3RXEA

Crystal structure of trypsin complexed with benzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxeA02
1EZUC 2O8WA 4ABFA 1IQHA 2TGAA 3M7TA 1Y5BT 2GVFA 4IW4E 4I8GA 1MAXA 3L3TA 4HTCH 5A0BA 4B74A 2FI3E 2YNAA 4MNXA 1C1VH 4CH8B 2ANKH 4WH6A 3ZV8A 1BA8B 1ZHMA 1WV7H 1SQAA 1H9IE 1FV9A 2QGRA 6CHAB 4GUXA 4AFSA 2SFAA 4X6NA 2HVXA 3RXTA 4WH8A 3UOPA 1LMWB 4INHA 2PV9B 3A82A 3LH3A 1EPTC 1JIMA 1FI8A 1AKSB 3HK6B 4BOHA 4RSPA 2A32A 1OWDA 5FX6A 1FIWA 3I78A 3PO1B 5JB9S 3A89A 3ENSB 3F9EA 1MZAA 1C1WH 4ZKSU 1DS2E 3MH7A 1AE8H 1WAYB 3ATMA 2FZZA 1C9PA 1KXDA 1D3TB 3BG8A 2ODYB 5DK1A 2VWMA 3ATLA 5DP3A 2QCYA 1H8IH 2XW9A 2QXJA 3SJ9A 3FANA 4A1VA 5EXNA 5L2YH 1TNIA 1YKTA 1PQAA 1GVKB 1AVGH 1BT7A 4Y8XA 1O3OA 1Y3VA 1F2SE 2BDGA 2ALVA 2HNTE 2QN5T 1TNGA 2XBYA 1FN8A 1ELTA 4LZ4B 5H4IB 1OWEA 3SOSA 2EA3A 4FVBA 2HPQH 2BVRH 3TVJB 1DPOA 1HPGA 1O3AA 2ZIQH 1ACBE 1QR3E 2THFB 4CHAB 3LIWA 2BD9A 1CT4E 1IQKA 1D6WA 1V2VT 2ZCLP 3MNXA 1MTWA 1UK4A 1H9HE 4TY7A 2ZGHA 1EKBB 5EG4A 4MNVA 1ZTJA 4X1NU 3DFJA 1Z71A 1CSOE 1OSSA 1SB1H 2C3SA 4YOGA 1IQMA 1SGNE 2D1JA 1SGTA 1BTUA 1O30A 2WPLS 3HATH 4Y7AA 1ID5H 2G81E 4MLFB 2OQUA 1O35A 4CRGA 1QB6A 1V2PT 3LPRA 3NK8A 5GIBA 3O8CA 1HAVA 1OS8A 1ZSKA 1O3EA 4F49A 2QC2A 6ESTA 1INCA 1MU8B 2C90B 1TBRH 1CA0C 3FP6E 5EW2H 1P57B 1TA2A 4H42U 1TNLA 2BY5X 3BN9A 3F1SB 1J8AA 2ZO3H 1SPJA 4VGCC 5FCRA 4UDWH 4DT7B 1BRAA 3RMNH 4B2BA 2Z6BD 2GCTB 1TOMH 3KIDU 2ZDLA 1T7CA 4ZHAA 5DJ7A 3RUOA 5I25A 1EJAA 1CGIE 1FAXA 4AGJA 1SGQE 3M36A 1SLXB 5CMXH 1BJVA 1TONA 3FZZA 3P70B 4ZAEA 2ZHFH 4X1PU 4K1SA 1A46H 1YPJH 1QCPA 1T31A 3A84A 2R2WU 3RU4E 1P2OA 1DDJA 5JYIA 1QRWA 1FIZA 4UFEH 1TFXA 2TGPZ 4K1TA 1CHOG 3RXRA 3SI3H 4AG1A 1ZHPA 3SGAE 1O2QA 4GLYA 2UWOA 4TPYA 3MOCA 2H9TH 2C8WB 1ZPBA 1S83A 4FUIA 1YF4A 3H7TA 4DOQA 2BD8A 4X6PA 2P3FH 1JXPA 3KCGH 3SBKA 2W7SA 4KTUA 1TA6A 3RXKA 3UUZA 1HGTH 1TGBA 6CHAC 1ZMLA 3S9AA 3ATIA 1EX3A 3SZNA 1WQVH 3PLPA 1OWKA 1C5SA 1DM4B 1C1TA 3GCTF 2SGAA 2TBSA 2GV6A 3EDXB 4CREA 4DG4A 3ZZ9A 1RTFB 2WYJA 1O31A 3MO3A 3MU1A 1MBQA 3PO1C 4PROA 1DWDH 2HLCA 1UCYK 4DIHH 2FTMA 1MTSA 1BIOA 4JK5A 4BAKB 2FTLE 5LPFA 4A92A 3LJOA 2ZTXA 2JETB 4RN6A 1ANEA 1HAVB 1GL0E 1VITF 9LPRA 1AVXA 1UTKA 3RC6A 1KXAA 5HM9A 1SGPE 4CR9A 1YCPM 1EUFA 2BM2A 7ESTE 5I46H 3M5MA 1WOFA 4MVNA 3U8OH 4FUEA 2RA3A 1Z8GA 3PMAB 3HKIB 4CBNA 1GJDB 5DG6A 3Q3XA 3D65E 1YP9A 1D9IA 1O3DA 3GICB 1UMAH 1AU8A 1KIGH 4TY6A 3SUGA 2ESTE 4I7YH 2P59A 3MNBA 1O0DH 1TBQH 3SNEA 4LXBH 5EPYA 3OY5U 1AUJA 1C2EA 1MAYA 3TK6A 1CGHA 1V2RT 2PW8H 2ZG0H 3A8DA 5GDSH 3U1IB 1QRXA 1SFQB 1HCGA 1O2JA 3B8JA 3IWMA 3LC5A 3ZV9A 1UJ1A 3ZZCA 5F03A 1UK3A 2ZFPH 2ZQ1A 4AB9A 1O2XA 2QXIA 3U1JB 3TLOA 1XUKA 1H4WA 2FOFA 2ODPA 1AHTH 2FODA 3E8LA 4AYYB 3RC5A 4Y8ZA 3F6UH 1B5GH 2A4QA 3TH3H 1Y3WA 2ILNA 1KY9A 2Y5GA 4XBBA 4U2WA 1Y3UA 1F0TA 4JZDH 4WF8A 2SNVA 1DSTA 1O3GA 3HK3B 3S0NA 5AF9H 3V13A 1BMNH 2H9HA 3SV6A 1V2QT 2GCTC 3QK1A 1IQFA 1PPGE 1SQTA 3QZRA 1KLJH 4TPIZ 3TH2H 1YPGH 2VVVA 4XE4A 2W5EA 5A2MH 4OS7A 1G2LA 1GHAF 3OTJE 1IQGA 1L1NA 3C1KA 2ZU3A 1GBKA 1C1NA 2B5TB 1O2VA 5F6MA 4R8TB 3B9FH 4FUDA 3RM0H 1CO7E 3KHVA 4WXVA 8GCHF 1BRCE 4I8HA 4D7GA 4GPGA 1H9LB 1VITH 2FOEA 3EQ0H 3BSQA 1RIWC 3RXOA 3PWBA 2JH5D 1TNKA 2G51A 4WJG2 3AW0A 2FOAA 1E35B 3VB3A 1ELAA 2HPPH 2A45B 1O5FH 1QL7A 2AIPA 3BEIB 5LPEA 2BHGA 2AGEX 5FAHA 1NRQH 1UTMA 3L33A 2FYRA 3A7YA 1A0HB 1DWEH 2J38A 1SI5H 3KQCA 2ZTYA 1FXYA 2BD3A 1TABE 1ZPCA 1GL1A 1P09A 4O3TA 2ANYA 1O3IA 4B73A 1LPGB 1D6RA 5G4BA 1Y3XA 3MNSA 4AZ2B 2AMQA 3SJ8A 1QJ7B 4U32A 1ETSH 3KL6A 1ORFA 3P8GA 1TPOA 1XM1A 4BXWA 2DUCA 2C93B 3O8BA 3SNBA 1GCDA 2C8XB 2F9BH 4MQAA 2HOBA 1GJ5H 2RCEA 5ETXA 3A83A 1PQ5A 2BQ6B 1O2RA 1K1PA 1MKWH 3SNDA 3T28A 1NTPA 1DY8A 1GJ8B 4NZQA 4WMDA 2G4TA 1P2NA 1HAIH 2VH6A 5DGJA 2JETC 5DP9A 1YLDA 4O9VA 1A5GH 2STAE 2BY7X 3EE0B 3OX7U 1XVOA 3SN8A 3BIUH 5BRRE 1XMNB 3TNSA 1IQLA 2A7HA 4BTUB 1CVWH 1TIOA 1SGIB 3ZZ5A 3SHCH 1TB6H 2F91A 4BTIB 1ZLRA 1VJAU 4K3JA 1ZR0A 3LGYA 4HFPB 1P11E 4CR5A 3U69H 4NA9H 3P92A 4WWYA 1MTVA 2VB0A 1M9UA 1PPBH 2OC7A 1TRYA 3RMMH 1FY4A 1K1LA 1NZQH 1QBOA 2BLQA 3OYPA 1QB1A 5JDUB 2AMDA 3TJNA 1XVMA 4CRFA 3SQEE 3CS7A 3F9HA 1GCTB 1JOUB 1ZGVA 2Q6FA 3SUDA 3O8RA 1O36A 1AO5A 1HAZB 3JZ2B 1T8LA 3M5LA 1S0QA 1SHYA 2WPIS 4Y8YA 1AWHB 4AFQA 3BTME 1SGFG 3MMGA 1NY22 2QA9E 4D8NA 1C1MA 3TK9A 1V2UT 3BTEE 3PTBA 2F9UA 3ZZ4A 3BEUA 5J4SA 1NPMA 3TU7H 1OYTH 3PM3A 5FXLA 1HAHH 1DANH 3UOUA 1DSUA 2I6QA 1THPB 1O37A 4Y79A 4NWLA 1HAYB 4K2YA 2ZKSA 2FOMB 1MTNB 1EJMA 4FUHA 4YLQH 2ZDVH 2F9NA 1FY5A 1C5LH 2GD4B 2SGEE 3SNCA 2UUJB 2IN2A 2KAIA 1BTPA 2ZP0H 5T6FA 3DT0H 1A0LA 2ZU5A 2Y81A 3PTNA 3LJJA 4QT8C 1PQ7A 1HAXB 1ABJH 3URCA 1D3QB 3P17H 1BBRE 2IPHA 1C2GA 3A8AA 1L1JA 2ZCKP 3PYHA 1GBMA 2BY6X 3V0XA 3UQVA 2VWNA 1IQIA 2NWNA 4X2VA 3SV7A 4ESTE 3PB1E 2WV4A 4K1EA 1LVYA 4X2WA 1FY1A 5FBIA 5K0HA 1BUIA 3RDZA 3DHKH 2F9VA 4BANB 1GBIA 2GT8A 2BDBA 2ZEBA 1C1SA 1Y8TA 1WTGH 4ZKOU 2PUQH 4NG9H 4JYTA 1CHOF 1MKXH 4A1XA 5F8XA 5T6GA 4I33A 4NIYA 5K7RA 4D76A 2AGIX 4HGCA 2BY9X 2VGCB 1P02A 1SC8U 2GDDA 2TRMA 3ODDA 2H1UA 1ABIH 4LZ1H 1SLVB 4IBLH 1AIXH 1LVBA 1S5SA 1AVWA 2RDLA 5JBCS 4JCNA 4B1TA 1C5RA 4ISOA 3K6ZA 4Z6AH 1T8OA 4Q7ZA 1NRPH 3SGQE 2ODQA 4OS1A 3ZVBA 1W7XH 1TGNA 1C2FA 2O9QA 4M7GA 1WBGB 5IYTA 4DJZB 1L0ZA 4YM9A 5C5NA 2PR3A 2BLWA 3GY7A 7GCHF 1TX7A 1YGCH 1TPPA 3TGKE 2J4IA 1GMHF 3EA9A 1NU9A 4KELA 1GMCG 5GCHF 5DP7A 1P9UA 3NUMA 5C1UA 1J14A 2KAIB 3MU5A 1AY6H 2F9PA 3RXQA 2A2XH 3AVZA 1OKXA 3U9AH 4SGBE 4J2YB 5C3NA 4NIVA 5FPTA 5ESTE 3Q3YA 1S6HA 2QXGA 1ARBA 1BITA 2OBOA 2WINI 3LH1A 1NRNH 4K8BA 3HGNA 1TMUH 3BG4C 3U8RH 4MDSA 3LGVA 3NXPA 3QGJA 1GBTA 1W3CA 5EW1H 1G3CA 4MTBA 2D26C 1GJ6A 2BD4A 2A7JA 1BZXE 2BTCE 3MWIU 1Z8JB 2ZQ2A 3QTVH 1O3BA 2ASUB 1HJ9A 4BAHB 1C5WB 4I31A 4NSYA 3VB6A 1GBDA 1JRSA 1C4Y2 2W3KA 1KDQA 1C4V2 1F5RA 1XKAC 3VPKA 1SGDE 3PV4A 1AFQC 5GPIB 4YTAA 1V3XA 1E0FD 2BLVA 3ZVEA 2AMPA 3ZVCA 3QGNB 4K5ZA 2GCHG 5HM2A 2XCFA 2Q6GA 1VGCC 3GCHB 2AEIH 1C1UH 3CS0A 3KN2A 5CE1A 1LQEA 1J17T 2ZGXH 4F4OC 1PJPA 4O97A 1ZMJA 3VGCC 1HUTH 2C8ZB 1W14U 3UNSA 3BTHE 1BMAA 4X0WU 2R3YA 2WV5A 3A88A 2BOHB 1BB0B 1FY3A 4OGXA 1ANBA 1FAKH 1K22H 2ANMH 3M61U 4FUJA 4D9RA 2CV3A 3P8NA 2V3HH 1DVAH 3MO6A 1LHCH 4E06H 1KLIH 4Q2KA 5DP4A 1HB0B 1O3PB 1HXFH 3Q3KA 2WUCA 2OP9A 1O2TA 3G01A 4AORA 2ZFRH 5ESBA 2G00A 1O39A 2QAAA 3QTOH 2P16A 4FUGA 1C2KA 3A81A 1S85A 4NIXA 5ABWA 5FPSA 1F5LA 1G37A 1O2YA 1BTWA 3ELAH 1A4WH 3FVFB 2VIWA 1C5XB 3DA9B 1C2IA 3ZVFA 1F0UA 5HGGA 1PYTC 4YOJA 4ZUHA 3M5OA 2PKAA 1K21H 5E0HA 1QL8A 1AFEH 1C2HA 1GJ9B 1Z6JH 2XBXA 3M37A 3TGIE 1V2JT 1LHEH 3GY6A 1LPKB 2Z9KA 4ZKNU 2TIOA 3LGIA 2BLOA 4UFFH 2ZGJA 1KDQB 1A3EH 2GZ7A 3AW1A 3UR9A 3SU6A 1V6DA 2Z3DA 1HV7A 1C5YB 2A4OA 4K8YA 4ASHA 1S84A 2FESH 3ZVAA 3RMLH 4WMFA 1ELGA 1GJ4H 1O5EH 2G8TA 5B6OA 1NRRH 3GY8A 5FBEA 1GHVH 3SU3A 1E36B 1ETTH 3GISB 1ZRKA 2EI7A 5PTPA 3RXAA 1LO6A 3UTUH 2FOBA 4LK4A 1UVUH 1X7AC 1P2JA 3SNAA 3MH6A 1O3KA 3MHWU 5C20A 1P3CA 2GP9B 4XOJA 3E16B 1TRNA 4O03A 2ZI2H 5JB8S 1KLTA 1AD8H 5C1YA 1GI7B 4YLUA 2BY8X 3ZYEA 1EASA 3RXEA 2BZ6H 2BMGB 2STBE 1SMFE 1BRBE 1SQOA 1ELEE 1V2KT 1BTZA 3M3SA 4B71A 1YPMH 3E3TA 1FUJA 3RLWH 5DKMA 4GAWA 1W0YH 1RRKA 2OCVB 2VU8E 2JH0D 1QGFA 1O34A 2FLBH 3M7QA 4AG2A 3O8DA 2WUBA 1GDQA 1P2IA 2J92A 3MTYA 3ZZDA 1SLUB 1P01A 3UY9A 2ZFTA 1XX9A 3GCNA 3E1XB 1SLWB 1AE5A 1C2JA 4X8TH 5BPEA 4ZKRU 3RU4D 1MMJN 1G3BA 1C1OA 1GHBG 3SJKA 2QF3A 3TJUA 2FEQH 3F9GA 1RD3B 3P8FA 5HMAA 1MKWK 2PKAB 4NA7A 3U98H 1H8DH 1PPHE 1Q2WA 3QUMP 6GCHG 1O3HA 1NN6A 4Y10E 1LCYA 1AQ7A 4CHAC 1QRZA 1RGQA 4Y0YE 5EQRA 3EYDA 1SGEE 4K60A 3TNTA 2YOLA 3JZ1B 3TJOA 4K69A 1HAOH 5FHTA 1O3JA 4UD9H 2VIOA 1LHFH 3RXIA 2XWAA 3RXVA 3GYMA 1KXBA 3E6PH 4NA8A 1TQ0B 1HDTH 1A5HA 1ELCA 4WVPE 1KXCA 1ELVA 4TYDA 1HRTH 5DP5A 2CN0H 1TAWA 2R0KA 2Z94A 2ZHQH 5FX5A 1C5TA 1C1PA 5A09A 7LPRA 2CF8H 2LNCA 1O2ZA 4H6TA 1BTXA 1T4UH 1UO6A 1WU1A 4GCHF 1G32B 2BOKA 1NM6A 2Y82A 3T62A 4ABBA 1ESAA 1W2KH 1C5QA 3OU0A 5EPNA 2ZU4A 2H6MA 4ZXYH 1NFWA 2I6SA 4Q80A 1RFNA 4JYUH 1GBBA 1WYKA 1EP5A 8KME2 2XCNA 4ISHH 3BEFB 1P03A 5GXPA 4WMEA 1C4U2 1QQ4A 4A5TS 1F5KU 1SSXA 1UTQA 5C67A 4NGAH 2ZZUH 2PFEA 1O5BB 3LKWA 4OS6A 4E7RG 1LVMA 1SGCA 1QY6A 1CA8B 2Z9JA 1TGSZ 2Y7XA 2G5VA 1OP0A 1O2GH 2VVUA 4RKJB 4DURA 3T2NA 2J94A 3BIVH 4DIIH 1QQUA 4THNH 1N8OB 1C5ZB 3UREA 3RXLA 1ELFA 3V3MA 1EXFA 8LPRA 1GMDF 3UIRA 1KTSB 4CRCA 4CRBA 1LPZB 1J9CH 3UR6A 1C1RA 1MUEB 3TITA 3E90B 1MD8A 1O2PA 1HJAB 1P0SH 1THSH 3IITA 3T27A 1NRSH 3RXMA 4O3UA 1JIRA 3MH5A 1V2LT 2ZHWH 4ISLA 4XBCA 2FIRH 1DUAA 3F9FA 2PTCE 3LGUA 1ZPZA 1F7ZA 1LKAA 1MH0A 2F83A 4XBDA 2SGQE 1MQ5A 3K6YA 1QHRB 1C5MD 4JK6A 1YBWA 2ZU1A 4Y76A 2QY0B 4Y11E 2WYGA 2UWLA 2BQ7B 1MKXK 1KTTB 1LKBA 1XUFA 2W26A 2WPKS 2ZHEH 3SI4H 4I32A 4B2AA 2CMYA 3K9XB 3U8TH 1CHGA 1EB2A 3BTWE 3MH4A 2GX4A 2Q1JA 3NKKA 1SGRE 1NESE 2P95A 3GY2A 4ZMAH 4Q7YA 1GI8B 3V7TA 2BDYA 1ZJDA 3T25A 1XUIA 2VINA 2CXVA 3URDA 2XNIA 3RXFA 2GMTB 1V2ST 4OGYA 4AN7A 3QWCH 3RMOH 1C5UA 1TNHA 1ZJKA 2GCHF 4E05H 1GPZA 1AB9B 5GJ4B 5EQSA 3M7UA 1YPHC 2G52A 4B76A 1LHGH 5A8ZA 4FUFA 2VNTA 4SGAE 3W95A 1AZZA 3DFLA 3CP7A 4NFFA 3MO9A 3CENA 4IC5A 1VCWA 5E0JA 1RTKA 2BD5A 2OQ5A 1MTUA 1NROH 1UHBA 1E38B 1YLCA 2BZAA 2H5CA 1ELDE 2YNBA 1GBFA 2A5IA 2OBQA 4DVAU 1EAXA 1GWAA 3RXUA 1XUJA 3I29A 2FM2A 1WTHD 1UVSH 1T32A 1TNJA 2GDEH 1N6XA 1GI3A 2XYAA 4UE7H 1P2KA 5L30H 3FZDA 1XXFA 1P05A 3GCTG 2P8OB 4FUBA 1W13U 1FPHH 3OY6U 1G30B 5EGMA 4BTTB 3FP7E 1ZOMA 1L4DA 1RTLA 3HKJB 2OUAA 1O2UA 1W10U 2QYIA 3SJOA 2G4UA 1P9SA 3GDVA 2J2UA 2BDCA 2HALA 4FU9A 4BAQB 4Y0ZE 1O5DH 1TRMA 2VJ1A 4JZ1A 1VITG 5DP8A 1JMOH 1O2OA 4A1TA 2V3OH 2QIQA 3EA8A 1P3EA 3SV8A 1JWTA 2V35A 3SJIA 1EPTB 3VXEH 1Q31A 4X2YA 2C8YB 5LPRA 3R3GB 4YT7H 3QLPH 3F68H 2BXUH 1EZSC 1BBRK 4XDEA 3UWJH 5F8ZA 1K1JA 5DPAA 3HPTB 2A2QH 4Q7XA 1L4ZA 1NFYA 2UWPA 2ZDAH 2NU4E 4AB8A 3ZZ8A 3ZVGA 3A85A 4MPWA 3K65B 4NCYA 1QFKH 2P3TB 1ESTA 2BX4A 4AYVB 1TE0A 4U30A 1MQ6A 2Y7ZA 4B75A 1S6FA 1ZTLA 1HJAC 1C2DA 1DWCH 4D9QA 2CF9H 2ZPRA 2GT7A 3MYWA 5TCAA 3R0FA 4CRAA 2JH6D 1Y59T 3BV9B 4X8UH 3PLKA 4KKDA 3LU9B 1YCPH 1OWIA 2TGDA 1BTYA 1UHBB 2R3UA 1NC6A 1P04A 1VZQH 3RXBA 1AN1E 1SR5C 4BXSA 4A7IB 1DOJA 2BYAX 5EOKA 2FP7B 4GSOA 1RJXB 2ZHDA 4IS5A 2R0LA 9ESTA 1GI2A 4Z0KA 1DFPA 1XUGA 1QB9A 5T3HA 2PWXA 3A7XA 1IQEA 4INLA 1CA0B 1TPAE 2VVCA 1SOTA 1QL9A 2J34A 2FXRA 1GHWH 2CJIA 2PLXA 1C5NH 2GMTC 8GCHG 1YM0A 1CT0E 2Y5FA 2A4GA 3GY3A 1A0JA 5EU8A 3PLBA 2BDHA 5J4QA 1GI6A 1UTNA 4INKA 3A7ZA 2A4RA 1BDAA 3UPEA 8ESTE 4ZHLU 3TJVA 2ZCHP 3MI4A 1GCTC 1K2I1 3A87A 1B0EA 1O3MA 1TLDA 1GJBB 1TMBH 1HIAB 2ZECA 1P2MA 2IJOB 1LVOA 3D62A 1UK2A 4X8SH 5HYOA 3KF2A 2IOTA 1WUNH 3ATWA 3WY8A 2QXHA 1DLKB 1IAUA 2OC8A 1H1BA 2Z3EA 3BTTE 4R0IA 3LONA 1OXGA 2FWWA 2PGBB 3MU8A 1GBCA 2FDAA 4JYVH 4ZH8A 1DITH 1RS0A 4IN1A 1F92A 2P8OC 3QX5H 4JZFH 5JBBS 1FQ3A 5JBAS 4ABIA 1O2SA 1TWXB 1NFUA 5JBTA 1W12U 5A0CA 1BBRH 2JKHA 1GGDB 3ZZ7A 1MTNC 3M35A 4X1QU 1HYLA 3ODFA 4MPXA 3VB4A 1S82A 3SHAH 3AASA 1F0SA 3VFEA 1OPHB 4Y71A 1TX8A 2F3CE 3SU1A 1DXPA 2ZF0H 3SUFA 2Z9LA 1CU1A 2EI8A 2BB4A 5AHGH 1KSNA 1YPEH 1GHZA 1K1MA 3PMBB 4Y7BA 3I77A 2EI6A 4NIWA 5EXMA 1EOLA 2ZPQA 4D7FA 1EZXC 1DLEA 4HZHA 4ISIH 1G2MA 2Z7FE 4X2XA 2TPIZ 1AI8H 1G9IE 2J9NA 3E91A 2XBVA 1EAWA 1IHTH 3RXJA 5A8XA 1ANCA 3NWUA 2VIQA 1LTOA 3D23A 5C5OA 3M3TA 3GY5A 1WCZA 3A86A 3AAUA 2H2ZA 1QA0A 1KXFA 1OP8A 1FMGA 1GHYH 2V0BA 2FX6A 3FP8E 2C4FH 1EZQA 3PMJA 2AFQB 3MFJA 2HNTF 4Y6DA 2ZTZA 3KQBA 1QNJA 5AFZH 5E8EH 1GVZA 1ZSLA 2VGCC 4U01A 3GOVB 4I8LA 4J1YA 1UVOA 1A5IA 3ZYDA 1W0ZU 1C5VA 1W7GH 1D3DB 2PKSB 3FAOA 2Z9IA 1ZYOA 1IHSH 2ZU2A 3VB7A 4YESB 3RM2H 4ABJA 5C2ZA 4WXIA 1TBZH 3LGWA 1DT2A 1GBJA 1HBTH 1SGFA 2A31A 1TALA 2SGFE 2ZC9H 3ESTA 1GI0A 4BNRA 3LDXH 4CRDA 2F9OA 4NZLA 1XUHA 2R9PA 2BXTH 3MU4A 3E0NB 4DGJA 1PPFE 1Z7KA 4B2CA 4KGAA 1P06A 2A5KA 3ITIA 3OSYA 2WPMS 1O5GH 7KMEH 1P8VC 3H5CB 3TH4H 2PSXA 1BTHH 1FY8E 3KGPA 1GDUA 1T8MA 3Q77A 1O3CA 1EATA 2P3UB 1O2WA 3H7OA 1A61H 2J95A 2P94A 5JPMH 2B7DH 3RXSA 3HGPA 1ZHRA 1YPKH 3GY4A 1UTJA 1N6YA 1GG6B 4ZROA 1NU7B 3P95A 3QDZB 3LT3A 1RIWB 1GI5A 4KTSA 1O2LA 2G55A 3ZZAA 1CQQA 2ZWLH 1OWHA 4H4FA 4MG3A 5EXLA 3BTKE 4MPVA 2XC4A 1FLEE 2ULLA 2A0QB 1OYQA 4YZUA 1V2OT 3KQEA 3TGJE 3NPSA 3SQHE 1T8NA 1A2CH 1UVTH 3B23B 1GGDC 2OC1A 1YPHE 1UTOA 2O8UA 2O8LA 1A7SA 1SL3A 1CGJE 3A80A 1UTLM 1WSSH 3UWIA 2FOCA 1O2MA 4AGKA 2P93A 2W3IA 1SBWA 1BMMH 2BQWB 1D3PB 1FN6A 1ZTKA 2ZFFH 1FPCH 1F0RA 3EGKH 1UCYE 3GCHC 4XFQA 4BAMB 1AZ8A 3P6ZB 3NZIA 7GCHG 2HWLB 1NO9H 1SGYE 2Y6TA 1GMHG 2ALPA 4IMZA 3M3VA 1GJCB 1AMHA 2H9EH 1V2TT 5GCHG 1XKBC 1MCVA 3ZZ6A 2XBWA 3UQOA 2AYWA 2ANWA 2QF0A 3S9BA 1C5OH 3RXPA 3SUEA 1O3FA 2ZPSA 3MNCA 2B8OH 4OS5A 1O3NA 4UONA 1O2HA 1W11U 4TWWA 3STJA 2NU2E 2FOHA 2HGTH 2RG3A 1IQNA 1MCTA 4ABEA 4I8KA 2ZGBH 2NU3E 1BHXF 4OS2A 3C27B 3BTGE 1KYNA 1J15A 4UFDH 3PROA 1K1OA 2XTTB 3RXDA 2CGAA 1EP6A 1GI4A 1Z1IA 1NS3A 1SHHB 1GBAA 1A1RA 3RC4A 2PKSC 2BDAA 3SU0A 2FS8A 1B7XB 2FYQA 2CHAB 1QA7A 2FOGA 4IMQA 2SNWA 4RKOB 5CHAB 1QURH 4FVDA 1IQJA 2HNTC 1HNEE 2GKVE 3SV9A 1BHXB 1ZGIA 4OS4A 1FZZA 1O32A 1SG8B 1THRH 1LDTT 5TCCA 3W94A 1WQSA 4UFGH 2DE8A 2O8MA 1MZDA 1HAPH 2ZDNA 3Q00A 4X8VH 3TIUA 1OP2A 1EB1H 1P2QA 2FI4E 1EOJA 2FMJA 2XC5A 2Z3CA 1CBWB 3D49H 1TOCB 1BMLA 1PQ8A 1NFXA 5L6NH 1KXEA 2GZ8A 5E2PA 2R2MB 1B0FA 3A7WA 3L6PA 1K9OE 1Z1JA 3K2UA 2Q6DA 2Y80A 2GGVB 1DICA 3GCOA 1ESBA 1Y3YA 5FPYA 1GMCF 2PUXB 4HI3A 2OLGA 1GG6C 2AS9A 2SGDE 1DX5M 3V12A 1V2MT 5DP6A 1GJ7B 3PWCA 2XXLA 4X1RU 1T4VH 1TQ7B 4YOIA 2O8TA 5C1XA 1FDPA 2AH4X 5SGAE 2H5DA 1S81A 1J16A 1MBMA 3VB5A 2ZDKA 5AFYH 1DXWA 3P8OA 1UCYH 2UUYA 1N1LA 1VJ9U 2ZFQH 1K1NA 2ZGCA 4FXGH 1Y5AT 1ZSJA 4UEHH 2BVXH 1EPTA 1GI1A 2OINA 1OX1A 3FFGA 1FJSA 4ABHA 1TX6A 4ABGA 1P12E 5E2OA 4ZXXH 3GYLB 5GWZA 1HJ8A 2HRVA 1OOKB 3GDUA 1BJUA 4MNYA 3SO3A 3VXFH 2PSYA 1DUEA 2FX4A 1ELBA 1QJ6B 5A8YA 2EC9H 4DW2U 3ZVDA 5AVDA 1GVLA 2EEKA 4MNWA 3KNXA 2GV7A 3DD2H 3TK5A 3EA7A 3UFAA 1YCPK 3S69A 4GHTA 1FONA 3LC3A 2D8WA 5EODA 2LPRA 1U6QA 1TPSA 2FO9A 2VH0A 3M5NA 2AIQA 3BTDE 1BRUP 2BDIA 1P10A 3RU4T 5L2ZH 3KEEA 3N7OA 1RXPA 3ZZBA 3IG6B 1V2NT 4YT6H 5A0AE 1Y5UT 3BF6H 1QBVH 1O2IA 1OWJA 1AWFH 1C2MA 1LQDB 1YPLH 2OD3B 3A8BA 4NWKA 3RXGA 4TWYA 1ANDA 2FS9A 3QO6A 1TGTA 3SW2B 2XC0A 2Z9GA 1G36A 1K1IA 3SGBE 3SU5A 1C9TA 1FNIA 1GDNA 2ZFSA 2XWBI 5F8TA 3AAVA 2TGTA 3RXHA 4X6OA 1ZMNA 2B9LA 1VCPA 3A7VA 1Q3XA 1SVPA 3GDSA 1AGJA 2G5NA 3T26A 4FU7A 2RA0A 1PFXC 2WPJS 3QN7A 4ISNA 2CHAC 3BG4B 5IDKA 2VWLA 4GHQA 1G3DA 2PHBA 5CHAC 1K28D 4WY3A 1E34B 2AGGX 3E0PB 2ZA5A 3QZQA 2VWOA 4GVUA 2NU0E 1MD7A 2NU1E 2D2DA 1HLTH 1IOEA 1PPZA 4I8JA 4FUCA 1QJ1B 1ARCA 2BD7A 1W8BH 2VIVA 1QBNA 2ZNKH 1S0RA 3VEQB 3EAJA 1EQ9A 5HXFA 2A7CA 1CBWC 2DE9A 1DE7H 2AERH 2BVSH 1LHDH 2VIDA 3TPIZ 4IGDA 1TGCA 1YYY1 1C5PA 4KP0A 1HAGE 4JZEH 1AFQB 1HIAA 3SU2A 2BX3A 1L2EA 2PTNA 1SOZA 2K1QA 1D4PB 2XRCA 1SFIA 5TJXA 4DCDA 4JZIA 1GJAB 4ZHMU 4BAOB 4JMYA 1QIXB 1HXEH 1N8OC 1V2WT 2GZ9A 2QV1A 4H6SB 3RXCA 3S7KB 1HFDA 1VGCB 3S9CA 1ZZZA 4FU8A 2FI5E 3VGCB 1DY9A 3A7TA 3NCLA 1O5CB 3PMHB 3ATKA 1PPCE 2BD2A 1XXDA 3A8CA 1YC0A 4ABAA 1CE5A 1GBHA 2OC0A 1MU6B 1JBUH 4CBOA 1O5AB 1C2LA 4AFZA 3STIA 3T5FH 1O38A 1UVPA 3RP2A 1TMTH 1BCUH 3T29A 2VIPA 4E7NA 2OTVA 2UUKB 4IC6A 2FPZA 5E0GA 5T6DA 1AKSA 3S7HB 1BOQA 2SGPE 3RLYH 3SORA 4GCHG 1EAUA 2PGQB 4A6LA 2V6NA 3SU4A 1Z6EA 3MU0A 4NFEA 4KTCA 4MPUA 2A5AA 1O2NA 1O33A 2Y5HA 2W7UA 5DO4H 4LOYH 4AOQA 1EJNA 1Z8IB 1L1GA 4DY7B 5LH8A 4ABDA 1JRTA 4XSKU 2UUFB 1GHAG 3UNRA 1GBLA 2M5TA 2FLRH 4IN2A 4AX9H 2B0FA 1NT1A 3LOXA 1O2KA 3Q76A 1UTPA 1AUTC 5FCKA 3UNQA 3ZZ3A 3BTQE 2WPHS 4AFUA 3BTFE 1GHXH 3DUXH 4VGCB 1EAIA 1G3EA 1QTFA 1TYNA 1VR1H 5LGOA 4X6MA 4CH2B 1AB9C 1PYTD 1A3BH 6LPRA 2A1DB 1C1QA 1BQYA 3KQDA 1O3LA 1GHBF 1Z8RA 4NSVA 1DWBH 1VCQA 1ZRBA 3SV2H 2GTBA 4X1SU 1CT2E 2OXSA 1GBEA 2ZDMA 1E37B 3LGTA 6GCHF 1GI9B 4YO9A 1ETRH 1PPEE 5EQQA 1GMDG
chains in the Genus database with same CATH superfamily
1EZUC 3FOAA 2O8WA 4ABFA 1IQHA 2TGAA 3M7TA 1Y5BT 2GVFA 4IW4E 1OHHD 4I8GA 1MAXA 3L3TA 4HTCH 5A0BA 4B74A 2FI3E 2YNAA 4MNXA 1C1VH 4CH8B 2ANKH 4WH6A 3ZV8A 1BA8B 1MABB 1ZHMA 1WV7H 1SQAA 1H9IE 4I86A 1FV9A 2QGRA 6CHAB 4GUXA 4AFSA 2SFAA 4X6NA 2HVXA 3RXTA 4WH8A 3UOPA 1LMWB 4INHA 2PV9B 3A82A 3LH3A 1EPTC 1JIMA 1FI8A 1AKSB 3HK6B 4BOHA 4RSPA 2A32A 1OWDA 5FX6A 1FIWA 3I78A 3PO1B 5JB9S 3A89A 3ENSB 3F9EA 1MZAA 1C1WH 4ZKSU 1DS2E 3MH7A 1AE8H 1WAYB 3ATMA 2FZZA 1C9PA 1KXDA 1D3TB 3BG8A 1KMHB 2ODYB 2LELA 4Q63A 5DK1A 2VWMA 3ATLA 5DP3A 2QCYA 1H8IH 2XW9A 3N7DA 2QXJA 3N99A 3SJ9A 3FANA 4A1VA 5EXNA 5L2YH 1TNIA 1YKTA 1PQAA 1GVKB 1AVGH 1BT7A 3F0PA 4Y8XA 1O3OA 1Y3VA 1F2SE 2BDGA 2ALVA 2HNTE 2QN5T 1TNGA 2XBYA 1FN8A 1ELTA 4LZ4B 5H4IB 1OWEA 3SOSA 2EA3A 4FVBA 2HPQH 2BVRH 3TVJB 1DPOA 1HPGA 1O3AA 2ZIQH 1ACBE 1QR3E 2THFB 4CHAB 3LIWA 2BD9A 1CT4E 1IQKA 1D6WA 1V2VT 2ZCLP 3MNXA 1MTWA 1UK4A 1H9HE 4TY7A 2ZGHA 1EKBB 5EG4A 4MNVA 1ZTJA 4X1NU 3DFJA 1Z71A 1CSOE 1OSSA 1SB1H 2C3SA 4YOGA 1IQMA 1SGNE 2D1JA 1SGTA 1BTUA 1O30A 2WPLS 3HATH 4Y7AA 1ID5H 2G81E 4MLFB 2OQUA 1O35A 4CRGA 1QB6A 1V2PT 3LPRA 3NK8A 5GIBA 3O8CA 1HAVA 1OS8A 1ZSKA 1O3EA 4F49A 2QC2A 6ESTA 1INCA 1MU8B 2C90B 1TBRH 1CA0C 3FP6E 5EW2H 1P57B 1TA2A 4H42U 1TNLA 2BY5X 3BN9A 3F1SB 1J8AA 2ZO3H 4YXWD 1SPJA 4VGCC 5FCRA 4UDWH 4DT7B 1BRAA 3RMNH 4B2BA 2Z6BD 2GCTB 1TOMH 3KIDU 2ZDLA 1T7CA 4ZHAA 4B6EA 5DJ7A 3F2FA 2CK3D 3RUOA 5I25A 1EJAA 1CGIE 5CHBA 1FAXA 4AGJA 1SGQE 3M36A 1SLXB 5CMXH 1BJVA 1TONA 3FZZA 3P70B 3PV2A 4ZAEA 2ZHFH 4X1PU 4K1SA 1A46H 1YPJH 1QCPA 1T31A 3A84A 4DT4A 2R2WU 3RU4E 1P2OA 1DDJA 5JYIA 1QRWA 1FIZA 4UFEH 1TFXA 2TGPZ 4K1TA 1CHOG 3RXRA 3SI3H 4AG1A 1ZHPA 3SGAE 1O2QA 4GLYA 3OTPA 1H8ED 2UWOA 4TPYA 3MOCA 2H9TH 2C8WB 1ZPBA 1S83A 4FUIA 2KFWA 1YF4A 3H7TA 4DOQA 2BD8A 4X6PA 2P3FH 1JXPA 3KCGH 3SBKA 2W7SA 4KTUA 1TA6A 3RXKA 5C94A 3UUZA 1HGTH 1TGBA 6CHAC 1ZMLA 3S9AA 3ATIA 1EX3A 3SZNA 1WQVH 3PLPA 1OWKA 1C5SA 1DM4B 1C1TA 3GCTF 2SGAA 2TBSA 2GV6A 3EDXB 4CREA 4DG4A 3ZZ9A 1RTFB 2WYJA 1O31A 3MO3A 3MU1A 1MBQA 3PO1C 4PROA 1DWDH 2HLCA 1UCYK 4DIHH 2FTMA 1MTSA 1BIOA 4JK5A 4BAKB 2FTLE 5LPFA 4A92A 3LJOA 2ZTXA 2JETB 4RN6A 1ANEA 1HAVB 1GL0E 1VITF 9LPRA 1AVXA 1UTKA 3RC6A 1KXAA 5HM9A 1SGPE 4CR9A 3OFND 1YCPM 1EUFA 2BM2A 7ESTE 5I46H 3M5MA 1WOFA 4MVNA 3U8OH 4FUEA 2RA3A 1YY3A 1Z8GA 3PMAB 3HKIB 4CBNA 1GJDB 5DG6A 3Q3XA 3D65E 3NRLA 1YP9A 1D9IA 1O3DA 3GICB 1UMAH 1AU8A 1KIGH 4TY6A 3SUGA 2ESTE 4I7YH 2P59A 4AC9A 3MNBA 1O0DH 1TBQH 3SNEA 4LXBH 5EPYA 3OY5U 1AUJA 1C2EA 1MAYA 3TK6A 1CGHA 1V2RT 2PW8H 2ZG0H 3A8DA 5GDSH 3U1IB 1QRXA 1SFQB 1HCGA 1O2JA 3B8JA 3IWMA 3LC5A 3ZV9A 1UJ1A 3ZZCA 5F03A 1UK3A 2ZFPH 2ZQ1A 4AB9A 2KCYA 1O2XA 2QXIA 3U1JB 2GJGA 3TLOA 1XUKA 1H4WA 2FOFA 2ODPA 1AHTH 2FODA 3E8LA 4AYYB 3RC5A 4Y8ZA 3F6UH 5DSFA 1B5GH 2A4QA 3TH3H 1Y3WA 2ILNA 1KY9A 2Y5GA 4XBBA 4U2WA 1Y3UA 1F0TA 4JZDH 4WF8A 2SNVA 1DSTA 1O3GA 3HK3B 3OEED 3S0NA 5AF9H 3V13A 1BMNH 2H9HA 3SV6A 1V2QT 2GCTC 3QK1A 1IQFA 1PPGE 1SQTA 3QZRA 1KLJH 4TPIZ 3TH2H 1YPGH 2VVVA 4XE4A 2W5EA 5A2MH 4OS7A 1G2LA 1GHAF 3OTJE 1IQGA 1L1NA 3C1KA 2ZU3A 1GBKA 1C1NA 2B5TB 1O2VA 5F6MA 4R8TB 3B9FH 4FUDA 3RM0H 3UAIC 1CO7E 3KHVA 4WXVA 8GCHF 1BRCE 4I8HA 5KEDA 4D7GA 4GPGA 1H9LB 1VITH 2FOEA 3EQ0H 3BSQA 1RIWC 3RXOA 4FETA 3PWBA 2JH5D 1TNKA 2G51A 4WJG2 3AW0A 2FOAA 1E35B 3VB3A 1ELAA 2HPPH 2A45B 1O5FH 1QL7A 2AIPA 3BEIB 5LPEA 2BHGA 2AGEX 5FAHA 1NRQH 1UTMA 3L33A 2FYRA 3A7YA 4F48B 1A0HB 1DWEH 2J38A 1SI5H 3KQCA 2ZTYA 1FXYA 2BD3A 1TABE 1ZPCA 1GL1A 1P09A 4O3TA 2ANYA 1O3IA 4B73A 1LPGB 1D6RA 5G4BA 1Y3XA 3MNSA 4AZ2B 2AMQA 3SJ8A 1QJ7B 4U32A 1ETSH 3KL6A 1ORFA 3P8GA 1TPOA 1XM1A 4BXWA 2DUCA 2C93B 3O8BA 3SNBA 1GCDA 2C8XB 2F9BH 4MQAA 2HOBA 1GJ5H 2RCEA 5ETXA 3A83A 1PQ5A 2BQ6B 1O2RA 1K1PA 1MKWH 3SNDA 3T28A 1NTPA 1DY8A 1GJ8B 4NZQA 4WMDA 2G4TA 1P2NA 1HAIH 2VH6A 2WHXA 5DGJA 2JETC 5DP9A 1YLDA 4O9VA 1A5GH 5C0TA 2STAE 2BY7X 3EE0B 3OX7U 1XVOA 3SN8A 3BIUH 4ZCNA 5BRRE 1XMNB 3TNSA 1IQLA 2A7HA 4BTUB 1CVWH 1TIOA 2WSSD 1SGIB 3ZZ5A 3SHCH 1TB6H 2F91A 4BTIB 1ZLRA 1VJAU 4K3JA 1ZR0A 3LGYA 4HFPB 1P11E 4CR5A 3U69H 2AHME 4NA9H 3P92A 4WWYA 1MTVA 2VB0A 1M9UA 1PPBH 2OC7A 1TRYA 3RMMH 1FY4A 1K1LA 1NZQH 1QBOA 2BLQA 2F4LA 3OYPA 1QB1A 5JDUB 2AMDA 3TJNA 1XVMA 4CRFA 3SQEE 3CS7A 3F9HA 1GCTB 1JOUB 1ZGVA 2Q6FA 3SUDA 3O8RA 1O36A 1AO5A 1HAZB 3JZ2B 1T8LA 3M5LA 1S0QA 1SHYA 2WPIS 2V7QD 4Y8YA 1AWHB 1NBMD 3MQKC 4AFQA 3BTME 1SGFG 3MMGA 2KCPA 1NY22 2QA9E 4D8NA 1C1MA 3TK9A 1V2UT 3BTEE 3PTBA 2F9UA 3ZZ4A 3BEUA 5J4SA 1NPMA 3TU7H 1OYTH 3PM3A 5FXLA 1HAHH 1DANH 3UOUA 1DSUA 2I6QA 1THPB 1O37A 4Y79A 4XRNA 4NWLA 1HAYB 4K2YA 2ZKSA 2FOMB 2KX4A 1MTNB 1EJMA 4FUHA 4YLQH 2ZDVH 2F9NA 1FY5A 1C5LH 2GD4B 2SGEE 3SNCA 2UUJB 2IN2A 2KAIA 1BTPA 2ZP0H 5T6FA 3DT0H 1A0LA 2ZU5A 2Y81A 3PTNA 3OAAD 3LJJA 4QT8C 1PQ7A 1HAXB 1ABJH 3URCA 1D3QB 3P17H 1BBRE 2IPHA 1C2GA 3A8AA 5B6LA 1L1JA 2ZCKP 3PYHA 1GBMA 2BY6X 3V0XA 3UQVA 2VWNA 1IQIA 2NWNA 4X2VA 3SV7A 4ESTE 3PB1E 2WV4A 4K1EA 1LVYA 4X2WA 1FY1A 4FOUC 5FBIA 5K0HA 1BUIA 4ACAA 3RDZA 3DHKH 2F9VA 4BANB 1GBIA 2GT8A 2BDBA 2ZEBA 1C1SA 1Y8TA 1WTGH 4ZKOU 2PUQH 4NG9H 4JYTA 4F55A 1CHOF 1MKXH 3PV5A 2YMSC 4A1XA 5F8XA 5T6GA 4I33A 4NIYA 5K7RA 4D76A 2AGIX 4HGCA 2BY9X 2VGCB 1P02A 1SC8U 2GDDA 2TRMA 3ODDA 2H1UA 1ABIH 4LZ1H 1SLVB 4IBLH 1AIXH 1LVBA 1S5SA 1AVWA 2RDLA 5EJ1A 5JBCS 4JCNA 4B1TA 1C5RA 4ISOA 3K6ZA 4Z6AH 1T8OA 2W6JD 4Q7ZA 4XD7D 1NRPH 3SGQE 3EE7A 2ODQA 4OS1A 3ZVBA 1W7XH 1TGNA 1C2FA 2O9QA 4M7GA 1WBGB 5IYTA 4DJZB 1L0ZA 4YM9A 5C5NA 2PR3A 2BLWA 3GY7A 7GCHF 1TX7A 1YGCH 1TPPA 3TGKE 1W0JD 2J4IA 1GMHF 3EA9A 1NU9A 4KELA 1GMCG 5GCHF 5DP7A 1P9UA 3NUMA 5C1UA 1J14A 2KAIB 5DN6D 3MU5A 1AY6H 2F9PA 3RXQA 2A2XH 3AVZA 1OKXA 3U9AH 2IPQX 4SGBE 4J2YB 5C3NA 4NIVA 5FPTA 5ESTE 3Q3YA 1S6HA 2QXGA 5EJZA 1ARBA 1BITA 2K0QA 2OBOA 2WINI 3LH1A 1NRNH 4K8BA 3HGNA 1COWD 1TMUH 3BG4C 3U8RH 4MDSA 3LGVA 3NXPA 3QGJA 1GBTA 2K8IA 3F3BA 1W3CA 5EW1H 1G3CA 4MTBA 2D26C 1GJ6A 2BD4A 2A7JA 1BZXE 2BTCE 3MWIU 1Z8JB 2ZQ2A 3QTVH 1O3BA 2ASUB 3DCLA 1HJ9A 4BAHB 1C5WB 4I31A 4NSYA 3VB6A 1GBDA 1JRSA 1C4Y2 2W3KA 1KDQA 1C4V2 1F5RA 1XKAC 3VPKA 1SGDE 3PV4A 1AFQC 5GPIB 4YTAA 2OK5A 1V3XA 2KCOA 1E0FD 2BLVA 3ZVEA 2AMPA 3ZVCA 3QGNB 4K5ZA 2GCHG 5HM2A 2XCFA 2Q6GA 1VGCC 3GCHB 2AEIH 1C1UH 3CS0A 3KN2A 5CE1A 1LQEA 1J17T 2ZGXH 4F4OC 1PJPA 4O97A 1ZMJA 3VGCC 1HUTH 2C8ZB 1W14U 3UNSA 3BTHE 1BMAA 4X0WU 5KECA 2R3YA 2WV5A 3A88A 2BOHB 1BB0B 1FY3A 4OGXA 1ANBA 1FAKH 1K22H 2ANMH 3M61U 4FUJA 4D9RA 2CV3A 3P8NA 2V3HH 1DVAH 3MO6A 1LHCH 4E06H 1KLIH 4Q2KA 5DP4A 1HB0B 1O3PB 1HXFH 3Q3KA 4TT3D 2WUCA 2OP9A 1O2TA 3G01A 4AORA 2ZFRH 5ESBA 2G00A 1O39A 2QAAA 3KQ5A 2P16A 3QTOH 4FUGA 2PP6A 1C2KA 3A81A 1S85A 4NIXA 5ABWA 5FPSA 5C17A 2KR7A 1F5LA 1G37A 1O2YA 1BTWA 3ELAH 1A4WH 3FVFB 2VIWA 1C5XB 1BMFD 3DA9B 1C2IA 3ZVFA 1F0UA 5HGGA 1PYTC 4YOJA 4ZUHA 3M5OA 2PKAA 1K21H 5E0HA 3AK5A 1QL8A 1AFEH 1C2HA 1GJ9B 1Z6JH 2XBXA 3M37A 3TGIE 2J97A 1V2JT 1LHEH 3GY6A 1LPKB 2Z9KA 4ZKNU 5HIYA 2TIOA 3H09A 2BLOA 3LGIA 4UFFH 2ZGJA 1KDQB 1A3EH 2GZ7A 3AW1A 3UR9A 3SU6A 3DSGA 1V6DA 2Z3DA 1HV7A 1C5YB 1E1RD 2A4OA 4K8YA 4ASHA 1S84A 2FESH 3ZVAA 3RMLH 4WMFA 1ELGA 1GJ4H 1O5EH 2G8TA 5B6OA 1NRRH 3GY8A 5FBEA 1GHVH 1K0HA 3SU3A 1E36B 2KZ4A 1ETTH 3GISB 1ZRKA 2EI7A 5PTPA 3RXAA 1LO6A 3UTUH 2FOBA 4LK4A 1UVUH 3WW7A 1X7AC 1P2JA 3SNAA 3MH6A 1O3KA 3MHWU 3WWFA 5C20A 1P3CA 2GP9B 4XOJA 3E16B 1TRNA 4O03A 2ZI2H 5JB8S 1KLTA 1AD8H 5C1YA 1GI7B 4YLUA 2BY8X 3ZYEA 1EASA 3RXEA 2BZ6H 2BMGB 1VKYA 2STBE 1SMFE 1BRBE 1SQOA 1ELEE 1V2KT 1BTZA 3M3SA 4B71A 1YPMH 3E3TA 1FUJA 3RLWH 5DKMA 4GAWA 1W0YH 1RRKA 2OCVB 2QF5A 2VU8E 2JH0D 1QGFA 1O34A 2FLBH 3M7QA 4AG2A 3O8DA 2WUBA 1GDQA 1P2IA 2J92A 3MTYA 3ZZDA 1SLUB 1P01A 3UY9A 2ZFTA 1XX9A 3GCNA 3WWBA 3E1XB 1SLWB 1AE5A 1C2JA 3F0OA 4X8TH 5BPEA 3F2HA 4ZKRU 3RU4D 1MMJN 1G3BA 1C1OA 1GHBG 3SJKA 2QF3A 3TJUA 2FEQH 3F9GA 1RD3B 3P8FA 5HMAA 2W6ID 1MKWK 2J98B 2PKAB 4NA7A 3U98H 1H8DH 1PPHE 1Q2WA 3QUMP 6GCHG 1O3HA 1E1QD 1NN6A 4Y10E 1LCYA 1AQ7A 4CHAC 1QRZA 1RGQA 4Y0YE 5EQRA 3EYDA 1SGEE 4K60A 3TNTA 2YOLA 3JZ1B 3TJOA 4K69A 1HAOH 5FHTA 1O3JA 4UD9H 2VIOA 1LHFH 3RXIA 2XWAA 3RXVA 3GYMA 1KXBA 3E6PH 4NA8A 1TQ0B 1HDTH 1A5HA 1ELCA 4WVPE 1KXCA 1ELVA 4TYDA 1HRTH 5DP5A 2CN0H 2L74A 1TAWA 2R0KA 2Z94A 2ZHQH 5FX5A 1C5TA 1C1PA 5A09A 7LPRA 2CF8H 2LNCA 1O2ZA 1WXRA 4H6TA 1BTXA 1T4UH 1UO6A 1WU1A 4GCHF 1G32B 2BOKA 1NM6A 2Y82A 3T62A 4ABBA 1ESAA 1W2KH 1C5QA 3OU0A 5EPNA 2ZU4A 2H6MA 4ZXYH 1NFWA 2I6SA 4Q80A 1RFNA 4JYUH 1GBBA 1WYKA 1EP5A 8KME2 2XCNA 4ISHH 3BEFB 1P03A 5GXPA 4OM9A 4WMEA 1C4U2 1QQ4A 4A5TS 1F5KU 1SSXA 1UTQA 5C67A 4NGAH 2ZZUH 2PFEA 1O5BB 3LKWA 4OS6A 4E7RG 1LVMA 1SGCA 2KM0A 1QY6A 1CA8B 2Z9JA 1TGSZ 2Y7XA 2G5VA 1OP0A 1O2GH 2VVUA 4RKJB 4DURA 3T2NA 2J94A 3UB0A 3BIVH 4DIIH 1QQUA 4THNH 2L6OA 1N8OB 1C5ZB 3UREA 3RXLA 1ELFA 3V3MA 1EXFA 8LPRA 1GMDF 3UIRA 1KTSB 4CRCA 1S6LA 4CRBA 1LPZB 1J9CH 3UR6A 1C1RA 1MUEB 3TITA 3E90B 1MD8A 1O2PA 1HJAB 1P0SH 1THSH 3IITA 5IK2D 3T27A 1NRSH 3RXMA 4O3UA 1JIRA 3MH5A 1V2LT 2ZHWH 4ISLA 4XBCA 2FIRH 1DUAA 3F9FA 2PTCE 3LGUA 2HVYB 1ZPZA 1F7ZA 1LKAA 1MH0A 2F83A 4XBDA 3CNRA 2SGQE 1MQ5A 3K6YA 1QHRB 1C5MD 4JK6A 1YBWA 2ZU1A 4RT0A 4Y76A 2QY0B 4Y11E 2WYGA 2UWLA 2BQ7B 1MKXK 1KTTB 1LKBA 1XUFA 2W26A 2WPKS 2ZHEH 3SI4H 4I32A 4B2AA 2CMYA 3K9XB 3U8TH 1CHGA 1EB2A 3BTWE 3MH4A 2GX4A 2Q1JA 3NKKA 1SGRE 1NESE 2P95A 3GY2A 4ZMAH 4Q7YA 2XOKD 1GI8B 3V7TA 2BDYA 1ZJDA 3T25A 1XUIA 2VINA 2CXVA 3URDA 2XNIA 3RXFA 2GMTB 1V2ST 4P02A 4OGYA 4AN7A 3QWCH 3RMOH 1C5UA 1TNHA 1ZJKA 2GCHF 4E05H 1GPZA 1AB9B 5GJ4B 5EQSA 3M7UA 1YPHC 2G52A 4B76A 1LHGH 5A8ZA 4FUFA 2VNTA 4SGAE 3W95A 1AZZA 2LP6A 3CP7A 3DFLA 4NFFA 3MO9A 3CENA 4IC5A 1VCWA 5E0JA 1RTKA 2BD5A 2OQ5A 1MTUA 1NROH 1UHBA 1E38B 1YLCA 2BZAA 2H5CA 1ELDE 2YNBA 1GBFA 2A5IA 2OBQA 4DVAU 1EAXA 1GWAA 3RXUA 1XUJA 3I29A 2FM2A 3W1EA 1WTHD 1UVSH 1T32A 1TNJA 2GDEH 1N6XA 1GI3A 2XYAA 4UE7H 1P2KA 5L30H 3FZDA 5T1VA 1XXFA 1P05A 3GCTG 2P8OB 4FUBA 1W13U 1FPHH 3OY6U 1G30B 5EGMA 4BTTB 2QE7D 3FP7E 1ZOMA 1L4DA 1RTLA 3HKJB 2OUAA 1O2UA 1W10U 2QYIA 3SJOA 2G4UA 1P9SA 2J5UA 3GDVA 2J2UA 2BDCA 2HALA 4FU9A 4BAQB 4Y0ZE 1O5DH 1TRMA 2VJ1A 4JZ1A 1VITG 5DP8A 1JMOH 1O2OA 4A1TA 2V3OH 2QIQA 3EA8A 1P3EA 2JJ2D 3SV8A 1JWTA 2V35A 3SJIA 1EPTB 3VXEH 1Q31A 4X2YA 2C8YB 5LPRA 3R3GB 4YT7H 3QLPH 3F68H 2BXUH 1EZSC 1BBRK 2JDID 4XDEA 5F8ZA 3UWJH 1K1JA 5DPAA 3HPTB 2A2QH 4Q7XA 1L4ZA 1NFYA 2UWPA 2ZDAH 2NU4E 4AB8A 3ZZ8A 3ZVGA 3A85A 4MPWA 3K65B 4NCYA 1QFKH 2P3TB 1ESTA 2BX4A 4AYVB 1TE0A 4U30A 1MQ6A 2Y7ZA 4B75A 1S6FA 1ZTLA 1HJAC 1C2DA 1DWCH 4D9QA 2CF9H 2ZPRA 2GT7A 3MYWA 5TCAA 1WDIA 3R0FA 4CRAA 2JH6D 1Y59T 3BV9B 4X8UH 3PLKA 4KKDA 5HKKD 3LU9B 1YCPH 1OWIA 2TGDA 1BTYA 1UHBB 2R3UA 1NC6A 1P04A 1VZQH 3RXBA 1AN1E 1SR5C 3VG8A 4BXSA 4A7IB 1DOJA 5C0UA 2BYAX 5EOKA 3PRBA 2FP7B 4GSOA 1RJXB 2ZHDA 4IS5A 2R0LA 9ESTA 1GI2A 4Z0KA 3DSOA 2KCAA 1DFPA 1FX0B 1XUGA 1QB9A 5T3HA 2PWXA 3A7XA 1IQEA 4INLA 1CA0B 4ACBA 1TPAE 2VVCA 1SOTA 1QL9A 2J34A 2FXRA 1GHWH 2CJIA 2PLXA 4Q4LA 1C5NH 2GMTC 8GCHG 1YM0A 1CT0E 2Y5FA 2A4GA 3GY3A 4HG6A 1A0JA 5EU8A 3PLBA 5FL7D 2BDHA 5J4QA 1GI6A 1UTNA 4INKA 3ZIAD 3A7ZA 2A4RA 1BDAA 1SKYE 3UPEA 8ESTE 4ZHLU 3TJVA 2ZCHP 3MI4A 5CDFE 1GCTC 1K2I1 3A87A 1B0EA 1O3MA 1TLDA 1GJBB 1TMBH 1HIAB 2ZECA 1P2MA 2IJOB 3FKSD 1LVOA 3D62A 1UK2A 4X8SH 5HYOA 3KF2A 2IOTA 1WUNH 3ATWA 3WY8A 2QXHA 1DLKB 1IAUA 2OC8A 1H1BA 1EFRD 2Z3EA 3BTTE 4R0IA 3LONA 1OXGA 2FWWA 2PGBB 3MU8A 2QF4A 1GBCA 2FDAA 4JYVH 4ZH8A 1DITH 1RS0A 4IN1A 1F92A 2P8OC 3QX5H 4JZFH 5JBBS 1FQ3A 5JBAS 4ABIA 1O2SA 1TWXB 1NFUA 5JBTA 1W12U 5A0CA 1BBRH 2JKHA 1GGDB 3ZZ7A 1MTNC 3M35A 4X1QU 1HYLA 3ODFA 4MPXA 3VB4A 1S82A 2JJ1D 3SHAH 3AASA 1F0SA 3VFEA 1OPHB 4Y71A 1TX8A 2F3CE 3SU1A 1DXPA 2ZF0H 3SUFA 2Z9LA 1CU1A 2EI8A 4ASUD 2BB4A 5AHGH 1KSNA 1YPEH 1GHZA 1K1MA 3PMBB 4Y7BA 3I77A 2EI6A 4NIWA 5EXMA 1EOLA 2ZPQA 4D7FA 1EZXC 1DLEA 4HZHA 4ISIH 1G2MA 2Z7FE 4X2XA 2TPIZ 1AI8H 1G9IE 2J9NA 3E91A 2XBVA 1EAWA 1IHTH 3RXJA 5A8XA 1ANCA 3NWUA 2VIQA 1LTOA 3D23A 5C5OA 3M3TA 3GY5A 1WCZA 3A86A 3AAUA 2H2ZA 1QA0A 1KXFA 1OP8A 1FMGA 1GHYH 2V0BA 2FX6A 3FP8E 2C4FH 1EZQA 3PMJA 2AFQB 3MFJA 2HNTF 4Y6DA 2JIZD 2ZTZA 3KQBA 1QNJA 5AFZH 5E8EH 1GVZA 1ZSLA 2VGCC 4U01A 3GOVB 4I8LA 5GNDA 4J1YA 1UVOA 1A5IA 3ZYDA 1W0ZU 1C5VA 1W7GH 1D3DB 2PKSB 3FAOA 2Z9IA 1ZYOA 1IHSH 2ZU2A 3VB7A 4YESB 3RM2H 4ABJA 5C2ZA 3OEHD 4WXIA 1TBZH 3LGWA 1DT2A 1GBJA 1HBTH 2J98A 1SGFA 2A31A 1TALA 2SGFE 2ZC9H 3ESTA 2EY4C 1GI0A 4RT1A 4BNRA 3LDXH 4CRDA 2F9OA 4NZLA 4B6FA 1XUHA 2R9PA 2BXTH 3MU4A 3E0NB 4DGJA 2V3MA 1PPFE 3DSPA 1Z7KA 4B2CA 4KGAA 1P06A 1E79D 2A5KA 3ITIA 3OSYA 2WPMS 1O5GH 7KMEH 1P8VC 3H5CB 4RI0A 3TH4H 2PSXA 1BTHH 1FY8E 3KGPA 1GDUA 1T8MA 3N7EA 3Q77A 1O3CA 1EATA 2P3UB 1O2WA 3H7OA 1A61H 2J95A 2P94A 5JPMH 2B7DH 3RXSA 3HGPA 1ZHRA 1YPKH 5KGOA 3GY4A 1UTJA 1N6YA 1GG6B 3SZEA 4ZROA 1NU7B 3P95A 3QDZB 3LT3A 1RIWB 1GI5A 4KTSA 1O2LA 2G55A 3ZZAA 1CQQA 2ZWLH 1OWHA 4H4FA 4MG3A 5EXLA 3BTKE 4MPVA 2XC4A 1FLEE 2ULLA 2A0QB 1OYQA 4YZUA 1V2OT 3KQEA 3TGJE 3NPSA 3SQHE 1T8NA 1A2CH 1UVTH 3B23B 1GGDC 1W0KD 2OC1A 1YPHE 1UTOA 2O8UA 2O8LA 1A7SA 1SL3A 1CGJE 3A80A 1UTLM 1WSSH 3UWIA 2FOCA 1O2MA 4AGKA 2P93A 2W3IA 1SBWA 1BMMH 2BQWB 1D3PB 1FN6A 3KYGA 1ZTKA 2ZFFH 1FPCH 1F0RA 3EGKH 1UCYE 3GCHC 4XFQA 4BAMB 1AZ8A 3P6ZB 3NZIA 7GCHG 1YLNA 2HWLB 1NO9H 1SGYE 2Y6TA 1GMHG 2ALPA 4IMZA 3M3VA 1GJCB 1AMHA 2H9EH 1V2TT 5GCHG 1XKBC 1MCVA 3ZZ6A 2XBWA 3UQOA 2AYWA 2ANWA 2IJD1 2QF0A 3S9BA 1C5OH 2EQNA 3RXPA 3SUEA 1O3FA 2ZPSA 3MNCA 2B8OH 4OS5A 1O3NA 4UONA 1O2HA 1W11U 4TWWA 3STJA 2NU2E 2FOHA 2HGTH 2RG3A 3U28C 1IQNA 1MCTA 4ABEA 4I8KA 2ZGBH 2NU3E 1BHXF 4OS2A 3C27B 3BTGE 3FN8A 1KYNA 1J15A 4UFDH 3PROA 1K1OA 2XTTB 3RXDA 2CGAA 1EP6A 1GI4A 1Z1IA 1NS3A 1SHHB 1GBAA 1SQRA 1A1RA 3RC4A 2PKSC 2BDAA 3SU0A 2FS8A 1B7XB 2FYQA 2CHAB 1QA7A 2FOGA 4IMQA 2SNWA 4RKOB 5CHAB 1QURH 4FVDA 1IQJA 2HNTC 1HNEE 2GKVE 2HLDD 3SV9A 1BHXB 1ZGIA 4OS4A 1FZZA 1O32A 1SG8B 1THRH 4M9FA 1LDTT 5TCCA 5HIZA 3W94A 1WQSA 4UFGH 2DE8A 2O8MA 1MZDA 1HAPH 2ZDNA 3Q00A 4X8VH 1YWUA 3TIUA 1OP2A 1EB1H 1P2QA 2FI4E 1EOJA 2FMJA 2XC5A 2Z3CA 1CBWB 3D49H 1TOCB 1BMLA 1PQ8A 2RFKC 1NFXA 5L6NH 1KXEA 2GZ8A 5E2PA 2R2MB 1B0FA 3A7WA 3L6PA 1K9OE 1Z1JA 3K2UA 2Q6DA 2Y80A 2GGVB 1DICA 3GCOA 1ESBA 1Y3YA 5FPYA 1GMCF 2PUXB 4HI3A 2OLGA 1GG6C 2AS9A 2SGDE 1DX5M 3V12A 1V2MT 5DP6A 1GJ7B 3PWCA 2M2AA 2XXLA 4X1RU 1T4VH 1TQ7B 4YOIA 2O8TA 4P00A 5C1XA 1FDPA 2AH4X 5SGAE 2H5DA 1S81A 1J16A 1MBMA 3VB5A 2ZDKA 5AFYH 1DXWA 3P8OA 1UCYH 2UUYA 1N1LA 1VJ9U 2ZFQH 1K1NA 2ZGCA 4FXGH 1Y5AT 1ZSJA 4UEHH 2BVXH 1EPTA 1GI1A 2OINA 1OX1A 3FFGA 1FJSA 4ABHA 1TX6A 4ABGA 1P12E 2YMSB 5E2OA 4ZXXH 3GYLB 5EJLA 5GWZA 1HJ8A 2HRVA 1OOKB 3GDUA 1BJUA 4MNYA 3SO3A 3VXFH 2PSYA 3KYFA 1DUEA 2FX4A 2YMSD 1ELBA 1QJ6B 5A8YA 2EC9H 4DW2U 3ZVDA 1NBME 5AVDA 1GVLA 2EEKA 4MNWA 3KNXA 2GV7A 3DD2H 3TK5A 3EA7A 3UFAA 1YCPK 4TSFD 3S69A 4GHTA 1FONA 3LC3A 3PRDA 2D8WA 5EODA 2LPRA 1U6QA 1TPSA 2FO9A 2VH0A 3M5NA 2AIQA 3BTDE 1BRUP 2BDIA 1P10A 3RU4T 5L2ZH 3KEEA 3N7OA 1RXPA 3ZZBA 3IG6B 1V2NT 4YT6H 3GS9A 3F2GA 5A0AE 1Y5UT 3BF6H 1QBVH 1O2IA 1OWJA 1AWFH 1C2MA 1LQDB 1YPLH 2OD3B 3A8BA 4NWKA 3RXGA 4TWYA 1ANDA 2FS9A 3QO6A 1TGTA 4Z1MD 3SW2B 2XC0A 2Z9GA 1UW7A 1G36A 1K1IA 3SGBE 3SU5A 1C9TA 1FNIA 1GDNA 2ZFSA 2XWBI 5F8TA 3AAVA 2TGTA 3RXHA 4X6OA 1ZMNA 2B9LA 1VCPA 3A7VA 3SYJA 1Q3XA 1SVPA 3GDSA 1AGJA 2G5NA 3T26A 1QZ8A 4FU7A 2RA0A 1PFXC 2WPJS 3QN7A 4ISNA 2CHAC 3BG4B 5IDKA 2VWLA 4GHQA 1G3DA 2PHBA 5CHAC 5F53A 1K28D 4WY3A 1E34B 2AGGX 3E0PB 2ZA5A 3QZQA 2VWOA 4GVUA 2NU0E 1MD7A 2NU1E 2D2DA 1HLTH 1IOEA 1PPZA 4I8JA 4FUCA 1QJ1B 1ARCA 2BD7A 1W8BH 2VIVA 1QBNA 2XNDD 2ZNKH 1S0RA 3VEQB 3EAJA 2RDEA 1EQ9A 5HXFA 2A7CA 1CBWC 2DE9A 1DE7H 2AERH 2BVSH 1LHDH 2VIDA 3TPIZ 4IGDA 1TGCA 1YYY1 1C5PA 4KP0A 1HAGE 4JZEH 5EIYA 1AFQB 1HIAA 3SU2A 2BX3A 1L2EA 2PTNA 1SOZA 2K1QA 1D4PB 2XRCA 1SFIA 5TJXA 4DCDA 4JZIA 1GJAB 4ZHMU 4BAOB 4JMYA 1QIXB 1HXEH 1N8OC 1V2WT 2GZ9A 2QV1A 4H6SB 3RXCA 3S7KB 1HFDA 1VGCB 3S9CA 1ZZZA 4FU8A 2FI5E 3VGCB 1DY9A 3OE7D 3A7TA 3NCLA 1O5CB 3PMHB 3ATKA 1PPCE 2BD2A 1XXDA 3A8CA 1YC0A 4ABAA 1CE5A 1GBHA 2OC0A 1MU6B 1JBUH 4CBOA 3FO8D 1O5AB 1C2LA 4AFZA 3STIA 3T5FH 1O38A 1UVPA 3RP2A 1TMTH 1BCUH 3T29A 2VIPA 4E7NA 2OTVA 2UUKB 2WZQA 4IC6A 2FPZA 5E0GA 5T6DA 1AKSA 3S7HB 1BOQA 2SGPE 3RLYH 3SORA 4GCHG 1EAUA 2PGQB 4A6LA 2V6NA 3SU4A 1Z6EA 3MU0A 4NFEA 4KTCA 4MPUA 2A5AA 1O2NA 1O33A 2Y5HA 1H8HD 2W7UA 5DO4H 2WV9A 4LOYH 4AOQA 1EJNA 1Z8IB 1L1GA 4DY7B 2WPDD 5LH8A 4ABDA 2F43B 1JRTA 4XSKU 2UUFB 1GHAG 3UNRA 1GBLA 2M5TA 2FLRH 4IN2A 4AX9H 2B0FA 1NT1A 3LOXA 1O2KA 3Q76A 1UTPA 1AUTC 5FCKA 3UNQA 3ZZ3A 3BTQE 2WPHS 4AFUA 3BTFE 1GHXH 3DUXH 4VGCB 1EAIA 1G3EA 1QTFA 1TYNA 1VR1H 5LGOA 4X6MA 4CH2B 1AB9C 1PYTD 1A3BH 6LPRA 2A1DB 1C1QA 1BQYA 3KQDA 1O3LA 1GHBF 1Z8RA 4NSVA 1DWBH 1VCQA 1ZRBA 3SV2H 2GTBA 4X1SU 1CT2E 2OXSA 1GBEA 2ZDMA 1E37B 3LGTA 6GCHF 1GI9B 4YO9A 1ETRH 2VBCA 1PPEE 5EQQA 1GMDG
chains in the Genus database with same CATH topology
1EZUC 2O8WA 4ABFA 1IQHA 2TGAA 3M7TA 1Y5BT 2GVFA 4IW4E 4I8GA 1MAXA 3L3TA 4HTCH 5A0BA 4B74A 2FI3E 2YNAA 4MNXA 1C1VH 4CH8B 2ANKH 4WH6A 3ZV8A 1BA8B 1ZHMA 1WV7H 1SQAA 1H9IE 1FV9A 2QGRA 6CHAB 4GUXA 4AFSA 2SFAA 4X6NA 2HVXA 3RXTA 4WH8A 3UOPA 1LMWB 4INHA 2PV9B 3A82A 3LH3A 1EPTC 1JIMA 1FI8A 1AKSB 3HK6B 4BOHA 4RSPA 2A32A 1OWDA 5FX6A 1FIWA 3I78A 3PO1B 5JB9S 3A89A 3ENSB 3F9EA 1MZAA 1C1WH 4ZKSU 1DS2E 3MH7A 1AE8H 1WAYB 3ATMA 2FZZA 1C9PA 1KXDA 1D3TB 3BG8A 2ODYB 5DK1A 2VWMA 3ATLA 5DP3A 2QCYA 1H8IH 2XW9A 2QXJA 3SJ9A 3FANA 4A1VA 5EXNA 5L2YH 1TNIA 1YKTA 1PQAA 1GVKB 1AVGH 1BT7A 4Y8XA 1O3OA 1Y3VA 1F2SE 2BDGA 2ALVA 2HNTE 2QN5T 1TNGA 2XBYA 1FN8A 1ELTA 4LZ4B 5H4IB 1OWEA 3SOSA 2EA3A 4FVBA 2HPQH 2BVRH 3TVJB 1DPOA 1HPGA 1O3AA 2ZIQH 1ACBE 1QR3E 2THFB 4CHAB 3LIWA 2BD9A 1CT4E 1IQKA 1D6WA 1V2VT 2ZCLP 3MNXA 1MTWA 1UK4A 1H9HE 4TY7A 2ZGHA 1EKBB 5EG4A 4MNVA 1ZTJA 4X1NU 3DFJA 1Z71A 1CSOE 1OSSA 1SB1H 2C3SA 4YOGA 1IQMA 1SGNE 2D1JA 1SGTA 1BTUA 1O30A 2WPLS 3HATH 4Y7AA 1ID5H 2G81E 4MLFB 2OQUA 1O35A 4CRGA 1QB6A 1V2PT 3LPRA 3NK8A 5GIBA 3O8CA 1HAVA 1OS8A 1ZSKA 1O3EA 4F49A 2QC2A 6ESTA 1INCA 1MU8B 2C90B 1TBRH 1CA0C 3FP6E 5EW2H 1P57B 1TA2A 4H42U 1TNLA 2BY5X 3BN9A 3F1SB 1J8AA 2ZO3H 1SPJA 4VGCC 5FCRA 4UDWH 4DT7B 1BRAA 3RMNH 4B2BA 2Z6BD 2GCTB 1TOMH 3KIDU 2ZDLA 1T7CA 4ZHAA 5DJ7A 3RUOA 5I25A 1EJAA 1CGIE 1FAXA 4AGJA 1SGQE 3M36A 1SLXB 5CMXH 1BJVA 1TONA 3FZZA 3P70B 4ZAEA 2ZHFH 4X1PU 4K1SA 1A46H 1YPJH 1QCPA 1T31A 3A84A 2R2WU 3RU4E 1P2OA 1DDJA 5JYIA 1QRWA 1FIZA 4UFEH 1TFXA 2TGPZ 4K1TA 1CHOG 3RXRA 3SI3H 4AG1A 1ZHPA 3SGAE 1O2QA 4GLYA 2UWOA 4TPYA 3MOCA 2H9TH 2C8WB 1ZPBA 1S83A 4FUIA 1YF4A 3H7TA 4DOQA 2BD8A 4X6PA 2P3FH 1JXPA 3KCGH 3SBKA 2W7SA 4KTUA 1TA6A 3RXKA 3UUZA 1HGTH 1TGBA 6CHAC 1ZMLA 3S9AA 3ATIA 1EX3A 3SZNA 1WQVH 3PLPA 1OWKA 1C5SA 1DM4B 1C1TA 3GCTF 2SGAA 2TBSA 2GV6A 3EDXB 4CREA 4DG4A 3ZZ9A 1RTFB 2WYJA 1O31A 3MO3A 3MU1A 1MBQA 3PO1C 4PROA 1DWDH 2HLCA 1UCYK 4DIHH 2FTMA 1MTSA 1BIOA 4JK5A 4BAKB 2FTLE 5LPFA 4A92A 3LJOA 2ZTXA 2JETB 4RN6A 1ANEA 1HAVB 1GL0E 1VITF 9LPRA 1AVXA 1UTKA 3RC6A 1KXAA 5HM9A 1SGPE 4CR9A 1YCPM 1EUFA 2BM2A 7ESTE 5I46H 3M5MA 1WOFA 4MVNA 3U8OH 4FUEA 2RA3A 1Z8GA 3PMAB 3HKIB 4CBNA 1GJDB 5DG6A 3Q3XA 3D65E 1YP9A 1D9IA 1O3DA 3GICB 1UMAH 1AU8A 1KIGH 4TY6A 3SUGA 2ESTE 4I7YH 2P59A 3MNBA 1O0DH 1TBQH 3SNEA 4LXBH 5EPYA 3OY5U 1AUJA 1C2EA 1MAYA 3TK6A 1CGHA 1V2RT 2PW8H 2ZG0H 3A8DA 5GDSH 3U1IB 1QRXA 1SFQB 1HCGA 1O2JA 3B8JA 3IWMA 3LC5A 3ZV9A 1UJ1A 3ZZCA 5F03A 1UK3A 2ZFPH 2ZQ1A 4AB9A 1O2XA 2QXIA 3U1JB 3TLOA 1XUKA 1H4WA 2FOFA 2ODPA 1AHTH 2FODA 3E8LA 4AYYB 3RC5A 4Y8ZA 3F6UH 1B5GH 2A4QA 3TH3H 1Y3WA 2ILNA 1KY9A 2Y5GA 4XBBA 4U2WA 1Y3UA 1F0TA 4JZDH 4WF8A 2SNVA 1DSTA 1O3GA 3HK3B 3S0NA 5AF9H 3V13A 1BMNH 2H9HA 3SV6A 1V2QT 2GCTC 3QK1A 1IQFA 1PPGE 1SQTA 3QZRA 1KLJH 4TPIZ 3TH2H 1YPGH 2VVVA 4XE4A 2W5EA 5A2MH 4OS7A 1G2LA 1GHAF 3OTJE 1IQGA 1L1NA 3C1KA 2ZU3A 1GBKA 1C1NA 2B5TB 1O2VA 5F6MA 4R8TB 3B9FH 4FUDA 3RM0H 1CO7E 3KHVA 4WXVA 8GCHF 1BRCE 4I8HA 4D7GA 4GPGA 1H9LB 1VITH 2FOEA 3EQ0H 3BSQA 1RIWC 3RXOA 3PWBA 2JH5D 1TNKA 2G51A 4WJG2 3AW0A 2FOAA 1E35B 3VB3A 1ELAA 2HPPH 2A45B 1O5FH 1QL7A 2AIPA 3BEIB 5LPEA 2BHGA 2AGEX 5FAHA 1NRQH 1UTMA 3L33A 2FYRA 3A7YA 1A0HB 1DWEH 2J38A 1SI5H 3KQCA 2ZTYA 1FXYA 2BD3A 1TABE 1ZPCA 1GL1A 1P09A 4O3TA 2ANYA 1O3IA 4B73A 1LPGB 1D6RA 5G4BA 1Y3XA 3MNSA 4AZ2B 2AMQA 3SJ8A 1QJ7B 4U32A 1ETSH 3KL6A 1ORFA 3P8GA 1TPOA 1XM1A 4BXWA 2DUCA 2C93B 3O8BA 3SNBA 1GCDA 2C8XB 2F9BH 4MQAA 2HOBA 1GJ5H 2RCEA 5ETXA 3A83A 1PQ5A 2BQ6B 1O2RA 1K1PA 1MKWH 3SNDA 3T28A 1NTPA 1DY8A 1GJ8B 4NZQA 4WMDA 2G4TA 1P2NA 1HAIH 2VH6A 5DGJA 2JETC 5DP9A 1YLDA 4O9VA 1A5GH 2STAE 2BY7X 3EE0B 3OX7U 1XVOA 3SN8A 3BIUH 5BRRE 1XMNB 3TNSA 1IQLA 2A7HA 4BTUB 1CVWH 1TIOA 1SGIB 3ZZ5A 3SHCH 1TB6H 2F91A 4BTIB 1ZLRA 1VJAU 4K3JA 1ZR0A 3LGYA 4HFPB 1P11E 4CR5A 3U69H 4NA9H 3P92A 4WWYA 1MTVA 2VB0A 1M9UA 1PPBH 2OC7A 1TRYA 3RMMH 1FY4A 1K1LA 1NZQH 1QBOA 2BLQA 3OYPA 1QB1A 5JDUB 2AMDA 3TJNA 1XVMA 4CRFA 3SQEE 3CS7A 3F9HA 1GCTB 1JOUB 1ZGVA 2Q6FA 3SUDA 3O8RA 1O36A 1AO5A 1HAZB 3JZ2B 1T8LA 3M5LA 1S0QA 1SHYA 2WPIS 4Y8YA 1AWHB 4AFQA 3BTME 1SGFG 3MMGA 1NY22 2QA9E 4D8NA 1C1MA 3TK9A 1V2UT 3BTEE 3PTBA 2F9UA 3ZZ4A 3BEUA 5J4SA 1NPMA 3TU7H 1OYTH 3PM3A 5FXLA 1HAHH 1DANH 3UOUA 1DSUA 2I6QA 1THPB 1O37A 4Y79A 4NWLA 1HAYB 4K2YA 2ZKSA 2FOMB 1MTNB 1EJMA 4FUHA 4YLQH 2ZDVH 2F9NA 1FY5A 1C5LH 2GD4B 2SGEE 3SNCA 2UUJB 2IN2A 2KAIA 1BTPA 2ZP0H 5T6FA 3DT0H 1A0LA 2ZU5A 2Y81A 3PTNA 3LJJA 4QT8C 1PQ7A 1HAXB 1ABJH 3URCA 1D3QB 3P17H 1BBRE 2IPHA 1C2GA 3A8AA 1L1JA 2ZCKP 3PYHA 1GBMA 2BY6X 3V0XA 3UQVA 2VWNA 1IQIA 2NWNA 4X2VA 3SV7A 4ESTE 3PB1E 2WV4A 4K1EA 1LVYA 4X2WA 1FY1A 5FBIA 5K0HA 1BUIA 3RDZA 3DHKH 2F9VA 4BANB 1GBIA 2GT8A 2BDBA 2ZEBA 1C1SA 1Y8TA 1WTGH 4ZKOU 2PUQH 4NG9H 4JYTA 1CHOF 1MKXH 4A1XA 5F8XA 5T6GA 4I33A 4NIYA 5K7RA 4D76A 2AGIX 4HGCA 2BY9X 2VGCB 1P02A 1SC8U 2GDDA 2TRMA 3ODDA 2H1UA 1ABIH 4LZ1H 1SLVB 4IBLH 1AIXH 1LVBA 1S5SA 1AVWA 2RDLA 5JBCS 4JCNA 4B1TA 1C5RA 4ISOA 3K6ZA 4Z6AH 1T8OA 4Q7ZA 1NRPH 3SGQE 2ODQA 4OS1A 3ZVBA 1W7XH 1TGNA 1C2FA 2O9QA 4M7GA 1WBGB 5IYTA 4DJZB 1L0ZA 4YM9A 5C5NA 2PR3A 2BLWA 3GY7A 7GCHF 1TX7A 1YGCH 1TPPA 3TGKE 2J4IA 1GMHF 3EA9A 1NU9A 4KELA 1GMCG 5GCHF 5DP7A 1P9UA 3NUMA 5C1UA 1J14A 2KAIB 3MU5A 1AY6H 2F9PA 3RXQA 2A2XH 3AVZA 1OKXA 3U9AH 4SGBE 4J2YB 5C3NA 4NIVA 5FPTA 5ESTE 3Q3YA 1S6HA 2QXGA 1ARBA 1BITA 2OBOA 2WINI 3LH1A 1NRNH 4K8BA 3HGNA 1TMUH 3BG4C 3U8RH 4MDSA 3LGVA 3NXPA 3QGJA 1GBTA 1W3CA 5EW1H 1G3CA 4MTBA 2D26C 1GJ6A 2BD4A 2A7JA 1BZXE 2BTCE 3MWIU 1Z8JB 2ZQ2A 3QTVH 1O3BA 2ASUB 1HJ9A 4BAHB 1C5WB 4I31A 4NSYA 3VB6A 1GBDA 1JRSA 1C4Y2 2W3KA 1KDQA 1C4V2 1F5RA 1XKAC 3VPKA 1SGDE 3PV4A 1AFQC 5GPIB 4YTAA 1V3XA 1E0FD 2BLVA 3ZVEA 2AMPA 3ZVCA 3QGNB 4K5ZA 2GCHG 5HM2A 2XCFA 2Q6GA 1VGCC 3GCHB 2AEIH 1C1UH 3CS0A 3KN2A 5CE1A 1LQEA 1J17T 2ZGXH 4F4OC 1PJPA 4O97A 1ZMJA 3VGCC 1HUTH 2C8ZB 1W14U 3UNSA 3BTHE 1BMAA 4X0WU 2R3YA 2WV5A 3A88A 2BOHB 1BB0B 1FY3A 4OGXA 1ANBA 1FAKH 1K22H 2ANMH 3M61U 4FUJA 4D9RA 2CV3A 3P8NA 2V3HH 1DVAH 3MO6A 1LHCH 4E06H 1KLIH 4Q2KA 5DP4A 1HB0B 1O3PB 1HXFH 3Q3KA 2WUCA 2OP9A 1O2TA 3G01A 4AORA 2ZFRH 5ESBA 2G00A 1O39A 2QAAA 3QTOH 2P16A 4FUGA 1C2KA 3A81A 1S85A 4NIXA 5ABWA 5FPSA 1F5LA 1G37A 1O2YA 1BTWA 3ELAH 1A4WH 3FVFB 2VIWA 1C5XB 3DA9B 1C2IA 3ZVFA 1F0UA 5HGGA 1PYTC 4YOJA 4ZUHA 3M5OA 2PKAA 1K21H 5E0HA 1QL8A 1AFEH 1C2HA 1GJ9B 1Z6JH 2XBXA 3M37A 3TGIE 1V2JT 1LHEH 3GY6A 1LPKB 2Z9KA 4ZKNU 2TIOA 3LGIA 2BLOA 4UFFH 2ZGJA 1KDQB 1A3EH 2GZ7A 3AW1A 3UR9A 3SU6A 1V6DA 2Z3DA 1HV7A 1C5YB 2A4OA 4K8YA 4ASHA 1S84A 2FESH 3ZVAA 3RMLH 4WMFA 1ELGA 1GJ4H 1O5EH 2G8TA 5B6OA 1NRRH 3GY8A 5FBEA 1GHVH 3SU3A 1E36B 1ETTH 3GISB 1ZRKA 2EI7A 5PTPA 3RXAA 1LO6A 3UTUH 2FOBA 4LK4A 1UVUH 1X7AC 1P2JA 3SNAA 3MH6A 1O3KA 3MHWU 5C20A 1P3CA 2GP9B 4XOJA 3E16B 1TRNA 4O03A 2ZI2H 5JB8S 1KLTA 1AD8H 5C1YA 1GI7B 4YLUA 2BY8X 3ZYEA 1EASA 3RXEA 2BZ6H 2BMGB 2STBE 1SMFE 1BRBE 1SQOA 1ELEE 1V2KT 1BTZA 3M3SA 4B71A 1YPMH 3E3TA 1FUJA 3RLWH 5DKMA 4GAWA 1W0YH 1RRKA 2OCVB 2VU8E 2JH0D 1QGFA 1O34A 2FLBH 3M7QA 4AG2A 3O8DA 2WUBA 1GDQA 1P2IA 2J92A 3MTYA 3ZZDA 1SLUB 1P01A 3UY9A 2ZFTA 1XX9A 3GCNA 3E1XB 1SLWB 1AE5A 1C2JA 4X8TH 5BPEA 4ZKRU 3RU4D 1MMJN 1G3BA 1C1OA 1GHBG 3SJKA 2QF3A 3TJUA 2FEQH 3F9GA 1RD3B 3P8FA 5HMAA 1MKWK 2PKAB 4NA7A 3U98H 1H8DH 1PPHE 1Q2WA 3QUMP 6GCHG 1O3HA 1NN6A 4Y10E 1LCYA 1AQ7A 4CHAC 1QRZA 1RGQA 4Y0YE 5EQRA 3EYDA 1SGEE 4K60A 3TNTA 2YOLA 3JZ1B 3TJOA 4K69A 1HAOH 5FHTA 1O3JA 4UD9H 2VIOA 1LHFH 3RXIA 2XWAA 3RXVA 3GYMA 1KXBA 3E6PH 4NA8A 1TQ0B 1HDTH 1A5HA 1ELCA 4WVPE 1KXCA 1ELVA 4TYDA 1HRTH 5DP5A 2CN0H 1TAWA 2R0KA 2Z94A 2ZHQH 5FX5A 1C5TA 1C1PA 5A09A 7LPRA 2CF8H 2LNCA 1O2ZA 4H6TA 1BTXA 1T4UH 1UO6A 1WU1A 4GCHF 1G32B 2BOKA 1NM6A 2Y82A 3T62A 4ABBA 1ESAA 1W2KH 1C5QA 3OU0A 5EPNA 2ZU4A 2H6MA 4ZXYH 1NFWA 2I6SA 4Q80A 1RFNA 4JYUH 1GBBA 1WYKA 1EP5A 8KME2 2XCNA 4ISHH 3BEFB 1P03A 5GXPA 4WMEA 1C4U2 1QQ4A 4A5TS 1F5KU 1SSXA 1UTQA 5C67A 4NGAH 2ZZUH 2PFEA 1O5BB 3LKWA 4OS6A 4E7RG 1LVMA 1SGCA 1QY6A