4FU7A

Crystal structure of the urokinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
total genus 56
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fu7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fu7A01
1BRAA 5CE1A 1UTLM 1U6QA 3A82A 4JCNA 2P3FH 1OS8A 1EUFA 1GI1A 1O2VA 1HXEH 1QA0A 3OSYA 3MWIU 1TONA 1J17T 2O8MA 6GCHF 2FI5E 3UR9A 1C9TA 4UFFH 3UOUA 1SLVB 3RC5A 3ZZCA 1SL3A 1H8DH 3OX7U 1OYQA 2UUYA 2O8LA 5E2OA 3GCHC 1LVBA 1TRMA 2ZFSA 1W0YH 1UJ1A 3U98H 1S0RA 4ISOA 2A1DB 2SNVA 1FY3A 3ENSB 2VWNA 2BD8A 4LZ4B 2ZTYA 1G36A 3RMMH 1OYTH 5FPSA 1LHDH 1O5GH 1QJ1B 3MOCA 5EW2H 1XXDA 4NIXA 2FO9A 1MD7A 4NZLA 3M36A 1C2JA 2B8OH 3RP2A 5LH8A 2A4OA 1Q2WA 3SO3A 3ZZ4A 4Y10E 1ZSLA 3SGBE 5EG4A 3Q3YA 4ISIH 1P57B 3HGPA 3ODDA 4Q7XA 4WH6A 4AX9H 1AI8H 2IPHA 3U1JB 5ESBA 4U30A 2ALVA 2QY0B 2PUQH 4KELA 2WYGA 5EQRA 3TH2H 5JYIA 3DD2H 2D2DA 4INLA 2H2ZA 3GCOA 5JBBS 3RXAA 3SV2H 1CBWB 1TWXB 3STIA 5G4BA 1KIGH 3O8CA 4A6LA 3SHCH 2AIPA 3BTFE 1SC8U 3KQBA 4AGKA 1GI7B 5FPTA 3GY2A 4SGAE 1S6FA 2HALA 2VIPA 3H5CB 4UFGH 3T29A 1O2NA 1EAXA 2QXGA 3GCNA 1YKTA 4Y76A 1QB9A 4K60A 1SG8B 4YO9A 1ETTH 1JWTA 1A5IA 1KXCA 1OPHB 1WCZA 2ZFTA 1ANCA 1GBJA 1UTKA 4Y6DA 1Z8IB 2G5VA 1CBWC 2QCYA 2VWOA 3NCLA 3E1XB 4TPIZ 1JIMA 4K1TA 1TALA 2TRMA 3EA8A 3GY4A 1CHGA 1SQTA 2C8YB 2BDGA 2EEKA 3RXDA 1YYY1 3TJNA 2LPRA 3C1KA 5J4SA 1GI9B 2BLOA 2F9BH 2ZFRH 2BQ6B 1SGFG 3ZVEA 1KXFA 1DX5M 2QXHA 1BTUA 1JBUH 1VCQA 3K65B 5GPIB 1LHFH 3S9AA 3SNBA 3ATKA 1GMCG 1TRNA 3UWIA 4CRGA 1HAGE 4H6TA 3SU4A 1TNKA 1B7XB 1TNIA 4X8VH 3RC6A 1EPTA 8LPRA 3ZZ5A 5L2YH 4K2YA 1F7ZA 1SB1H 1TA2A 3RXPA 3UIRA 4NIYA 4DIIH 1GBMA 4LXBH 3BTEE 4U2WA 4JZ1A 3T62A 4B2CA 1HYLA 5E8EH 2PV9B 3S69A 4AFSA 2BDYA 2VB0A 4Z0KA 1AWFH 1MTNB 5DPAA 1UVPA 1DWCH 1MBQA 1DFPA 1LQEA 4U32A 4AN7A 3SUEA 1GBCA 3RC4A 3ZVGA 2D8WA 2C8ZB 1XXFA 3SNDA 1AFEH 2BQWB 3U69H 4CH8B 2A5AA 3ZZ6A 3O8BA 3D65E 3BTHE 2CHAC 2OC1A 3BTGE 1GI2A 7LPRA 4OS7A 4ZKRU 2C3SA 4INKA 1TGNA 4ABFA 4MTBA 2Q6DA 4SGBE 1RFNA 1TGBA 3BTTE 3AAVA 1FIWA 1ZSJA 2FDAA 3A80A 4FUHA 4DOQA 1AUJA 1MTNC 2BLVA 1YCPK 1Y3YA 3BTKE 2BMGB 1P0SH 4B73A 2Z9LA 1Y8TA 4RKOB 4D9QA 2CGAA 3DT0H 3N7OA 2W5EA 1YBWA 4ZHLU 3B9FH 5A09A 2ZPQA 2O8WA 1TX7A 3VFEA 3AVZA 1NO9H 1TNJA 1PQ8A 3LKWA 1GVKB 2EC9H 2GD4B 1HAVB 1O31A 2R9PA 2ZU5A 3MU1A 1O3MA 3FP8E 3MMGA 4FUBA 5EPNA 3SNAA 1IQHA 3MU0A 3P8NA 5TJXA 3HKJB 1HIAA 2WPLS 4H4FA 4KKDA 5DK1A 3PO1B 1PJPA 2G5NA 5FHTA 1L0ZA 1P8VC 3S9BA 2OINA 4O97A 5A0BA 1TPOA 4XOJA 2R2WU 1JRTA 3K9XB 2QXIA 2VVUA 3IITA 1GJBB 1LVMA 5DKMA 4ZKSU 2ZCLP 2WPHS 1W8BH 4Y11E 1LDTT 3Q3XA 3ZVCA 2VWLA 4DIHH 1KTTB 4JZFH 5T6GA 3M5OA 3H7OA 2AGGX 3PLKA 1LVOA 3P92A 1T8MA 1AKSA 2FMJA 3PO1C 1A1RA 1EATA 4CH2B 1OX1A 3P70B 1T7CA 1O5EH 1C1WH 3O8DA 1NESE 1V2VT 3ZVFA 2OCVB 2ZIQH 4ABAA 4Y79A 1ARBA 1FI8A 5DP4A 3EQ0H 3QLPH 1AMHA 1O0DH 2TGTA 5FPYA 3KCGH 4BAKB 3RXJA 2BHGA 1SGIB 3V3MA 1BMMH 1YPJH 4FUJA 3SJ8A 1D4PB 1HDTH 3EE0B 1YPLH 1ZPBA 4NSVA 1O5FH 1CSOE 2YNBA 4ZHAA 1WTGH 1QR3E 1ZGVA 3QUMP 2GCHF 1WQVH 2QA9E 3ZZAA 1CHOG 2AGIX 4ESTE 2OQ5A 3LJJA 1S0QA 2JH0D 3WY8A 2OC7A 3FZZA 1VJAU 1V2PT 2ANMH 1UTMA 1SPJA 3Q3KA 1D3PB 1UTOA 2PHBA 1GPZA 1SGEE 2KAIB 3RXMA 4MVNA 3B23B 4AB9A 1QCPA 1WUNH 4OS2A 3RM0H 5DO4H 4FVBA 2BX3A 4Y8YA 4IC6A 4F49A 1ZPCA 3A84A 4O9VA 3QN7A 2G4TA 3QDZB 3MU8A 1AQ7A 1JIRA 2SFAA 1DXPA 4NG9H 1GJ9B 3DFJA 3FANA 1YF4A 2YNAA 1GMHF 1WTHD 1C1TA 4JZDH 2TBSA 1OWHA 4CRFA 1ZLRA 3SU6A 1MAXA 1RRKA 1SHYA 1NRRH 1F0UA 2QF0A 3MU5A 5GCHF 1FONA 1DOJA 4XDEA 1SGQE 2AIQA 2SGPE 2GZ7A 5EQQA 3TGKE 2PWXA 2FESH 4WMDA 1HFDA 2FM2A 1PPGE 2ZI2H 1CVWH 1ELFA 1PPFE 2AERH 4TY7A 3MH6A 5TCCA 1RTLA 1SGYE 4FU8A 4Y0YE 2VGCB 5JPMH 3FAOA 3JZ2B 1EOLA 3P95A 1A0HB 3M5LA 3RDZA 2BOHB 5LPRA 1KSNA 3IG6B 1O3HA 1L4ZA 3HKIB 2DE9A 1E34B 3BEUA 2B7DH 2ZFPH 1TQ0B 1PPHE 5F8ZA 1OSSA 1SGCA 1YM0A 1E36B 3LC3A 4FUEA 4XBCA 1D3QB 1SFQB 1D3DB 1QA7A 3FP6E 1BJUA 7GCHF 5F03A 2LNCA 1QGFA 2VGCC 1O3CA 3BV9B 1UK2A 3RXEA 1ZYOA 3ZZ7A 1C2EA 1ANEA 4IGDA 2VIQA 2J38A 1TQ7B 2QV1A 2ZA5A 3T25A 2GV7A 1K1IA 4I8LA 1MAYA 3UOPA 1EAIA 4ZROA 2ZGCA 1V2RT 1A5GH 4X6OA 2ZPSA 2JETB 1C5XB 1THRH 1DSTA 4B75A 2J4IA 1P9SA 1LHGH 2TGDA 1L1JA 3RXTA 5T6FA 3OTJE 2CJIA 4B76A 2ILNA 1TX8A 1ELTA 2J9NA 3ZV8A 2SNWA 1KYNA 2FYQA 4H42U 3UNSA 3LGYA 2ZGHA 3U8TH 3UNRA 1C2IA 1QJ7B 1YCPM 4E05H 2D26C 1CU1A 1O2TA 2Z9GA 1E35B 2ZHWH 2V3HH 2PUXB 4AYVB 1O39A 8GCHF 4K1EA 1FPHH 1EJNA 2CMYA 3FP7E 2RA0A 1C2GA 1ELEE 3LC5A 2ANYA 3M3TA 1K1NA 4FU9A 5J4QA 4LZ1H 1KLTA 1PQ7A 4A1XA 2Y81A 2O8TA 2R3UA 3PLPA 2VIWA 1GBHA 3L3TA 1BTYA 2UWLA 5CHAB 1K22H 1ELBA 3V0XA 1GBDA 3A8BA 4X1NU 5C3NA 4I8KA 4YLUA 3PM3A 1GI5A 1EASA 2FOGA 2XNIA 2A7JA 2PTCE 4X6MA 4OS4A 3FFGA 3UY9A 2O9QA 3UTUH 2STBE 4NA9H 1C5PA 2JH5D 5C1UA 1GHBG 1MQ6A 4X2XA 4IW4E 7KMEH 1F2SE 3EGKH 5DP5A 2HRVA 3UQOA 1ZMLA 4TY6A 1TFXA 1MTVA 2AYWA 3K6ZA 3TK9A 1BHXB 6CHAB 5LPFA 3ZZ8A 3NPSA 3TVJB 1A5HA 1V2TT 2PLXA 4X1SU 2BY6X 4NA8A 3GCTF 3P8OA 4WJG2 1O30A 3KEEA 1ZRKA 2O8UA 1FDPA 1O2LA 2XBWA 2ODYB 2G00A 4X1RU 1ZR0A 1A46H 1GHAF 2VNTA 4UE7H 1GDUA 4B71A 1AFQB 2ZGBH 1E0FD 3K6YA 2ZHDA 4GCHF 1AGJA 1NT1A 4MG3A 6CHAC 1MTWA 2ZWLH 1C5SA 2R0LA 3NKKA 1C1MA 1GBTA 1TABE 1HPGA 2FOMB 3GOVB 4TWYA 2HNTC 1O2MA 1G32B 1A61H 3DHKH 3SJKA 1XVMA 3ITIA 3O8RA 5EGMA 2BX4A 5DP9A 1GMDF 2Y82A 4R8TB 1K1JA 3A83A 2XC4A 2ANKH 4BTIB 1TNLA 2BDIA 4K8BA 4JZEH 1AFQC 3PMBB 5DGJA 1AD8H 1HB0B 4WXIA 1XUKA 4ABEA 1JOUB 1GJ6A 2WPKS 3AW0A 4GAWA 3ZVDA 3Q76A 5DJ7A 4FXGH 3M37A 1O3FA 1VITF 1V2LT 2J94A 1THSH 3M7TA 1C5QA 2FWWA 1F5LA 1NFUA 1P9UA 3FZDA 3VB6A 2HVXA 5FCRA 3M5NA 1YPEH 4IC5A 2WPIS 1O35A 3LGUA 3PROA 3UPEA 2GDEH 1UTJA 1DPOA 2ZEBA 1O3LA 5HMAA 1UVOA 2ZDKA 1ETSH 4Q7YA 4Q2KA 1XMNB 2UWPA 1H9HE 3A87A 1XKBC 4GLYA 2ZECA 2PSXA 3CS7A 2P95A 1W12U 1FY4A 2A32A 4I8HA 2A4RA 2FS9A 4OGXA 4TWWA 1BCUH 1PPEE 1L2EA 3BTWE 1TMTH 4UFDH 4ZXXH 2PKAB 3GY8A 1WBGB 1QL9A 4X8SH 3LGWA 1Y3UA 4YT6H 1XX9A 1SOZA 1C4Y2 5FCKA 1KXBA 5FBIA 3TU7H 4CR9A 1HAVA 1O2PA 2AH4X 4AZ2B 1T31A 3TNSA 5GWZA 3QZQA 1F92A 3RXQA 1TMUH 1EOJA 1ID5H 4XFQA 2Y5FA 1PPBH 3PWBA 2BD9A 1M9UA 1QL8A 3KN2A 5GIBA 3DA9B 2GKVE 3ZZ3A 8KME2 4JYVH 1GG6C 4DURA 2FXRA 2GT7A 1LCYA 2ZDVH 3RMLH 3URCA 1QB6A 3A8AA 3HATH 3E91A 1C1RA 4E7RG 1KXAA 2Z9JA 1GJ8B 1C1SA 1TGCA 2ZHQH 1GBAA 2RG3A 3F1SB 3RXHA 3MNSA 2F3CE 3LT3A 3V13A 3EAJA 3RXGA 4BTUB 1CA8B 4FUDA 4CRAA 1O2IA 1F5RA 2OBOA 1HGTH 1DT2A 1EB2A 2BY7X 2DUCA 3OY6U 2TGAA 2F91A 1P2JA 3K2UA 2SGFE 1P01A 4ZH8A 4NFEA 4ABIA 1EXFA 5ETXA 1O3GA 2VWMA 2AMPA 1BMLA 1Z8JB 1KDQB 4IMZA 3GDUA 3SU1A 1SFIA 5A2MH 1FZZA 1BTWA 1G3CA 1VCPA 3GY5A 4X8UH 2I6SA 2ZTZA 5GJ4B 4A92A 3L6PA 1F0SA 4J2YB 1IQKA 4TPYA 1NFYA 3Q00A 1SQAA 2UUKB 2V6NA 5FXLA 2YOLA 1T8NA 2V0BA 1O2YA 1SLWB 1GDQA 1C2LA 1GJCB 3LDXH 4GHQA 1VITH 4U01A 2F9NA 3EA7A 1HAYB 4FU7A 1DE7H 1C5VA 3CENA 3KQCA 3ESTA 2KAIA 5JDUB 5A0AE 4MPWA 1NC6A 2CHAB 2H9TH 3KF2A 2G8TA 1HJ8A 2P59A 1ZTJA 1GI6A 1Q3XA 1SLXB 5AFZH 4WMFA 4ZUHA 3HGNA 1J9CH 1QQ4A 1UVSH 3D62A 3MO6A 3MFJA 3QTOH 2BDCA 5JBTA 4D9RA 1XUGA 3UWJH 2VVVA 4ISNA 3SORA 2NU4E 1PPCE 5FX5A 1Z71A 2ZCHP 1RJXB 4IS5A 2C4FH 2D1JA 2P94A 1PQAA 3A89A 1D3TB 2B0FA 2QXJA 1BHXF 1TNHA 1LHCH 1QB1A 1UTPA 1YGCH 2ANWA 1MZDA 1K1PA 1UO6A 1BBRH 1BUIA 1NY22 1RTFB 1UCYH 1P03A 2RA3A 4IN1A 4F4OC 1TA6A 2I6QA 1QRXA 1V2WT 2G4UA 2NU1E 4K3JA 3CP7A 2G81E 2Z94A 2WV5A 1Z1IA 4Y0ZE 3S0NA 4I33A 1S85A 5B6OA 1C5LH 1THPB 3UFAA 1FXYA 3KHVA 2OXSA 1LMWB 1K28D 2JH6D 5EOKA 1DVAH 3TH4H 2Z3EA 1Q31A 1P12E 4OS5A 2PFEA 4X0WU 8ESTE 1BMAA 1UMAH 3UQVA 3QO6A 2RCEA 1V6DA 1NRSH 2QF3A 1KY9A 2OLGA 4JK5A 1G3BA 3RXOA 2VIDA 1MMJN 3OY5U 3LOXA 2STAE 3P17H 2A2XH 4Y71A 2A7HA 1G2LA 3RMOH 1TPAE 5C5NA 1GVZA 1TYNA 1S81A 2A0QB 1AE8H 2ODPA 2W3IA 4E7NA 1EZQA 2WPMS 1WV7H 1GHXH 1GMHG 3I78A 4YESB 3T2NA 1YPHC 2PR3A 4JZIA 1GI8B 5GCHG 3BTDE 5ESTE 1C5TA 1O5DH 1GBLA 2FS8A 1K1MA 3ATIA 1BJVA 3GYMA 9ESTA 1OXGA 2IJOB 5CMXH 1ETRH 3SW2B 2GDDA 3TJOA 2FZZA 4DJZB 4XBBA 2OUAA 2W26A 2ZO3H 4B2AA 1QIXB 4ABJA 1W10U 1ARCA 2FOBA 1BRCE 1KLIH 4ABHA 1GCTB 1A2CH 1C5RA 4AG1A 3A7WA 4UDWH 1EZXC 3P6ZB 1GHWH 1AU8A 2ZG0H 3SJIA 2OD3B 2BLQA 2THFB 3PMHB 1S6HA 3RXVA 1FQ3A 2SGAA 3TNTA 3PB1E 1QRZA 4BXSA 5H4IB 3SV6A 1C1UH 5A8YA 1YLDA 2A4GA 1GHZA 1O5CB 3SUGA 2XWBI 2C93B 1GCTC 4Y8XA 4CBNA 1EQ9A 1NRQH 4UD9H 4X1QU 1IQEA 1LTOA 1OWJA 1AIXH 1OP0A 2OC0A 1O2WA 1C1NA 1UTQA 2GZ9A 1C5YB 2NWNA 3U1IB 4WMEA 2VJ1A 1BRUP 3M7UA 1G37A 1DANH 4MQAA 1C5MD 3PLBA 2BY8X 2NU0E 2WUCA 3SU2A 1O3IA 3D49H 2XC0A 1O2XA 1DLKB 3TITA 1ORFA 1P09A 4AG2A 2BD5A 3RU4T 1ZOMA 3MNCA 3PYHA 3SJOA 1Y5BT 3SUFA 1O2ZA 4I7YH 1BTXA 2EI8A 1HAIH 1G3EA 3ATWA 4YTAA 3RMNH 1NU9A 2H9EH 2ZF0H 1O3BA 5T6DA 1AY6H 1C5UA 4MNWA 4PROA 1HAZB 4MNVA 5HM9A 1KXEA 4DW2U 4DT7B 4MDSA 1UK4A 4NA7A 4ZKNU 1CT2E 4X6NA 1T8OA 4FUGA 8GCHG 2FP7B 1V2KT 4Y7AA 2BD4A 5JB8S 5C1XA 4BOHA 4ASHA 1EJMA 2QC2A 3RXKA 5EXNA 5A8XA 2XBVA 2BY9X 3RU4E 5HXFA 4CRBA 1OKXA 1H1BA 3MTYA 5IDKA 3ELAH 1QY6A 1HAOH 3KIDU 3F9EA 1ANDA 1CA0B 1GI3A 4ABGA 2FLBH 1ELDE 3LJOA 3M35A 4GSOA 1CGJE 1P06A 1AVGH 1ZHRA 1GJ4H 1EAWA 1QBOA 3E8LA 3HK6B 2XBYA 5E0HA 3M7QA 4H6SB 3MHWU 1V2UT 1SGDE 2W3KA 1J8AA 4X2VA 1K2I1 1TBQH 4DGJA 1O2OA 4BNRA 2BXUH 2H1UA 1O2UA 4B1TA 2NU3E 5FX6A 2PGBB 2G55A 1P3CA 4Q80A 4ZAEA 2R0KA 2HPPH 4AFZA 4ISHH 3E0PB 1CA0C 3QWCH 1BITA 5ABWA 1P2MA 3SOSA 4ABBA 1DSUA 1SGFA 1NS3A 2BDHA 3KQEA 4UEHH 2GMTB 5HM2A 4B2BA 5L2ZH 2VINA 5DP3A 1AVXA 4IMQA 3STJA 1ELAA 2BOKA 5BPEA 1XVOA 1PQ5A 4GCHG 1GVLA 2R3YA 1LVYA 5EQSA 4J1YA 1CHOF 1ZPZA 2Y7XA 2J95A 1P2IA 2XWAA 1C1QA 1P04A 3R0FA 1HBTH 3PMAB 4YT7H 3A88A 1HJAB 4RN6A 1N6YA 4X2WA 1GJ7B 1INCA 4VGCC 1NFWA 1YPGH 2GTBA 3VXEH 2J2UA 2GMTC 1O5AB 2PKAA 1LKBA 3EYDA 4D7GA 2FI4E 3QK1A 1F5KU 3P8GA 5LGOA 1N1LA 2IN2A 4JMYA 4OGYA 5F6MA 4I8GA 3MNBA 4WWYA 2XBXA 1ELVA 2BD7A 1W13U 4AORA 1SR5C 1FUJA 2VH6A 1SGNE 1HJAC 3SU5A 1IQJA 1ZMJA 1IQNA 2GP9B 2UUFB 3U8OH 1ZTLA 4DY7B 2FLRH 2PGQB 6GCHG 2A7CA 4MPUA 1T32A 1VJ9U 5EU8A 1DICA 1BT7A 5DP6A 1IQGA 1ESBA 1YC0A 3MH5A 2P93A 1HJ9A 1SSXA 1TGSZ 4O3TA 1AE5A 4THNH 2F9UA 1AUTC 3C27B 5K0HA 1FMGA 1AWHB 2WPJS 1P3EA 4FUIA 1W7GH 2AFQB 1DXWA 1CT4E 4GPGA 1MQ5A 1MH0A 1TOMH 1QBNA 1LPZB 4NIVA 4ZMAH 1OWDA 1F0TA 1MKXH 1MKXK 3RM2H 4NCYA 2BVXH 2Q6GA 1W0ZU 2IOTA 5EODA 3VB3A 1IQIA 3MYWA 1TNGA 2BQ7B 1DY8A 2FPZA 5E0GA 3T5FH 1C5WB 2J34A 1ESAA 1GI4A 1S83A 1XKAC 1GDNA 1ABJH 4Z6AH 2FOHA 4Y8ZA 1GBFA 3NWUA 3KL6A 2ODQA 2NU2E 1KDQA 1O3JA 1KTSB 2XRCA 1GHYH 4YOIA 3T27A 1ZMNA 1NN6A 1ANBA 1MUEB 1FV9A 5AVDA 1IQFA 1QJ6B 3I29A 1O3AA 2VH0A 3VB5A 3S9CA 5DP7A 1BMNH 1J16A 3ZZBA 5BRRE 3VB7A 1B0EA 4I31A 3NK8A 1IQLA 3HK3B 1O33A 4IN2A 1N8OB 2EI7A 2G52A 4K5ZA 1HAPH 1V2MT 2ZFQH 1O37A 1SQOA 4YZUA 4YLQH 3ZVAA 4WF8A 1P10A 3OYPA 1O2RA 1HLTH 1T4UH 3A7VA 4X2YA 4NFFA 5SGAE 4BAHB 5A0CA 3QGJA 4RKJB 1FN8A 1UK3A 2AGEX 4INHA 1YPKH 3TJVA 4AFUA 1GBKA 2OTVA 4YM9A 1V2JT 1O3NA 1FIZA 1N8OC 4WXVA 1KLJH 3SNCA 3SQEE 1C2HA 4FUCA 4NIWA 1BBRE 1DDJA 2AMDA 2XCNA 3GYLB 2ZNKH 1UCYE 1SMFE 1D9IA 3SNEA 1AHTH 2ZHFH 2GVFA 3SV8A 3E0NB 1O2SA 2GZ8A 3SGAE 2ZDAH 3BTME 3MNXA 5E0JA 3S7KB 2K1QA 4HI3A 4ISLA 2ZU4A 1Z1JA 2TIOA 5L30H 1QNJA 2QIQA 3RXRA 1FJSA 3LIWA 2OBQA 3LGTA 4DVAU 1TE0A 4A1TA 1E37B 3EA9A 2GCTB 2GV6A 1GHBF 5I25A 1SGPE 3A7TA 3ZV9A 1HAHH 1FLEE 1BIOA 1GG6B 3M61U 3MH7A 4OS6A 3KGPA 1AB9B 1OP8A 2ZU1A 5C2ZA 3A81A 1GJAB 3LGIA 4A1VA 4K8YA 1QRWA 1IHTH 1P02A 2BLWA 2BVRH 1F0RA 3PTBA 3UNQA 3L33A 1BOQA 1EP5A 4JYTA 3NUMA 4O03A 2F9VA 4KGAA 3TK5A 1O3PB 2QN5T 4TYDA 1GL1A 2GCTC 1TBZH 5F8TA 1H4WA 1WSSH 3TPIZ 1DUEA 1RTKA 5T3HA 1T8LA 1O3KA 1AB9C 1ZJDA 1ZHPA 2BD3A 2GGVB 2WUBA 1QTFA 2Y6TA 1UTNA 1VZQH 1L1GA 1P11E 1RD3B 3CS0A 4X1PU 1SVPA 1GBIA 3SJ9A 2GT8A 2UUJB 2ZDNA 3LPRA 3F6UH 3G01A 3SV9A 1HAXB 1O2QA 5AFYH 1A7SA 3SQHE 1DLEA 3BSQA 1B5GH 3E3TA 3EDXB 3GDVA 2ZQ1A 3V7TA 4HFPB 1BQYA 4X6PA 3RXIA 3P8FA 3MO9A 1OOKB 1RGQA 1XUJA 1D6RA 2P3TB 3ZZ9A 1Y3VA 4CREA 2F9PA 1O34A 4KP0A 1SI5H 1W11U 4CHAB 3M5MA 1HNEE 2Z9IA 2ZQ2A 3F9FA 3Q77A 4ABDA 1A3BH 1ZHMA 2A45B 3JZ1B 3TLOA 4CBOA 2EA3A 5EXMA 1H8IH 2BDBA 4Y7BA 1DUAA 4QT8C 1O2KA 1V2QT 3M3VA 2C8XB 1NM6A 4GVUA 1LKAA 2P16A 1FY8E 1ELCA 1GL0E 2FOFA 1P2QA 2CXVA 3F9GA 3SBKA 1ZJKA 1G3DA 1Z8RA 2ASUB 1FNIA 2ZHEH 1DM4B 4K69A 1K1LA 1QQUA 2HNTE 4CHAC 3LH1A 2VU8E 3OU0A 1MZAA 1FAKH 1AVWA 1AZZA 4CRDA 2B5TB 2ZDLA 1O2GH 1UHBB 1C2MA 1C4U2 1CE5A 2B9LA 2TPIZ 4AFQA 2Q6FA 2Z7FE 1A0LA 1NRNH 3SI3H 3TGIE 1S5SA 1C1PA 1BBRK 1NZQH 2CF9H 3LU9B 1TGTA 3U9AH 1UCYK 2HNTF 1Y5UT 1HXFH 2A31A 2H5CA 2FEQH 2PW8H 3LONA 1X7AC 2FYRA 2GCHG 2PTNA 2ZTXA 1MD8A 3QTVH 3BEIB 5EXLA 1DS2E 1EZUC 1W7XH 3BG8A 1QHRB 1C1VH 2BTCE 4D8NA 3RXUA 1FN6A 5DG6A 3MU4A 2G51A 1BA8B 3BIVH 4I8JA 3S7HB 4BAMB 1PYTD 1ABIH 2AEIH 5PTPA 3R3GB 5C67A 1O32A 2Y5GA 1TAWA 2F83A 4HTCH 1W3CA 1EAUA 1NFXA 4XSKU 4GHTA 1A4WH 1SGTA 1YCPH 1D6WA 3QZRA 2ZP0H 3F68H 3MI4A 4UFEH 1P2NA 4OS1A 1TX6A 1BTPA 2C90B 4FVDA 4O3UA 5EPYA 2Z3DA 1NPMA 2XTTB 3BN9A 1XM1A 4ZHMU 1BZXE 3SV7A 1Z6EA 3H7TA 1Z8GA 2OC8A 2Y80A 1C2DA 3QGNB 1L4DA 2ZGXH 4E06H 1G2MA 1ZRBA 1CO7E 3B8JA 1P2OA 1GBEA 1RXPA 1K9OE 2BB4A 1O3DA 3MH4A 1G9IE 3BG4B 2JKHA 2HLCA 3LGVA 2ZU3A 2SGQE 1FPCH 2BVSH 4M7GA 1AO5A 1AZ8A 1GMCF 1LQDB 1GJ5H 2AS9A 1WAYB 1IHSH 3SZNA 2QGRA 2BZAA 1V3XA 1PPZA 4MLFB 3URDA 3GISB 3GY3A 2ZPRA 1ZSKA 4A5TS 2P8OB 5F8XA 2A5IA 1GI0A 2FOEA 7GCHG 4XBDA 4CR5A 1VGCB 2BZ6H 3UUZA 4UONA 3BG4C 2M5TA 4WY3A 3ODFA 4WH8A 4RSPA 9LPRA 1GHVH 2ULLA 2ZU2A 3TH3H 1O2JA 2HPQH 5E2PA 4XE4A 1V2ST 4FUFA 1RS0A 1Z7KA 1O36A 1ZTKA 3A7XA 1JRSA 1T4VH 1MBMA 1OWKA 2OQUA 2PSYA 4LK4A 3SN8A 3ZVBA 2R2MB 1C9PA 2P8OC 3PWCA 5I46H 1O38A 1LPKB 1VGCC 3SU3A 2SGDE 1GGDB 1CGIE 4KTSA 4Q7ZA 2AMQA 3A85A 1SLUB 5LPEA 1ZGIA 4X8TH 3RXSA 3M3SA 2VIVA 5IYTA 1DWEH 1EPTB 2WINI 2V3OH 1P05A 2BXTH 4KTUA 3RXCA 4MNYA 2FI3E 3A86A 1MTUA 1GCDA 2EI6A 2ZGJA 1C5ZB 1WQSA 3TK6A 3ATLA 2FIRH 1ELGA 1E38B 3UREA 1GGDC 3BF6H 1ZZZA 2Z3CA 2PKSB 1TRYA 1WOFA 2W7UA 5TCAA 3SI4H 4YOJA 5C1YA 3GDSA 3DUXH 3U8RH 2ZKSA 2Q1JA 3TIUA 2HOBA 2CF8H 4MPXA 1EPTC 3SUDA 5GDSH 1J14A 3D23A 3PTNA 4MPVA 3RXBA 1P2KA 5K7RA 3TJUA 1W2KH 5GXPA 1MU6B 3VPKA 1XUFA 2FX4A 1HV7A 2XYAA 3BEFB 4JK6A 3I77A 1QL7A 2A4QA 4NWLA 2ZDMA 1OWIA 4K1SA 3ZZDA 1S84A 3VXFH 2Y7ZA 3NXPA 2PKSC 1WYKA 1EJAA 3SHAH 5AF9H 6ESTA 4BXWA 1W14U 2UWOA 3AAUA 1BTHH 1FY1A 1HUTH 2GX4A 1HCGA 1NU7B 2Y5HA 1DITH 4KTCA 4DG4A 1V2OT 4NWKA 3PMJA 1H9LB 3AW1A 1Z6JH 3GCTG 1DWDH 1TMBH 4VGCB 3BTQE 1DY9A 3A8DA 4A7IB 3RLYH 1PFXC 2WV4A 5C5OA 1RIWB 1GHAG 1HIAB 1EP6A 1YPHE 1IQMA 2BY5X 3TGJE 4DCDA 4JYUH 5C20A 1QBVH 1UVUH 3MO3A 1K1OA 1QFKH 1FAXA 4AYYB 2ESTE 4NGAH 3PV4A 3GY7A 4BAOB 4GUXA 2FTLE 3RXFA 3DFLA 3VGCB 1DWBH 1ESTA 4I32A 1GMDG 2A2QH 4R0IA 1LPGB 1ACBE 3ZYDA 1O3EA 1RIWC 2WYJA 4NSYA 3E6PH 1AKSB 4MNXA 3RLWH 3V12A 1NROH 2J92A 3F9HA 3HPTB 2ZC9H 3ATMA 2H9HA 2FTMA 2DE8A 3E16B 4BTTB 1GJDB 1SHHB 1Y3XA 1B0FA 2BM2A 4NZQA 1NRPH 4ZKOU 2JETC 3W95A 1GWAA 1GBBA 1VITG 3VGCC 4AB8A 3RU4D 4AGJA 6LPRA 2XXLA 2TGPZ 3ZYEA 2QYIA 2Z9KA 2BYAX 4BANB 1KXDA 2XC5A 2XW9A 2VIOA 2FOAA 5EW1H 1C5NH 4IBLH 1Y59T 1QURH 1OP2A 3NZIA 1TB6H 3VEQB 3SU0A 2RDLA 1BTZA 1BB0B 4YOGA 2FX6A 3A8CA 1L1NA 1S82A 2QAAA 1WU1A 2A5KA 1J15A 3GY6A 3KNXA 4ZXYH 4HGCA 1TLDA 1C2FA 1PYTC 1NTPA 3T28A 1AN1E 1IAUA 1XUHA 4WVPE 2W7SA 1H9IE 3VB4A 1CQQA 1UVTH 1MU8B 2HWLB 2ZZUH 1OWEA 1LHEH 2ZFFH 4BAQB 1MKWH 2BDAA 1A3EH 5A8ZA 1MKWK 2ZCKP 2HGTH 1MTSA 3A7ZA 5CHAC 1TIOA 1EKBB 5AHGH 3E90B 2V35A 1G30B 1HRTH 2Z6BD 4LOYH 1C1OA 1O3OA 2SGEE 1TPSA 5L6NH 3FVFB 2ALPA 1Y5AT 3RUOA 4AOQA 1BRBE 1BDAA 1TBRH 2BD2A 1SGRE 3IWMA 5HYOA 4D7FA 1Y3WA 1VR1H 3UR6A 1EZSC 3QX5H 1TOCB 1XUIA 1O5BB 3LH3A 1MCVA 2XCFA 4D76A 3T26A 1O2HA 1FY5A 2H5DA 1V2NT 2H6MA 5JB9S 3AASA 3A7YA 5JBCS 1CGHA 2C8WB 1A0JA 1YPMH 1LO6A 2P3UB 3RXLA 1YP9A 1MCTA 1C5OH 5JBAS 4CRCA 7ESTE 5DP8A 1C4V2 2FOCA 1TPPA 3W94A 1EB1H 1IOEA 1EX3A 5HGGA 1SOTA 3GICB 1JXPA 1K21H 1N6XA 4B74A 3SGQE 1VCWA 2FODA 2VVCA 1CT0E 1C2KA 1YLCA 3BIUH 5FAHA 2CV3A 1UHBA 2CN0H 4HZHA 3GCHB 1SBWA 1JMOH 5FBEA 3KQDA 2F9OA 2OP9A
chains in the Genus database with same CATH superfamily
1BRAA 5CE1A 1UTLM 1U6QA 3A82A 4JCNA 2P3FH 1OS8A 1EUFA 1GI1A 1O2VA 1HXEH 1NBME 1QA0A 3OSYA 3MWIU 1TONA 1J17T 2O8MA 5C0TA 6GCHF 2FI5E 3UR9A 1C9TA 4UFFH 3UOUA 1SLVB 3RC5A 3ZZCA 5EJ1A 1SL3A 1H8DH 3OX7U 1OYQA 2UUYA 2O8LA 5E2OA 3GCHC 1LVBA 1TRMA 2ZFSA 1W0YH 1UJ1A 3U98H 1S0RA 4ISOA 2A1DB 2SNVA 1FY3A 3ENSB 5C94A 2VWNA 2BD8A 2V7QD 4LZ4B 2ZTYA 1G36A 3RMMH 1OYTH 5FPSA 1LHDH 1O5GH 1QJ1B 3MOCA 5EW2H 1XXDA 4NIXA 2FO9A 1MD7A 3PRBA 4NZLA 3M36A 1C2JA 2B8OH 3RP2A 5LH8A 2A4OA 1Q2WA 3SO3A 3ZZ4A 4Y10E 1ZSLA 3SGBE 5EG4A 3Q3YA 4ISIH 1P57B 3HGPA 3ODDA 4Q7XA 4WH6A 4AX9H 1AI8H 2IPHA 3U1JB 5ESBA 4U30A 2ALVA 2QY0B 2PUQH 4KELA 2WYGA 5EQRA 3TH2H 4B6EA 5JYIA 3DD2H 2D2DA 4INLA 2H2ZA 3GCOA 5JBBS 3RXAA 3SV2H 5HIZA 1CBWB 1TWXB 3STIA 5G4BA 1KIGH 3O8CA 4A6LA 3SHCH 2AIPA 3BTFE 1SC8U 3KQBA 4AGKA 1GI7B 5FPTA 1YWUA 3GY2A 4SGAE 1S6FA 2HALA 2VIPA 3H5CB 4UFGH 3T29A 1O2NA 1UW7A 1EAXA 2QXGA 3GCNA 1YKTA 4Y76A 1QB9A 4K60A 1SG8B 4YO9A 2AHME 1ETTH 1JWTA 1A5IA 1KXCA 1OPHB 1WCZA 2ZFTA 1ANCA 1GBJA 1UTKA 4Y6DA 1Z8IB 2G5VA 1CBWC 2QCYA 2VWOA 3NCLA 3E1XB 4TPIZ 1JIMA 4K1TA 2M2AA 1TALA 2TRMA 3EA8A 3GY4A 1CHGA 1SQTA 3MQKC 2C8YB 1FX0B 2BDGA 2EEKA 3RXDA 1YYY1 3TJNA 2LPRA 3C1KA 5J4SA 1GI9B 2BLOA 2F9BH 2ZFRH 2BQ6B 1SGFG 3ZVEA 1KXFA 1DX5M 2QXHA 3EE7A 1BTUA 1JBUH 1VCQA 3K65B 5GPIB 1LHFH 3S9AA 3SNBA 3ATKA 1GMCG 1TRNA 3UWIA 4CRGA 1HAGE 4H6TA 3SU4A 1TNKA 1B7XB 1TNIA 2F4LA 4X8VH 3RC6A 1EPTA 3KYFA 8LPRA 3ZZ5A 5L2YH 5F53A 4K2YA 1F7ZA 1SB1H 1TA2A 3RXPA 1MABB 3UIRA 4NIYA 4DIIH 1GBMA 4LXBH 3BTEE 4U2WA 4JZ1A 3T62A 4B2CA 1HYLA 5E8EH 2PV9B 3S69A 4AFSA 2BDYA 2VB0A 4Z0KA 1AWFH 1MTNB 5DPAA 1UVPA 1DWCH 5KGOA 1MBQA 1DFPA 1LQEA 4U32A 4AN7A 3SUEA 1GBCA 3RC4A 3ZVGA 2D8WA 5HKKD 2C8ZB 1XXFA 3WWBA 3SNDA 4ZCNA 1AFEH 2BQWB 3U69H 4CH8B 2A5AA 3ZZ6A 2HVYB 3O8BA 4RT0A 3D65E 3BTHE 2CHAC 2JJ2D 2OC1A 3BTGE 1GI2A 7LPRA 3AK5A 4OS7A 4ZKRU 2C3SA 4INKA 1TGNA 4ABFA 4MTBA 2Q6DA 4SGBE 1RFNA 1TGBA 3BTTE 3AAVA 1FIWA 1ZSJA 2FDAA 3A80A 4FUHA 4DOQA 1AUJA 1MTNC 2BLVA 1YCPK 1Y3YA 3BTKE 2BMGB 1P0SH 4B73A 2Z9LA 1Y8TA 4FETA 4RKOB 5B6LA 4D9QA 2CGAA 3DT0H 3N7OA 2W5EA 1YBWA 4ZHLU 3B9FH 5A09A 2ZPQA 2O8WA 2WSSD 1TX7A 3VFEA 3AVZA 1NO9H 1TNJA 1PQ8A 3LKWA 1GVKB 2EC9H 2GD4B 1HAVB 4P00A 1O31A 2R9PA 2ZU5A 3MU1A 1O3MA 3FP8E 3MMGA 4FUBA 5EPNA 3SNAA 1IQHA 3MU0A 3P8NA 5TJXA 3HKJB 1HIAA 2WPLS 4H4FA 4KKDA 5DK1A 2IPQX 1PJPA 2G5NA 3PO1B 1L0ZA 1P8VC 5FHTA 3S9BA 2OINA 4O97A 5A0BA 1TPOA 4XOJA 2R2WU 1JRTA 3K9XB 2QXIA 2VVUA 3IITA 1GJBB 1LVMA 5DKMA 4ZKSU 2ZCLP 2WPHS 1W8BH 4Y11E 1LDTT 3Q3XA 3ZVCA 2VWLA 4DIHH 1KTTB 4JZFH 5T6GA 3M5OA 3H7OA 2AGGX 3PLKA 1LVOA 3P92A 1T8MA 1AKSA 2FMJA 3PO1C 1A1RA 1EATA 4CH2B 1OX1A 3DSPA 3P70B 1T7CA 4ACBA 1O5EH 1C1WH 3O8DA 1NESE 1V2VT 3ZVFA 2OCVB 2ZIQH 4ABAA 4I86A 4Y79A 1ARBA 1FI8A 3ZIAD 5DP4A 3EQ0H 3QLPH 1AMHA 3H09A 2F43B 1O0DH 2TGTA 5FPYA 3KCGH 4BAKB 3RXJA 2BHGA 1SGIB 4Q63A 2GJGA 3V3MA 1BMMH 1YPJH 4FUJA 3SJ8A 1D4PB 1HDTH 3EE0B 1YPLH 1ZPBA 4NSVA 1O5FH 1CSOE 2YNBA 4ZHAA 1WTGH 1QR3E 1ZGVA 3QUMP 2GCHF 1WQVH 2QA9E 3ZZAA 1CHOG 2AGIX 4ESTE 2OQ5A 3LJJA 1S0QA 2JH0D 3WY8A 2OC7A 3FZZA 1VJAU 1V2PT 2ANMH 1UTMA 1SPJA 2QF4A 3Q3KA 1D3PB 1UTOA 2PHBA 1GPZA 1SGEE 2KAIB 3RXMA 4MVNA 3B23B 4AB9A 1QCPA 1WUNH 4OS2A 3RM0H 4F48B 5DO4H 4FVBA 2BX3A 4Y8YA 4IC6A 4F49A 1ZPCA 3A84A 4O9VA 3QN7A 2G4TA 3QDZB 5EJZA 3MU8A 3U28C 1AQ7A 1JIRA 2SFAA 1DXPA 4NG9H 1GJ9B 3DFJA 3FANA 1YF4A 2YNAA 4OM9A 1GMHF 1WTHD 1C1TA 4JZDH 2TBSA 1OWHA 3SYJA 4CRFA 1ZLRA 3SU6A 1MAXA 1RRKA 2QF5A 3PRDA 1SHYA 1NRRH 1F0UA 2QF0A 3MU5A 5GCHF 1FONA 1DOJA 4XDEA 1SGQE 2AIQA 2SGPE 2GZ7A 5EQQA 3TGKE 2PWXA 2FESH 4WMDA 1HFDA 2FM2A 1PPGE 2ZI2H 1CVWH 1ELFA 1PPFE 2AERH 4TY7A 3MH6A 5TCCA 1RTLA 1SGYE 4FU8A 4Y0YE 2VGCB 5JPMH 3FAOA 3JZ2B 1EOLA 3P95A 1A0HB 3M5LA 3RDZA 2BOHB 5LPRA 1KSNA 3IG6B 1O3HA 1L4ZA 3HKIB 2DE9A 1E34B 3BEUA 2B7DH 2ZFPH 1TQ0B 1PPHE 5F8ZA 1OSSA 4XD7D 1SGCA 1YM0A 1E36B 3LC3A 4FUEA 4XBCA 1D3QB 1BMFD 1SFQB 1D3DB 1QA7A 3FP6E 1BJUA 7GCHF 5F03A 2LNCA 1QGFA 2VGCC 1O3CA 3BV9B 1UK2A 3RXEA 1ZYOA 3ZZ7A 1C2EA 1ANEA 4IGDA 2VIQA 2J38A 1TQ7B 2QV1A 2ZA5A 3T25A 2GV7A 1K1IA 4I8LA 1MAYA 3UOPA 1EAIA 4ZROA 2ZGCA 1V2RT 1A5GH 4X6OA 2ZPSA 2JETB 4ACAA 1C5XB 1THRH 1DSTA 4B75A 2J4IA 1P9SA 1LHGH 2TGDA 1L1JA 3RXTA 5T6FA 3OTJE 2CJIA 2K8IA 4B76A 2ILNA 1TX8A 1ELTA 2J9NA 3ZV8A 2SNWA 1KYNA 2FYQA 4H42U 3UNSA 3LGYA 2ZGHA 3U8TH 3UNRA 1C2IA 1QJ7B 1YCPM 4E05H 2D26C 1CU1A 1O2TA 2Z9GA 1E35B 2ZHWH 2V3HH 2PUXB 4AYVB 1O39A 8GCHF 4K1EA 1FPHH 1EJNA 2CMYA 3FP7E 2RA0A 1C2GA 1ELEE 3LC5A 2ANYA 3M3TA 1K1NA 4FU9A 5J4QA 4LZ1H 1KLTA 1PQ7A 4A1XA 2Y81A 2O8TA 2R3UA 3PLPA 2VIWA 1GBHA 3L3TA 1BTYA 2UWLA 5CHAB 1K22H 1ELBA 3V0XA 1GBDA 3A8BA 4X1NU 5C3NA 4I8KA 4YLUA 3PM3A 1GI5A 1EASA 2FOGA 2XNIA 2A7JA 2PTCE 4X6MA 4OS4A 3FFGA 3UY9A 2O9QA 3UTUH 2STBE 4NA9H 1C5PA 2JH5D 5C1UA 1GHBG 1MQ6A 4X2XA 4IW4E 7KMEH 1F2SE 3EGKH 5DP5A 2EQNA 2HRVA 4AC9A 3UQOA 1ZMLA 2EY4C 4TY6A 1TFXA 1MTVA 2AYWA 3K6ZA 3TK9A 1BHXB 6CHAB 5LPFA 3ZZ8A 3NPSA 3TVJB 1A5HA 1V2TT 2PLXA 4X1SU 2BY6X 4NA8A 3GCTF 3P8OA 4WJG2 1O30A 3KEEA 1ZRKA 2HLDD 2O8UA 1FDPA 1O2LA 2XBWA 2ODYB 2G00A 4X1RU 1ZR0A 1A46H 1GHAF 2VNTA 4UE7H 1GDUA 4B71A 1AFQB 2ZGBH 1E0FD 3K6YA 2ZHDA 4GCHF 1KMHB 1AGJA 2KCYA 1NT1A 4MG3A 6CHAC 1MTWA 2ZWLH 1C5SA 2R0LA 3NKKA 1C1MA 2J5UA 1GBTA 1TABE 1HPGA 2FOMB 3GOVB 2VBCA 4TWYA 2HNTC 1O2MA 1G32B 1A61H 3DHKH 3SJKA 1XVMA 3ITIA 3O8RA 5EGMA 2BX4A 5DP9A 1GMDF 4P02A 2Y82A 4R8TB 1K1JA 3A83A 2XC4A 2W6ID 2ANKH 4BTIB 1TNLA 2BDIA 4K8BA 4JZEH 1AFQC 3PMBB 5DGJA 1AD8H 1HB0B 4WXIA 1XUKA 4ABEA 1JOUB 1GJ6A 3F3BA 2WPKS 3AW0A 4GAWA 3ZVDA 3Q76A 5DJ7A 4FXGH 3M37A 1O3FA 1VITF 1V2LT 2J94A 1THSH 3M7TA 1C5QA 2FWWA 1F5LA 1NFUA 1P9UA 3FZDA 3VB6A 2HVXA 5FCRA 3M5NA 1YPEH 4IC5A 2WPIS 1O35A 3LGUA 3PROA 3UPEA 2GDEH 1UTJA 1DPOA 2ZEBA 1O3LA 3OEHD 5HMAA 1UVOA 2ZDKA 1ETSH 4Q7YA 4Q2KA 1XMNB 2UWPA 1H9HE 3A87A 1XKBC 4GLYA 2ZECA 2PSXA 3CS7A 2P95A 1W12U 1FY4A 2A32A 4I8HA 5C17A 2A4RA 2FS9A 4OGXA 4TWWA 1BCUH 1PPEE 1L2EA 3BTWE 1TMTH 4UFDH 4ZXXH 2PKAB 3GY8A 1WBGB 1QL9A 4X8SH 3LGWA 1Y3UA 2KR7A 4YT6H 1XX9A 1SOZA 1C4Y2 2L6OA 5FCKA 1KXBA 5FBIA 3TU7H 4CR9A 1HAVA 3F0PA 1O2PA 2AH4X 4AZ2B 1T31A 3TNSA 5GWZA 3QZQA 1F92A 3RXQA 1TMUH 1EOJA 1ID5H 4XFQA 2Y5FA 1PPBH 3PWBA 2BD9A 1M9UA 1QL8A 3KN2A 5GIBA 3DA9B 2GKVE 3ZZ3A 8KME2 4JYVH 1GG6C 4DURA 2FXRA 2GT7A 1LCYA 2ZDVH 3RMLH 3URCA 1QB6A 3A8AA 3HATH 3E91A 1C1RA 4E7RG 1KXAA 2Z9JA 1GJ8B 1C1SA 1TGCA 2ZHQH 2KCPA 1GBAA 1EFRD 2RG3A 3F1SB 3RXHA 3MNSA 2F3CE 3LT3A 1OHHD 3V13A 3EAJA 2YMSC 3RXGA 4BTUB 1CA8B 4FUDA 4CRAA 1O2IA 1F5RA 2OBOA 1HGTH 1DT2A 1W0JD 1EB2A 2BY7X 2DUCA 3OY6U 2TGAA 3OTPA 2F91A 1P2JA 3K2UA 2SGFE 1P01A 4ZH8A 4NFEA 4ABIA 1EXFA 5ETXA 1O3GA 1NBMD 2VWMA 2AMPA 1BMLA 1Z8JB 1KDQB 4IMZA 3GDUA 3SU1A 1SFIA 5A2MH 1FZZA 1BTWA 1G3CA 1VCPA 3GY5A 4X8UH 2I6SA 2ZTZA 5GJ4B 4A92A 3L6PA 1F0SA 4J2YB 1IQKA 4TPYA 1NFYA 3Q00A 1SQAA 2UUKB 2V6NA 5FXLA 2YOLA 2WPDD 1T8NA 3NRLA 2V0BA 1O2YA 1SLWB 1GDQA 1E1RD 1C2LA 1GJCB 3LDXH 4GHQA 1SQRA 1VITH 4U01A 2F9NA 3EA7A 1HAYB 4FU7A 1DE7H 1C5VA 3CENA 3KQCA 3ESTA 2KAIA 5JDUB 5A0AE 4MPWA 1NC6A 2CHAB 2H9TH 3KF2A 2G8TA 1HJ8A 2P59A 1ZTJA 1GI6A 1Q3XA 1SLXB 3W1EA 5AFZH 4HG6A 2JIZD 4WMFA 3HGNA 4ZUHA 1J9CH 1QQ4A 1UVSH 3D62A 3MO6A 3MFJA 3QTOH 2BDCA 5JBTA 4D9RA 1XUGA 3UWJH 2VVVA 4ISNA 3SORA 2NU4E 1PPCE 5FX5A 1Z71A 2ZCHP 1RJXB 4IS5A 2C4FH 2D1JA 2P94A 1PQAA 3A89A 1D3TB 2B0FA 2QXJA 1BHXF 1TNHA 1LHCH 1QB1A 1UTPA 1YGCH 2ANWA 1MZDA 1K1PA 1UO6A 1BBRH 1BUIA 1NY22 1RTFB 1UCYH 1P03A 2RA3A 4IN1A 4F4OC 3SZEA 1TA6A 2I6QA 1QRXA 1V2WT 2G4UA 2NU1E 4K3JA 3CP7A 2G81E 2Z94A 2WV5A 1Z1IA 4Y0ZE 3S0NA 4I33A 1S85A 5B6OA 1C5LH 1THPB 3UFAA 1FXYA 3KHVA 2OXSA 1LMWB 1K28D 2JH6D 5EOKA 1DVAH 3TH4H 2Z3EA 1Q31A 1P12E 4OS5A 2PFEA 4X0WU 8ESTE 1BMAA 1UMAH 3UQVA 3QO6A 2RCEA 1V6DA 1NRSH 2QF3A 1KY9A 2OLGA 4JK5A 3UAIC 3WWFA 1G3BA 3RXOA 2VIDA 1MMJN 3OY5U 3LOXA 2STAE 3P17H 2A2XH 4Y71A 2A7HA 1G2LA 3RMOH 1TPAE 5C0UA 5C5NA 1GVZA 1TYNA 1S81A 2A0QB 1AE8H 2ODPA 2W3IA 4E7NA 1EZQA 2WPMS 1WV7H 1GHXH 1GMHG 3I78A 4YESB 3T2NA 1YPHC 2PR3A 4YXWD 4JZIA 1GI8B 5GCHG 3BTDE 5ESTE 1C5TA 1O5DH 1GBLA 2FS8A 1K1MA 3ATIA 1BJVA 3GYMA 9ESTA 1OXGA 2IJOB 5CMXH 1ETRH 3SW2B 2GDDA 1WDIA 3TJOA 2FZZA 4DJZB 4XBBA 2OUAA 2W26A 2ZO3H 4B2AA 1QIXB 4ABJA 3FOAA 3KQ5A 1W10U 1ARCA 2FOBA 1BRCE 1KLIH 4ABHA 1GCTB 1A2CH 1C5RA 4AG1A 3A7WA 4UDWH 1EZXC 3P6ZB 1GHWH 1AU8A 2ZG0H 3SJIA 2OD3B 2BLQA 2THFB 3PMHB 1S6HA 3RXVA 2L74A 1FQ3A 2SGAA 3TNTA 3PB1E 1QRZA 4BXSA 5H4IB 3SV6A 1C1UH 5A8YA 1YLDA 2A4GA 1GHZA 1O5CB 3SUGA 2LELA 2XWBI 2C93B 1GCTC 4Y8XA 4CBNA 1EQ9A 1NRQH 4UD9H 4X1QU 1IQEA 1LTOA 1OWJA 1AIXH 1OP0A 2OC0A 5GNDA 1O2WA 1C1NA 1UTQA 2GZ9A 1C5YB 2NWNA 5KECA 3U1IB 4WMEA 2RFKC 2VJ1A 1BRUP 3M7UA 1G37A 1DANH 4MQAA 1C5MD 3PLBA 2BY8X 2NU0E 4Q4LA 2WUCA 3SU2A 1O3IA 3D49H 2XC0A 1O2XA 1DLKB 3TITA 1ORFA 1P09A 4AG2A 2BD5A 3RU4T 1ZOMA 3MNCA 3PYHA 3SJOA 1Y5BT 3OAAD 3SUFA 1O2ZA 4I7YH 4B6FA 1BTXA 4FOUC 2EI8A 1HAIH 1G3EA 3ATWA 4YTAA 3RMNH 1NU9A 2H9EH 2ZF0H 1O3BA 5T6DA 1AY6H 1C5UA 4MNWA 4PROA 1HAZB 2KCOA 4MNVA 5HM9A 1KXEA 4DW2U 4DT7B 4MDSA 1UK4A 4NA7A 4ZKNU 1CT2E 4X6NA 1T8OA 4FUGA 8GCHG 2FP7B 1V2KT 4Y7AA 2BD4A 5JB8S 5C1XA 4BOHA 4ASHA 1EJMA 2QC2A 3RXKA 5EXNA 5A8XA 2XBVA 2BY9X 1SKYE 3RU4E 5HXFA 4CRBA 1OKXA 4Z1MD 1H1BA 3MTYA 5IDKA 3ELAH 1QY6A 1HAOH 3KIDU 2YMSD 3F9EA 1ANDA 1CA0B 1GI3A 4ABGA 2FLBH 1ELDE 3LJOA 3M35A 4GSOA 1CGJE 1P06A 1AVGH 1ZHRA 3FO8D 1GJ4H 1EAWA 2KCAA 1QBOA 5DN6D 3E8LA 3HK6B 2XBYA 5E0HA 3M7QA 4H6SB 3MHWU 1V2UT 1SGDE 2W3KA 1J8AA 4X2VA 1K2I1 1TBQH 4DGJA 1O2OA 3OE7D 4BNRA 2BXUH 2H1UA 1O2UA 4B1TA 2NU3E 5FX6A 2PGBB 2G55A 1P3CA 4Q80A 4ZAEA 2R0KA 2HPPH 4AFZA 4ISHH 3E0PB 2OK5A 1CA0C 3QWCH 1BITA 5ABWA 1P2MA 3SOSA 4ABBA 1DSUA 1SGFA 1NS3A 2BDHA 3KQEA 4UEHH 2GMTB 5HM2A 4B2BA 5L2ZH 2VINA 5DP3A 1AVXA 4IMQA 3STJA 3F2HA 1ELAA 2BOKA 5BPEA 1XVOA 1PQ5A 4GCHG 1GVLA 2R3YA 1LVYA 5EQSA 4J1YA 1CHOF 1ZPZA 2Y7XA 2J95A 1P2IA 2XWAA 1C1QA 1H8ED 1P04A 3R0FA 1HBTH 3PMAB 4YT7H 3A88A 1HJAB 4RN6A 1N6YA 4X2WA 1GJ7B 1INCA 4VGCC 1NFWA 1YPGH 2GTBA 3VXEH 2J2UA 2GMTC 1O5AB 2PKAA 1LKBA 3EYDA 4D7GA 2FI4E 3QK1A 1F5KU 3P8GA 2CK3D 5LGOA 1N1LA 2IN2A 4JMYA 4OGYA 5F6MA 4I8GA 3MNBA 4WWYA 2XBXA 1ELVA 2BD7A 1W13U 4AORA 1SR5C 1FUJA 2VH6A 1SGNE 1HJAC 3SU5A 1IQJA 1ZMJA 1IQNA 2GP9B 2UUFB 3U8OH 1ZTLA 4DY7B 2FLRH 2PGQB 6GCHG 2A7CA 4MPUA 1T32A 1VJ9U 5EU8A 1DICA 1BT7A 5DP6A 1S6LA 1IQGA 1ESBA 1YC0A 3MH5A 2P93A 1VKYA 1HJ9A 1SSXA 1TGSZ 4O3TA 1AE5A 4THNH 2F9UA 1AUTC 3C27B 5K0HA 1FMGA 1AWHB 2WPJS 1P3EA 4FUIA 1W7GH 2AFQB 1DXWA 1CT4E 4GPGA 1MQ5A 1MH0A 1TOMH 1QBNA 1LPZB 2KX4A 4NIVA 2IJD1 4ZMAH 1OWDA 1F0TA 1MKXH 1MKXK 3RM2H 4NCYA 2BVXH 2Q6GA 1W0ZU 2IOTA 5EODA 3VB3A 1IQIA 3MYWA 1TNGA 2BQ7B 1DY8A 2FPZA 5E0GA 3T5FH 1C5WB 2J34A 1ESAA 1GI4A 1S83A 1XKAC 1GDNA 1ABJH 4Z6AH 2FOHA 4Y8ZA 1GBFA 3NWUA 3KL6A 2ODQA 2NU2E 1KDQA 1O3JA 1KTSB 2XRCA 1GHYH 4YOIA 3T27A 1ZMNA 1NN6A 1ANBA 1MUEB 5HIYA 1FV9A 3FN8A 5AVDA 1IQFA 1QJ6B 3I29A 1O3AA 2VH0A 3VB5A 2RDEA 3S9CA 5DP7A 1BMNH 1J16A 3ZZBA 5BRRE 3VB7A 1B0EA 4I31A 3NK8A 1IQLA 3HK3B 1O33A 4IN2A 1N8OB 2EI7A 2G52A 2K0QA 4K5ZA 1HAPH 1V2MT 2ZFQH 1O37A 1SQOA 4YZUA 4YLQH 3ZVAA 4WF8A 1P10A 2J98B 3OYPA 1O2RA 1HLTH 1T4UH 3A7VA 4X2YA 4NFFA 5SGAE 4BAHB 5A0CA 3QGJA 4RKJB 1FN8A 1UK3A 2AGEX 4INHA 1YPKH 3TJVA 4AFUA 1GBKA 2XOKD 2OTVA 4YM9A 1V2JT 1O3NA 5IK2D 1FIZA 1N8OC 4WXVA 1KLJH 3SNCA 3SQEE 1C2HA 4FUCA 4NIWA 1BBRE 1DDJA 2AMDA 2XCNA 3GYLB 2ZNKH 1E1QD 1UCYE 1SMFE 1D9IA 3SNEA 1AHTH 2ZHFH 4M9FA 1YLNA 2GVFA 5KEDA 3SV8A 3E0NB 1O2SA 2GZ8A 3SGAE 3N7DA 2PP6A 2ZDAH 3BTME 3FKSD 3MNXA 5E0JA 3S7KB 2K1QA 4HI3A 3WW7A 4ISLA 2ZU4A 1Z1JA 2TIOA 4RT1A 5L30H 5FL7D 1QNJA 2QIQA 3RXRA 1FJSA 3LIWA 2OBQA 3LGTA 4DVAU 1TE0A 4A1TA 1E37B 3EA9A 2GCTB 2GV6A 2WZQA 1GHBF 5I25A 1SGPE 3A7TA 3ZV9A 1HAHH 1FLEE 1BIOA 1GG6B 3M61U 3MH7A 3F0OA 4OS6A 3KGPA 1AB9B 1OP8A 2ZU1A 5C2ZA 3A81A 1GJAB 3LGIA 4A1VA 4K8YA 1QRWA 1IHTH 1W0KD 1P02A 2BLWA 2BVRH 1F0RA 3PTBA 3UNQA 3L33A 4TT3D 1BOQA 1EP5A 4JYTA 3NUMA 2YMSB 4O03A 2F9VA 4KGAA 3TK5A 1O3PB 2QN5T 3OFND 4TYDA 1GL1A 2GCTC 1TBZH 5F8TA 1H4WA 1WSSH 3TPIZ 1DUEA 1RTKA 5T3HA 4RI0A 1T8LA 1O3KA 1AB9C 1ZJDA 1ZHPA 2BD3A 2V3MA 2GGVB 2WUBA 1QTFA 2Y6TA 1UTNA 1VZQH 1L1GA 1P11E 1RD3B 3CS0A 4X1PU 1SVPA 1GBIA 3SJ9A 3N7EA 2GT8A 2UUJB 2ZDNA 3LPRA 3F6UH 3G01A 3SV9A 1HAXB 1O2QA 5AFYH 1A7SA 3SQHE 1DLEA 3BSQA 1B5GH 3E3TA 3EDXB 3GDVA 2ZQ1A 3V7TA 4HFPB 1BQYA 4X6PA 3RXIA 3P8FA 3MO9A 2JDID 1OOKB 1RGQA 1XUJA 1D6RA 2P3TB 3ZZ9A 1Y3VA 4CREA 2F9PA 2LP6A 1O34A 4KP0A 1SI5H 1W11U 4CHAB 3M5MA 1HNEE 2Z9IA 2ZQ2A 3F9FA 3Q77A 4ABDA 1A3BH 1ZHMA 2A45B 3JZ1B 3TLOA 4CBOA 2EA3A 5EXMA 1H8IH 2BDBA 4Y7BA 1DUAA 4QT8C 1O2KA 1V2QT 3M3VA 2C8XB 1NM6A 4GVUA 1LKAA 2P16A 1FY8E 1ELCA 1GL0E 2FOFA 1P2QA 2CXVA 3F9GA 3SBKA 1ZJKA 1G3DA 1Z8RA 2ASUB 1FNIA 2ZHEH 1DM4B 4K69A 1K1LA 1QQUA 3GS9A 2HNTE 4CHAC 3LH1A 2VU8E 3OU0A 1MZAA 3F2GA 1FAKH 1AVWA 1AZZA 4CRDA 2B5TB 2ZDLA 1O2GH 1UHBB 1C2MA 1C4U2 1CE5A 2B9LA 2TPIZ 4AFQA 2Q6FA 2Z7FE 1A0LA 1NRNH 2KFWA 3SI3H 3TGIE 1S5SA 1C1PA 1BBRK 3N99A 1NZQH 2CF9H 3LU9B 1TGTA 3U9AH 1UCYK 2HNTF 1Y5UT 1HXFH 2A31A 2H5CA 3PV2A 2FEQH 5CHBA 2PW8H 3LONA 1X7AC 5DSFA 2FYRA 2GCHG 2PTNA 2ZTXA 1MD8A 3QTVH 2WV9A 3BEIB 5EXLA 1DS2E 1EZUC 1W7XH 3BG8A 1QHRB 1C1VH 2BTCE 4D8NA 3RXUA 1FN6A 5DG6A 3MU4A 2G51A 1BA8B 3BIVH 4I8JA 3S7HB 4BAMB 1PYTD 1ABIH 2AEIH 5PTPA 5EIYA 3R3GB 5C67A 1O32A 2Y5GA 1TAWA 1K0HA 2F83A 4HTCH 1W3CA 1EAUA 1NFXA 4XSKU 4GHTA 1A4WH 1SGTA 1YCPH 1D6WA 3QZRA 2ZP0H 3F68H 3MI4A 4UFEH 1P2NA 4OS1A 1TX6A 1BTPA 2C90B 4FVDA 4O3UA 5EJLA 5EPYA 2Z3DA 1NPMA 2XTTB 3BN9A 1XM1A 4ZHMU 1BZXE 3SV7A 1Z6EA 3H7TA 3VG8A 1Z8GA 2OC8A 2Y80A 1C2DA 3QGNB 3KYGA 1L4DA 2ZGXH 4E06H 1G2MA 1ZRBA 1CO7E 3B8JA 1P2OA 1GBEA 1RXPA 1K9OE 2BB4A 4F55A 1O3DA 3MH4A 2QE7D 1G9IE 3BG4B 2JKHA 2HLCA 3LGVA 2ZU3A 2SGQE 1FPCH 2BVSH 4M7GA 1AO5A 1AZ8A 1GMCF 1LQDB 1GJ5H 2AS9A 1WAYB 1IHSH 3SZNA 2QGRA 2BZAA 1V3XA 1PPZA 4MLFB 3URDA 3GISB 3GY3A 2ZPRA 1ZSKA 4A5TS 2P8OB 5F8XA 2A5IA 2KM0A 1GI0A 2FOEA 7GCHG 4XBDA 4CR5A 1VGCB 2BZ6H 3UUZA 4UONA 3BG4C 2M5TA 4WY3A 3ODFA 4WH8A 4RSPA 9LPRA 1E79D 1GHVH 2ULLA 2ZU2A 3TH3H 1O2JA 2HPQH 5E2PA 4XE4A 1V2ST 4FUFA 1RS0A 1Z7KA 1O36A 1ZTKA 3A7XA 1JRSA 5CDFE 4TSFD 1T4VH 1MBMA 1OWKA 2OQUA 2PSYA 4LK4A 3SN8A 3ZVBA 2R2MB 1C9PA 2P8OC 3PWCA 5I46H 1O38A 3DCLA 1LPKB 1VGCC 3SU3A 2SGDE 1GGDB 1CGIE 4KTSA 4Q7ZA 2AMQA 3A85A 1SLUB 5LPEA 1ZGIA 4X8TH 3RXSA 3M3SA 2VIVA 5IYTA 1DWEH 1EPTB 2WINI 2V3OH 1P05A 2BXTH 4KTUA 3RXCA 4MNYA 2FI3E 3A86A 1MTUA 1YY3A 1GCDA 2EI6A 2ZGJA 1C5ZB 1WQSA 3TK6A 3ATLA 2FIRH 1ELGA 1E38B 3UREA 1GGDC 3BF6H 3CNRA 1ZZZA 2Z3CA 2KZ4A 1TRYA 1WOFA 2PKSB 2W7UA 5TCAA 3SI4H 4YOJA 5C1YA 3GDSA 3DUXH 3OEED 3U8RH 2ZKSA 2Q1JA 3TIUA 3PV5A 2HOBA 2CF8H 4MPXA 1EPTC 3SUDA 5GDSH 1J14A 3D23A 3PTNA 4MPVA 3RXBA 1P2KA 5K7RA 3TJUA 1W2KH 5GXPA 1MU6B 3VPKA 1XUFA 2FX4A 1HV7A 2XYAA 3BEFB 4JK6A 3I77A 1QL7A 2A4QA 4NWLA 5T1VA 2ZDMA 1OWIA 2WHXA 4K1SA 3ZZDA 1S84A 3VXFH 2Y7ZA 3NXPA 2PKSC 1WYKA 1EJAA 3SHAH 5AF9H 6ESTA 2J98A 4BXWA 1W14U 2UWOA 3AAUA 1BTHH 1FY1A 1HUTH 2GX4A 1HCGA 1NU7B 2Y5HA 1DITH 4KTCA 4DG4A 1V2OT 4NWKA 3PMJA 1H9LB 3AW1A 1Z6JH 3GCTG 1DWDH 1TMBH 4VGCB 3BTQE 1DY9A 3A8DA 4A7IB 3RLYH 1PFXC 2WV4A 5C5OA 1RIWB 1GHAG 1HIAB 1EP6A 1YPHE 1IQMA 2BY5X 3TGJE 4DCDA 4JYUH 5C20A 1QBVH 1UVUH 3MO3A 1K1OA 1QFKH 1FAXA 4AYYB 2ESTE 4NGAH 3PV4A 3GY7A 2J97A 4BAOB 4GUXA 2FTLE 3RXFA 3DFLA 3VGCB 1DWBH 1ESTA 4I32A 1GMDG 2A2QH 4R0IA 1LPGB 1ACBE 3ZYDA 1O3EA 1RIWC 2WYJA 4NSYA 3E6PH 1AKSB 4MNXA 3RLWH 3V12A 1NROH 2J92A 3F9HA 3DSGA 3HPTB 2ZC9H 3ATMA 4DT4A 2H9HA 2FTMA 2DE8A 3E16B 4BTTB 1COWD 1GJDB 1SHHB 1Y3XA 1B0FA 2BM2A 4NZQA 1NRPH 4ZKOU 2JETC 3W95A 1GWAA 1GBBA 1VITG 3VGCC 4AB8A 3RU4D 4AGJA 6LPRA 2XXLA 3F2FA 2TGPZ 3ZYEA 2QYIA 2Z9KA 4XRNA 2BYAX 4BANB 1KXDA 2XC5A 2XW9A 2VIOA 2FOAA 5EW1H 1C5NH 4IBLH 1Y59T 1QURH 1OP2A 3NZIA 4ASUD 1TB6H 3VEQB 1QZ8A 1H8HD 3SU0A 2RDLA 1BTZA 1BB0B 4YOGA 2FX6A 3A8CA 1L1NA 1S82A 2QAAA 1WU1A 2A5KA 1J15A 3GY6A 3KNXA 4ZXYH 4HGCA 1TLDA 1C2FA 1PYTC 1NTPA 3T28A 1AN1E 1IAUA 1XUHA 4WVPE 2W7SA 1H9IE 3VB4A 1CQQA 1UVTH 1MU8B 2HWLB 2ZZUH 1OWEA 1LHEH 2ZFFH 4BAQB 1MKWH 2BDAA 1A3EH 5A8ZA 1MKWK 2ZCKP 2HGTH 1MTSA 3A7ZA 5CHAC 1TIOA 1EKBB 5AHGH 3E90B 2V35A 1G30B 1HRTH 2Z6BD 4LOYH 1C1OA 1O3OA 2SGEE 1TPSA 5L6NH 3FVFB 2ALPA 1Y5AT 3RUOA 4AOQA 1BRBE 1BDAA 1TBRH 2BD2A 1SGRE 3IWMA 5HYOA 4D7FA 1Y3WA 1VR1H 3UR6A 1EZSC 3QX5H 3UB0A 1TOCB 1XUIA 1O5BB 3LH3A 1MCVA 2XCFA 2W6JD 4D76A 3T26A 1O2HA 1FY5A 2H5DA 1V2NT 2H6MA 5JB9S 3AASA 3A7YA 5JBCS 1CGHA 2C8WB 1A0JA 1YPMH 1LO6A 1WXRA 2P3UB 3RXLA 1YP9A 1MCTA 1C5OH 5JBAS 4CRCA 7ESTE 5DP8A 1C4V2 2FOCA 1TPPA 3W94A 2JJ1D 1EB1H 1IOEA 1EX3A 5HGGA 1SOTA 3GICB 1JXPA 2XNDD 1K21H 1N6XA 4B74A 3SGQE 1VCWA 2FODA 2VVCA 1CT0E 3DSOA 1C2KA 1YLCA 3BIUH 5FAHA 2CV3A 1UHBA 2CN0H 4HZHA 3GCHB 1SBWA 1JMOH 5FBEA 3KQDA 2F9OA 2OP9A
chains in the Genus database with same CATH topology
1BRAA 5CE1A 1UTLM 1U6QA 3A82A 4JCNA 2P3FH 1OS8A 1EUFA 1GI1A 1O2VA 1HXEH 1QA0A 3OSYA 3MWIU 1TONA 1J17T 2O8MA 6GCHF 2FI5E 3UR9A 1C9TA 4UFFH 3UOUA 1SLVB 3RC5A 3ZZCA 1SL3A 1H8DH 3OX7U 1OYQA 2UUYA 2O8LA 5E2OA 3GCHC 1LVBA 1TRMA 2ZFSA 1W0YH 1UJ1A 3U98H 1S0RA 4ISOA 2A1DB 2SNVA 1FY3A 3ENSB 2VWNA 2BD8A 4LZ4B 2ZTYA 1G36A 3RMMH 1OYTH 5FPSA 1LHDH 1O5GH 1QJ1B 3MOCA 5EW2H 1XXDA 4NIXA 2FO9A 1MD7A 4NZLA 3M36A 1C2JA 2B8OH 3RP2A 5LH8A 2A4OA 1Q2WA 3SO3A 3ZZ4A 4Y10E 1ZSLA 3SGBE 5EG4A 3Q3YA 4ISIH 1P57B 3HGPA 3ODDA 4Q7XA 4WH6A 4AX9H 1AI8H 2IPHA 3U1JB 5ESBA 4U30A 2ALVA 2QY0B 2PUQH 4KELA 2WYGA 5EQRA 3TH2H 5JYIA 3DD2H 2D2DA 4INLA 2H2ZA 3GCOA 5JBBS 3RXAA 3SV2H 1CBWB 1TWXB 3STIA 5G4BA 1KIGH 3O8CA 4A6LA 3SHCH 2AIPA 3BTFE 1SC8U 3KQBA 4AGKA 1GI7B 5FPTA 3GY2A 4SGAE 1S6FA 2HALA 2VIPA 3H5CB 4UFGH 3T29A 1O2NA 1EAXA 2QXGA 3GCNA 1YKTA 4Y76A 1QB9A 4K60A 1SG8B 4YO9A 1ETTH 1JWTA 1A5IA 1KXCA 1OPHB 1WCZA 2ZFTA 1ANCA 1GBJA 1UTKA 4Y6DA 1Z8IB 2G5VA 1CBWC 2QCYA 2VWOA 3NCLA 3E1XB 4TPIZ 1JIMA 4K1TA 1TALA 2TRMA 3EA8A 3GY4A 1CHGA 1SQTA 2C8YB 2BDGA 2EEKA 3RXDA 1YYY1 3TJNA 2LPRA 3C1KA 5J4SA 1GI9B 2BLOA 2F9BH 2ZFRH 2BQ6B 1SGFG 3ZVEA 1KXFA 1DX5M 2QXHA 1BTUA 1JBUH 1VCQA 3K65B 5GPIB 1LHFH 3S9AA 3SNBA 3ATKA 1GMCG 1TRNA 3UWIA 4CRGA 1HAGE 4H6TA 3SU4A 1TNKA 1B7XB 1TNIA 4X8VH 3RC6A 1EPTA 8LPRA 3ZZ5A 5L2YH 4K2YA 1F7ZA 1SB1H 1TA2A 3RXPA 3UIRA 4NIYA 4DIIH 1GBMA 4LXBH 3BTEE 4U2WA 4JZ1A 3T62A 4B2CA 1HYLA 5E8EH 2PV9B 3S69A 4AFSA 2BDYA 2VB0A 4Z0KA 1AWFH 1MTNB 5DPAA 1UVPA 1DWCH 1MBQA 1DFPA 1LQEA 4U32A 4AN7A 3SUEA 1GBCA 3RC4A 3ZVGA 2D8WA 2C8ZB 1XXFA 3SNDA 1AFEH 2BQWB 3U69H 4CH8B 2A5AA 3ZZ6A 3O8BA 3D65E 3BTHE 2CHAC 2OC1A 3BTGE 1GI2A 7LPRA 4OS7A 4ZKRU 2C3SA 4INKA 1TGNA 4ABFA 4MTBA 2Q6DA 4SGBE 1RFNA 1TGBA 3BTTE 3AAVA 1FIWA 1ZSJA 2FDAA 3A80A 4FUHA 4DOQA 1AUJA 1MTNC 2BLVA 1YCPK 1Y3YA 3BTKE 2BMGB 1P0SH 4B73A 2Z9LA 1Y8TA 4RKOB 4D9QA 2CGAA 3DT0H 3N7OA 2W5EA 1YBWA 4ZHLU 3B9FH 5A09A 2ZPQA 2O8WA 1TX7A 3VFEA 3AVZA 1NO9H 1TNJA 1PQ8A 3LKWA 1GVKB 2EC9H 2GD4B 1HAVB 1O31A 2R9PA 2ZU5A 3MU1A 1O3MA 3FP8E 3MMGA 4FUBA 5EPNA 3SNAA 1IQHA 3MU0A 3P8NA 5TJXA 3HKJB 1HIAA 2WPLS 4H4FA 4KKDA 5DK1A 3PO1B 1PJPA 2G5NA 5FHTA 1L0ZA 1P8VC 3S9BA 2OINA 4O97A 5A0BA 1TPOA 4XOJA 2R2WU 1JRTA 3K9XB 2QXIA 2VVUA 3IITA 1GJBB 1LVMA 5DKMA 4ZKSU 2ZCLP 2WPHS 1W8BH 4Y11E 1LDTT 3Q3XA 3ZVCA 2VWLA 4DIHH 1KTTB 4JZFH 5T6GA 3M5OA 3H7OA 2AGGX 3PLKA 1LVOA 3P92A 1T8MA 1AKSA 2FMJA 3PO1C 1A1RA 1EATA 4CH2B 1OX1A 3P70B 1T7CA 1O5EH 1C1WH 3O8DA 1NESE 1V2VT 3ZVFA 2OCVB 2ZIQH 4ABAA 4Y79A 1ARBA 1FI8A 5DP4A 3EQ0H 3QLPH 1AMHA 1O0DH 2TGTA 5FPYA 3KCGH 4BAKB 3RXJA 2BHGA 1SGIB 3V3MA 1BMMH 1YPJH 4FUJA 3SJ8A 1D4PB 1HDTH 3EE0B 1YPLH 1ZPBA 4NSVA 1O5FH 1CSOE 2YNBA 4ZHAA 1WTGH 1QR3E 1ZGVA 3QUMP 2GCHF 1WQVH 2QA9E 3ZZAA 1CHOG 2AGIX 4ESTE 2OQ5A 3LJJA 1S0QA 2JH0D 3WY8A 2OC7A 3FZZA 1VJAU 1V2PT 2ANMH 1UTMA 1SPJA 3Q3KA 1D3PB 1UTOA 2PHBA 1GPZA 1SGEE 2KAIB 3RXMA 4MVNA 3B23B 4AB9A 1QCPA 1WUNH 4OS2A 3RM0H 5DO4H 4FVBA 2BX3A 4Y8YA 4IC6A 4F49A 1ZPCA 3A84A 4O9VA 3QN7A 2G4TA 3QDZB 3MU8A 1AQ7A 1JIRA 2SFAA 1DXPA 4NG9H 1GJ9B 3DFJA 3FANA 1YF4A 2YNAA 1GMHF 1WTHD 1C1TA 4JZDH 2TBSA 1OWHA 4CRFA 1ZLRA 3SU6A 1MAXA 1RRKA 1SHYA 1NRRH 1F0UA 2QF0A 3MU5A 5GCHF 1FONA 1DOJA 4XDEA 1SGQE 2AIQA 2SGPE 2GZ7A 5EQQA 3TGKE 2PWXA 2FESH 4WMDA 1HFDA 2FM2A 1PPGE 2ZI2H 1CVWH 1ELFA 1PPFE 2AERH 4TY7A 3MH6A 5TCCA 1RTLA 1SGYE 4FU8A 4Y0YE 2VGCB 5JPMH 3FAOA 3JZ2B 1EOLA 3P95A 1A0HB 3M5LA 3RDZA 2BOHB 5LPRA 1KSNA 3IG6B 1O3HA 1L4ZA 3HKIB 2DE9A 1E34B 3BEUA 2B7DH 2ZFPH 1TQ0B 1PPHE 5F8ZA 1OSSA 1SGCA 1YM0A 1E36B 3LC3A 4FUEA 4XBCA 1D3QB 1SFQB 1D3DB 1QA7A 3FP6E 1BJUA 7GCHF 5F03A 2LNCA 1QGFA 2VGCC 1O3CA 3BV9B 1UK2A 3RXEA 1ZYOA 3ZZ7A 1C2EA 1ANEA 4IGDA 2VIQA 2J38A 1TQ7B 2QV1A 2ZA5A 3T25A 2GV7A 1K1IA 4I8LA 1MAYA 3UOPA 1EAIA 4ZROA 2ZGCA 1V2RT 1A5GH 4X6OA 2ZPSA 2JETB 1C5XB 1THRH 1DSTA 4B75A 2J4IA 1P9SA 1LHGH 2TGDA 1L1JA 3RXTA 5T6FA 3OTJE 2CJIA 4B76A 2ILNA 1TX8A 1ELTA 2J9NA 3ZV8A 2SNWA 1KYNA 2FYQA 4H42U 3UNSA 3LGYA 2ZGHA 3U8TH 3UNRA 1C2IA 1QJ7B 1YCPM 4E05H 2D26C 1CU1A 1O2TA 2Z9GA 1E35B 2ZHWH 2V3HH 2PUXB 4AYVB 1O39A 8GCHF 4K1EA 1FPHH 1EJNA 2CMYA 3FP7E 2RA0A 1C2GA 1ELEE 3LC5A 2ANYA 3M3TA 1K1NA 4FU9A 5J4QA 4LZ1H 1KLTA 1PQ7A 4A1XA 2Y81A 2O8TA 2R3UA 3PLPA 2VIWA 1GBHA 3L3TA 1BTYA 2UWLA 5CHAB 1K22H 1ELBA 3V0XA 1GBDA 3A8BA 4X1NU 5C3NA 4I8KA 4YLUA 3PM3A 1GI5A 1EASA 2FOGA 2XNIA 2A7JA 2PTCE 4X6MA 4OS4A 3FFGA 3UY9A 2O9QA 3UTUH 2STBE 4NA9H 1C5PA 2JH5D 5C1UA 1GHBG 1MQ6A 4X2XA 4IW4E 7KMEH 1F2SE 3EGKH 5DP5A 2HRVA 3UQOA 1ZMLA 4TY6A 1TFXA 1MTVA 2AYWA 3K6ZA 3TK9A 1BHXB 6CHAB 5LPFA 3ZZ8A 3NPSA 3TVJB 1A5HA 1V2TT 2PLXA 4X1SU 2BY6X 4NA8A 3GCTF 3P8OA 4WJG2 1O30A 3KEEA 1ZRKA 2O8UA 1FDPA 1O2LA 2XBWA 2ODYB 2G00A 4X1RU 1ZR0A 1A46H 1GHAF 2VNTA 4UE7H 1GDUA 4B71A 1AFQB 2ZGBH 1E0FD 3K6YA 2ZHDA 4GCHF 1AGJA 1NT1A 4MG3A 6CHAC 1MTWA 2ZWLH 1C5SA 2R0LA 3NKKA 1C1MA 1GBTA 1TABE 1HPGA 2FOMB 3GOVB 4TWYA 2HNTC 1O2MA 1G32B 1A61H 3DHKH 3SJKA 1XVMA 3ITIA 3O8RA 5EGMA 2BX4A 5DP9A 1GMDF 2Y82A 4R8TB 1K1JA 3A83A 2XC4A 2ANKH 4BTIB 1TNLA 2BDIA 4K8BA 4JZEH 1AFQC 3PMBB 5DGJA 1AD8H 1HB0B 4WXIA 1XUKA 4ABEA 1JOUB 1GJ6A 2WPKS 3AW0A 4GAWA 3ZVDA 3Q76A 5DJ7A 4FXGH 3M37A 1O3FA 1VITF 1V2LT 2J94A 1THSH 3M7TA 1C5QA 2FWWA 1F5LA 1NFUA 1P9UA 3FZDA 3VB6A 2HVXA 5FCRA 3M5NA 1YPEH 4IC5A 2WPIS 1O35A 3LGUA 3PROA 3UPEA 2GDEH 1UTJA 1DPOA 2ZEBA 1O3LA 5HMAA 1UVOA 2ZDKA 1ETSH 4Q7YA 4Q2KA 1XMNB 2UWPA 1H9HE 3A87A 1XKBC 4GLYA 2ZECA 2PSXA 3CS7A 2P95A 1W12U 1FY4A 2A32A 4I8HA 2A4RA 2FS9A 4OGXA 4TWWA 1BCUH 1PPEE 1L2EA 3BTWE 1TMTH 4UFDH 4ZXXH 2PKAB 3GY8A 1WBGB 1QL9A 4X8SH 3LGWA 1Y3UA 4YT6H 1XX9A 1SOZA 1C4Y2 5FCKA 1KXBA 5FBIA 3TU7H 4CR9A 1HAVA 1O2PA 2AH4X 4AZ2B 1T31A 3TNSA 5GWZA 3QZQA 1F92A 3RXQA 1TMUH 1EOJA 1ID5H 4XFQA 2Y5FA 1PPBH 3PWBA 2BD9A 1M9UA 1QL8A 3KN2A 5GIBA 3DA9B 2GKVE 3ZZ3A 8KME2 4JYVH 1GG6C 4DURA 2FXRA 2GT7A 1LCYA 2ZDVH 3RMLH 3URCA 1QB6A 3A8AA 3HATH 3E91A 1C1RA 4E7RG 1KXAA 2Z9JA 1GJ8B 1C1SA 1TGCA 2ZHQH 1GBAA 2RG3A 3F1SB 3RXHA 3MNSA 2F3CE 3LT3A 3V13A 3EAJA 3RXGA 4BTUB 1CA8B 4FUDA 4CRAA 1O2IA 1F5RA 2OBOA 1HGTH 1DT2A 1EB2A 2BY7X 2DUCA 3OY6U 2TGAA 2F91A 1P2JA 3K2UA 2SGFE 1P01A 4ZH8A 4NFEA 4ABIA 1EXFA 5ETXA 1O3GA 2VWMA 2AMPA 1BMLA 1Z8JB 1KDQB 4IMZA 3GDUA 3SU1A 1SFIA 5A2MH 1FZZA 1BTWA 1G3CA 1VCPA 3GY5A 4X8UH 2I6SA 2ZTZA 5GJ4B 4A92A 3L6PA 1F0SA 4J2YB 1IQKA 4TPYA 1NFYA 3Q00A 1SQAA 2UUKB 2V6NA 5FXLA 2YOLA 1T8NA 2V0BA 1O2YA 1SLWB 1GDQA 1C2LA 1GJCB 3LDXH 4GHQA 1VITH 4U01A 2F9NA 3EA7A 1HAYB 4FU7A 1DE7H 1C5VA 3CENA 3KQCA 3ESTA 2KAIA 5JDUB 5A0AE 4MPWA 1NC6A 2CHAB 2H9TH 3KF2A 2G8TA 1HJ8A 2P59A 1ZTJA 1GI6A 1Q3XA 1SLXB 5AFZH 4WMFA 4ZUHA 3HGNA 1J9CH 1QQ4A 1UVSH 3D62A 3MO6A 3MFJA 3QTOH 2BDCA 5JBTA 4D9RA 1XUGA 3UWJH 2VVVA 4ISNA 3SORA 2NU4E 1PPCE 5FX5A 1Z71A 2ZCHP 1RJXB 4IS5A 2C4FH 2D1JA 2P94A 1PQAA 3A89A 1D3TB 2B0FA 2QXJA 1BHXF 1TNHA 1LHCH 1QB1A 1UTPA 1YGCH 2ANWA 1MZDA 1K1PA 1UO6A 1BBRH 1BUIA 1NY22 1RTFB 1UCYH 1P03A 2RA3A 4IN1A 4F4OC 1TA6A 2I6QA 1QRXA 1V2WT 2G4UA 2NU1E 4K3JA 3CP7A 2G81E 2Z94A 2WV5A 1Z1IA 4Y0ZE 3S0NA 4I33A 1S85A 5B6OA 1C5LH 1THPB 3UFAA 1FXYA 3KHVA 2OXSA 1LMWB 1K28D 2JH6D 5EOKA 1DVAH 3TH4H 2Z3EA 1Q31A 1P12E 4OS5A 2PFEA 4X0WU 8ESTE 1BMAA 1UMAH 3UQVA 3QO6A 2RCEA 1V6DA 1NRSH 2QF3A 1KY9A 2OLGA 4JK5A 1G3BA 3RXOA 2VIDA 1MMJN 3OY5U 3LOXA 2STAE 3P17H 2A2XH 4Y71A 2A7HA 1G2LA 3RMOH 1TPAE 5C5NA 1GVZA 1TYNA 1S81A 2A0QB 1AE8H 2ODPA 2W3IA 4E7NA 1EZQA 2WPMS 1WV7H 1GHXH 1GMHG 3I78A 4YESB 3T2NA 1YPHC 2PR3A 4JZIA 1GI8B 5GCHG 3BTDE 5ESTE 1C5TA 1O5DH 1GBLA 2FS8A 1K1MA 3ATIA 1BJVA 3GYMA 9ESTA 1OXGA 2IJOB 5CMXH 1ETRH 3SW2B 2GDDA 3TJOA 2FZZA 4DJZB 4XBBA 2OUAA 2W26A 2ZO3H 4B2AA 1QIXB 4ABJA 1W10U 1ARCA 2FOBA 1BRCE 1KLIH 4ABHA 1GCTB 1A2CH 1C5RA 4AG1A 3A7WA 4UDWH 1EZXC 3P6ZB 1GHWH 1AU8A 2ZG0H 3SJIA 2OD3B 2BLQA 2THFB 3PMHB 1S6HA 3RXVA 1FQ3A 2SGAA 3TNTA 3PB1E 1QRZA 4BXSA 5H4IB 3SV6A 1C1UH 5A8YA 1YLDA 2A4GA 1GHZA 1O5CB 3SUGA 2XWBI 2C93B 1GCTC 4Y8XA 4CBNA 1EQ9A 1NRQH 4UD9H 4X1QU 1IQEA 1LTOA