4FU7A

Crystal structure of the urokinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fu7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fu7A01
1DT2A 5JBTA 1MZAA 2CHAB 2V35A 5JB9S 4B76A 1W13U 4LK4A 1OWKA 1BMNH 3PWBA 4Z0KA 3SI3H 2PWXA 2CF9H 1C2GA 4NGAH 4VGCC 2A4QA 1EAIA 7GCHG 1TALA 1C1WH 3NKKA 1GCDA 2ZFQH 3BTME 1TOCB 2NWNA 3DA9B 3U8OH 3H5CB 4CH2B 1O32A 3KF2A 2VGCB 1SFQB 9LPRA 1DWCH 1TLDA 3M3TA 1C5YB 1DSTA 1THSH 2ZU1A 4AX9H 4AFUA 4U32A 1V2JT 2FS8A 2AH4X 1MCTA 3A85A 1IHSH 1SGFA 2GDDA 2ZF0H 1Z8RA 4AFZA 1AE8H 1C5LH 5IYTA 1J15A 1TOMH 2GDEH 3GDUA 2FXRA 1P2MA 2O8TA 1PQ8A 1G36A 1TMTH 4CRCA 3BTFE 4OS2A 1V2WT 2K1QA 3MMGA 4K60A 2GZ9A 1WOFA 2RA3A 3K6ZA 4GCHG 3RP2A 4YO9A 1NU7B 1TYNA 4Y8YA 3BF6H 1NRPH 1HJ9A 3P92A 4FU9A 1Y5UT 1C1RA 1WAYB 2ZC9H 1O37A 2BB4A 4BAOB 1HGTH 4SGAE 1O2OA 5DP7A 3KNXA 4ZXYH 5J4SA 1CBWC 2YOLA 1GMCF 1D3QB 3NZIA 3LGTA 3ZZAA 2VU8E 1HAOH 1AB9B 1GJ8B 1O3AA 1T8LA 1UTOA 2GZ7A 2ZDAH 4X8UH 5EPNA 4ABAA 4LZ4B 1DSUA 4JZEH 4NA8A 1FJSA 1HJ8A 4Q7YA 5FPSA 4J2YB 3L33A 4IN2A 5DP3A 3HKJB 1GJBB 1H9LB 1XUJA 1VGCC 1BITA 1AMHA 3ATWA 3IG6B 1ZZZA 4DJZB 3PLPA 1IQEA 2QXHA 2JETC 4YESB 2G52A 3PROA 4TY7A 1UMAH 1J9CH 1MAYA 2B5TB 4E7RG 4BTUB 1A0JA 5FBIA 3ODDA 3SU6A 2BQWB 4CHAC 1SGEE 2OBOA 3V0XA 2BD4A 1MCVA 1DUEA 1PFXC 3RXAA 3U8TH 4RKJB 1O3DA 2QXGA 1C9PA 2FOHA 3RM2H 2BM2A 3P8OA 1AWFH 2WPKS 4X6OA 1PQ7A 1KXAA 4ISOA 3Q3YA 1C5ZB 3SGQE 4ZXXH 1JBUH 4MNVA 5A0AE 1BRUP 1K1OA 4O9VA 1FLEE 1WTHD 2EI7A 2A7CA 1GI3A 4FU7A 3KQEA 4AORA 1TPSA 4F4OC 1NRSH 3LC5A 4DVAU 1UK4A 5TCCA 1MMJN 5DPAA 3A7VA 1EAWA 2HOBA 3O8DA 2A45B 4IN1A 3VB7A 3T62A 1UTMA 2ILNA 1TRYA 1HUTH 5AHGH 2GKVE 1T8OA 1C2MA 4GHTA 3UY9A 1PPEE 1YKTA 3U98H 2Y5HA 4BTTB 1A2CH 2C8WB 1HNEE 4XDEA 3MU0A 2XC0A 1YC0A 4Q2KA 2BHGA 3SZNA 2FTMA 1EJAA 2BD8A 1P05A 1W0YH 4B1TA 3M5NA 1JOUB 3A84A 3PYHA 5I25A 1NESE 3JZ2B 1BIOA 1J14A 1GMHG 1O2TA 1YPHC 4OS4A 1TONA 3NPSA 2OC7A 3GY5A 1V2UT 1HDTH 1EB1H 1XKBC 3GCHC 1MD7A 2AS9A 4E06H 1NRQH 4Y0YE 2FI3E 1MAXA 1ZMLA 1O5DH 4GSOA 4Z6AH 1A0HB 1PJPA 4WY3A 2PTNA 1YP9A 4BTIB 1BMAA 1OKXA 1ZPBA 1N6YA 2FODA 2G81E 2Y80A 3RXGA 1O3MA 4Q7XA 1PPZA 1F0SA 1O30A 1PPCE 3OX7U 2G4TA 6LPRA 3BG8A 4X6NA 2FX6A 1A5IA 2BVXH 8GCHG 4DIIH 2PFEA 1GVKB 4KTSA 2EI6A 1EP6A 1LHFH 3A7TA 3BIVH 3SNCA 2XBVA 3H7OA 2BDYA 2A7HA 1C5QA 1Y3UA 1MKWK 3SJ8A 3SUFA 1SR5C 1TGNA 2SNWA 4RKOB 1OOKB 4ZKSU 5DP9A 2Z9KA 3UWIA 5E0JA 2QF3A 1O3NA 2F9UA 3E3TA 1OYTH 2W3KA 2ZFFH 4XOJA 1TBRH 2GMTC 3OTJE 3TLOA 1YPGH 1EPTB 2A7JA 2ANMH 1ZPZA 4OS6A 1GI8B 2XNIA 2XRCA 4ABFA 5A8XA 1K1MA 4YOIA 4YOJA 1H8DH 1HBTH 5L2YH 1TA2A 2P16A 2ZNKH 3LU9B 4DW2U 1O2GH 2EA3A 5DJ7A 1V2QT 5EG4A 1CBWB 3GY7A 1ZMJA 2ANKH 3ZZ4A 1C5SA 1ZSLA 1O3LA 3EE0B 4CRDA 1RD3B 3ZV8A 1RGQA 2AERH 4A7IB 1VGCB 2PTCE 5E2OA 1O35A 3ELAH 1C2JA 3HKIB 1W12U 3MOCA 3TIUA 3RMOH 2ZFPH 2PKAA 1F5RA 1V2MT 3P17H 2G5VA 3O8RA 4DURA 4I33A 1TPOA 1C1SA 3LKWA 2F9VA 4MLFB 1FY8E 4CHAB 7GCHF 3T5FH 3QLPH 2CGAA 2BD3A 2BY9X 8KME2 2P8OB 3EGKH 3VB6A 2XCFA 1FUJA 4DY7B 2FZZA 2Y81A 4JZDH 3SU0A 1KY9A 1O5GH 4XBCA 1OWEA 2B8OH 2ZU4A 2FOEA 1LCYA 4MDSA 2UUKB 1E0FD 2GV7A 1SPJA 2A4RA 2W7UA 1KTTB 2BXTH 1C4Y2 5CHAB 1H9HE 1XUIA 3MFJA 4CR9A 2Q1JA 4B75A 1AUJA 1TX6A 2QXIA 5FPTA 2P95A 2OP9A 3SI4H 4GCHF 3AASA 4AN7A 4I8HA 1K1PA 4X1PU 1YM0A 5FBEA 2BY6X 1ZHPA 2BX4A 2J38A 3SUEA 2BLVA 1TABE 4M7GA 1GI0A 4TPYA 1GHYH 3M3VA 3UIRA 1EAXA 3MNCA 5GCHG 1EX3A 2QAAA 4K1SA 4ASHA 2BY7X 1K9OE 1MTNC 3KIDU 3RXEA 3UQVA 2TGAA 1QTFA 1LVMA 1GHZA 1NY22 1O0DH 5EPYA 2EI8A 1EQ9A 4ABBA 4JZFH 3PMBB 2ANWA 1NM6A 4FUJA 5A0CA 4HTCH 4WMFA 4YT6H 1OS8A 3RC4A 1J17T 1T7CA 1NZQH 5EXLA 5EOKA 1MTSA 1IOEA 1YF4A 3RM0H 1D3TB 1SVPA 2AGIX 1O5FH 1AZZA 1P2IA 3ZZ3A 3A7XA 3LT3A 5CE1A 4MNWA 4CBOA 3EA7A 4UD9H 1AN1E 1BTUA 1SLWB 1W7XH 1DWDH 1W0ZU 1QBOA 1V2TT 2BYAX 1LHCH 1UVOA 3QWCH 4ISIH 1B0FA 1FONA 2QGRA 4FUHA 1TFXA 5LPRA 3TGJE 1QRXA 5K7RA 4O97A 3JZ1B 3U69H 1HJAC 2XC4A 4NIYA 1V2RT 3LGYA 2VIDA 3A88A 4WJG2 1SQAA 2PUQH 4ZKOU 1DX5M 1C2KA 2FWWA 1C2IA 4J1YA 1CT2E 1GBCA 3PTNA 1ARBA 3M5LA 4JK6A 1GL1A 4ISLA 1OWDA 1QJ1B 3BEIB 2BDCA 1FI8A 1A46H 2A4GA 1PPBH 4H6SB 2ZFTA 3RDZA 1ZJKA 3BTHE 1HAVA 1LVBA 3DD2H 6CHAC 5FHTA 4FUCA 3RXJA 2VVVA 2VH0A 1GMHF 3WY8A 1FQ3A 3OYPA 5DP6A 3B8JA 1XUGA 1N8OB 1O2MA 2FESH 4KGAA 1TX8A 1DWBH 4KKDA 5FCKA 3VXFH 2SGPE 3PMAB 4X1QU 1S0RA 3D23A 4UFGH 2TRMA 4BOHA 1A5HA 1TA6A 1AGJA 2ZTXA 1TGCA 5ABWA 1HIAB 1C5PA 1SGNE 1C4V2 1D3PB 4F49A 3VEQB 6ESTA 2J2UA 1DLKB 3A8AA 3EYDA 3LH1A 1SHHB 1K1IA 2NU4E 3E0PB 1LHEH 3LPRA 4YLUA 3ZVDA 3R3GB 8GCHF 1A0LA 4K5ZA 2ZTZA 2R0KA 1C1NA 2BXUH 2Z3CA 2PHBA 5DK1A 4TPIZ 1LPKB 4ZH8A 1ANEA 4WH8A 6GCHG 1GWAA 3U1JB 1WV7H 1G30B 3F68H 2H2ZA 1P3EA 1TNHA 3TJVA 1YPEH 1PQ5A 1XUFA 5DGJA 3ZZBA 1ZRBA 4WXIA 3DUXH 4X2XA 2RCEA 3FFGA 1DICA 4ZMAH 2ZWLH 1EZXC 2WPIS 1CGHA 5FXLA 1GJ9B 4A1TA 3FP7E 3VXEH 1MZDA 4XFQA 2R2MB 3GY8A 3BV9B 3T25A 3MYWA 2BLQA 4R8TB 3PMJA 2EC9H 1Z7KA 2F9OA 1TRNA 2HLCA 5FPYA 4ZROA 1KLJH 1KSNA 1MUEB 1SQTA 1O2IA 3DHKH 4A92A 1JRTA 2F9PA 1NPMA 2IJOB 3GY4A 4NIXA 3BG4C 3ZZ5A 1UHBA 4ZHLU 3I77A 5T6FA 1ZJDA 5HM9A 3MWIU 1C4U2 2PR3A 1P0SH 1TE0A 1LQDB 4DOQA 4MG3A 4ABDA 1G3EA 3F9GA 2TIOA 3QK1A 1SL3A 4XSKU 2A2XH 1KDQA 1TPAE 2RG3A 3SU4A 1GG6C 1MU6B 4RSPA 3F6UH 1GBTA 1QB6A 1Z1IA 4ZHMU 1BMMH 1Z71A 2ZG0H 3TJNA 2H1UA 2ALVA 2AIPA 3SW2B 4ABEA 1K28D 2GP9B 1TWXB 3CP7A 2PSYA 1SGQE 2ZGHA 3E1XB 3LJJA 3RXTA 2ZGCA 4BAMB 2D8WA 1ANDA 1P3CA 1YCPH 1FIZA 5C1UA 3QTOH 1O34A 4HZHA 4WMEA 3ZVFA 1C5UA 1ANCA 1TNLA 2TGDA 2ZPRA 1O38A 2C90B 4LXBH 4WVPE 1GDQA 1WUNH 1K21H 1HJAB 1T4VH 3TGIE 2VNTA 1YCPK 2UUJB 1QRZA 4X8TH 1GJ7B 1SLVB 3SHCH 2ZHQH 4YOGA 2BDGA 3P95A 3W95A 3S69A 1CA0C 3I29A 3MO3A 1TBZH 4XBDA 1MQ6A 2SNVA 2NU0E 1H8IH 2UUYA 2R3UA 3U9AH 1IQGA 2KAIA 1EJMA 2BLWA 2ESTE 2V6NA 4K1EA 3FZDA 1GBIA 1J8AA 1EZQA 1Q3XA 4IMZA 1YGCH 1QRWA 3SJKA 3LGWA 5F8TA 3MU8A 2GCHG 1P11E 1NTPA 1BRCE 3RXQA 1F0TA 1YLCA 1YYY1 1RTKA 4MPXA 6CHAB 3V3MA 1P2OA 1SOTA 2Q6DA 2QIQA 4NIVA 1SGRE 5GCHF 5L6NH 2FLBH 1Y59T 2NU1E 1Z6JH 3LIWA 3AVZA 1GPZA 5IDKA 2AMDA 1EATA 3QZQA 1HV7A 1NO9H 1OX1A 2ZIQH 3T27A 3ZZ9A 1LKBA 1GJ5H 3FZZA 3EAJA 3ODFA 1S6HA 2D26C 3A81A 3S7KB 1BTZA 2XWBI 2WV5A 2WYJA 2HVXA 1UVPA 2A5IA 3ZZ6A 3IWMA 5EQQA 1GJ4H 1Y3WA 4UFDH 1M9UA 1OP0A 2I6QA 2FX4A 3MO9A 3BTDE 3OY5U 1GMDG 3M36A 4E7NA 2Z7FE 1G3DA 1SFIA 2WUBA 3ZVCA 2B9LA 4FXGH 3QN7A 3OY6U 3KQBA 2W26A 2ZCHP 1J16A 5FAHA 1S84A 3RXPA 1CGJE 1OWIA 1TBQH 4X2YA 3TH3H 1IAUA 1IQFA 1BTPA 1WQSA 2BZ6H 3GISB 4I8LA 3SU1A 1LVOA 1EAUA 4Q80A 2R3YA 1FY4A 4DGJA 3S9BA 4U30A 2W7SA 1LKAA 2ZZUH 3P8NA 3TITA 1SI5H 1GJAB 3ATKA 3ZZCA 2G5NA 3ATMA 1THRH 2XYAA 1GCTB 4DG4A 2VVUA 4I32A 3RXHA 5HGGA 1XUHA 3UNQA 2H5CA 3Q77A 4BANB 4D9RA 5EGMA 3P6ZB 2GVFA 4Y8XA 2Y5FA 4X1SU 4OS7A 1VZQH 4CBNA 3BG4B 4X8SH 4FUBA 1SGDE 2HPPH 2VJ1A 4R0IA 1LO6A 2A4OA 2LPRA 1WTGH 4JYTA 3STIA 5JBCS 3V12A 4IC6A 1FY5A 2XBYA 1A1RA 1V2OT 2J34A 2A2QH 2PGQB 1KXEA 1NRNH 2ULLA 3H7TA 4B2AA 1GVLA 1GG6B 1SGFG 2BQ6B 5EU8A 1F2SE 1GDNA 1P2JA 1DM4B 3M35A 2FOAA 1V2VT 1EJNA 4FVDA 3NWUA 1O2KA 5TCAA 5EQSA 5DP8A 1F0RA 1GBEA 1KLIH 2LNCA 5T6DA 4NCYA 1F5LA 4GPGA 2OTVA 4INLA 3DFJA 1Y3YA 3PMHB 5EXMA 1BA8B 5LGOA 4ISNA 5BPEA 3RXRA 2Z9GA 6GCHF 1F5KU 4K8BA 1GI4A 4VGCB 1FAXA 1MKWH 3A7ZA 4INHA 4CRBA 1B5GH 1ELFA 2PV9B 1O2WA 3CS7A 3UTUH 3BTWE 2Z9LA 2IOTA 3TK6A 2ALPA 4AG2A 2IPHA 2HNTE 3UREA 1P12E 5DP4A 1WQVH 3N7OA 3BTTE 1NS3A 5GDSH 2FOBA 1G3CA 1KXCA 3VFEA 1YPJH 5A0BA 5GXPA 1Z8JB 3TU7H 1A3EH 1MKXK 3URCA 2ZU2A 4UE7H 1TRMA 1BTYA 1BDAA 1MU8B 4E05H 2P59A 1AKSB 3SV8A 3IITA 1HXFH 1TGSZ 2TPIZ 2A31A 1C5OH 2STAE 2UWLA 1L4ZA 3E6PH 4NIWA 1WU1A 1C5TA 1FNIA 1MTWA 3V7TA 1L1JA 1VCPA 5F6MA 3TNTA 2J95A 3K6YA 1BTXA 3BTEE 3PB1E 3TH4H 2ZPQA 3SUDA 3SNBA 2ZHEH 3KCGH 1V2LT 2BY8X 3RC6A 2RA0A 1GGDC 1TNGA 1F92A 1C2EA 2F3CE 1P9UA 3TVJB 5EW2H 3AAVA 1OPHB 1ARCA 3EA8A 5EW1H 3RXMA 3SHAH 1BUIA 1FN8A 2NU3E 1Z8GA 1NFYA 2BDBA 3QO6A 2GT8A 3E8LA 1QL8A 1JXPA 1SGCA 2JETB 5DP5A 1S6FA 2ZGXH 1QNJA 3LC3A 4GHQA 1LPGB 1O2LA 2O9QA 3A87A 1SGTA 1SBWA 1VITG 3EA9A 1BJVA 2Q6GA 3A8DA 1ELAA 1UTNA 8ESTE 4NFFA 1JIRA 3Q00A 4I8GA 2FP7B 1IHTH 3LOXA 4FVBA 1UTPA 1EZUC 2P3FH 1FPHH 1P02A 1O36A 4O3UA 3MH7A 1C5NH 2Y6TA 4B2BA 1FMGA 1C1PA 1H4WA 1O3FA 1VCWA 1LTOA 1LQEA 2B7DH 3D65E 5EXNA 4Y7BA 4ZUHA 1EP5A 1HAHH 2G8TA 1H9IE 2BDAA 1QQUA 1ZSKA 5AFYH 5C5NA 4GAWA 2Y82A 1X7AC 1O5BB 2F91A 1HCGA 2GCHF 3E90B 3ATIA 3UQOA 1AVXA 1QBVH 1O3JA 2OC1A 1T8MA 3SJIA 4AB8A 2Y5GA 5T6GA 1E38B 1NFXA 3SJOA 2JH5D 1QJ7B 4ZKNU 1QR3E 1O2HA 1LMWB 1P8VC 5A8YA 1ETTH 3O8BA 1O3OA 3VB3A 2O8MA 3S0NA 1YPLH 1TGBA 1UO6A 2HALA 1D6RA 4CH8B 1UVUH 3LJOA 1YPKH 1FPCH 1ZHMA 2OINA 2XCNA 3A86A 1CT0E 2V3HH 2C8XB 3R0FA 3ZZ8A 3S7HB 3FP6E 1A5GH 2OBQA 3SU3A 5T3HA 1KIGH 3HGPA 3GY6A 1GMDF 3FANA 1SQOA 3GCHB 1BHXF 2BDIA 1K1NA 2VWLA 1Q2WA 2A1DB 2XW9A 2VWNA 1FY1A 2WYGA 1O2JA 1IQHA 2ANYA 1CA8B 4YT7H 1VCQA 1DPOA 1O39A 2VIPA 3URDA 3MO6A 3CS0A 2BY5X 3DT0H 1VITH 2G55A 1HAIH 2XBWA 3GY3A 1T8NA 2PGBB 2AGEX 3PO1C 2R0LA 3ZZ7A 4WH6A 4U01A 3A83A 1QJ6B 1AVWA 3TNSA 1GI5A 1ZGVA 1EASA 4PROA 2ZHDA 3A7YA 1S85A 7ESTE 1D9IA 2A5AA 1UCYH 2BDHA 4YLQH 2F9NA 5A09A 1ZSJA 1AU8A 4X0WU 1A61H 4Y71A 1SSXA 1GBFA 2XWAA 1QB1A 3VGCC 2AGGX 1GHXH 1KLTA 1P2NA 2TGTA 5A8ZA 4KTCA 1MTUA 2G4UA 3SNAA 4DCDA 2GX4A 2HGTH 1UCYK 1C5WB 2GMTB 1E34B 5EODA 5C1YA 1JRSA 4ABGA 7KMEH 2WINI 2J94A 1CQQA 3ENSB 3T29A 3SU2A 1QY6A 1WSSH 3S9AA 3EDXB 3M7TA 3KL6A 3STJA 5C20A 3ITIA 4FUIA 2XC5A 3MNBA 1Y5AT 4OGXA 5AF9H 1GBAA 1C2HA 1GGDB 4KP0A 1DDJA 1OWJA 4ISHH 3RXUA 3RXBA 1DY8A 3F9HA 3UPEA 3MU4A 1RTLA 1HAXB 5FX6A 2VVCA 1ELTA 2BD5A 4A6LA 4CR5A 1P06A 1O3IA 3ZVEA 4AG1A 2Z6BD 3D49H 1C1TA 4X8VH 1EPTA 3TJOA 1K1JA 2QCYA 4JZ1A 1TB6H 2C3SA 4THNH 4B73A 4Y76A 1EXFA 3LGVA 2AMQA 2VWMA 3A89A 3BSQA 1ESTA 4KTUA 1ELDE 4A1XA 1GBKA 3M5MA 1OXGA 5G4BA 3GCNA 2YNBA 2FLRH 3L6PA 2Z3EA 1U6QA 1AHTH 1AO5A 2UUFB 1W2KH 3T26A 2VIVA 1G2LA 4FU8A 1E36B 1HRTH 2BZAA 3QTVH 4ZHAA 3MH4A 1SMFE 1AB9C 1AWHB 4NSVA 1C5MD 4IC5A 5JB8S 5GIBA 1TMBH 1HB0B 3I78A 1O31A 1S82A 3PTBA 2V3OH 3QGJA 2C8ZB 1BBRK 1XVOA 3FAOA 1TMUH 4B2CA 1BZXE 1OP2A 2SGQE 1YCPM 3A8BA 1G9IE 5E0HA 1MBMA 1QB9A 4I31A 4AOQA 1TQ7B 1P57B 4JMYA 2ODPA 1N1LA 3F9FA 1ABJH 1C2LA 1D6WA 1P9SA 1QFKH 5AFZH 5C1XA 5AVDA 3SBKA 1IQMA 1P2KA 2BQ7B 1DUAA 1O5CB 2HNTC 5PTPA 1RJXB 4YM9A 3K2UA 1ABIH 2RDLA 3P8GA 4Y8ZA 3MH6A 2W5EA 1XXDA 1B7XB 2FOMB 4UEHH 4D9QA 4MPVA 1MTNB 1C5VA 5BRRE 3SNDA 3KHVA 5LH8A 4Y0ZE 2JH0D 3SQEE 2H9EH 2Z3DA 1HAPH 2ZECA 1V2PT 3F1SB 2PKSC 1V2ST 3MH5A 3SN8A 3OU0A 1ZTJA 2H6MA 2VIOA 1QCPA 1VJ9U 3GYLB 1XX9A 3RMMH 1LVYA 5DG6A 2J4IA 3KEEA 4NG9H 1VITF 5HXFA 1W3CA 3LH3A 5F8ZA 2VH6A 1QURH 4A5TS 3OSYA 3RMLH 3UOPA 1SHYA 1XUKA 2DE8A 3RXKA 5GWZA 1BQYA 2JH6D 3VPKA 1DY9A 1GBHA 4IS5A 1AVGH 5ESBA 1SB1H 4GVUA 4JK5A 1AD8H 1C9TA 1OWHA 2STBE 1F0UA 1O2NA 3GDSA 1QQ4A 1C1VH 3C1KA 4B74A 2IN2A 3DFLA 2FI4E 3MTYA 4Y11E 1WBGB 1AE5A 2F83A 2QF0A 2EEKA 3VGCB 4BAKB 1T32A 2C4FH 5DKMA 5F03A 2CMYA 3PWCA 3M3SA 3CENA 3GCOA 1C5RA 5JBBS 1L0ZA 2OUAA 1ZR0A 1GBBA 1ZPCA 3GY2A 3T28A 1TIOA 2Z94A 2THFB 4BXWA 1QBNA 2CF8H 2AMPA 3RXVA 1FAKH 2Q6FA 1ELBA 1TNIA 4NSYA 1MBQA 3QZRA 2FPZA 1G3BA 1Y8TA 3SORA 4CRFA 1O2PA 1ELEE 2A5KA 2SGDE 4AB9A 1XKAC 2A32A 2FTLE 1UCYE 4DIHH 1O2VA 1HAZB 3SV2H 1LHDH 1GI7B 1OP8A 1BB0B 1D4PB 1QL9A 1VR1H 2Z9IA 1NC6A 2Y7ZA 2WUCA 1S0QA 4CRGA 4BXSA 2ZO3H 1RFNA 3FVFB 1RXPA 3UFAA 5FX5A 1O3PB 2ODQA 2ZGBH 4X2VA 3SOSA 2SGFE 5E8EH 1EPTC 1A4WH 1Z1JA 4LOYH 2PKAB 1GVZA 3RXDA 1MQ5A 2GGVB 3MU5A 1SG8B 1B0EA 4IBLH 4MVNA 2QA9E 4K1TA 4Y7AA 1GHBG 4CRAA 1L1NA 1Z6EA 2O8WA 2GD4B 4NA9H 3A82A 2OLGA 3ZZDA 1ESBA 1ZMNA 3HPTB 3P70B 1GL0E 3UNRA 2FOGA 5GPIB 1KXBA 2ZEBA 1GBJA 3RLYH 3SNEA 1PPGE 1VJAU 3SU5A 2YNAA 3RXSA 1HIAA 1UTJA 5LPEA 3RXIA 3MNSA 3ZVGA 4IGDA 3RXOA 1GHAG 1WCZA 3QDZB 3TH2H 1JMOH 3RXLA 3RUOA 3RU4E 1C1QA 1O2UA 3SV6A 2OCVB 1BBRE 4WWYA 3SGBE 3TK5A 1GI2A 4D7GA 1FIWA 1GJCB 2P8OC 1P09A 1DITH 2QC2A 1O3KA 2ZHWH 2G00A 2FS9A 1TNJA 2J92A 3RU4T 3GYMA 2WV4A 4ABJA 1W8BH 4MTBA 2B0FA 3K9XB 3NUMA 4MPWA 3B9FH 4RN6A 1DXWA 2CXVA 1QA0A 4JYVH 3ZYEA 3MI4A 2ZCLP 5FCRA 1S5SA 2PKSB 3HK6B 5CHAC 2WPMS 3KGPA 3PLBA 1IQIA 4NZLA 1CVWH 2HNTF 2BOHB 2JKHA 1Q31A 2ZP0H 1UTKA 5C5OA 3FP8E 5C3NA 1CHOG 1KXFA 4CREA 4ABHA 1W14U 2OQ5A 1ETSH 2P93A 1PPHE 2FMJA 2F9BH 3VB5A 1XM1A 1UK3A 1DXPA 1CU1A 4QT8C 4H42U 1DVAH 4TWYA 2FDAA 2O8UA 1EZSC 1G32B 1XXFA 5JBAS 4X2WA 3P8FA 1C1UH 1PYTC 1FV9A 2BOKA 3S9CA 5K0HA 1ESAA 1AQ7A 1C1MA 1RRKA 3AAUA 1DLEA 1MKXH 2GV6A 3M5OA 3LGUA 2D1JA 1TX7A 2ZU3A 2BTCE 4JCNA 4OS1A 1CA0B 2FEQH 5LPFA 3HATH 2A0QB 3RXFA 1IQNA 1TQ0B 1H1BA 2CV3A 3RXCA 2ODYB 2HWLB 3E91A 4YZUA 1CE5A 2QXJA 3GCTG 4TY6A 3HGNA 1QL7A 3TJUA 3GOVB 1OSSA 5HM2A 1K1LA 4K8YA 3KN2A 1TGTA 1O2YA 1GI1A 1THPB 5E0GA 1HAVB 1ZGIA 2PW8H 1UVTH 3PV4A 4I7YH 3AW1A 2PSXA 2AFQB 3QX5H 3RMNH 1RIWC 2ZQ2A 1L4DA 2QN5T 3GICB 2QV1A 1DFPA 1HAYB 3MU1A 5L2ZH 2Y7XA 1O2RA 2BD7A 3BTGE 2WPLS 3M61U 1UTLM 2SFAA 4OGYA 2ZDNA 3M37A 4MNYA 1DS2E 1EOLA 1KYNA 2DUCA 2GTBA 3UNSA 2VINA 1C5XB 5H4IB 2UWPA 5HMAA 4BAQB 1BTHH 1SGIB 2AEIH 1PYTD 3KQCA 5E2PA 1GI6A 5GJ4B 1V6DA 4NA7A 1ID5H 4FUEA 2AIQA 1O3CA 3M7QA 1BRAA 1GDUA 2GCTC 1O5AB 4K3JA 3UWJH 4FUDA 2VB0A 2UWOA 3MHWU 2P3UB 4WMDA 1N8OC 2XBXA 1C2FA 1UVSH 3PM3A 3Q3KA 3RLWH 3SO3A 5B6OA 4SGBE 5TJXA 4I8KA 4UONA 1Y3XA 3TK9A 4D8NA 1W10U 1SGPE 2FYRA 4Y79A 2BMGB 1K2I1 2TBSA 2ZHFH 2FI5E 2ZI2H 1HXEH 4AFSA 2M5TA 2AYWA 1FZZA 1E37B 3A8CA 3L3TA 2GZ8A 1G2MA 1V3XA 1G37A 3LDXH 2HPQH 4AYVB 3SJ9A 2BLOA 1SLXB 4O3TA 1AIXH 3BTKE 3SV7A 3F9EA 1TAWA 3LONA 2CN0H 1IQJA 2OC0A 1BHXB 1UHBB 3M7UA 2PUXB 4XBBA 1JWTA 2BVRH 2C93B 4ZKRU 4INKA 3G01A 3ATLA 1Y3VA 4LZ1H 2BD9A 2C8YB 4NWKA 2ZTYA 1AFQC 2ZKSA 2ZFRH 1KDQB 1UJ1A 2TGPZ 4O03A 4IMQA 1EB2A 1UK2A 1PPFE 4UFEH 1DOJA 1FDPA 2ZA5A 1O3HA 1NFWA 1BCUH 1AY6H 1ETRH 5HYOA 1DE7H 1HYLA 5JDUB 1CSOE 3D62A 2W3IA 1GHBF 4HGCA 5I46H 4TYDA 2ZDVH 4MNXA 1GBLA 1ZOMA 1QHRB 4HI3A 4NZQA 3A80A 5SGAE 3W94A 1O2XA 9ESTA 1IQLA 2WPHS 3SGAE 5ETXA 3PLKA 1TNKA 2GT7A 1EKBB 4HFPB 4Q7ZA 3VB4A 4FUFA 2XXLA 3NCLA 3ESTA 1AI8H 2FYQA 1CHGA 1ZTLA 2FM2A 3U1IB 1MTVA 1UTQA 1P01A 1GI9B 3V13A 1GHAF 1GMCG 3C27B 2FOCA 2FOFA 3ZYDA 4X6PA 1O2QA 3RC5A 1BRBE 1BJUA 1ZLRA 3T2NA 1AZ8A 1SOZA 1O3EA 1GBDA 5L30H 1A7SA 2DE9A 1C2DA 2SGEE 4D7FA 2CHAC 1V2NT 1N6XA 2D2DA 2I6SA 4JZIA 2KAIB 4MQAA 5DO4H 1V2KT 1SLUB 5C2ZA 4K2YA 3LGIA 3AW0A 2P3TB 2WPJS 3SQHE 1O33A 2VIQA 1GHVH 2CJIA 1K22H 1LDTT 2BX3A 5C67A 1EOJA 2VIWA 4U2WA 1FN6A 1Y5BT 1INCA 4GUXA 1RIWB 1QIXB 1RTFB 4AYYB 2H9TH 2OC8A 1BTWA 2ASUB 1XVMA 1LPZB 2PLXA 3KQDA 5JPMH 5J4QA 1C1OA 1KXDA 2FO9A 3HK3B 2VGCC 1O5EH 4UFFH 3BIUH 2R2WU 1HPGA 4H6TA 4X6MA 1WYKA 1NROH 1ZHRA 1P10A 2ZDMA 3UOUA 1TPPA 4I8JA 3ZVAA 1CHOF 3BTQE 1CGIE 1AKSA 1YPMH 5EQRA 1EUFA 2ZFSA 1Z8IB 5F8XA 4NFEA 1YPHE 2ZDLA 4AGJA 1SGYE 2VWOA 4ABIA 2H5DA 2ZGJA 4BNRA 3E16B 1ORFA 3SUGA 3BN9A 4ZAEA 4NWLA 2GCTB 4FUGA 3Q76A 4AFQA 1JIMA 2BD2A 2R9PA 2J9NA 3B23B 1T4UH 4A1VA 2OXSA 1A3BH 3K65B 4AZ2B 1BBRH 4H4FA 2ZU5A 1DWEH 3E0NB 1MH0A 1AFEH 1P04A 2QYIA 1ANBA 1NT1A 4K69A 1BOQA 4KELA 1O3GA 1GHWH 7LPRA 4X1RU 1QA7A 2G51A 1RS0A 4JYUH 3NXPA 1XMNB 3QGNB 1YBWA 3A7WA 4TWWA 1CT4E 3UR6A 5JYIA 3GCTF 1PQAA 1S81A 1F7ZA 1NRRH 4UDWH 3O8CA 3TGKE 1ZRKA 5CMXH 1YLDA 4AGKA 1D3DB 4IW4E 1S83A 3NK8A 4ESTE 1O2ZA 1L1GA 2ZQ1A 3RU4D 1NU9A 1OYQA 1HAGE 1ELVA 4GLYA 2XTTB 4YTAA 3BEFB 1IQKA 3ZVBA 2ZCKP 2BVSH 3ZV9A 2OD3B 1AFQB 4XE4A 3U8RH 8LPRA 1NN6A 1DANH 3GDVA 3Q3XA 4X1NU 4D76A 1QGFA 2O8LA 1FY3A 2H9HA 1ACBE 1AUTC 2ZPSA 4OS5A 1GCTC 5ESTE 2P94A 4BAHB 1GJDB 1FXYA 4MPUA 4DT7B 2NU2E 2Z9JA 1ZYOA 3UR9A 4WXVA 3EQ0H 1CO7E 1LHGH 1GBMA 2HRVA 1NFUA 4B71A 1W7GH 1ELCA 4WF8A 5A2MH 1BMLA 1SC8U 3PO1B 3QUMP 1P2QA 1W11U 2FIRH 1O2SA 3UUZA 1KTSB 1P03A 1BT7A 1L2EA 2SGAA 2ZDKA 1T31A 1O3BA 4Y10E 1HLTH 3TPIZ 2QY0B 1MD8A 2V0BA 3MNXA 1ELGA 1GJ6A 1E35B 3BEUA 1ZTKA 4Y6DA 2OQUA 1HFDA 3SV9A
chains in the Genus database with same CATH superfamily
1DT2A 5JBTA 1MZAA 2CHAB 2V35A 5JB9S 4B76A 4I86A 1W13U 4LK4A 1OWKA 1BMNH 3PWBA 4Z0KA 3SI3H 2PWXA 2CF9H 1C2GA 4NGAH 4VGCC 2A4QA 1EAIA 7GCHG 1TALA 1C1WH 3NKKA 1GCDA 2ZFQH 3BTME 1TOCB 2NWNA 3DA9B 3U8OH 3H5CB 4CH2B 1O32A 3KF2A 2VGCB 1SFQB 9LPRA 1DWCH 1TLDA 3M3TA 1C5YB 3OEED 1DSTA 1THSH 2ZU1A 4AX9H 4AFUA 4U32A 1V2JT 2FS8A 4M9FA 2AH4X 1MCTA 3A85A 1IHSH 1SGFA 2GDDA 2ZF0H 1Z8RA 4AFZA 1AE8H 1C5LH 5IYTA 1J15A 1TOMH 4XD7D 2GDEH 3GDUA 2FXRA 1P2MA 2O8TA 3N7DA 1PQ8A 1G36A 1TMTH 2F4LA 4CRCA 3BTFE 4OS2A 1V2WT 2K1QA 3MMGA 4K60A 2GZ9A 1WOFA 2RA3A 3K6ZA 4GCHG 3RP2A 4YO9A 5DN6D 1NU7B 5T1VA 1TYNA 4Y8YA 3BF6H 1NRPH 1HJ9A 3P92A 4FU9A 1Y5UT 1C1RA 1WAYB 2ZC9H 1O37A 2BB4A 4BAOB 1HGTH 4SGAE 1O2OA 5DP7A 3KNXA 4ZXYH 5J4SA 1CBWC 2YOLA 1GMCF 1D3QB 3NZIA 3LGTA 3ZZAA 2VU8E 1HAOH 1AB9B 1GJ8B 1O3AA 1T8LA 1NBME 1UTOA 2GZ7A 2ZDAH 4X8UH 5EPNA 3WW7A 4ABAA 1DSUA 4JZEH 4ACBA 4NA8A 1FJSA 1HJ8A 4Q7YA 5FPSA 4J2YB 3L33A 4IN2A 2EQNA 5DP3A 3HKJB 1GJBB 1H9LB 1XUJA 1VGCC 1BITA 1AMHA 3ATWA 3IG6B 1ZZZA 4DJZB 3PLPA 1IQEA 2QXHA 2JETC 4YESB 2G52A 3PROA 4TY7A 1UMAH 1J9CH 1MAYA 2B5TB 4E7RG 4BTUB 1A0JA 5FBIA 3ODDA 3SU6A 2JIZD 2BQWB 4CHAC 1SGEE 2OBOA 3V0XA 2BD4A 1MCVA 1DUEA 1PFXC 3RXAA 3U8TH 4RKJB 5KGOA 1O3DA 2QXGA 1C9PA 2FOHA 3RM2H 2W6JD 2BM2A 3P8OA 1AWFH 2WPKS 4X6OA 1PQ7A 1KXAA 4ISOA 3Q3YA 1C5ZB 3SGQE 4ZXXH 1COWD 1JBUH 2LP6A 4MNVA 5A0AE 1BRUP 1K1OA 4O9VA 1FLEE 1WTHD 2EI7A 2A7CA 1GI3A 2QF4A 2GJGA 4FU7A 3KQEA 4AORA 1TPSA 4F4OC 1NRSH 3LC5A 4DVAU 1UK4A 5TCCA 1MMJN 5DPAA 3A7VA 1EAWA 2HOBA 3O8DA 2A45B 4IN1A 3VB7A 3T62A 1UTMA 2ILNA 1TRYA 1HUTH 5AHGH 2GKVE 1T8OA 1C2MA 4GHTA 3UY9A 1PPEE 1YKTA 3MQKC 3U98H 2Y5HA 2JDID 4BTTB 1A2CH 2C8WB 1HNEE 2V3MA 4XDEA 3MU0A 2XC0A 1YC0A 4Q2KA 2BHGA 3SZNA 2FTMA 1EJAA 2BD8A 1P05A 1W0YH 4B1TA 3M5NA 1JOUB 3A84A 3PYHA 5I25A 1NESE 3JZ2B 1BIOA 1J14A 1GMHG 1O2TA 1YPHC 4OS4A 3SYJA 1TONA 3NPSA 2OC7A 3GY5A 1V2UT 1HDTH 1EB1H 1XKBC 3GCHC 1MD7A 2AS9A 4E06H 1NRQH 4Y0YE 2FI3E 1MAXA 1ZMLA 1O5DH 3CNRA 4GSOA 4Z6AH 1A0HB 1PJPA 4WY3A 2PTNA 1YP9A 4BTIB 1BMAA 1OKXA 1ZPBA 1N6YA 2FODA 2G81E 2Y80A 3RXGA 1O3MA 4Q7XA 1PPZA 1F0SA 3EE7A 1O30A 1PPCE 3OX7U 2G4TA 6LPRA 3BG8A 4X6NA 2FX6A 1A5IA 2BVXH 8GCHG 4DIIH 2PFEA 1GVKB 4KTSA 2EI6A 1EP6A 1LHFH 3A7TA 3BIVH 3SNCA 2XBVA 3H7OA 2BDYA 2A7HA 1C5QA 1Y3UA 1MKWK 3SJ8A 3SUFA 2RDEA 1VKYA 1SR5C 1TGNA 2SNWA 4RKOB 1OOKB 4ZKSU 5DP9A 2Z9KA 3UWIA 5E0JA 2QF3A 1O3NA 2F9UA 3E3TA 1OYTH 2W3KA 2ZFFH 4XOJA 1TBRH 2GMTC 3OTJE 3TLOA 1YPGH 1EPTB 2A7JA 2ANMH 1ZPZA 4OS6A 1GI8B 2XNIA 2XRCA 4ABFA 5A8XA 1K1MA 4YOIA 4YOJA 1H8DH 1HBTH 5L2YH 1TA2A 2P16A 2ZNKH 3LU9B 4DW2U 1O2GH 2EA3A 5DJ7A 1V2QT 5EG4A 1CBWB 3GY7A 1ZMJA 2ANKH 3ZZ4A 1C5SA 1ZSLA 1O3LA 3EE0B 4CRDA 1RD3B 3ZV8A 1RGQA 2AERH 1MABB 3PRDA 4A7IB 1VGCB 2PTCE 5E2OA 5DSFA 1O35A 4P00A 3ELAH 1C2JA 3HKIB 1W12U 3MOCA 3TIUA 3RMOH 2ZFPH 2PKAA 1F5RA 1V2MT 3P17H 2G5VA 3O8RA 4DURA 4I33A 1TPOA 1C1SA 3LKWA 2F9VA 4MLFB 1FY8E 4CHAB 7GCHF 3T5FH 3QLPH 2CGAA 2BD3A 2BY9X 8KME2 2P8OB 3EGKH 3VB6A 2XCFA 2JJ2D 1FUJA 4DY7B 2FZZA 2Y81A 4JZDH 3SU0A 1KY9A 1O5GH 4XBCA 1OWEA 2B8OH 2ZU4A 2FOEA 1LCYA 4MDSA 2UUKB 1E0FD 2GV7A 1SPJA 2A4RA 2W7UA 1KTTB 2BXTH 1C4Y2 5CHAB 1H9HE 1XUIA 3MFJA 4CR9A 2Q1JA 4B75A 1AUJA 1TX6A 2QXIA 5FPTA 2P95A 2OP9A 3SI4H 4GCHF 3AASA 4AN7A 4I8HA 1K1PA 4X1PU 1YM0A 5FBEA 2BY6X 1ZHPA 2BX4A 2J38A 3SUEA 3OE7D 2BLVA 1TABE 4M7GA 1GI0A 4TPYA 1GHYH 3M3VA 2CK3D 3UIRA 1EAXA 3MNCA 5GCHG 1EX3A 2QAAA 4K1SA 4ASHA 2BY7X 1K9OE 1MTNC 3KIDU 3RXEA 3UQVA 5HIYA 2TGAA 1QTFA 1LVMA 2KCOA 1GHZA 1NY22 1O0DH 5EPYA 2EI8A 1EQ9A 4ABBA 4JZFH 3PMBB 2ANWA 1NM6A 4RT0A 4FUJA 5A0CA 4HTCH 4WMFA 4YT6H 1OS8A 3RC4A 1J17T 1T7CA 1NZQH 5EXLA 5EOKA 1MTSA 2OK5A 1IOEA 1YF4A 3RM0H 4P02A 1D3TB 1SVPA 2AGIX 1O5FH 1AZZA 1P2IA 3ZZ3A 3A7XA 3LT3A 5CE1A 4MNWA 4CBOA 3EA7A 4UD9H 1AN1E 1BTUA 1SLWB 3KQ5A 1W7XH 1DWDH 1W0ZU 1QBOA 1V2TT 2BYAX 2PP6A 1LHCH 1UVOA 4FOUC 3QWCH 4ISIH 1B0FA 1FONA 2QGRA 4FUHA 1K0HA 1TFXA 5LPRA 3TGJE 1QRXA 5K7RA 4O97A 3JZ1B 3U69H 1HJAC 1SQRA 2XC4A 4NIYA 1V2RT 3LGYA 3U28C 2VIDA 3A88A 4WJG2 1SQAA 2PUQH 4ZKOU 1DX5M 1C2KA 2FWWA 1C2IA 4J1YA 5B6LA 1CT2E 1GBCA 3PTNA 1ARBA 3M5LA 3OTPA 4JK6A 3F2FA 1GL1A 4ISLA 1OWDA 1QJ1B 3BEIB 2BDCA 1FI8A 1A46H 2A4GA 1PPBH 4H6SB 2ZFTA 3RDZA 1ZJKA 3BTHE 1HAVA 1LVBA 3DD2H 6CHAC 5FHTA 2WHXA 4FUCA 3RXJA 2VVVA 2VH0A 1GMHF 3WY8A 1FQ3A 3OYPA 5DP6A 3B8JA 1XUGA 1N8OB 1O2MA 2FESH 4KGAA 1TX8A 1DWBH 4RI0A 4KKDA 5FCKA 3VXFH 4TSFD 2SGPE 3PMAB 4X1QU 1S0RA 3D23A 4UFGH 2TRMA 4BOHA 1A5HA 1TA6A 1AGJA 2IJD1 2ZTXA 1TGCA 5ABWA 1HIAB 1C5PA 3SZEA 1SGNE 1C4V2 1D3PB 4F49A 3VEQB 6ESTA 2J2UA 1DLKB 3A8AA 3EYDA 3LH1A 1SHHB 1K1IA 2NU4E 3E0PB 1LHEH 3LPRA 4YLUA 3ZVDA 3R3GB 8GCHF 1A0LA 4K5ZA 2ZTZA 2R0KA 1C1NA 2BXUH 2Z3CA 2PHBA 5DK1A 4TPIZ 1LPKB 3PV5A 4ZH8A 1ANEA 4WH8A 6GCHG 1GWAA 3U1JB 1WV7H 1G30B 2KZ4A 3F68H 2H2ZA 1P3EA 1TNHA 3TJVA 1YPEH 1PQ5A 1XUFA 5DGJA 3ZZBA 1ZRBA 4WXIA 3DUXH 4X2XA 2RCEA 3FFGA 1DICA 4ZMAH 2ZWLH 2K0QA 2VBCA 1EZXC 2WPIS 1CGHA 5FXLA 1GJ9B 4A1TA 3FP7E 3VXEH 1MZDA 4XFQA 2R2MB 5GNDA 3GY8A 3BV9B 3T25A 3MYWA 2BLQA 4R8TB 3PMJA 2EC9H 1Z7KA 2QE7D 2F9OA 1TRNA 2HLCA 5FPYA 4ZROA 1KLJH 1KSNA 1MUEB 1SQTA 1O2IA 3DHKH 4A92A 1JRTA 2F9PA 1NPMA 2IJOB 3GY4A 4NIXA 3BG4C 3ZZ5A 1UHBA 1W0JD 4ZHLU 3I77A 5T6FA 1ZJDA 5HM9A 3MWIU 1C4U2 2PR3A 1P0SH 1TE0A 1LQDB 4DOQA 4MG3A 4ABDA 1BMFD 1G3EA 3F9GA 2TIOA 3QK1A 1SL3A 4XSKU 2A2XH 5EJLA 1KDQA 1TPAE 2RG3A 3SU4A 1GG6C 1MU6B 4RSPA 3F6UH 1GBTA 1QB6A 1Z1IA 4ZHMU 1BMMH 1Z71A 2ZG0H 3TJNA 2H1UA 2ALVA 2AIPA 3SW2B 3FO8D 4ABEA 1K28D 2GP9B 1TWXB 4B6EA 3CP7A 2PSYA 1SGQE 3NRLA 2ZGHA 3OEHD 3E1XB 3LJJA 3RXTA 2ZGCA 4BAMB 2D8WA 1ANDA 1P3CA 1YCPH 1FIZA 5C1UA 3QTOH 1O34A 4HZHA 4WMEA 3ZVFA 1C5UA 1ANCA 1TNLA 2TGDA 2ZPRA 2XNDD 1O38A 3AK5A 2C90B 4LXBH 4WVPE 1GDQA 1WUNH 1K21H 1HJAB 1T4VH 3TGIE 2VNTA 1YCPK 2UUJB 1QRZA 4X8TH 1GJ7B 1SLVB 3SHCH 2ZHQH 4YOGA 5CHBA 2BDGA 3P95A 3W95A 4FETA 1CA0C 3S69A 3I29A 3MO3A 1TBZH 4XBDA 1MQ6A 2SNVA 2NU0E 1H8IH 2UUYA 3F2HA 2R3UA 3U9AH 1IQGA 2KAIA 1EJMA 2BLWA 2ESTE 2V6NA 4K1EA 3FZDA 1GBIA 1J8AA 1EZQA 1Q3XA 4IMZA 1YGCH 1QRWA 1YWUA 3SJKA 3LGWA 5F8TA 2J97A 3MU8A 2GCHG 1P11E 1NTPA 1BRCE 3RXQA 1F0TA 1YLCA 1YYY1 1RTKA 4MPXA 6CHAB 3V3MA 1P2OA 1SOTA 2Q6DA 2QIQA 4NIVA 1SGRE 5GCHF 5L6NH 2FLBH 1Y59T 3OAAD 2NU1E 2KCPA 1Z6JH 3LIWA 3AVZA 1GPZA 5IDKA 2AMDA 1EATA 3QZQA 1HV7A 4ASUD 1NO9H 1OX1A 2ZIQH 3T27A 3ZZ9A 1LKBA 1GJ5H 3FZZA 4RT1A 3EAJA 3ODFA 1S6HA 2D26C 3A81A 3S7KB 1BTZA 2XWBI 2WV5A 2WYJA 2HVXA 1UVPA 2A5IA 3ZZ6A 3IWMA 5EQQA 1GJ4H 1Y3WA 1YLNA 4UFDH 1M9UA 1OP0A 2I6QA 2FX4A 3MO9A 3BTDE 3OY5U 1GMDG 3M36A 4E7NA 2Z7FE 1G3DA 1SFIA 3GS9A 2WUBA 3ZVCA 2B9LA 4FXGH 3QN7A 3OY6U 3KQBA 2W26A 2ZCHP 1J16A 5FAHA 1S84A 3RXPA 1CGJE 1OWIA 1TBQH 4X2YA 3TH3H 1E1QD 1IAUA 1IQFA 1BTPA 1WQSA 2BZ6H 1OHHD 3GISB 4I8LA 3SU1A 1LVOA 1EAUA 4Q80A 2R3YA 1FY4A 4DGJA 3UB0A 2HVYB 3S9BA 4U30A 2W7SA 1LKAA 2ZZUH 3P8NA 3TITA 1SI5H 1GJAB 3ATKA 3ZZCA 2G5NA 3ATMA 1THRH 2XYAA 1GCTB 4DG4A 2VVUA 4I32A 2J98B 3RXHA 5HGGA 1XUHA 3UNQA 2H5CA 3Q77A 4BANB 4D9RA 5EGMA 3P6ZB 2GVFA 4Y8XA 2Y5FA 4HG6A 4X1SU 4OS7A 1VZQH 4CBNA 3BG4B 4X8SH 4FUBA 1SGDE 2HPPH 2VJ1A 4R0IA 1LO6A 2A4OA 2LPRA 1WTGH 4JYTA 3STIA 5JBCS 3V12A 4IC6A 1FY5A 2XBYA 1A1RA 1V2OT 2J34A 2A2QH 2PGQB 1KXEA 1NRNH 2ULLA 3H7TA 4B2AA 1GVLA 1GG6B 1SGFG 2BQ6B 5CDFE 5EU8A 1F2SE 1GDNA 1P2JA 1DM4B 3M35A 2FOAA 1V2VT 1EJNA 4FVDA 3NWUA 1O2KA 5TCAA 1EFRD 5EQSA 5DP8A 1F0RA 1GBEA 1KLIH 2LNCA 5T6DA 4NCYA 1F5LA 4GPGA 2OTVA 4INLA 3DFJA 1Y3YA 3PMHB 2RFKC 5EXMA 1BA8B 5LGOA 4ISNA 5BPEA 3RXRA 2Z9GA 6GCHF 1F5KU 4K8BA 1GI4A 4VGCB 1FAXA 1MKWH 3A7ZA 4INHA 4CRBA 1B5GH 1ELFA 2PV9B 1O2WA 3CS7A 3UTUH 3BTWE 2Z9LA 2IOTA 3TK6A 2ALPA 4AG2A 2IPHA 2HNTE 3UREA 1P12E 5DP4A 1WQVH 3N7OA 3BTTE 1NS3A 5GDSH 2FOBA 1G3CA 1KXCA 3VFEA 1YPJH 5A0BA 5EJ1A 5GXPA 1Z8JB 3N7EA 4OM9A 3TU7H 1A3EH 1MKXK 3URCA 2ZU2A 4UE7H 1TRMA 1BTYA 1BDAA 1MU8B 2W6ID 4E05H 2P59A 1AKSB 3SV8A 3F0PA 3IITA 1HXFH 1TGSZ 2TPIZ 2A31A 1C5OH 2STAE 2UWLA 1L4ZA 3E6PH 4NIWA 1WU1A 1C5TA 1FNIA 1MTWA 3V7TA 3KYFA 1L1JA 2J5UA 1VCPA 5F6MA 3TNTA 2J95A 3K6YA 1BTXA 3BTEE 3PB1E 3TH4H 2ZPQA 2KR7A 3SUDA 3SNBA 2ZHEH 5HIZA 3KCGH 1V2LT 2BY8X 3RC6A 2RA0A 1GGDC 4LZ4B 1TNGA 1F92A 1C2EA 2F3CE 1P9UA 3TVJB 2JJ1D 5EW2H 3AAVA 1OPHB 1ARCA 3EA8A 5EW1H 3RXMA 3SHAH 1BUIA 1FN8A 2NU3E 1Z8GA 1NFYA 2BDBA 3QO6A 2GT8A 1WDIA 3E8LA 1QL8A 1JXPA 1SGCA 2JETB 5DP5A 1S6FA 2ZGXH 1QNJA 3LC3A 4GHQA 1LPGB 1O2LA 2O9QA 3A87A 1SGTA 1SBWA 2M2AA 1VITG 3EA9A 1BJVA 2Q6GA 3A8DA 1ELAA 1UTNA 8ESTE 4NFFA 1JIRA 4TT3D 3Q00A 4I8GA 2FP7B 1IHTH 3LOXA 4FVBA 5HKKD 1UTPA 1EZUC 2P3FH 1FPHH 1P02A 1O36A 4O3UA 3MH7A 2L6OA 1C5NH 2Y6TA 4B2BA 1FMGA 1C1PA 1H4WA 1O3FA 1VCWA 1LTOA 1LQEA 2B7DH 2WSSD 3D65E 5EXNA 4Y7BA 4ZUHA 3KYGA 1EP5A 1HAHH 2G8TA 1H9IE 2BDAA 1QQUA 1ZSKA 3DSOA 5AFYH 5C5NA 4GAWA 2Y82A 1X7AC 1O5BB 2F91A 1HCGA 2GCHF 3E90B 3ATIA 3UQOA 1AVXA 1QBVH 1O3JA 2OC1A 1T8MA 3SJIA 1SKYE 4AB8A 2Y5GA 5T6GA 1E38B 1NFXA 3SJOA 2JH5D 1QJ7B 4ZKNU 1QR3E 1O2HA 1LMWB 1P8VC 5A8YA 1ETTH 3O8BA 1O3OA 3VB3A 2O8MA 3S0NA 1YPLH 1TGBA 1UO6A 2HALA 1D6RA 4CH8B 4XRNA 3OFND 3FKSD 1UVUH 3LJOA 1YPKH 1FPCH 1ZHMA 2OINA 2XCNA 3A86A 1CT0E 2V3HH 2C8XB 3R0FA 3ZZ8A 3S7HB 3FP6E 1A5GH 2OBQA 3SU3A 5T3HA 1KIGH 2WPDD 3HGPA 3GY6A 1GMDF 3FANA 1SQOA 3GCHB 1BHXF 2BDIA 1K1NA 2VWLA 1Q2WA 2A1DB 2XW9A 2VWNA 1FY1A 2WYGA 1O2JA 1IQHA 2ANYA 1CA8B 2K8IA 4YT7H 1VCQA 1DPOA 1O39A 2VIPA 3URDA 3MO6A 3CS0A 2BY5X 3DT0H 1VITH 2G55A 1HAIH 2XBWA 3GY3A 1T8NA 2PGBB 2AGEX 3PO1C 2R0LA 3ZZ7A 4WH6A 4U01A 3A83A 1QJ6B 1AVWA 3TNSA 1GI5A 1ZGVA 1EASA 4PROA 2ZHDA 3A7YA 1S85A 7ESTE 1D9IA 2A5AA 1UCYH 2BDHA 4YLQH 2F9NA 5A09A 1ZSJA 1AU8A 4X0WU 1A61H 4Y71A 1SSXA 1GBFA 2XWAA 1QB1A 3VGCC 2AGGX 1GHXH 1KLTA 1P2NA 2TGTA 5A8ZA 4KTCA 1MTUA 2G4UA 3SNAA 4DCDA 2GX4A 2HGTH 1UCYK 1C5WB 2EY4C 1E34B 2GMTB 5EODA 5C1YA 1JRSA 4ABGA 7KMEH 2WINI 2J94A 1CQQA 2YMSD 3ENSB 3T29A 3SU2A 1QY6A 1WSSH 3FN8A 3S9AA 3EDXB 3M7TA 3KL6A 3STJA 5C20A 3ITIA 4FUIA 2XC5A 3MNBA 1Y5AT 4Z1MD 4OGXA 5AF9H 1GBAA 1C2HA 1GGDB 4KP0A 1DDJA 1OWJA 4ISHH 3RXUA 3RXBA 1DY8A 3F9HA 3UPEA 3MU4A 1RTLA 1HAXB 5FX6A 2VVCA 1ELTA 2BD5A 4A6LA 4CR5A 1P06A 1O3IA 3ZVEA 4AG1A 2Z6BD 3D49H 1C1TA 4X8VH 1EPTA 3TJOA 1K1JA 2QCYA 4JZ1A 1TB6H 2C3SA 4THNH 4B73A 4Y76A 1EXFA 3LGVA 2AMQA 2VWMA 1E79D 3A89A 3BSQA 1ESTA 4KTUA 1ELDE 5EJZA 4A1XA 1GBKA 3M5MA 1OXGA 5G4BA 3GCNA 2YNBA 2FLRH 3L6PA 2Z3EA 1U6QA 1AHTH 1AO5A 2UUFB 1W2KH 3T26A 2VIVA 1G2LA 4FU8A 1E36B 1HRTH 2BZAA 3QTVH 4ZHAA 3MH4A 1SMFE 1AB9C 2F43B 1AWHB 4NSVA 4F48B 1C5MD 4IC5A 5JB8S 5GIBA 1TMBH 1HB0B 3I78A 1O31A 1S82A 3PTBA 2V3OH 3QGJA 2C8ZB 1QZ8A 1BBRK 1XVOA 3FAOA 1TMUH 3F2GA 4B2CA 1BZXE 1OP2A 2SGQE 3FOAA 1YCPM 3A8BA 1G9IE 5E0HA 1MBMA 1QB9A 4I31A 4AOQA 1TQ7B 1P57B 4JMYA 2ODPA 1N1LA 3F9FA 1ABJH 1C2LA 1D6WA 1P9SA 1QFKH 1WXRA 5AFZH 5C1XA 5AVDA 3SBKA 1IQMA 1P2KA 2BQ7B 1DUAA 1O5CB 2HNTC 5PTPA 1RJXB 4YM9A 3K2UA 1ABIH 2RDLA 3P8GA 4Y8ZA 3MH6A 2W5EA 1XXDA 1B7XB 2FOMB 4UEHH 4DT4A 4D9QA 4MPVA 4ACAA 1MTNB 1C5VA 5BRRE 3SNDA 3KHVA 5LH8A 4Y0ZE 2JH0D 3SQEE 2H9EH 2Z3DA 2WZQA 1HAPH 2ZECA 1V2PT 3F1SB 2PKSC 1V2ST 3MH5A 3SN8A 3OU0A 1ZTJA 2H6MA 2VIOA 1QCPA 1VJ9U 3GYLB 1XX9A 3RMMH 1LVYA 5DG6A 2J4IA 3KEEA 4NG9H 1VITF 5HXFA 1W3CA 3LH3A 5F8ZA 2VH6A 1QURH 4A5TS 3OSYA 3RMLH 3UOPA 1SHYA 2DE8A 1XUKA 3RXKA 5GWZA 2LELA 1BQYA 2JH6D 3VPKA 1DY9A 1GBHA 4IS5A 4YXWD 1AVGH 5ESBA 3PV2A 1SB1H 4GVUA 4JK5A 1AD8H 1C9TA 1OWHA 2STBE 1F0UA 1O2NA 3GDSA 1QQ4A 1C1VH 3C1KA 4B74A 2IN2A 3DFLA 2FI4E 3MTYA 4Y11E 1WBGB 1AE5A 2F83A 2QF0A 2EEKA 3VGCB 4BAKB 1T32A 3DSGA 2C4FH 5DKMA 5F03A 2CMYA 3PWCA 3M3SA 3CENA 4F55A 3GCOA 1C5RA 5JBBS 1L0ZA 2OUAA 1ZR0A 1GBBA 1ZPCA 3GY2A 3T28A 1TIOA 2Z94A 2THFB 4BXWA 1QBNA 2CF8H 2AMPA 3RXVA 1FAKH 2Q6FA 1ELBA 1TNIA 2V7QD 4NSYA 1MBQA 3QZRA 2FPZA 1G3BA 1Y8TA 3SORA 4CRFA 1O2PA 1ELEE 2A5KA 2SGDE 4AB9A 1XKAC 2A32A 2FTLE 1UCYE 4DIHH 1O2VA 1HAZB 3N99A 3SV2H 1LHDH 1GI7B 1OP8A 1BB0B 1D4PB 1QL9A 1VR1H 2Z9IA 1NC6A 2Y7ZA 2WUCA 1S0QA 4CRGA 4BXSA 2ZO3H 1RFNA 3FVFB 1RXPA 3UFAA 5FX5A 1O3PB 2ODQA 2ZGBH 4X2VA 3SOSA 2SGFE 5E8EH 1EPTC 1A4WH 1Z1JA 4LOYH 2PKAB 1GVZA 3RXDA 5IK2D 1MQ5A 2GGVB 3MU5A 1SG8B 1B0EA 4IBLH 4MVNA 2QA9E 4K1TA 4Y7AA 1GHBG 4CRAA 1L1NA 1Z6EA 2O8WA 2GD4B 4NA9H 3A82A 2OLGA 3ZZDA 1ESBA 1ZMNA 3HPTB 3P70B 1GL0E 3UNRA 2FOGA 5GPIB 1KXBA 2ZEBA 1GBJA 3RLYH 3SNEA 1PPGE 1VJAU 2QF5A 3SU5A 2YNAA 3RXSA 1HIAA 1UTJA 5LPEA 3RXIA 3MNSA 3ZVGA 4IGDA 3RXOA 1GHAG 1WCZA 3QDZB 3TH2H 1JMOH 3RXLA 3RUOA 3RU4E 1C1QA 1O2UA 3SV6A 2OCVB 1BBRE 4WWYA 3SGBE 3TK5A 1GI2A 4D7GA 1FIWA 1GJCB 2P8OC 1P09A 1DITH 2QC2A 3H09A 1O3KA 2ZHWH 2G00A 2FS9A 1TNJA 1H8ED 2J92A 3RU4T 3GYMA 2WV4A 4ABJA 1W8BH 4MTBA 2B0FA 3K9XB 4Q4LA 3NUMA 4MPWA 3B9FH 4RN6A 1DXWA 2CXVA 1QA0A 4JYVH 3ZYEA 3MI4A 2ZCLP 5FCRA 1S5SA 2PKSB 3HK6B 5CHAC 2WPMS 3KGPA 3PLBA 1IQIA 4NZLA 1CVWH 2HNTF 4B6FA 1YY3A 2BOHB 2JKHA 1Q31A 2ZP0H 1UTKA 5C5OA 3FP8E 2KX4A 1CHOG 5C3NA 1KXFA 4CREA 4ABHA 1W14U 2OQ5A 1ETSH 2P93A 5C0TA 1PPHE 2FMJA 2F9BH 3VB5A 2AHME 1XM1A 1UK3A 1DXPA 1CU1A 4QT8C 4H42U 1DVAH 4TWYA 2FDAA 2O8UA 1EZSC 1G32B 1XXFA 5JBAS 4X2WA 3P8FA 1C1UH 1PYTC 1FV9A 2BOKA 3S9CA 5K0HA 3UAIC 4Q63A 1ESAA 1AQ7A 1C1MA 1RRKA 3AAUA 1DLEA 1MKXH 2GV6A 3F3BA 3M5OA 3LGUA 2D1JA 1TX7A 2ZU3A 2BTCE 4JCNA 4OS1A 1CA0B 2FEQH 5LPFA 3HATH 2A0QB 3RXFA 1IQNA 1TQ0B 1H1BA 2CV3A 3RXCA 2ODYB 2HWLB 3E91A 4YZUA 1CE5A 2QXJA 3GCTG 3ZIAD 1KMHB 4TY6A 3VG8A 3HGNA 5F53A 1QL7A 3TJUA 3GOVB 1OSSA 5HM2A 1K1LA 4K8YA 3KN2A 1TGTA 1O2YA 1GI1A 1THPB 5E0GA 1HAVB 1ZGIA 2PW8H 1UVTH 3PV4A 4I7YH 3AW1A 2PSXA 2AFQB 3QX5H 3RMNH 1RIWC 2ZQ2A 1L4DA 2QN5T 3GICB 2QV1A 1DFPA 1HAYB 3MU1A 5L2ZH 2Y7XA 1O2RA 2BD7A 3BTGE 2WPLS 3M61U 1UTLM 2SFAA 4OGYA 2ZDNA 3M37A 4MNYA 1DS2E 1EOLA 1KYNA 2DUCA 2GTBA 3UNSA 2VINA 2KCYA 1C5XB 5H4IB 2UWPA 5HMAA 5FL7D 4BAQB 1BTHH 1SGIB 2AEIH 1PYTD 3KQCA 5E2PA 1H8HD 1GI6A 5GJ4B 1V6DA 4NA7A 1ID5H 4FUEA 2AIQA 3DCLA 1O3CA 3M7QA 1BRAA 1GDUA 2GCTC 1O5AB 4K3JA 3UWJH 4FUDA 2VB0A 2UWOA 3MHWU 2P3UB 4WMDA 1N8OC 2XBXA 1C2FA 1UVSH 3PM3A 3Q3KA 3RLWH 3SO3A 5B6OA 5KEDA 4SGBE 5TJXA 4I8KA 4UONA 1Y3XA 3TK9A 4D8NA 1W10U 1SGPE 2FYRA 4Y79A 2BMGB 1K2I1 2TBSA 2ZHFH 2FI5E 2ZI2H 1HXEH 4AFSA 2M5TA 2AYWA 1W0KD 1FZZA 1E37B 3A8CA 3L3TA 2GZ8A 1G2MA 1V3XA 1G37A 3LDXH 2HPQH 4AYVB 3SJ9A 2BLOA 1SLXB 4O3TA 1AIXH 3BTKE 3SV7A 3F9EA 1FX0B 1TAWA 3LONA 2CN0H 1IQJA 2OC0A 1BHXB 1UHBB 3M7UA 2PUXB 4XBBA 1JWTA 2BVRH 2C93B 4ZKRU 4INKA 2YMSC 3G01A 3ATLA 1Y3VA 4LZ1H 3WWBA 2BD9A 2C8YB 4NWKA 2ZTYA 1AFQC 2ZKSA 2ZFRH 1KDQB 1UJ1A 2TGPZ 4O03A 4IMQA 1EB2A 1UK2A 1PPFE 4UFEH 1DOJA 1FDPA 2ZA5A 1O3HA 1NFWA 1BCUH 1AY6H 1ETRH 2J98A 5HYOA 1DE7H 1HYLA 5JDUB 1CSOE 3D62A 2W3IA 1GHBF 4HGCA 5I46H 4TYDA 2ZDVH 4MNXA 2KM0A 1GBLA 1ZOMA 1QHRB 4HI3A 4NZQA 3A80A 5SGAE 3W94A 1O2XA 9ESTA 1IQLA 2WPHS 2HLDD 3SGAE 5ETXA 3PLKA 1TNKA 2GT7A 5C17A 1EKBB 4HFPB 4Q7ZA 5C94A 3VB4A 4FUFA 2XXLA 3NCLA 3ESTA 1AI8H 2FYQA 1CHGA 1ZTLA 2FM2A 3U1IB 1MTVA 5EIYA 1UTQA 2XOKD 1P01A 1GI9B 2WV9A 3V13A 1GHAF 1GMCG 3C27B 3WWFA 2FOCA 2FOFA 3ZYDA 4X6PA 1O2QA 3RC5A 1BRBE 1BJUA 1ZLRA 3T2NA 1AZ8A 1SOZA 1O3EA 1GBDA 5L30H 1A7SA 2DE9A 1C2DA 2SGEE 4D7FA 2CHAC 1V2NT 3F0OA 1N6XA 2D2DA 2I6SA 4JZIA 2KAIB 4MQAA 5DO4H 1V2KT 1SLUB 5C2ZA 4K2YA 3LGIA 3AW0A 2P3TB 2WPJS 2KFWA 3SQHE 1O33A 2VIQA 1GHVH 1UW7A 2CJIA 1K22H 1LDTT 2BX3A 5C67A 1EOJA 2VIWA 4U2WA 1FN6A 1Y5BT 1INCA 4GUXA 1RIWB 1S6LA 1QIXB 1RTFB 4AYYB 2H9TH 2OC8A 1BTWA 4AC9A 2ASUB 1XVMA 1LPZB 2PLXA 3KQDA 5JPMH 5J4QA 1C1OA 1KXDA 2FO9A 3HK3B 2VGCC 1O5EH 4UFFH 3BIUH 2R2WU 1HPGA 4H6TA 4X6MA 1WYKA 1NROH 1ZHRA 1P10A 1E1RD 2ZDMA 1TPPA 3UOUA 4I8JA 3ZVAA 1CHOF 3BTQE 1CGIE 1AKSA 1YPMH 5EQRA 1EUFA 2ZFSA 1Z8IB 2L74A 5F8XA 4NFEA 1YPHE 2ZDLA 4AGJA 1SGYE 2VWOA 4ABIA 2H5DA 2ZGJA 4BNRA 3E16B 1ORFA 3SUGA 3BN9A 4ZAEA 4NWLA 2GCTB 4FUGA 3Q76A 4AFQA 1JIMA 2BD2A 2R9PA 2J9NA 3B23B 1T4UH 4A1VA 2OXSA 1A3BH 3K65B 4AZ2B 1BBRH 4H4FA 2ZU5A 1DWEH 3E0NB 1MH0A 1AFEH 1P04A 2QYIA 1ANBA 1NT1A 4K69A 1BOQA 4KELA 1O3GA 1GHWH 7LPRA 4X1RU 1QA7A 2G51A 1RS0A 4JYUH 1NBMD 3NXPA 3DSPA 1XMNB 3QGNB 1YBWA 3A7WA 4TWWA 1CT4E 3UR6A 5JYIA 3GCTF 1PQAA 1S81A 2KCAA 1F7ZA 1NRRH 4UDWH 3O8CA 3TGKE 1ZRKA 5CMXH 1YLDA 4AGKA 1D3DB 4IW4E 1S83A 3NK8A 4ESTE 1O2ZA 1L1GA 2ZQ1A 4ZCNA 3RU4D 1NU9A 1OYQA 1HAGE 1ELVA 4GLYA 5KECA 5C0UA 2XTTB 2YMSB 4YTAA 3BEFB 1IQKA 3ZVBA 2ZCKP 2BVSH 3ZV9A 2OD3B 1AFQB 4XE4A 3U8RH 8LPRA 1NN6A 1DANH 3GDVA 3Q3XA 4X1NU 4D76A 1QGFA 2O8LA 1FY3A 2H9HA 1ACBE 1AUTC 2ZPSA 4OS5A 1GCTC 5ESTE 2P94A 4BAHB 1GJDB 1FXYA 4MPUA 2IPQX 4DT7B 2NU2E 2Z9JA 1ZYOA 3UR9A 4WXVA 3EQ0H 1CO7E 1LHGH 1GBMA 2HRVA 1NFUA 3W1EA 1W7GH 4B71A 1ELCA 4WF8A 5A2MH 1BMLA 1SC8U 3PO1B 3QUMP 1P2QA 1W11U 2FIRH 1O2SA 3UUZA 1KTSB 3PRBA 1P03A 1BT7A 1L2EA 2SGAA 2ZDKA 1T31A 1O3BA 4Y10E 1HLTH 3TPIZ 2QY0B 1MD8A 2V0BA 3MNXA 1ELGA 1GJ6A 1E35B 3BEUA 1ZTKA 4Y6DA 2OQUA 1HFDA 3SV9A
chains in the Genus database with same CATH topology
1DT2A 5JBTA 1MZAA 2CHAB 2V35A 5JB9S 4B76A 1W13U 4LK4A 1OWKA 1BMNH 3PWBA 4Z0KA 3SI3H 2PWXA 2CF9H 1C2GA 4NGAH 4VGCC 2A4QA 1EAIA 7GCHG 1TALA 1C1WH 3NKKA 1GCDA 2ZFQH 3BTME 1TOCB 2NWNA 3DA9B 3U8OH 3H5CB 4CH2B 1O32A 3KF2A 2VGCB 1SFQB 9LPRA 1DWCH 1TLDA 3M3TA 1C5YB 1DSTA 1THSH 2ZU1A 4AX9H 4AFUA 4U32A 1V2JT 2FS8A 2AH4X 1MCTA 3A85A 1IHSH 1SGFA 2GDDA 2ZF0H 1Z8RA 4AFZA 1AE8H 1C5LH 5IYTA 1J15A 1TOMH 2GDEH 3GDUA 2FXRA 1P2MA 2O8TA 1PQ8A 1G36A 1TMTH 4CRCA 3BTFE 4OS2A 1V2WT 2K1QA 3MMGA 4K60A 2GZ9A 1WOFA 2RA3A 3K6ZA 4GCHG 3RP2A 4YO9A 1NU7B 1TYNA 4Y8YA 3BF6H 1NRPH 1HJ9A 3P92A 4FU9A 1Y5UT 1C1RA 1WAYB 2ZC9H 1O37A 2BB4A 4BAOB 1HGTH 4SGAE 1O2OA 5DP7A 3KNXA 4ZXYH 5J4SA 1CBWC 2YOLA 1GMCF 1D3QB 3NZIA 3LGTA 3ZZAA 2VU8E 1HAOH 1AB9B 1GJ8B 1O3AA 1T8LA 1UTOA 2GZ7A 2ZDAH 4X8UH 5EPNA 4ABAA 4LZ4B 1DSUA 4JZEH 4NA8A 1FJSA 1HJ8A 4Q7YA 5FPSA 4J2YB 3L33A 4IN2A 5DP3A 3HKJB 1GJBB 1H9LB 1XUJA 1VGCC 1BITA 1AMHA 3ATWA 3IG6B 1ZZZA 4DJZB 3PLPA 1IQEA 2QXHA 2JETC 4YESB 2G52A 3PROA 4TY7A 1UMAH 1J9CH 1MAYA 2B5TB 4E7RG 4BTUB 1A0JA 5FBIA 3ODDA 3SU6A 2BQWB 4CHAC 1SGEE 2OBOA 3V0XA 2BD4A 1MCVA 1DUEA 1PFXC 3RXAA 3U8TH 4RKJB 1O3DA 2QXGA 1C9PA 2FOHA 3RM2H 2BM2A 3P8OA 1AWFH 2WPKS 4X6OA 1PQ7A 1KXAA 4ISOA 3Q3YA 1C5ZB 3SGQE 4ZXXH 1JBUH 4MNVA 5A0AE 1BRUP 1K1OA 4O9VA 1FLEE 1WTHD 2EI7A 2A7CA 1GI3A 4FU7A 3KQEA 4AORA 1TPSA 4F4OC 1NRSH 3LC5A 4DVAU 1UK4A 5TCCA 1MMJN 5DPAA 3A7VA 1EAWA 2HOBA 3O8DA 2A45B 4IN1A 3VB7A 3T62A 1UTMA 2ILNA 1TRYA 1HUTH 5AHGH 2GKVE 1T8OA 1C2MA 4GHTA 3UY9A 1PPEE 1YKTA 3U98H 2Y5HA 4BTTB 1A2CH 2C8WB 1HNEE 4XDEA 3MU0A 2XC0A 1YC0A 4Q2KA 2BHGA 3SZNA 2FTMA 1EJAA 2BD8A 1P05A 1W0YH 4B1TA 3M5NA 1JOUB 3A84A 3PYHA 5I25A 1NESE 3JZ2B 1BIOA 1J14A 1GMHG 1O2TA 1YPHC 4OS4A 1TONA 3NPSA 2OC7A 3GY5A 1V2UT 1HDTH 1EB1H 1XKBC 3GCHC 1MD7A 2AS9A 4E06H 1NRQH 4Y0YE 2FI3E 1MAXA 1ZMLA 1O5DH 4GSOA 4Z6AH 1A0HB 1PJPA 4WY3A 2PTNA 1YP9A 4BTIB 1BMAA 1OKXA 1ZPBA 1N6YA 2FODA 2G81E 2Y80A 3RXGA 1O3MA 4Q7XA 1PPZA 1F0SA 1O30A 1PPCE 3OX7U 2G4TA 6LPRA 3BG8A 4X6NA 2FX6A 1A5IA 2BVXH 8GCHG 4DIIH 2PFEA 1GVKB 4KTSA 2EI6A 1EP6A 1LHFH 3A7TA 3BIVH 3SNCA 2XBVA 3H7OA 2BDYA 2A7HA 1C5QA 1Y3UA 1MKWK 3SJ8A 3SUFA 1SR5C 1TGNA 2SNWA 4RKOB 1OOKB 4ZKSU 5DP9A 2Z9KA 3UWIA 5E0JA 2QF3A 1O3NA 2F9UA 3E3TA 1OYTH 2W3KA 2ZFFH 4XOJA 1TBRH 2GMTC 3OTJE 3TLOA 1YPGH 1EPTB 2A7JA 2ANMH 1ZPZA 4OS6A 1GI8B 2XNIA 2XRCA 4ABFA 5A8XA 1K1MA 4YOIA 4YOJA 1H8DH 1HBTH 5L2YH 1TA2A 2P16A 2ZNKH 3LU9B 4DW2U 1O2GH 2EA3A 5DJ7A 1V2QT 5EG4A 1CBWB 3GY7A 1ZMJA 2ANKH 3ZZ4A 1C5SA 1ZSLA 1O3LA 3EE0B 4CRDA 1RD3B 3ZV8A 1RGQA 2AERH 4A7IB 1VGCB 2PTCE 5E2OA 1O35A 3ELAH 1C2JA 3HKIB 1W12U 3MOCA 3TIUA 3RMOH 2ZFPH 2PKAA 1F5RA 1V2MT 3P17H 2G5VA 3O8RA 4DURA 4I33A 1TPOA 1C1SA 3LKWA 2F9VA 4MLFB 1FY8E 4CHAB 7GCHF 3T5FH 3QLPH 2CGAA 2BD3A 2BY9X 8KME2 2P8OB 3EGKH 3VB6A 2XCFA 1FUJA 4DY7B 2FZZA 2Y81A 4JZDH 3SU0A 1KY9A 1O5GH 4XBCA 1OWEA 2B8OH 2ZU4A 2FOEA 1LCYA 4MDSA 2UUKB 1E0FD 2GV7A 1SPJA 2A4RA 2W7UA 1KTTB 2BXTH 1C4Y2 5CHAB 1H9HE 1XUIA 3MFJA 4CR9A 2Q1JA 4B75A 1AUJA 1TX6A 2QXIA 5FPTA 2P95A 2OP9A 3SI4H 4GCHF 3AASA 4AN7A 4I8HA 1K1PA 4X1PU 1YM0A 5FBEA 2BY6X 1ZHPA 2BX4A 2J38A 3SUEA 2BLVA 1TABE 4M7GA 1GI0A 4TPYA 1GHYH 3M3VA 3UIRA 1EAXA 3MNCA 5GCHG 1EX3A 2QAAA 4K1SA 4ASHA 2BY7X 1K9OE 1MTNC 3KIDU 3RXEA 3UQVA 2TGAA 1QTFA 1LVMA 1GHZA 1NY22 1O0DH 5EPYA 2EI8A 1EQ9A 4ABBA 4JZFH 3PMBB 2ANWA 1NM6A 4FUJA 5A0CA 4HTCH 4WMFA 4YT6H 1OS8A 3RC4A 1J17T 1T7CA 1NZQH 5EXLA 5EOKA 1MTSA 1IOEA 1YF4A 3RM0H 1D3TB 1SVPA 2AGIX 1O5FH 1AZZA 1P2IA 3ZZ3A 3A7XA 3LT3A 5CE1A 4MNWA 4CBOA 3EA7A 4UD9H 1AN1E 1BTUA 1SLWB 1W7XH 1DWDH 1W0ZU 1QBOA 1V2TT 2BYAX 1LHCH 1UVOA 3QWCH 4ISIH 1B0FA 1FONA 2QGRA 4FUHA 1TFXA 5LPRA 3TGJE 1QRXA 5K7RA 4O97A 3JZ1B 3U69H 1HJAC 2XC4A 4NIYA 1V2RT 3LGYA 2VIDA 3A88A 4WJG2 1SQAA 2PUQH 4ZKOU 1DX5M 1C2KA 2FWWA 1C2IA 4J1YA 1CT2E 1GBCA 3PTNA 1ARBA 3M5LA 4JK6A 1GL1A 4ISLA 1OWDA 1QJ1B 3BEIB 2BDCA 1FI8A 1A46H 2A4GA 1PPBH 4H6SB 2ZFTA 3RDZA 1ZJKA 3BTHE 1HAVA 1LVBA 3DD2H 6CHAC 5FHTA 4FUCA 3RXJA 2VVVA 2VH0A 1GMHF 3WY8A 1FQ3A 3OYPA 5DP6A 3B8JA 1XUGA 1N8OB 1O2MA 2FESH 4KGAA 1TX8A 1DWBH 4KKDA 5FCKA 3VXFH 2SGPE 3PMAB 4X1QU 1S0RA 3D23A 4UFGH 2TRMA 4BOHA 1A5HA 1TA6A 1AGJA 2ZTXA 1TGCA 5ABWA 1HIAB 1C5PA 1SGNE 1C4V2 1D3PB 4F49A 3VEQB 6ESTA 2J2UA 1DLKB 3A8AA 3EYDA 3LH1A 1SHHB 1K1IA 2NU4E 3E0PB 1LHEH 3LPRA 4YLUA 3ZVDA 3R3GB 8GCHF 1A0LA 4K5ZA 2ZTZA 2R0KA 1C1NA 2BXUH 2Z3CA 2PHBA 5DK1A 4TPIZ 1LPKB 4ZH8A 1ANEA 4WH8A 6GCHG 1GWAA 3U1JB 1WV7H 1G30B 3F68H 2H2ZA 1P3EA 1TNHA 3TJVA 1YPEH 1PQ5A 1XUFA 5DGJA 3ZZBA 1ZRBA 4WXIA 3DUXH 4X2XA 2RCEA 3FFGA 1DICA 4ZMAH 2ZWLH 1EZXC 2WPIS 1CGHA 5FXLA 1GJ9B 4A1TA 3FP7E 3VXEH 1MZDA 4XFQA 2R2MB 3GY8A 3BV9B 3T25A 3MYWA 2BLQA 4R8TB 3PMJA 2EC9H 1Z7KA 2F9OA 1TRNA 2HLCA 5FPYA 4ZROA 1KLJH 1KSNA 1MUEB 1SQTA 1O2IA 3DHKH 4A92A 1JRTA 2F9PA 1NPMA 2IJOB 3GY4A 4NIXA 3BG4C 3ZZ5A 1UHBA 4ZHLU 3I77A 5T6FA 1ZJDA 5HM9A 3MWIU 1C4U2 2PR3A 1P0SH 1TE0A 1LQDB 4DOQA 4MG3A 4ABDA 1G3EA 3F9GA 2TIOA 3QK1A 1SL3A 4XSKU 2A2XH 1KDQA 1TPAE 2RG3A 3SU4A 1GG6C 1MU6B 4RSPA 3F6UH 1GBTA 1QB6A 1Z1IA 4ZHMU 1BMMH 1Z71A 2ZG0H 3TJNA 2H1UA 2ALVA 2AIPA 3SW2B 4ABEA 1K28D 2GP9B 1TWXB 3CP7A 2PSYA 1SGQE 2ZGHA 3E1XB 3LJJA 3RXTA 2ZGCA 4BAMB 2D8WA 1ANDA 1P3CA 1YCPH 1FIZA 5C1UA 3QTOH 1O34A 4HZHA 4WMEA 3ZVFA 1C5UA 1ANCA 1TNLA 2TGDA 2ZPRA 1O38A 2C90B 4LXBH 4WVPE 1GDQA 1WUNH 1K21H 1HJAB 1T4VH 3TGIE 2VNTA 1YCPK 2UUJB 1QRZA 4X8TH 1GJ7B 1SLVB 3SHCH 2ZHQH 4YOGA 2BDGA 3P95A 3W95A 3S69A 1CA0C 3I29A 3MO3A 1TBZH 4XBDA 1MQ6A 2SNVA 2NU0E 1H8IH 2UUYA 2R3UA 3U9AH 1IQGA 2KAIA 1EJMA 2BLWA 2ESTE 2V6NA 4K1EA 3FZDA 1GBIA 1J8AA 1EZQA 1Q3XA 4IMZA 1YGCH 1QRWA 3SJKA 3LGWA 5F8TA 3MU8A 2GCHG 1P11E 1NTPA 1BRCE 3RXQA 1F0TA 1YLCA 1YYY1 1RTKA 4MPXA 6CHAB 3V3MA 1P2OA 1SOTA 2Q6DA 2QIQA 4NIVA 1SGRE 5GCHF 5L6NH 2FLBH 1Y59T 2NU1E 1Z6JH 3LIWA 3AVZA 1GPZA 5IDKA 2AMDA 1EATA 3QZQA 1HV7A 1NO9H 1OX1A 2ZIQH 3T27A 3ZZ9A 1LKBA 1GJ5H 3FZZA 3EAJA 3ODFA 1S6HA 2D26C 3A81A 3S7KB 1BTZA 2XWBI 2WV5A 2WYJA 2HVXA 1UVPA 2A5IA 3ZZ6A 3IWMA 5EQQA 1GJ4H 1Y3WA 4UFDH 1M9UA 1OP0A 2I6QA 2FX4A 3MO9A 3BTDE 3OY5U 1GMDG 3M36A 4E7NA 2Z7FE 1G3DA 1SFIA 2WUBA 3ZVCA 2B9LA 4FXGH 3QN7A 3OY6U 3KQBA 2W26A 2ZCHP 1J16A 5FAHA 1S84A 3RXPA 1CGJE 1OWIA 1TBQH 4X2YA 3TH3H 1IAUA 1IQFA 1BTPA 1WQSA 2BZ6H 3GISB 4I8LA 3SU1A 1LVOA 1EAUA 4Q80A 2R3YA 1FY4A 4DGJA 3S9BA 4U30A 2W7SA 1LKAA 2ZZUH 3P8NA 3TITA 1SI5H 1GJAB 3ATKA 3ZZCA 2G5NA 3ATMA 1THRH 2XYAA 1GCTB 4DG4A 2VVUA 4I32A 3RXHA 5HGGA 1XUHA 3UNQA 2H5CA 3Q77A 4BANB 4D9RA 5EGMA 3P6ZB 2GVFA 4Y8XA 2Y5FA 4X1SU 4OS7A 1VZQH 4CBNA 3BG4B 4X8SH 4FUBA 1SGDE 2HPPH 2VJ1A 4R0IA 1LO6A 2A4OA 2LPRA 1WTGH 4JYTA 3STIA 5JBCS 3V12A 4IC6A 1FY5A 2XBYA 1A1RA 1V2OT 2J34A 2A2QH 2PGQB 1KXEA 1NRNH 2ULLA 3H7TA 4B2AA 1GVLA 1GG6B 1SGFG 2BQ6B 5EU8A 1F2SE 1GDNA 1P2JA 1DM4B 3M35A 2FOAA 1V2VT 1EJNA 4FVDA 3NWUA 1O2KA 5TCAA 5EQSA 5DP8A 1F0RA 1GBEA 1KLIH 2LNCA 5T6DA 4NCYA 1F5LA 4GPGA 2OTVA 4INLA 3DFJA 1Y3YA 3PMHB 5EXMA 1BA8B 5LGOA 4ISNA 5BPEA 3RXRA 2Z9GA 6GCHF 1F5KU 4K8BA 1GI4A 4VGCB 1FAXA 1MKWH 3A7ZA 4INHA 4CRBA 1B5GH 1ELFA 2PV9B 1O2WA 3CS7A 3UTUH 3BTWE 2Z9LA 2IOTA 3TK6A 2ALPA 4AG2A 2IPHA 2HNTE 3UREA 1P12E 5DP4A 1WQVH 3N7OA 3BTTE 1NS3A 5GDSH 2FOBA 1G3CA 1KXCA 3VFEA 1YPJH 5A0BA 5GXPA 1Z8JB 3TU7H 1A3EH 1MKXK 3URCA 2ZU2A 4UE7H 1TRMA 1BTYA 1BDAA 1MU8B 4E05H 2P59A 1AKSB 3SV8A 3IITA 1HXFH 1TGSZ 2TPIZ 2A31A 1C5OH 2STAE 2UWLA 1L4ZA 3E6PH 4NIWA 1WU1A 1C5TA 1FNIA 1MTWA 3V7TA 1L1JA 1VCPA 5F6MA 3TNTA 2J95A 3K6YA 1BTXA 3BTEE 3PB1E 3TH4H 2ZPQA 3SUDA 3SNBA 2ZHEH 3KCGH 1V2LT 2BY8X 3RC6A 2RA0A 1GGDC 1TNGA 1F92A 1C2EA 2F3CE 1P9UA 3TVJB 5EW2H 3AAVA 1OPHB 1ARCA 3EA8A 5EW1H 3RXMA 3SHAH 1BUIA 1FN8A 2NU3E 1Z8GA 1NFYA 2BDBA 3QO6A 2GT8A 3E8LA 1QL8A 1JXPA 1SGCA 2JETB 5DP5A 1S6FA 2ZGXH 1QNJA 3LC3A 4GHQA 1LPGB 1O2LA 2O9QA 3A87A 1SGTA 1SBWA 1VITG 3EA9A 1BJVA 2Q6GA 3A8DA 1ELAA 1UTNA 8ESTE 4NFFA 1JIRA 3Q00A 4I8GA 2FP7B 1IHTH 3LOXA 4FVBA 1UTPA 1EZUC 2P3FH 1FPHH 1P02A 1O36A 4O3UA 3MH7A 1C5NH 2Y6TA 4B2BA 1FMGA