3OY5U

The crystal structure of upa complex with peptide inhibitor mh027 at ph7.4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
247
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSATLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 55
structure length 246
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy5U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy5U01
3KNXA 3HPTB 3L3TA 1F7ZA 4TPIZ 2BXTH 3RXUA 4Q7YA 1DWEH 4IMQA 1L1JA 4WMFA 2AGGX 2AEIH 1IQIA 4INLA 1C5RA 3TH4H 1KXEA 1SGTA 3H7OA 3M5NA 3PLPA 4HGCA 1C5OH 3MI4A 1VITH 3LH3A 1ELGA 3GY3A 1LHDH 4XSKU 4TWWA 1PPBH 4ISLA 1EP5A 1IAUA 1H9LB 4Y71A 1IQLA 2RA0A 5E0GA 2ZGCA 1IQHA 1VZQH 3RXLA 4A6LA 2FX4A 1XUIA 1P03A 3RP2A 5EQRA 1O36A 2D26C 5LGOA 2ZWLH 1V2KT 2H5DA 3MOCA 3VB5A 1ELCA 5EXNA 2JH5D 2FOCA 1TLDA 2FYRA 1HAHH 1NO9H 1V2OT 1GDUA 1P0SH 2OQ5A 3I77A 4NZLA 1HXEH 3S7HB 1GMCG 1PPZA 2PV9B 5EODA 3GCHB 2PUQH 4KTSA 4X6PA 3SV7A 1D3DB 5DGJA 2XTTB 3TPIZ 1L1GA 1SFQB 1ELBA 2BZAA 5LPEA 2B7DH 2Y80A 1LHEH 1O2ZA 3S9AA 1KSNA 2HGTH 5A8YA 2ZHDA 3GY8A 2F9UA 1TYNA 4NIVA 2VGCC 1C5NH 1DFPA 2ZTZA 3UTUH 3RMOH 1T32A 2PR3A 1VGCB 1H1BA 2VWMA 1NC6A 4FXGH 2C90B 3QGNB 4B2CA 1F2SE 5AFZH 1KLTA 1DLEA 1UHBB 2ZU3A 4KELA 2J4IA 2ZU4A 3GCHC 3A85A 1TNHA 1GHZA 1DWCH 4BANB 1FIWA 3RM2H 3SQEE 3IG6B 1S82A 1EUFA 4TWYA 1IQJA 1MAXA 1ANCA 1BTZA 1IQEA 2A1DB 1S83A 3GY4A 2PSYA 1AUJA 4K5ZA 1HUTH 1OOKB 1P04A 3SNEA 1OWHA 3LOXA 1FY5A 1WQVH 2FMJA 2PUXB 1AWHB 2AYWA 3M7TA 1E37B 2QF0A 1EKBB 1GJCB 1Y3WA 1AKSB 2PTCE 4FUCA 2C8WB 4GVUA 4MNXA 1BJUA 4X2WA 4U01A 1V2QT 3LJOA 3UQOA 1O5BB 1F0UA 4IS5A 2GGVB 1TRNA 1SGNE 1OXGA 1EZSC 1O5GH 4WXVA 1BJVA 4E7NA 1AE8H 3SNDA 1P2IA 2G52A 1FQ3A 1JXPA 3OY6U 1QQ4A 2UUFB 1O2WA 1O3JA 1H8DH 1D6RA 5JBTA 4NIWA 1C1RA 1HDTH 1DVAH 1GBTA 4OS7A 1GHAF 3SU4A 4MNYA 2A45B 1O3AA 1NRQH 2C3SA 3EQ0H 5I25A 3SV6A 3FP8E 1RXPA 4H6SB 2FLRH 2EI6A 4AN7A 3BTHE 2Q6GA 1TQ7B 4O97A 1VGCC 1EZQA 1OP8A 1QNJA 1YPJH 2VH0A 4YT7H 1OP2A 4DY7B 2D1JA 4GSOA 4X2YA 2VVUA 1QJ7B 5JDUB 1FONA 1EPTC 1L4ZA 3RLYH 1GBJA 1TX6A 1P12E 2SGAA 3RMMH 4SGBE 3RU4E 2ZF0H 3ZVAA 2QXIA 3MYWA 2V3HH 3WY8A 3JZ1B 1TNGA 2ZDKA 1BOQA 1LO6A 1FI8A 4JZDH 1P09A 2SNWA 5GDSH 3AVZA 2FPZA 1K2I1 1OWDA 1HV7A 1GJ4H 1J8AA 2FYQA 2GDDA 1OWIA 4AFQA 1HAOH 3LIWA 5L30H 2ZTXA 3DHKH 4SGAE 3TGJE 2TBSA 1S5SA 2CF9H 4B71A 1Z8GA 1EZXC 3T25A 1Z6EA 4IMZA 2VWLA 4NG9H 2CGAA 2ZFSA 4X6OA 5A0AE 3F6UH 2GT8A 4K8BA 5C1YA 1TWXB 4J1YA 1GL1A 3ZZ3A 3F1SB 2QCYA 1XUFA 4I8JA 4AGJA 1KDQA 1QBNA 2NU3E 1V2LT 3KQBA 3PTBA 1HNEE 1ZJDA 1HB0B 2ZPSA 1PQ5A 4JYUH 5EXMA 2VGCB 4IGDA 3HK3B 2CV3A 2KAIB 4B73A 3HKJB 1ELEE 1FAKH 8GCHG 4WF8A 1P01A 3KN2A 3EA7A 4NA9H 1X7AC 4Q80A 3QGJA 7GCHF 1TMUH 1TQ0B 3KL6A 3T26A 4AB8A 1BQYA 1B7XB 1FN8A 2O8MA 1S0RA 4OS5A 1PPCE 3CENA 1K9OE 4U32A 3U69H 2TGPZ 1UK2A 3ATMA 1ESTA 1SOZA 1FUJA 3QK1A 1TNLA 5JBCS 1O37A 4NSYA 3A7ZA 2ZIQH 1GCTC 1GJAB 1O3DA 2ILNA 3QWCH 1YKTA 3SU5A 3PLKA 4FUGA 4RKOB 4XBCA 9LPRA 1XX9A 4XFQA 5IYTA 2CJIA 1RIWC 1ZZZA 1JBUH 1OP0A 1W11U 1O2YA 4ZHLU 2G51A 2WUBA 3VB7A 5TJXA 1UTJA 3RXTA 2BDAA 2VIDA 5JB9S 1MTNB 1TOMH 4UONA 1RRKA 4MDSA 4BAHB 3TGIE 1RD3B 3RXAA 1RTFB 1C5UA 1INCA 2FIRH 4JYVH 3RC5A 2Z6BD 1BIOA 1WAYB 4MPWA 4YT6H 1YLDA 1UVOA 4E06H 4K1TA 1JRTA 1PYTD 1FY4A 4ISIH 3E8LA 1UTOA 3T5FH 3KQCA 2WUCA 2WYGA 5FX6A 1PQ7A 1IHSH 1V2PT 2ZFQH 4AFSA 1UTKA 4TY7A 1GI2A 1TX8A 4IC6A 3SORA 1N6XA 4U30A 2QXJA 4MPUA 1O5FH 4ABEA 4Y10E 1D4PB 4JK5A 5GJ4B 1ID5H 3KGPA 1SVPA 2THFB 2Q6DA 1GMDF 3SBKA 5T6DA 1AN1E 2O9QA 1BBRH 2J34A 1EZUC 1O2IA 3MH4A 4O03A 1D9IA 1O2GH 1QJ1B 3SNBA 3BIUH 4DG4A 3HKIB 4M7GA 1SGYE 2OD3B 4YOJA 1GHWH 1GJBB 3RUOA 4ZKNU 1NROH 3T62A 1BMAA 4D7FA 2VWOA 3QTOH 3MH7A 3GY6A 5AHGH 4QT8C 3MTYA 1BB0B 1C1MA 2CHAB 4FUDA 2I6SA 2OQUA 2Z9KA 1AVXA 1T8NA 4INKA 1LPGB 5C67A 2OTVA 3QZQA 3BTKE 4GCHG 4WVPE 3PMAB 2ZDNA 3P8NA 1EPTB 1L0ZA 3VPKA 1O35A 2A0QB 3RDZA 1AD8H 5FPTA 1AFQB 4CRDA 4K1SA 1LPZB 2V0BA 2R2WU 3RXVA 1TGCA 3U9AH 5GCHF 2XRCA 2GTBA 1O3OA 4ZH8A 3SI4H 3GICB 4ZROA 2GV7A 2ZHFH 2OC8A 2Y7XA 1PQ8A 3A84A 1VJAU 3ZVDA 1GBBA 3BG4B 1DANH 2XNIA 2W26A 1SGRE 1THPB 3SGBE 1GMCF 1BMMH 4HZHA 3FP6E 1AU8A 1H9HE 5E0HA 2EC9H 3TNTA 3LPRA 1UVTH 4YO9A 1O3GA 2ANMH 3KEEA 4B1TA 2ZFPH 2FWWA 1SGFG 1V2JT 3CP7A 3GYLB 2CHAC 4KGAA 3K2UA 2PW8H 1H8IH 2XBWA 1C5XB 1FAXA 4I31A 1O2OA 2FS8A 3FZDA 5F8ZA 1SLUB 2QXHA 3T28A 1MCTA 1WQSA 3BTQE 1J15A 1LVOA 1QA7A 1VCWA 2NU0E 2K1QA 1C1UH 1SQOA 1MU8B 4OS2A 3UNSA 1QGFA 2FTMA 3I78A 4B75A 3NPSA 1TONA 2UUJB 3EA9A 1C5YB 1Y8TA 2AH4X 3V12A 2AIPA 2RG3A 4MQAA 5HXFA 3SI3H 1SGQE 2GZ8A 1EJAA 3M35A 1WUNH 1ZPZA 2FOEA 5HM9A 1GBHA 1IOEA 5L2YH 1GMDG 1Q31A 3BTEE 2Z9IA 3LJJA 2WPMS 3I29A 2F9PA 3ZVGA 3PYHA 2FOFA 1NT1A 1YBWA 5HGGA 1L2EA 3SZNA 5E2OA 4ZMAH 3A83A 2QA9E 3STJA 1L1NA 3BTGE 1TPOA 2BY6X 3A7WA 4O3TA 1G9IE 3LH1A 1B5GH 3SHAH 4Y7BA 3RXSA 1ABIH 1NM6A 2BVXH 2GP9B 3GDSA 1SC8U 1C5LH 4HI3A 1ETTH 2B5TB 1AKSA 1W3CA 2A5KA 1MBQA 2VIVA 1V2ST 1KIGH 3SJOA 1C1WH 1NTPA 4AOQA 2AGEX 1HPGA 1F92A 5FHTA 1JWTA 1O2UA 3A8BA 1CA0B 3VXEH 5F8XA 4DJZB 1HAPH 2HNTF 1HFDA 1ZHRA 2B9LA 1BMLA 4A92A 2OC1A 1SGPE 4ISOA 1O0DH 1YPKH 4GHQA 4ZKSU 1N8OC 2NU4E 1DDJA 4GPGA 1SQAA 5ETXA 1PPGE 2ALPA 1O3IA 3ITIA 1O3EA 5FCKA 2H1UA 1QR3E 1AI8H 3VXFH 2GMTC 4A1TA 2BOHB 3BIVH 1ELDE 5DPAA 4Y0YE 3LU9B 1HJAC 1O33A 1G36A 2J92A 3TU7H 3MNBA 1QURH 2BD5A 1GI3A 2A7HA 4OGXA 3A82A 1F0TA 5EQQA 4X0WU 1C4U2 1TMTH 2RA3A 2STBE 1ANBA 1ELFA 1KYNA 5K0HA 3L6PA 2HRVA 4NCYA 3UNQA 5TCAA 3SU3A 4ISHH 4YESB 1T31A 2G5VA 1AFQC 3LGTA 1EPTA 4CRGA 2G55A 4FVBA 2PTNA 2AMQA 2BM2A 1VITG 4XE4A 1CVWH 1C4Y2 4X6NA 3A88A 2TGDA 2WV5A 2C8XB 1YPGH 1C5SA 1G2LA 1P11E 5BPEA 1IQNA 1GBMA 3VGCC 3FZZA 1J9CH 3URDA 1HAIH 2ZC9H 4B76A 5FXLA 1BZXE 4ASHA 2IOTA 1MTSA 2B0FA 1FY8E 5LH8A 2P3FH 2ZPQA 3Q3XA 1GI5A 1FY1A 2AIQA 1Y5AT 1C1NA 2RDLA 3P70B 5PTPA 1VITF 4ZHMU 1C2DA 1SMFE 3ZZ5A 1C5ZB 2ZU1A 3RXKA 3V0XA 1G3EA 1GHXH 2A2XH 1UK4A 3E6PH 3KQDA 5JPMH 3PMHB 2OC7A 2QXGA 1EX3A 4NFEA 1FY3A 1LHFH 2BOKA 5EPYA 1MD8A 1DLKB 1EB1H 2BD9A 1P2JA 5FBIA 1Z8IB 5T6FA 4ABBA 1CQQA 3QTVH 3OYPA 1TMBH 1GI4A 7LPRA 3UIRA 1TRMA 1AVWA 2ZP0H 4INHA 2ZDMA 1NS3A 5J4SA 4UFDH 4ABFA 1O3MA 3C27B 2LPRA 4CBNA 5CHAB 4BAOB 3UPEA 1O2XA 1JMOH 2BDCA 1HAYB 3VB4A 1CSOE 4GAWA 3RM0H 2ZNKH 2A32A 2FOAA 1O2SA 5FCRA 3R3GB 1C9PA 1YCPM 1T8LA 3RXGA 1QBOA 1GBEA 3MU0A 2ZPRA 5FAHA 3GCOA 5DK1A 3LDXH 1SHHB 1C5TA 4B74A 1THSH 1O3HA 3SUDA 1G37A 1GBAA 2XBXA 1V2NT 3MNSA 3NXPA 1S85A 2ODYB 5ESBA 2Q6FA 1P2QA 3E3TA 1W8BH 2QIQA 3OY5U 4IW4E 2A31A 4ZHAA 1A61H 3VEQB 2ZQ2A 1HJ8A 3TH3H 1HIAB 4Y8YA 3SJIA 1GHVH 1O32A 4CRAA 3TIUA 3NZIA 2TRMA 1NZQH 3CS7A 1SSXA 4DT7B 1GGDC 1EJMA 4CRFA 4MLFB 2R0LA 2P3TB 1BDAA 2O8WA 2ZA5A 3H5CB 3ZVEA 1GWAA 2YNAA 3BTDE 1FJSA 3UREA 3SUGA 2HVXA 1XVOA 1O5AB 5DP8A 5T3HA 5LPRA 1TNKA 3UOPA 2NU1E 2ZEBA 1M9UA 1NESE 1GI6A 3ZV9A 1TABE 3E91A 2OBQA 3VB6A 1GBIA 3IWMA 1LKAA 4AG2A 4ABJA 3S7KB 3ATKA 3ZZ8A 2VIQA 3D62A 8ESTE 2Z3CA 3MHWU 3T2NA 1IQKA 1A3BH 4RN6A 3ATIA 2GDEH 4NFFA 1F5RA 2GCTB 1OYQA 3A8DA 1FIZA 4AYVB 1SGEE 4CH8B 2ZG0H 4IBLH 5GCHG 2GCTC 3UR9A 2R3YA 2JH0D 4ABHA 5J4QA 1ARBA 1C5PA 1ZMNA 2H9HA 1BA8B 4Y79A 1A3EH 3AW1A 1IQFA 3LGVA 1A0LA 2WPJS 2ZHQH 1ZPBA 3RMNH 3V3MA 3RXHA 3SV8A 3GOVB 4Z0KA 4NGAH 3KIDU 5EXLA 2GT7A 1MTWA 3SJKA 1YP9A 1A4WH 2HLCA 3Q77A 1TBRH 1UMAH 4JZ1A 3P92A 2F91A 4ISNA 3SGQE 1WV7H 1TNIA 4I8LA 1JRSA 3E90B 1MBMA 2BDGA 2FOGA 4WH6A 4Y8ZA 4CRBA 1TRYA 2SGFE 3H7TA 1SL3A 1ESAA 2BDBA 2CN0H 3V7TA 1W0ZU 4UFFH 6GCHG 3SO3A 1MD7A 3ZV8A 1K1LA 2CXVA 1Y5UT 2VVVA 3TK6A 3PO1C 3TNSA 3URCA 1C2GA 2VIOA 3LGIA 1O39A 4R8TB 1CGIE 1PYTC 2SGQE 1HAGE 3LGUA 2BB4A 4I33A 1HLTH 2SNVA 1EJNA 1C1OA 3MWIU 4UFGH 5DP5A 1GG6C 4IN2A 1C2KA 1B0FA 1DITH 1HRTH 5E2PA 2BLQA 2GCHF 2FTLE 5GPIB 1DX5M 2B8OH 3GISB 4K60A 4UEHH 1VCPA 3OTJE 1KY9A 2ZU2A 4H6TA 2XW9A 1EQ9A 1BUIA 3D65E 1D3QB 4BNRA 4R0IA 1C2LA 1OWKA 3M5LA 9ESTA 2PGQB 1KXCA 3LC5A 1O3BA 2BTCE 4A1XA 2FOBA 1F5LA 2Y82A 2C8YB 1UO6A 2FP7B 2Z9GA 2M5TA 3RC6A 3MO6A 2JETC 3ZYEA 2AGIX 3W94A 2Y6TA 2BYAX 1K1NA 4Y11E 6GCHF 4CR5A 1HAVA 2FLBH 4MTBA 1KLJH 2VIWA 2WV4A 1MZAA 1XKAC 3MU5A 1O38A 1O2PA 3SJ9A 5E0JA 3P6ZB 1CA8B 4YZUA 1XMNB 1ETSH 1S6FA 1F5KU 1W12U 1NFUA 2OUAA 1ZMLA 3P8OA 4JYTA 4LZ4B 1BHXF 1SGIB 4CBOA 1QL8A 1KXFA 4XBDA 4VGCB 1L4DA 3S0NA 1GCDA 3PMBB 5EW1H 1PJPA 1TBZH 1E0FD 2BDHA 2ZQ1A 3RXCA 2DE9A 2F9NA 4I8KA 1C2IA 3ZZAA 2XBVA 4F4OC 1RFNA 2BDYA 4WXIA 4OS6A 1NN6A 1NFYA 4D76A 1BTYA 1KXBA 3RXDA 1GVKB 1DT2A 1LVBA 3BEIB 2QY0B 5DP4A 5C5NA 1T8OA 1IHTH 1BCUH 2WPHS 5G4BA 1SGDE 6CHAB 1O34A 4WMDA 2XYAA 4X1SU 2HOBA 1K1MA 5GXPA 2QF3A 1GI0A 1DUEA 3RXEA 4CRCA 4MNVA 4Q7ZA 4H42U 1BITA 2GVFA 1RTLA 3M3TA 4JMYA 5JBBS 3NKKA 1QFKH 3ZZ6A 2P8OC 1LVYA 2ANWA 1A0HB 4JCNA 3T29A 4NA7A 4NA8A 1DM4B 1XXDA 2BX4A 1A5HA 1QHRB 3KCGH 4Y8XA 1Y3XA 1FNIA 4NIYA 2GCHG 2GKVE 1QA0A 1A5GH 2UWOA 1XUKA 3Q00A 1P57B 3TJOA 2V35A 2PWXA 1GJ6A 1O30A 1TGBA 1XKBC 2V3OH 2W7SA 2DUCA 3DFLA 2EI8A 1V3XA 1C1VH 1C1PA 1DWDH 3M3SA 2A4OA 5GWZA 4FU7A 1FN6A 4ZXXH 3TLOA 2JH6D 3QO6A 4OS1A 3BSQA 3GCTG 1DY8A 1S81A 1K1IA 3PWBA 2DE8A 4ZUHA 3BTTE 1C2HA 3ZZCA 4OGYA 1GJ7B 2XWBI 5E8EH 3FFGA 4AORA 1GI8B 4E7RG 3OX7U 5F03A 5DO4H 2BD8A 5DP3A 2BZ6H 1QY6A 5F6MA 1BHXB 3MH6A 2TPIZ 3LGWA 1ESBA 3E0NB 2H9TH 3D49H 1O2JA 5DG6A 3O8BA 3EAJA 1BTXA 3AAUA 1AHTH 3VFEA 1DE7H 1MKXK 4FUJA 3RMLH 1XXFA 1ELAA 1QTFA 1ZOMA 1NFXA 1CGJE 4AFZA 4ZAEA 1UTQA 2V6NA 5DJ7A 2FDAA 3SV9A 2EI7A 1AGJA 1O2KA 4K69A 4KKDA 1W14U 1JIRA 1DUAA 1ELVA 3F9HA 4U2WA 2ZFTA 1SLXB 2GMTB 3S9CA 4WWYA 2ZECA 3N7OA 1XUHA 4YLQH 1AB9C 4UE7H 2GZ9A 1Y3VA 5A0BA 1GCTB 4JK6A 2XBYA 1S0QA 4KTCA 5A0CA 5DP9A 4BTTB 1VR1H 1NRPH 4Y6DA 1ZMJA 2R9PA 1AMHA 5C5OA 3UWIA 1EOLA 1DY9A 1YPEH 2A4RA 1Z6JH 3MO3A 1C5MD 1CBWC 1V2UT 5DP7A 3ZZBA 1DICA 1DSTA 1ZTJA 2XWAA 4K8YA 2PFEA 3U8RH 3LGYA 2HNTC 1G2MA 1LCYA 2OC0A 1SLVB 3MU4A 3NWUA 4MVNA 1UJ1A 3BG4C 2BLOA 1O3NA 2VB0A 1BTPA 4B2AA 1C1TA 5DP6A 2CF8H 1V2VT 2FI3E 1O3KA 2VWNA 4Y76A 1P8VC 1WOFA 1P05A 3SQHE 3U8OH 1Z7KA 2Z3EA 4NWKA 1GJ5H 1FXYA 2UUKB 2BLWA 1QJ6B 1NU7B 1EAIA 1DSUA 1HYLA 3F9EA 3OU0A 3LC3A 1YPMH 1TPPA 2AFQB 1N6YA 1HBTH 4BXWA 1JOUB 1GI7B 1XM1A 1ZHMA 2J38A 3MH5A 3S69A 1TGSZ 2BDIA 2QGRA 3A8CA 5FPYA 3RLWH 1Y5BT 2ZCLP 5DKMA 2F9BH 1MTUA 1FDPA 3ODFA 1XVMA 1BBRK 1GJ9B 1CHOF 2Z7FE 3BV9B 1BT7A 2ZFFH 3KHVA 1ACBE 2BQ6B 1A7SA 2FOMB 1C9TA 3A7YA 4CHAB 2ANYA 3M7QA 2BD4A 1HAVB 3TJVA 3BEUA 2WPLS 2PLXA 1P2NA 1TNJA 3LT3A 3NUMA 4LXBH 1P06A 2ODQA 1YPHC 7GCHG 1C2FA 1CA0C 4O9VA 1HJ9A 1V2WT 2SGEE 4X8UH 6LPRA 1GI9B 1K22H 1T7CA 1GVLA 5CE1A 4BAMB 4Z6AH 4X2VA 4HTCH 2Y81A 1Z71A 3M5MA 1ELTA 5LPFA 3AASA 5FPSA 4AX9H 1BTHH 3A80A 2BQWB 1C5QA 1KXDA 3GY7A 1GJ8B 4AYYB 5IDKA 1A1RA 2J95A 2XXLA 4IC5A 1O5EH 3QX5H 6ESTA 1BBRE 1QB9A 1NRSH 3T27A 2Y7ZA 4FU9A 1K28D 1P2KA 1CHGA 2ZHEH 1MQ6A 5CHAC 2TGAA 3UQVA 4DIIH 4WJG2 1A46H 1GDNA 1QB1A 1O5CB 4VGCC 3B23B 3RXFA 1KTTB 1QQUA 4BAKB 2SGDE 1MTNC 1CBWB 3PV4A 3ZVCA 1C1QA 2FM2A 1HGTH 1RTKA 4MPXA 1GGDB 3SW2B 1C4V2 2HPPH 3V13A 4UDWH 1LMWB 1QL7A 1QRWA 3A7VA 1TPAE 2FODA 1TGTA 3SGAE 3EA8A 2BD7A 2FZZA 2OCVB 3FP7E 4MNWA 1EXFA 4OS4A 3ZYDA 3EYDA 1BRUP 1ZSKA 4MPVA 1G30B 1HXFH 1LHGH 3JZ2B 3W95A 3Q3KA 2XCNA 2BVRH 1QCPA 3BF6H 2D8WA 3SUFA 5CMXH 3GYMA 1O2NA 1O31A 3E0PB 4YM9A 3EE0B 1GHBG 5ABWA 3M61U 3HGNA 4CH2B 1MUEB 2A5IA 1UK3A 4AGKA 2HNTE 2VINA 1MKWK 2BQ7B 5HM2A 2P8OB 1OWJA 4AFUA 4YOIA 3F68H 4I32A 1EP6A 3FAOA 3QZRA 1EASA 2OP9A 3TK9A 3VB3A 3RC4A 1GPZA 4A1VA 2H5CA 3O8RA 4X6MA 1GBDA 2WPIS 2BY9X 1P10A 5FX5A 1C5VA 3K6YA 1ETRH 1SGCA 4A7IB 1P2MA 3SV2H 5HYOA 2A4GA 1GVZA 1CT4E 2BD3A 1C5WB 1CT2E 3BG8A 3FVFB 1AZ8A 2FOHA 3RU4T 1NPMA 1N1LA 1LQEA 2J94A 1WU1A 2ZGJA 1YPLH 2FXRA 1IQGA 2G8TA 3A81A 4B2BA 4K3JA 4Y0ZE 2BMGB 1KDQB 1DXPA 1GJDB 5A8ZA 1DPOA 1C2EA 4TPYA 3UFAA 1G3BA 1NY22 1D3PB 2A7CA 2QYIA 2VU8E 3M5OA 4RSPA 2W5EA 1UVPA 4GHTA 1JIMA 2KAIA 1UVSH 2P3UB 4I7YH 2W3KA 4CREA 1HIAA 3TJNA 3TVJB 1U6QA 3ODDA 1A2CH 1W0YH 4XOJA 2TGTA 2P59A 3GCTF 4WMEA 2IPHA 5SGAE 3KQEA 1A5IA 3SU0A 4H4FA 7KMEH 3E1XB 1PFXC 5FBEA 1BTWA 1W2KH 5EPNA 1O2HA 1KLIH 1B0EA 3PM3A 2H6MA 3RXBA 1P02A 1W13U 4RKJB 1C2JA 3PMJA 2JETB 3PLBA 2YOLA 2GD4B 5HMAA 3UY9A 3RXMA 4LK4A 2AS9A 5JB8S 4XBBA 1KXAA 4ZXYH 1DS2E 1DWBH 1TX7A 3ELAH 1EB2A 1HJAB 3U98H 1UTMA 1SB1H 4NZQA 1QBVH 1SQTA 1LQDB 1TB6H 4DURA 2ZCHP 3PROA 3GCNA 1AO5A 1WTGH 1E34B 1MU6B 1THRH 1O2RA 1VCQA 1YGCH 3ZZ7A 3DT0H 1WBGB 4I8HA 4O3UA 2G4UA 2ZO3H 3D23A 4FVDA 5AFYH 4BOHA 1MH0A 1T4UH 3M7UA 1O3LA 3DUXH 1YF4A 1YCPH 4BXSA 4GCHF 2Z94A 2UWPA 4BTIB 2G4TA 5JYIA 1P3CA 3EGKH 4FUHA 2ASUB 1QB6A 3ESTA 4FUIA 2FESH 3HATH 4D8NA 1UTPA 1ZYOA 1RJXB 1W10U 1W7XH 5H4IB 4A5TS 3QN7A 2ZFRH 5C1XA 1QRZA 5GIBA 5EG4A 5AF9H 7ESTE 1EAUA 5T6GA 2OLGA 1TA6A 2ZDAH 3Q3YA 2ZKSA 1OS8A 3QLPH 5C20A 2ALVA 1QIXB 1CE5A 5F8TA 1CGHA 2P94A 1HAZB 2I6QA 1K1PA 1F0SA 1P2OA 4AB9A 1SI5H 1V2MT 2F9VA 2BHGA 5EU8A 3TK5A 1GBLA 1TGNA 2ZGHA 4ABAA 1SBWA 1FPHH 1OPHB 4DVAU 5JBAS 3TGKE 2PSXA 4JZEH 2OXSA 2D2DA 2Z3DA 3P8FA 4I8GA 1SLWB 4JZIA 1V2TT 3B8JA 2A2QH 1NFWA 4DIHH 1C2MA 1LHCH 4UFEH 1KTSB 2CMYA 4E05H 1TALA 1O3PB 4FUBA 4X1QU 2AMPA 4X1RU 1P3EA 3M3VA 2O8LA 2RCEA 1G3DA 1YC0A 4ESTE 1E38B 1BMNH 2SFAA 2XC0A 1E36B 3QDZB 1UTNA 1ZSJA 3K9XB 2J9NA 4WY3A 3ZZ4A 4JZFH 2VVCA 5EW2H 4K1EA 2ESTE 3F9GA 2XC4A 1GDQA 4D9QA 4DCDA 1O2LA 2EEKA 1UHBA 1ZHPA 3RXPA 4ABGA 1T8MA 3RXIA 1ZGIA 2C93B 1CHOG 1AQ7A 1PPHE 3BN9A 1P9UA 3ATWA 4X2XA 1EATA 1YCPK 1VJ9U 1K1OA 4FU8A 1FMGA 3GDVA 1PPEE 1YM0A 2FEQH 3FANA 1WYKA 1YLCA 3SU1A 5A2MH 3QUMP 3HGPA 3MU1A 2QV1A 4FUFA 2G81E 2Z9LA 2HWLB 3UUZA 2ZDLA 1BRAA 2UUYA 2GZ7A 1EAWA 3RXRA 3LKWA 1O2QA 1C1SA 1V2RT 2BY5X 4TY6A 2ZTYA 1GMHF 1RGQA 3F9FA 2FI5E 1T4VH 1WSSH 5EGMA 2P16A 1HAXB 4THNH 5L2ZH 4KTUA 1S6HA 1WTHD 1SHYA 2ZDVH 4FUEA 1MKXH 4WH8A 3A89A 3BTME 2HPQH 4K2YA 1O2TA 3MFJA 2J2UA 4YLUA 4BAQB 1GBKA 1WCZA 1QRXA 2XC5A 1FZZA 1ANEA 1O3FA 3AAVA 1Z8RA 2G00A 5BRRE 3SNCA 4LZ1H 1UCYE 1OX1A 2BY8X 3ZZ9A 2P93A 1MMJN 1DXWA 3ENSB 1Q3XA 2OINA 4ABDA 3RXOA 1RS0A 1CO7E 1LDTT 8GCHF 2F3CE 3STIA 5TCCA 2XCFA 3MO9A 1ZRBA 3PO1B 1NRRH 4Y7AA 5ESTE 3U8TH 1TAWA 1GBFA 1AY6H 1YYY1 1ZSLA 3SHCH 1ZR0A 1J17T 5L6NH 1DOJA 4PROA 1AB9B 1ARCA 1UVUH 3MNXA 3M36A 2Q1JA 1AIXH 4DW2U 1J16A 3A7TA 5B6OA 4NSVA 3UNRA 3RXJA 4X8TH 1ZTLA 4X8VH 4ZKRU 1OSSA 1PPFE 1TPSA 1SR5C 1Z8JB 1O5DH 4ZKOU 1MZDA 3DA9B 3TH2H 1GBCA 2ZGBH 1BTUA 5AVDA 2BY7X 1ZGVA 3BEFB 2UWLA 1HCGA 3TJUA 1AE5A 3S9BA 3U1JB 1A0JA 2WYJA 1K21H 5C3NA 3ATLA 2BLVA 3M37A 1SOTA 8LPRA 3UR6A 1G3CA 1YPHE 2TIOA 2QAAA 3MMGA 3ZVFA 5I46H 1O2MA 3RU4D 1ZTKA 3UOUA 2Y5GA 2ZZUH 3U1IB 2Y5FA 2LNCA 3SOSA 2OBOA 1XUGA 2WINI 2VJ1A 1OWEA 1TBQH 3A86A 1H4WA 3A87A 1J14A 2C8ZB 1TE0A 2QN5T 3A8AA 4NWLA 3PTNA 2GX4A 2JKHA 4X1NU 2PGBB 3UWJH 4GUXA 2VH6A 1MQ5A 1SGFA 4CHAC 2O8UA 4LOYH 2H9EH 3GDUA 1CT0E 3MU8A 1V6DA 1BRCE 2GV6A 4DOQA 3NK8A 1ZRKA 1S84A 2Z9JA 3BTWE 4ABIA 1Q2WA 2PKSB 1ORFA 2ZHWH 2IN2A 3GY5A 2R2MB 3MNCA 3K6ZA 3SU2A 2R0KA 3SUEA 1AFEH 2C4FH 2YNBA 1IQMA 3ZZDA 2O8TA 2NU2E 1PQAA 5EOKA 4CR9A 5K7RA 1G32B 1SFIA 3P8GA 2FO9A 3A7XA 1EOJA 1LVMA 2G5NA 2ODPA 2PKSC 4D7GA 3O8CA 1N8OB 1MCVA 4Q2KA 1W7GH 1H9IE 3HK6B 3SJ8A 2ANKH 3Q76A 3VGCB 4F49A 1FV9A 1E35B 1SPJA 1GL0E 1Y3UA 6CHAC 3AW0A 1ZLRA 2WPKS 3RXQA 2HALA 1K1JA 8KME2 1QL9A 2EA3A 2VNTA 5C2ZA 1ZPCA 3R0FA 1UTLM 4HFPB 2FX6A 3PB1E 3ZVBA 4UD9H 1LTOA 1MTVA 1GMHG 3SNAA 4AG1A 2PHBA 3P95A 4DGJA 3L33A 5A09A 3P17H 2BD2A 2R3UA 4D9RA 1AUTC 3G01A 4Q7XA 2ZU5A 1P9SA 1TA2A 1TIOA 4IN1A 2NWNA 2ULLA 1GI1A 2W7UA 4XDEA 2PKAA 1MKWH 1ANDA 1FLEE 3SU6A 4J2YB 2H2ZA 1MAYA 5EQSA 1AZZA 1GG6B 2A5AA 1OYTH 1EAXA 1O3CA 3KF2A 3O8DA 3PWCA 5A8XA 4X8SH 2P95A 1ZJKA 4KP0A 2SGPE 2A7JA 1RIWB 3B9FH 4YTAA 2FS9A 2VIPA 1XUJA 1GHBF 1LPKB 4NIXA 2BXUH 3K65B 1Z1JA 1NRNH 1OKXA 1Z1IA 3OSYA 3GY2A 4MG3A 1D6WA 1AWFH 2AMDA 2FI4E 4BTUB 1BRBE 3SN8A 1O2VA 1NU9A 2A4QA 3NCLA 1Y3YA 4TYDA 2PKAB 4GLYA 1LKBA 4YOGA 1ABJH 1FPCH 3CS0A 4X1PU 2ZGXH 3LONA 3EDXB 2BVSH 1TFXA 3DD2H 2STAE 2IJOB 1GHYH 1UCYH 2Y5HA 1UCYK 2BX3A 2QC2A 2ZI2H 2ZCKP 1F0RA 1Y59T 1D3TB 3BTFE 1GHAG 3IITA 1CU1A 3TITA 1SG8B 2AERH 3DFJA 4AZ2B 3C1KA 1AVGH 1TOCB 5C1UA 2W3IA 2F9OA 2F83A 3E16B
chains in the Genus database with same CATH superfamily
3KNXA 3HPTB 3L3TA 1F7ZA 4TPIZ 2BXTH 3RXUA 4Q7YA 1DWEH 4IMQA 1L1JA 4WMFA 2AGGX 2AEIH 1IQIA 4INLA 1C5RA 3TH4H 1KXEA 1SGTA 3H7OA 3M5NA 3PLPA 4HGCA 1C5OH 3MI4A 1VITH 3LH3A 1ELGA 3GY3A 1LHDH 3DSOA 4XSKU 4TWWA 1PPBH 4ISLA 1EP5A 1IAUA 1H9LB 2LP6A 4Y71A 1IQLA 2RA0A 5E0GA 2ZGCA 1IQHA 1VZQH 3RXLA 4A6LA 2FX4A 1XUIA 1P03A 3RP2A 5EQRA 1O36A 2D26C 5KEDA 3H09A 5LGOA 2ZWLH 1V2KT 2H5DA 3MOCA 3VB5A 1ELCA 5EXNA 2JH5D 2FOCA 1TLDA 2FYRA 1HAHH 1NO9H 1V2OT 1GDUA 1P0SH 2OQ5A 3I77A 4NZLA 1HXEH 3S7HB 1GMCG 1PPZA 2PV9B 5EODA 3GCHB 2PUQH 4KTSA 4X6PA 3SV7A 1D3DB 5DGJA 2XTTB 3TPIZ 1L1GA 1SFQB 1ELBA 2BZAA 5LPEA 2B7DH 3PV2A 2Y80A 1LHEH 1O2ZA 3S9AA 4F48B 1KSNA 2HGTH 5A8YA 2ZHDA 3GY8A 2F9UA 1TYNA 2IPQX 2VGCC 4NIVA 1C5NH 1DFPA 2ZTZA 2YMSD 3UTUH 3RMOH 1T32A 2PR3A 1VGCB 1H1BA 2VWMA 1NC6A 4FXGH 2C90B 3QGNB 4B2CA 2LELA 1F2SE 5AFZH 1KLTA 1DLEA 1UHBB 2ZU3A 4KELA 2J4IA 2ZU4A 3GCHC 3A85A 1TNHA 1GHZA 1DWCH 4BANB 1FIWA 2RFKC 3RM2H 3SQEE 3IG6B 1S82A 1EUFA 4TWYA 1IQJA 1MAXA 1ANCA 1BTZA 1IQEA 3KYGA 2A1DB 3F3BA 1S83A 3GY4A 2PSYA 1AUJA 4K5ZA 1HUTH 1OOKB 1P04A 3SNEA 1OWHA 3LOXA 1FY5A 1WQVH 2FMJA 2PUXB 1AWHB 2AYWA 3M7TA 1E37B 5HIYA 2QF0A 1EKBB 1GJCB 1Y3WA 1AKSB 2PTCE 4FUCA 4I86A 2C8WB 4GVUA 4MNXA 1BJUA 4X2WA 4U01A 1V2QT 3LJOA 3UQOA 3KYFA 1O5BB 1F0UA 4IS5A 2GGVB 1TRNA 1SGNE 1OXGA 1EZSC 1O5GH 4WXVA 5FL7D 1BJVA 4E7NA 1AE8H 3SNDA 1P2IA 2G52A 1FQ3A 1JXPA 3OY6U 1QQ4A 2UUFB 2J98B 1O2WA 1O3JA 1H8DH 1D6RA 5JBTA 4NIWA 1C1RA 1HDTH 2JJ2D 1DVAH 1GBTA 4OS7A 1GHAF 3SU4A 4MNYA 2A45B 1O3AA 1NRQH 2C3SA 3EQ0H 5I25A 3SV6A 3FP8E 1RXPA 2KCOA 4H6SB 2FLRH 2EI6A 4AN7A 3BTHE 3DCLA 2Q6GA 1TQ7B 4O97A 1VGCC 1EZQA 1OP8A 1QNJA 2XNDD 4RT0A 1YPJH 2VH0A 4YT7H 1OP2A 4DY7B 2D1JA 4GSOA 4X2YA 2VVUA 5T1VA 1QJ7B 5JDUB 1FONA 5C17A 1EPTC 1L4ZA 3RLYH 1GBJA 1TX6A 1P12E 2SGAA 3RMMH 4SGBE 3RU4E 2ZF0H 3ZVAA 2QXIA 3MYWA 2V3HH 3WY8A 3JZ1B 1TNGA 2ZDKA 1BOQA 1LO6A 1FI8A 4JZDH 1P09A 2SNWA 5GDSH 3AVZA 2FPZA 1K2I1 1OWDA 2OK5A 1HV7A 1GJ4H 1J8AA 2FYQA 2GDDA 1OWIA 4ACBA 4AFQA 1HAOH 4Q63A 1WXRA 3LIWA 5L30H 2ZTXA 3DHKH 4SGAE 3TGJE 2TBSA 1S5SA 2CF9H 3OAAD 4B71A 1Z8GA 1EZXC 3T25A 1Z6EA 4IMZA 2VWLA 4NG9H 2CGAA 2ZFSA 4X6OA 5A0AE 3F6UH 2GT8A 4K8BA 5C1YA 1TWXB 4J1YA 1GL1A 3ZZ3A 3F1SB 2QCYA 1XUFA 4I8JA 4AGJA 1KDQA 1QBNA 2NU3E 1V2LT 3KQBA 3PTBA 1HNEE 1ZJDA 1HB0B 2ZPSA 1PQ5A 4JYUH 5EXMA 2VGCB 2CK3D 4IGDA 3HK3B 2CV3A 2KAIB 4B73A 3HKJB 1ELEE 1FAKH 8GCHG 4WF8A 1P01A 3KN2A 3EA7A 4NA9H 1X7AC 4Q80A 3QGJA 7GCHF 1TMUH 1TQ0B 3KL6A 3T26A 4AB8A 1BQYA 1B7XB 1FN8A 5F53A 2O8MA 1S0RA 4OS5A 1PPCE 3CENA 1K9OE 4U32A 3U69H 2TGPZ 1UK2A 3ATMA 1ESTA 1SOZA 1FUJA 3QK1A 1TNLA 5JBCS 1O37A 4NSYA 3A7ZA 2ZIQH 1GCTC 1GJAB 1O3DA 2ILNA 3QWCH 1YKTA 3SU5A 3PLKA 4FUGA 4RKOB 2IJD1 4XBCA 9LPRA 1XX9A 4XFQA 5IYTA 2CJIA 1RIWC 5EJZA 1ZZZA 1JBUH 1OP0A 1W11U 1O2YA 1NBME 4ZHLU 2G51A 2WUBA 3VB7A 5TJXA 1UTJA 3RXTA 2BDAA 2VIDA 5JB9S 1MTNB 1TOMH 4UONA 1RRKA 4MDSA 4BAHB 3TGIE 1RD3B 3RXAA 1RTFB 1C5UA 1INCA 2FIRH 4JYVH 3RC5A 2Z6BD 1BIOA 1WAYB 4MPWA 4YT6H 1YLDA 1UVOA 4E06H 4K1TA 1EFRD 1JRTA 1PYTD 1E1QD 1FY4A 4ISIH 3E8LA 1UTOA 3T5FH 3KQCA 2WUCA 2WYGA 5FX6A 2QF4A 1PQ7A 1IHSH 1V2PT 2ZFQH 4AFSA 1UTKA 2EY4C 4TY7A 1GI2A 2HVYB 1TX8A 3PRBA 4IC6A 3SORA 1N6XA 1VKYA 4U30A 2QXJA 4MPUA 1O5FH 4ABEA 4Y10E 1QZ8A 1D4PB 4JK5A 5GJ4B 1ID5H 3KGPA 1SVPA 2THFB 2Q6DA 1GMDF 3SBKA 5T6DA 1AN1E 2O9QA 1BBRH 2J34A 1EZUC 1O2IA 3MH4A 4O03A 1D9IA 1O2GH 1QJ1B 3SNBA 3BIUH 4DG4A 3HKIB 4M7GA 1SGYE 2OD3B 4YOJA 1GHWH 1GJBB 3RUOA 4ZKNU 1NROH 3T62A 1BMAA 4D7FA 2VWOA 3QTOH 3MH7A 3GY6A 3DSGA 5AHGH 4QT8C 3MTYA 1BB0B 1C1MA 2CHAB 4FUDA 2I6SA 2OQUA 2KR7A 2Z9KA 1AVXA 1T8NA 4INKA 1LPGB 5C67A 2OTVA 3QZQA 3BTKE 4GCHG 4WVPE 3PMAB 2ZDNA 3P8NA 1EPTB 1L0ZA 3VPKA 1O35A 2A0QB 3RDZA 1AD8H 5FPTA 1AFQB 2K0QA 4CRDA 3FN8A 4K1SA 1LPZB 2V0BA 2R2WU 3RXVA 1TGCA 3U9AH 5GCHF 2XRCA 2GTBA 1O3OA 4ZH8A 3SI4H 3GICB 4ZROA 2GV7A 2ZHFH 2OC8A 2Y7XA 1H8HD 1PQ8A 3A84A 1VJAU 3ZVDA 1GBBA 2AHME 3BG4B 1DANH 2XNIA 2W26A 1SGRE 1THPB 3SGBE 1GMCF 1BMMH 4HZHA 3FP6E 1AU8A 1H9HE 5E0HA 2EC9H 3TNTA 3LPRA 1UVTH 4YO9A 1O3GA 2ANMH 3KEEA 4B1TA 2ZFPH 5HIZA 2FWWA 1SGFG 1K0HA 1V2JT 3CP7A 3GYLB 2CHAC 4KGAA 3K2UA 2PW8H 1H8IH 2XBWA 1C5XB 1FAXA 4I31A 1O2OA 2FS8A 3FZDA 5F8ZA 1SLUB 2QXHA 3T28A 1MCTA 1WQSA 3OEHD 3BTQE 1J15A 1LVOA 1QA7A 1VCWA 2NU0E 2K1QA 1C1UH 1SQOA 1MU8B 4OS2A 3UNSA 1QGFA 3F2HA 2FTMA 3I78A 4B75A 3NPSA 1TONA 2UUJB 3EA9A 1C5YB 1Y8TA 2AH4X 3V12A 2AIPA 2RG3A 4MQAA 5HXFA 3SI3H 1SGQE 2GZ8A 1EJAA 3M35A 1WUNH 1ZPZA 2FOEA 5HM9A 1GBHA 1IOEA 5L2YH 1GMDG 1Q31A 3BTEE 2Z9IA 3LJJA 2WPMS 3I29A 2F9PA 3ZVGA 2J98A 3PYHA 3U28C 2KCPA 2FOFA 1NT1A 1YBWA 5HGGA 1L2EA 3SZNA 5E2OA 4ZMAH 3A83A 2QA9E 3STJA 1L1NA 3BTGE 1TPOA 2BY6X 3A7WA 4O3TA 1G9IE 3LH1A 1B5GH 5KGOA 3SHAH 4Y7BA 3RXSA 1ABIH 1NM6A 2BVXH 2GP9B 3GDSA 1SC8U 3FOAA 1C5LH 4HI3A 1ETTH 1S6LA 2B5TB 1AKSA 1W3CA 2A5KA 1MBQA 2VIVA 3OEED 1V2ST 1KIGH 3SJOA 1C1WH 1NTPA 4AOQA 2AGEX 1HPGA 1F92A 5FHTA 1JWTA 1O2UA 3A8BA 1CA0B 3VXEH 2W6ID 5F8XA 4DJZB 1HAPH 2HNTF 1HFDA 1ZHRA 2B9LA 1BMLA 4A92A 2OC1A 1SGPE 4ISOA 1O0DH 2V7QD 1YPKH 4GHQA 4ZKSU 1N8OC 2NU4E 1DDJA 4GPGA 1SQAA 5ETXA 1PPGE 2ALPA 1O3IA 4Q4LA 3ITIA 1O3EA 5FCKA 2H1UA 1QR3E 1AI8H 3VXFH 2GMTC 4A1TA 2BOHB 3BIVH 1ELDE 5DPAA 4Y0YE 3LU9B 1HJAC 1O33A 1G36A 2J92A 3TU7H 3MNBA 1QURH 2BD5A 1GI3A 2A7HA 4OGXA 3A82A 1F0TA 5EQQA 4X0WU 1C4U2 1TMTH 2RA3A 2STBE 1ANBA 1ELFA 1KYNA 5K0HA 3L6PA 2HRVA 4NCYA 3UNQA 5TCAA 3SU3A 4ISHH 4YESB 1T31A 2G5VA 5CDFE 1AFQC 1BMFD 1EPTA 3LGTA 4CRGA 2G55A 4FVBA 2PTNA 2AMQA 2BM2A 1VITG 4XE4A 3UB0A 1CVWH 1C4Y2 4X6NA 3A88A 2TGDA 2WV5A 2C8XB 1YPGH 1C5SA 1G2LA 1P11E 5BPEA 3AK5A 1IQNA 1GBMA 3VGCC 3FZZA 1J9CH 3URDA 1HAIH 2ZC9H 4B76A 5FXLA 1BZXE 4ASHA 2IOTA 1MTSA 2B0FA 1FY8E 5LH8A 2P3FH 2ZPQA 3Q3XA 1GI5A 1SKYE 1FY1A 2AIQA 3W1EA 1Y5AT 1C1NA 2RDLA 3P70B 5PTPA 1VITF 4ZHMU 1C2DA 3VG8A 1SMFE 3ZZ5A 1C5ZB 2ZU1A 3RXKA 3V0XA 1G3EA 1GHXH 2A2XH 1UK4A 3E6PH 3KQDA 5JPMH 3PMHB 2OC7A 2QXGA 1EX3A 4NFEA 1FY3A 1LHFH 2BOKA 5EPYA 1MD8A 1DLKB 1EB1H 2BD9A 1P2JA 5FBIA 1Z8IB 4ZCNA 5T6FA 4ABBA 1CQQA 3QTVH 3OYPA 1TMBH 1GI4A 7LPRA 3UIRA 1TRMA 1AVWA 2ZP0H 4INHA 2ZDMA 1NS3A 5J4SA 4UFDH 4ABFA 1O3MA 3C27B 2LPRA 4CBNA 5CHAB 4BAOB 3UPEA 1O2XA 4B6FA 1JMOH 2BDCA 1HAYB 3VB4A 1CSOE 4GAWA 3RM0H 2ZNKH 2A32A 2FOAA 1O2SA 5FCRA 3R3GB 3F0OA 1C9PA 1YCPM 1T8LA 3RXGA 1QBOA 1GBEA 3MU0A 4ASUD 2ZPRA 5FAHA 3GCOA 5DK1A 3LDXH 1SHHB 1C5TA 4B74A 1THSH 1O3HA 3SUDA 1G37A 1GBAA 2XBXA 3MQKC 1V2NT 3MNSA 3NXPA 1S85A 2ODYB 2YMSB 1OHHD 5ESBA 2Q6FA 1P2QA 3E3TA 1W8BH 2QIQA 3OY5U 2K8IA 4IW4E 2A31A 4ZHAA 1A61H 3VEQB 2ZQ2A 4ACAA 1HJ8A 3TH3H 1HIAB 3N7DA 4Y8YA 3SJIA 1GHVH 1O32A 4CRAA 3TIUA 3NZIA 2TRMA 1NZQH 3CS7A 1SSXA 4DT7B 1GGDC 1EJMA 4CRFA 4MLFB 2R0LA 2P3TB 1BDAA 2O8WA 2ZA5A 3H5CB 3ZVEA 1GWAA 2YNAA 3BTDE 1FJSA 3UREA 3SUGA 2HVXA 1XVOA 1O5AB 5DP8A 5T3HA 5LPRA 1TNKA 3UOPA 2NU1E 2ZEBA 1M9UA 1NESE 1GI6A 4P00A 3ZV9A 1TABE 3E91A 4AC9A 2OBQA 3VB6A 1GBIA 3IWMA 1LKAA 4AG2A 4ABJA 3S7KB 3ATKA 3F0PA 3ZZ8A 5C0TA 2VIQA 3D62A 2WSSD 2Z3CA 3MHWU 8ESTE 3T2NA 1IQKA 1A3BH 4RN6A 3ATIA 2GDEH 4NFFA 1F5RA 2GCTB 1OYQA 3A8DA 1FIZA 4AYVB 1SGEE 4CH8B 2ZG0H 4IBLH 5GCHG 2GCTC 3UR9A 2R3YA 2JH0D 4ABHA 5J4QA 1ARBA 1C5PA 1ZMNA 2H9HA 2KCAA 1BA8B 4Y79A 1A3EH 3AW1A 1IQFA 3LGVA 1A0LA 2RDEA 2WPJS 2ZHQH 1ZPBA 3RMNH 3V3MA 3RXHA 3SV8A 3GOVB 4Z0KA 4NGAH 3KIDU 5EXLA 2GT7A 1MTWA 3SJKA 1YP9A 1A4WH 2HLCA 3Q77A 1TBRH 1UMAH 4JZ1A 3P92A 2F91A 4ISNA 3SGQE 1WV7H 1TNIA 4I8LA 1JRSA 3E90B 1MBMA 2BDGA 2FOGA 4WH6A 1MABB 4Y8ZA 4CRBA 1E1RD 1TRYA 2SGFE 3H7TA 1SL3A 1ESAA 2BDBA 2CN0H 3V7TA 1W0ZU 4UFFH 6GCHG 2F43B 3SO3A 1MD7A 1FX0B 3ZV8A 1K1LA 2CXVA 1Y5UT 2VVVA 3TK6A 3PO1C 3PRDA 3TNSA 3URCA 1C2GA 2VIOA 3LGIA 1O39A 4R8TB 1CGIE 1PYTC 2SGQE 3WWBA 1HAGE 3LGUA 2BB4A 4I33A 1HLTH 2SNVA 1EJNA 1C1OA 3MWIU 4FOUC 4UFGH 5DP5A 1GG6C 4IN2A 1C2KA 1B0FA 1DITH 1HRTH 5E2PA 2BLQA 2GCHF 2FTLE 5GPIB 1DX5M 2B8OH 3GISB 4K60A 5IK2D 4UEHH 1VCPA 3OTJE 1KY9A 2ZU2A 3KQ5A 4H6TA 2XW9A 1EQ9A 1BUIA 3D65E 1D3QB 4BNRA 4R0IA 1C2LA 1OWKA 3M5LA 9ESTA 2PGQB 1KXCA 3LC5A 1O3BA 2BTCE 4A1XA 2FOBA 1F5LA 2Y82A 2C8YB 1UO6A 2FP7B 2Z9GA 2M5TA 3RC6A 3MO6A 2JETC 3ZYEA 2AGIX 3W94A 2Y6TA 2BYAX 1K1NA 4Y11E 6GCHF 2WPDD 1HAVA 2FLBH 4CR5A 4MTBA 1KLJH 2VIWA 2WV4A 1MZAA 1XKAC 3MU5A 1O38A 1O2PA 3SJ9A 5E0JA 3P6ZB 1CA8B 4YZUA 1XMNB 1ETSH 1S6FA 1F5KU 1W12U 1NFUA 2OUAA 1ZMLA 3P8OA 4JYTA 4LZ4B 1BHXF 1SGIB 4CBOA 1QL8A 1KXFA 4XBDA 4VGCB 1L4DA 3S0NA 1GCDA 3PMBB 5EW1H 1PJPA 1TBZH 2WZQA 3SYJA 1E0FD 2BDHA 2ZQ1A 3RXCA 2DE9A 2F9NA 4I8KA 1C2IA 3ZZAA 2XBVA 4F4OC 1RFNA 2BDYA 4WXIA 4OS6A 1NN6A 1NFYA 4D76A 1BTYA 1KXBA 3RXDA 1GVKB 1DT2A 1LVBA 3BEIB 2QY0B 5DP4A 1NBMD 5C5NA 1T8OA 2WV9A 1IHTH 1BCUH 2WPHS 5G4BA 1SGDE 6CHAB 1O34A 4WMDA 5C0UA 2XYAA 4X1SU 2HOBA 1K1MA 5GXPA 2QF3A 1GI0A 3GS9A 1DUEA 3RXEA 4CRCA 4MNVA 4Q7ZA 4H42U 1WDIA 1BITA 2GVFA 2KX4A 1RTLA 3M3TA 5DN6D 4JMYA 5JBBS 3NKKA 1QFKH 3ZZ6A 2P8OC 1LVYA 2ANWA 1A0HB 4JCNA 3T29A 4NA7A 4NA8A 1DM4B 1XXDA 2BX4A 1A5HA 1QHRB 3KCGH 4Y8XA 1Y3XA 1FNIA 4NIYA 5DSFA 2GCHG 2GKVE 1QA0A 1A5GH 2UWOA 1XUKA 3Q00A 1P57B 3TJOA 3SZEA 2V35A 2PWXA 1GJ6A 1O30A 1TGBA 1XKBC 2V3OH 3F2FA 2W7SA 2DUCA 3DFLA 2EI8A 1V3XA 1C1VH 1C1PA 1DWDH 3M3SA 2A4OA 5GWZA 4FU7A 1FN6A 4ZXXH 3UAIC 3TLOA 2JH6D 3QO6A 4OS1A 3BSQA 3GCTG 1DY8A 1S81A 1K1IA 3PWBA 2DE8A 4ZUHA 3BTTE 2V3MA 1C2HA 3ZZCA 4OGYA 1GJ7B 2XWBI 5E8EH 3FFGA 4AORA 1GI8B 4E7RG 3OX7U 5F03A 5DO4H 2BD8A 5DP3A 2BZ6H 1QY6A 5F6MA 1BHXB 3MH6A 2TPIZ 3LGWA 1ESBA 3E0NB 2H9TH 3D49H 3N99A 1O2JA 5DG6A 4TT3D 3O8BA 3EAJA 1BTXA 3AAUA 1AHTH 3VFEA 1DE7H 4M9FA 1MKXK 4FUJA 3RMLH 1XXFA 1ELAA 1QTFA 1ZOMA 1NFXA 1CGJE 4AFZA 4ZAEA 1UTQA 2V6NA 5DJ7A 2FDAA 3SV9A 2EI7A 1AGJA 1O2KA 4K69A 4KKDA 3DSPA 1W14U 1JIRA 1DUAA 1ELVA 3F9HA 4U2WA 1YWUA 2L6OA 1SLXB 2GMTB 2ZFTA 3S9CA 4WWYA 2ZECA 3N7OA 1XUHA 4YLQH 1AB9C 2J97A 4UE7H 2GZ9A 1Y3VA 5A0BA 1GCTB 4JK6A 2XBYA 1S0QA 4KTCA 5A0CA 5DP9A 4BTTB 1VR1H 1NRPH 4Y6DA 1ZMJA 2R9PA 1AMHA 5C5OA 3UWIA 1EOLA 5C94A 1DY9A 1YPEH 2A4RA 1Z6JH 3MO3A 1C5MD 1CBWC 1V2UT 5DP7A 3ZZBA 1DICA 1DSTA 1ZTJA 2XWAA 4K8YA 2PFEA 3U8RH 3LGYA 2HNTC 1G2MA 1LCYA 2OC0A 1SLVB 3MU4A 3NWUA 4MVNA 1UJ1A 3BG4C 2BLOA 1O3NA 3N7EA 4F55A 2VB0A 3FO8D 1BTPA 4B2AA 1C1TA 5DP6A 2CF8H 1V2VT 2FI3E 1O3KA 2VWNA 3WWFA 4Y76A 1P8VC 1WOFA 1P05A 3SQHE 3U8OH 1Z7KA 2Z3EA 4NWKA 1GJ5H 1FXYA 2UUKB 2BLWA 1QJ6B 1NU7B 1EAIA 1DSUA 1HYLA 3F9EA 3OU0A 3LC3A 1YPMH 1TPPA 2AFQB 1N6YA 1HBTH 4BXWA 1JOUB 1GI7B 1XM1A 1ZHMA 2J38A 3MH5A 3S69A 1TGSZ 2BDIA 2QGRA 3A8CA 5FPYA 3RLWH 1Y5BT 2ZCLP 5DKMA 2F9BH 1MTUA 1FDPA 3EE7A 1XVMA 1BBRK 1GJ9B 3ODFA 4YXWD 1CHOF 2Z7FE 3BV9B 1BT7A 2ZFFH 3KHVA 1ACBE 2BQ6B 1A7SA 2FOMB 1C9TA 3A7YA 4CHAB 2ANYA 3M7QA 2BD4A 1HAVB 3TJVA 3BEUA 2WPLS 2F4LA 2PLXA 1P2NA 1TNJA 3LT3A 3NUMA 4LXBH 1P06A 2ODQA 1YPHC 3ZIAD 7GCHG 1C2FA 1CA0C 4O9VA 1HJ9A 1V2WT 3NRLA 2SGEE 4X8UH 6LPRA 1GI9B 1K22H 1T7CA 1GVLA 5CE1A 4BAMB 4Z6AH 4X2VA 3CNRA 4HTCH 2Y81A 1Z71A 3M5MA 1ELTA 5LPFA 3AASA 5FPSA 4AX9H 1BTHH 2JDID 3A80A 2BQWB 1C5QA 1KXDA 3GY7A 1GJ8B 4AYYB 5IDKA 1A1RA 2J95A 2XXLA 4IC5A 1O5EH 3QX5H 6ESTA 1BBRE 1QB9A 1NRSH 3T27A 2Y7ZA 4FU9A 1K28D 1P2KA 1CHGA 2ZHEH 1MQ6A 5CHAC 2TGAA 3UQVA 4DIIH 4WJG2 1A46H 1GDNA 1QB1A 1O5CB 4VGCC 3B23B 3RXFA 1KTTB 1QQUA 4BAKB 2SGDE 1MTNC 1CBWB 3PV4A 3ZVCA 1C1QA 2FM2A 5EIYA 1HGTH 1RTKA 3OFND 4MPXA 1GGDB 3SW2B 1C4V2 2HPPH 3V13A 4UDWH 1LMWB 1QL7A 1QRWA 3A7VA 1TPAE 2QE7D 2FODA 1TGTA 3SGAE 3EA8A 2BD7A 2FZZA 2OCVB 3FP7E 1YLNA 4MNWA 1EXFA 4OS4A 3ZYDA 3EYDA 1BRUP 1ZSKA 4MPVA 1G30B 1HXFH 1LHGH 3JZ2B 3W95A 3Q3KA 2XCNA 2BVRH 1QCPA 3BF6H 2D8WA 3SUFA 5CMXH 3GYMA 1O2NA 1O31A 3E0PB 4YM9A 3EE0B 1GHBG 5ABWA 3F2GA 3M61U 3HGNA 5GNDA 4CH2B 1MUEB 2A5IA 1UK3A 4AGKA 2HNTE 1MKWK 2BQ7B 2VINA 2KM0A 2P8OB 1OWJA 5HM2A 4AFUA 4YOIA 3F68H 4I32A 2GJGA 1EP6A 3FAOA 3QZRA 1EASA 2OP9A 3TK9A 3VB3A 3RC4A 1GPZA 4A1VA 2H5CA 3O8RA 4X6MA 1GBDA 2WPIS 2BY9X 1P10A 5FX5A 1C5VA 3K6YA 1ETRH 1SGCA 4A7IB 5KECA 1P2MA 3SV2H 5HYOA 2A4GA 1GVZA 1CT4E 2BD3A 1C5WB 1CT2E 3BG8A 3FVFB 1AZ8A 2FOHA 3RU4T 1NPMA 1N1LA 1LQEA 2J94A 1WU1A 2ZGJA 1YPLH 2FXRA 1IQGA 2G8TA 3A81A 4B2BA 4K3JA 4Y0ZE 2BMGB 1KDQB 2J5UA 1DXPA 1GJDB 2PP6A 5A8ZA 3WW7A 1DPOA 1C2EA 4TPYA 3UFAA 1G3BA 1NY22 1D3PB 2A7CA 2QYIA 2VU8E 3M5OA 4RSPA 2W5EA 1UVPA 4GHTA 5EJLA 1JIMA 2KAIA 1UVSH 2P3UB 4I7YH 2W3KA 4CREA 1HIAA 4XRNA 3TJNA 3TVJB 1U6QA 3ODDA 1A2CH 1W0YH 4XOJA 2TGTA 2P59A 3GCTF 4WMEA 2IPHA 5SGAE 3KQEA 1A5IA 4B6EA 3SU0A 4H4FA 7KMEH 3E1XB 1PFXC 5FBEA 1BTWA 1W2KH 5EPNA 1O2HA 1KLIH 1B0EA 3PM3A 2H6MA 3FKSD 3RXBA 1P02A 1W13U 4RKJB 1C2JA 3PMJA 2JETB 3PLBA 2YOLA 5HKKD 2GD4B 5HMAA 4RI0A 1SQRA 4TSFD 3UY9A 3RXMA 4LK4A 2AS9A 5JB8S 4XBBA 1KXAA 4ZXYH 1DS2E 1DWBH 1TX7A 3ELAH 1EB2A 1HJAB 3U98H 1UTMA 1SB1H 4NZQA 1QBVH 1SQTA 1LQDB 1TB6H 4DURA 2ZCHP 3PROA 3GCNA 1AO5A 1WTGH 1E34B 1MU6B 1THRH 1O2RA 1VCQA 1YGCH 3ZZ7A 3DT0H 1WBGB 4I8HA 4O3UA 2G4UA 2ZO3H 3D23A 2KFWA 4FVDA 5AFYH 4BOHA 1MH0A 1T4UH 3M7UA 1O3LA 3DUXH 1YF4A 1YCPH 4BXSA 4GCHF 2Z94A 2UWPA 4BTIB 2G4TA 3OE7D 5JYIA 1P3CA 3EGKH 4FUHA 2ASUB 1QB6A 3ESTA 4FUIA 2FESH 3HATH 4D8NA 1UTPA 1ZYOA 4XD7D 1RJXB 1W10U 1W7XH 4P02A 5H4IB 4A5TS 3QN7A 2ZFRH 5C1XA 1YY3A 3OTPA 1QRZA 5GIBA 5EG4A 5AF9H 7ESTE 1EAUA 2JIZD 5T6GA 2OLGA 1TA6A 2ZDAH 3Q3YA 2ZKSA 1OS8A 3QLPH 5C20A 2ALVA 1QIXB 1CE5A 5F8TA 2KZ4A 1CGHA 2P94A 1HAZB 2I6QA 1K1PA 1F0SA 1P2OA 4AB9A 1SI5H 1V2MT 2F9VA 2BHGA 5EU8A 3TK5A 1GBLA 1TGNA 2ZGHA 4ABAA 1SBWA 1FPHH 1OPHB 4DVAU 5JBAS 3TGKE 2PSXA 4JZEH 2OXSA 2D2DA 2Z3DA 2XOKD 3P8FA 4I8GA 1SLWB 4JZIA 1V2TT 3B8JA 2A2QH 1NFWA 4DIHH 1C2MA 1LHCH 4UFEH 1KTSB 2CMYA 4E05H 1TALA 1O3PB 4FUBA 4X1QU 2AMPA 4X1RU 1P3EA 3M3VA 2O8LA 2RCEA 1G3DA 1YC0A 4ESTE 1E38B 1BMNH 2SFAA 2XC0A 1E36B 3QDZB 1UTNA 1ZSJA 3K9XB 2J9NA 4WY3A 3ZZ4A 4FETA 4JZFH 2VVCA 5EW2H 4K1EA 2ESTE 3F9GA 2XC4A 1GDQA 4D9QA 4DCDA 1O2LA 1E79D 2EEKA 1UHBA 1ZHPA 3RXPA 4ABGA 1T8MA 4RT1A 3RXIA 1ZGIA 2C93B 1CHOG 1AQ7A 1PPHE 3BN9A 1P9UA 2WHXA 3ATWA 4X2XA 1EATA 1YCPK 1VJ9U 1K1OA 4FU8A 1FMGA 3GDVA 1PPEE 1YM0A 2FEQH 3FANA 1WYKA 1YLCA 3SU1A 5A2MH 3QUMP 3PV5A 3HGPA 3MU1A 2QV1A 4FUFA 2G81E 2Z9LA 2HWLB 3UUZA 2ZDLA 1BRAA 2UUYA 2GZ7A 1W0JD 1EAWA 3RXRA 3LKWA 1O2QA 1C1SA 1V2RT 2BY5X 4TY6A 2ZTYA 1GMHF 1RGQA 3F9FA 2FI5E 1T4VH 1WSSH 5EGMA 2P16A 1HAXB 4THNH 5L2ZH 4KTUA 1S6HA 1WTHD 1SHYA 2ZDVH 4FUEA 1MKXH 4WH8A 3A89A 3BTME 2HPQH 4K2YA 1O2TA 3MFJA 2J2UA 4YLUA 4BAQB 1GBKA 1WCZA 1QRXA 2XC5A 1FZZA 1ANEA 1O3FA 3AAVA 1Z8RA 2G00A 5BRRE 3SNCA 2W6JD 4LZ1H 1UCYE 1OX1A 1H8ED 2BY8X 3ZZ9A 2P93A 1MMJN 1DXWA 3ENSB 1Q3XA 1KMHB 2OINA 4ABDA 3RXOA 1RS0A 1CO7E 1LDTT 8GCHF 2F3CE 3STIA 5TCCA 2XCFA 3MO9A 2VBCA 1ZRBA 3PO1B 1NRRH 4Y7AA 5ESTE 3U8TH 1TAWA 5B6LA 1GBFA 1AY6H 1YYY1 1ZSLA 3SHCH 1ZR0A 1J17T 5L6NH 1DOJA 4PROA 1AB9B 1ARCA 1UVUH 3MNXA 3M36A 2Q1JA 1AIXH 4DW2U 1J16A 3A7TA 5B6OA 2YMSC 4NSVA 3UNRA 3RXJA 4X8TH 1ZTLA 4X8VH 4ZKRU 1OSSA 1PPFE 1TPSA 1SR5C 2M2AA 1Z8JB 1O5DH 4ZKOU 1MZDA 3DA9B 3TH2H 1GBCA 2ZGBH 1BTUA 5AVDA 2BY7X 1ZGVA 3BEFB 2UWLA 1HCGA 3TJUA 1AE5A 2QF5A 3S9BA 3U1JB 1A0JA 2WYJA 1K21H 5C3NA 3ATLA 2BLVA 3M37A 1SOTA 8LPRA 3UR6A 1G3CA 1YPHE 2TIOA 2QAAA 3MMGA 3ZVFA 5I46H 1O2MA 3RU4D 1ZTKA 3UOUA 2Y5GA 2ZZUH 3U1IB 2Y5FA 2LNCA 3SOSA 2L74A 1XUGA 2OBOA 2WINI 2VJ1A 1OWEA 1TBQH 3A86A 1H4WA 3A87A 2JJ1D 4DT4A 1J14A 2C8ZB 1TE0A 2QN5T 3A8AA 4NWLA 3PTNA 4HG6A 2GX4A 2JKHA 4X1NU 2PGBB 3UWJH 4GUXA 2VH6A 1MQ5A 1SGFA 4CHAC 2O8UA 4LOYH 2H9EH 3GDUA 1CT0E 5EJ1A 3MU8A 1V6DA 1BRCE 2GV6A 4DOQA 3NK8A 1ZRKA 1S84A 2Z9JA 3BTWE 4ABIA 1Q2WA 2PKSB 1ORFA 2ZHWH 4OM9A 2IN2A 3GY5A 2R2MB 3MNCA 3K6ZA 3SU2A 2R0KA 3SUEA 1AFEH 2C4FH 2YNBA 1IQMA 3ZZDA 2O8TA 2NU2E 1PQAA 5EOKA 4CR9A 5K7RA 1G32B 1SFIA 3P8GA 2FO9A 3A7XA 2EQNA 1EOJA 1LVMA 2G5NA 2ODPA 2PKSC 4D7GA 3O8CA 1N8OB 1MCVA 4Q2KA 1W7GH 1H9IE 3HK6B 3SJ8A 2ANKH 3Q76A 3VGCB 4F49A 1FV9A 1E35B 1SPJA 1GL0E 1Y3UA 6CHAC 3AW0A 1ZLRA 2WPKS 3RXQA 2HALA 1K1JA 8KME2 1QL9A 2EA3A 2VNTA 5C2ZA 1ZPCA 3R0FA 1UTLM 4HFPB 2FX6A 3PB1E 3ZVBA 4UD9H 1LTOA 1MTVA 1GMHG 3SNAA 4AG1A 2PHBA 3P95A 4DGJA 3L33A 5A09A 4Z1MD 3P17H 2BD2A 2R3UA 4D9RA 1AUTC 3G01A 4Q7XA 1W0KD 2ZU5A 1P9SA 1TA2A 1TIOA 4IN1A 2NWNA 2ULLA 1GI1A 2W7UA 4XDEA 2PKAA 1MKWH 1ANDA 1FLEE 3SU6A 4J2YB 2H2ZA 1MAYA 5EQSA 1AZZA 1GG6B 2A5AA 1OYTH 1EAXA 1O3CA 3KF2A 3O8DA 3PWCA 5A8XA 4X8SH 2P95A 1ZJKA 4KP0A 2SGPE 2A7JA 1RIWB 3B9FH 4YTAA 2FS9A 2VIPA 1XUJA 1GHBF 1LPKB 4NIXA 2BXUH 3K65B 1Z1JA 1NRNH 1OKXA 1Z1IA 3OSYA 3GY2A 4MG3A 1D6WA 1AWFH 2AMDA 2FI4E 4BTUB 1BRBE 3SN8A 1O2VA 2KCYA 1NU9A 2A4QA 3NCLA 1Y3YA 4TYDA 2PKAB 2HLDD 4GLYA 1LKBA 4YOGA 1ABJH 1FPCH 3CS0A 4X1PU 5CHBA 2ZGXH 3LONA 3EDXB 2BVSH 1TFXA 3DD2H 2STAE 2IJOB 1GHYH 1UCYH 1UW7A 2Y5HA 1UCYK 2BX3A 2QC2A 2ZI2H 2ZCKP 1F0RA 1Y59T 1D3TB 3BTFE 1GHAG 3IITA 1COWD 1CU1A 3TITA 1SG8B 2AERH 3DFJA 4AZ2B 3C1KA 1AVGH 1TOCB 5C1UA 2W3IA 2F9OA 2F83A 3E16B
chains in the Genus database with same CATH topology
3KNXA 3HPTB 3L3TA 1F7ZA 4TPIZ 2BXTH 3RXUA 4Q7YA 1DWEH 4IMQA 1L1JA 4WMFA 2AGGX 2AEIH 1IQIA 4INLA 1C5RA 3TH4H 1KXEA 1SGTA 3H7OA 3M5NA 3PLPA 4HGCA 1C5OH 3MI4A 1VITH 3LH3A 1ELGA 3GY3A 1LHDH 4XSKU 4TWWA 1PPBH 4ISLA 1EP5A 1IAUA 1H9LB 4Y71A 1IQLA 2RA0A 5E0GA 2ZGCA 1IQHA 1VZQH 3RXLA 4A6LA 2FX4A 1XUIA 1P03A 3RP2A 5EQRA 1O36A 2D26C 5LGOA 2ZWLH 1V2KT 2H5DA 3MOCA 3VB5A 1ELCA 5EXNA 2JH5D 2FOCA 1TLDA 2FYRA 1HAHH 1NO9H 1V2OT 1GDUA 1P0SH 2OQ5A 3I77A 4NZLA 1HXEH 3S7HB 1GMCG 1PPZA 2PV9B 5EODA 3GCHB 2PUQH 4KTSA 4X6PA 3SV7A 1D3DB 5DGJA 2XTTB 3TPIZ 1L1GA 1SFQB 1ELBA 2BZAA 5LPEA 2B7DH 2Y80A 1LHEH 1O2ZA 3S9AA 1KSNA 2HGTH 5A8YA 2ZHDA 3GY8A 2F9UA 1TYNA 4NIVA 2VGCC 1C5NH 1DFPA 2ZTZA 3UTUH 3RMOH 1T32A 2PR3A 1VGCB 1H1BA 2VWMA 1NC6A 4FXGH 2C90B 3QGNB 4B2CA 1F2SE 5AFZH 1KLTA 1DLEA 1UHBB 2ZU3A 4KELA 2J4IA 2ZU4A 3GCHC 3A85A 1TNHA 1GHZA 1DWCH 4BANB 1FIWA 3RM2H 3SQEE 3IG6B 1S82A 1EUFA 4TWYA 1IQJA 1MAXA 1ANCA 1BTZA 1IQEA 2A1DB 1S83A 3GY4A 2PSYA 1AUJA 4K5ZA 1HUTH 1OOKB 1P04A 3SNEA 1OWHA 3LOXA 1FY5A 1WQVH 2FMJA 2PUXB 1AWHB 2AYWA 3M7TA 1E37B 2QF0A 1EKBB 1GJCB 1Y3WA 1AKSB 2PTCE 4FUCA 2C8WB 4GVUA 4MNXA 1BJUA 4X2WA 4U01A 1V2QT 3LJOA 3UQOA 1O5BB 1F0UA 4IS5A 2GGVB 1TRNA 1SGNE 1OXGA 1EZSC 1O5GH 4WXVA 1BJVA 4E7NA 1AE8H 3SNDA 1P2IA 2G52A 1FQ3A 1JXPA 3OY6U 1QQ4A 2UUFB 1O2WA 1O3JA 1H8DH 1D6RA 5JBTA 4NIWA 1C1RA 1HDTH 1DVAH 1GBTA 4OS7A 1GHAF 3SU4A 4MNYA 2A45B 1O3AA 1NRQH 2C3SA 3EQ0H 5I25A 3SV6A 3FP8E 1RXPA 4H6SB 2FLRH 2EI6A 4AN7A 3BTHE 2Q6GA 1TQ7B 4O97A 1VGCC 1EZQA 1OP8A 1QNJA 1YPJH 2VH0A 4YT7H 1OP2A 4DY7B 2D1JA 4GSOA 4X2YA 2VVUA 1QJ7B 5JDUB 1FONA 1EPTC 1L4ZA 3RLYH 1GBJA 1TX6A 1P12E 2SGAA 3RMMH 4SGBE 3RU4E 2ZF0H 3ZVAA 2QXIA 3MYWA 2V3HH 3WY8A 3JZ1B 1TNGA 2ZDKA 1BOQA 1LO6A 1FI8A 4JZDH 1P09A 2SNWA 5GDSH 3AVZA 2FPZA 1K2I1 1OWDA 1HV7A 1GJ4H 1J8AA 2FYQA 2GDDA 1OWIA 4AFQA 1HAOH 3LIWA 5L30H 2ZTXA 3DHKH 4SGAE 3TGJE 2TBSA 1S5SA 2CF9H 4B71A 1Z8GA 1EZXC 3T25A 1Z6EA 4IMZA 2VWLA 4NG9H 2CGAA 2ZFSA 4X6OA 5A0AE 3F6UH 2GT8A 4K8BA 5C1YA 1TWXB 4J1YA 1GL1A 3ZZ3A 3F1SB 2QCYA 1XUFA 4I8JA 4AGJA 1KDQA 1QBNA 2NU3E 1V2LT 3KQBA 3PTBA 1HNEE 1ZJDA 1HB0B 2ZPSA 1PQ5A 4JYUH 5EXMA 2VGCB 4IGDA 3HK3B 2CV3A 2KAIB 4B73A 3HKJB 1ELEE 1FAKH 8GCHG 4WF8A 1P01A 3KN2A 3EA7A 4NA9H 1X7AC 4Q80A 3QGJA 7GCHF 1TMUH 1TQ0B 3KL6A 3T26A 4AB8A 1BQYA 1B7XB 1FN8A 2O8MA 1S0RA 4OS5A 1PPCE 3CENA 1K9OE 4U32A 3U69H 2TGPZ 1UK2A 3ATMA 1ESTA 1SOZA 1FUJA 3QK1A 1TNLA 5JBCS 1O37A 4NSYA 3A7ZA 2ZIQH 1GCTC 1GJAB 1O3DA 2ILNA 3QWCH 1YKTA 3SU5A 3PLKA 4FUGA 4RKOB 4XBCA 9LPRA 1XX9A 4XFQA 5IYTA 2CJIA 1RIWC 1ZZZA 1JBUH 1OP0A 1W11U 1O2YA 4ZHLU 2G51A 2WUBA 3VB7A 5TJXA 1UTJA 3RXTA 2BDAA 2VIDA 5JB9S 1MTNB 1TOMH 4UONA 1RRKA 4MDSA 4BAHB 3TGIE 1RD3B 3RXAA 1RTFB 1C5UA 1INCA 2FIRH 4JYVH 3RC5A 2Z6BD 1BIOA 1WAYB 4MPWA 4YT6H 1YLDA 1UVOA 4E06H 4K1TA 1JRTA 1PYTD 1FY4A 4ISIH 3E8LA 1UTOA 3T5FH 3KQCA 2WUCA 2WYGA 5FX6A 1PQ7A 1IHSH 1V2PT 2ZFQH 4AFSA 1UTKA 4TY7A 1GI2A 1TX8A 4IC6A 3SORA 1N6XA 4U30A 2QXJA 4MPUA 1O5FH 4ABEA 4Y10E 1D4PB 4JK5A 5GJ4B 1ID5H 3KGPA 1SVPA 2THFB 2Q6DA 1GMDF 3SBKA 5T6DA 1AN1E 2O9QA 1BBRH 2J34A 1EZUC 1O2IA 3MH4A 4O03A 1D9IA 1O2GH 1QJ1B 3SNBA 3BIUH 4DG4A 3HKIB 4M7GA 1SGYE 2OD3B 4YOJA 1GHWH 1GJBB 3RUOA 4ZKNU 1NROH 3T62A 1BMAA 4D7FA 2VWOA 3QTOH 3MH7A 3GY6A 5AHGH 4QT8C 3MTYA 1BB0B 1C1MA 2CHAB 4FUDA 2I6SA 2OQUA 2Z9KA 1AVXA 1T8NA 4INKA 1LPGB 5C67A 2OTVA 3QZQA 3BTKE 4GCHG 4WVPE 3PMAB 2ZDNA 3P8NA 1EPTB 1L0ZA 3VPKA 1O35A 2A0QB 3RDZA 1AD8H 5FPTA 1AFQB 4CRDA 4K1SA 1LPZB 2V0BA 2R2WU 3RXVA 1TGCA 3U9AH 5GCHF 2XRCA 2GTBA 1O3OA 4ZH8A 3SI4H 3GICB 4ZROA 2GV7A 2ZHFH 2OC8A 2Y7XA 1PQ8A 3A84A 1VJAU 3ZVDA 1GBBA 3BG4B 1DANH 2XNIA 2W26A 1SGRE 1THPB 3SGBE 1GMCF 1BMMH 4HZHA 3FP6E 1AU8A 1H9HE 5E0HA 2EC9H 3TNTA 3LPRA 1UVTH 4YO9A 1O3GA 2ANMH 3KEEA 4B1TA 2ZFPH 2FWWA 1SGFG 1V2JT 3CP7A 3GYLB 2CHAC 4KGAA 3K2UA 2PW8H 1H8IH 2XBWA 1C5XB 1FAXA 4I31A 1O2OA 2FS8A 3FZDA 5F8ZA 1SLUB 2QXHA 3T28A 1MCTA 1WQSA 3BTQE 1J15A 1LVOA 1QA7A 1VCWA 2NU0E 2K1QA 1C1UH 1SQOA 1MU8B 4OS2A 3UNSA 1QGFA 2FTMA 3I78A 4B75A 3NPSA 1TONA 2UUJB 3EA9A 1C5YB 1Y8TA 2AH4X 3V12A 2AIPA 2RG3A 4MQAA 5HXFA 3SI3H 1SGQE 2GZ8A 1EJAA 3M35A 1WUNH 1ZPZA 2FOEA 5HM9A 1GBHA 1IOEA 5L2YH 1GMDG 1Q31A 3BTEE 2Z9IA 3LJJA 2WPMS 3I29A 2F9PA 3ZVGA 3PYHA 2FOFA 1NT1A 1YBWA 5HGGA 1L2EA 3SZNA 5E2OA 4ZMAH 3A83A 2QA9E 3STJA 1L1NA 3BTGE 1TPOA 2BY6X 3A7WA 4O3TA 1G9IE 3LH1A 1B5GH 3SHAH 4Y7BA 3RXSA 1ABIH 1NM6A 2BVXH 2GP9B 3GDSA 1SC8U 1C5LH 4HI3A 1ETTH 2B5TB 1AKSA 1W3CA 2A5KA 1MBQA 2VIVA 1V2ST 1KIGH 3SJOA 1C1WH 1NTPA 4AOQA 2AGEX 1HPGA 1F92A 5FHTA 1JWTA 1O2UA 3A8BA 1CA0B 3VXEH 5F8XA 4DJZB 1HAPH 2HNTF 1HFDA 1ZHRA 2B9LA 1BMLA 4A92A 2OC1A 1SGPE 4ISOA 1O0DH 1YPKH 4GHQA 4ZKSU 1N8OC 2NU4E 1DDJA 4GPGA 1SQAA 5ETXA 1PPGE 2ALPA 1O3IA 3ITIA 1O3EA 5FCKA 2H1UA 1QR3E 1AI8H 3VXFH 2GMTC 4A1TA 2BOHB 3BIVH 1ELDE 5DPAA 4Y0YE 3LU9B 1HJAC 1O33A 1G36A 2J92A 3TU7H 3MNBA 1QURH 2BD5A 1GI3A 2A7HA 4OGXA 3A82A 1F0TA 5EQQA 4X0WU 1C4U2 1TMTH 2RA3A 2STBE 1ANBA 1ELFA 1KYNA 5K0HA 3L6PA 2HRVA 4NCYA 3UNQA 5TCAA 3SU3A 4ISHH 4YESB 1T31A 2G5VA 1AFQC 3LGTA 1EPTA 4CRGA 2G55A 4FVBA 2PTNA 2AMQA 2BM2A 1VITG 4XE4A 1CVWH 1C4Y2 4X6NA 3A88A 2TGDA 2WV5A 2C8XB 1YPGH 1C5SA 1G2LA 1P11E 5BPEA 1IQNA 1GBMA 3VGCC 3FZZA 1J9CH 3URDA 1HAIH 2ZC9H 4B76A 5FXLA 1BZXE 4ASHA 2IOTA 1MTSA 2B0FA 1FY8E 5LH8A 2P3FH 2ZPQA 3Q3XA 1GI5A 1FY1A 2AIQA 1Y5AT 1C1NA 2RDLA 3P70B 5PTPA 1VITF 4ZHMU 1C2DA 1SMFE 3ZZ5A 1C5ZB 2ZU1A 3RXKA 3V0XA 1G3EA 1GHXH 2A2XH 1UK4A 3E6PH 3KQDA 5JPMH 3PMHB 2OC7A 2QXGA 1EX3A 4NFEA 1FY3A 1LHFH 2BOKA 5EPYA 1MD8A 1DLKB 1EB1H 2BD9A 1P2JA 5FBIA 1Z8IB 5T6FA 4ABBA 1CQQA 3QTVH 3OYPA 1TMBH 1GI4A 7LPRA 3UIRA 1TRMA 1AVWA 2ZP0H 4INHA 2ZDMA 1NS3A 5J4SA 4UFDH 4ABFA 1O3MA 3C27B 2LPRA 4CBNA 5CHAB 4BAOB 3UPEA 1O2XA 1JMOH 2BDCA 1HAYB 3VB4A 1CSOE 4GAWA 3RM0H 2ZNKH 2A32A 2FOAA 1O2SA 5FCRA 3R3GB 1C9PA 1YCPM 1T8LA 3RXGA 1QBOA 1GBEA 3MU0A 2ZPRA 5FAHA 3GCOA 5DK1A 3LDXH 1SHHB 1C5TA 4B74A 1THSH 1O3HA 3SUDA 1G37A 1GBAA 2XBXA 1V2NT 3MNSA 3NXPA 1S85A 2ODYB 5ESBA 2Q6FA 1P2QA 3E3TA 1W8BH 2QIQA 3OY5U 4IW4E 2A31A 4ZHAA 1A61H 3VEQB 2ZQ2A 1HJ8A 3TH3H 1HIAB 4Y8YA 3SJIA 1GHVH 1O32A 4CRAA 3TIUA 3NZIA 2TRMA 1NZQH 3CS7A 1SSXA 4DT7B 1GGDC 1EJMA 4CRFA 4MLFB 2R0LA 2P3TB 1BDAA 2O8WA 2ZA5A 3H5CB 3ZVEA 1GWAA 2YNAA 3BTDE 1FJSA 3UREA 3SUGA 2HVXA 1XVOA 1O5AB 5DP8A 5T3HA 5LPRA 1TNKA 3UOPA 2NU1E 2ZEBA 1M9UA 1NESE 1GI6A 3ZV9A 1TABE 3E91A 2OBQA 3VB6A 1GBIA 3IWMA 1LKAA 4AG2A 4ABJA 3S7KB 3ATKA 3ZZ8A 2VIQA 3D62A 8ESTE 2Z3CA 3MHWU 3T2NA 1IQKA 1A3BH 4RN6A 3ATIA 2GDEH 4NFFA 1F5RA 2GCTB 1OYQA 3A8DA 1FIZA 4AYVB 1SGEE 4CH8B 2ZG0H 4IBLH 5GCHG 2GCTC 3UR9A 2R3YA 2JH0D 4ABHA 5J4QA 1ARBA 1C5PA 1ZMNA 2H9HA 1BA8B 4Y79A 1A3EH 3AW1A 1IQFA 3LGVA 1A0LA 2WPJS 2ZHQH 1ZPBA 3RMNH 3V3MA 3RXHA 3SV8A 3GOVB 4Z0KA 4NGAH 3KIDU 5EXLA 2GT7A 1MTWA 3SJKA 1YP9A 1A4WH 2HLCA 3Q77A 1TBRH 1UMAH 4JZ1A 3P92A 2F91A 4ISNA 3SGQE 1WV7H 1TNIA 4I8LA 1JRSA 3E90B 1MBMA 2BDGA 2FOGA 4WH6A 4Y8ZA 4CRBA 1TRYA 2SGFE 3H7TA 1SL3A 1ESAA 2BDBA 2CN0H 3V7TA 1W0ZU 4UFFH 6GCHG 3SO3A 1MD7A 3ZV8A 1K1LA 2CXVA 1Y5UT 2VVVA 3TK6A 3PO1C 3TNSA 3URCA 1C2GA 2VIOA 3LGIA 1O39A 4R8TB 1CGIE 1PYTC 2SGQE 1HAGE 3LGUA 2BB4A 4I33A 1HLTH 2SNVA 1EJNA 1C1OA 3MWIU 4UFGH 5DP5A 1GG6C 4IN2A 1C2KA 1B0FA 1DITH 1HRTH 5E2PA 2BLQA 2GCHF 2FTLE 5GPIB 1DX5M 2B8OH 3GISB 4K60A 4UEHH 1VCPA 3OTJE 1KY9A 2ZU2A 4H6TA 2XW9A 1EQ9A 1BUIA 3D65E 1D3QB 4BNRA 4R0IA 1C2LA 1OWKA 3M5LA 9ESTA 2PGQB 1KXCA 3LC5A 1O3BA 2BTCE 4A1XA 2FOBA 1F5LA 2Y82A 2C8YB 1UO6A 2FP7B 2Z9GA 2M5TA 3RC6A 3MO6A 2JETC 3ZYEA 2AGIX 3W94A 2Y6TA 2BYAX 1K1NA 4Y11E 6GCHF 4CR5A 1HAVA 2FLBH 4MTBA 1KLJH 2VIWA 2WV4A 1MZAA 1XKAC 3MU5A 1O38A 1O2PA 3SJ9A 5E0JA 3P6ZB 1CA8B 4YZUA 1XMNB 1ETSH 1S6FA 1F5KU 1W12U 1NFUA 2OUAA 1ZMLA 3P8OA 4JYTA 4LZ4B 1BHXF 1SGIB 4CBOA 1QL8A 1KXFA 4XBDA 4VGCB 1L4DA 3S0NA 1GCDA 3PMBB 5EW1H 1PJPA 1TBZH 1E0FD 2BDHA 2ZQ1A 3RXCA 2DE9A 2F9NA 4I8KA 1C2IA 3ZZAA 2XBVA 4F4OC 1RFNA 2BDYA 4WXIA 4OS6A 1NN6A 1NFYA 4D76A