3OY5U

The crystal structure of upa complex with peptide inhibitor mh027 at ph7.4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
247
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSATLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 55
structure length 246
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy5U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy5U01
1VCQA 5F8ZA 1C1WH 2J92A 3TK5A 1ZYOA 2HNTF 1AUJA 3RXFA 2H6MA 4KTCA 1NFYA 1CGJE 3VFEA 1WCZA 1P0SH 2WYJA 3VEQB 1E38B 3K9XB 4HFPB 2V6NA 1IAUA 1GHZA 1C2EA 2G8TA 1YF4A 3Q3YA 1GBDA 3QO6A 2ZKSA 3GY7A 2GCTC 1CA0B 2UWOA 2J94A 2IPHA 3PWBA 1XVMA 5IYTA 3B9FH 1P11E 4AFSA 1U6QA 1MKWK 2EC9H 2FODA 3QUMP 1BQYA 1MZAA 1C5NH 5EODA 4D8NA 2GZ9A 2ZHFH 4AORA 1ZGVA 2IOTA 1TRMA 3LKWA 2WUBA 1K22H 4RSPA 3E91A 2C4FH 2FYRA 3FZZA 1XUFA 1V2WT 3LU9B 4X8UH 1SGQE 1E35B 1GHBG 4R8TB 4WVPE 3H7TA 1K1LA 1GI1A 4NA7A 1Q3XA 1T8OA 1TIOA 5FX6A 3U8TH 1C5LH 2F9PA 4H6SB 1AO5A 1Q31A 1HNEE 3VB7A 1MTWA 1CA8B 8KME2 4K2YA 2A2XH 2FX6A 5JB9S 1EAWA 1RJXB 9ESTA 4VGCB 2QIQA 2FOEA 1ARCA 1G3DA 4J1YA 3KIDU 5GDSH 1H9IE 3SV9A 5CMXH 2AEIH 1O3FA 3BTWE 4BTIB 1XUGA 1S85A 1GBLA 1Y5UT 1O39A 3MNBA 3P92A 1J9CH 3KF2A 4BAMB 1VJ9U 5I25A 2FO9A 1SSXA 1GHYH 2SGFE 1OP0A 3BIVH 1FIWA 2BMGB 2FOHA 2HOBA 1EJAA 2FTMA 1ZPBA 3A82A 3ELAH 3MI4A 3S7KB 1IQLA 1W7GH 4K5ZA 1OYTH 4JZIA 1O35A 1SL3A 3EE0B 1ANCA 1FMGA 3SNDA 1DICA 2RA3A 1ORFA 3MH4A 1O2KA 2FEQH 3URCA 3PLBA 1C1QA 4RN6A 2J4IA 3ITIA 2VVCA 4MVNA 2Z3CA 2BQ7B 4IC5A 4NA9H 1EZUC 2Z3DA 4X2XA 2HALA 1LPZB 4ABIA 3UOPA 1V2OT 3K65B 3OX7U 1L2EA 1QRXA 2THFB 2FOGA 1SR5C 2GMTB 2XCNA 3L3TA 5FCRA 4ZXYH 5T6FA 1PFXC 2G4TA 4YZUA 2EA3A 1SGDE 4FUFA 1A3BH 2ZQ1A 5DP9A 4XDEA 4BANB 2NU2E 1GBCA 5HM2A 2ZF0H 3GCTF 1TYNA 2QC2A 1MTUA 3FP7E 1C1PA 4X2WA 1TOCB 1DPOA 3UNRA 1QRZA 3KQEA 4YTAA 4A1VA 1TQ0B 3CS0A 1AUTC 2ZGJA 2ILNA 4YOGA 4YT6H 5GCHF 2J95A 5A0CA 1F5RA 1F0UA 1O31A 3R3GB 1HIAB 1SGYE 1BTUA 3F1SB 1EP6A 1S82A 1MKXH 4JCNA 1UK4A 2OUAA 2ZFFH 1C2HA 2Z9LA 3GY8A 1SQAA 1XX9A 2OLGA 8GCHG 3UPEA 1DUAA 2FS8A 3QX5H 4AZ2B 1DXPA 1PYTD 1P2NA 1O2RA 1QA7A 2CHAC 3SOSA 2BVSH 1PYTC 3LPRA 1CT4E 3M37A 5L30H 1FY4A 4UFFH 2BLOA 1YCPK 5SGAE 5JDUB 1Z1JA 3E90B 1X7AC 3A86A 4UD9H 1GGDB 1FIZA 5E2OA 3M5OA 3I78A 3O8RA 1QIXB 1ZJKA 2BX4A 1TB6H 1AFQC 1DWDH 3UREA 1TPOA 1C5RA 3LGIA 3ENSB 2XXLA 3K6ZA 2FLRH 1DY8A 2C93B 3UNSA 1AKSB 1PQAA 3GDUA 1O2XA 2ZWLH 1LPKB 2OC1A 1QRWA 1V2QT 1TGBA 1O5EH 1RTFB 1LVMA 4NWLA 4Q7XA 1P2KA 1J8AA 1GMCG 1TGSZ 1TOMH 8ESTE 1O2MA 2Z3EA 2O9QA 4YESB 3VB6A 1C1VH 2A5KA 1AZZA 4NCYA 5C1UA 3GY4A 4UDWH 1GVKB 1F0RA 3VB3A 3RC6A 5E0JA 1P57B 3RDZA 1C5OH 2XC4A 2ZECA 3A84A 2PTNA 2XC0A 2ZFTA 1ESTA 3LOXA 3ZZ9A 2ZTXA 1GVZA 3ESTA 2BXTH 1UVPA 3NPSA 1W12U 3RXIA 1VJAU 3DHKH 2GTBA 3QK1A 1TQ7B 1FPHH 5EG4A 2C8WB 3E1XB 2P93A 3PROA 4CRAA 4MPXA 4NZLA 3PMHB 4GAWA 1SLWB 4NG9H 2ANKH 1RS0A 1ZHRA 2SGPE 3A80A 1L1NA 4UE7H 3TK6A 3RMLH 3JZ2B 2R0LA 1G2LA 2OC7A 1EATA 1MQ5A 1ZR0A 2AERH 4GCHG 1AVGH 4BAQB 1GHXH 2FM2A 2A7HA 2FXRA 1XUKA 2P94A 1GI7B 4XE4A 2NU0E 3VXFH 1MU8B 1F2SE 3GCHC 2JH6D 1IHTH 2P95A 3LJJA 3HK3B 4CHAB 1GI2A 1J15A 4I8KA 1G30B 1BMNH 3H5CB 2BHGA 1G3CA 7ESTE 5CHAB 1Y5AT 2A7CA 1P2QA 2A5AA 2UUJB 1VR1H 4K3JA 3LC3A 3M3TA 1F5LA 1G9IE 1JBUH 1YPEH 3T29A 1DT2A 1NS3A 4WH8A 2UUFB 2ZO3H 3A7ZA 4WMEA 1TBZH 4GLYA 4OGYA 1C9TA 4YLUA 5TJXA 3KN2A 2G00A 1GJ6A 1WOFA 1MKXK 1YLDA 1RRKA 3E0NB 1NRSH 1UK3A 1Y5BT 3F9FA 1L0ZA 1GMHG 1AVWA 1OKXA 2R2WU 1DSUA 3P6ZB 7LPRA 4O3UA 3LH3A 5HM9A 2FS9A 2P16A 5C2ZA 1ZRBA 5LGOA 1BRAA 1S0QA 1C5SA 1NN6A 1ELEE 5GJ4B 1EZXC 2A4RA 2A32A 3SNEA 4OGXA 5LPEA 1W7XH 3BTTE 4ABDA 2BOHB 4YO9A 5PTPA 1Z8GA 4Q2KA 1AB9C 2OBOA 5EQRA 1QURH 2R2MB 5LH8A 4H6TA 1UHBA 1TX6A 1O3HA 2A45B 1JRSA 1EQ9A 1ZMLA 1C2JA 2QF3A 2A1DB 2FESH 3GCOA 3GCTG 4Q7ZA 1K1MA 1T8NA 4I31A 3BTKE 2GDEH 3UWJH 3A8BA 2P3FH 2QY0B 2PKAB 2ZHWH 4KKDA 3VGCC 2HLCA 4UFDH 1NRRH 1O37A 2ULLA 3EA7A 4Y0YE 1C5VA 4SGAE 4I32A 4JZ1A 4ISLA 1H9HE 1V2LT 2BD9A 1XXDA 1V6DA 3TGIE 1D6RA 5C1XA 1TPAE 1C5UA 1YGCH 1O2LA 3A8CA 5ETXA 2WPKS 2W3KA 8GCHF 2V3OH 2ANMH 4CRBA 3BV9B 1Y8TA 1QFKH 3URDA 2D1JA 1SOZA 5AF9H 1QQ4A 4A7IB 1C2MA 1SHYA 3ZVGA 2ZA5A 3UNQA 3OY6U 2VIQA 4CHAC 4QT8C 1AE8H 1GCTB 2UUKB 3SBKA 3SO3A 3SU5A 1HAPH 1KIGH 1CVWH 1KTSB 4GPGA 2NWNA 3LDXH 1KTTB 1VITF 1OWEA 1UCYK 1AI8H 4NGAH 2VWMA 2ZFPH 1UVOA 1G32B 1O2TA 4AYYB 5GWZA 5JBAS 1IQGA 1M9UA 4OS2A 4Y79A 3NKKA 2ZU2A 4LK4A 2YNBA 3RXCA 3GISB 2FTLE 1KLIH 2D2DA 2TGAA 1WUNH 3FAOA 1DDJA 1ETRH 3G01A 3F6UH 1K1JA 1AZ8A 5JBCS 4THNH 1KDQA 1Y3XA 2O8LA 1QHRB 3EA8A 1KXBA 1LCYA 5JBTA 1NPMA 1K1OA 1SGCA 1N6XA 3MU8A 3RXGA 2Y81A 3I77A 2NU1E 5DGJA 4ZKRU 2J9NA 2YNAA 1A2CH 1TRNA 1QL9A 4D9QA 1O2NA 1ZGIA 1NM6A 1F0SA 2Z9IA 3V7TA 2RCEA 4X2VA 1Y3VA 2ZDAH 3Q76A 1P04A 1O3NA 1NFUA 2F9BH 5DPAA 2B9LA 1O3PB 2XRCA 1WQVH 1HAGE 2GKVE 2OCVB 2ZFRH 3LGTA 3RXAA 2VIWA 5HYOA 4AOQA 1LHCH 2PLXA 1YCPM 3GDVA 3S7HB 4LXBH 3SI4H 5E0GA 1PPFE 1GJAB 1BB0B 3B8JA 2Y5FA 3P70B 2Z9JA 2C3SA 1E36B 1CO7E 1C1RA 1HRTH 1HAZB 5DP6A 3LGUA 2BY5X 1G2MA 4WJG2 1K1PA 5C3NA 1D4PB 2PSXA 4KELA 1WTHD 2SGEE 3ATIA 3TPIZ 3VXEH 1Q2WA 1SFQB 4MNYA 3MH5A 4X1PU 4E05H 4NIXA 1N6YA 2QN5T 3SJ8A 1BDAA 1AIXH 5DP7A 2PV9B 1YPJH 3M61U 3KQBA 2GX4A 1LVYA 1O3JA 3A83A 1EX3A 5EU8A 1ELCA 3MU4A 3RM0H 1YPKH 3UQVA 1BTPA 3TGJE 1AWFH 4AFUA 1CT0E 2CGAA 1FZZA 1QQUA 1LQDB 5L2YH 3LH1A 1N8OB 1TNGA 1BMAA 4X6NA 5CHAC 2XYAA 1MD8A 3Q3XA 2PR3A 2XBWA 5HGGA 1OPHB 2WV4A 3U8RH 3CP7A 3L33A 1BA8B 5T6DA 5K7RA 2H2ZA 4FU7A 4X6PA 4IGDA 4KTUA 2BVRH 1G3EA 2CF8H 1GBBA 1QTFA 1TA6A 3UR9A 2ZZUH 3SUFA 1FNIA 3VB5A 1HXEH 1Y3YA 1CT2E 1QGFA 1E37B 1BBRE 2AGIX 2BY8X 1SGPE 1FONA 3MNXA 4AG1A 3GDSA 4HZHA 1GPZA 3D62A 5EPNA 2SGQE 1TNJA 2HRVA 1RIWB 3LJOA 1BUIA 3UQOA 1CGIE 4E06H 3KL6A 7GCHF 1SQOA 4FU9A 2QXJA 1F7ZA 1IQNA 3TITA 3UR6A 3MU1A 1GI8B 3LT3A 2G55A 1V3XA 2M5TA 4ISNA 4LOYH 4X2YA 4A92A 1GBAA 5L2ZH 1EAUA 5A0BA 1TABE 1DOJA 4JYTA 6LPRA 2F9OA 4FUEA 3SW2B 1EOLA 2G4UA 2Q6DA 1DE7H 5DJ7A 1BTZA 3GYMA 1D9IA 4MTBA 3FP8E 3A7WA 1HLTH 3A8DA 4NSYA 1CE5A 2Y80A 5A09A 2FOBA 2OINA 2Y82A 1TX8A 1YYY1 1G3BA 1DWEH 1TPPA 1GJCB 1CGHA 5A8XA 3V0XA 1NFXA 1UTQA 1WBGB 3ZYDA 4WH6A 3ZVEA 1FXYA 2VJ1A 4WWYA 2CF9H 1EOJA 1DFPA 3N7OA 3P17H 3BG8A 1MQ6A 3SHAH 1IQIA 1PPBH 1NESE 3Q77A 1EZSC 3QZQA 4ZAEA 3WY8A 3QLPH 4R0IA 4U2WA 2PGBB 1O3EA 5E8EH 3LGYA 3TH2H 3O8DA 4YM9A 1NO9H 1ELAA 4WF8A 4BTUB 1H8IH 1GBEA 2V35A 4AFZA 1EPTB 1QB6A 2XBVA 2FOAA 2GZ8A 4Y71A 3P8GA 5C5OA 1O3CA 2AYWA 1TPSA 2BDBA 4K1SA 2BDYA 3RMMH 1FUJA 3ZZAA 3ATLA 1XUIA 2OC8A 1GHWH 1UVUH 3MMGA 4CRCA 1TONA 5ABWA 1B5GH 2BOKA 2GZ7A 2LPRA 4NWKA 3A7XA 3LGWA 2Q1JA 4JYVH 2VIVA 4RKOB 4DT7B 2Y7ZA 3V3MA 3S9AA 1AQ7A 4XOJA 4FUJA 2ZGXH 1XUHA 5FHTA 1SMFE 2B0FA 2BD2A 1K21H 3SN8A 3A89A 1OWJA 4K8BA 3SI3H 4CRDA 5BRRE 3OU0A 5EXNA 4IN1A 2WPIS 1AKSA 3M5NA 2P3UB 1EUFA 2XWAA 1C4Y2 5EQQA 1A0JA 3K2UA 3KNXA 1TGTA 1TNIA 4INHA 2AGGX 2AMPA 2O8WA 1T7CA 2PKSC 1BTWA 1TALA 5L6NH 2F9NA 1WAYB 3P8OA 3SGAE 3VB4A 4B75A 2ZFQH 1P3EA 1SI5H 3DUXH 1BMLA 4LZ1H 1OWDA 2OTVA 1HAHH 2UWPA 2FIRH 4D7GA 3E8LA 2GV7A 1IQMA 4RKJB 1EJMA 2V0BA 1THPB 1VCWA 3ZV8A 2ALVA 2O8TA 2FI3E 3SU2A 2ZTZA 3TIUA 1B0FA 1ABJH 1ZZZA 4KP0A 1HIAA 1P02A 2FWWA 1V2PT 3TJUA 1H4WA 3RP2A 4AFQA 2XBXA 4Z0KA 2NU4E 1XVOA 4ZKSU 1P10A 5TCCA 1WV7H 3ZVAA 3T62A 2CMYA 4ABFA 1VGCB 2UUYA 3VPKA 4CRGA 3VGCB 1OS8A 1P9UA 2AMDA 1CSOE 2P8OB 4FVBA 3ZVCA 4CH2B 2PUQH 3RLYH 1ZTLA 4GCHF 2DUCA 3ZV9A 4OS6A 3A7TA 3RXVA 4I8GA 2OBQA 5FCKA 1ZLRA 3KEEA 3L6PA 1O5CB 5IDKA 5GCHG 1MTNB 1THSH 3SZNA 1P03A 1L4DA 1GDQA 3CENA 2ZI2H 3GYLB 1PPGE 2FLBH 2ZP0H 1P2MA 1GBFA 3AAUA 4Y6DA 1A5GH 1KXDA 1O2UA 2XBYA 4X1NU 4MLFB 2FX4A 1QL8A 5J4SA 5CE1A 1O2JA 1T31A 1GCTC 2PKSB 3KHVA 2HPPH 3SGQE 1ELBA 3AW0A 4BXWA 3ATMA 5C1YA 1EP5A 2YOLA 4BAKB 1IHSH 2GCHF 3EAJA 4AG2A 1Z8RA 3M7UA 1ZPZA 1MCVA 7GCHG 1TNKA 4I33A 1O2VA 1RGQA 2VINA 3LIWA 2GT7A 1ESBA 1ZSLA 2B8OH 2K1QA 4O9VA 1S83A 1O3MA 3S9BA 2ZGBH 3RXRA 1ZHMA 1ARBA 2ZDKA 1K9OE 4K1EA 2PTCE 3GY6A 2WPJS 4DURA 4DW2U 3A8AA 2AH4X 4IMQA 1T8LA 2AS9A 3R0FA 2IN2A 4B73A 4Y8ZA 1HAXB 3EQ0H 1GJ5H 1GI5A 4FVDA 1O30A 1ZTKA 1H9LB 2B5TB 3OSYA 3GY3A 3DA9B 4XFQA 1BT7A 1HV7A 2H9TH 4WY3A 1XKAC 1UHBB 3E0PB 1Z71A 3TH4H 2PFEA 4AB8A 2W7SA 1WU1A 4I7YH 1LKBA 1O2IA 3ZZ3A 1OSSA 3KQDA 1IQJA 1GI3A 4JZFH 4B76A 3TLOA 4X8SH 4Z6AH 3DFJA 1D6WA 2ZPRA 1SBWA 4X6OA 2P3TB 2BVXH 3FANA 1YPHC 1C1OA 1ZPCA 1JIMA 3NXPA 2GCHG 1GG6C 2GV6A 2PHBA 1P8VC 1T4UH 4K1TA 1GL0E 4B2BA 1RTLA 2GGVB 3QTOH 2J34A 1SGRE 2TGPZ 1YLCA 2BDCA 1P2IA 1AD8H 1SGIB 1OWIA 3SJOA 3E16B 3C27B 5C5NA 2JKHA 1OYQA 2R3YA 2H9HA 4Q80A 3IITA 3PV4A 2CV3A 3KCGH 3SQEE 1MBQA 1CHOG 1NU9A 1ZHPA 1MTVA 5ESTE 1D3TB 2ZFSA 3M35A 3F9EA 3SU0A 1KSNA 4D7FA 1GG6B 1QNJA 3PMAB 1Z7KA 2XNIA 4GSOA 3SJKA 2V3HH 1GI6A 5DKMA 1N8OC 2C90B 2GP9B 2QXHA 3RMNH 4MPVA 2PUXB 1O3AA 3BG4C 1C2LA 5ESBA 1BHXF 4IS5A 1QBOA 3RC4A 1O2WA 1S81A 1C1TA 4NSVA 5JPMH 1ANDA 1C1NA 2AMQA 1V2UT 1CHGA 1UTPA 2VB0A 4INKA 3M3SA 1Z1IA 1GBTA 2Z94A 3GCNA 1AFQB 4XBDA 1DANH 2Z9KA 4MNXA 3PMJA 5T6GA 1PQ7A 2BDHA 1LQEA 4WMFA 1KY9A 1WYKA 1TX7A 1CU1A 3D65E 3M3VA 2ESTE 4VGCC 1BOQA 2ZU5A 3GY2A 4X6MA 2BD5A 2C8ZB 2BZAA 3A7YA 4MG3A 2Q6GA 1LO6A 1WQSA 4DGJA 1HB0B 1C5WB 4ZKNU 2TBSA 3MO6A 3RLWH 4Y8YA 1D3DB 1MMJN 1HPGA 3IWMA 5FX5A 3BTGE 1W0ZU 3AVZA 5DP3A 4MQAA 1FQ3A 3RC5A 4NFEA 3LONA 1GJDB 1LHFH 5DK1A 5FBIA 1A0LA 3MYWA 3V13A 4O97A 2O8MA 1HAVA 3TJNA 2D8WA 1A61H 4OS4A 1O2HA 2CXVA 3PLPA 3ATWA 2KAIA 1EASA 1AGJA 4NZQA 1C4U2 1QR3E 2HNTE 1XKBC 1TAWA 1UVTH 1INCA 1C2DA 2DE9A 4MPUA 2BY6X 2H1UA 1NU7B 1ELFA 4YLQH 2G52A 2ZDLA 1GWAA 3BTDE 3C1KA 5GXPA 3STJA 1SB1H 1Z8IB 2JH5D 2A2QH 1VZQH 1KDQB 2WV5A 3ZVDA 1O2YA 1O2QA 1KLTA 2BTCE 1DVAH 1C9PA 3FVFB 1G36A 1C5YB 1Z8JB 1HJ9A 1V2MT 3T26A 1GCDA 1E34B 2XWBI 4SGBE 4UONA 1LTOA 2Y5HA 2A5IA 1BTXA 4NIVA 1P9SA 4ISOA 1HAVB 3QWCH 1SLUB 2QA9E 4XBCA 3U98H 1BZXE 4I8LA 4DG4A 3BTEE 3MU5A 6CHAC 3A81A 2XC5A 4A6LA 4B2CA 1BTYA 1OWHA 1MAYA 1QBNA 5TCAA 2G5VA 1DUEA 3HPTB 1DLEA 5J4QA 1O34A 4CR9A 2A4OA 1NY22 1TLDA 4Y11E 1MCTA 3UTUH 1QJ6B 1O3IA 1GBIA 1YPHE 1GGDC 5C20A 1O38A 4DOQA 1FJSA 2GVFA 1NT1A 1MUEB 3SNCA 2H9EH 4BXSA 3O8CA 1YBWA 3MNCA 3D49H 3DT0H 4ZROA 4NIWA 4K8YA 1C5ZB 3HGPA 2CHAB 1D3PB 4X1RU 1F92A 2ODQA 3SGBE 1BBRK 3M7QA 4JK6A 1O3DA 6CHAB 4ASHA 1GJ9B 1EAIA 5DP8A 2A0QB 4X8TH 1DS2E 1SGTA 3PYHA 4TY7A 5LPFA 2G81E 2ZG0H 1EXFA 3BTQE 4TY6A 2VIDA 3T5FH 2QAAA 4TPYA 1GI0A 1BBRH 5DP5A 1SLXB 2VU8E 3EA9A 1ANEA 2WUCA 2EI7A 2JETC 2HNTC 1V2JT 1EAXA 3UY9A 1HJAB 1DXWA 2OXSA 1TGCA 4ISIH 3SUEA 1FN6A 1O33A 2OC0A 3MH6A 3UIRA 2QV1A 2BY7X 1SOTA 3SHCH 1PPEE 1S6FA 1V2VT 2BB4A 4IMZA 3RXEA 4BAHB 4YT7H 5A8YA 2Y6TA 3ATKA 2TGTA 1HJAC 1ZMNA 2STAE 1TRYA 1V2TT 5HXFA 1UMAH 3HKIB 3RXDA 1AU8A 3IG6B 1C1MA 3ZZDA 2FDAA 1C2GA 1VCPA 2QGRA 2W5EA 4DVAU 2QF0A 1FAXA 3UFAA 1L1GA 1H8DH 1K1NA 1W13U 1TBQH 3SU4A 3BIUH 3RXOA 2A4GA 1BTHH 3ZZ7A 2TRMA 6ESTA 1W0YH 2HVXA 3PLKA 3RMOH 2BZ6H 4GHTA 3PWCA 4ZHAA 2VWLA 1XXFA 1SFIA 1FN8A 3MNSA 2SNVA 4Y7AA 1O32A 2EEKA 3A88A 4F4OC 1S6HA 5LPRA 1GHBF 1CQQA 3QN7A 4B1TA 2HPQH 1KXCA 4A1XA 2VH6A 2RA0A 4FUIA 1TMTH 4TPIZ 3PO1C 3RXSA 3SNAA 3QDZB 1GDNA 1TGNA 5F8TA 5GIBA 3S69A 2OQ5A 2J38A 1WTGH 1HUTH 2Z6BD 4Y76A 3TVJB 1GJ7B 1TNHA 3ZZBA 1MU6B 2G51A 1MKWH 4AB9A 2ZC9H 2SNWA 2NU3E 3RU4D 1MAXA 2BD7A 3T25A 1P01A 1QCPA 2A7JA 5FBEA 4LZ4B 1T4VH 4WMDA 2GMTC 1J16A 2LNCA 1TMUH 3RXHA 4Y10E 1HGTH 3DD2H 2CN0H 1O5FH 1T8MA 4DY7B 2Z9GA 2ZCLP 1SLVB 1UVSH 1O3BA 1RIWC 1UTOA 1V2RT 4D76A 1YPMH 4GUXA 3MHWU 3PM3A 1GL1A 1V2NT 2WPHS 1AVXA 4CREA 3SV6A 4NIYA 4K69A 1GMDG 3HK6B 2F3CE 1GMCF 2VWOA 1KXEA 1ETSH 1J14A 3JZ1B 3F9GA 3NUMA 1SG8B 2GCTB 3LGVA 5DG6A 2GT8A 3F68H 2ZTYA 3FZDA 1EZQA 2RDLA 3RXQA 4DIIH 1FPCH 1IQHA 1LKAA 4B2AA 1LHGH 2ZQ2A 4JK5A 1GHAF 3BEIB 1PPZA 1FY5A 4IN2A 4O03A 4OS1A 3SU6A 5FAHA 1YC0A 3MH7A 1BRUP 1B7XB 1O5GH 3SU3A 1BJUA 1L4ZA 2XW9A 1IQEA 4OS5A 4ZHMU 1JIRA 3F9HA 1DX5M 4HI3A 2GD4B 1ZRKA 2XCFA 1A5IA 5H4IB 1W8BH 2FI4E 1GJ4H 1ID5H 4IC6A 1O2ZA 2FPZA 5EW1H 1SGNE 2JH0D 3RXTA 1FY8E 1F0TA 3KGPA 3EGKH 4NFFA 1YPGH 2FOCA 1ANBA 4X1QU 2VVUA 4DIHH 3BG4B 3U1IB 1P09A 1C1SA 3ZYEA 1K1IA 1QA0A 1YCPH 3GOVB 4U32A 3MFJA 4AYVB 1GMDF 5E0HA 2EI8A 3SORA 2FOFA 2BD3A 4FUHA 1UTLM 1C5TA 4MDSA 4Y7BA 1D3QB 1UK2A 4B74A 5EOKA 4KGAA 3QGNB 1NRPH 1P2JA 5F03A 3RU4T 1Y3UA 4J2YB 1W10U 3S9CA 1IQFA 1GVLA 4H4FA 4BOHA 1C5MD 1FDPA 4JMYA 4TWYA 1P2OA 3ZZ5A 3MO3A 2BDAA 2F9VA 2PWXA 2BM2A 4MNWA 1HDTH 1QY6A 4IBLH 3HGNA 4CBNA 1SGFG 1LVOA 1AHTH 2G5NA 4KTSA 2C8YB 3GICB 3OY5U 1YM0A 3W95A 3BTFE 5FPTA 1THRH 2QYIA 3RXJA 1UO6A 4FUCA 2VH0A 2RG3A 3CS7A 1LHDH 3QGJA 1BHXB 1PQ8A 3EDXB 2W26A 1GI9B 1O3LA 2PGQB 2BXUH 4WXVA 4Y8XA 1SC8U 1KXFA 1ELGA 2ALPA 3T2NA 1CHOF 2AFQB 2WINI 1SPJA 3H7OA 4FUGA 4ZH8A 5DP4A 7KMEH 1AFEH 1XUJA 1QBVH 4M7GA 1QL7A 5B6OA 2F83A 2FP7B 1GBHA 2C8XB 1A7SA 1A1RA 1LHEH 4UFGH 5AFZH 1DY9A 5EQSA 3BF6H 2TIOA 3RUOA 4FXGH 3RXUA 1QJ7B 3RXKA 1NROH 3DFLA 1MTSA 1QB1A 2F91A 1SGEE 4TYDA 5AFYH 3SNBA 1HAIH 1UTNA 2ZU1A 1Z6EA 4CR5A 3UOUA 1FY1A 1OP8A 2ZHEH 4Q7YA 1P06A 2Y5GA 5GPIB 2ZDNA 1P05A 4HGCA 1GBJA 1V2KT 9LPRA 3BEFB 4BTTB 1DM4B 1JOUB 4ESTE 3BTME 3NWUA 4AX9H 4A5TS 3U69H 2ZGCA 3T27A 1NZQH 1W2KH 1ZJDA 4AN7A 2VIOA 5K0HA 1O0DH 4FUDA 3BTHE 3EYDA 1AY6H 4IW4E 1HAOH 2P59A 2BLQA 1PPHE 1UTMA 4ABJA 1CBWB 1O3OA 2AGEX 3GY5A 5A8ZA 2H5DA 3LC5A 1O3KA 3ZZ4A 1LPGB 3UUZA 1GJBB 1O2GH 3E3TA 1PJPA 4JYUH 1FAKH 5FXLA 3I29A 2BQ6B 3RXLA 1HBTH 3RXPA 1ABIH 1T32A 3TJVA 3FP6E 2ZCHP 4OS7A 1W11U 5EXMA 2O8UA 4NA8A 1C5QA 1DLKB 1OP2A 2WYGA 2SFAA 3NZIA 4UFEH 3O8BA 2VVVA 1ELTA 2ZCKP 5HMAA 4FU8A 1RTKA 3AAVA 4I8JA 4JZDH 5A2MH 1K28D 2VGCC 2ASUB 1O36A 1GI4A 2FZZA 3HKJB 1FY3A 1DWBH 5JBBS 2BLWA 1IQKA 3ZZ6A 2QXIA 5BPEA 3S0NA 1HFDA 3ODFA 4ZMAH 3M5LA 1GJ8B 1DITH 1SGFA 3ZZ8A 3P95A 2IJOB 1GHVH 1O2SA 1PPCE 1WSSH 3SV7A 2R9PA 2Q6FA 2BDIA 1EKBB 1MZDA 1CA0C 4ABHA 2FI5E 2BLVA 1HJ8A 4UEHH 1GHAG 1TE0A 5JYIA 1S0RA 1BIOA 3TNSA 1ZSKA 1SHHB 1E0FD 3MO9A 1AE5A 4K60A 1Y59T 2ANWA 4BAOB 1MTNC 3PMBB 2OP9A 5EGMA 1MD7A 3T28A 3GCHB 2ODPA 1C1UH 1W3CA 3OTJE 3TNTA 3A85A 4ABBA 1EJNA 1K2I1 1QJ1B 3QZRA 4FUBA 3KQCA 4INLA 1O5DH 1TA2A 3SJ9A 1GDUA 2P8OC 3M36A 5JB8S 1KLJH 1VGCC 4GHQA 4X0WU 3PTNA 1FLEE 3SQHE 2DE8A 1OXGA 5EPYA 2Y7XA 1EB2A 1S5SA 2ZPQA 3RU4E 4I8HA 4TWWA 3TJOA 5FPYA 1EB1H 1SVPA 1FI8A 2QCYA 2BQWB 2PKAA 1TNLA 4F49A 1OWKA 3Q00A 1KYNA 3SV8A 2PW8H 3SUGA 1Z6JH 4ZHLU 1YP9A 4CRFA 2Z7FE 3TU7H 2VWNA 1NRQH 3RM2H 1O2PA 3NK8A 3A7VA 3Q3KA 3NCLA 1PQ5A 1DSTA 2CJIA 2GDDA 4E7RG 1ZOMA 1NC6A 2STBE 2ZPSA 5F8XA 3TK9A 1TWXB 1RD3B 1UCYH 4PROA 1SQTA 4DJZB 2SGDE 1BCUH 1JMOH 4AGJA 4YOJA 1BMMH 1TMBH 1GBMA 1HAYB 2B7DH 5T3HA 2HGTH 1ZSJA 1LMWB 2ZU4A 4X1SU 4DCDA 1ACBE 1C5XB 2R3UA 2A31A 1P12E 1VITH 3BEUA 3PO1B 4U30A 3M5MA 1O3GA 1NRNH 4ABEA 5F6MA 3U9AH 4ABGA 3AASA 4X8VH 1C4V2 4HTCH 2I6SA 1TBRH 2BDGA 2H5CA 1DWCH 3MU0A 1BITA 1LDTT 4ISHH 4ZUHA 3V12A 1C5PA 2ZDVH 4CBOA 4D9RA 3HATH 1FV9A 1OX1A 1IOEA 1AB9B 1YPLH 2PSYA 1UTJA 4O3TA 1GMHF 3BN9A 4ABAA 2AIQA 2VIPA 3MOCA 3TGKE 2VGCB 3U8OH 2AIPA 5AVDA 5FPSA 4JZEH 2JETB 1G37A 2ZHDA 3QTVH 2OQUA 1A3EH 1ESAA 3ZVBA 3P8FA 1L1JA 2BD8A 2XTTB 2TGDA 1YKTA 5I46H 1O5AB 3UWIA 1GBKA 4YOIA 5G4BA 1NTPA 3PTBA 3U1JB 1XM1A 2F9UA 3SJIA 2W7UA 1TFXA 5C67A 1HCGA 3E6PH 4GVUA 1A5HA 2FYQA 3ZVFA 2ZHQH 1AWHB 1HYLA 3MWIU 2ODYB 1W14U 1ELVA 1ETTH 1O5BB 1C2IA 3PB1E 3MTYA 5E2PA 6GCHG 5AHGH 2ZEBA 1A4WH 5EW2H 1AN1E 2R0KA 1UTKA 3BSQA 3RXMA 3SU1A 1ELDE 5A0AE 3SUDA 2EI6A 2BY9X 4E7NA 3K6YA 1VITG 1B0EA 1EPTC 5EXLA 1EPTA 3M7TA 2D26C 3OYPA 3A87A 2FMJA 1N1LA 4H42U 1NFWA 4Y0ZE 1UCYE 4XSKU 1BRCE 1CBWC 2BX3A 2I6QA 2UWLA 1S84A 1KXAA 1AMHA 1LVBA 1UJ1A 1C2KA 4MNVA 3D23A 1JXPA 2SGAA 1MBMA 1Y3WA 4AGKA 1V2ST 3B23B 3RXBA 4ZKOU 2WPMS 4B71A 2ANYA 2ZIQH 3AW1A 5DO4H 1F5KU 1C2FA 1H1BA 2BD4A 2TPIZ 2ZDMA 1BRBE 2WPLS 1HXFH 2ZU3A 1XMNB 2FOMB 1ZMJA 2ZNKH 3ODDA 2VNTA 2A4QA 1A0HB 2OD3B 4U01A 1MH0A 1O2OA 1QB9A 6GCHF 1ZTJA 4A1TA 2QXGA 1OOKB 1A46H 2BYAX 4ZXXH 3ZZCA 4CH8B 1RFNA 3P8NA 4BNRA 2HWLB 3FFGA 1J17T 3SV2H 3STIA 1JRTA 8LPRA 2J2UA 2KAIB 4MPWA 1JWTA 1RXPA 1BJVA 2ZGHA 4XBBA 3TH3H 4WXIA 3W94A 2W3IA 1P3CA
chains in the Genus database with same CATH superfamily
1VCQA 5F8ZA 1C1WH 2J92A 3TK5A 1ZYOA 2HNTF 1AUJA 3RXFA 2H6MA 4KTCA 1NFYA 1CGJE 3VFEA 1WCZA 1P0SH 1H8HD 2WYJA 3VEQB 1E38B 3K9XB 4HFPB 2V6NA 5B6LA 1IAUA 1GHZA 1C2EA 2G8TA 1YF4A 3Q3YA 1GBDA 3QO6A 3WWBA 2ZKSA 3GY7A 2GCTC 1CA0B 2UWOA 2J94A 1SQRA 2IPHA 3PWBA 1XVMA 1W0JD 5IYTA 3B9FH 1P11E 4AFSA 1U6QA 1MKWK 3UB0A 2EC9H 2FODA 3QUMP 4RI0A 1BQYA 1MZAA 1C5NH 5EODA 4D8NA 2GZ9A 2ZHFH 4AORA 1ZGVA 2IOTA 1TRMA 3LKWA 2WUBA 1K22H 4RSPA 3E91A 2C4FH 2FYRA 3FZZA 1XUFA 1V2WT 3LU9B 4X8UH 1SGQE 1E35B 1GHBG 4R8TB 4WVPE 3H7TA 1K1LA 1GI1A 4NA7A 1Q3XA 1T8OA 1TIOA 4Q4LA 5FX6A 3U8TH 1C5LH 2F9PA 4H6SB 1AO5A 1Q31A 1HNEE 3VB7A 1MTWA 1CA8B 8KME2 4K2YA 2A2XH 2FX6A 5JB9S 1EAWA 1RJXB 9ESTA 4VGCB 2QIQA 2FOEA 1ARCA 1G3DA 4J1YA 3KIDU 5GDSH 1H9IE 3SV9A 5CMXH 2AEIH 1O3FA 3BTWE 4BTIB 1XUGA 1S85A 1GBLA 1Y5UT 1O39A 3MNBA 3P92A 1J9CH 3KF2A 4BAMB 1VJ9U 5I25A 2FO9A 1SSXA 1GHYH 2SGFE 1OP0A 3BIVH 1FIWA 2BMGB 2FOHA 2HOBA 1EJAA 2FTMA 1ZPBA 3A82A 3ELAH 3MI4A 3S7KB 1IQLA 1W7GH 4K5ZA 1OYTH 4JZIA 1O35A 1SL3A 3EE0B 1ANCA 1FMGA 3SNDA 1DICA 2RA3A 1ORFA 3MH4A 1O2KA 2FEQH 3URCA 3PLBA 1C1QA 4RN6A 2J4IA 3ITIA 2VVCA 4MVNA 2Z3CA 2BQ7B 4IC5A 4NA9H 1EZUC 2Z3DA 4X2XA 3DSOA 2HALA 1LPZB 4ABIA 3UOPA 1V2OT 3K65B 3OX7U 1L2EA 2J5UA 1QRXA 2THFB 2FOGA 1SR5C 2GMTB 2XCNA 3L3TA 5FCRA 4ZXYH 5T6FA 1PFXC 2G4TA 4YZUA 2EA3A 1SGDE 4FUFA 2QF5A 1A3BH 2ZQ1A 5DP9A 4XDEA 4BANB 1FX0B 2NU2E 1GBCA 5HM2A 2ZF0H 3GCTF 1TYNA 2QC2A 1MTUA 3FP7E 1C1PA 4RT1A 4X2WA 1TOCB 1DPOA 3UNRA 1QRZA 3KQEA 4YTAA 4A1VA 1TQ0B 3CS0A 1AUTC 2ZGJA 2ILNA 4YOGA 4YT6H 5GCHF 2J95A 5A0CA 1F5RA 1F0UA 1O31A 3R3GB 1HIAB 1SGYE 1BTUA 3F1SB 1EP6A 1S82A 1MKXH 4JCNA 1E79D 1UK4A 2OUAA 2ZFFH 1C2HA 2Z9LA 3GY8A 1SQAA 1XX9A 2OLGA 8GCHG 3UPEA 2JDID 1DUAA 2FS8A 3QX5H 4AZ2B 1DXPA 1PYTD 1P2NA 1O2RA 1QA7A 2CHAC 3SOSA 2BVSH 1PYTC 3LPRA 1CT4E 3M37A 5L30H 1FY4A 4UFFH 2BLOA 1YCPK 5SGAE 5JDUB 1Z1JA 3E90B 1X7AC 3A86A 4UD9H 1GGDB 1FIZA 5E2OA 3M5OA 3I78A 3O8RA 1QIXB 1ZJKA 2BX4A 1TB6H 1AFQC 3N7DA 1DWDH 3UREA 3AK5A 1TPOA 1C5RA 3LGIA 3ENSB 2XXLA 3K6ZA 2FLRH 1DY8A 2C93B 3UNSA 1AKSB 1PQAA 3GDUA 1O2XA 2ZWLH 1LPKB 2OC1A 1QRWA 1V2QT 1TGBA 1O5EH 1RTFB 1LVMA 4NWLA 4Q7XA 1P2KA 1J8AA 1GMCG 1TGSZ 1TOMH 8ESTE 1O2MA 2Z3EA 2O9QA 4YESB 3VB6A 1C1VH 2A5KA 1AZZA 4NCYA 5C1UA 3GY4A 4UDWH 1GVKB 1F0RA 3VB3A 3RC6A 5E0JA 1P57B 3RDZA 1C5OH 2XC4A 2ZECA 3A84A 2PTNA 2XC0A 2ZFTA 4ZCNA 1ESTA 3LOXA 3ZZ9A 2ZTXA 1GVZA 3ESTA 2BXTH 1UVPA 3NPSA 1W12U 3RXIA 1VJAU 4XRNA 3DHKH 2GTBA 3QK1A 1TQ7B 1FPHH 5EG4A 2C8WB 3E1XB 2P93A 3PROA 4CRAA 4MPXA 4NZLA 3PMHB 4GAWA 1SLWB 4NG9H 2ANKH 1RS0A 1ZHRA 2SGPE 3A80A 1L1NA 4UE7H 3TK6A 3RMLH 2KZ4A 3JZ2B 2R0LA 1G2LA 2OC7A 1EATA 1MQ5A 1ZR0A 2AERH 4GCHG 1AVGH 4BAQB 1GHXH 2FM2A 2A7HA 2FXRA 1XUKA 2P94A 1GI7B 4XE4A 2NU0E 3VXFH 1MU8B 1F2SE 3GCHC 2JH6D 1IHTH 2P95A 3VG8A 3LJJA 3HK3B 4CHAB 1GI2A 1J15A 4I8KA 1G30B 1BMNH 3H5CB 2BHGA 1G3CA 7ESTE 5CHAB 1Y5AT 2A7CA 1P2QA 2A5AA 2UUJB 1VR1H 4K3JA 3LC3A 3M3TA 1F5LA 1G9IE 1JBUH 1YPEH 3T29A 1DT2A 1NS3A 4WH8A 2UUFB 2ZO3H 3A7ZA 4WMEA 1TBZH 4GLYA 4OGYA 1C9TA 4YLUA 2J97A 5TJXA 3KN2A 2G00A 1GJ6A 3UAIC 1WOFA 1MKXK 1YLDA 1RRKA 3E0NB 1NRSH 3SZEA 1UK3A 1Y5BT 3F9FA 1L0ZA 1GMHG 1AVWA 1OKXA 2R2WU 1DSUA 3P6ZB 7LPRA 4O3UA 3LH3A 5HM9A 2FS9A 2WZQA 2P16A 5C2ZA 1WDIA 1ZRBA 5LGOA 1BRAA 1S0QA 1C5SA 1NN6A 1ELEE 5GJ4B 1EZXC 2A4RA 2A32A 3SNEA 4OGXA 5LPEA 1W7XH 3BTTE 4ABDA 2BOHB 4YO9A 5PTPA 1Z8GA 4Q2KA 1AB9C 2OBOA 5EQRA 1QURH 4OM9A 2R2MB 5LH8A 4H6TA 1UHBA 1TX6A 1O3HA 2A45B 1JRSA 1EQ9A 1ZMLA 1C2JA 2QF3A 2A1DB 2FESH 3GCOA 2L74A 3GCTG 4Q7ZA 1K1MA 1T8NA 4I31A 3BTKE 2GDEH 3UWJH 3A8BA 2P3FH 2QY0B 2PKAB 2ZHWH 4KKDA 3VGCC 2HLCA 2LP6A 4UFDH 1NRRH 1O37A 2ULLA 3EA7A 4Y0YE 1C5VA 4SGAE 4I32A 4JZ1A 4ISLA 1H9HE 1V2LT 2BD9A 1XXDA 1V6DA 3TGIE 1D6RA 5C1XA 1TPAE 1C5UA 1YGCH 1O2LA 3A8CA 5ETXA 2WPKS 2W3KA 8GCHF 2V3OH 2ANMH 3KYFA 4CRBA 3BV9B 1Y8TA 1QFKH 3URDA 2D1JA 1SOZA 5AF9H 1QQ4A 4A7IB 1C2MA 1SHYA 3ZVGA 2ZA5A 3UNQA 3OY6U 2VIQA 4CHAC 2V3MA 4QT8C 1AE8H 1GCTB 2UUKB 3SBKA 3SO3A 3SU5A 1HAPH 1KIGH 1CVWH 1KTSB 4GPGA 2NWNA 3LDXH 1KTTB 1VITF 1OWEA 1UCYK 1AI8H 4NGAH 2VWMA 2ZFPH 1UVOA 1G32B 1O2TA 4ASUD 4AYYB 5GWZA 5JBAS 1IQGA 1M9UA 4OS2A 4Y79A 3NKKA 2ZU2A 4LK4A 2YNBA 3RXCA 3GISB 2FTLE 4DT4A 1KLIH 2D2DA 2TGAA 1WUNH 3FAOA 1DDJA 1ETRH 1MABB 3G01A 3F6UH 1K1JA 1AZ8A 5JBCS 4THNH 1KDQA 1Y3XA 2O8LA 1QHRB 3EA8A 1KXBA 5HKKD 1LCYA 5JBTA 1YLNA 1NPMA 1K1OA 1SGCA 1N6XA 3MU8A 3RXGA 2Y81A 1WXRA 3I77A 2NU1E 5DGJA 4ZKRU 2J9NA 2YNAA 4P02A 1A2CH 1TRNA 1QL9A 4D9QA 1O2NA 1ZGIA 1NM6A 1F0SA 2Z9IA 3V7TA 2RCEA 4X2VA 1Y3VA 5F53A 2ZDAH 3Q76A 1P04A 1O3NA 1NFUA 2F9BH 5DPAA 2B9LA 1O3PB 2XRCA 1WQVH 1HAGE 2GKVE 2OCVB 2ZFRH 3LGTA 3RXAA 2VIWA 5HYOA 4AOQA 1LHCH 2PLXA 1YCPM 3F3BA 3GDVA 3S7HB 4LXBH 3SI4H 5E0GA 1PPFE 1GJAB 1BB0B 3B8JA 2Y5FA 3P70B 2Z9JA 2C3SA 1E36B 1CO7E 1C1RA 1HRTH 1HAZB 5DP6A 3LGUA 2BY5X 1G2MA 4WJG2 1K1PA 5C3NA 1D4PB 2PSXA 4KELA 1WTHD 2SGEE 3ATIA 3TPIZ 3VXEH 1Q2WA 1SFQB 4MNYA 3MH5A 4X1PU 4E05H 4NIXA 1N6YA 2QN5T 3SJ8A 1BDAA 1AIXH 2W6ID 5DP7A 2PV9B 1YPJH 3M61U 3KQBA 2GX4A 1OHHD 2WSSD 1LVYA 1O3JA 3A83A 1EX3A 5EU8A 1ELCA 3MU4A 3RM0H 1YPKH 5DSFA 3UQVA 1BTPA 3TGJE 1AWFH 4AFUA 1CT0E 2CGAA 1FZZA 1QQUA 1LQDB 5L2YH 3LH1A 1N8OB 1TNGA 1BMAA 4X6NA 5CHAC 2XYAA 1MD8A 2KX4A 3Q3XA 2PR3A 2XBWA 3U28C 5HGGA 1OPHB 2WV4A 3U8RH 3CP7A 3L33A 1BA8B 5T6DA 5K7RA 2H2ZA 4HG6A 4B6EA 5EJZA 4FU7A 4X6PA 4IGDA 4KTUA 2BVRH 1G3EA 2CF8H 1GBBA 1QTFA 1TA6A 2KR7A 3UR9A 2ZZUH 3SUFA 1FNIA 3VB5A 1HXEH 1Y3YA 1CT2E 1QGFA 1E37B 1BBRE 2AGIX 1E1RD 2BY8X 1SGPE 1FONA 2JJ2D 3MNXA 4AG1A 3GDSA 4HZHA 1GPZA 3D62A 5EPNA 2SGQE 1TNJA 2HRVA 1RIWB 3LJOA 1BUIA 3UQOA 1CGIE 4E06H 3KL6A 7GCHF 1SQOA 4FU9A 2QXJA 1F7ZA 1IQNA 3TITA 3UR6A 3MU1A 1GI8B 3LT3A 2G55A 1V3XA 2M5TA 2KM0A 2L6OA 4ISNA 4LOYH 4X2YA 4A92A 1GBAA 5L2ZH 1EAUA 5A0BA 1TABE 1DOJA 4JYTA 6LPRA 2F9OA 4FUEA 3SW2B 1EOLA 2G4UA 3W1EA 2Q6DA 1DE7H 5DJ7A 1BTZA 3DSPA 3GYMA 1D9IA 4MTBA 3FP8E 3A7WA 1HLTH 3A8DA 4NSYA 1CE5A 2Y80A 5A09A 2FOBA 2OINA 2Y82A 1TX8A 1YYY1 1G3BA 1DWEH 1TPPA 1GJCB 1CGHA 5A8XA 3V0XA 1NFXA 1UTQA 1WBGB 3ZYDA 4WH6A 3ZVEA 1FXYA 2VJ1A 4WWYA 2CF9H 1EOJA 1DFPA 3N7OA 3P17H 3BG8A 1MQ6A 3SHAH 1IQIA 1PPBH 1NESE 3Q77A 1EZSC 3QZQA 4ZAEA 3WY8A 3QLPH 1K0HA 3OE7D 4R0IA 4U2WA 2PGBB 1O3EA 5E8EH 3LGYA 3TH2H 5CDFE 5C0UA 3O8DA 4YM9A 1NO9H 1ELAA 4WF8A 4BTUB 1H8IH 1GBEA 2V35A 4AFZA 1EPTB 1QB6A 2XBVA 2FOAA 2GZ8A 3OFND 3P8GA 4Y71A 5C5OA 1O3CA 2AYWA 1TPSA 2BDBA 4K1SA 2BDYA 3RMMH 1FUJA 3ZZAA 3ATLA 1XUIA 2OC8A 1GHWH 1UVUH 3MMGA 4CRCA 1TONA 5ABWA 1B5GH 2BOKA 1SKYE 2GZ7A 2LPRA 4NWKA 3A7XA 3LGWA 2Q1JA 4JYVH 2VIVA 4RKOB 4DT7B 5C0TA 2Y7ZA 3V3MA 3S9AA 1AQ7A 2HLDD 4XOJA 4FUJA 2ZGXH 1XUHA 5FHTA 1SMFE 2B0FA 2BD2A 1K21H 3SN8A 3A89A 1OWJA 4K8BA 3SI3H 4CRDA 5BRRE 3OU0A 5EXNA 4IN1A 2WPIS 1AKSA 3M5NA 2P3UB 1EUFA 2XWAA 1C4Y2 5EQQA 1A0JA 3K2UA 3KNXA 1TGTA 1TNIA 4INHA 2AGGX 2AMPA 2O8WA 1T7CA 2KCPA 2PKSC 1BTWA 1TALA 5L6NH 2F9NA 1WAYB 3P8OA 3SGAE 3VB4A 4B75A 2ZFQH 1P3EA 1SI5H 4Q63A 3DUXH 1BMLA 4LZ1H 1OWDA 2OTVA 1HAHH 2K0QA 2FIRH 2UWPA 4D7GA 3E8LA 2GV7A 1IQMA 4RKJB 1EJMA 2V0BA 1THPB 1VCWA 3ZV8A 2ALVA 2O8TA 2FI3E 3SU2A 2ZTZA 3TIUA 1B0FA 1ABJH 1ZZZA 2YMSB 4KP0A 1HIAA 1P02A 2FWWA 1V2PT 3TJUA 1H4WA 3RP2A 4AFQA 2XBXA 4Z0KA 2NU4E 1XVOA 4ZKSU 1P10A 5TCCA 1WV7H 5C94A 3ZVAA 3T62A 2CMYA 4ABFA 1VGCB 2UUYA 3VPKA 4CRGA 3VGCB 1OS8A 1P9UA 2AMDA 1CSOE 2P8OB 4FVBA 3ZVCA 4CH2B 2PUQH 3RLYH 1ZTLA 4GCHF 2DUCA 3ZV9A 4OS6A 3A7TA 3RXVA 4I8GA 2OBQA 5FCKA 1ZLRA 3KEEA 3L6PA 1O5CB 5IDKA 5GCHG 1MTNB 1THSH 2IJD1 3SZNA 1P03A 1L4DA 1GDQA 3CENA 2ZI2H 3GYLB 1PPGE 2FLBH 2ZP0H 1P2MA 1GBFA 3AAUA 4Y6DA 1A5GH 1KXDA 1O2UA 2XBYA 4X1NU 4MLFB 2FX4A 1QL8A 5J4SA 5CE1A 1O2JA 1T31A 1GCTC 2PKSB 3KHVA 2HPPH 3SGQE 1ELBA 3AW0A 4BXWA 3ATMA 3OAAD 1KMHB 5C1YA 1EP5A 2JJ1D 2YOLA 4BAKB 2EQNA 1IHSH 2GCHF 3EAJA 4AG2A 1Z8RA 3M7UA 1ZPZA 1MCVA 2W6JD 7GCHG 1TNKA 4I33A 1O2VA 2J98A 1RGQA 2VINA 3LIWA 2GT7A 1ESBA 1ZSLA 2B8OH 2K1QA 4O9VA 1S83A 1O3MA 3S9BA 2ZGBH 3RXRA 1ZHMA 1ARBA 2ZDKA 1K9OE 4K1EA 2PTCE 3GY6A 2WPJS 4F48B 4DURA 4DW2U 3A8AA 2AH4X 4IMQA 1T8LA 2AS9A 2JIZD 3R0FA 2IN2A 4B73A 4Y8ZA 1HAXB 2XNDD 3EQ0H 3PRDA 1GJ5H 1GI5A 4FVDA 1O30A 1ZTKA 1H9LB 2B5TB 3OSYA 3GY3A 3DA9B 4XFQA 1BT7A 1HV7A 2H9TH 4WY3A 1XKAC 4M9FA 2CK3D 1UHBB 3E0PB 1Z71A 3TH4H 2PFEA 4AB8A 2W7SA 1WU1A 4I7YH 1LKBA 1O2IA 3ZZ3A 1OSSA 3KQDA 1IQJA 1GI3A 4JZFH 4B76A 3TLOA 4X8SH 4Z6AH 3DFJA 1D6WA 4XD7D 2ZPRA 1SBWA 4X6OA 4P00A 2J98B 2P3TB 2BVXH 3FANA 1BMFD 1YPHC 1C1OA 1ZPCA 1JIMA 3NXPA 1NBME 2GCHG 1GG6C 2GV6A 2PHBA 1P8VC 1T4UH 4K1TA 1GL0E 4B2BA 1RTLA 2GGVB 3QTOH 2KFWA 2J34A 2VBCA 1SGRE 2TGPZ 1YLCA 2BDCA 1P2IA 1AD8H 1SGIB 1OWIA 3SJOA 3E16B 3C27B 5C5NA 2JKHA 1OYQA 2R3YA 2H9HA 4Q80A 5EJLA 3IITA 3PV4A 2CV3A 3KCGH 3SQEE 1MBQA 1CHOG 1NU9A 1ZHPA 1MTVA 5ESTE 1D3TB 2ZFSA 3M35A 3F0PA 3F9EA 3SU0A 1KSNA 4D7FA 1GG6B 1QNJA 3PMAB 1Z7KA 2QF4A 2XNIA 4GSOA 3SJKA 2V3HH 1GI6A 5DKMA 1N8OC 2C90B 2GP9B 2OK5A 2QXHA 3RMNH 4MPVA 2PUXB 5KGOA 1QZ8A 1O3AA 3BG4C 1C2LA 5ESBA 1BHXF 4IS5A 1QBOA 3RC4A 1O2WA 1S81A 1C1TA 4NSVA 5JPMH 1ANDA 1C1NA 2AMQA 1V2UT 1CHGA 4ACAA 1UTPA 2VB0A 4INKA 1YWUA 3M3SA 1Z1IA 1GBTA 2Z94A 3GCNA 1AFQB 4XBDA 1DANH 2Z9KA 4MNXA 2EY4C 3PMJA 5T6GA 1PQ7A 2BDHA 1LQEA 4WMFA 1KY9A 1WYKA 1TX7A 1CU1A 3D65E 3M3VA 5DN6D 2ESTE 4VGCC 1BOQA 2ZU5A 3GY2A 4X6MA 2BD5A 2C8ZB 2BZAA 3A7YA 4MG3A 2Q6GA 1LO6A 1WQSA 4DGJA 1HB0B 1C5WB 5GNDA 4ZKNU 2TBSA 3MO6A 3RLWH 4Y8YA 1D3DB 2YMSD 1MMJN 1HPGA 3IWMA 5FX5A 3BTGE 1W0ZU 1H8ED 3AVZA 5DP3A 4MQAA 1FQ3A 3RC5A 4NFEA 3LONA 1GJDB 3F2FA 1LHFH 5DK1A 5FBIA 1A0LA 3MYWA 3V13A 4O97A 2O8MA 1HAVA 3TJNA 2D8WA 1A61H 4OS4A 1O2HA 2CXVA 3PLPA 3ATWA 2KAIA 1EASA 1AGJA 4NZQA 1C4U2 1QR3E 2HNTE 1XKBC 1TAWA 1UVTH 1INCA 1C2DA 2DE9A 4MPUA 2BY6X 3OEED 5HIZA 2H1UA 1NU7B 1ELFA 4YLQH 2G52A 2ZDLA 1GWAA 2XOKD 3BTDE 3C1KA 5GXPA 3STJA 1SB1H 1Z8IB 2JH5D 2A2QH 1VZQH 1KDQB 2WV5A 3ZVDA 1O2YA 1O2QA 1KLTA 2BTCE 1DVAH 1C9PA 3FVFB 1G36A 1C5YB 1Z8JB 1HJ9A 1V2MT 3T26A 1GCDA 1E34B 2XWBI 4SGBE 4UONA 1LTOA 5HIYA 2Y5HA 5CHBA 2A5IA 1BTXA 4NIVA 1P9SA 4ISOA 1HAVB 3QWCH 1SLUB 2QA9E 4XBCA 3U98H 2WHXA 1BZXE 4I8LA 4DG4A 3BTEE 3MU5A 6CHAC 3A81A 2XC5A 4A6LA 4B2CA 1BTYA 1OWHA 1MAYA 1QBNA 5TCAA 2G5VA 1DUEA 3HPTB 3PV5A 1DLEA 5J4QA 1O34A 4CR9A 2A4OA 1NY22 1TLDA 4Y11E 1MCTA 3UTUH 1QJ6B 1O3IA 1GBIA 1YPHE 1GGDC 5C20A 1O38A 4DOQA 1FJSA 2GVFA 1NT1A 1MUEB 3SNCA 2H9EH 4BXSA 3O8CA 1YBWA 3MNCA 3D49H 3DT0H 4ZROA 4NIWA 4K8YA 1C5ZB 3HGPA 2CHAB 1D3PB 4X1RU 1F92A 2WPDD 2ODQA 3SGBE 1BBRK 3M7QA 4JK6A 1O3DA 6CHAB 4ASHA 1GJ9B 1EAIA 5DP8A 4I86A 2A0QB 4X8TH 2M2AA 1DS2E 1SGTA 3PYHA 4TY7A 5LPFA 2G81E 2ZG0H 2QE7D 1EXFA 3BTQE 4TY6A 2VIDA 3T5FH 2QAAA 4TPYA 1GI0A 1BBRH 5DP5A 1SLXB 2VU8E 3H09A 3EA9A 1ANEA 2F43B 2EI7A 2JETC 2WUCA 2HNTC 3F2HA 1V2JT 1EAXA 3UY9A 1HJAB 1DXWA 2OXSA 1TGCA 4ISIH 3SUEA 1FN6A 1O33A 2OC0A 3MH6A 3UIRA 2QV1A 2BY7X 1SOTA 3SHCH 1PPEE 1S6FA 1V2VT 2BB4A 4IMZA 3RXEA 4BAHB 4YT7H 5A8YA 2Y6TA 3ATKA 2TGTA 1HJAC 1ZMNA 5C17A 2STAE 1TRYA 1V2TT 5HXFA 1UMAH 3HKIB 3RXDA 1AU8A 3IG6B 1C1MA 3ZZDA 2FDAA 1C2GA 1VCPA 2QGRA 2W5EA 4DVAU 2QF0A 1FAXA 3UFAA 1L1GA 1H8DH 1K1NA 1W13U 1TBQH 3SU4A 2IPQX 3BIUH 3RXOA 2A4GA 1BTHH 3ZZ7A 2TRMA 6ESTA 1W0YH 2HVXA 3PLKA 3RMOH 2BZ6H 4GHTA 3PWCA 4ZHAA 2VWLA 1XXFA 4Z1MD 1SFIA 1FN8A 3MNSA 2SNVA 4Y7AA 1O32A 2EEKA 3A88A 4F4OC 1S6HA 5LPRA 1GHBF 1CQQA 3QN7A 4B1TA 2HPQH 1KXCA 4A1XA 2VH6A 2RA0A 4FUIA 1TMTH 4TPIZ 3PO1C 3RXSA 3SNAA 3QDZB 1GDNA 2KCYA 1TGNA 3FN8A 5F8TA 5GIBA 3S69A 2OQ5A 2J38A 1WTGH 2GJGA 2V7QD 1HUTH 3OEHD 2Z6BD 4Y76A 1COWD 3TVJB 1GJ7B 1TNHA 3ZZBA 1MU6B 2G51A 1MKWH 4AB9A 2ZC9H 2SNWA 2NU3E 3RU4D 1MAXA 2BD7A 3T25A 4TSFD 1P01A 1QCPA 2A7JA 5FBEA 2AHME 4LZ4B 1T4VH 4WMDA 2GMTC 1J16A 2LNCA 1TMUH 3RXHA 4Y10E 1HGTH 3DD2H 2CN0H 1O5FH 1T8MA 4DY7B 2Z9GA 2ZCLP 1SLVB 1UVSH 1O3BA 1RIWC 1UTOA 1V2RT 4D76A 3WWFA 1YPMH 4GUXA 3MHWU 3PM3A 1GL1A 1V2NT 2WPHS 1AVXA 4CREA 3SV6A 4NIYA 4K69A 1GMDG 3HK6B 2F3CE 1GMCF 2VWOA 1KXEA 1ETSH 1J14A 3JZ1B 3F9GA 3NUMA 1SG8B 2GCTB 3LGVA 5DG6A 2GT8A 3F68H 2ZTYA 3FZDA 1EZQA 2RDLA 3RXQA 4DIIH 1FPCH 1IQHA 2YMSC 1LKAA 4B2AA 1LHGH 2ZQ2A 4JK5A 1GHAF 3F0OA 3BEIB 1PPZA 1FY5A 4IN2A 4O03A 4OS1A 3SU6A 5FAHA 1YC0A 3MH7A 1BRUP 1B7XB 1O5GH 3SU3A 1BJUA 1L4ZA 2XW9A 1IQEA 4OS5A 4ZHMU 1JIRA 3F9HA 1DX5M 4HI3A 4B6FA 2GD4B 1ZRKA 2XCFA 1A5IA 5H4IB 1W8BH 2FI4E 1GJ4H 3FOAA 3PRBA 1ID5H 4IC6A 1O2ZA 2FPZA 5EW1H 1SGNE 2JH0D 3RXTA 1FY8E 1F0TA 3KGPA 3EGKH 4NFFA 1YPGH 2FOCA 1ANBA 2RDEA 4X1QU 2VVUA 4DIHH 3BG4B 3U1IB 1P09A 1C1SA 1S6LA 3ZYEA 1K1IA 2HVYB 4YXWD 1QA0A 1YCPH 5EJ1A 3GOVB 4U32A 3MFJA 4AYVB 1GMDF 5E0HA 2EI8A 3SORA 2FOFA 2BD3A 4FUHA 1UTLM 1C5TA 4MDSA 4Y7BA 5T1VA 1D3QB 1UK2A 4B74A 5EOKA 2KCAA 4KGAA 3QGNB 1NRPH 1P2JA 5F03A 3RU4T 4ACBA 3KQ5A 1Y3UA 4J2YB 1W10U 3S9CA 1IQFA 1GVLA 4H4FA 4BOHA 1C5MD 1FDPA 4JMYA 4TWYA 1P2OA 3ZZ5A 3MO3A 2BDAA 2F9VA 2PWXA 3SYJA 2BM2A 4MNWA 1HDTH 1QY6A 4IBLH 3HGNA 4CBNA 1SGFG 1LVOA 1AHTH 2G5NA 4KTSA 2C8YB 3PV2A 3GICB 3OY5U 1YM0A 3W95A 3BTFE 5FPTA 1THRH 2QYIA 3RXJA 1UO6A 3WW7A 4FUCA 2VH0A 2RG3A 3CS7A 1LHDH 3QGJA 1BHXB 1PQ8A 3EDXB 2W26A 1GI9B 1O3LA 2PGQB 2BXUH 4WXVA 4Y8XA 1SC8U 1KXFA 1ELGA 2ALPA 3T2NA 1CHOF 2AFQB 2WINI 1SPJA 3H7OA 4FUGA 4ZH8A 5DP4A 7KMEH 1AFEH 1XUJA 1QBVH 4M7GA 1QL7A 5B6OA 2F83A 2FP7B 1GBHA 2C8XB 1A7SA 1A1RA 1LHEH 4UFGH 5AFZH 1DY9A 5EQSA 3BF6H 2TIOA 3RUOA 4FXGH 3RXUA 1QJ7B 3RXKA 1NROH 3DFLA 1MTSA 1QB1A 3GS9A 2F91A 5KEDA 1SGEE 4TYDA 5AFYH 3SNBA 1HAIH 1UTNA 2ZU1A 1Z6EA 4CR5A 3UOUA 4AC9A 1FY1A 1OP8A 2ZHEH 4Q7YA 1P06A 2Y5GA 5GPIB 2ZDNA 1P05A 4HGCA 2KCOA 1GBJA 1V2KT 9LPRA 3BEFB 4BTTB 1DM4B 1JOUB 4ESTE 3BTME 3NWUA 4AX9H 4A5TS 3U69H 2ZGCA 3T27A 1NZQH 1W2KH 1ZJDA 4AN7A 2VIOA 5K0HA 1O0DH 4FUDA 3BTHE 3EYDA 5IK2D 1AY6H 4IW4E 1HAOH 2P59A 2BLQA 1PPHE 1UTMA 4ABJA 1CBWB 1O3OA 2AGEX 3GY5A 5A8ZA 3OTPA 2H5DA 3LC5A 1O3KA 3ZZ4A 1LPGB 3UUZA 1GJBB 1O2GH 3E3TA 1PJPA 4JYUH 1FAKH 1W0KD 5FXLA 3I29A 2BQ6B 3RXLA 1HBTH 3RXPA 1ABIH 1T32A 3TJVA 3FP6E 2ZCHP 4OS7A 1W11U 5EXMA 2O8UA 4NA8A 1C5QA 1DLKB 1OP2A 2SFAA 2WYGA 3F2GA 3NZIA 3CNRA 4UFEH 3O8BA 2VVVA 4FETA 1ELTA 2ZCKP 5HMAA 4FU8A 1RTKA 3AAVA 4I8JA 2LELA 4JZDH 5A2MH 4F55A 5FL7D 1K28D 2VGCC 2ASUB 1O36A 1GI4A 2FZZA 3HKJB 1FY3A 1DWBH 5JBBS 2BLWA 1IQKA 3ZZ6A 2QXIA 5BPEA 3S0NA 1HFDA 3ODFA 4ZMAH 3M5LA 1GJ8B 1DITH 3ZIAD 1YY3A 1SGFA 3ZZ8A 3P95A 2IJOB 1GHVH 1O2SA 1PPCE 1WSSH 3SV7A 2R9PA 2Q6FA 2BDIA 3MQKC 1EKBB 1MZDA 1CA0C 4ABHA 2FI5E 2BLVA 1HJ8A 4UEHH 1GHAG 1TE0A 5JYIA 1S0RA 1BIOA 3TNSA 1ZSKA 2RFKC 1SHHB 1E0FD 3MO9A 1AE5A 4K60A 2PP6A 1Y59T 2ANWA 4BAOB 1MTNC 3PMBB 2OP9A 5EGMA 1MD7A 3T28A 3GCHB 2ODPA 1C1UH 1W3CA 3OTJE 3TNTA 3A85A 4ABBA 3FO8D 1EJNA 1K2I1 1QJ1B 3QZRA 4FUBA 3KQCA 4INLA 1O5DH 1TA2A 3SJ9A 1GDUA 2P8OC 3M36A 5JB8S 1NBMD 1KLJH 1VGCC 3EE7A 4GHQA 4X0WU 3PTNA 1FLEE 3SQHE 4RT0A 2DE8A 1OXGA 5EPYA 2Y7XA 1EB2A 1S5SA 2ZPQA 3RU4E 4I8HA 3DSGA 4TWWA 3TJOA 5FPYA 3N7EA 1EB1H 1SVPA 1FI8A 2QCYA 2BQWB 2PKAA 1TNLA 4F49A 1OWKA 3Q00A 1KYNA 3SV8A 2PW8H 3SUGA 1Z6JH 4ZHLU 1YP9A 4CRFA 2Z7FE 3TU7H 2VWNA 1NRQH 3RM2H 1O2PA 3NK8A 3A7VA 3Q3KA 3NCLA 1PQ5A 1DSTA 2CJIA 2K8IA 2GDDA 4E7RG 1ZOMA 1NC6A 2STBE 3FKSD 2ZPSA 5F8XA 3TK9A 1TWXB 1RD3B 1UCYH 4PROA 1SQTA 4DJZB 2SGDE 1BCUH 1JMOH 4AGJA 4YOJA 1BMMH 1TMBH 1GBMA 1HAYB 2B7DH 5T3HA 2HGTH 4TT3D 1ZSJA 1LMWB 2ZU4A 4X1SU 4DCDA 1ACBE 1C5XB 2R3UA 2A31A 1P12E 1VITH 3BEUA 3PO1B 2F4LA 4U30A 3M5MA 1O3GA 1NRNH 4ABEA 5F6MA 3U9AH 4ABGA 3AASA 4X8VH 1C4V2 4HTCH 2I6SA 1TBRH 2BDGA 2H5CA 1DWCH 3MU0A 1BITA 1LDTT 4ISHH 4ZUHA 3V12A 1C5PA 2ZDVH 4CBOA 4D9RA 3HATH 1FV9A 1OX1A 1IOEA 1AB9B 1YPLH 2PSYA 1UTJA 4O3TA 1GMHF 3BN9A 4ABAA 2AIQA 2VIPA 3MOCA 3TGKE 2VGCB 3U8OH 2AIPA 5AVDA 5FPSA 4JZEH 2JETB 1G37A 2ZHDA 5KECA 3QTVH 2OQUA 1A3EH 2WV9A 1ESAA 3ZVBA 3P8FA 1L1JA 2BD8A 2XTTB 2TGDA 1YKTA 5I46H 1E1QD 1O5AB 3UWIA 1GBKA 3NRLA 4YOIA 5G4BA 1NTPA 4FOUC 3PTBA 3U1JB 3N99A 1XM1A 2F9UA 3SJIA 2W7UA 1TFXA 5C67A 1HCGA 3E6PH 4GVUA 1A5HA 2FYQA 3ZVFA 2ZHQH 1AWHB 1HYLA 1VKYA 3MWIU 2ODYB 1W14U 1ELVA 1ETTH 1O5BB 1C2IA 3PB1E 3MTYA 5E2PA 6GCHG 5AHGH 2ZEBA 1A4WH 5EW2H 1AN1E 2R0KA 1UTKA 3BSQA 3RXMA 3SU1A 1ELDE 5A0AE 3SUDA 3KYGA 2EI6A 2BY9X 4E7NA 3K6YA 1VITG 1B0EA 1EPTC 5EXLA 1UW7A 1EPTA 3M7TA 2D26C 3OYPA 3A87A 2FMJA 1N1LA 4H42U 1NFWA 4Y0ZE 1UCYE 4XSKU 3DCLA 1BRCE 1CBWC 2BX3A 2I6QA 2UWLA 1S84A 1KXAA 1AMHA 1LVBA 1UJ1A 1C2KA 4MNVA 3D23A 1JXPA 2SGAA 1MBMA 1Y3WA 4AGKA 1V2ST 3B23B 3RXBA 4ZKOU 2WPMS 4B71A 2ANYA 2ZIQH 3AW1A 5DO4H 1F5KU 1C2FA 1H1BA 2BD4A 2TPIZ 2ZDMA 1BRBE 2WPLS 1HXFH 2ZU3A 1XMNB 2FOMB 1ZMJA 2ZNKH 3ODDA 2VNTA 2A4QA 1A0HB 5EIYA 2OD3B 4U01A 1MH0A 1O2OA 1EFRD 1QB9A 6GCHF 1ZTJA 4A1TA 2QXGA 1OOKB 1A46H 2BYAX 4ZXXH 3ZZCA 4CH8B 1RFNA 3P8NA 4BNRA 2HWLB 3FFGA 1J17T 3SV2H 3STIA 1JRTA 8LPRA 2J2UA 2KAIB 4MPWA 1JWTA 1RXPA 1BJVA 2ZGHA 4XBBA 3TH3H 4WXIA 3W94A 2W3IA 1P3CA
chains in the Genus database with same CATH topology
1VCQA 5F8ZA 1C1WH 2J92A 3TK5A 1ZYOA 2HNTF 1AUJA 3RXFA 2H6MA 4KTCA 1NFYA 1CGJE 3VFEA 1WCZA 1P0SH 2WYJA 3VEQB 1E38B 3K9XB 4HFPB 2V6NA 1IAUA 1GHZA 1C2EA 2G8TA 1YF4A 3Q3YA 1GBDA 3QO6A 2ZKSA 3GY7A 2GCTC 1CA0B 2UWOA 2J94A 2IPHA 3PWBA 1XVMA 5IYTA 3B9FH 1P11E 4AFSA 1U6QA 1MKWK 2EC9H 2FODA 3QUMP 1BQYA 1MZAA 1C5NH 5EODA 4D8NA 2GZ9A 2ZHFH 4AORA 1ZGVA 2IOTA 1TRMA 3LKWA 2WUBA 1K22H 4RSPA 3E91A 2C4FH 2FYRA 3FZZA 1XUFA 1V2WT 3LU9B 4X8UH 1SGQE 1E35B 1GHBG 4R8TB 4WVPE 3H7TA 1K1LA 1GI1A 4NA7A 1Q3XA 1T8OA 1TIOA 5FX6A 3U8TH 1C5LH 2F9PA 4H6SB 1AO5A 1Q31A 1HNEE 3VB7A 1MTWA 1CA8B 8KME2 4K2YA 2A2XH 2FX6A 5JB9S 1EAWA 1RJXB 9ESTA 4VGCB 2QIQA 2FOEA 1ARCA 1G3DA 4J1YA 3KIDU 5GDSH 1H9IE 3SV9A 5CMXH 2AEIH 1O3FA 3BTWE 4BTIB 1XUGA 1S85A 1GBLA 1Y5UT 1O39A 3MNBA 3P92A 1J9CH 3KF2A 4BAMB 1VJ9U 5I25A 2FO9A 1SSXA 1GHYH 2SGFE 1OP0A 3BIVH 1FIWA 2BMGB 2FOHA 2HOBA 1EJAA 2FTMA 1ZPBA 3A82A 3ELAH 3MI4A 3S7KB 1IQLA 1W7GH 4K5ZA 1OYTH 4JZIA 1O35A 1SL3A 3EE0B 1ANCA 1FMGA 3SNDA 1DICA 2RA3A 1ORFA 3MH4A 1O2KA 2FEQH 3URCA 3PLBA 1C1QA 4RN6A 2J4IA 3ITIA 2VVCA 4MVNA 2Z3CA 2BQ7B 4IC5A 4NA9H 1EZUC 2Z3DA 4X2XA 2HALA 1LPZB 4ABIA 3UOPA 1V2OT 3K65B 3OX7U 1L2EA 1QRXA 2THFB 2FOGA 1SR5C 2GMTB 2XCNA 3L3TA 5FCRA 4ZXYH 5T6FA 1PFXC 2G4TA 4YZUA 2EA3A 1SGDE 4FUFA 1A3BH 2ZQ1A 5DP9A 4XDEA 4BANB 2NU2E 1GBCA 5HM2A 2ZF0H 3GCTF 1TYNA 2QC2A 1MTUA 3FP7E 1C1PA 4X2WA 1TOCB 1DPOA 3UNRA 1QRZA 3KQEA 4YTAA 4A1VA 1TQ0B 3CS0A 1AUTC 2ZGJA 2ILNA 4YOGA 4YT6H 5GCHF 2J95A 5A0CA 1F5RA 1F0UA 1O31A 3R3GB 1HIAB 1SGYE 1BTUA 3F1SB 1EP6A 1S82A 1MKXH 4JCNA 1UK4A 2OUAA 2ZFFH 1C2HA 2Z9LA 3GY8A 1SQAA 1XX9A 2OLGA 8GCHG 3UPEA 1DUAA 2FS8A 3QX5H 4AZ2B 1DXPA 1PYTD 1P2NA 1O2RA 1QA7A 2CHAC 3SOSA 2BVSH 1PYTC 3LPRA 1CT4E 3M37A 5L30H 1FY4A 4UFFH 2BLOA 1YCPK 5SGAE 5JDUB 1Z1JA 3E90B 1X7AC 3A86A 4UD9H 1GGDB 1FIZA 5E2OA 3M5OA 3I78A 3O8RA 1QIXB 1ZJKA 2BX4A 1TB6H 1AFQC 1DWDH 3UREA 1TPOA 1C5RA 3LGIA 3ENSB 2XXLA 3K6ZA 2FLRH 1DY8A 2C93B 3UNSA 1AKSB 1PQAA 3GDUA 1O2XA 2ZWLH 1LPKB 2OC1A 1QRWA 1V2QT 1TGBA 1O5EH 1RTFB 1LVMA 4NWLA 4Q7XA 1P2KA 1J8AA 1GMCG 1TGSZ 1TOMH 8ESTE 1O2MA 2Z3EA 2O9QA 4YESB 3VB6A 1C1VH 2A5KA 1AZZA 4NCYA 5C1UA 3GY4A 4UDWH 1GVKB 1F0RA 3VB3A 3RC6A 5E0JA 1P57B 3RDZA 1C5OH 2XC4A 2ZECA 3A84A 2PTNA 2XC0A 2ZFTA 1ESTA 3LOXA 3ZZ9A 2ZTXA 1GVZA 3ESTA 2BXTH 1UVPA 3NPSA 1W12U 3RXIA 1VJAU 3DHKH 2GTBA 3QK1A 1TQ7B 1FPHH 5EG4A 2C8WB 3E1XB 2P93A 3PROA 4CRAA 4MPXA 4NZLA 3PMHB 4GAWA 1SLWB 4NG9H 2ANKH 1RS0A 1ZHRA 2SGPE 3A80A 1L1NA 4UE7H 3TK6A 3RMLH 3JZ2B 2R0LA 1G2LA 2OC7A 1EATA 1MQ5A 1ZR0A 2AERH 4GCHG 1AVGH 4BAQB 1GHXH 2FM2A 2A7HA 2FXRA 1XUKA 2P94A 1GI7B 4XE4A 2NU0E 3VXFH 1MU8B 1F2SE 3GCHC 2JH6D 1IHTH 2P95A 3LJJA 3HK3B 4CHAB 1GI2A 1J15A 4I8KA 1G30B 1BMNH 3H5CB 2BHGA 1G3CA 7ESTE 5CHAB 1Y5AT 2A7CA 1P2QA 2A5AA 2UUJB 1VR1H 4K3JA 3LC3A 3M3TA 1F5LA 1G9IE 1JBUH 1YPEH 3T29A 1DT2A 1NS3A 4WH8A 2UUFB 2ZO3H 3A7ZA 4WMEA 1TBZH 4GLYA 4OGYA 1C9TA 4YLUA 5TJXA 3KN2A 2G00A 1GJ6A 1WOFA 1MKXK 1YLDA 1RRKA 3E0NB 1NRSH 1UK3A 1Y5BT 3F9FA 1L0ZA 1GMHG 1AVWA 1OKXA 2R2WU 1DSUA 3P6ZB 7LPRA 4O3UA 3LH3A 5HM9A 2FS9A 2P16A 5C2ZA 1ZRBA 5LGOA 1BRAA 1S0QA 1C5SA 1NN6A 1ELEE 5GJ4B 1EZXC 2A4RA 2A32A 3SNEA 4OGXA 5LPEA 1W7XH 3BTTE 4ABDA 2BOHB 4YO9A 5PTPA 1Z8GA 4Q2KA 1AB9C 2OBOA 5EQRA 1QURH 2R2MB 5LH8A 4H6TA 1UHBA 1TX6A 1O3HA 2A45B 1JRSA 1EQ9A 1ZMLA 1C2JA 2QF3A 2A1DB 2FESH 3GCOA 3GCTG 4Q7ZA 1K1MA 1T8NA 4I31A 3BTKE 2GDEH 3UWJH 3A8BA 2P3FH 2QY0B 2PKAB 2ZHWH 4KKDA 3VGCC 2HLCA 4UFDH 1NRRH 1O37A 2ULLA 3EA7A 4Y0YE 1C5VA 4SGAE 4I32A 4JZ1A 4ISLA 1H9HE 1V2LT 2BD9A 1XXDA 1V6DA 3TGIE 1D6RA 5C1XA 1TPAE 1C5UA 1YGCH 1O2LA 3A8CA 5ETXA 2WPKS 2W3KA 8GCHF 2V3OH 2ANMH 4CRBA 3BV9B 1Y8TA 1QFKH 3URDA 2D1JA 1SOZA 5AF9H 1QQ4A 4A7IB 1C2MA 1SHYA 3ZVGA 2ZA5A 3UNQA 3OY6U 2VIQA 4CHAC 4QT8C 1AE8H 1GCTB 2UUKB 3SBKA 3SO3A 3SU5A 1HAPH 1KIGH 1CVWH 1KTSB 4GPGA 2NWNA 3LDXH 1KTTB 1VITF 1OWEA 1UCYK 1AI8H 4NGAH 2VWMA 2ZFPH 1UVOA 1G32B 1O2TA 4AYYB 5GWZA 5JBAS 1IQGA 1M9UA 4OS2A 4Y79A 3NKKA 2ZU2A 4LK4A 2YNBA 3RXCA 3GISB 2FTLE 1KLIH 2D2DA 2TGAA 1WUNH 3FAOA 1DDJA 1ETRH 3G01A 3F6UH 1K1JA 1AZ8A 5JBCS 4THNH 1KDQA 1Y3XA 2O8LA 1QHRB 3EA8A 1KXBA 1LCYA 5JBTA 1NPMA 1K1OA 1SGCA 1N6XA 3MU8A 3RXGA 2Y81A 3I77A 2NU1E 5DGJA 4ZKRU 2J9NA 2YNAA 1A2CH 1TRNA 1QL9A 4D9QA 1O2NA 1ZGIA 1NM6A 1F0SA 2Z9IA 3V7TA 2RCEA 4X2VA 1Y3VA 2ZDAH 3Q76A 1P04A 1O3NA 1NFUA 2F9BH 5DPAA 2B9LA 1O3PB 2XRCA 1WQVH 1HAGE 2GKVE 2OCVB 2ZFRH 3LGTA 3RXAA 2VIWA 5HYOA 4AOQA 1LHCH 2PLXA 1YCPM 3GDVA 3S7HB 4LXBH 3SI4H 5E0GA 1PPFE 1GJAB 1BB0B 3B8JA 2Y5FA 3P70B 2Z9JA 2C3SA 1E36B 1CO7E 1C1RA 1HRTH 1HAZB 5DP6A 3LGUA 2BY5X 1G2MA 4WJG2 1K1PA 5C3NA 1D4PB 2PSXA 4KELA 1WTHD 2SGEE 3ATIA 3TPIZ 3VXEH 1Q2WA 1SFQB 4MNYA 3MH5A 4X1PU 4E05H 4NIXA 1N6YA 2QN5T 3SJ8A 1BDAA 1AIXH 5DP7A 2PV9B 1YPJH 3M61U 3KQBA 2GX4A 1LVYA 1O3JA 3A83A 1EX3A 5EU8A 1ELCA 3MU4A 3RM0H 1YPKH 3UQVA 1BTPA 3TGJE 1AWFH 4AFUA 1CT0E 2CGAA 1FZZA 1QQUA 1LQDB 5L2YH 3LH1A 1N8OB 1TNGA 1BMAA 4X6NA 5CHAC 2XYAA 1MD8A 3Q3XA 2PR3A 2XBWA 5HGGA 1OPHB 2WV4A 3U8RH 3CP7A 3L33A 1BA8B 5T6DA 5K7RA 2H2ZA 4FU7A 4X6PA 4IGDA 4KTUA 2BVRH 1G3EA 2CF8H 1GBBA 1QTFA 1TA6A 3UR9A 2ZZUH 3SUFA 1FNIA 3VB5A 1HXEH 1Y3YA 1CT2E 1QGFA 1E37B 1BBRE 2AGIX 2BY8X 1SGPE 1FONA 3MNXA 4AG1A 3GDSA 4HZHA 1GPZA 3D62A 5EPNA 2SGQE 1TNJA 2HRVA 1RIWB 3LJOA 1BUIA 3UQOA 1CGIE 4E06H 3KL6A 7GCHF 1SQOA 4FU9A 2QXJA 1F7ZA 1IQNA 3TITA 3UR6A 3MU1A 1GI8B 3LT3A 2G55A 1V3XA 2M5TA 4ISNA 4LOYH 4X2YA 4A92A 1GBAA 5L2ZH 1EAUA 5A0BA 1TABE 1DOJA 4JYTA 6LPRA 2F9OA 4FUEA 3SW2B 1EOLA 2G4UA 2Q6DA 1DE7H 5DJ7A 1BTZA 3GYMA 1D9IA 4MTBA 3FP8E 3A7WA 1HLTH 3A8DA 4NSYA 1CE5A 2Y80A 5A09A 2FOBA 2OINA 2Y82A 1TX8A 1YYY1 1G3BA 1DWEH 1TPPA 1GJCB 1CGHA 5A8XA 3V0XA 1NFXA 1UTQA 1WBGB 3ZYDA 4WH6A 3ZVEA 1FXYA 2VJ1A 4WWYA 2CF9H 1EOJA 1DFPA 3N7OA 3P17H 3BG8A 1MQ6A 3SHAH 1IQIA 1PPBH 1NESE 3Q77A 1EZSC 3QZQA 4ZAEA 3WY8A 3QLPH 4R0IA 4U2WA 2PGBB 1O3EA 5E8EH 3LGYA 3TH2H 3O8DA 4YM9A 1NO9H 1ELAA 4WF8A 4BTUB 1H8IH 1GBEA 2V35A 4AFZA 1EPTB 1QB6A 2XBVA 2FOAA 2GZ8A 4Y71A 3P8GA 5C5OA 1O3CA 2AYWA 1TPSA 2BDBA 4K1SA 2BDYA 3RMMH 1FUJA 3ZZAA 3ATLA 1XUIA 2OC8A 1GHWH 1UVUH 3MMGA 4CRCA 1TONA 5ABWA 1B5GH 2BOKA 2GZ7A 2LPRA 4NWKA 3A7XA 3LGWA 2Q1JA 4JYVH 2VIVA 4RKOB 4DT7B 2Y7ZA 3V3MA 3S9AA 1AQ7A 4XOJA 4FUJA 2ZGXH 1XUHA 5FHTA 1SMFE 2B0FA 2BD2A 1K21H 3SN8A 3A89A 1OWJA 4K8BA 3SI3H 4CRDA 5BRRE 3OU0A 5EXNA 4IN1A 2WPIS 1AKSA 3M5NA 2P3UB 1EUFA 2XWAA 1C4Y2 5EQQA 1A0JA 3K2UA 3KNXA 1TGTA 1TNIA 4INHA 2AGGX 2AMPA 2O8WA 1T7CA 2PKSC 1BTWA 1TALA 5L6NH 2F9NA 1WAYB 3P8OA 3SGAE 3VB4A 4B75A 2ZFQH 1P3EA 1SI5H 3DUXH 1BMLA 4LZ1H 1OWDA 2OTVA 1HAHH 2UWPA 2FIRH 4D7GA 3E8LA 2GV7A 1IQMA 4RKJB 1EJMA 2V0BA 1THPB 1VCWA 3ZV8A 2ALVA 2O8TA 2FI3E 3SU2A 2ZTZA 3TIUA 1B0FA 1ABJH 1ZZZA 4KP0A 1HIAA 1P02A 2FWWA 1V2PT 3TJUA 1H4WA 3RP2A 4AFQA 2XBXA 4Z0KA 2NU4E 1XVOA 4ZKSU 1P10A 5TCCA 1WV7H 3ZVAA 3T62A 2CMYA 4ABFA 1VGCB 2UUYA 3VPKA 4CRGA 3VGCB 1OS8A 1P9UA 2AMDA 1CSOE 2P8OB 4FVBA 3ZVCA 4CH2B 2PUQH 3RLYH 1ZTLA 4GCHF 2DUCA 3ZV9A 4OS6A 3A7TA 3RXVA 4I8GA 2OBQA 5FCKA 1ZLRA 3KEEA 3L6PA 1O5CB 5IDKA 5GCHG 1MTNB 1THSH 3SZNA 1P03A 1L4DA 1GDQA 3CENA 2ZI2H 3GYLB 1PPGE 2FLBH 2ZP0H 1P2MA 1GBFA 3AAUA 4Y6DA 1A5GH 1KXDA 1O2UA 2XBYA 4X1NU 4MLFB 2FX4A 1QL8A 5J4SA 5CE1A 1O2JA 1T31A 1GCTC 2PKSB 3KHVA 2HPPH 3SGQE 1ELBA 3AW0A 4BXWA 3ATMA 5C1YA 1EP5A 2YOLA 4BAKB 1IHSH 2GCHF 3EAJA 4AG2A 1Z8RA 3M7UA 1ZPZA 1MCVA 7GCHG 1TNKA 4I33A 1O2VA 1RGQA 2VINA 3LIWA 2GT7A 1ESBA 1ZSLA 2B8OH 2K1QA 4O9VA 1S83A 1O3MA 3S9BA 2ZGBH 3RXRA 1ZHMA 1ARBA 2ZDKA 1K9OE 4K1EA 2PTCE 3GY6A 2WPJS 4DURA 4DW2U 3A8AA 2AH4X 4IMQA 1T8LA 2AS9A 3R0FA 2IN2A 4B73A 4Y8ZA 1HAXB 3EQ0H 1GJ5H 1GI5A 4FVDA 1O30A 1ZTKA 1H9LB 2B5TB 3OSYA 3GY3A 3DA9B 4XFQA 1BT7A 1HV7A 2H9TH 4WY3A 1XKAC 1UHBB 3E0PB 1Z71A 3TH4H 2PFEA 4AB8A 2W7SA 1WU1A 4I7YH 1LKBA 1O2IA 3ZZ3A 1OSSA 3KQDA 1IQJA 1GI3A 4JZFH 4B76A 3TLOA 4X8SH 4Z6AH 3DFJA 1D6WA 2ZPRA 1SBWA 4X6OA 2P3TB 2BVXH 3FANA 1YPHC 1C1OA 1ZPCA 1JIMA 3NXPA 2GCHG 1GG6C 2GV6A