A 2A0QB 3UQOA 1SGYE 2GX4A 2ANWA 1XUHA 2BDAA 3F68H 3A87A 4BAOB 4NZLA 1KXAA 1C9TA 1ZMJA 1C2KA 2FLBH 5ABWA 1W7GH 5JYIA 2GT7A 3U8OH 1J14A 3BTKE 2OC1A 2J9NA 4LK4A 2XC0A 3T2NA 1C1RA 1EATA 4Y6DA 1YBWA 3NCLA 2HNTE 4Y7AA 1EJMA 3MU5A 3M7QA 2PTNA 2VIQA 2BD7A 1LHDH 4WJG2 3A8AA 1BT7A 2W3KA 3OTJE 1O37A 3O8CA 3E8LA 3GCNA 3NWUA 2NU4E 2HRVA 1ZJKA 2JETC 2ASUB 1DFPA 1L4ZA 3BV9B 3GY8A 1DLKB 4K69A 1V2VT 1QB1A 1S83A 2WPHS 1P2OA 3TJNA 4XBCA 2ZDVH 4THNH 3SNEA 2AFQB 1HAGE 3BTQE 4RKJB 5TCCA 2ULLA 1HPGA 2B0FA 3ATWA 2V6NA 2ANYA 1QBVH 2ZA5A 5HXFA 2A7JA 1GI0A 3BN9A 4CH8B 1SC8U 2OLGA 1TA2A 4XDEA 3RXEA 4ABFA 1ELGA 2O9QA 1GJ7B 1WU1A 4NFFA 4JZIA 2ZDNA 1UVSH 1GMHG 1SB1H 4OGYA 1NFYA 1AFEH 2BD9A 1O5GH 1GBLA 2GVFA 2CGAA 2FZZA 5C20A 1C5ZB 2R9PA 3UNSA 3SJIA 5GPIB 1DWEH 3V7TA 1BDAA 1VJAU 3HPTB 3BTFE 4NSVA 2P3UB 5LH8A 3SOSA 3SV2H 1H9HE 1HFDA 3U8RH 3B23B 4I8GA 3SUEA 3PLKA 4OS1A 3RXLA 3TJVA 1EX3A 1O5FH 1QJ6B 3TH3H 4CBNA 4Z6AH 2SNVA 3QO6A 1YF4A 1A3EH 3A89A 1SGNE 2JKHA 2GZ8A 2VH0A 5HYOA 1O2LA 2GT8A 1SQAA 1O0DH 1YCPK 1HV7A 1B0EA 2ZIQH 1UO6A 1EPTC 2BLVA 2XBYA 3QWCH 3SBKA 3RXIA 1T4VH 1UVOA 1AWFH 4NGAH 5C2ZA 3SW2B 1THPB 4FUBA 4LXBH 3SUDA 3SI4H 1FY4A 3OY6U 1LVMA 2PKSB 4ABJA 1Q31A 2D2DA 2V35A 2C8XB 1TGCA 4MVNA 1ZGIA 3IITA 1TNJA 3SNAA 3ENSB 4YOIA 1P0SH 4WVPE 3FP7E 3RXRA 2GP9B 4KKDA 1ELFA 3V3MA 1GHBG 1TPOA 3P8OA 1GHBF 3RUOA 4I31A 3RXHA 1TA6A 2H5CA 5JB8S 3FANA 2BDYA 3MWIU 4ISLA 4JK5A 3BG8A 1GVZA 2BYAX 1GCTB 1G37A 4KTCA 3S9CA 1C5VA 2BY6X 3T25A 5EXLA 1QTFA 2HNTC 1ZPZA 4O97A 5EXMA 1ZRKA 1FY1A 1RS0A 5FX5A 1F0RA 2BY5X 1CHOF 3M3VA 4INHA 2AS9A 3LC3A 1AHTH 1Q3XA 3SU3A 4FUCA 4WH6A 1C4V2 2FOEA 2FP7B 1EPTB 2IPHA 1ZMLA 4GHQA 2GZ9A 3DD2H 1HDTH 3MO9A 4U32A 2R0KA 3CENA 1F0TA 1GI5A 1OOKB 1L4DA 3C1KA 4X2VA 3K6ZA 5EU8A 1NS3A 1O2SA 2BQWB 2WPKS 5IYTA 1A2CH 1PYTC 1TQ0B 1WSSH 5A0CA 5EW2H 2G00A 1UVPA 1G2MA 3MMGA 1O3FA 2IJOB 2ZCLP 2BDIA 1E35B 2ALPA 8LPRA 1YC0A 2ZG0H 1A61H 1GBKA 3MNXA 2J4IA 2F91A 1DUEA 2FS8A 2BX3A 2BVRH 1A7SA 2NU0E 1LHFH 4IC5A 1EB1H 2M5TA 3RXTA 3UR9A 1ZSKA 4BAMB 1IQKA 2BDHA 3W95A 6LPRA 1ACBE 2UUKB 1UTNA 5JDUB 3ZZ5A 2AGGX 3FFGA 1AN1E 1AZ8A 4E7NA 2UWLA 2XWAA 1HCGA 3ZZ4A 2BZ6H 3ZZDA 1XVMA 3Q3YA 3T62A 2OBOA 1ZTJA 3A80A 2XCFA 4A92A 2CN0H 5EQSA 4YM9A 3I78A 4O03A 3EYDA 3SUFA 2WPIS 1C1WH 3ZV8A 3ZZBA 2VGCC 4DW2U 2QA9E 5K7RA 3LH3A 1EZQA 2QC2A 3ZVDA 1O2YA 1XMNB 3RC6A 1GBFA 2Z94A 2BY8X 3QZQA 2ODYB 1XXFA 3GDSA 5FBEA 5GDSH 4DURA 5CE1A 3Q3KA 4GLYA 5TJXA 1BHXF 1BTWA 3LH1A 1G3CA 1DITH 1TX6A 1P2QA 1A0LA 2YNBA 1O2GH 3ZZ6A 2GGVB 2J38A