3OY5U

The crystal structure of upa complex with peptide inhibitor mh027 at ph7.4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
247
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSATLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 246
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy5U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy5U01
2JETC 3KQEA 2Z9LA 3MYWA 2HOBA 3SV7A 4YM9A 1TA2A 3OY5U 3STIA 2ZFQH 3SO3A 4TWWA 1NRRH 2VIWA 3SNDA 4ZROA 2QCYA 4X6NA 3FP6E 1W7GH 1ZMLA 3H7OA 1O3NA 1ZSLA 2BLQA 1C5RA 1BBRE 1SLXB 1UK4A 3M5MA 1FN8A 4AGJA 2TGDA 1BHXB 1GJ9B 4FU8A 4AFQA 1DANH 1FPCH 3A7VA 4U01A 3PB1E 1VJ9U 3ZZCA 1KIGH 1OXGA 3MU5A 1EOJA 1ZLRA 4X1SU 1DITH 3ATIA 3QTOH 4Y10E 1MAXA 9LPRA 4MVNA 1YCPH 1GBDA 1KXCA 1C5SA 1RRKA 2G55A 1RS0A 2GCTB 2JKHA 3BTME 1ZMJA 1S0QA 3BTDE 1Y3XA 2P3FH 2GKVE 3BEIB 1UTKA 1XKBC 1A0HB 2PKAB 2Q6FA 1AI8H 1GI7B 1YCPK 3KHVA 5FX6A 4B1TA 2A45B 2CJIA 2FMJA 1P05A 1O39A 4Y7AA 1V2MT 1MQ5A 3TGJE 2CF8H 4NIYA 4BAMB 8LPRA 1QB6A 2BDYA 3LGWA 5FBEA 4ZKNU 3I29A 1GCTC 4DIIH 1MKXK 1T32A 2NU3E 2JH6D 3O8BA 3RXJA 3KL6A 3UWJH 2PLXA 3H5CB 3HGNA 4YZUA 1GBIA 3LGUA 1BTXA 1C5MD 4Y71A 1ELCA 3CS0A 1C4U2 1LHCH 1ZGIA 3URCA 4ASHA 3MHWU 1HBTH 2SNVA 3RXTA 2GZ8A 3B9FH 4FUCA 3T28A 5DP5A 2VVCA 1FZZA 2NWNA 1K1NA 2XWBI 2W3IA 2ZTZA 1TGNA 5ESBA 2RCEA 2V0BA 3PTBA 1OWIA 3ATKA 1O2WA 1O3LA 5B6OA 3P8GA 1UJ1A 1A3EH 1IAUA 2A1DB 3Q77A 4MLFB 4U30A 2P59A 4HGCA 1KXFA 1H4WA 1U6QA 5DG6A 1Y8TA 5EQQA 3VEQB 4YLQH 1SFIA 1SLUB 2TBSA 1DWEH 4UFFH 2BX4A 1K1OA 1W13U 3MNBA 3T5FH 1FY8E 4BAQB 3Q76A 4FVBA 2BVRH 2AEIH 4IMZA 4NWLA 4IC6A 1Y3VA 3BTFE 5C5OA 3RXVA 1Y5UT 3LH1A 3TJNA 1SGNE 2F9UA 3LT3A 1O3MA 2EI7A 3RXMA 4FUIA 3ESTA 1FIZA 2F3CE 5JPMH 2FOMB 2ZTYA 1NFUA 2GX4A 4NWKA 2VWOA 3SUGA 1SLWB 5CHAB 2ZDLA 5A09A 3TITA 2PKSB 4NCYA 2HLCA 1C2MA 1WAYB 4CRGA 2FOHA 4KTSA 3VFEA 3UR9A 1C4V2 5DP3A 1O3DA 1DLKB 1V2OT 1GJBB 1P02A 1ACBE 1HIAB 5A8YA 1UCYE 2EI8A 2VH0A 1A5IA 1CGIE 1O2MA 2O8MA 4D9QA 2EEKA 1TWXB 4MPXA 3SQEE 5L30H 3NCLA 5IYTA 1KXDA 3EA8A 4UFDH 1GDUA 4PROA 5F03A 4OS1A 1W10U 2ZDMA 1KDQB 2G4UA 4NZQA 1LVMA 1GVLA 4BTIB 1O2KA 2RA3A 3AASA 3A7ZA 3AW1A 4IMQA 3RDZA 3VPKA 3OSYA 2F9BH 4RSPA 2PTNA 1WBGB 1Z1IA 2ZFTA 1PPGE 1GJ7B 3E1XB 2ZDKA 4U2WA 1C5QA 1SB1H 4JK5A 3GY8A 1CVWH 3V12A 3ATWA 1MTNC 2H5CA 2OBQA 1S5SA 1VGCC 1LQDB 1T4UH 5GCHF 1MD7A 1NC6A 1D3TB 4A1TA 1LVBA 1AMHA 5F8XA 1C1SA 1TGCA 1YC0A 2I6QA 3ZVCA 1F2SE 1SR5C 1D3QB 4XE4A 1ELBA 2FESH 2TGTA 4ZHAA 3GY7A 3GCTG 3NK8A 1G9IE 4GHQA 4RKJB 4LZ1H 1SGFA 3ZVDA 1HV7A 4KTUA 2FYRA 2PV9B 5DP4A 1LVYA 1IQIA 1KTSB 2WINI 2AIQA 2BD7A 3PWCA 4YLUA 4XBBA 1TGBA 3TGKE 1VCPA 2FP7B 1OWDA 3UY9A 3K6YA 2ZHFH 3GYMA 4WVPE 1ZTKA 4YOJA 3RXBA 1SVPA 2BY6X 3MTYA 3U98H 2XNIA 1DWCH 1TNGA 3VB7A 4Y7BA 3ZVFA 4ISNA 1MBMA 1XKAC 4AN7A 1G2MA 8KME2 1WTGH 3MO6A 3TH4H 2A32A 3RUOA 7ESTE 2V3HH 2FM2A 4FUGA 5HYOA 3BG8A 2VVUA 4Q7XA 1FONA 2VWNA 1YM0A 2Y7XA 1GHBG 1FPHH 4MPVA 2P8OB 4KGAA 1EZQA 3RXUA 3UNQA 1ZJDA 3E16B 5E0GA 1Z8RA 3FANA 2VIPA 3GDVA 4YESB 1WQSA 1L1NA 1NU7B 3IWMA 4INHA 1AWHB 3ELAH 1G30B 2CGAA 2OQUA 5AVDA 2R3YA 1PYTC 4AYVB 4KTCA 1UTQA 4X1PU 2QY0B 1K1MA 1BA8B 3SGAE 5EW1H 3SUDA 2R3UA 4R0IA 2G51A 1GL0E 1NRNH 4LXBH 1YLDA 2XC0A 5EPNA 1KXAA 1ABIH 3JZ1B 3QK1A 3M3VA 3E8LA 1JBUH 1OS8A 1FY3A 1B0EA 1NROH 2PGQB 1HDTH 2ZPQA 2ZO3H 1SGTA 3C27B 4UD9H 3S7HB 1UHBB 1DVAH 2G8TA 1B5GH 1EZSC 2EI6A 3FZZA 6GCHG 1V2RT 4I8KA 4JZIA 4A5TS 5A2MH 1SFQB 4WF8A 1BJUA 3I78A 1HIAA 1ELFA 2XTTB 1L2EA 2ESTE 3HKIB 2BOKA 3D65E 1AIXH 1KXEA 3BG4B 2PGBB 1O3GA 2ZGXH 5C1YA 1C9PA 1GJ4H 2P3UB 1W12U 4JYTA 3FFGA 3LDXH 1HJAC 1SOTA 1P03A 2C4FH 3TK6A 1O2HA 2OC0A 5A0AE 4B71A 4GLYA 3SJOA 3UTUH 1J15A 1PYTD 1KXBA 2XBVA 2A7JA 1HAVB 5EODA 3U9AH 1OYTH 1PFXC 2WUBA 1JXPA 2FEQH 1QB9A 4UONA 1ETRH 4TY6A 2GCTC 4WMEA 1KSNA 3RXPA 3T62A 1DICA 1W7XH 2BDHA 2F9PA 2BMGB 1C5LH 1TMTH 1B7XB 2PWXA 4ZKOU 1H8IH 2ANMH 1BBRH 1GVZA 1O2OA 1C2LA 1LMWB 1V2NT 4B2AA 1FN6A 2C8WB 1V2KT 1XVOA 1P06A 4ABBA 1YYY1 1O38A 4K1SA 2ZFFH 3ZZ9A 3E91A 2VIVA 1P2NA 3TPIZ 1BOQA 3F1SB 3BEFB 3F68H 4WWYA 1FLEE 2BYAX 5HMAA 1ABJH 1TX7A 1O2XA 2Q6DA 2TGPZ 2VINA 1BBRK 2VWLA 2Z6BD 4Y8ZA 4OGXA 3R3GB 1DY8A 3HATH 1ELDE 1C1NA 4F4OC 2XWAA 1XVMA 3T26A 1QL9A 3ZYEA 4CBOA 2J92A 4M7GA 3CS7A 5A8XA 3MNXA 1NRPH 1ZTLA 4CRDA 1S82A 3GDSA 1O2PA 1P11E 1WSSH 2FS8A 1EZXC 1VCQA 8ESTE 1G32B 2BZAA 1C9TA 2B8OH 3UR6A 4DVAU 4GVUA 2ODQA 1YBWA 1O3PB 1YPJH 1HLTH 2ZU3A 2C8YB 1Z7KA 1GJAB 2CF9H 1EP5A 2ZEBA 3RU4T 1BDAA 1AFQC 3SI3H 4D9RA 2LPRA 3ZZ7A 1SQAA 5AFYH 1QY6A 1UMAH 1WYKA 2Z9GA 2GDDA 1N8OC 1AQ7A 3GCNA 2IJOB 1Y5BT 3FAOA 1XUIA 1VITH 2PW8H 1HYLA 1QJ6B 2BDAA 1RFNA 3FVFB 2UWLA 1DWDH 1EAXA 1JIRA 3BTGE 1MU8B 4Q80A 5H4IB 1BTUA 2UUKB 2BLWA 4FU9A 1DSTA 3A82A 4O3UA 2C8ZB 1YKTA 2A0QB 5T6FA 1MTWA 1UHBA 3M35A 1Y3UA 1IQGA 3TK9A 5F6MA 1ANDA 3GYLB 2CV3A 4YOIA 3RM0H 5LGOA 4OS7A 1BRBE 4JYUH 1K1IA 3SGQE 1O3KA 3QLPH 4SGBE 3MI4A 4VGCB 4ZHLU 4I7YH 2A5AA 4NIWA 1QHRB 4A6LA 1CA0B 1HAIH 4H42U 2PUQH 4ZMAH 4K8BA 4TWYA 1O3HA 2XCNA 2PKSC 1GBKA 4D8NA 3S0NA 1MZDA 4BOHA 2R0LA 3ODFA 5TJXA 2GP9B 4X8TH 1AGJA 1SLVB 3A8CA 4JMYA 1L1GA 1BTPA 1TB6H 1S6HA 1ZR0A 2ZI2H 4WH6A 1NO9H 2ASUB 1PPFE 4GCHF 1P12E 5JDUB 1K1JA 4LOYH 3VB6A 2VIQA 1P10A 2TPIZ 5C3NA 1HAVA 5BRRE 2ZTXA 5FHTA 1Z6JH 1E37B 5FX5A 4D7FA 3RMMH 2ZDVH 3SW2B 5GDSH 5DGJA 5F8ZA 2PSXA 4ISIH 3UREA 1TMBH 4JZ1A 1GHAF 1L1JA 3A7YA 3RXKA 1O2IA 2FZZA 1BB0B 1UCYH 4UFEH 1Y5AT 2FX4A 1O2QA 1TRNA 1AHTH 4B2CA 1LHFH 1ZPBA 2PTCE 4IC5A 1PPEE 1LPGB 1O0DH 4ABIA 4CHAC 5E2PA 1WUNH 1QJ1B 2FDAA 1PQ7A 1ETTH 4K69A 5DJ7A 2WPKS 1EQ9A 2HPQH 4GPGA 5DO4H 3SV8A 2Y6TA 1GHWH 1UCYK 1TBQH 1AVXA 1C5TA 4Y6DA 3ZVAA 1L0ZA 1VZQH 2AGEX 4X2VA 5LPRA 3QTVH 4NIXA 8GCHF 1NS3A 3EGKH 5ABWA 2A4GA 2ZGHA 1IQMA 4CH8B 1E38B 1JOUB 1C1OA 1JIMA 1QRWA 2ZCHP 3M3TA 2KAIA 1AE8H 1OYQA 3NPSA 3TGIE 4FUFA 1AB9B 4KP0A 1DUAA 1V2LT 3ATMA 3O8RA 1WOFA 4GHTA 3ZZ3A 1ANCA 2R2WU 4DIHH 1CE5A 3LKWA 3PMAB 3P8NA 5GCHG 2H5DA 4DW2U 1J17T 1O2UA 1SI5H 3M5OA 4FVDA 2P8OC 1KY9A 1GBLA 4I8GA 1V3XA 1ZMNA 2FX6A 2ZU5A 2IN2A 1D6RA 2BZ6H 2BD9A 2Y7ZA 1K1PA 1TGSZ 4IN1A 1DOJA 4GAWA 2J2UA 3RMOH 1HJ9A 3KF2A 2HNTF 3BTQE 1TQ7B 3RXQA 3SZNA 4UE7H 1FY5A 5FPSA 1F0RA 5FAHA 1TONA 1C5XB 1SBWA 2OC1A 2B0FA 1OP2A 2FS9A 2GV6A 1TPAE 4K1TA 1A46H 4BAOB 3LGYA 3RC5A 3U8OH 1PPZA 1DS2E 3UQVA 1PJPA 3SU3A 3BIUH 1O2JA 1QR3E 4ZKSU 2JH0D 1YPLH 3MNSA 2FTMA 1C5UA 2V35A 4X1NU 5FPYA 4MQAA 5G4BA 3NKKA 2ZU2A 5L2ZH 4INLA 2BY8X 3VGCC 2GVFA 3RXAA 5L6NH 1NRSH 2P93A 2ZA5A 2W26A 1OWEA 1RD3B 1GMHF 3GCHB 4Z0KA 3N7OA 4NFFA 1CGHA 2QXHA 2G5NA 5DP9A 1ELEE 1TOCB 1QB1A 1C1TA 4BAHB 2ILNA 3SUFA 3MH4A 2CHAC 1RGQA 2Y5FA 1CO7E 3A86A 2HWLB 4O03A 4Q2KA 1CT4E 4TPYA 1AUJA 3LIWA 4Y79A 3BG4C 1ZJKA 1SG8B 3RLWH 3ZZ5A 4E06H 4DGJA 1E35B 1GBFA 2ODYB 3E0PB 3E6PH 3GY3A 3LU9B 3ZV8A 1TA6A 3A85A 4I32A 4D76A 4NA8A 1ZTJA 4K1EA 2BD2A 5EXMA 1GG6B 2BVSH 1SGFG 3BTHE 2O8WA 3LOXA 5LH8A 3QDZB 1GHYH 1X7AC 1GI1A 1O2YA 2SNWA 1O5AB 3TK5A 1GBHA 1BIOA 3GY2A 3A7TA 1CT0E 4AZ2B 2WUCA 4DG4A 2ULLA 4H6SB 1AO5A 2XRCA 1KLIH 2B9LA 3SV2H 1DT2A 1P57B 4HZHA 4BTTB 1EPTA 2GT7A 1C2GA 1O30A 4JK6A 3UPEA 2RA0A 3P70B 2QGRA 1D6WA 1XM1A 3KQDA 3BV9B 4J2YB 1YPGH 1C2EA 1JMOH 1AUTC 4KKDA 4NFEA 4AB9A 1CHOF 1O3BA 2C90B 3TIUA 3RXSA 2XC4A 1Y59T 1LKAA 1FDPA 4ISHH 2SGEE 4O97A 4O3TA 3ZZAA 2P94A 1NPMA 4OS6A 2FI3E 2GMTB 2A5IA 2ZKSA 2B7DH 4ABFA 1O3EA 1AKSB 3STJA 2B5TB 3T29A 1HUTH 1DX5M 3OU0A 1VR1H 2SGFE 1A2CH 2BXUH 3L6PA 3DA9B 3PTNA 3M61U 2ZDAH 4WXIA 1TABE 1C2HA 1GI9B 1Q3XA 3ZZ4A 1W3CA 1TNJA 2WPHS 3A83A 1F5KU 2VIOA 1MUEB 1GHVH 1T8LA 4X8VH 1W11U 1AN1E 2ZDNA 3S9BA 3M7TA 4CRFA 1LVOA 4BXSA 5EQSA 1DSUA 1UVSH 2RG3A 4FUDA 3HKJB 4JCNA 1W0ZU 2BD5A 1V2PT 1P2KA 3S9AA 4ZHMU 7GCHF 1O2LA 4K60A 1GWAA 2G00A 5LPEA 3QGNB 4A7IB 2AGGX 1J9CH 1G3EA 1SGIB 1Z8JB 1HNEE 5DKMA 2WV4A 5EW2H 3SNEA 5JB9S 1C2DA 2GT8A 1ZHRA 2BOHB 1S6FA 1MTVA 1HAOH 1P0SH 3GDUA 3ZZDA 3QZQA 1C2JA 5C20A 2PHBA 3L33A 4KELA 5PTPA 3ZZ6A 3GY6A 1GPZA 2AMDA 4AFSA 3U1IB 4ISOA 3VB3A 3MU4A 1G37A 1TPOA 1G2LA 1MBQA 1GJDB 3MMGA 1LDTT 2VVVA 1W0YH 2ZC9H 3U8TH 5IDKA 2BY7X 1NU9A 4ABAA 2G5VA 2C93B 3ZV9A 4XSKU 4ABJA 3A7XA 2G4TA 6CHAB 2F9OA 1XUJA 3IG6B 3UNRA 1P9UA 4A1XA 3U69H 2WPMS 4VGCC 2YNBA 5E0HA 1Z1JA 1CHGA 1BTYA 5A8ZA 1HJ8A 1TBRH 5JB8S 1D9IA 1K22H 3KEEA 1TX6A 1VITF 1ZGVA 3MU1A 2A31A 4ISLA 3A8AA 1FQ3A 1YF4A 2XBXA 1GCTB 1W8BH 2OTVA 1HAYB 4MNWA 2C3SA 2QN5T 1MQ6A 1D3PB 1CGJE 4XBDA 1VJAU 2P95A 2ZCLP 3V7TA 2BM2A 1MCTA 2HRVA 4K3JA 2K1QA 1IHSH 2FTLE 3M37A 5DP8A 1M9UA 3LJOA 3MH7A 4OS4A 1QBVH 1TNLA 1O3OA 4J1YA 2FOAA 2D1JA 1G36A 1SQOA 4WMFA 1PQ5A 3A88A 1KLTA 3MU0A 1EJMA 2A2XH 1NFYA 2BY9X 4AORA 2QXIA 2BQ6B 3D23A 1GBEA 3M7UA 1S0RA 1GDQA 1LCYA 2SGAA 3JZ2B 3F9EA 4CBNA 4XDEA 3HPTB 3A87A 1O32A 1SMFE 1TRMA 2AS9A 1HPGA 3RXFA 2CMYA 1IHTH 1Z8IB 2WV5A 4JZFH 1RXPA 1EOLA 1ZHMA 1T8NA 1GHZA 3TNTA 2FYQA 4H6TA 1EB2A 4DJZB 2F83A 1SOZA 1O2VA 2P3TB 4BXWA 1O34A 3EE0B 1L4ZA 1A5GH 1P3EA 1E34B 4B76A 1ZRBA 1O2NA 4AFZA 4TY7A 2Q6GA 2BDBA 1BJVA 4O9VA 1O3JA 4HFPB 1ZRKA 4ESTE 3BTKE 3FP8E 1AKSA 1HAPH 5EGMA 1GI3A 2H1UA 2J9NA 3ITIA 3TJOA 3PWBA 3PO1B 2VGCB 3A89A 6LPRA 2P16A 1IOEA 1C1MA 1FXYA 3CENA 3OX7U 3NUMA 2DE9A 1S81A 2OC8A 4WMDA 2AH4X 4Y0ZE 1EB1H 1GI4A 3RXDA 5HM9A 3AAVA 5DP6A 5AFZH 1F0UA 1SHHB 4IN2A 1K2I1 3QO6A 2OD3B 1TGTA 3SU4A 1QL7A 2QV1A 5GJ4B 1TFXA 1BRCE 1K28D 4FU7A 4A1VA 1JRSA 1T7CA 3PYHA 1YPMH 1AB9C 3NWUA 1GHAG 3RXLA 1MAYA 3VXEH 3A80A 1O33A 1TNHA 2FOFA 4YTAA 5EXNA 2ZECA 3SHAH 2ZQ1A 1DFPA 2ZU4A 1KLJH 2OXSA 1WTHD 4GUXA 3Q3KA 1RTLA 1O2RA 2FIRH 3M7QA 4NA9H 1PPHE 1BZXE 1ANBA 1OSSA 4F49A 1O5GH 1GMDF 1K9OE 2QA9E 3E3TA 1BMMH 1T4VH 1SSXA 3UQOA 2UWPA 1LHEH 1QCPA 2PR3A 2ZGBH 3E0NB 4ABHA 3BTTE 2PUXB 1Y3YA 3BSQA 1PPCE 1XMNB 1DUEA 1QA0A 3PLPA 4MNVA 2CXVA 1QFKH 1TIOA 2FLRH 2OUAA 1KTTB 1C2IA 2KAIB 1SGRE 3D62A 1VGCB 4CR9A 1FNIA 5J4SA 1DLEA 1IQKA 1P2IA 4X0WU 5E8EH 5EU8A 3GCHC 2ZQ2A 3SV9A 2WPIS 5A0BA 4X6OA 5GIBA 1THSH 1TPPA 2Y5GA 4BAKB 1O5BB 5LPFA 1GJCB 3RXHA 3PMHB 4Y8YA 1P2JA 1TPSA 1UTOA 3MO3A 1GBBA 1C2FA 2ZGJA 1GJ6A 1AE5A 1S84A 4XOJA 1EJAA 1EKBB 2R0KA 1GMCF 1D4PB 4QT8C 1GBMA 3TVJB 1IQJA 4OS2A 1GG6C 2NU4E 4UEHH 3TH3H 2Y80A 1F0TA 5A0CA 1H8DH 1QRXA 1TOMH 4JZDH 1Z71A 2F9VA 3QUMP 2LNCA 4K2YA 5CHAC 3RMNH 3Q3YA 1AVWA 1P2MA 2J34A 5FXLA 1AU8A 3SQHE 1TRYA 2VIDA 2OCVB 1RTFB 1BTZA 2J94A 2V6NA 1C1PA 1ELTA 5I25A 1F5LA 2BHGA 4TYDA 1GMHG 3DHKH 2W3KA 1XUHA 3LJJA 2OINA 2O8UA 2BD3A 1ORFA 4B74A 4MNYA 3KGPA 2EC9H 1C1VH 2ZNKH 1GL1A 3SJ9A 1FAXA 4MPWA 1D3DB 4RKOB 1H9LB 1O2ZA 3PLBA 5GPIB 1UVUH 3VXFH 5JBTA 1EZUC 3URDA 1V2UT 2ALVA 2GMTC 1ESBA 1HRTH 3C1KA 1V2WT 1SGQE 1VCWA 1BRAA 3BTEE 3LONA 3FZDA 3P95A 3LGTA 2FODA 5EPYA 1QRZA 4Y8XA 5ETXA 1HFDA 1HXEH 2GCHF 3GY5A 1PPBH 2PFEA 1O5FH 1FV9A 2ZG0H 1C5PA 2Z3EA 1DE7H 1O3AA 1QNJA 2ANWA 3SU0A 3PM3A 1MTSA 2ZPRA 1CU1A 1O5EH 3GCOA 1EPTB 2HALA 3ZVGA 3TLOA 3GISB 3RM2H 1TNKA 1ZYOA 2DUCA 3LGIA 1C1WH 1BMNH 1XUFA 4ABEA 5J4QA 1C5WB 1C1QA 1BQYA 1QURH 1ZPCA 2ZP0H 1OWHA 5EOKA 1B0FA 2QXGA 2Z9JA 1CHOG 1MD8A 3ENSB 5EQRA 1OP0A 1AD8H 1CT2E 1P9SA 1A5HA 1IQEA 2PSYA 2VNTA 1HJAB 3BIVH 1ELAA 3CP7A 5JBCS 5DK1A 4YT7H 3BF6H 1RIWB 1TQ0B 4Y76A 4UDWH 1LKBA 2BDGA 1WV7H 3DT0H 2UUFB 3MH6A 3TH2H 2SGDE 2XBWA 2BDCA 2OP9A 3ZYDA 1QA7A 2TRMA 1J16A 3S69A 1EUFA 6CHAC 1RJXB 1GJ8B 4YT6H 1TMUH 1MKXH 1Z8GA 1QBNA 1HAHH 2J4IA 1ZHPA 2ZHQH 4MG3A 1AY6H 1FJSA 4FUEA 3P8OA 5AHGH 2A7HA 1EJNA 5C1UA 3O8CA 2IOTA 2GDEH 1UVTH 4FUHA 4ZKRU 1ELVA 1ZZZA 5T3HA 2W7SA 7GCHG 1EX3A 1O3IA 1XX9A 2GGVB 1LQEA 2Q1JA 5BPEA 3DFJA 4AX9H 2QIQA 3ZVBA 3IITA 1C5VA 2NU0E 3SJIA 1DM4B 1CBWB 1P3CA 1DY9A 1FY1A 1IQFA 1ARCA 3B8JA 3PMJA 1YGCH 3A8DA 1F0SA 4FUJA 1P2OA 2W5EA 3TNSA 3OTJE 2A2QH 2UWOA 2GZ7A 3UOUA 1HAXB 3T2NA 1T8MA 2Z9KA 4WY3A 1GCDA 2OQ5A 5I46H 1YPEH 3EA9A 3D49H 3SOSA 2ZHWH 5DPAA 2GV7A 1V2JT 3P8FA 1GGDB 2FO9A 2ZU1A 2FOCA 3F9FA 2FPZA 5F8TA 1OWKA 3K9XB 3EQ0H 3UFAA 1HXFH 1AFQB 1BTHH 1RTKA 1MZAA 2Y5HA 2QAAA 2R2MB 1GDNA 1SQTA 5JBBS 1AWFH 1LPZB 1VITG 1N8OB 2HGTH 3LC5A 4X2XA 5FBIA 2BLVA 2BQWB 1EATA 1TE0A 3F9HA 1GI6A 1EP6A 1SHYA 5JBAS 1N1LA 1UVOA 2Y81A 4X1RU 2HVXA 5E2OA 2AYWA 1JRTA 5TCCA 3PROA 4Q7ZA 1THRH 3PO1C 2VGCC 4IS5A 2FOEA 5HGGA 2QC2A 3UIRA 1SGDE 2AIPA 4AB8A 1TYNA 4E7RG 1OWJA 2WYGA 3RXIA 3SHCH 3QWCH 5JYIA 2ZCKP 1HB0B 3WY8A 1O2GH 1Y3WA 2DE8A 1UK3A 2ZGCA 3UNSA 2A4RA 1V2TT 1TX8A 1XXDA 2QXJA 2XW9A 2ZWLH 1S85A 2TGAA 1CA8B 1GVKB 3RXOA 3RU4E 1QJ7B 1CQQA 2BX3A 2HNTC 1BITA 2XC5A 5TCAA 3KIDU 1SGYE 3MH5A 1UTMA 3UOPA 2BB4A 1V6DA 6ESTA 2A4QA 3MO9A 3O8DA 4BANB 2TIOA 2WPLS 3DD2H 1OOKB 3V3MA 2D26C 5C1XA 7KMEH 2ANYA 3ZZ8A 4CRAA 4IGDA 4NGAH 2GD4B 2VU8E 4Y0YE 3Q00A 4YOGA 1ARBA 4LZ4B 1EAIA 3A84A 2JETB 1IQHA 4ZAEA 4OS5A 1OP8A 1NZQH 2NU1E 3B23B 2H9HA 1QIXB 2PKAA 2BD4A 2UUYA 3SU5A 1DXPA 1UK2A 2NU2E 3BEUA 2M5TA 1NM6A 1YP9A 1P01A 1H1BA 1A4WH 5DP7A 1FAKH 2G52A 2RDLA 4I33A 1GHXH 1E36B 1TAWA 3F6UH 3T27A 1NN6A 4CHAB 2ODPA 3DFLA 2WYJA 1H9IE 1NRQH 4NZLA 1XXFA 1GBTA 2BD8A 2XYAA 3LPRA 1GI8B 2H2ZA 4Q7YA 4ABDA 5C2ZA 3GICB 3S7KB 1MTUA 1BT7A 4A92A 2I6SA 3H7TA 3F9GA 1GMDG 1O3CA 1QTFA 2STAE 3AAUA 1BHXF 1F5RA 1GJ5H 1O3FA 2H9TH 4NA7A 2OBOA 3RXCA 4CRCA 3SV6A 1W14U 2AMQA 3P17H 1YPHC 2GTBA 4OGYA 1AFEH 2ANKH 3K65B 2BQ7B 1HGTH 2A4OA 3PMBB 1SGEE 1OKXA 2SGQE 1AZ8A 1IQLA 3U1JB 1O5DH 3MWIU 4HTCH 1PQAA 1GI5A 3ATLA 2ZFPH 3I77A 4AOQA 2F91A 1C1UH 1BCUH 2ZPSA 1CA0C 1OX1A 2AMPA 3M5NA 3HK3B 1SL3A 1F7ZA 1WCZA 3R0FA 4AYYB 1QQUA 2OC7A 2BTCE 4UFGH 1S83A 2G81E 2ZZUH 4X8SH 3A7WA 3KCGH 1NFWA 1ZOMA 4DT7B 1SPJA 1PQ8A 2VWMA 2STBE 1BTWA 2Z94A 2ZF0H 3MU8A 4NSYA 5L2YH 4CREA 3KQCA 2YNAA 1NT1A 3QZRA 1AVGH 4XBCA 4E05H 3LC3A 5CMXH 1A1RA 1ID5H 4CH2B 3EDXB 2JH5D 4IBLH 2A7CA 4HI3A 1W2KH 1EAWA 2HPPH 2QYIA 5GXPA 3K6ZA 3MFJA 4MTBA 3SJ8A 1QQ4A 2W7UA 1L4DA 5E0JA 1K21H 1ZSJA 1GBAA 2O8LA 1UTLM 1V2ST 2ZHDA 1ZPZA 1GMCG 5FPTA 2V3OH 3M5LA 1KYNA 4X8UH 3EYDA 4JZEH 1THPB 3G01A 2FXRA 4XFQA 1C5OH 2AERH 4IW4E 4X2WA 3M3SA 3VB5A 2GZ9A 2FI5E 3TJUA 4JYVH 1O2SA 1IQNA 3HK6B 3LGVA 3VGCB 2FWWA 1FUJA 2ZIQH 3GY4A 1LPKB 1EPTC 4GSOA 2Y82A 2F9NA 4X1QU 2ZHEH 1NTPA 4DURA 2J95A 5GWZA 3RC4A 3BN9A 3SU2A 2CHAB 3EAJA 3MOCA 1XUGA 2BLOA 2Z9IA 4GCHG 4MNXA 1C4Y2 3A8BA 3V0XA 3SU1A 2D2DA 4RN6A 1QL8A 2C8XB 1LO6A 1MKWH 2FLBH 1C5ZB 1O31A 1TALA 3L3TA 7LPRA 4NSVA 1KDQA 1NESE 2Z3DA 2O8TA 5AF9H 1GI0A 2ZFRH 3LH3A 4LK4A 1A0LA 5EG4A 4E7NA 3QGJA 1TBZH 2H9EH 1NFXA 3PV4A 1RIWC 3SJKA 2VB0A 1C5YB 2ZFSA 3AVZA 1GI2A 1ANEA 4Z6AH 1P8VC 1SGPE 1T8OA 1DPOA 3HGPA 3T25A 4ABGA 1MKWK 4FUBA 4B73A 1F92A 1FI8A 3SNCA 4DY7B 2BDIA 1A3BH 2GCHG 4H4FA 1YLCA 3GCTF 3S9CA 2ALPA 3AW0A 1G3BA 1DXWA 3RC6A 3KN2A 5HXFA 1G3DA 4NIVA 4WXVA 2Z3CA 4INKA 5HM2A 4K5ZA 2YOLA 5T6DA 1TNIA 5T6GA 3SUEA 4MPUA 3ZZBA 2R9PA 3W95A 1JWTA 2FI4E 3W94A 5C5NA 1GBCA 1YCPM 1EAUA 4K8YA 2XCFA 2J38A 4WJG2 1BMLA 3OY6U 1CBWC 4AG1A 1G3CA 3TU7H 3SNAA 8GCHG 4CR5A 4X6PA 1Z6EA 5K7RA 2XBYA 1UTPA 1C2KA 1N6XA 3ZVEA 3FP7E 4X2YA 2XXLA 1ETSH 4R8TB 3UUZA 1ELGA 1MTNB 1CSOE 1V2QT 1EXFA 2Z7FE 3NZIA 1P09A 3MNCA 2HNTE 2A5KA 2VJ1A 2H6MA 1EASA 1GHBF 3SGBE 1DWBH 1TLDA 3A81A 2AFQB 3U8RH 3Q3XA 2BXTH 2THFB 3KNXA 3V13A 4DCDA 1E0FD 3QX5H 1GGDC 5CE1A 3SNBA 1ESTA 2FOGA 4D7GA 3QN7A 2O9QA 3BTWE 3KQBA 1O35A 4X6MA 3SORA 1MH0A 1O37A 1O36A 1QBOA 1H9HE 4I8HA 2EA3A 2BY5X 2SFAA 1A61H 1MCVA 1DDJA 2OLGA 4WH8A 3VB4A 1MMJN 1P04A 4Y11E 1N6YA 1C5NH 3GOVB 2CN0H 4YO9A 3P92A 2FOBA 2D8WA 4ZUHA 1C1RA 2WPJS 4AGKA 4I8JA 2VH6A 3EA7A 4BNRA 1K1LA 1HAZB 4NG9H 1FIWA 1FMGA 4TPIZ 2AGIX 6GCHF 1ZSKA 4U32A 1SC8U 4I31A 5ESTE 3M36A 2QF0A 3SI4H 4DOQA 2QF3A 4B75A 3OYPA 1QGFA 2UUJB 4B2BA 1O5CB 1V2VT 3RXGA 5C67A 1HCGA 4SGAE 1UTNA 1FY4A 3RXRA 2BVXH 3DUXH 1GBJA 9ESTA 1P2QA 3SU6A 1YPHE 1BUIA 1XUKA 3RP2A 4THNH 5FCRA 1OPHB 5FCKA 4I8LA 3SBKA 3ODDA 1UO6A 4CRBA 1SGCA 3NXPA 1BRUP 1HAGE 2SGPE 1J14A 2IPHA 1INCA 4FXGH 1LHDH 3E90B 1NY22 4MDSA 4ZXYH 3RMLH 1T31A 3RLYH 1MU6B 3K2UA 1WU1A 5K0HA 4AFUA 1YPKH 4BTUB 1J8AA 1UVPA 1BMAA 4ZH8A 1AZZA 1A0JA 3RXEA 3PLKA 4AG2A 1A7SA 3TJVA 5SGAE 1LHGH 1ESAA 1Q31A 3P6ZB 1LTOA 1UTJA 5EXLA 3RU4D 3UWIA 3SN8A 1O2TA 1Q2WA 4ZXXH 1WQVH
chains in the Genus database with same CATH superfamily
2JETC 3KQEA 2Z9LA 3MYWA 2HOBA 3SV7A 4YM9A 1TA2A 3OY5U 3STIA 2ZFQH 1NBMD 3SO3A 4TWWA 1NRRH 3OEHD 2VIWA 3SNDA 4ZROA 2QCYA 4X6NA 3FP6E 1W7GH 1ZMLA 3H7OA 1O3NA 1ZSLA 2BLQA 4Q4LA 1C5RA 4TT3D 1BBRE 1SLXB 1UK4A 3M5MA 1W0JD 1FN8A 4AGJA 2TGDA 1BHXB 1GJ9B 4FU8A 5IK2D 4AFQA 1DANH 4Q63A 1FPCH 3A7VA 4U01A 3PB1E 1VJ9U 3ZZCA 1KIGH 1OXGA 3MU5A 1EOJA 1ZLRA 4X1SU 1DITH 3ATIA 3QTOH 4Y10E 1MAXA 1E79D 9LPRA 5CDFE 4MVNA 1YCPH 4B6EA 1GBDA 1KXCA 1C5SA 1RRKA 2G55A 4ZCNA 1RS0A 2GCTB 2JKHA 3BTME 1ZMJA 5CHBA 1S0QA 3BTDE 2XNDD 1Y3XA 2P3FH 2EQNA 2GKVE 3BEIB 1UTKA 1XKBC 1A0HB 2PKAB 2Q6FA 1AI8H 2KM0A 1GI7B 5C94A 1YCPK 3KHVA 3OE7D 5FX6A 4B1TA 2A45B 2CJIA 2FMJA 1P05A 1O39A 4Y7AA 1V2MT 1MQ5A 3TGJE 2CF8H 4NIYA 4BAMB 8LPRA 1QB6A 2BDYA 3LGWA 5FBEA 4ZKNU 3I29A 1GCTC 4DIIH 1MKXK 1T32A 2NU3E 2JH6D 3O8BA 3RXJA 3KL6A 3UWJH 2PLXA 3H5CB 3U28C 3HGNA 4YZUA 3F0OA 1GBIA 2YMSB 3LGUA 1BTXA 1C5MD 4Y71A 1ELCA 3CS0A 1C4U2 1LHCH 1ZGIA 3URCA 4ASHA 3MHWU 1HBTH 2SNVA 3RXTA 2GZ8A 3B9FH 3PV5A 4FUCA 3T28A 5DP5A 2VVCA 1FZZA 2NWNA 2PP6A 1K1NA 2XWBI 2W3IA 2ZTZA 1TGNA 5ESBA 2RCEA 2V0BA 3PTBA 1OWIA 3ATKA 1O2WA 1O3LA 5B6OA 3P8GA 1UJ1A 2IJD1 1A3EH 1IAUA 2A1DB 3Q77A 4MLFB 4U30A 2P59A 4HGCA 1KXFA 1H4WA 1U6QA 5DG6A 1Y8TA 5EQQA 3VEQB 4YLQH 1SFIA 1SLUB 2GJGA 2TBSA 1DWEH 4UFFH 3UAIC 2BX4A 1K1OA 1W13U 3MNBA 3T5FH 1FY8E 3SYJA 4BAQB 3Q76A 4FVBA 2BVRH 2AEIH 4IMZA 3MQKC 4NWLA 4HG6A 4IC6A 1Y3VA 3BTFE 5C5OA 3RXVA 1Y5UT 3LH1A 3TJNA 1SGNE 2F9UA 3LT3A 1O3MA 2EI7A 3RXMA 4FUIA 3ESTA 1FIZA 2F3CE 5JPMH 2FOMB 2ZTYA 1NFUA 2GX4A 4NWKA 2VWOA 3SUGA 1SLWB 5CHAB 2ZDLA 5A09A 3TITA 2PKSB 4NCYA 2HLCA 1C2MA 1WAYB 4CRGA 2FOHA 4KTSA 3VFEA 3UR9A 1C4V2 5DP3A 1O3DA 1DLKB 1V2OT 1GJBB 1P02A 1ACBE 3FOAA 1HIAB 5A8YA 1UCYE 2EI8A 2VH0A 1A5IA 4ACBA 1CGIE 1O2MA 2O8MA 4D9QA 2EEKA 1TWXB 4MPXA 3SQEE 5L30H 3NCLA 5IYTA 1KXDA 3EA8A 4UFDH 1GDUA 4PROA 5F03A 4OS1A 1W10U 2ZDMA 1KDQB 2G4UA 4NZQA 5T1VA 2EY4C 1EFRD 1LVMA 1GVLA 4BTIB 1O2KA 2RA3A 3AASA 3A7ZA 3AW1A 4IMQA 3RDZA 3VPKA 3WWBA 3OSYA 2F9BH 4RSPA 2PTNA 1WBGB 1Z1IA 2ZFTA 1PPGE 2KCOA 1GJ7B 3E1XB 2ZDKA 3KYFA 4U2WA 1C5QA 1SB1H 4JK5A 3GY8A 1CVWH 3V12A 3ATWA 1MTNC 2H5CA 2OBQA 1S5SA 1VGCC 1LQDB 1T4UH 5GCHF 1MD7A 1NC6A 1D3TB 4A1TA 1LVBA 1AMHA 5F8XA 1C1SA 1TGCA 1YC0A 2I6QA 3ZVCA 1K0HA 1F2SE 1SR5C 1D3QB 4XE4A 1ELBA 2FESH 2TGTA 4ZHAA 3GY7A 3GCTG 3AK5A 3NK8A 1G9IE 4GHQA 4RKJB 4LZ1H 3H09A 1SGFA 3ZVDA 1HV7A 4KTUA 2FYRA 2PV9B 5DP4A 1LVYA 1IQIA 1KTSB 5C17A 2WINI 2AIQA 2BD7A 3PWCA 4YLUA 4XBBA 1TGBA 3TGKE 1VCPA 5C0TA 2FP7B 1OWDA 3UY9A 3K6YA 2ZHFH 4DT4A 3GYMA 4WVPE 1ZTKA 4YOJA 3RXBA 1SVPA 2BY6X 3MTYA 3U98H 2XNIA 1DWCH 1TNGA 3VB7A 4Y7BA 3ZVFA 3WW7A 4ISNA 1MBMA 1XKAC 4AN7A 1G2MA 8KME2 1WTGH 3MO6A 3TH4H 2A32A 3RUOA 7ESTE 2V3HH 2FM2A 4FUGA 5HYOA 3BG8A 2VVUA 4Q7XA 5DSFA 1FONA 2VWNA 1YM0A 2Y7XA 1GHBG 3OFND 1FPHH 4MPVA 2P8OB 4KGAA 1EZQA 3RXUA 3UNQA 1ZJDA 3E16B 5E0GA 1Z8RA 3FANA 2VIPA 3GDVA 4YESB 1WQSA 1L1NA 1NU7B 3IWMA 4INHA 1AWHB 3ELAH 1G30B 2CGAA 2K0QA 2OQUA 5AVDA 2R3YA 1PYTC 4AYVB 4KTCA 1UTQA 4X1PU 2QY0B 1K1MA 1BA8B 5HIZA 3SGAE 5EW1H 3SUDA 2R3UA 4R0IA 2WPDD 2G51A 1GL0E 1NRNH 3F2HA 4LXBH 3F3BA 1YLDA 2XC0A 5EPNA 1KXAA 1ABIH 3JZ1B 3QK1A 3M3VA 3E8LA 1JBUH 1OS8A 1FY3A 1B0EA 1NROH 2PGQB 1HDTH 2ZPQA 2ZO3H 1SGTA 3C27B 4UD9H 3S7HB 1UHBB 1DVAH 2G8TA 1B5GH 1EZSC 2EI6A 3FZZA 6GCHG 1V2RT 3WWFA 4I8KA 4JZIA 4A5TS 5A2MH 1SFQB 4WF8A 1BJUA 3I78A 1HIAA 1ELFA 2XTTB 1L2EA 2ESTE 3HKIB 2BOKA 3D65E 1AIXH 1KXEA 3BG4B 2PGBB 1O3GA 3EE7A 2ZGXH 5C1YA 1C9PA 1GJ4H 2P3UB 1W12U 4JYTA 3FFGA 3LDXH 1HJAC 1SOTA 1P03A 2C4FH 3TK6A 1O2HA 2OC0A 5A0AE 4B71A 4GLYA 3SJOA 3UTUH 1J15A 1PYTD 1KXBA 2XBVA 2A7JA 3DSOA 1HAVB 5EODA 3U9AH 1OYTH 1PFXC 2WUBA 1JXPA 2FEQH 1QB9A 4UONA 1ETRH 4TY6A 2GCTC 4WMEA 1KSNA 3RXPA 3T62A 1DICA 1W7XH 2BDHA 2F9PA 2BMGB 1C5LH 1TMTH 1B7XB 2PWXA 4ZKOU 1H8IH 2ANMH 1BBRH 1GVZA 1O2OA 1C2LA 1LMWB 1V2NT 3N99A 4B2AA 1FN6A 2C8WB 1V2KT 1XVOA 1P06A 4ABBA 1YYY1 1O38A 4K1SA 2ZFFH 3ZZ9A 3E91A 2VIVA 1P2NA 3TPIZ 1BOQA 3F1SB 3BEFB 3F68H 4WWYA 1FLEE 2BYAX 5HMAA 1ABJH 1TX7A 1O2XA 2Q6DA 2TGPZ 2VINA 1BBRK 2VWLA 2Z6BD 4Y8ZA 4B6FA 4OGXA 3R3GB 1DY8A 3HATH 2YMSC 1ELDE 1C1NA 4F4OC 2XWAA 1XVMA 3T26A 1QL9A 3ZYEA 4CBOA 2J92A 4M7GA 3CS7A 5A8XA 3MNXA 1NRPH 1ZTLA 4CRDA 1S82A 3GDSA 1O2PA 1P11E 1WSSH 2FS8A 1EZXC 1VCQA 8ESTE 1G32B 2BZAA 1C9TA 2B8OH 1YLNA 3UR6A 4DVAU 4GVUA 2ODQA 1YBWA 1O3PB 1YPJH 1HLTH 2ZU3A 2C8YB 1Z7KA 1GJAB 2CF9H 1EP5A 2ZEBA 3RU4T 1BDAA 1AFQC 3SI3H 4D9RA 2LPRA 3ZZ7A 1SQAA 5AFYH 1QY6A 1UMAH 1WYKA 2Z9GA 2GDDA 1N8OC 1AQ7A 3GCNA 2IJOB 1Y5BT 3FAOA 1XUIA 4F48B 1VITH 2PW8H 1HYLA 1QJ6B 3OAAD 2BDAA 1RFNA 3FVFB 5KECA 2UWLA 1DWDH 1EAXA 1JIRA 3BTGE 1MU8B 4Q80A 5H4IB 1BTUA 2UUKB 2BLWA 4FU9A 1DSTA 3A82A 4O3UA 2C8ZB 1YKTA 2A0QB 5T6FA 1MTWA 1UHBA 3M35A 1Y3UA 1IQGA 3TK9A 5F6MA 1ANDA 3GYLB 2CV3A 4YOIA 3RM0H 1W0KD 5LGOA 4OS7A 1BRBE 4JYUH 1K1IA 3SGQE 3OTPA 1O3KA 3QLPH 4SGBE 3MI4A 4VGCB 4ZHLU 4I7YH 2A5AA 4NIWA 1QHRB 4A6LA 1CA0B 1HAIH 4H42U 2PUQH 4ZMAH 4K8BA 4TWYA 1O3HA 2XCNA 2PKSC 1GBKA 4D8NA 3S0NA 1MZDA 4I86A 4BOHA 2R0LA 1S6LA 3ODFA 5TJXA 2GP9B 4X8TH 1AGJA 1SLVB 3A8CA 4JMYA 1L1GA 1BTPA 1TB6H 1S6HA 1ZR0A 2ZI2H 4WH6A 1NO9H 2ASUB 1PPFE 4GCHF 1P12E 5JDUB 1K1JA 4LOYH 3VB6A 2VIQA 1P10A 2TPIZ 5C3NA 1HAVA 5BRRE 2ZTXA 5FHTA 1Z6JH 1E37B 5FX5A 4D7FA 3RMMH 2ZDVH 3SW2B 5GDSH 5DGJA 5F8ZA 2PSXA 4ISIH 3UREA 1TMBH 4JZ1A 2VBCA 1GHAF 1L1JA 3A7YA 3RXKA 4RT0A 1O2IA 2FZZA 1BB0B 1VKYA 1UCYH 3W1EA 4UFEH 1Y5AT 2FX4A 1O2QA 1TRNA 1AHTH 4B2CA 1LHFH 1ZPBA 2PTCE 4IC5A 1PPEE 1LPGB 1O0DH 4ABIA 4CHAC 5E2PA 1WUNH 1QJ1B 2FDAA 1PQ7A 1ETTH 4K69A 5DJ7A 2WPKS 1EQ9A 2HPQH 4RI0A 4GPGA 5DO4H 3SV8A 2Y6TA 1GHWH 1UCYK 2KR7A 1TBQH 1AVXA 5EIYA 1C5TA 1H8ED 5EJZA 4Y6DA 3ZVAA 1L0ZA 1VZQH 2AGEX 4X2VA 5C0UA 5LPRA 3QTVH 3FO8D 4NIXA 8GCHF 3F0PA 1NS3A 3EGKH 5ABWA 2A4GA 2ZGHA 1IQMA 4CH8B 1E38B 1JOUB 1C1OA 2W6ID 1JIMA 1QRWA 2ZCHP 3M3TA 2KAIA 1AE8H 1OYQA 3NPSA 3TGIE 4FUFA 1AB9B 4KP0A 1DUAA 1V2LT 3ATMA 3O8RA 1WOFA 4GHTA 3ZZ3A 1ANCA 2R2WU 4DIHH 1CE5A 3LKWA 3PMAB 3P8NA 5GCHG 2H5DA 4DW2U 1J17T 1O2UA 1SI5H 3M5OA 4FVDA 2P8OC 1KY9A 1GBLA 4I8GA 1V3XA 1ZMNA 2FX6A 2ZU5A 2IN2A 1D6RA 2BZ6H 2BD9A 2Y7ZA 1K1PA 1TGSZ 4IN1A 1DOJA 4GAWA 2J2UA 3RMOH 1HJ9A 4Z1MD 3KF2A 2HNTF 3BTQE 1TQ7B 3RXQA 3SZNA 4UE7H 1FY5A 2V3MA 5FPSA 1F0RA 3PRBA 5FAHA 1TONA 1C5XB 1SBWA 2OC1A 2B0FA 1OP2A 2FS9A 2GV6A 1TPAE 4K1TA 1A46H 4BAOB 3LGYA 3RC5A 3U8OH 1PPZA 1DS2E 3UQVA 1PJPA 3SU3A 3BIUH 1O2JA 1QR3E 4ZKSU 2JH0D 1YPLH 3MNSA 2FTMA 1C5UA 2V35A 4X1NU 5FPYA 4MQAA 5G4BA 3NKKA 2V7QD 2ZU2A 5L2ZH 4INLA 2BY8X 3VGCC 2GVFA 3RXAA 5L6NH 1NRSH 2P93A 2ZA5A 2W26A 1OWEA 1RD3B 1GMHF 3GCHB 4Z0KA 3N7OA 4NFFA 1CGHA 2QXHA 2G5NA 2JDID 1ELEE 5DP9A 1TOCB 1QB1A 1C1TA 4BAHB 2ILNA 3SUFA 3MH4A 2CHAC 1RGQA 2Y5FA 1CO7E 3A86A 2HWLB 4O03A 4Q2KA 1CT4E 4TPYA 1AUJA 3LIWA 4Y79A 3BG4C 1ZJKA 1SG8B 3RLWH 3ZZ5A 4E06H 4DGJA 1E35B 1GBFA 2ODYB 3E0PB 3E6PH 3GY3A 3LU9B 3ZV8A 1TA6A 3A85A 4I32A 4D76A 4NA8A 1ZTJA 4K1EA 2BD2A 5EXMA 1GG6B 2BVSH 1SGFG 3BTHE 2O8WA 3LOXA 5LH8A 3QDZB 1GHYH 1X7AC 1GI1A 1O2YA 2SNWA 1O5AB 3TK5A 1GBHA 1BIOA 3GY2A 3A7TA 3DCLA 1CT0E 4AZ2B 2WUCA 4DG4A 2ULLA 4H6SB 1AO5A 2XRCA 1KLIH 4XD7D 2B9LA 3SV2H 1DT2A 1P57B 4HZHA 4BTTB 1EPTA 2GT7A 1C2GA 1O30A 4JK6A 3UPEA 2RA0A 3P70B 2QGRA 1D6WA 1XM1A 3KQDA 3BV9B 4J2YB 1YPGH 1C2EA 1JMOH 1AUTC 4KKDA 4NFEA 4AB9A 1CHOF 1O3BA 2C90B 3TIUA 3RXSA 2XC4A 1Y59T 1LKAA 1FDPA 4ISHH 2SGEE 4O97A 4O3TA 3ZZAA 2P94A 1NPMA 4OS6A 5B6LA 2FI3E 2GMTB 2A5IA 2ZKSA 2B7DH 4ABFA 1O3EA 1AKSB 4P00A 3STJA 2B5TB 3T29A 1HUTH 1DX5M 3OU0A 1VR1H 2SGFE 1A2CH 2BXUH 3L6PA 3DA9B 3PTNA 3M61U 2ZDAH 4WXIA 1TABE 1C2HA 1GI9B 1Q3XA 3FKSD 3ZZ4A 1W3CA 3SZEA 1TNJA 2WPHS 3A83A 1F5KU 2VIOA 1MUEB 1GHVH 1T8LA 4X8VH 1W11U 1AN1E 2ZDNA 3S9BA 3M7TA 4CRFA 1LVOA 4BXSA 5EQSA 1DSUA 1UVSH 2RG3A 4FUDA 3HKJB 4JCNA 1W0ZU 2BD5A 1V2PT 1P2KA 3S9AA 4ZHMU 7GCHF 1O2LA 4K60A 2J98A 1GWAA 2G00A 5LPEA 3QGNB 4A7IB 2AGGX 1J9CH 1G3EA 1SGIB 1Z8JB 1HNEE 5DKMA 2WV4A 5EW2H 3SNEA 5JB9S 1C2DA 2GT8A 4P02A 1ZHRA 2BOHB 1S6FA 1MTVA 1HAOH 1P0SH 3GDUA 3ZZDA 3QZQA 1C2JA 5C20A 2PHBA 3L33A 4KELA 5PTPA 3ZZ6A 3GY6A 1GPZA 2AMDA 4AFSA 3U1IB 1COWD 4FOUC 4ISOA 3VB3A 3MU4A 1G37A 1TPOA 1G2LA 1MBQA 1GJDB 2QE7D 3MMGA 1LDTT 2VVVA 1W0YH 2ZC9H 3U8TH 5IDKA 2BY7X 1NU9A 4ABAA 1MABB 2G5VA 2C93B 3ZV9A 4XSKU 4ABJA 3A7XA 4TSFD 2G4TA 6CHAB 2F9OA 1XUJA 3IG6B 3UNRA 1P9UA 4A1XA 3U69H 5HKKD 2WPMS 2W6JD 4VGCC 2YNBA 5E0HA 1Z1JA 1CHGA 1BTYA 1UW7A 5A8ZA 1HJ8A 1TBRH 5JB8S 1D9IA 1K22H 3KEEA 1TX6A 1VITF 1ZGVA 3MU1A 2A31A 4ISLA 3A8AA 1FQ3A 2JJ1D 1YF4A 2XBXA 1GCTB 2LELA 1W8BH 2OTVA 1HAYB 2HLDD 4MNWA 2C3SA 2QN5T 1MQ6A 1D3PB 1CGJE 4XBDA 1VJAU 2P95A 2ZCLP 3V7TA 2BM2A 1MCTA 2HRVA 4K3JA 2K1QA 1IHSH 2FTLE 3M37A 5DP8A 1M9UA 3NRLA 3LJOA 3MH7A 4OS4A 1QBVH 1TNLA 1O3OA 4J1YA 2FOAA 2D1JA 1G36A 1SQOA 4WMFA 1PQ5A 3A88A 1KLTA 3MU0A 1EJMA 2A2XH 1NFYA 2BY9X 4AORA 2QXIA 2BQ6B 3D23A 1GBEA 3M7UA 1S0RA 1GDQA 1LCYA 2SGAA 3JZ2B 3F9EA 4CBNA 4XDEA 3HPTB 3A87A 1O32A 1SMFE 1TRMA 2AS9A 1HPGA 3RXFA 2CMYA 1IHTH 1Z8IB 2WV5A 4JZFH 1RXPA 1EOLA 1ZHMA 1T8NA 1GHZA 3TNTA 2FYQA 4H6TA 1EB2A 4DJZB 2F83A 1SOZA 1O2VA 2P3TB 4BXWA 1O34A 3EE0B 1L4ZA 1A5GH 1P3EA 1E34B 4B76A 1ZRBA 1O2NA 4AFZA 4TY7A 2Q6GA 2BDBA 1BJVA 4O9VA 1O3JA 4HFPB 1ZRKA 4ESTE 3BTKE 3FP8E 1AKSA 1HAPH 5EGMA 1GI3A 2H1UA 2J9NA 3ITIA 3TJOA 3PWBA 3PO1B 2VGCB 3A89A 6LPRA 2P16A 1IOEA 1C1MA 1FXYA 3CENA 3OX7U 3NUMA 2DE9A 1S81A 2OC8A 4WMDA 2AH4X 4Y0ZE 1EB1H 1GI4A 3RXDA 5HM9A 1KMHB 3AAVA 1YWUA 5DP6A 5AFZH 1F0UA 1SHHB 2J97A 1K2I1 3QO6A 4IN2A 2OD3B 1TGTA 3SU4A 1QL7A 2QV1A 5GJ4B 1TFXA 1BRCE 1K28D 4FU7A 4A1VA 1JRSA 1T7CA 3PYHA 1YPMH 1AB9C 3NWUA 1GHAG 3RXLA 1MAYA 3VXEH 3A80A 1O33A 1TNHA 2FOFA 4YTAA 5EXNA 2ZECA 3SHAH 2ZQ1A 1DFPA 2ZU4A 1KLJH 2OXSA 1WTHD 4GUXA 3Q3KA 1RTLA 1O2RA 2FIRH 3M7QA 4NA9H 1PPHE 1BZXE 1ANBA 1OSSA 4F49A 4YXWD 1O5GH 1GMDF 1K9OE 2QA9E 3E3TA 1BMMH 1T4VH 1SSXA 3UQOA 2UWPA 1LHEH 1QCPA 2PR3A 2ZGBH 3E0NB 4ABHA 3BTTE 2PUXB 1Y3YA 3BSQA 1PPCE 1XMNB 1DUEA 1QA0A 3PLPA 4MNVA 2CXVA 1QFKH 1TIOA 2FLRH 2OUAA 3DSPA 2CK3D 1KTTB 3KYGA 1C2IA 2KAIB 3OEED 1SGRE 3D62A 2KFWA 1VGCB 4CR9A 1FNIA 5J4SA 1DLEA 1IQKA 1P2IA 4X0WU 5E8EH 5EU8A 3GCHC 2ZQ2A 3SV9A 2WPIS 5A0BA 4X6OA 5GIBA 2IPQX 1THSH 1TPPA 2Y5GA 4BAKB 1O5BB 5LPFA 1GJCB 2HVYB 3RXHA 3PMHB 3DSGA 4Y8YA 1P2JA 1TPSA 1UTOA 3MO3A 1GBBA 1E1QD 1C2FA 2ZGJA 1GJ6A 3N7DA 1AE5A 1S84A 4XOJA 1EJAA 1EKBB 2R0KA 4ASUD 1GMCF 1D4PB 4QT8C 1GBMA 3TVJB 1IQJA 4OS2A 1GG6C 2NU4E 4UEHH 3TH3H 2Y80A 1F0TA 5A0CA 2QF4A 1H8DH 2YMSD 1QRXA 1TOMH 4JZDH 1Z71A 2F9VA 3QUMP 2LNCA 4K2YA 5CHAC 3RMNH 2WSSD 3Q3YA 2KCPA 1AVWA 1P2MA 2J34A 5FXLA 1AU8A 3SQHE 1TRYA 3F2GA 2VIDA 2OCVB 1RTFB 1BTZA 2J94A 2V6NA 2KX4A 1C1PA 1ELTA 5HIYA 5I25A 1F5LA 2BHGA 4TYDA 1GMHG 3DHKH 2W3KA 1XUHA 3LJJA 2OINA 2JIZD 2O8UA 2BD3A 1ORFA 4B74A 4MNYA 3KGPA 2EC9H 1C1VH 2ZNKH 1GL1A 3SJ9A 1FAXA 4MPWA 1D3DB 4RKOB 1H9LB 1O2ZA 3PLBA 5GPIB 1UVUH 3VXFH 5JBTA 1EZUC 3URDA 1V2UT 2ALVA 2GMTC 1ESBA 1HRTH 5KEDA 3C1KA 1V2WT 1SGQE 1VCWA 1BRAA 3BTEE 3LONA 3FZDA 3P95A 3LGTA 2FODA 5EPYA 1QRZA 4Y8XA 5ETXA 1HFDA 1HXEH 2GCHF 3GY5A 1PPBH 2PFEA 1O5FH 1FV9A 2ZG0H 1C5PA 2Z3EA 1DE7H 1O3AA 1QNJA 2ANWA 3SU0A 3PM3A 1MTSA 2ZPRA 1CU1A 1O5EH 3GCOA 1EPTB 2HALA 3ZVGA 3TLOA 3GISB 3RM2H 1TNKA 1ZYOA 2DUCA 3LGIA 1C1WH 3UB0A 1BMNH 1XUFA 4ABEA 5J4QA 1C5WB 1C1QA 1BQYA 1QURH 1ZPCA 2ZP0H 1OWHA 5EOKA 1B0FA 2QXGA 2Z9JA 1CHOG 1MD8A 3ENSB 5EQRA 1OP0A 1AD8H 1CT2E 1P9SA 1A5HA 1IQEA 2PSYA 2VNTA 1HJAB 3BIVH 1ELAA 3CP7A 5JBCS 5DK1A 4YT7H 3BF6H 1RIWB 1TQ0B 4Y76A 4UDWH 1LKBA 2BDGA 1WV7H 3DT0H 2UUFB 3MH6A 3TH2H 2SGDE 2XBWA 2BDCA 2OP9A 3ZYDA 1QA7A 2TRMA 1J16A 3S69A 1EUFA 6CHAC 1RJXB 1GJ8B 2J5UA 4YT6H 1TMUH 1MKXH 1Z8GA 5DN6D 1QBNA 4RT1A 1HAHH 2J4IA 1ZHPA 2ZHQH 4MG3A 1AY6H 1FJSA 4FUEA 3P8OA 2L74A 2A7HA 1EJNA 5AHGH 5C1UA 2J98B 3O8CA 2IOTA 2GDEH 1UVTH 4FUHA 4ZKRU 1ELVA 1ZZZA 5T3HA 2W7SA 7GCHG 1EX3A 1O3IA 1XX9A 2GGVB 1LQEA 2Q1JA 5BPEA 3DFJA 4AX9H 2QIQA 3ZVBA 3IITA 1C5VA 2NU0E 3SJIA 1DM4B 1CBWB 1P3CA 4F55A 1DY9A 1FY1A 1IQFA 1QZ8A 1ARCA 3KQ5A 3B8JA 3PMJA 1YGCH 3A8DA 1WXRA 1F0SA 4FUJA 1P2OA 2W5EA 3TNSA 3OTJE 2A2QH 2UWOA 3N7EA 2KCYA 2GZ7A 3UOUA 1HAXB 3T2NA 1T8MA 2Z9KA 4WY3A 1GCDA 5GNDA 2OQ5A 5I46H 1YPEH 3EA9A 4XRNA 3D49H 3SOSA 2ZHWH 5DPAA 2GV7A 1V2JT 3P8FA 1GGDB 2FO9A 2ZU1A 2FOCA 3F9FA 2FPZA 5F8TA 1OWKA 2WHXA 3K9XB 3EQ0H 3UFAA 1HXFH 1AFQB 1BTHH 1RTKA 1MZAA 2Y5HA 2QAAA 2R2MB 1GDNA 1SQTA 5JBBS 1AWFH 1LPZB 1VITG 1N8OB 2HGTH 3LC5A 4X2XA 5FBIA 2BLVA 2BQWB 1EATA 1TE0A 3F9HA 1GI6A 1EP6A 1SHYA 5JBAS 1N1LA 1UVOA 2Y81A 4X1RU 2HVXA 5E2OA 2AYWA 1JRTA 5TCCA 3PROA 4Q7ZA 1THRH 3PO1C 2VGCC 4IS5A 2FOEA 5HGGA 2QC2A 3UIRA 1SGDE 2AIPA 4AB8A 1TYNA 4E7RG 1OWJA 2WYGA 3RXIA 3SHCH 3QWCH 5JYIA 2ZCKP 1HB0B 3WY8A 1O2GH 1WDIA 1Y3WA 2DE8A 1UK3A 1E1RD 2ZGCA 3UNSA 2A4RA 1V2TT 1TX8A 1XXDA 2QXJA 2XW9A 2ZWLH 1S85A 2TGAA 1CA8B 2KCAA 1GVKB 3RXOA 3RU4E 1QJ7B 1CQQA 2BX3A 2HNTC 1BITA 2XC5A 5TCAA 3KIDU 1SGYE 3MH5A 1UTMA 3UOPA 2BB4A 1V6DA 6ESTA 2K8IA 2A4QA 3MO9A 5EJLA 4AC9A 3O8DA 1NBME 4BANB 2TIOA 2WPLS 3DD2H 1OOKB 3V3MA 2D26C 5C1XA 7KMEH 2ANYA 3ZZ8A 2XOKD 4CRAA 4IGDA 4NGAH 3CNRA 2M2AA 2GD4B 2VU8E 4Y0YE 3FN8A 3Q00A 4YOGA 1ARBA 4LZ4B 1EAIA 3A84A 2JETB 1IQHA 4ZAEA 4OS5A 1OP8A 1NZQH 2L6OA 2NU1E 3B23B 2H9HA 1QIXB 2PKAA 2BD4A 2UUYA 3SU5A 1DXPA 1UK2A 2NU2E 3BEUA 2M5TA 1NM6A 1YP9A 1P01A 1H1BA 1A4WH 5DP7A 1FAKH 2G52A 2RDLA 4I33A 1GHXH 1E36B 1TAWA 3F2FA 3F6UH 5F53A 3T27A 1NN6A 4CHAB 2ODPA 3DFLA 2WYJA 1H9IE 1NRQH 4NZLA 1XXFA 1GBTA 2BD8A 2XYAA 3LPRA 1GI8B 2H2ZA 4Q7YA 4ABDA 5C2ZA 2AHME 3GICB 3S7KB 1MTUA 1BT7A 4A92A 2I6SA 3H7TA 3F9GA 1GMDG 1O3CA 1QTFA 2STAE 3AAUA 1BHXF 1F5RA 1GJ5H 1O3FA 2H9TH 4NA7A 2OBOA 3RXCA 4CRCA 3SV6A 1W14U 2AMQA 3P17H 1YPHC 2GTBA 4OGYA 1AFEH 2ANKH 3K65B 2BQ7B 1HGTH 2A4OA 3PMBB 1SGEE 1OKXA 2SGQE 1AZ8A 1IQLA 4FETA 3U1JB 1O5DH 3MWIU 4HTCH 1PQAA 1GI5A 3ATLA 2ZFPH 3I77A 4AOQA 2F91A 1C1UH 1BCUH 2ZPSA 1CA0C 1OX1A 2AMPA 3M5NA 3HK3B 4OM9A 1SL3A 1F7ZA 2QF5A 1WCZA 3R0FA 4AYYB 1QQUA 2OC7A 1SQRA 2BTCE 4UFGH 1S83A 2G81E 2ZZUH 4X8SH 3A7WA 3KCGH 1NFWA 1ZOMA 4DT7B 1SPJA 1PQ8A 2VWMA 2STBE 1BTWA 2Z94A 2ZF0H 3MU8A 4NSYA 5L2YH 4CREA 3KQCA 2YNAA 1NT1A 3QZRA 3VG8A 1AVGH 4XBCA 4E05H 3LC3A 5CMXH 1H8HD 1A1RA 1ID5H 4CH2B 3EDXB 2JH5D 4IBLH 2A7CA 4HI3A 1W2KH 1EAWA 2HPPH 2QYIA 5GXPA 3K6ZA 3MFJA 4MTBA 3SJ8A 1QQ4A 2W7UA 1L4DA 5E0JA 1K21H 1ZSJA 1GBAA 2O8LA 1UTLM 1V2ST 2ZHDA 1ZPZA 4ACAA 1GMCG 5FPTA 2V3OH 3M5LA 1KYNA 4X8UH 3EYDA 4JZEH 1THPB 3G01A 2FXRA 4XFQA 1C5OH 2AERH 4IW4E 4X2WA 3M3SA 3VB5A 2GZ9A 2FI5E 3TJUA 4JYVH 1O2SA 1IQNA 3HK6B 3LGVA 3VGCB 2FWWA 1FUJA 2ZIQH 3GY4A 1LPKB 1EPTC 4GSOA 2Y82A 2F9NA 4X1QU 1FX0B 2ZHEH 1NTPA 4DURA 2J95A 5GWZA 3RC4A 3BN9A 3SU2A 2CHAB 3EAJA 3MOCA 1XUGA 1OHHD 2BLOA 2Z9IA 3PV2A 4GCHG 4MNXA 1C4Y2 3A8BA 3V0XA 3SU1A 2D2DA 4RN6A 1QL8A 2C8XB 1LO6A 1MKWH 2FLBH 1C5ZB 1O31A 1TALA 3L3TA 7LPRA 4NSVA 1KDQA 1NESE 2Z3DA 2O8TA 5AF9H 1GI0A 2ZFRH 3LH3A 4LK4A 1A0LA 5EG4A 4E7NA 3QGJA 1TBZH 2H9EH 1NFXA 3PV4A 1RIWC 3SJKA 2VB0A 1C5YB 2ZFSA 3AVZA 2WZQA 1GI2A 1ANEA 4Z6AH 1P8VC 1SGPE 1T8OA 1YY3A 1DPOA 3HGPA 3T25A 4ABGA 1MKWK 4FUBA 4B73A 1F92A 1FI8A 3SNCA 4DY7B 2BDIA 1A3BH 2GCHG 4H4FA 1YLCA 3GCTF 3S9CA 2ALPA 3AW0A 1G3BA 1DXWA 5FL7D 3RC6A 3KN2A 5HXFA 1G3DA 4NIVA 4WXVA 2Z3CA 5KGOA 4INKA 5HM2A 4K5ZA 2YOLA 5T6DA 1TNIA 5T6GA 3SUEA 4MPUA 5EJ1A 3ZZBA 2R9PA 3W95A 1JWTA 2FI4E 3W94A 5C5NA 1GBCA 1YCPM 1EAUA 4K8YA 2XCFA 2J38A 4WJG2 1BMLA 3OY6U 1CBWC 4AG1A 1G3CA 3TU7H 2LP6A 3SNAA 8GCHG 4CR5A 4X6PA 1Z6EA 5K7RA 2XBYA 1UTPA 2WV9A 1C2KA 1N6XA 3ZVEA 3FP7E 4X2YA 2XXLA 1ETSH 4R8TB 3UUZA 1ELGA 1MTNB 1CSOE 1V2QT 1EXFA 2Z7FE 3NZIA 1P09A 3MNCA 2HNTE 2A5KA 2VJ1A 2H6MA 1EASA 1GHBF 3SGBE 1DWBH 1TLDA 3A81A 2AFQB 3U8RH 3Q3XA 1BMFD 2BXTH 2THFB 3KNXA 3V13A 4DCDA 1E0FD 3QX5H 1GGDC 5CE1A 3SNBA 4M9FA 1ESTA 2FOGA 4D7GA 3QN7A 2O9QA 3BTWE 3KQBA 1O35A 4X6MA 3SORA 1MH0A 1O37A 1O36A 1QBOA 1H9HE 4I8HA 2EA3A 2BY5X 2SFAA 1A61H 1MCVA 1DDJA 2OLGA 4WH8A 3VB4A 1MMJN 1P04A 4Y11E 2JJ2D 1N6YA 1C5NH 3GOVB 2CN0H 4YO9A 3P92A 2FOBA 2D8WA 4ZUHA 1C1RA 2WPJS 4AGKA 4I8JA 2VH6A 3EA7A 4BNRA 1K1LA 1HAZB 4NG9H 1FIWA 1FMGA 4TPIZ 3PRDA 2AGIX 6GCHF 1ZSKA 4U32A 1SC8U 4I31A 5ESTE 3M36A 2QF0A 3SI4H 4DOQA 2QF3A 4B75A 3OYPA 1QGFA 2UUJB 4B2BA 1O5CB 2RFKC 1V2VT 3RXGA 2F4LA 5C67A 1HCGA 4SGAE 1UTNA 1FY4A 3RXRA 2BVXH 3DUXH 1GBJA 9ESTA 1P2QA 3SU6A 2RDEA 1YPHE 1BUIA 1XUKA 3RP2A 4THNH 5FCRA 1OPHB 5FCKA 4I8LA 3SBKA 3ODDA 1UO6A 4CRBA 1SGCA 3NXPA 1BRUP 1HAGE 2SGPE 1J14A 2OK5A 2IPHA 3GS9A 1INCA 4FXGH 1LHDH 3E90B 1NY22 4MDSA 4ZXYH 3ZIAD 3RMLH 1T31A 3RLYH 1MU6B 3K2UA 1WU1A 5K0HA 4AFUA 1YPKH 4BTUB 1J8AA 1UVPA 1BMAA 4ZH8A 1AZZA 1A0JA 3RXEA 3PLKA 4AG2A 1A7SA 3TJVA 5SGAE 2KZ4A 1LHGH 1ESAA 1Q31A 3P6ZB 1LTOA 1UTJA 5EXLA 3RU4D 3UWIA 1SKYE 3SN8A 1O2TA 2F43B 1Q2WA 4ZXXH 1WQVH
chains in the Genus database with same CATH topology
2JETC 3KQEA 2Z9LA 3MYWA 2HOBA 3SV7A 4YM9A 1TA2A 3OY5U 3STIA 2ZFQH 3SO3A 4TWWA 1NRRH 2VIWA 3SNDA 4ZROA 2QCYA 4X6NA 3FP6E 1W7GH 1ZMLA 3H7OA 1O3NA 1ZSLA 2BLQA 1C5RA 1BBRE 1SLXB 1UK4A 3M5MA 1FN8A 4AGJA 2TGDA 1BHXB 1GJ9B 4FU8A 4AFQA 1DANH 1FPCH 3A7VA 4U01A 3PB1E 1VJ9U 3ZZCA 1KIGH 1OXGA 3MU5A 1EOJA 1ZLRA 4X1SU 1DITH 3ATIA 3QTOH 4Y10E 1MAXA 9LPRA 4MVNA 1YCPH 1GBDA 1KXCA 1C5SA 1RRKA 2G55A 1RS0A 2GCTB 2JKHA 3BTME 1ZMJA 1S0QA 3BTDE 1Y3XA 2P3FH 2GKVE 3BEIB 1UTKA 1XKBC 1A0HB 2PKAB 2Q6FA 1AI8H 1GI7B 1YCPK 3KHVA 5FX6A 4B1TA 2A45B 2CJIA 2FMJA 1P05A 1O39A 4Y7AA 1V2MT 1MQ5A 3TGJE 2CF8H 4NIYA 4BAMB 8LPRA 1QB6A 2BDYA 3LGWA 5FBEA 4ZKNU 3I29A 1GCTC 4DIIH 1MKXK 1T32A 2NU3E 2JH6D 3O8BA 3RXJA 3KL6A 3UWJH 2PLXA 3H5CB 3HGNA 4YZUA 1GBIA 3LGUA 1BTXA 1C5MD 4Y71A 1ELCA 3CS0A 1C4U2 1LHCH 1ZGIA 3URCA 4ASHA 3MHWU 1HBTH 2SNVA 3RXTA 2GZ8A 3B9FH 4FUCA 3T28A 5DP5A 2VVCA 1FZZA 2NWNA 1K1NA 2XWBI 2W3IA 2ZTZA 1TGNA 5ESBA 2RCEA 2V0BA 3PTBA 1OWIA 3ATKA 1O2WA 1O3LA 5B6OA 3P8GA 1UJ1A 1A3EH 1IAUA 2A1DB 3Q77A 4MLFB 4U30A 2P59A 4HGCA 1KXFA 1H4WA 1U6QA 5DG6A 1Y8TA 5EQQA 3VEQB 4YLQH 1SFIA 1SLUB 2TBSA 1DWEH 4UFFH 2BX4A 1K1OA 1W13U 3MNBA 3T5FH 1FY8E 4BAQB 3Q76A 4FVBA 2BVRH 2AEIH 4IMZA 4NWLA 4IC6A 1Y3VA 3BTFE 5C5OA 3RXVA 1Y5UT 3LH1A 3TJNA 1SGNE 2F9UA 3LT3A 1O3MA 2EI7A 3RXMA 4FUIA 3ESTA 1FIZA 2F3CE 5JPMH 2FOMB 2ZTYA 1NFUA 2GX4A 4NWKA 2VWOA 3SUGA 1SLWB 5CHAB 2ZDLA 5A09A 3TITA 2PKSB 4NCYA 2HLCA 1C2MA 1WAYB 4CRGA 2FOHA 4KTSA 3VFEA 3UR9A 1C4V2 5DP3A 1O3DA 1DLKB 1V2OT 1GJBB 1P02A 1ACBE 1HIAB 5A8YA 1UCYE 2EI8A 2VH0A 1A5IA 1CGIE 1O2MA 2O8MA 4D9QA 2EEKA 1TWXB 4MPXA 3SQEE 5L30H 3NCLA 5IYTA 1KXDA 3EA8A 4UFDH 1GDUA 4PROA 5F03A 4OS1A 1W10U 2ZDMA 1KDQB 2G4UA 4NZQA 1LVMA 1GVLA 4BTIB 1O2KA 2RA3A 3AASA 3A7ZA 3AW1A 4IMQA 3RDZA 3VPKA 3OSYA 2F9BH 4RSPA 2PTNA 1WBGB 1Z1IA 2ZFTA 1PPGE 1GJ7B 3E1XB 2ZDKA 4U2WA 1C5QA 1SB1H 4JK5A 3GY8A 1CVWH 3V12A 3ATWA 1MTNC 2H5CA 2OBQA 1S5SA 1VGCC 1LQDB 1T4UH 5GCHF 1MD7A 1NC6A 1D3TB 4A1TA 1LVBA 1AMHA 5F8XA 1C1SA 1TGCA 1YC0A 2I6QA 3ZVCA 1F2SE 1SR5C 1D3QB 4XE4A 1ELBA 2FESH 2TGTA 4ZHAA 3GY7A 3GCTG 3NK8A 1G9IE 4GHQA 4RKJB 4LZ1H 1SGFA 3ZVDA 1HV7A 4KTUA 2FYRA 2PV9B 5DP4A 1LVYA 1IQIA 1KTSB 2WINI 2AIQA 2BD7A 3PWCA 4YLUA 4XBBA 1TGBA 3TGKE 1VCPA 2FP7B 1OWDA 3UY9A 3K6YA 2ZHFH 3GYMA 4WVPE 1ZTKA 4YOJA 3RXBA 1SVPA 2BY6X 3MTYA 3U98H 2XNIA 1DWCH 1TNGA 3VB7A 4Y7BA 3ZVFA 4ISNA 1MBMA 1XKAC 4AN7A 1G2MA 8KME2 1WTGH 3MO6A 3TH4H 2A32A 3RUOA 7ESTE 2V3HH 2FM2A 4FUGA 5HYOA 3BG8A 2VVUA 4Q7XA 1FONA 2VWNA 1YM0A 2Y7XA 1GHBG 1FPHH 4MPVA 2P8OB 4KGAA 1EZQA 3RXUA 3UNQA 1ZJDA 3E16B 5E0GA 1Z8RA 3FANA 2VIPA 3GDVA 4YESB 1WQSA 1L1NA 1NU7B 3IWMA 4INHA 1AWHB 3ELAH 1G30B 2CGAA 2OQUA 5AVDA 2R3YA 1PYTC 4AYVB 4KTCA 1UTQA 4X1PU 2QY0B 1K1MA 1BA8B 3SGAE 5EW1H 3SUDA 2R3UA 4R0IA 2G51A 1GL0E 1NRNH 4LXBH 1YLDA 2XC0A 5EPNA 1KXAA 1ABIH 3JZ1B 3QK1A 3M3VA 3E8LA 1JBUH 1OS8A 1FY3A 1B0EA 1NROH 2PGQB 1HDTH 2ZPQA 2ZO3H 1SGTA 3C27B 4UD9H 3S7HB 1UHBB 1DVAH 2G8TA 1B5GH 1EZSC 2EI6A 3FZZA 6GCHG 1V2RT 4I8KA 4JZIA 4A5TS 5A2MH 1SFQB 4WF8A 1BJUA 3I78A 1HIAA 1ELFA 2XTTB 1L2EA 2ESTE 3HKIB 2BOKA 3D65E 1AIXH 1KXEA 3BG4B 2PGBB 1O3GA 2ZGXH 5C1YA 1C9PA 1GJ4H 2P3UB 1W12U 4JYTA 3FFGA 3LDXH 1HJAC 1SOTA 1P03A 2C4FH 3TK6A 1O2HA 2OC0A 5A0AE 4B71A 4GLYA 3SJOA 3UTUH 1J15A 1PYTD 1KXBA 2XBVA 2A7JA 1HAVB 5EODA 3U9AH 1OYTH 1PFXC 2WUBA 1JXPA 2FEQH 1QB9A 4UONA 1ETRH 4TY6A 2GCTC 4WMEA 1KSNA 3RXPA 3T62A 1DICA 1W7XH 2BDHA 2F9PA 2BMGB 1C5LH 1TMTH 1B7XB 2PWXA 4ZKOU 1H8IH 2ANMH 1BBRH 1GVZA 1O2OA 1C2LA 1LMWB 1V2NT 4B2AA 1FN6A 2C8WB 1V2KT 1XVOA 1P06A 4ABBA 1YYY1 1O38A 4K1SA 2ZFFH 3ZZ9A 3E91A 2VIVA 1P2NA 3TPIZ 1BOQA 3F1SB 3BEFB 3F68H 4WWYA 1FLEE 2BYAX 5HMAA 1ABJH 1TX7A 1O2XA 2Q6DA 2TGPZ 2VINA 1BBRK 2VWLA 2Z6BD 4Y8ZA 4OGXA 3R3GB 1DY8A 3HATH 1ELDE 1C1NA 4F4OC 2XWAA 1XVMA 3T26A 1QL9A 3ZYEA 4CBOA 2J92A 4M7GA 3CS7A 5A8XA 3MNXA 1NRPH 1ZTLA 4CRDA 1S82A 3GDSA 1O2PA 1P11E 1WSSH 2FS8A 1EZXC 1VCQA 8ESTE 1G32B 2BZAA 1C9TA 2B8OH 3UR6A 4DVAU 4GVUA 2ODQA 1YBWA 1O3PB 1YPJH 1HLTH 2ZU3A 2C8YB 1Z7KA 1GJAB 2CF9H 1EP5A 2ZEBA 3RU4T 1BDAA 1AFQC 3SI3H 4D9RA 2LPRA 3ZZ7A 1SQAA 5AFYH 1QY6A 1UMAH 1WYKA 2Z9GA 2GDDA 1N8OC 1AQ7A 3GCNA 2IJOB 1Y5BT 3FAOA 1XUIA 1VITH 2PW8H 1HYLA 1QJ6B 2BDAA 1RFNA 3FVFB 2UWLA 1DWDH 1EAXA 1JIRA 3BTGE 1MU8B 4Q80A 5H4IB 1BTUA 2UUKB 2BLWA 4FU9A 1DSTA 3A82A 4O3UA 2C8ZB 1YKTA 2A0QB 5T6FA 1MTWA 1UHBA 3M35A 1Y3UA 1IQGA 3TK9A 5F6MA 1ANDA 3GYLB 2CV3A 4YOIA 3RM0H 5LGOA 4OS7A 1BRBE 4JYUH 1K1IA 3SGQE 1O3KA 3QLPH 4SGBE 3MI4A 4VGCB 4ZHLU 4I7YH 2A5AA 4NIWA 1QHRB 4A6LA 1CA0B 1HAIH 4H42U 2PUQH 4ZMAH 4K8BA 4TWYA 1O3HA 2XCNA 2PKSC 1GBKA 4D8NA 3S0NA 1MZDA 4BOHA 2R0LA 3ODFA 5TJXA 2GP9B 4X8TH 1AGJA 1SLVB 3A8CA 4JMYA 1L1GA 1BTPA 1TB6H 1S6HA 1ZR0A 2ZI2H 4WH6A 1NO9H 2ASUB 1PPFE 4GCHF 1P12E 5JDUB 1K1JA 4LOYH 3VB6A 2VIQA 1P10A 2TPIZ 5C3NA 1HAVA 5BRRE 2ZTXA 5FHTA 1Z6JH 1E37B 5FX5A 4D7FA 3RMMH 2ZDVH 3SW2B 5GDSH 5DGJA 5F8ZA 2PSXA 4ISIH 3UREA 1TMBH 4JZ1A 1GHAF 1L1JA 3A7YA 3RXKA 1O2IA 2FZZA 1BB0B 1UCYH 4UFEH 1Y5AT 2FX4A 1O2QA 1TRNA 1AHTH 4B2CA 1LHFH 1ZPBA 2PTCE 4IC5A 1PPEE 1LPGB 1O0DH 4ABIA 4CHAC 5E2PA 1WUNH 1QJ1B 2FDAA 1PQ7A 1ETTH 4K69A 5DJ7A 2WPKS 1EQ9A 2HPQH 4GPGA 5DO4H 3SV8A 2Y6TA 1GHWH 1UCYK 1TBQH 1AVXA 1C5TA 4Y6DA 3ZVAA 1L0ZA 1VZQH 2AGEX 4X2VA 5LPRA 3QTVH 4NIXA 8GCHF 1NS3A 3EGKH 5ABWA 2A4GA 2ZGHA 1IQMA 4CH8B 1E38B 1JOUB 1C1OA 1JIMA 1QRWA 2ZCHP 3M3TA 2KAIA 1AE8H 1OYQA 3NPSA 3TGIE 4FUFA 1AB9B 4KP0A 1DUAA 1V2LT 3ATMA 3O8RA 1WOFA 4GHTA 3ZZ3A 1ANCA 2R2WU 4DIHH 1CE5A 3LKWA 3PMAB 3P8NA 5GCHG 2H5DA 4DW2U 1J17T 1O2UA 1SI5H 3M5OA 4FVDA 2P8OC 1KY9A 1GBLA 4I8GA 1V3XA 1ZMNA 2FX6A 2ZU5A 2IN2A 1D6RA 2BZ6H 2BD9A 2Y7ZA 1K1PA 1TGSZ 4IN1A 1DOJA 4GAWA 2J2UA 3RMOH 1HJ9A 3KF2A 2HNTF 3BTQE 1TQ7B 3RXQA 3SZNA 4UE7H 1FY5A 5FPSA 1F0RA 5FAHA 1TONA 1C5XB 1SBWA 2OC1A 2B0FA 1OP2A 2FS9A 2GV6A 1TPAE 4K1TA 1A46H 4BAOB 3LGYA 3RC5A 3U8OH 1PPZA 1DS2E 3UQVA 1PJPA 3SU3A 3BIUH 1O2JA 1QR3E 4ZKSU 2JH0D 1YPLH 3MNSA 2FTMA 1C5UA 2V35A 4X1NU 5FPYA 4MQAA 5G4BA 3NKKA 2ZU2A 5L2ZH 4INLA 2BY8X 3VGCC 2GVFA 3RXAA 5L6NH 1NRSH 2P93A 2ZA5A 2W26A 1OWEA 1RD3B 1GMHF 3GCHB 4Z0KA 3N7OA 4NFFA 1CGHA 2QXHA 2G5NA 5DP9A 1ELEE 1TOCB 1QB1A 1C1TA 4BAHB 2ILNA 3SUFA 3MH4A 2CHAC 1RGQA 2Y5FA 1CO7E 3A86A 2HWLB 4O03A 4Q2KA 1CT4E 4TPYA 1AUJA 3LIWA 4Y79A 3BG4C 1ZJKA 1SG8B 3RLWH 3ZZ5A 4E06H 4DGJA 1E35B 1GBFA 2ODYB 3E0PB 3E6PH 3GY3A 3LU9B 3ZV8A 1TA6A 3A85A 4I32A 4D76A 4NA8A 1ZTJA 4K1EA 2BD2A 5EXMA 1GG6B 2BVSH 1SGFG 3BTHE 2O8WA 3LOXA 5LH8A 3QDZB 1GHYH 1X7AC 1GI1A 1O2YA 2SNWA 1O5AB 3TK5A 1GBHA 1BIOA 3GY2A 3A7TA 1CT0E 4AZ2B 2WUCA 4DG4A 2ULLA 4H6SB 1AO5A 2XRCA 1KLIH 2B9LA 3SV2H 1DT2A 1P57B 4HZHA 4BTTB 1EPTA 2GT7A 1C2GA 1O30A 4JK6A 3UPEA 2RA0A 3P70B 2QGRA 1D6WA 1XM1A 3KQDA 3BV9B 4J2YB 1YPGH 1C2EA 1JMOH 1AUTC 4KKDA 4NFEA 4AB9A 1CHOF 1O3BA 2C90B 3TIUA 3RXSA 2XC4A 1Y59T 1LKAA 1FDPA 4ISHH 2SGEE 4O97A 4O3TA 3ZZAA 2P94A 1NPMA 4OS6A 2FI3E 2GMTB 2A5IA 2ZKSA 2B7DH 4ABFA 1O3EA 1AKSB 3STJA 2B5TB 3T29A 1HUTH 1DX5M 3OU0A 1VR1H 2SGFE 1A2CH 2BXUH 3L6PA 3DA9B 3PTNA 3M61U 2ZDAH 4WXIA 1TABE 1C2HA 1GI9B 1Q3XA 3ZZ4A 1W3CA 1TNJA 2WPHS 3A83A 1F5KU 2VIOA 1MUEB 1GHVH 1T8LA 4X8VH 1W11U 1AN1E 2ZDNA 3S9BA 3M7TA 4CRFA 1LVOA 4BXSA 5EQSA 1DSUA 1UVSH 2RG3A 4FUDA 3HKJB 4JCNA 1W0ZU 2BD5A 1V2PT 1P2KA 3S9AA 4ZHMU 7GCHF 1O2LA 4K60A 1GWAA 2G00A 5LPEA 3QGNB 4A7IB 2AGGX 1J9CH 1G3EA 1SGIB 1Z8JB 1HNEE 5DKMA 2WV4A 5EW2H 3SNEA 5JB9S 1C2DA 2GT8A 1ZHRA 2BOHB 1S6FA 1MTVA 1HAOH 1P0SH 3GDUA 3ZZDA 3QZQA 1C2JA 5C20A 2PHBA 3L33A 4KELA 5PTPA 3ZZ6A 3GY6A 1GPZA 2AMDA 4AFSA 3U1IB 4ISOA 3VB3A 3MU4A 1G37A 1TPOA 1G2LA 1MBQA 1GJDB 3MMGA 1LDTT 2VVVA 1W0YH 2ZC9H 3U8TH 5IDKA 2BY7X 1NU9A 4ABAA 2G5VA 2C93B 3ZV9A 4XSKU 4ABJA 3A7XA 2G4TA 6CHAB 2F9OA 1XUJA 3IG6B 3UNRA 1P9UA 4A1XA 3U69H 2WPMS 4VGCC 2YNBA 5E0HA 1Z1JA 1CHGA 1BTYA 5A8ZA 1HJ8A 1TBRH 5JB8S 1D9IA 1K22H 3KEEA 1TX6A 1VITF 1ZGVA 3MU1A 2A31A 4ISLA 3A8AA 1FQ3A 1YF4A 2XBXA 1GCTB 1W8BH 2OTVA 1HAYB 4MNWA 2C3SA