3OY5U

The crystal structure of upa complex with peptide inhibitor mh027 at ph7.4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
247
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSATLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 246
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy5U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy5U01
1ETRH 1QJ1B 5JPMH 2O9QA 3RLWH 3LDXH 4K60A 4NA8A 1BTZA 4WVPE 1S83A 4LXBH 3GYLB 3LONA 1LVYA 2ZFSA 2B8OH 2TGDA 1BA8B 5AFYH 1MMJN 1PJPA 5JBCS 2HALA 1BDAA 1SGFG 3N7OA 3RXAA 3PLKA 1DUAA 4ZKNU 1VJAU 1HAVA 3SW2B 3GISB 2OBQA 2AIPA 2BY6X 2ZFRH 1NM6A 2TGPZ 1HAOH 1HIAA 1HJ9A 4RKJB 3RC6A 1TABE 2UUKB 3RXMA 1DT2A 4B74A 1VITF 2UWLA 3M5OA 3ZZ9A 3RXGA 1UVTH 1BTYA 2CF8H 4KTUA 1ESTA 2W7UA 4Y8YA 2RA0A 2FTLE 4OGYA 3U1JB 1S85A 4WWYA 4IGDA 2VVUA 1DPOA 1HUTH 2VWLA 3FFGA 3TPIZ 2ZDKA 1ZGIA 4INLA 7ESTE 3MMGA 2SGPE 1C9TA 1Y3UA 1CGHA 2ZU4A 1C1QA 2BXUH 2ZO3H 5PTPA 2ZDAH 1O2LA 2FOBA 4MPVA 3RMOH 4AG2A 3BTDE 1P01A 2G5VA 4VGCC 5L30H 2PFEA 2VIVA 3RXKA 5T6GA 5DP8A 4X2VA 1YPKH 4DW2U 3SUEA 5JB9S 2VVVA 4ABEA 1T7CA 2A2XH 2ZDLA 4H6TA 2STBE 2ZQ1A 2PV9B 2XCNA 1FXYA 3T28A 4FUCA 5GDSH 2FXRA 3IG6B 2Y6TA 1HGTH 2H9TH 2G52A 1SL3A 1E38B 1O5GH 1KXCA 2BXTH 1GMHG 3FAOA 5FPYA 2XTTB 3TJOA 3ZZAA 2ASUB 2WUCA 3P95A 5EG4A 2AIQA 5FX6A 1EXFA 3HKIB 2FS9A 3RP2A 3OTJE 1LQEA 2SNVA 4ABFA 2C8WB 5DP6A 1AGJA 1LHEH 1O2TA 1GHZA 1WU1A 4X1NU 1CHGA 1HJAB 2GT8A 2D2DA 3T29A 2C8ZB 4DURA 1P2IA 1Z71A 2A7CA 1OYTH 2G51A 4CHAB 1P02A 3HATH 2H6MA 4K1EA 3S9AA 1CA0C 2SGQE 3RXJA 1BRBE 4BTUB 1UVSH 2H9EH 1F0RA 7LPRA 3NKKA 2ALVA 3UQVA 1SGEE 1XVOA 2TPIZ 1L4DA 1OSSA 1SGDE 1ANBA 3DD2H 4NFEA 3F1SB 2IJOB 1ZMJA 1ARBA 5B6OA 4R0IA 3I78A 4HTCH 4O03A 2Q6GA 3ZVCA 1O3OA 4FU7A 1J9CH 5HYOA 1SVPA 1HDTH 2TBSA 1SGIB 1OKXA 2NU1E 5L2ZH 1J15A 3MYWA 2GV7A 2NU0E 1UCYE 2HVXA 1OYQA 1AVWA 2FZZA 2Z7FE 4NSVA 4Y6DA 1AB9C 4Y8XA 2ZHQH 1GMDF 3O8RA 3H7TA 1ABIH 4LOYH 3F68H 2PGQB 4K1TA 2XW9A 2H2ZA 2BD4A 2QF0A 4B76A 1QQUA 1QB6A 4NGAH 4UEHH 4X6NA 5A0AE 1GHBG 2ZWLH 1A0LA 3NCLA 3E0NB 1UCYK 1UTKA 5EQSA 3PWCA 3VFEA 3MI4A 4DVAU 1O34A 3RXVA 1ZYOA 1QQ4A 2IPHA 5TCAA 3U69H 1BBRK 1C2IA 1XUKA 1SI5H 1YC0A 1C5MD 3A86A 3JZ2B 3UOUA 1NFUA 2VJ1A 2ZU3A 1GJAB 4SGAE 2GCHF 4Y0YE 1GBJA 2FOEA 5GIBA 4JZFH 2OC8A 3ATKA 4UFFH 1EPTC 3UUZA 4B2AA 4LK4A 2WPIS 1FJSA 1P2QA 1WV7H 1TRYA 4I8LA 2NU3E 1SGTA 1K1OA 2PSXA 1ZMNA 4INKA 1EQ9A 4NZLA 3VXEH 3MH6A 2BQWB 3MO3A 3K9XB 3SO3A 2FYRA 1D3TB 1TOMH 4NIXA 1ESBA 4FUEA 4A6LA 5A2MH 1RXPA 1O37A 3BV9B 3VB4A 1UTLM 3ZVDA 1SGCA 5EQRA 1O2SA 4CBNA 2JKHA 2PHBA 2QXJA 1D3QB 1SG8B 2Z9IA 2ZKSA 1AE8H 4U32A 1ZRBA 5AVDA 1A5GH 4RSPA 1TB6H 1F7ZA 2FMJA 1AE5A 2G8TA 2ZF0H 3URDA 5LPEA 3ZYEA 1DS2E 5TCCA 1DM4B 1BBRH 5DGJA 1HLTH 3A88A 1GHYH 4ZROA 2P8OB 1O5CB 1QGFA 1UTNA 3E0PB 2Z9GA 1GJ6A 3KQDA 1O5FH 1TNIA 1TGTA 3E8LA 3SU0A 4MNYA 1MTNB 1HAYB 3CS7A 1WBGB 1XX9A 1Q31A 3I29A 5FCRA 1W3CA 1ELAA 1GHAG 3F9GA 3PMJA 2F9VA 3KL6A 4K2YA 1P9SA 2FS8A 1NC6A 2BLOA 4RN6A 1RIWC 2BDCA 1P06A 3HGPA 1EOLA 3UNQA 1H9IE 2FESH 4DY7B 3QK1A 3SN8A 3MNXA 3R3GB 2VGCB 2EC9H 2FEQH 2PLXA 2R0KA 5DKMA 2OCVB 1QB1A 1P57B 1SLUB 2CGAA 1LVBA 2HNTE 1GI3A 2SGEE 1S82A 1ZOMA 1AY6H 3L3TA 2JETB 1A3BH 3A83A 3QUMP 1GDUA 3FZDA 1XUIA 1BMLA 1XUGA 4AG1A 5AF9H 5ESTE 2O8UA 5JB8S 4FU9A 1IOEA 2G5NA 2FO9A 4X8UH 5T6FA 3F9HA 2KAIA 2BX4A 3TK9A 3BSQA 1ZZZA 5EOKA 4E05H 1MU6B 5F8XA 2WPJS 1F0UA 1SHYA 4XBDA 1O2UA 1ELVA 2R3YA 3B8JA 1P03A 1O2QA 2ANMH 2PKAA 1HAVB 2CHAB 3E90B 2OC1A 2A5IA 1AI8H 1YPLH 1CGJE 1J16A 2WPKS 3RU4T 1J14A 1HIAB 1ZJDA 1SSXA 3QTOH 3KQBA 5C67A 2B0FA 1P2OA 1NRQH 2ZQ2A 3VPKA 1EP5A 1KXFA 3BEIB 3GY3A 3MU0A 1LHGH 2FYQA 3BTWE 2Y5FA 5HGGA 2DE8A 5EW1H 4CBOA 2Z9KA 2O8MA 4MG3A 1P09A 1KTTB 1OX1A 3D62A 3TK5A 3UREA 1C1NA 1O2OA 2BDGA 5K7RA 1DICA 1ZRKA 3A7YA 1KY9A 1G3BA 1SPJA 1FDPA 3RXBA 2EI7A 1EJNA 1FMGA 1XM1A 1NO9H 5SGAE 1V2MT 1O2HA 1GJDB 2QIQA 4NG9H 2TIOA 3ZZ5A 1V3XA 2BTCE 1CHOG 3F6UH 2ZDMA 4YOIA 4K5ZA 1GBCA 4FUFA 1IQJA 4WXIA 1G2MA 4H42U 1SB1H 2WUBA 1Q3XA 2A45B 1KSNA 2EI8A 2C4FH 2LNCA 3K65B 2OBOA 2BD8A 1TNJA 2JH5D 1ACBE 1EKBB 4FXGH 4UFGH 1SC8U 1LHCH 3ITIA 1Y3WA 3S0NA 1AU8A 3KQEA 4AYYB 1AWHB 2FI4E 1OS8A 3ZZ8A 1GJ8B 1Y5UT 2HGTH 1DXPA 1G3DA 3MNCA 1O0DH 3GY8A 4AFUA 1K1JA 1V2UT 1TQ7B 1GBIA 2RDLA 1QL9A 1K9OE 3F9FA 3EA8A 4JZ1A 2CMYA 1T8LA 2VIWA 4H4FA 1WQVH 1D3DB 1MH0A 3PWBA 4ZKOU 2Z3DA 3LT3A 3S69A 2QYIA 1KXEA 3RM2H 3RXUA 1GJ9B 1GMCF 1Y3YA 1BTWA 1C1WH 1RTLA 2ZG0H 2P59A 2J9NA 2EA3A 4F49A 1GI8B 3SV2H 3TGJE 5E2PA 2XC4A 3V13A 3U9AH 1TNLA 5K0HA 3SQHE 2WV4A 5A8ZA 3NZIA 2ZGXH 3DFLA 1N6YA 3AASA 4YLUA 1LKAA 3KIDU 1GJBB 4WY3A 3L33A 4Q7ZA 1DXWA 1BHXF 1JMOH 1FONA 2QCYA 3Q76A 2ODQA 3MTYA 1NRNH 1AZZA 2F9BH 1NRRH 1MTSA 3AAVA 2LPRA 1OP0A 1IQKA 1GPZA 4JYVH 4KELA 2A2QH 1ZPBA 4Y76A 1Z6JH 3ATWA 1MQ5A 3M3SA 1D6WA 1BITA 1ID5H 2H9HA 2ALPA 3SNBA 1O2NA 1BB0B 1GI7B 3SUDA 4XBBA 1WQSA 3LGYA 1FIZA 2F9NA 1TPSA 3LGUA 2VIPA 4J2YB 1K1NA 1C2LA 1E34B 1EAUA 2G55A 2V3OH 3Q3YA 3TK6A 4X6PA 1O3NA 2FOFA 2PKSC 3GICB 4ABBA 5FCKA 1G30B 1LPGB 1YPHE 4YM9A 3SGBE 2YOLA 5ABWA 3OU0A 4ZHMU 2I6SA 1GI1A 2RG3A 2ZPQA 4JZEH 3V0XA 1HAZB 3A8AA 1XKAC 1BTHH 3T26A 1NFWA 5E0GA 1IQEA 1P2JA 2BY7X 2FODA 1OOKB 1AO5A 3LH1A 2WPHS 4Z6AH 3QWCH 2PTNA 1AFQC 2W3IA 4YESB 1Z8RA 3MWIU 4WMDA 3RUOA 4CRFA 1MBQA 4A1TA 1IQMA 1JRTA 1BCUH 4Y7AA 1FAKH 4JK5A 2FI5E 4NIYA 4AN7A 1A61H 2Z3CA 1AQ7A 4TPYA 4UD9H 3S7KB 4Q7XA 1L2EA 5DK1A 2XBVA 3GY6A 3VB5A 1EAWA 3TJVA 1CA8B 3UOPA 1XXDA 4CH2B 4AGKA 1D3PB 1DLEA 5E0JA 1XXFA 1C5WB 3RXDA 2R3UA 4NIWA 1W0ZU 2VH6A 2B7DH 4TY6A 1Y5AT 2AERH 1TWXB 2FLBH 1A4WH 4GUXA 2PUXB 1ZPCA 1ZTJA 5A0BA 3AW1A 4DIHH 1C4U2 3MH4A 1P04A 4B73A 5DPAA 4MPUA 1Y8TA 3MFJA 2BVXH 1Z8JB 2P93A 3LIWA 1O2KA 4AORA 4DCDA 5BRRE 1OWHA 2SGFE 1QIXB 1PPZA 2VWOA 3EYDA 4A7IB 2ZC9H 3VEQB 1GDNA 2IN2A 5FBEA 1ANCA 1UO6A 2J95A 5E0HA 2ZFPH 1QA0A 4OS7A 1C1SA 5CE1A 1HNEE 1SLVB 3HGNA 3SJOA 1ELFA 1S84A 2A4OA 1NESE 4LZ1H 1GBDA 2O8LA 3SU4A 4K3JA 1NFYA 1Z1JA 3TJUA 2XWBI 4MPXA 3PLBA 1TGNA 3EE0B 1YPJH 3SJIA 8GCHG 1W14U 3ESTA 4WH6A 1O3DA 2PGBB 1UVUH 1HXEH 3FP6E 2FI3E 4ZHAA 3EAJA 1N8OC 1EZQA 3GCHB 3RMMH 4X2WA 2AEIH 2GGVB 1TMBH 1FV9A 1NN6A 4A1XA 9LPRA 1A3EH 1S81A 3BIUH 4WMEA 1GJ5H 1GI9B 2ZA5A 2JETC 4I33A 1THRH 2A32A 1H8IH 2BD7A 1SHHB 3FP8E 3VGCB 2KAIB 2GZ8A 2ZPRA 2VIQA 1SGQE 4Y8ZA 2BOKA 1YYY1 1FAXA 1Y5BT 2Q6FA 2PKAB 1P05A 3LOXA 1HRTH 2HOBA 3RXTA 3SGQE 3SUGA 3LGIA 3P8NA 2PW8H 5DP4A 5C20A 1IQNA 4AFZA 1KDQA 1LVOA 4MVNA 1ZMLA 2Y81A 3P8GA 1FLEE 1QTFA 1P3CA 5EPYA 3BIVH 1AIXH 4H6SB 1FUJA 4ZKRU 2G00A 2Z6BD 3SU6A 1TRNA 3LKWA 1UMAH 4SGBE 1QURH 1DWCH 3BTFE 1KYNA 1IQIA 1C5LH 1C4Y2 2A31A 5JBBS 2W5EA 2FM2A 1RGQA 2ZCHP 1AWFH 1TONA 1T4VH 5GWZA 4ZHLU 2NWNA 2BYAX 3BG4C 5E8EH 2BX3A 1FZZA 1PPEE 1TOCB 5EXLA 1O3AA 2BM2A 1TMTH 1O2GH 2TGTA 2A1DB 4WJG2 2ANYA 4FUBA 2W7SA 2WV5A 4JZIA 2WYJA 3K2UA 4ASHA 1SGNE 3PTNA 1C1PA 4Q2KA 5C5NA 2WPLS 4NZQA 5EW2H 1CVWH 4Y11E 1TBRH 3UNSA 1W12U 3LJJA 3RXCA 2ZTZA 3GCTG 1IQGA 3ZZ3A 1CBWC 3M5LA 3T62A 3NUMA 4U01A 1UTQA 3A85A 3TH3H 1TNKA 1QRZA 1BBRE 3ODFA 2PTCE 1IAUA 3SBKA 8GCHF 4CR9A 4I8GA 1ZTLA 2TRMA 3TH2H 1O5EH 2BHGA 1TE0A 3W95A 3MNSA 1FY5A 4XDEA 5F8TA 4HGCA 2WPMS 3U1IB 5EU8A 1SQAA 1VCPA 4OS2A 4XSKU 1F0SA 1UK3A 1MAYA 4DT7B 1QRWA 4I8KA 2AGIX 1V2NT 3EDXB 4WH8A 1GWAA 1GBBA 1MCTA 2ZIQH 4ISLA 5EXMA 1GMHF 5LPRA 4ZUHA 2I6QA 4U30A 2ZU5A 5CHAC 3PMAB 3U8RH 2BZ6H 4O97A 4D7FA 1NY22 2BY5X 2GX4A 3OSYA 1EAXA 4M7GA 4Y7BA 1SLXB 4Y79A 1Y59T 4FVDA 1O2VA 1GL0E 2H5DA 4ISOA 3A8BA 1C5NH 1C1OA 2J34A 4ABHA 3P8FA 4UFEH 1PPHE 2XWAA 1O3CA 5F03A 1RD3B 2OP9A 3ZZCA 1ZJKA 2V0BA 1GI0A 5FPTA 3EQ0H 1GG6C 1T4UH 3CENA 1N6XA 1GGDC 2Y5GA 6ESTA 2BVSH 1DE7H 1HBTH 1EP6A 4MTBA 4OS1A 5CMXH 1T8OA 1X7AC 2A4QA 1C2GA 2ZZUH 5FPSA 5J4QA 2ZGBH 1EZUC 1H1BA 4JYTA 1FN6A 1JBUH 2Z9JA 4X2XA 1ZPZA 3HPTB 4BAOB 2GMTC 2F83A 3GCTF 3A82A 2P94A 1JIRA 3QO6A 3SUFA 1QJ6B 2R2MB 4I7YH 2BDHA 3T2NA 3W94A 1HAHH 4FUIA 4BAHB 4GHTA 1P0SH 4GSOA 3ZZ6A 1UJ1A 1B7XB 1HYLA 3OYPA 2Y7ZA 1TBZH 5T3HA 1O38A 1BZXE 2HLCA 4CRAA 1GHBF 2Y5HA 1PPBH 1ETSH 1PPCE 5C1XA 4JYUH 4XOJA 1O3HA 1O3LA 1K1MA 1V2TT 1SOZA 1QBVH 3NPSA 2ZCKP 3P92A 3RC4A 1M9UA 1KXAA 4I8HA 1YPGH 3MO9A 4DG4A 2ZGCA 3RMNH 1GCTC 4TY7A 3RU4E 2GZ9A 5FBIA 1ZLRA 1EZXC 1BIOA 3TIUA 4O3UA 1QHRB 1AKSA 1HJ8A 4VGCB 2HNTC 1NRSH 3BN9A 1GVLA 1BMAA 3P8OA 4JMYA 2VIDA 3RXRA 1C2FA 4B71A 2Z3EA 4E7NA 3M36A 1FY4A 2QXIA 2QA9E 3H7OA 2OC7A 4X1SU 1FY3A 2GD4B 3SNDA 5GCHG 1EJAA 2BY9X 3SNAA 1D9IA 2VINA 3SHCH 2DUCA 3A7XA 2THFB 1MU8B 1T31A 3E3TA 3A80A 3KN2A 1RJXB 1V2QT 1LDTT 1V2PT 2A4RA 3VB6A 5GPIB 1EB2A 1H9HE 1FN8A 1ANDA 1QY6A 2ZTXA 3QGNB 4IC6A 4HI3A 1ORFA 3RDZA 3STIA 1AMHA 1G2LA 3PB1E 3GY2A 1SGPE 3PO1B 2Y80A 2BOHB 5DO4H 1K1LA 1O3EA 3SORA 1THSH 3E1XB 3TNTA 2ANWA 3T27A 1OWDA 4HFPB 1PQ8A 1CA0B 1NS3A 4THNH 5JYIA 1ELBA 2BLQA 1HAXB 1DVAH 1MTVA 3RLYH 5GJ4B 5F6MA 4MDSA 1KLTA 3QGJA 1GHAF 1IQFA 1TALA 3GDUA 1J8AA 1XMNB 1C4V2 2UUJB 4E7RG 1FQ3A 1OPHB 5C5OA 3TJNA 4ABAA 1TA6A 1E36B 3VGCC 1JXPA 1FNIA 1GBHA 1MQ6A 3MNBA 2STAE 4DOQA 1P2NA 1S0RA 2CV3A 1V2VT 2RCEA 4BOHA 1E35B 3UFAA 2EI6A 1OP2A 2GP9B 3RC5A 1GHXH 1AB9B 1KDQB 1LO6A 4D76A 4IS5A 1L1JA 1OXGA 1UVPA 1MCVA 1IHTH 5DP3A 2C93B 1AHTH 2ZPSA 1RTKA 3B23B 4X1RU 1D6RA 5DP5A 1V2LT 2IOTA 1P2KA 2UWPA 4ZKSU 2F3CE 1SGFA 5ESBA 4AB8A 1V2WT 7GCHG 3RU4D 3RXIA 1OP8A 4E06H 2XRCA 4FUDA 1HAGE 1HJAC 1E0FD 1C5XB 1LVMA 2J92A 1HAPH 1FI8A 3ZV9A 2BDYA 3GY7A 4CHAC 2XBYA 1C5TA 1MAXA 3QDZB 1HV7A 3LGVA 3BEUA 1AD8H 1BMMH 2P3FH 2SGDE 3MHWU 3LH3A 5GCHF 4AB9A 1AUTC 2OUAA 1N1LA 4FU8A 1BRCE 1O5AB 3PMBB 2CXVA 3A7ZA 3KHVA 1SOTA 3P17H 3BTQE 1XKBC 1NFXA 1UK4A 4Y0ZE 2QV1A 1O3JA 1P2MA 1K22H 1MZDA 1Z8IB 2XNIA 3BTME 3DA9B 1IHSH 3LC3A 2FX6A 2ZEBA 1W7GH 1WTGH 5IDKA 1GBLA 4YO9A 5I46H 1TLDA 1CT0E 4AYVB 3HK6B 1FIWA 1CHOF 1W0YH 4K8BA 4MQAA 1NTPA 5C3NA 1XUHA 4X8TH 4BAQB 2EEKA 1SQTA 1DY8A 2VNTA 2GV6A 1MD8A 2FOMB 4YT7H 1VITG 1PQ7A 4ZMAH 1QB9A 1EAIA 1P3EA 4X8SH 4K8YA 3UWJH 3M37A 1F5KU 3V12A 2HNTF 2YNBA 3GDVA 2AGGX 3M61U 2ZU2A 1O2JA 1G9IE 8LPRA 1YPHC 2ZTYA 4WXVA 1TA2A 1HB0B 3V3MA 1RS0A 2CN0H 3GCOA 4GCHG 4HZHA 2NU2E 2ZDNA 1MUEB 4I31A 1PPFE 3S7HB 2FLRH 2NU4E 3T5FH 2J4IA 3RXPA 4AFQA 1L1NA 3IWMA 2ESTE 2ZHFH 3MOCA 1O3IA 3O8BA 4GHQA 1MKXK 3QLPH 1MBMA 3U8OH 2D8WA 7GCHF 4A1VA 3S9CA 5FXLA 4BAMB 3TH4H 6LPRA 1YBWA 1YCPM 1GI6A 3SJ9A 3ZZ4A 1GJCB 2GDDA 1UHBA 2Q6DA 1FPHH 3ZV8A 2O8WA 4IMZA 3ZZDA 2H1UA 1W7XH 3GDSA 1EATA 2OLGA 3K6ZA 1PYTD 3GYMA 1SFQB 1O3FA 3SQEE 1O30A 1QA7A 4XBCA 4UDWH 2F9PA 2GKVE 2ZU1A 3A87A 1CO7E 1LCYA 2Y7XA 1LMWB 3RXQA 5T6DA 4A5TS 2XCFA 2P16A 2C8XB 4IN1A 3UQOA 1QL8A 4WF8A 1YCPH 4NA7A 1O33A 2Y82A 2ZDVH 3SJ8A 1YLDA 2ZFFH 2P8OC 1EX3A 7KMEH 1IQLA 2VB0A 1D4PB 2BDAA 1O2PA 2GT7A 1WTHD 2A5AA 3SOSA 4BXSA 1MTNC 2BD3A 5IYTA 1BRUP 3KF2A 3DHKH 1MD7A 1NPMA 1TGSZ 1KTSB 1VZQH 2A5KA 1ZHMA 3WY8A 1BJVA 1O36A 4LZ4B 1MKXH 4GPGA 1K21H 2R0LA 5A09A 4MNXA 3QN7A 1THPB 1YPEH 5DJ7A 1LPKB 2ZGJA 3SV6A 5DG6A 1AUJA 3MU1A 4X1PU 5C1YA 1AFEH 1ESAA 3QZRA 1O2IA 3M7UA 2ZHWH 1ELTA 2VGCC 3UTUH 3RM0H 2OD3B 2OQUA 1LHDH 2D26C 5I25A 1A0HB 3BTKE 1W11U 1WOFA 2XBWA 1B0EA 1G36A 3ZVGA 2OC0A 4Y10E 1YF4A 3UWIA 3FZZA 4NCYA 1JOUB 2FOHA 1GMDG 1GI5A 1ZSKA 3D65E 4MNWA 6GCHG 2C3SA 4GCHF 1QJ7B 1AKSB 3K6YA 2WINI 1P10A 1VCWA 3A89A 4O3TA 4ABJA 4ESTE 4CR5A 1B0FA 1C1UH 1BMNH 1Z6EA 1TAWA 2BLVA 5G4BA 4IMQA 2FWWA 4ZXYH 6CHAB 1WAYB 3UR6A 4INHA 1O2ZA 5C1UA 3M5MA 3SV7A 2BD9A 2VWMA 4BNRA 2HRVA 1MTWA 2P3UB 3A84A 4DJZB 5A8YA 1XVMA 2QAAA 1DWBH 2K1QA 3LGWA 1BJUA 2J2UA 1ABJH 3KCGH 2CHAC 3NK8A 3RXLA 3LPRA 1T32A 1LPZB 4XFQA 1O3MA 3E16B 3M3TA 3D49H 1JIMA 2CF9H 1TBQH 2ZNKH 1O2MA 1A46H 1O5DH 9ESTA 1DITH 1JWTA 2GCHG 2P95A 3S9BA 2C8YB 4X6OA 2W26A 1PQ5A 1G37A 1YP9A 4MNVA 1TPOA 1HAIH 4JK6A 2RA3A 1HPGA 1NROH 4J1YA 4DIIH 1RFNA 2UWOA 1DANH 1BRAA 3MH5A 1F5RA 2FDAA 1BQYA 1YKTA 3GY5A 4WMFA 1PQAA 1V2KT 3PO1C 4ISHH 4MPWA 3R0FA 2FPZA 1LKBA 1BTPA 3ZVEA 5L2YH 1AVXA 5H4IB 3MO6A 3M7TA 5A0CA 1Z1IA 1EPTA 4TWYA 2GVFA 3MH7A 2H5CA 4RKOB 4GVUA 5JDUB 1DLKB 3UR9A 1A5HA 1L4ZA 1TPPA 4X0WU 4B2BA 5LPFA 1XUJA 3BG8A 4CRBA 1SGYE 1C5UA 1B5GH 2PSYA 2ZHDA 1C2KA 2VU8E 1W2KH 3LC5A 4CREA 4OS6A 1CQQA 2GCTB 3AW0A 4KTSA 1C2EA 1O31A 1ZHRA 3AVZA 1OWJA 3AAUA 4CRCA 2J94A 4NIVA 3M5NA 3SI4H 4YOJA 2Q1JA 4D7GA 2VVCA 5HM2A 3SU1A 3DFJA 1VGCB 3GOVB 4MLFB 4IC5A 4O9VA 2VH0A 1O3GA 1DX5M 1TPAE 1VJ9U 1WSSH 3V7TA 4CH8B 1A7SA 1F2SE 1TNGA 3ODDA 3ATLA 3O8CA 2FIRH 4YT6H 1A1RA 1Y3VA 4ABIA 3TLOA 6GCHF 2XXLA 4YLQH 3GY4A 1O2WA 1P12E 1C5YB 2M5TA 2PKSB 3BTGE 2Z94A 4JZDH 1WYKA 5JBTA 1IQHA 3SU5A 3STJA 4D8NA 8KME2 1ZR0A 1SFIA 1PPGE 1K2I1 1QFKH 2SGAA 3C1KA 3Q77A 2VWNA 3TITA 2A0QB 2QF3A 3M7QA 4AFSA 3UIRA 1A0JA 1SGRE 1TGBA 1S6FA 1GI4A 1HXFH 1H4WA 2OXSA 1BTUA 1DSTA 3MU4A 2F91A 2BY8X 1P8VC 3TNSA 1DFPA 4Q7YA 2BD5A 2QC2A 3SV8A 1EOJA 3E91A 3PTBA 1NU9A 1GBTA 2F9OA 3VB7A 3KEEA 1GJ7B 1INCA 2P3TB 1Z8GA 1QNJA 2D1JA 1AFQB 2HPQH 5FHTA 4AOQA 4K1SA 5HXFA 4IN2A 1O5BB 1O35A 3LJOA 1MZAA 4NWLA 1DDJA 1SQOA 2W3KA 4U2WA 3Q3XA 5AFZH 2BMGB 3F9EA 1ZGVA 4XE4A 1O32A 4CRDA 1CU1A 3RXSA 2BDBA 1BUIA 1UTMA 3SNCA 1QBOA 4YTAA 5DP7A 3NWUA 1TRMA 5E2OA 1V2OT 1HCGA 2DE9A 1NRPH 2BLWA 1SLWB 5DP9A 4JCNA 3BTTE 4IBLH 3DUXH 1UCYH 4BXWA 3RXOA 1TFXA 1T8NA 3M35A 1O2RA 1RRKA 1NZQH 3A7WA 1QL7A 2OINA 2VIOA 2XBXA 2AYWA 3PLPA 1C1MA 1KXBA 2XC5A 2QN5T 3BEFB 3KGPA 3A7VA 1A5IA 3ATIA 3ATMA 2UUFB 1QCPA 1TQ0B 1GL1A 1KIGH 3UNRA 1GHVH 1C2MA 2ODYB 2FX4A 1ELCA 1F5LA 2A4GA 3P6ZB 1GVZA 2G4UA 1J17T 4TPIZ 3FVFB 4UE7H 1C1TA 1C5OH 1C5VA 1MTUA 1KXDA 1TIOA 2Z9LA 3RXEA 3FP7E 3PM3A 4FVBA 4X6MA 4BTIB 3ENSB 1UHBB 1ANEA 2V6NA 1BOQA 1N8OB 5AHGH 1OWIA 1NT1A 3TGKE 2ZI2H 1FY1A 1XUFA 3O8DA 5EQQA 2AMPA 1O3PB 4GLYA 1C1RA 1KLJH 4FUGA 2XC0A 1DUEA 3BTHE 4BANB 1TYNA 4PROA 4NSYA 1BTXA 1W13U 5FX5A 5TJXA 3LGTA 2ZGHA 3FANA 2BVRH 3MU5A 1C2HA 3LU9B 1WCZA 5FAHA 1Q2WA 4K69A 2AS9A 2ZFQH 2SFAA 1GMCG 3VB3A 1C9PA 1K1PA 1JRSA 1LHFH 3MU8A 3C27B 4NWKA 2ZHEH 3OY5U 5HMAA 1V2JT 1SR5C 1G3CA 1DY9A 4ZAEA 1O2YA 2J38A 1GBEA 5LH8A 1GCDA 5EGMA 4I32A 5GXPA 5HM9A 4A92A 2AMDA 1F92A 1O3BA 2UUYA 4IW4E 1TX8A 1W10U 1AZ8A 2YNAA 3RMLH 3BF6H 3ZVFA 1WUNH 1TNHA 3ELAH 3A81A 3EGKH 2BQ6B 1ELGA 2BD2A 2FOAA 5A8XA 1EB1H 1SMFE 4KKDA 1C5ZB 1ETTH 3PROA 4X8VH 1ELEE 4D9RA 1Z7KA 1G32B 1AN1E 1C2DA 2QGRA 1QR3E 1ZHPA 2ZCLP 1UTJA 5ETXA 4NFFA 1TX7A 3GCNA 1HFDA 3EA9A 1S5SA 3GCHC 2PR3A 1CT2E 4R8TB 3BG4B 2B9LA 4NA9H 1F0TA 1UTOA 3BTEE 4B75A 3SU2A 1V2RT 3Q3KA 2GZ7A 1T8MA 1W8BH 3SNEA 1C5QA 3D23A 1RTFB 2PUQH 3SGAE 1UK2A 3OX7U 3JZ1B 3SJKA 2BZAA 4F4OC 2FTMA 2A7JA 1C5PA 1SBWA 4Z0KA 4GAWA 5J4SA 3H5CB 4ISIH 2O8TA 4ZH8A 4KGAA 2HPPH 2BDIA 1L1GA 2QXGA 6CHAC 1CBWB 1CSOE 2AFQB 4BTTB 1C1VH 4YOGA 1EASA 2AMQA 3CP7A 2QXHA 1GI2A 1EZSC 1GBKA 1FY8E 4Q80A 5C2ZA 5L6NH 2B5TB 1C5SA 2ZFTA 1ZSLA 1DSUA 2SNWA 4AX9H 1DOJA 3RXHA 3U98H 5EODA 4ZXXH 3KQCA 4FUJA 3OY6U 3EA7A 3UY9A 3QX5H 5EPNA 1S0QA 1ZTKA 1H8DH 4B1TA 8ESTE 3L6PA 3NXPA 1TGCA 3SI3H 1L0ZA 1GDQA 3PMHB 3SU3A 3SZNA 2ULLA 3IITA 2BQ7B 2G4TA 2QY0B 1S6HA 4OS4A 5BPEA 3U8TH 2JH0D 1GBMA 2OTVA 1VCQA 1EJMA 1EPTB 1PYTC 5CHAB 1MKWK 1H9LB 2FOCA 5EXNA 3QTVH 2FOGA 1BT7A 4AZ2B 1TMUH 3QZQA 1YGCH 2JH6D 2TGAA 1QBNA 1G3EA 1LTOA 3DT0H 2PWXA 3HK3B 3PYHA 1C2JA 2ANKH 2F9UA 4UONA 2AH4X 4KP0A 3URCA 3ZYDA 4ABDA 1Y3XA 3A7TA 2GCTC 1GHWH 1AVGH 3TVJB 4ISNA 1CE5A 4X2YA 2ZP0H 1OWKA 1GG6B 1V6DA 4TYDA 1NU7B 1GBAA 1O39A 1VGCC 1A2CH 2GTBA 1GGDB 2XYAA 1U6QA 3HKJB 4YZUA 4CRGA 2ILNA 1DWEH 1FPCH 3G01A 3ZZBA 4X1QU 3KNXA 3UPEA 2BB4A 2G81E 3E6PH 4B2CA 4DGJA 1DWDH 1P9UA 3CS0A 1VITH 2WYGA 1YCPK 1E37B 2ODPA 1BHXB 4BAKB 3RXFA 1GVKB 3M3VA 1GJ4H 1YPMH 3SHAH 2GMTB 1CGIE 1MKWH 4OS5A 2CJIA 3ZZ7A 3ZVAA 2ZECA 3B9FH 5JBAS 2OQ5A 3P70B 3ZVBA 2A7HA 1YLCA 1GBFA 4TWWA 4ABGA 1UTPA 1RIWB 3VXFH 2AGEX 2C90B 2HWLB 1YM0A 1UVOA 1K28D 1ELDE 1O3KA 1PFXC 1C5RA 3TGIE 4QT8C 5F8ZA 1VR1H 3A8CA 1LQDB 1QRXA 1V2ST 4OGXA 3TU7H 2R2WU 2V3HH 1OWEA 2V35A 1KLIH 2R9PA 4Y71A 1EUFA 3Q00A 2FP7B 3PV4A 4I8JA 2GDEH 1TX6A 3A8DA 1CT4E 4KTCA 4UFDH 5LGOA 3SV9A 1ZSJA 3I77A 1GCTB 4AGJA 4FUHA 1O2XA 1P11E 4D9QA 1K1IA 1ARCA 3T25A
chains in the Genus database with same CATH superfamily
1ETRH 1QJ1B 2K0QA 5JPMH 2O9QA 3RLWH 3LDXH 4K60A 4NA8A 1BTZA 4WVPE 1S83A 4LXBH 3GYLB 3LONA 4ZCNA 1LVYA 2ZFSA 2B8OH 2TGDA 1BA8B 3OFND 5AFYH 1MMJN 1PJPA 5JBCS 2HALA 1BDAA 1SGFG 3N7OA 3RXAA 3PLKA 1DUAA 5C0UA 3FN8A 1VJAU 4ZKNU 1HAVA 3SW2B 3GISB 2OBQA 2AIPA 2BY6X 2ZFRH 1NM6A 2TGPZ 4ACAA 1HAOH 1HIAA 1HJ9A 4RKJB 3RC6A 1TABE 2UUKB 3RXMA 1DT2A 4B74A 1VITF 2UWLA 3M5OA 3ZZ9A 3RXGA 1UVTH 1BTYA 2CF8H 4KTUA 5IK2D 1ESTA 2W7UA 4Y8YA 2RA0A 2FTLE 4OGYA 3F0OA 3U1JB 1S85A 4WWYA 4IGDA 2VVUA 1DPOA 1HUTH 2VWLA 3FFGA 3TPIZ 2ZDKA 1ZGIA 4INLA 7ESTE 3MMGA 2SGPE 1C9TA 1Y3UA 1CGHA 2ZU4A 1C1QA 2BXUH 2HLDD 2ZO3H 5PTPA 2ZDAH 1O2LA 2FOBA 4MPVA 3RMOH 4AG2A 3BTDE 1P01A 2G5VA 4VGCC 5L30H 2PFEA 2VIVA 3RXKA 4Q4LA 5T6GA 5DP8A 4DT4A 4X2VA 1YPKH 4DW2U 3SUEA 5JB9S 2VVVA 4ABEA 1T7CA 2A2XH 2ZDLA 4H6TA 2STBE 2ZQ1A 2PV9B 2XCNA 1FXYA 3T28A 4FUCA 5GDSH 2FXRA 3IG6B 2Y6TA 1HGTH 5CDFE 2H9TH 2G52A 1SL3A 1E38B 1O5GH 1KXCA 2BXTH 1GMHG 3FAOA 5FPYA 2XTTB 3TJOA 3ZZAA 2ASUB 5EIYA 2WUCA 3P95A 5EG4A 2AIQA 5FX6A 1EXFA 3HKIB 2FS9A 3RP2A 3OTJE 1LQEA 2SNVA 4ABFA 2C8WB 5DP6A 1AGJA 1LHEH 1O2TA 1GHZA 1WU1A 4X1NU 1CHGA 1HJAB 2GT8A 2VBCA 2D2DA 1NBMD 3T29A 2C8ZB 4DURA 1P2IA 1Z71A 2A7CA 1OYTH 5HIYA 1COWD 2G51A 4CHAB 1E1RD 3F2GA 1P02A 3HATH 2H6MA 4K1EA 3S9AA 1CA0C 2SGQE 3RXJA 1BRBE 4BTUB 1UVSH 1QZ8A 2H9EH 1F0RA 7LPRA 3NKKA 2ALVA 3UQVA 1SGEE 1XVOA 2TPIZ 1L4DA 1OSSA 1SGDE 1ANBA 3DD2H 4NFEA 3F1SB 2IJOB 1ZMJA 1ARBA 5B6OA 4R0IA 3I78A 4HTCH 4O03A 2Q6GA 3ZVCA 1O3OA 4FU7A 1J9CH 5HYOA 1SVPA 1HDTH 2TBSA 1SGIB 1OKXA 2NU1E 5L2ZH 1J15A 3MYWA 2GV7A 2NU0E 1UCYE 2HVXA 1OYQA 1AVWA 2FZZA 2Z7FE 4NSVA 4Y6DA 1AB9C 4Y8XA 2ZHQH 1GMDF 3O8RA 3H7TA 1ABIH 4LOYH 3F68H 2PGQB 4K1TA 2XW9A 3F0PA 2H2ZA 2BD4A 2QF0A 4B76A 1QQUA 1QB6A 4NGAH 4UEHH 4X6NA 5A0AE 1GHBG 2ZWLH 1A0LA 3NCLA 3E0NB 2XOKD 1UCYK 1UTKA 5EQSA 3PWCA 3VFEA 3MI4A 4DVAU 1O34A 3RXVA 1ZYOA 1QQ4A 2IPHA 5TCAA 3U69H 1BBRK 1C2IA 1XUKA 3DSGA 1SI5H 1YC0A 1C5MD 3A86A 3JZ2B 3UOUA 1NFUA 2VJ1A 2ZU3A 1GJAB 4SGAE 2GCHF 2L6OA 1GBJA 2FOEA 4Y0YE 5GIBA 4JZFH 2OC8A 3ATKA 4UFFH 1EPTC 3UUZA 4B2AA 4LK4A 2WPIS 1FJSA 1P2QA 1WV7H 1TRYA 4I8LA 2NU3E 3H09A 1SGTA 1K1OA 2PSXA 1ZMNA 4INKA 1EQ9A 4NZLA 3VXEH 3MH6A 2BQWB 3MO3A 3K9XB 3SO3A 5DSFA 2FYRA 1D3TB 1TOMH 4NIXA 1ESBA 4FUEA 4A6LA 5A2MH 1RXPA 1O37A 3BV9B 3VB4A 1UTLM 3ZVDA 1SGCA 5EQRA 1O2SA 4CBNA 2JKHA 2PHBA 2QXJA 1D3QB 1SG8B 2Z9IA 2ZKSA 1AE8H 4U32A 1ZRBA 5AVDA 1A5GH 4RSPA 1TB6H 1F7ZA 2FMJA 1AE5A 2W6ID 2G8TA 2ZF0H 3URDA 5LPEA 3ZYEA 1DS2E 5TCCA 1DM4B 1BBRH 5DGJA 1HLTH 3A88A 1GHYH 4ZROA 1O5CB 1QGFA 2P8OB 1UTNA 3E0PB 2Z9GA 1GJ6A 3KQDA 1O5FH 4ACBA 1TNIA 1TGTA 3E8LA 3SU0A 4MNYA 1MTNB 1HAYB 3CS7A 1WBGB 1XX9A 1Q31A 3I29A 5FCRA 1W3CA 3OEED 1ELAA 2YMSB 1GHAG 3F9GA 3PMJA 2F9VA 3KL6A 4K2YA 1P9SA 2FS8A 1NC6A 2BLOA 4RN6A 1RIWC 2BDCA 1P06A 3HGPA 1EOLA 3UNQA 1H9IE 2FESH 4DY7B 3QK1A 3SN8A 3MNXA 3R3GB 2KCOA 2VGCB 2EC9H 2FEQH 2PLXA 3UB0A 2R0KA 5DKMA 2OCVB 1QB1A 1P57B 1SLUB 2CGAA 1LVBA 2HNTE 1GI3A 2SGEE 1S82A 1ZOMA 1AY6H 3L3TA 2JETB 1A3BH 3A83A 3QUMP 1GDUA 3FZDA 4RT0A 1XUIA 1BMLA 1XUGA 4AG1A 5AF9H 5ESTE 2O8UA 5JB8S 4FU9A 1IOEA 2G5NA 2FO9A 4X8UH 5T6FA 3F9HA 2KAIA 2BX4A 3TK9A 3BSQA 1ZZZA 5EOKA 4E05H 1MU6B 5F8XA 2WPJS 1F0UA 1SHYA 4XBDA 1O2UA 1ELVA 3PV5A 2IPQX 2R3YA 3B8JA 1P03A 3KQ5A 1O2QA 2ANMH 2PKAA 1HAVB 2CHAB 3E90B 2OC1A 2A5IA 1AI8H 1YPLH 1CGJE 1J16A 2WPKS 3RU4T 1J14A 1HIAB 1ZJDA 1SSXA 3QTOH 3KQBA 5C67A 2B0FA 1P2OA 1NRQH 2ZQ2A 3VPKA 1EP5A 1KXFA 3BEIB 3GY3A 3MU0A 1LHGH 2FYQA 3BTWE 2Y5FA 5HGGA 2DE8A 5EW1H 4CBOA 2Z9KA 2O8MA 4MG3A 1P09A 1KTTB 1OX1A 3D62A 3TK5A 3UREA 1C1NA 1O2OA 2BDGA 5K7RA 1DICA 1ZRKA 3A7YA 5HKKD 1KY9A 1G3BA 1SPJA 1FDPA 3RXBA 2EI7A 1EJNA 1FMGA 2JDID 1XM1A 1NO9H 5SGAE 1V2MT 1O2HA 1GJDB 2QIQA 4NG9H 2TIOA 3WW7A 3ZZ5A 1V3XA 2BTCE 1CHOG 3F6UH 2ZDMA 4YOIA 4K5ZA 1GBCA 4FUFA 1IQJA 3WWBA 4WXIA 5KECA 1G2MA 4H42U 1SB1H 2WUBA 1Q3XA 2A45B 1KSNA 2EI8A 2C4FH 2LNCA 3K65B 2OBOA 5HIZA 2BD8A 5DN6D 1TNJA 2JH5D 1ACBE 1EKBB 4FXGH 4UFGH 1SC8U 1LHCH 3ITIA 1H8ED 1Y3WA 3S0NA 1AU8A 3KQEA 4AYYB 1AWHB 2FI4E 1OS8A 3ZZ8A 1GJ8B 1Y5UT 2HGTH 1DXPA 1G3DA 3MNCA 1O0DH 3GY8A 4AFUA 1K1JA 1V2UT 1TQ7B 1GBIA 2KCPA 2RDLA 1QL9A 1K9OE 3F9FA 3EA8A 4JZ1A 2CMYA 1T8LA 2VIWA 4H4FA 1WQVH 1D3DB 1MH0A 3PWBA 4ZKOU 2Z3DA 3LT3A 3S69A 2QYIA 1KXEA 3RM2H 3RXUA 1GJ9B 1GMCF 1Y3YA 1BTWA 1C1WH 1RTLA 2ZG0H 2P59A 2J9NA 2EA3A 4F49A 1GI8B 3SV2H 5B6LA 3TGJE 5E2PA 2XC4A 3V13A 3U9AH 1TNLA 5K0HA 3SQHE 2WV4A 5A8ZA 3NZIA 2ZGXH 3DFLA 1N6YA 3AASA 4YLUA 1LKAA 3KIDU 1GJBB 4OM9A 4WY3A 3L33A 4Q7ZA 1DXWA 1BHXF 1JMOH 1FONA 2QCYA 3Q76A 2ODQA 5C17A 3MTYA 1NRNH 1AZZA 3WWFA 2F9BH 1NRRH 1MTSA 3AAVA 2LPRA 1OP0A 1IQKA 1GPZA 4JYVH 4KELA 2A2QH 1ZPBA 4Y76A 1Z6JH 3ATWA 1MQ5A 3M3SA 1D6WA 1BITA 1ID5H 2H9HA 2ALPA 3SNBA 1O2NA 1BB0B 1GI7B 3SUDA 4XBBA 5CHBA 1WQSA 3LGYA 1FIZA 2F9NA 1TPSA 3LGUA 2VIPA 4J2YB 1K1NA 1C2LA 1E34B 1EAUA 2G55A 2V3OH 3Q3YA 3TK6A 4X6PA 1O3NA 2FOFA 2PKSC 3GICB 3SYJA 4ABBA 5FCKA 1G30B 1LPGB 1YPHE 4YM9A 3SGBE 2YOLA 3PV2A 5ABWA 3OU0A 4ZHMU 2I6SA 1GI1A 2PP6A 2RG3A 2ZPQA 4JZEH 3V0XA 1HAZB 3A8AA 5C94A 1XKAC 1BTHH 5EJ1A 3T26A 1NFWA 5E0GA 1IQEA 1P2JA 1KMHB 2BY7X 5T1VA 2FODA 1OOKB 1AO5A 3LH1A 2WPHS 4Z6AH 3QWCH 2LP6A 2PTNA 1AFQC 2W3IA 4YESB 1Z8RA 3MWIU 4WMDA 3RUOA 4CRFA 2JIZD 1MBQA 4A1TA 1IQMA 1JRTA 1BCUH 4Y7AA 1FAKH 4JK5A 2FI5E 4NIYA 2WZQA 4AN7A 1A61H 2Z3CA 1AQ7A 4TPYA 4UD9H 3S7KB 4Q7XA 1L2EA 5C0TA 5DK1A 2RDEA 2XBVA 3GY6A 3VB5A 1EAWA 3TJVA 1CA8B 3UOPA 5FL7D 1XXDA 4CH2B 4AGKA 1D3PB 1DLEA 5E0JA 1XXFA 1C5WB 3RXDA 2R3UA 4NIWA 1W0ZU 2VH6A 2B7DH 4TY6A 1Y5AT 2AERH 1TWXB 2FLBH 1A4WH 4GUXA 2PUXB 1ZPCA 1ZTJA 5A0BA 3AW1A 4DIHH 1C4U2 3MH4A 1P04A 4B73A 5DPAA 4MPUA 1Y8TA 3MFJA 2BVXH 1Z8JB 2P93A 3LIWA 1O2KA 4AORA 4DCDA 5BRRE 1OWHA 2SGFE 1QIXB 1PPZA 2VWOA 3EYDA 4A7IB 2ZC9H 3VEQB 1GDNA 2IN2A 5FBEA 1WDIA 1ANCA 1UO6A 2J95A 5E0HA 2ZFPH 1QA0A 4OS7A 1C1SA 5CE1A 1HNEE 1SLVB 3HGNA 3SJOA 1ELFA 1S84A 2A4OA 1NESE 4FETA 4LZ1H 1GBDA 2O8LA 3SU4A 4K3JA 1NFYA 1Z1JA 3TJUA 2XWBI 1E79D 3PLBA 4MPXA 1TGNA 3EE0B 1YPJH 3SJIA 8GCHG 1W14U 3ESTA 4WH6A 1O3DA 2PGBB 1UVUH 1HXEH 3FP6E 3U28C 2FI3E 4ZHAA 3EAJA 1N8OC 1EZQA 3GCHB 2KM0A 4F48B 3RMMH 4X2WA 2AEIH 2GGVB 1TMBH 1FV9A 1NN6A 4A1XA 9LPRA 1A3EH 1S81A 3BIUH 4WMEA 1GJ5H 1GI9B 2ZA5A 2JETC 4I33A 1THRH 2A32A 2L74A 1H8IH 2BD7A 1SHHB 3FP8E 3VGCB 2KAIB 2GZ8A 2ZPRA 2VIQA 1SGQE 4Y8ZA 2BOKA 1YYY1 1FAXA 1Y5BT 2Q6FA 2PKAB 1P05A 3LOXA 1HRTH 2EY4C 2HOBA 1MABB 3RXTA 3SGQE 3SUGA 1K0HA 3LGIA 3P8NA 2PW8H 5DP4A 5C20A 1IQNA 4AFZA 1KDQA 1LVOA 4MVNA 1ZMLA 3MQKC 2Y81A 3P8GA 1FLEE 1QTFA 1P3CA 3OEHD 5EPYA 3BIVH 1AIXH 4H6SB 1FUJA 4ZKRU 2G00A 4AC9A 2Z6BD 4HG6A 3SU6A 1TRNA 3LKWA 1UMAH 4SGBE 1QURH 1DWCH 3BTFE 1KYNA 1IQIA 1C5LH 1C4Y2 2A31A 5JBBS 2W5EA 2FM2A 1RGQA 2ZCHP 1AWFH 1TONA 1T4VH 3FOAA 5GWZA 4ZHLU 2NWNA 2BYAX 3BG4C 5E8EH 2BX3A 1FZZA 1PPEE 4P02A 1TOCB 5EXLA 1O3AA 2BM2A 1TMTH 1O2GH 2TGTA 2A1DB 4WJG2 2ANYA 4FUBA 2W7SA 2YMSD 2WV5A 4JZIA 2WYJA 3K2UA 4ASHA 1SGNE 3PTNA 1C1PA 4Q2KA 5C5NA 2WPLS 4NZQA 5EW2H 1CVWH 4Y11E 4Z1MD 1TBRH 3UNSA 1W12U 3LJJA 3RXCA 2QF4A 2ZTZA 3GCTG 1IQGA 3ZZ3A 1CBWC 3M5LA 3T62A 3NUMA 4U01A 1UTQA 3A85A 4Q63A 3TH3H 1TNKA 1QRZA 1BBRE 3ODFA 2PTCE 1IAUA 3SBKA 8GCHF 4CR9A 4I8GA 1ZTLA 2TRMA 3TH2H 1O5EH 2BHGA 1TE0A 3W95A 3MNSA 1FY5A 4XDEA 5F8TA 4HGCA 2WPMS 3U1IB 3SZEA 5EU8A 1SQAA 1VCPA 4OS2A 4XSKU 1F0SA 1UK3A 1MAYA 4DT7B 1QRWA 3KYFA 4I8KA 2AGIX 1V2NT 2AHME 3EDXB 4WH8A 1GWAA 1GBBA 1MCTA 2EQNA 2ZIQH 4ISLA 5EXMA 1GMHF 5LPRA 4ZUHA 2I6QA 4U30A 2ZU5A 5CHAC 3PMAB 3U8RH 2BZ6H 2QF5A 4O97A 4D7FA 1NY22 2BY5X 2GX4A 3OSYA 1FX0B 1EAXA 4M7GA 4Y7BA 1SLXB 2KR7A 4Y79A 5KGOA 1Y59T 4FVDA 1O2VA 1GL0E 2H5DA 3OAAD 4ISOA 3A8BA 1C5NH 1C1OA 2J34A 4ABHA 3P8FA 4UFEH 2W6JD 1PPHE 2XWAA 1O3CA 5F03A 1RD3B 2OP9A 3ZZCA 2WPDD 1ZJKA 4B6FA 2V0BA 1GI0A 5FPTA 3EQ0H 1GG6C 1T4UH 3CENA 1N6XA 1GGDC 2Y5GA 6ESTA 2BVSH 1DE7H 1HBTH 2K8IA 1EP6A 4MTBA 4OS1A 5CMXH 1T8OA 1X7AC 2A4QA 1C2GA 2ZZUH 5FPSA 3ZIAD 5J4QA 2ZGBH 1EZUC 1H1BA 4JYTA 1FN6A 1JBUH 2Z9JA 4X2XA 1ZPZA 3OE7D 3HPTB 4BAOB 2GMTC 2F83A 3GCTF 3A82A 2P94A 1JIRA 3QO6A 3SUFA 1YWUA 1QJ6B 2R2MB 4I7YH 2BDHA 3T2NA 3W94A 1HAHH 4FUIA 2WHXA 2KZ4A 4BAHB 3EE7A 4GHTA 1P0SH 2WSSD 4GSOA 3ZZ6A 1UJ1A 1B7XB 1HYLA 3OYPA 2Y7ZA 1TBZH 5T3HA 1O38A 1BZXE 2HLCA 2XNDD 4CRAA 1GHBF 2Y5HA 1PPBH 1ETSH 1PPCE 5C1XA 4JYUH 4XOJA 3GS9A 1O3HA 1O3LA 1K1MA 1V2TT 1SOZA 1QBVH 3NPSA 2ZCKP 3P92A 3RC4A 1M9UA 1KXAA 4I8HA 1YPGH 3MO9A 4DG4A 2ZGCA 3RMNH 1GCTC 4TY7A 3RU4E 2GZ9A 5FBIA 1ZLRA 1EZXC 1BIOA 3TIUA 4O3UA 1QHRB 1AKSA 1HJ8A 4VGCB 2HNTC 1NRSH 3BN9A 1GVLA 1BMAA 3P8OA 4JMYA 2VIDA 3RXRA 1C2FA 4B71A 2Z3EA 4E7NA 3M36A 1FY4A 2QXIA 2QA9E 3H7OA 2OC7A 4X1SU 1FY3A 2GD4B 3SNDA 5GCHG 1EJAA 2BY9X 3SNAA 1D9IA 2VINA 3SHCH 2DUCA 3A7XA 2THFB 1MU8B 1T31A 3E3TA 3A80A 3KN2A 2JJ1D 1RJXB 1BMFD 1V2QT 1LDTT 1V2PT 2A4RA 3VB6A 5GPIB 1EB2A 1H9HE 1FN8A 1ANDA 1QY6A 2ZTXA 2KCAA 3QGNB 4IC6A 4HI3A 1YY3A 1ORFA 3RDZA 3STIA 1AMHA 3PRDA 1G2LA 3PB1E 3GY2A 1SGPE 3PO1B 2Y80A 2BOHB 5DO4H 1K1LA 1O3EA 3SORA 1THSH 3E1XB 3TNTA 2ANWA 3T27A 1OWDA 4HFPB 1PQ8A 1CA0B 1NS3A 4THNH 5JYIA 1ELBA 2BLQA 1HAXB 1DVAH 1MTVA 3RLYH 5GJ4B 5F6MA 4MDSA 1KLTA 3QGJA 1GHAF 1IQFA 4TSFD 1TALA 3GDUA 1J8AA 1XMNB 1C4V2 2UUJB 4E7RG 1FQ3A 1OPHB 5C5OA 3TJNA 4ABAA 1TA6A 1E36B 3VGCC 1JXPA 1FNIA 1GBHA 1MQ6A 3MNBA 2STAE 4DOQA 1P2NA 1S0RA 2CV3A 1V2VT 2RCEA 4BOHA 1E35B 3UFAA 2EI6A 1OP2A 2GP9B 3RC5A 1GHXH 2JJ2D 1AB9B 1KDQB 1LO6A 4D76A 4IS5A 1L1JA 1OXGA 1UVPA 1MCVA 1IHTH 5DP3A 3PRBA 2C93B 1AHTH 2ZPSA 1RTKA 3B23B 4X1RU 1D6RA 5DP5A 1V2LT 2IOTA 1P2KA 2UWPA 4ZKSU 2F3CE 1SGFA 5ESBA 4AB8A 1V2WT 7GCHG 3RU4D 3RXIA 1OP8A 4E06H 2XRCA 4FUDA 1HAGE 1HJAC 1E0FD 1C5XB 1LVMA 2J92A 1HAPH 1FI8A 3ZV9A 2BDYA 3GY7A 4CHAC 2XBYA 1C5TA 5KEDA 1MAXA 3QDZB 1HV7A 1YLNA 3LGVA 3BEUA 1AD8H 1BMMH 2P3FH 2SGDE 3MHWU 3LH3A 5GCHF 4AB9A 2LELA 1AUTC 2OUAA 1N1LA 4FU8A 1BRCE 1O5AB 3PMBB 2CXVA 3A7ZA 3KHVA 1SOTA 3P17H 3BTQE 1XKBC 1NFXA 1UK4A 4Y0ZE 2QV1A 1O3JA 1P2MA 1K22H 1MZDA 1Z8IB 2XNIA 3BTME 3DA9B 1IHSH 3LC3A 2FX6A 2ZEBA 1W7GH 1WTGH 5IDKA 1GBLA 4YO9A 5I46H 1TLDA 1CT0E 4AYVB 3HK6B 1FIWA 1CHOF 1W0YH 4K8BA 4MQAA 1NTPA 5C3NA 1XUHA 4X8TH 4BAQB 2EEKA 1SQTA 1DY8A 2VNTA 4B6EA 2GV6A 1MD8A 2FOMB 4YT7H 1VITG 1PQ7A 3OTPA 1QB9A 4ZMAH 1EAIA 1P3EA 4X8SH 4K8YA 1EFRD 3UWJH 3M37A 1F5KU 4I86A 3V12A 3N7DA 2HNTF 2YNBA 3GDVA 2AGGX 3M61U 2ZU2A 1O2JA 1G9IE 8LPRA 1YPHC 2ZTYA 4WXVA 1TA2A 1HB0B 3V3MA 1RS0A 2CN0H 3GCOA 4GCHG 4HZHA 2NU2E 2ZDNA 1MUEB 4I31A 1PPFE 3S7HB 2FLRH 2NU4E 3T5FH 2J98A 2J4IA 3RXPA 4AFQA 1L1NA 3IWMA 2ESTE 2ZHFH 3MOCA 1O3IA 3W1EA 3O8BA 2M2AA 4GHQA 1MKXK 3QLPH 1MBMA 3U8OH 2D8WA 7GCHF 4A1VA 3S9CA 5FXLA 4BAMB 3TH4H 6LPRA 1YBWA 1YCPM 1GI6A 3SJ9A 3ZZ4A 1GJCB 2GDDA 1UHBA 2Q6DA 1FPHH 3ZV8A 2O8WA 4IMZA 3ZZDA 2OK5A 2H1UA 1W7XH 3GDSA 1EATA 2OLGA 3K6ZA 1PYTD 3GYMA 1SFQB 1O3FA 3SQEE 1O30A 1QA7A 4XBCA 4UDWH 2F9PA 2GKVE 2ZU1A 3A87A 1CO7E 1LCYA 2Y7XA 1LMWB 1NBME 3RXQA 5T6DA 4A5TS 2XCFA 2P16A 2C8XB 4IN1A 3UQOA 1QL8A 4WF8A 1YCPH 4NA7A 1O33A 2Y82A 2ZDVH 3SJ8A 1YLDA 2ZFFH 2P8OC 2RFKC 1EX3A 7KMEH 1IQLA 2VB0A 1D4PB 2BDAA 1O2PA 2GT7A 1WTHD 2A5AA 4RI0A 2WV9A 3SOSA 4BXSA 1MTNC 2BD3A 5IYTA 1BRUP 3KF2A 3DHKH 1MD7A 1NPMA 1TGSZ 1KTSB 1VZQH 2A5KA 1ZHMA 2YMSC 3WY8A 1BJVA 1O36A 5EJLA 1MKXH 4GPGA 4LZ4B 1K21H 2R0LA 5A09A 4MNXA 3N99A 3QN7A 1THPB 1YPEH 5DJ7A 1LPKB 2ZGJA 3SV6A 5DG6A 1AUJA 3MU1A 4X1PU 5C1YA 1AFEH 1ESAA 1S6LA 3QZRA 1O2IA 3M7UA 2ZHWH 1ELTA 2VGCC 3UTUH 3RM0H 4XRNA 2OD3B 2OQUA 1LHDH 2D26C 5I25A 1A0HB 3BTKE 1W11U 1WOFA 2XBWA 1B0EA 1G36A 3ZVGA 2OC0A 4Y10E 1YF4A 3UWIA 3FZZA 4NCYA 1JOUB 2FOHA 1GMDG 1GI5A 1ZSKA 3D65E 4MNWA 3FO8D 6GCHG 2C3SA 4GCHF 1QJ7B 1AKSB 3K6YA 2WINI 1P10A 1VCWA 3A89A 4O3TA 5GNDA 4ABJA 4ESTE 4CR5A 1B0FA 1C1UH 1BMNH 1Z6EA 1TAWA 2BLVA 4ASUD 5G4BA 4IMQA 2FWWA 4ZXYH 6CHAB 1WAYB 3UR6A 4INHA 1O2ZA 5C1UA 3M5MA 3SV7A 2BD9A 2VWMA 4BNRA 2HRVA 1MTWA 2P3UB 3A84A 4DJZB 5A8YA 1XVMA 2QAAA 1DWBH 2K1QA 3LGWA 1BJUA 2J2UA 1ABJH 3KCGH 2CHAC 3NK8A 3RXLA 3LPRA 1T32A 1LPZB 4XFQA 1O3MA 3E16B 3M3TA 3D49H 1JIMA 2CF9H 1TBQH 2QE7D 1O2MA 1A46H 1O5DH 2ZNKH 9ESTA 1DITH 1JWTA 2GCHG 2P95A 3S9BA 2C8YB 4X6OA 2W26A 1PQ5A 1G37A 1YP9A 4MNVA 1TPOA 1HAIH 4JK6A 2RA3A 1HPGA 1NROH 4J1YA 4DIIH 1RFNA 3KYGA 2UWOA 1DANH 1BRAA 3MH5A 1F5RA 2FDAA 1BQYA 1YKTA 3GY5A 4WMFA 1PQAA 1V2KT 3PO1C 4ISHH 4MPWA 3R0FA 2FPZA 1LKBA 1BTPA 3ZVEA 5L2YH 1AVXA 5H4IB 3MO6A 3M7TA 5A0CA 1Z1IA 1EPTA 4TWYA 2GVFA 3MH7A 2H5CA 4RKOB 5F53A 4GVUA 5JDUB 3UAIC 1DLKB 3UR9A 1A5HA 1L4ZA 1TPPA 4X0WU 4B2BA 5LPFA 1XUJA 3BG8A 4CRBA 1SGYE 1C5UA 1B5GH 2PSYA 2ZHDA 1C2KA 2VU8E 1W2KH 3LC5A 4CREA 4OS6A 4RT1A 1CQQA 2GCTB 3AW0A 4KTSA 1C2EA 1O31A 1ZHRA 3AVZA 2V3MA 1OWJA 3AAUA 4CRCA 2J94A 4NIVA 3M5NA 3SI4H 4YOJA 2Q1JA 4D7GA 2VVCA 5HM2A 3SU1A 3DFJA 1VGCB 3GOVB 4MLFB 4IC5A 4O9VA 2VH0A 1O3GA 1DX5M 1TPAE 1VJ9U 1WSSH 3V7TA 4CH8B 2J97A 1A7SA 1F2SE 1TNGA 3ODDA 3ATLA 3O8CA 2FIRH 4YT6H 1A1RA 1Y3VA 4ABIA 3TLOA 1SQRA 6GCHF 2IJD1 2XXLA 3N7EA 3GY4A 4YLQH 1O2WA 1P12E 1C5YB 2M5TA 2PKSB 3BTGE 2Z94A 4JZDH 1WYKA 5JBTA 1IQHA 3SU5A 3STJA 4D8NA 8KME2 2F43B 1ZR0A 1SFIA 1PPGE 1K2I1 1QFKH 2SGAA 3C1KA 3Q77A 2VWNA 3TITA 2A0QB 2QF3A 3M7QA 4AFSA 3UIRA 1A0JA 1SGRE 1TGBA 1S6FA 1GI4A 1HXFH 1H4WA 2OXSA 1BTUA 1DSTA 3MU4A 2F91A 2BY8X 1P8VC 3TNSA 1DFPA 4Q7YA 2BD5A 2J5UA 2QC2A 3SV8A 1EOJA 3E91A 3PTBA 1NU9A 1GBTA 2F9OA 3VB7A 3KEEA 1GJ7B 1INCA 2P3TB 3F2HA 1Z8GA 1QNJA 2D1JA 1AFQB 2HPQH 5FHTA 4AOQA 2KFWA 4K1SA 5HXFA 4IN2A 3F3BA 1O5BB 1O35A 3LJOA 1MZAA 4NWLA 1DDJA 1SQOA 2W3KA 4U2WA 3Q3XA 5AFZH 2BMGB 3F9EA 1ZGVA 4XE4A 1O32A 4CRDA 1CU1A 3RXSA 2BDBA 1BUIA 1UTMA 3SNCA 1QBOA 4YTAA 3DSPA 3VG8A 4XD7D 3FKSD 3NWUA 5DP7A 1TRMA 5E2OA 1V2OT 1HCGA 2DE9A 1NRPH 2BLWA 1SLWB 5DP9A 4JCNA 3BTTE 4IBLH 3DUXH 1UCYH 1E1QD 4BXWA 3RXOA 1TFXA 1T8NA 3M35A 1O2RA 1RRKA 1NZQH 3DCLA 3A7WA 1QL7A 2OINA 2VIOA 2XBXA 2AYWA 3PLPA 1C1MA 1KXBA 2XC5A 2QN5T 3BEFB 3KGPA 3A7VA 1A5IA 3ATIA 3ATMA 2UUFB 2GJGA 1QCPA 1TQ0B 2J98B 1GL1A 1KIGH 3UNRA 1GHVH 1C2MA 2ODYB 2FX4A 1ELCA 1F5LA 2A4GA 3P6ZB 1GVZA 2G4UA 1J17T 4TPIZ 3FVFB 4UE7H 4F55A 1C1TA 1C5OH 1C5VA 1MTUA 1KXDA 1TIOA 2Z9LA 3RXEA 3FP7E 3PM3A 4FVBA 4X6MA 4BTIB 3ENSB 1UHBB 1ANEA 2V6NA 1BOQA 1N8OB 2KX4A 5AHGH 1OWIA 1NT1A 3TGKE 2ZI2H 1FY1A 1XUFA 3O8DA 5EQQA 2AMPA 1O3PB 4GLYA 1C1RA 1KLJH 4FUGA 2XC0A 1DUEA 3BTHE 4P00A 4BANB 1TYNA 4PROA 4NSYA 1BTXA 1W13U 5FX5A 5TJXA 3LGTA 2ZGHA 3FANA 2BVRH 3MU5A 1C2HA 3LU9B 1WCZA 5FAHA 1Q2WA 4K69A 2AS9A 2ZFQH 2SFAA 1GMCG 3VB3A 1C9PA 1K1PA 1JRSA 1LHFH 2V7QD 3MU8A 3C27B 4NWKA 2ZHEH 3OY5U 5HMAA 1V2JT 1SR5C 2HVYB 1G3CA 1DY9A 4ZAEA 1O2YA 2J38A 1GBEA 5LH8A 1GCDA 5EGMA 4I32A 5GXPA 1W0KD 5HM9A 4A92A 2AMDA 1F92A 1O3BA 2UUYA 4IW4E 1TX8A 1W10U 1AZ8A 2YNAA 3RMLH 3BF6H 3ZVFA 1WUNH 1TNHA 3ELAH 3A81A 3EGKH 2BQ6B 1ELGA 2BD2A 2FOAA 5A8XA 1EB1H 1SMFE 4KKDA 1C5ZB 1ETTH 3PROA 4X8VH 1ELEE 4D9RA 1Z7KA 1G32B 1AN1E 1C2DA 2QGRA 1QR3E 1ZHPA 2ZCLP 1UTJA 5ETXA 4NFFA 1TX7A 3GCNA 1HFDA 5EJZA 3EA9A 1S5SA 3GCHC 2PR3A 1CT2E 4R8TB 3BG4B 2B9LA 4NA9H 1F0TA 1UTOA 3BTEE 4B75A 3SU2A 1V2RT 3Q3KA 2GZ7A 1T8MA 1W8BH 3SNEA 1C5QA 1H8HD 1RTFB 2PUQH 3D23A 3SGAE 1UK2A 3OX7U 3JZ1B 3SJKA 2BZAA 4F4OC 2FTMA 2A7JA 1C5PA 1SBWA 4Z0KA 4GAWA 5J4SA 3H5CB 4ISIH 2O8TA 4ZH8A 4KGAA 2HPPH 2BDIA 3NRLA 1L1GA 2QXGA 6CHAC 1CBWB 1CSOE 2AFQB 4BTTB 1C1VH 4YOGA 1EASA 2AMQA 3CP7A 2QXHA 3F2FA 2CK3D 1GI2A 1EZSC 1GBKA 1FY8E 4Q80A 5C2ZA 5L6NH 2B5TB 1C5SA 2ZFTA 1OHHD 1ZSLA 4M9FA 1DSUA 2SNWA 4AX9H 1DOJA 3RXHA 3U98H 5EODA 4ZXXH 3KQCA 4FUJA 3OY6U 3EA7A 3UY9A 3QX5H 1W0JD 5EPNA 1S0QA 1ZTKA 1H8DH 4B1TA 8ESTE 3L6PA 3NXPA 1TGCA 3SI3H 1L0ZA 1GDQA 1VKYA 3PMHB 3SU3A 3SZNA 2ULLA 3IITA 2BQ7B 2G4TA 2QY0B 1S6HA 4OS4A 3DSOA 5BPEA 3U8TH 2JH0D 1GBMA 2OTVA 1VCQA 1EJMA 1EPTB 1PYTC 5CHAB 1MKWK 1H9LB 2FOCA 5EXNA 3QTVH 2FOGA 1BT7A 4FOUC 4AZ2B 1TMUH 3QZQA 1YGCH 2JH6D 2TGAA 1QBNA 1G3EA 1LTOA 3DT0H 1SKYE 2PWXA 3HK3B 3PYHA 1C2JA 2ANKH 2F9UA 4UONA 2AH4X 4KP0A 1WXRA 3URCA 3ZYDA 4ABDA 1Y3XA 3A7TA 2GCTC 4TT3D 1GHWH 1AVGH 3TVJB 4ISNA 1CE5A 4X2YA 2ZP0H 1OWKA 1GG6B 2KCYA 1V6DA 4TYDA 1NU7B 1GBAA 1O39A 1VGCC 1A2CH 2GTBA 1GGDB 2XYAA 1U6QA 3HKJB 4YZUA 4CRGA 2ILNA 1DWEH 1FPCH 3G01A 3ZZBA 4X1QU 3KNXA 3UPEA 2BB4A 4YXWD 2F4LA 2G81E 3E6PH 4B2CA 4DGJA 1UW7A 1DWDH 1P9UA 3CS0A 1VITH 2WYGA 1YCPK 1E37B 2ODPA 3AK5A 1BHXB 4BAKB 3RXFA 1GVKB 3M3VA 1GJ4H 1YPMH 3SHAH 2GMTB 1CGIE 1MKWH 4OS5A 2CJIA 3ZZ7A 3ZVAA 2ZECA 3B9FH 5JBAS 2OQ5A 3P70B 3ZVBA 2A7HA 1YLCA 1GBFA 4TWWA 4ABGA 1UTPA 1RIWB 3VXFH 2AGEX 3CNRA 2C90B 2HWLB 1YM0A 1UVOA 1K28D 1ELDE 1O3KA 1PFXC 1C5RA 3TGIE 4QT8C 5F8ZA 1VR1H 3A8CA 1LQDB 1QRXA 1V2ST 4OGXA 3TU7H 2R2WU 2V3HH 1OWEA 2V35A 1KLIH 2R9PA 4Y71A 1EUFA 3Q00A 2FP7B 3PV4A 4I8JA 2GDEH 1TX6A 3A8DA 1CT4E 4KTCA 4UFDH 5LGOA 3SV9A 1ZSJA 3I77A 1GCTB 4AGJA 4FUHA 1O2XA 1P11E 4D9QA 1K1IA 1ARCA 3T25A
chains in the Genus database with same CATH topology
1ETRH 1QJ1B 5JPMH 2O9QA 3RLWH 3LDXH 4K60A 4NA8A 1BTZA 4WVPE 1S83A 4LXBH 3GYLB 3LONA 1LVYA 2ZFSA 2B8OH 2TGDA 1BA8B 5AFYH 1MMJN 1PJPA 5JBCS 2HALA 1BDAA 1SGFG 3N7OA 3RXAA 3PLKA 1DUAA 4ZKNU 1VJAU 1HAVA 3SW2B 3GISB 2OBQA 2AIPA 2BY6X 2ZFRH 1NM6A 2TGPZ 1HAOH 1HIAA 1HJ9A 4RKJB 3RC6A 1TABE 2UUKB 3RXMA 1DT2A 4B74A 1VITF 2UWLA 3M5OA 3ZZ9A 3RXGA 1UVTH 1BTYA 2CF8H 4KTUA 1ESTA 2W7UA 4Y8YA 2RA0A 2FTLE 4OGYA 3U1JB 1S85A 4WWYA 4IGDA 2VVUA 1DPOA 1HUTH 2VWLA 3FFGA 3TPIZ 2ZDKA 1ZGIA 4INLA 7ESTE 3MMGA 2SGPE 1C9TA 1Y3UA 1CGHA 2ZU4A 1C1QA 2BXUH 2ZO3H 5PTPA 2ZDAH 1O2LA 2FOBA 4MPVA 3RMOH 4AG2A 3BTDE 1P01A 2G5VA 4VGCC 5L30H 2PFEA 2VIVA 3RXKA 5T6GA 5DP8A 4X2VA 1YPKH 4DW2U 3SUEA 5JB9S 2VVVA 4ABEA 1T7CA 2A2XH 2ZDLA 4H6TA 2STBE 2ZQ1A 2PV9B 2XCNA 1FXYA 3T28A 4FUCA 5GDSH 2FXRA 3IG6B 2Y6TA 1HGTH 2H9TH 2G52A 1SL3A 1E38B 1O5GH 1KXCA 2BXTH 1GMHG 3FAOA 5FPYA 2XTTB 3TJOA 3ZZAA 2ASUB 2WUCA 3P95A 5EG4A 2AIQA 5FX6A 1EXFA 3HKIB 2FS9A 3RP2A 3OTJE 1LQEA 2SNVA 4ABFA 2C8WB 5DP6A 1AGJA 1LHEH 1O2TA 1GHZA 1WU1A 4X1NU 1CHGA 1HJAB 2GT8A 2D2DA 3T29A 2C8ZB 4DURA 1P2IA 1Z71A 2A7CA 1OYTH 2G51A 4CHAB 1P02A 3HATH 2H6MA 4K1EA 3S9AA 1CA0C 2SGQE 3RXJA 1BRBE 4BTUB 1UVSH 2H9EH 1F0RA 7LPRA 3NKKA 2ALVA 3UQVA 1SGEE 1XVOA 2TPIZ 1L4DA 1OSSA 1SGDE 1ANBA 3DD2H 4NFEA 3F1SB 2IJOB 1ZMJA 1ARBA 5B6OA 4R0IA 3I78A 4HTCH 4O03A 2Q6GA 3ZVCA 1O3OA 4FU7A 1J9CH 5HYOA 1SVPA 1HDTH 2TBSA 1SGIB 1OKXA 2NU1E 5L2ZH 1J15A 3MYWA 2GV7A 2NU0E 1UCYE 2HVXA 1OYQA 1AVWA 2FZZA 2Z7FE 4NSVA 4Y6DA 1AB9C 4Y8XA 2ZHQH 1GMDF 3O8RA 3H7TA 1ABIH 4LOYH 3F68H 2PGQB 4K1TA 2XW9A 2H2ZA 2BD4A 2QF0A 4B76A 1QQUA 1QB6A 4NGAH 4UEHH 4X6NA 5A0AE 1GHBG 2ZWLH 1A0LA 3NCLA 3E0NB 1UCYK 1UTKA 5EQSA 3PWCA 3VFEA 3MI4A 4DVAU 1O34A 3RXVA 1ZYOA 1QQ4A 2IPHA 5TCAA 3U69H 1BBRK 1C2IA 1XUKA 1SI5H 1YC0A 1C5MD 3A86A 3JZ2B 3UOUA 1NFUA 2VJ1A 2ZU3A 1GJAB 4SGAE 2GCHF 4Y0YE 1GBJA 2FOEA 5GIBA 4JZFH 2OC8A 3ATKA 4UFFH 1EPTC 3UUZA 4B2AA 4LK4A 2WPIS 1FJSA 1P2QA 1WV7H 1TRYA 4I8LA 2NU3E 1SGTA 1K1OA 2PSXA 1ZMNA 4INKA 1EQ9A 4NZLA 3VXEH 3MH6A 2BQWB 3MO3A 3K9XB 3SO3A 2FYRA 1D3TB 1TOMH 4NIXA 1ESBA 4FUEA 4A6LA 5A2MH 1RXPA 1O37A 3BV9B 3VB4A 1UTLM 3ZVDA 1SGCA 5EQRA 1O2SA 4CBNA 2JKHA 2PHBA 2QXJA 1D3QB 1SG8B 2Z9IA 2ZKSA 1AE8H 4U32A 1ZRBA 5AVDA 1A5GH 4RSPA 1TB6H 1F7ZA 2FMJA 1AE5A 2G8TA 2ZF0H 3URDA 5LPEA 3ZYEA 1DS2E 5TCCA 1DM4B 1BBRH 5DGJA 1HLTH 3A88A 1GHYH 4ZROA 2P8OB 1O5CB 1QGFA 1UTNA 3E0PB 2Z9GA 1GJ6A 3KQDA 1O5FH 1TNIA 1TGTA 3E8LA 3SU0A 4MNYA 1MTNB 1HAYB 3CS7A 1WBGB 1XX9A 1Q31A 3I29A 5FCRA 1W3CA 1ELAA 1GHAG 3F9GA 3PMJA 2F9VA 3KL6A 4K2YA 1P9SA 2FS8A 1NC6A 2BLOA 4RN6A 1RIWC 2BDCA 1P06A 3HGPA 1EOLA 3UNQA 1H9IE 2FESH 4DY7B 3QK1A 3SN8A 3MNXA 3R3GB 2VGCB 2EC9H 2FEQH 2PLXA 2R0KA 5DKMA 2OCVB 1QB1A 1P57B 1SLUB 2CGAA 1LVBA 2HNTE 1GI3A 2SGEE 1S82A 1ZOMA 1AY6H 3L3TA 2JETB 1A3BH 3A83A 3QUMP 1GDUA 3FZDA 1XUIA 1BMLA 1XUGA 4AG1A 5AF9H 5ESTE 2O8UA 5JB8S 4FU9A 1IOEA 2G5NA 2FO9A 4X8UH 5T6FA 3F9HA 2KAIA 2BX4A 3TK9A 3BSQA 1ZZZA 5EOKA 4E05H 1MU6B 5F8XA 2WPJS 1F0UA 1SHYA 4XBDA 1O2UA 1ELVA 2R3YA 3B8JA 1P03A 1O2QA 2ANMH 2PKAA 1HAVB 2CHAB 3E90B 2OC1A 2A5IA 1AI8H 1YPLH 1CGJE 1J16A 2WPKS 3RU4T 1J14A 1HIAB 1ZJDA 1SSXA 3QTOH 3KQBA 5C67A 2B0FA 1P2OA 1NRQH 2ZQ2A 3VPKA 1EP5A 1KXFA 3BEIB 3GY3A 3MU0A 1LHGH 2FYQA 3BTWE 2Y5FA 5HGGA 2DE8A 5EW1H 4CBOA 2Z9KA 2O8MA 4MG3A 1P09A 1KTTB 1OX1A 3D62A 3TK5A 3UREA 1C1NA 1O2OA 2BDGA 5K7RA 1DICA 1ZRKA 3A7YA 1KY9A 1G3BA 1SPJA 1FDPA 3RXBA 2EI7A 1EJNA 1FMGA 1XM1A 1NO9H 5SGAE 1V2MT 1O2HA 1GJDB 2QIQA 4NG9H 2TIOA 3ZZ5A 1V3XA 2BTCE 1CHOG 3F6UH 2ZDMA 4YOIA 4K5ZA 1GBCA 4FUFA 1IQJA 4WXIA 1G2MA 4H42U 1SB1H 2WUBA 1Q3XA 2A45B 1KSNA 2EI8A 2C4FH 2LNCA 3K65B 2OBOA 2BD8A 1TNJA 2JH5D 1ACBE 1EKBB 4FXGH 4UFGH 1SC8U 1LHCH 3ITIA 1Y3WA 3S0NA 1AU8A 3KQEA 4AYYB 1AWHB 2FI4E 1OS8A 3ZZ8A 1GJ8B 1Y5UT 2HGTH 1DXPA 1G3DA 3MNCA 1O0DH 3GY8A 4AFUA 1K1JA 1V2UT 1TQ7B 1GBIA 2RDLA 1QL9A 1K9OE 3F9FA 3EA8A 4JZ1A 2CMYA 1T8LA 2VIWA 4H4FA 1WQVH 1D3DB 1MH0A 3PWBA 4ZKOU 2Z3DA 3LT3A 3S69A 2QYIA 1KXEA 3RM2H 3RXUA 1GJ9B 1GMCF 1Y3YA 1BTWA 1C1WH 1RTLA 2ZG0H 2P59A 2J9NA 2EA3A 4F49A 1GI8B 3SV2H 3TGJE 5E2PA 2XC4A 3V13A 3U9AH 1TNLA 5K0HA 3SQHE 2WV4A 5A8ZA 3NZIA 2ZGXH 3DFLA 1N6YA 3AASA 4YLUA 1LKAA 3KIDU 1GJBB 4WY3A 3L33A 4Q7ZA 1DXWA 1BHXF 1JMOH 1FONA 2QCYA 3Q76A 2ODQA 3MTYA 1NRNH 1AZZA 2F9BH 1NRRH 1MTSA 3AAVA 2LPRA 1OP0A 1IQKA 1GPZA 4JYVH 4KELA 2A2QH 1ZPBA 4Y76A 1Z6JH 3ATWA 1MQ5A 3M3SA 1D6WA 1BITA 1ID5H 2H9HA 2ALPA 3SNBA 1O2NA 1BB0B 1GI7B 3SUDA 4XBBA 1WQSA 3LGYA 1FIZA 2F9NA 1TPSA 3LGUA 2VIPA 4J2YB 1K1NA 1C2LA 1E34B 1EAUA 2G55A 2V3OH 3Q3YA 3TK6A 4X6PA 1O3NA 2FOFA 2PKSC 3GICB 4ABBA 5FCKA 1G30B 1LPGB 1YPHE 4YM9A 3SGBE 2YOLA 5ABWA 3OU0A 4ZHMU 2I6SA 1GI1A 2RG3A 2ZPQA 4JZEH 3V0XA 1HAZB 3A8AA 1XKAC 1BTHH 3T26A 1NFWA 5E0GA 1IQEA 1P2JA 2BY7X 2FODA 1OOKB 1AO5A 3LH1A 2WPHS 4Z6AH 3QWCH 2PTNA 1AFQC 2W3IA 4YESB 1Z8RA 3MWIU 4WMDA 3RUOA 4CRFA 1MBQA 4A1TA 1IQMA 1JRTA 1BCUH 4Y7AA 1FAKH 4JK5A 2FI5E 4NIYA 4AN7A 1A61H 2Z3CA 1AQ7A 4TPYA 4UD9H 3S7KB 4Q7XA 1L2EA 5DK1A 2XBVA 3GY6A 3VB5A 1EAWA 3TJVA 1CA8B 3UOPA 1XXDA 4CH2B 4AGKA 1D3PB 1DLEA 5E0JA 1XXFA 1C5WB 3RXDA 2R3UA 4NIWA 1W0ZU 2VH6A 2B7DH 4TY6A 1Y5AT 2AERH 1TWXB 2FLBH 1A4WH 4GUXA 2PUXB 1ZPCA 1ZTJA 5A0BA 3AW1A 4DIHH 1C4U2 3MH4A 1P04A 4B73A 5DPAA 4MPUA 1Y8TA 3MFJA 2BVXH 1Z8JB 2P93A 3LIWA 1O2KA 4AORA 4DCDA 5BRRE 1OWHA 2SGFE 1QIXB 1PPZA 2VWOA 3EYDA 4A7IB 2ZC9H 3VEQB 1GDNA 2IN2A 5FBEA 1ANCA 1UO6A 2J95A 5E0HA 2ZFPH 1QA0A 4OS7A 1C1SA 5CE1A 1HNEE 1SLVB 3HGNA 3SJOA 1ELFA 1S84A 2A4OA 1NESE 4LZ1H 1GBDA 2O8LA 3SU4A 4K3JA 1NFYA 1Z1JA 3TJUA 2XWBI 4MPXA 3PLBA 1TGNA 3EE0B 1YPJH 3SJIA 8GCHG 1W14U 3ESTA 4WH6A 1O3DA 2PGBB 1UVUH 1HXEH 3FP6E 2FI3E 4ZHAA 3EAJA 1N8OC 1EZQA 3GCHB 3RMMH 4X2WA 2AEIH 2GGVB 1TMBH 1FV9A 1NN6A 4A1XA 9LPRA 1A3EH 1S81A 3BIUH 4WMEA 1GJ5H 1GI9B 2ZA5A 2JETC 4I33A 1THRH 2A32A 1H8IH 2BD7A 1SHHB 3FP8E 3VGCB 2KAIB 2GZ8A 2ZPRA 2VIQA 1SGQE 4Y8ZA 2BOKA 1YYY1 1FAXA 1Y5BT 2Q6FA 2PKAB 1P05A 3LOXA 1HRTH 2HOBA 3RXTA 3SGQE 3SUGA 3LGIA 3P8NA 2PW8H 5DP4A 5C20A 1IQNA 4AFZA 1KDQA 1LVOA 4MVNA 1ZMLA 2Y81A 3P8GA 1FLEE 1QTFA 1P3CA 5EPYA 3BIVH 1AIXH 4H6SB 1FUJA 4ZKRU 2G00A 2Z6BD 3SU6A 1TRNA 3LKWA 1UMAH 4SGBE 1QURH 1DWCH 3BTFE 1KYNA 1IQIA 1C5LH 1C4Y2 2A31A 5JBBS 2W5EA 2FM2A 1RGQA 2ZCHP 1AWFH 1TONA 1T4VH 5GWZA 4ZHLU 2NWNA 2BYAX 3BG4C 5E8EH 2BX3A 1FZZA 1PPEE 1TOCB 5EXLA 1O3AA 2BM2A 1TMTH 1O2GH 2TGTA 2A1DB 4WJG2 2ANYA 4FUBA 2W7SA 2WV5A 4JZIA 2WYJA 3K2UA 4ASHA 1SGNE 3PTNA 1C1PA 4Q2KA 5C5NA 2WPLS 4NZQA 5EW2H 1CVWH 4Y11E 1TBRH 3UNSA 1W12U 3LJJA 3RXCA 2ZTZA 3GCTG 1IQGA 3ZZ3A 1CBWC 3M5LA 3T62A 3NUMA 4U01A 1UTQA 3A85A 3TH3H 1TNKA 1QRZA 1BBRE 3ODFA 2PTCE 1IAUA 3SBKA 8GCHF 4CR9A 4I8GA 1ZTLA 2TRMA 3TH2H 1O5EH 2BHGA 1TE0A 3W95A 3MNSA 1FY5A 4XDEA 5F8TA 4HGCA 2WPMS 3U1IB 5EU8A 1SQAA 1VCPA 4OS2A 4XSKU 1F0SA 1UK3A 1MAYA 4DT7B 1QRWA 4I8KA 2AGIX 1V2NT 3EDXB 4WH8A 1GWAA 1GBBA 1MCTA 2ZIQH 4ISLA 5EXMA 1GMHF 5LPRA 4ZUHA 2I6QA 4U30A 2ZU5A 5CHAC 3PMAB 3U8RH 2BZ6H 4O97A 4D7FA 1NY22 2BY5X 2GX4A 3OSYA 1EAXA 4M7GA 4Y7BA 1SLXB 4Y79A 1Y59T 4FVDA 1O2VA 1GL0E 2H5DA 4ISOA 3A8BA 1C5NH 1C1OA 2J34A 4ABHA 3P8FA 4UFEH 1PPHE 2XWAA 1O3CA 5F03A 1RD3B 2OP9A 3ZZCA 1ZJKA 2V0BA 1GI0A 5FPTA 3EQ0H 1GG6C 1T4UH 3CENA 1N6XA 1GGDC 2Y5GA 6ESTA 2BVSH 1DE7H 1HBTH 1EP6A 4MTBA 4OS1A 5CMXH 1T8OA 1X7AC 2A4QA 1C2GA 2ZZUH 5FPSA 5J4QA 2ZGBH 1EZUC 1H1BA 4JYTA 1FN6A 1JBUH 2Z9JA 4X2XA 1ZPZA 3HPTB 4BAOB 2GMTC 2F83A 3GCTF 3A82A 2P94A 1JIRA 3QO6A 3SUFA 1QJ6B 2R2MB 4I7YH 2BDHA 3T2NA 3W94A 1HAHH 4FUIA 4BAHB 4GHTA 1P0SH 4GSOA 3ZZ6A 1UJ1A 1B7XB 1HYLA 3OYPA 2Y7ZA 1TBZH 5T3HA 1O38A 1BZXE 2HLCA 4CRAA 1GHBF 2Y5HA 1PPBH 1ETSH 1PPCE 5C1XA 4JYUH 4XOJA 1O3HA 1O3LA 1K1MA 1V2TT 1SOZA 1QBVH 3NPSA 2ZCKP 3P92A 3RC4A 1M9UA 1KXAA 4I8HA 1YPGH 3MO9A 4DG4A 2ZGCA 3RMNH 1GCTC 4TY7A 3RU4E 2GZ9A 5FBIA 1ZLRA 1EZXC 1BIOA 3TIUA 4O3UA 1QHRB 1AKSA 1HJ8A 4VGCB 2HNTC 1NRSH 3BN9A 1GVLA 1BMAA 3P8OA 4JMYA 2VIDA 3RXRA 1C2FA 4B71A 2Z3EA 4E7NA 3M36A 1FY4A