3RXEA

Crystal structure of trypsin complexed with benzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxeA02
1DITH 2PGQB 4E7NA 4I7YH 4ABJA 3I29A 4K60A 3TITA 1HJ9A 3PV4A 1BBRK 3HKJB 5EW1H 5FBEA 1IQKA 2CMYA 4U32A 4YT7H 2OD3B 1C2JA 3VB4A 1H8DH 2BD7A 1BRAA 1C2IA 2BY6X 3HPTB 1Y3UA 2F91A 1PYTC 1TBRH 2BTCE 1D3TB 5H4IB 1OWEA 1O2RA 2WINI 3ZVEA 5K7RA 2QY0B 1K1IA 5GCHF 5GWZA 3U1JB 3KQBA 2HLCA 1GMDG 1FAKH 5C2ZA 3RXLA 1FY8E 1GI9B 2WYJA 1F0SA 4DGJA 2F9BH 3QN7A 4OS2A 1FIWA 1H9LB 2Z3CA 4JZIA 1GDNA 3A80A 4CHAB 1F7ZA 1FAXA 7GCHG 1TABE 2H2ZA 1C5TA 2XWAA 2VWNA 1MAXA 4GHTA 5L30H 1TPSA 2G51A 5DP7A 4ZHLU 2ANWA 3ZZ3A 1T8MA 1XKAC 1GHZA 2ZPQA 1N6YA 5T6FA 3MU8A 1GI3A 2WPKS 5EQQA 4E06H 3ESTA 1SFQB 2R3YA 2P8OB 1J17T 1C2LA 3M7TA 4RSPA 5AFZH 1QQUA 3SNDA 1AVGH 2Y5GA 3M5OA 1T8LA 2ZDMA 3RMMH 3PWCA 2ZDVH 3SU0A 2JH6D 1AE8H 1DXPA 1OSSA 2BVSH 1SOTA 2M5TA 1PPEE 2FODA 1C1RA 3DFJA 4IN1A 5FCKA 1HB0B 1SGFG 3P70B 1ABIH 3NZIA 1WU1A 2B5TB 1OP8A 1O30A 1SGIB 1CHOF 1TX6A 1S5SA 1E38B 1AFQC 1O5GH 3GY6A 4UE7H 4GVUA 2CJIA 1O3BA 4YTAA 2EA3A 1FPCH 3TH3H 3KF2A 4D7GA 2BYAX 1THSH 1YPLH 1GBKA 3M3SA 4NA7A 1BBRE 2PWXA 3IWMA 1D3PB 4MPVA 4NIXA 3RLYH 5J4QA 2BB4A 2IPHA 5B6OA 4FXGH 1P2QA 1GDQA 2H9HA 1MBMA 1BTZA 4X1RU 3LT3A 2GDDA 2BHGA 2ALVA 2FS9A 1P2JA 4BXWA 4ABEA 2ANYA 1B7XB 2AYWA 1P04A 2WPJS 5DO4H 5AF9H 2J4IA 4M7GA 5JBBS 4XFQA 2BX3A 3BEIB 1IQMA 1ANBA 1YP9A 4BAQB 3QTVH 5EXLA 2J2UA 4FUDA 3SHAH 3V13A 1ZOMA 1NZQH 1OWKA 1WTHD 1HAPH 1O3LA 2OP9A 2QXIA 3JZ1B 3K2UA 2BD4A 2PGBB 2FOFA 1QIXB 2A1DB 1GHVH 2ESTE 4NWKA 2ZFTA 5JYIA 2UUFB 2FYQA 2V35A 1MTVA 1RIWC 1O34A 1QRXA 3C27B 1V2WT 1TB6H 1EZXC 1Q31A 1TX8A 3KEEA 4A1XA 1KTTB 4X2YA 2I6QA 2Z3EA 5F03A 1GJBB 1MH0A 1Y3WA 1ZJKA 4UD9H 1Z8IB 1C2HA 1BT7A 3E1XB 1KXBA 1KIGH 2BLQA 3OX7U 3GDUA 4AYYB 1LHDH 3GCHB 1UVSH 3FP6E 2A5IA 2ILNA 1EATA 3MU0A 4F4OC 1C5XB 1RGQA 3SOSA 1ZSKA 2XYAA 2Q6FA 4IN2A 2TRMA 1QJ7B 5FBIA 3STIA 1MZAA 1SGEE 3M7QA 1E34B 1P11E 1ZSLA 1A3BH 4CRFA 4VGCC 3BTHE 3TVJB 2PUQH 3SUDA 5GXPA 3QTOH 2RDLA 3RXBA 3SU1A 6GCHF 4CHAC 4CRAA 1K1JA 3SNCA 1C1QA 1G2LA 1PPCE 3ZYDA 1EPTB 2IJOB 1P01A 1O3PB 3NWUA 1TNKA 4DG4A 3RC5A 2FPZA 3MO6A 3SORA 1TNHA 3RMOH 3A7YA 3P8GA 1NROH 1XUHA 2XBWA 2FX6A 3SNBA 1YCPM 4ABGA 2A2QH 2ZU5A 1FY1A 4FUGA 4CRGA 1HLTH 3RUOA 2C90B 2QAAA 3LC5A 1HJ8A 1MU6B 4DVAU 2VNTA 4AGJA 1FY3A 1V2QT 2G5VA 2R0KA 3OTJE 2KAIA 2GCTC 1QJ1B 1MTUA 3UFAA 1CA0B 4CH2B 1A1RA 4JYVH 4GSOA 2ZHEH 3MNXA 1HAHH 3F6UH 2VINA 3S69A 3ZZDA 1AMHA 1OOKB 1P3EA 3AVZA 4H6TA 2BLWA 5C1YA 3K9XB 4NIVA 5ETXA 1GI7B 1AWHB 4ABHA 5E2PA 1BDAA 1CE5A 4MLFB 3GY4A 2HPQH 1HV7A 4B1TA 1OS8A 1KXCA 4D9QA 5DP9A 4O97A 2FOMB 1A2CH 1C5ZB 1FDPA 1VITH 1NRRH 2P95A 1QRWA 3PO1B 3UTUH 1V2UT 3SQEE 3D23A 5CHAC 1VJ9U 3F9HA 3HKIB 1ZSJA 4X1PU 3T27A 1KDQB 2J94A 1IQNA 2W3IA 3ZZ8A 1PJPA 1ARCA 4Q2KA 2A7HA 1ELCA 1NT1A 4ZMAH 3QZRA 1VGCC 4TWYA 5BRRE 1UMAH 1YPHE 2G4TA 2ZP0H 5A2MH 1FPHH 3LU9B 1O0DH 3MHWU 4K2YA 1P2KA 1G3BA 2BD2A 1C5UA 1UTKA 1ZGVA 4A92A 1SPJA 4ZAEA 1O2UA 2ZGJA 1C4U2 1TPAE 1S83A 3KL6A 1O32A 3LJOA 5K0HA 2A32A 1IQHA 2OQ5A 3P8NA 1BUIA 2ZU4A 2K1QA 1CQQA 3ODDA 4CR9A 2BDIA 1UK3A 1TQ7B 1YPMH 2FLRH 3DUXH 2VH6A 1QBOA 3BEUA 1RTLA 2GGVB 4KGAA 1LVYA 1AD8H 2G52A 3LONA 3A84A 2H5DA 3QK1A 2VVVA 1SVPA 1HCGA 3A7VA 3OSYA 3TK5A 4IW4E 4D76A 1O3OA 1WQVH 3TGJE 2F9PA 2VWMA 4OS4A 1HUTH 2ANKH 3B8JA 3UQOA 2QCYA 2BQWB 2TGAA 4BOHA 1YPGH 1MTNB 1K1NA 1EPTC 2F9NA 2HVXA 5GPIB 3U8TH 5HMAA 2F3CE 4Y71A 2ZC9H 1ZMLA 1GBAA 4F49A 4K1SA 1C1WH 4DJZB 1AIXH 1UHBA 3RXTA 1LMWB 1AY6H 3O8CA 2Q1JA 1ZHPA 1SGTA 3ZZ6A 1O5DH 3SV2H 3BTFE 2G00A 4IC5A 4JYTA 1F92A 2AS9A 1KLJH 1EX3A 1K2I1 2VVCA 1HIAB 3LIWA 1ELGA 2C93B 2NU2E 2G4UA 5TCAA 1GBHA 1GBBA 5HXFA 1EAXA 3EQ0H 1N6XA 8GCHF 5A8XA 1TWXB 3OYPA 1BRUP 5FCRA 4TPIZ 1KXDA 5T6GA 6ESTA 3VGCB 1F5LA 1EJMA 1AI8H 1FUJA 1GWAA 2BVXH 3NXPA 3BF6H 1W0ZU 2FIRH 1GBCA 5C20A 1PYTD 2BOHB 1LTOA 3PMAB 1Z1JA 2FM2A 3MU4A 3LJJA 1O2VA 3SJ8A 3KIDU 3ZVAA 4X8UH 2OQUA 1G37A 3RXIA 3ATIA 1EOJA 3A87A 1IQEA 1GHWH 2VIQA 3BTME 2CF9H 3FZDA 4Y8XA 1O33A 4Y7AA 3PO1C 4D7FA 4KELA 1FI8A 2V3HH 2A7JA 4B75A 4BAOB 3TLOA 4ZROA 2ZQ2A 1CVWH 2A4QA 1O38A 1S84A 1WYKA 1YC0A 2FYRA 2AFQB 3SU5A 1K1LA 2J9NA 2ZECA 3VB6A 4MNWA 1IQIA 3RXDA 3AAVA 4TPYA 1LCYA 4LZ4B 3ZZ9A 1NS3A 1GJ5H 1YBWA 1C5MD 1GBEA 5EU8A 1J8AA 1AFEH 1SQAA 1S0QA 3E16B 3RLWH 2Z9GA 1P03A 1CSOE 2WPHS 2BDCA 2W5EA 4KP0A 3T29A 4ZHAA 1WAYB 3RXFA 2A0QB 1O3FA 4AB9A 2HNTF 3H5CB 1C2FA 3LGYA 2BZAA 1ZR0A 4JK5A 2ZG0H 1OYQA 1C1VH 1TNIA 1FY5A 6CHAC 1VCQA 4NGAH 1SR5C 1AWFH 1G3EA 2XBXA 4YLQH 5A8ZA 3GYMA 4ASHA 1C4V2 4AFSA 4IS5A 1HAOH 2B7DH 1VJAU 1AKSA 1LHCH 1LDTT 2ZGXH 4I8HA 1MQ6A 3PTBA 5GDSH 3C1KA 2PKSC 1EZUC 1DUAA 1YF4A 1ZJDA 1LVMA 1A4WH 2Z9JA 1O3JA 4H6SB 1DXWA 3SNEA 3ZZ4A 1SLVB 2FOCA 3UOPA 1UTOA 4AZ2B 2XTTB 1MCVA 3A88A 1AVWA 3A8DA 1X7AC 1LQEA 4ZHMU 3NK8A 2OC1A 1G9IE 3Q3XA 1BCUH 1T31A 3U8RH 1GI6A 1S6HA 2JETB 4Z0KA 2BD9A 3P92A 1KLTA 3QDZB 3SGAE 3KQEA 1TYNA 3RXSA 2QN5T 1V3XA 1Y5AT 1MD8A 3MOCA 1YM0A 3PLKA 1W7GH 1BTPA 1C4Y2 1UK2A 1GMHG 3P6ZB 1JIRA 1V2MT 3TPIZ 1ID5H 1MMJN 1HJAC 2BD8A 4UFFH 1ELVA 1JIMA 3SUGA 1T32A 1QA7A 2R0LA 3V0XA 1QBVH 1AGJA 3LKWA 4MPXA 4DURA 2C3SA 3TH2H 1AE5A 1UVUH 1T7CA 4WXIA 1DS2E 1XVMA 2BQ7B 1GHYH 1ZMJA 2OTVA 3ENSB 3RU4D 1MD7A 3SU2A 1GBMA 3E6PH 4LXBH 4KTSA 3PMBB 2BVRH 4RKJB 4FVBA 1L2EA 1GHBF 2OBOA 3UR6A 1SLXB 1C5SA 4O3TA 1TLDA 2GV6A 3STJA 3MTYA 4WJG2 1PQAA 1DWBH 1L4DA 1NRPH 2V6NA 4K8BA 1CHGA 3TU7H 3TNSA 1GG6B 1GDUA 1HBTH 3UQVA 3MH7A 1GJ6A 2ODYB 1IHTH 1KTSB 1GVLA 3DT0H 2H6MA 1AVXA 3W94A 1TALA 2C8WB 3O8DA 1UTMA 1CBWC 3RXKA 1VITF 2WPLS 4Z6AH 2UUYA 3GDSA 4CRDA 1KXEA 1O3AA 1NRNH 5EGMA 1V2KT 5FAHA 1ZTJA 4NWLA 1NN6A 1PQ7A 2GCHF 4X2VA 1E36B 4AYVB 4PROA 1OWIA 3M37A 3Q00A 3SO3A 4YOJA 5GJ4B 3BTDE 3TGIE 1W0YH 2ZI2H 3R0FA 3RXMA 1HAGE 1LQDB 2AMPA 2ALPA 3DHKH 1Z8JB 1O5CB 1O2KA 5TJXA 2R2WU 4RN6A 1A0HB 2FESH 2GMTB 3HATH 3MU5A 1A7SA 4DW2U 3U1IB 5L2ZH 2LPRA 3T62A 1EZSC 1H8IH 2QXHA 2O9QA 1BZXE 1O39A 1F0TA 3ZYEA 1WUNH 1AZ8A 2RA0A 4MPWA 4YO9A 3SUFA 1ORFA 1AZZA 3E8LA 1C1SA 1AU8A 4MTBA 1LHFH 2ZNKH 3M61U 4NFFA 4BAMB 2NU3E 1XUGA 1DT2A 1UTLM 1Y3YA 2ODQA 3SGQE 4K3JA 1HDTH 4DCDA 2BD5A 3QUMP 3P17H 1Z71A 2SGDE 3BN9A 3RU4T 2F9VA 2YOLA 1UTPA 2AEIH 5FPTA 3E0NB 4ABFA 4U2WA 1AB9C 1T8OA 2GT8A 1ZTKA 3MMGA 1OWHA 1QR3E 1SQOA 1VCPA 2YNAA 1Z6JH 1RTFB 3PLPA 3RM0H 2CF8H 3KGPA 3GCNA 4ABAA 1N8OC 3SI4H 2BQ6B 1EKBB 4LK4A 2SGPE 1VCWA 1RD3B 1GJ8B 4NFEA 4RKOB 4I31A 3BEFB 1SFIA 1EP5A 2ZCKP 1GMCF 3BG4B 4AFZA 2EEKA 1MKWH 2RG3A 5GCHG 5LPFA 8KME2 3A7XA 1NTPA 1DWCH 3GDVA 4TY6A 1J15A 4Y0ZE 1FNIA 1HAZB 3D49H 2A31A 3GCTF 3PB1E 2BXUH 3SJIA 3BTEE 1B0FA 5ABWA 1GG6C 1QTFA 2I6SA 3A83A 1W11U 1SLWB 1GCTB 1MUEB 2Y5FA 5EXMA 4AG1A 3L33A 1P02A 2Q6GA 1P10A 3F9FA 1DUEA 1TRNA 3URDA 2FTMA 3KQCA 1PQ5A 1UCYH 2BLVA 2ZTXA 2H9TH 3QLPH 2FI5E 1ZPBA 4AG2A 1MU8B 1NPMA 3VB3A 5I46H 4K1TA 1HRTH 3CS7A 5EG4A 2XC5A 2CGAA 4NSVA 3M5NA 2A5AA 4JZDH 1DVAH 2AMDA 4CBOA 2BDBA 3CENA 3SBKA 4CRCA 4ESTE 3HK6B 1Q3XA 1RJXB 1GPZA 1CHOG 1H9IE 2ZGHA 4OS5A 1FIZA 1ZRKA 1GBTA 3ATMA 4J1YA 3UOUA 1BOQA 2SGFE 1EASA 1SGNE 2SNVA 1C9TA 1EP6A 5HM2A 2FLBH 3RXVA 1BRBE 5C5NA 3H7TA 4BAKB 1LPZB 1WCZA 2W7UA 1LPGB 4IMZA 4MDSA 4ISOA 5EOKA 1LVOA 3MU1A 3DD2H 2P8OC 1A5GH 1YPKH 1J16A 2Z9KA 4HI3A 2ZFPH 1SHYA 3NKKA 4THNH 5A09A 4GCHF 3ZZ7A 2W26A 3VFEA 3TK6A 2OBQA 5CMXH 3A89A 2QXJA 1SGCA 1D3DB 1GL0E 4B71A 3SJ9A 4TWWA 1C2DA 4KTUA 1V2TT 3EYDA 1SGFA 3EE0B 1EAWA 1MBQA 1TOMH 1UJ1A 1O2GH 4IBLH 2FXRA 1S6FA 3RMLH 2GZ7A 1THPB 2EI7A 2B9LA 2FS8A 2UWLA 1YPJH 4X2XA 1S85A 2F9OA 1Y5BT 5EXNA 5SGAE 4MPUA 4AFUA 3PTNA 2FOGA 3MH4A 4AX9H 2GTBA 3UWJH 1VR1H 5EPNA 1O2HA 1FN8A 5FPSA 4YLUA 3QZQA 1LO6A 2A2XH 2EC9H 1OWDA 1OX1A 2DUCA 4UDWH 2FX4A 5F8ZA 5AHGH 4K8YA 2BDGA 1W8BH 2ZHQH 2Z9LA 2WYGA 2ANMH 2HRVA 5I25A 1MKXH 3BG4C 3RU4E 1GHAF 2KAIB 4LZ1H 2J34A 3UNSA 4IMQA 1GBLA 1YCPH 1H9HE 3S7HB 1O35A 2STAE 1O2YA 2B8OH 3S7KB 3RXUA 1ZGIA 1DM4B 6GCHG 1BITA 3VPKA 1QQ4A 1ZTLA 1FN6A 4E7RG 1AHTH 4NCYA 2J92A 1B5GH 3T26A 2WUBA 2DE8A 2GP9B 3QGNB 1RFNA 3NUMA 1K1MA 1NM6A 5PTPA 1JRSA 1O2MA 3ZZCA 2BZ6H 2CHAB 3KQDA 4MG3A 1TNLA 4B2AA 4TY7A 3P8FA 3DA9B 2VIOA 1ELEE 3QWCH 4X6NA 3ZZBA 2QV1A 2XC0A 5FX6A 1N1LA 1NFWA 3GCHC 3BG8A 5AVDA 4SGBE 1EQ9A 1MKWK 2GKVE 4CREA 2HNTC 2Y7XA 3FAOA 8ESTE 2NWNA 4NA8A 1D6RA 1OP0A 3M5LA 1T8NA 2ZF0H 3LGUA 1FLEE 4FU8A 3U9AH 4A1TA 1T4UH 2Y82A 3TJNA 1QBNA 2DE9A 5HYOA 1EB1H 3K6ZA 2J38A 3U98H 4SGAE 1SGPE 3GOVB 4K69A 3E90B 3UR9A 2QF3A 1WV7H 1BTYA 3Q77A 2ZU3A 1JRTA 2BX4A 3PROA 1MQ5A 4Q7YA 1LKBA 3B23B 2O8MA 3A8AA 2JKHA 1TGNA 1UCYK 1GGDB 2NU1E 1ETSH 4X0WU 3BTGE 3TJOA 1PPFE 2QYIA 1EAIA 2TGTA 3SV9A 1F5KU 2ZDAH 2ZZUH 4AOQA 1BTXA 1DSUA 4Y8YA 2C4FH 1PPBH 1CA0C 1SQTA 3E91A 1TE0A 2P59A 1Y8TA 2G8TA 3M5MA 2ZDLA 3MO9A 1J9CH 1DY8A 4WVPE 4GAWA 1XX9A 2BDHA 1OPHB 1FXYA 1QL9A 1O3MA 1Q2WA 1C5VA 2FOAA 4JK6A 1BTWA 1O3IA 1ZHMA 1S0RA 3Q3KA 2BM2A 3T5FH 3SNAA 3F9GA 3LDXH 1ELFA 4GHQA 2GT7A 2ZU1A 1RRKA 1DICA 2QIQA 2UWOA 1XUFA 4GPGA 1UHBB 3MWIU 2HGTH 1ESAA 4O03A 2RA3A 3HGNA 3SU3A 1P2NA 5G4BA 2PHBA 3BV9B 1U6QA 1DDJA 2TBSA 3WY8A 4AGKA 1F5RA 2XXLA 1BJVA 3RP2A 4Y0YE 1O3NA 4FUJA 1O2XA 3FFGA 4ABDA 1ARBA 1THRH 4X1SU 1W14U 1IOEA 1BHXB 5DKMA 4XE4A 1P12E 2O8LA 1A0LA 2VWOA 3RC4A 5E2OA 1Z7KA 2XNIA 3EDXB 2VGCB 1GVZA 2QF0A 4H42U 3B9FH 1FONA 4XBCA 1XUKA 1EZQA 1CT0E 1SGRE 4NIWA 2LNCA 4AN7A 1DE7H 1BA8B 1DSTA 1HAVA 5CE1A 1ACBE 1VZQH 1EOLA 1WBGB 3RDZA 1UCYE 4NZQA 3SJKA 1W10U 2VVUA 2BMGB 4JYUH 3D65E 3A7WA 3I78A 1CA8B 1EB2A 1W7XH 1DANH 2HPPH 4A5TS 1XMNB 3ITIA 2GZ9A 2HOBA 1LPKB 1O5EH 3TH4H 1C1UH 1W3CA 2JH5D 1H1BA 4WXVA 2Y80A 2AMQA 4BXSA 1O2SA 2ZDNA 1KSNA 4WY3A 1EUFA 1G32B 1ZPZA 4ISHH 1YCPK 4X8TH 1UO6A 4X6MA 3BTTE 3K65B 4ZKOU 4FU7A 3NPSA 8GCHG 5JDUB 2VIVA 1V2ST 2PKAA 3A82A 1CT2E 4XSKU 1E35B 1MTNC 1F2SE 1DLKB 1ABJH 2GD4B 3EAJA 4HZHA 4YZUA 3A81A 2Z94A 1OWJA 2O8TA 2ZCHP 1ELTA 3UREA 4ABIA 2UWPA 3GYLB 1TGBA 2SFAA 2UUJB 3OY5U 1TPPA 3LH3A 3PLBA 1QHRB 5A0CA 1GMDF 2ZHDA 3V12A 1GGDC 4DIHH 1ELDE 3H7OA 1GJCB 1TA6A 3MFJA 5DK1A 1AFQB 2AGEX 2ZCLP 1A5HA 1G2MA 1O2PA 1OP2A 7GCHF 2GZ8A 3BTWE 1AKSB 1QL8A 1A46H 3MNBA 5EQRA 4OGXA 1TNGA 1UTNA 1WQSA 2Y7ZA 1P05A 5E0HA 1IQLA 1JWTA 1NY22 1WOFA 1HAXB 2OINA 3VGCC 5HGGA 3QX5H 3URCA 2PV9B 4WMFA 4U01A 2SNWA 1TIOA 1TONA 1IQGA 2P3FH 2OCVB 3MNCA 4H4FA 4AFQA 2G55A 1TGCA 1YGCH 5AFYH 2WPIS 1P2OA 3LGIA 5DGJA 2CV3A 5GIBA 2WUCA 1MZDA 5LPRA 4X1QU 5T6DA 1GI5A 4YM9A 3RM2H 2NU4E 2XC4A 3P8OA 2FP7B 4BNRA 1YLCA 1ESBA 1IHSH 2AERH 5F8TA 1SSXA 3UPEA 3V3MA 2AH4X 3RXHA 4I8KA 2ZFRH 1TBQH 2D2DA 1C5NH 2FDAA 2ZQ1A 3AASA 2D8WA 3BTKE 5L2YH 4JZEH 2ZO3H 2FEQH 2C8YB 1RIWB 1KLIH 3ZV8A 2GV7A 4B76A 3RC6A 7KMEH 2VGCC 1H4WA 1QB6A 1EJNA 1ESTA 1QFKH 4INKA 2P16A 2Z9IA 5FX5A 1DLEA 3E3TA 3S9BA 2V0BA 1TPOA 4NZLA 1K22H 1NC6A 1ZZZA 1P09A 5LPEA 1DY9A 1O3HA 3QO6A 1BB0B 4TYDA 3VB7A 1XUIA 1IQFA 4NA9H 1O2WA 3RXGA 2FZZA 1TRMA 2Q6DA 1GJ9B 1O2LA 5EODA 2SGAA 3IITA 2B0FA 2BY5X 1QY6A 2ZGCA 1Y3XA 5E0JA 4VGCB 1AUTC 2WV4A 2OC8A 4Y10E 4YOIA 2OC7A 4OS1A 3HGPA 1TNJA 1UK4A 2EI6A 1C5QA 5C3NA 4FUCA 1XXDA 1YKTA 1BJUA 2PSXA 1G30B 3M35A 3P95A 1DWEH 4BTUB 1WTGH 3S9CA 3MO3A 2FO9A 1ETTH 1F0UA 1G3CA 4YESB 1GI8B 1HAIH 4B2BA 4ZKRU 5C1XA 4MNXA 5IDKA 1C2MA 1SBWA 1Z6EA 3GY2A 1GHBG 5DP6A 1QJ6B 4X8SH 4KKDA 5LH8A 5HM9A 2JETC 3LGVA 3OU0A 2ZFFH 2PFEA 3MI4A 4I8GA 1P9UA 4OGYA 4E05H 1YYY1 1V2VT 4JZFH 1K21H 2BY9X 2GCTB 2NU0E 3F68H 3SV8A 2WV5A 2Z3DA 4ZKSU 3UUZA 1P8VC 4FUBA 2FOBA 1BTUA 1XM1A 1UVTH 3LH1A 1ETRH 2FTLE 3U69H 1TGSZ 2QXGA 1TMTH 4ABBA 3SU4A 2AIPA 1O2JA 2ZGBH 5C5OA 4ZH8A 3GISB 1VITG 3ZVCA 3EA7A 3SW2B 3RXPA 1O36A 1KY9A 4Q80A 1ZHRA 2P93A 4A6LA 4JCNA 1XKBC 3ZZAA 3KHVA 2THFB 2CN0H 2TPIZ 2D1JA 4CBNA 2PTCE 3ZVFA 2GCHG 1A61H 1SOZA 1TRYA 1NRQH 5FPYA 1L1GA 1INCA 3KCGH 1ELBA 1V2NT 4CR5A 5CHAB 1AUJA 1W2KH 1BHXF 4FVDA 1V6DA 1MTWA 1DWDH 1XVOA 2TIOA 1C1NA 2ZWLH 1ZPCA 1HPGA 2CXVA 1E0FD 2C8XB 4MNVA 1TBZH 2IN2A 2F83A 1VGCB 4FUFA 3RXQA 3BSQA 2H1UA 1O2ZA 1TMUH 1C5LH 3TIUA 3VB5A 3UIRA 3IG6B 2FMJA 4WMDA 1EPTA 2VIWA 5JB9S 5TCCA 1D4PB 1K1PA 3FVFB 4WH6A 1SGDE 1Z1IA 3CP7A 2P3UB 2UUKB 5E8EH 2XCNA 2H5CA 1K1OA 1C1MA 5ESTE 3TJVA 4LOYH 5DP3A 1ZYOA 1O3EA 3EGKH 1TX7A 2XBVA 3ATLA 1V2OT 1BMLA 1BRCE 4DIIH 2H9EH 3LPRA 3RMNH 1NFYA 4UFDH 3V7TA 1L0ZA 1OYTH 1SLUB 1YPHC 3FZZA 4JMYA 1JOUB 2R9PA 1P2IA 1ANEA 3SGBE 1UTJA 1ANDA 1C5WB 3VEQB 1C5PA 5EQSA 3TNTA 4X8VH 1SL3A 3VXFH 3FP8E 1P2MA 1PQ8A 4DY7B 1HXFH 2GMTC 4Y8ZA 3SI3H 4I33A 1CGJE 3K6YA 3SZNA 1MCTA 1W13U 5DP8A 4MVNA 3SJOA 2BDAA 2ZFQH 1E37B 3TGKE 1T4VH 1OKXA 3LGWA 3MH5A 1GBJA 5LGOA 3VXEH 4ZXYH 1SI5H 2A5KA 2ASUB 1TAWA 1O5BB 4A1VA 3MYWA 4NIYA 2SGEE 4Q7ZA 1GMCG 5DG6A 1JMOH 1L1NA 3L3TA 3PMJA 3Q76A 1KDQA 1ZLRA 2BY7X 1B0EA 1SMFE 2PTNA 1MTSA 3AW0A 3M3TA 1D6WA 1GBFA 3GCTG 2PW8H 3ATWA 2TGPZ 1UTQA 1PPZA 2D26C 4XOJA 4FUEA 2ZKSA 1PPGE 1KYNA 1Z8GA 2Y6TA 3BTQE 1SGYE 3KNXA 3TK9A 1JXPA 2BOKA 4X1NU 2YNBA 4INLA 4UFGH 4ISNA 2ZTZA 2BDYA 1TMBH 2ZHFH 1GI1A 2FWWA 1HGTH 1K9OE 1RTKA 4Y76A 2FOEA 3QGJA 4UEHH 3M36A 1BMAA 3RXRA 1EXFA 1O2OA 4MQAA 2TGDA 1V2PT 3SU6A 4O3UA 3GCOA 2RCEA 4WMEA 4Y11E 4DT7B 4BANB 4Y79A 2QA9E 1LHGH 1WSSH 4X6PA 4B2CA 1O31A 3RXJA 5C67A 3UWIA 3T25A 5J4SA 1Y5UT 1C5OH 2R3UA 3PWBA 3MH6A 1W12U 1NESE 2V3OH 1QA0A 3S9AA 1DFPA 3ZVGA 1ANCA 1GCTC 3GY7A 1RS0A 2ZU2A 1DPOA 2IOTA 3S0NA 1LVBA 1SC8U 1DOJA 4BTIB 1TA2A 2XWBI 1ZMNA 2STBE 1PFXC 4INHA 5DJ7A 3SUEA 5IYTA 3SV7A 3O8RA 1O2QA 4I8LA 3A8CA 3RXEA 1QB1A 1GI0A 3D62A 2A4GA 1NRSH 4GCHG 1V2JT 1XUJA 1EJAA 4FUHA 5FHTA 4I8JA 5C1UA 4R8TB 1S81A 1L4ZA 3UNRA 1A0JA 3A7TA 6CHAB 2AIQA 3T28A 2XW9A 4A7IB 1S82A 3GY3A 4XBBA 1O2NA 2VB0A 1FQ3A 1Y59T 3W95A 4BTTB 1HIAA 2HALA 1AO5A 1BTHH 1UVPA 1QNJA 1ZRBA 3GY5A 1SB1H 2HWLB 3RXOA 1KXFA 4WF8A 4WH8A 4YOGA 2PKSB 2VIDA 1O2IA 2G5NA 5F6MA 4Y7BA 5E0GA 7ESTE 1BMNH 1K28D 1FZZA 3TJUA 1D9IA 3M7UA 4B74A 2JH0D 1HXEH 2PR3A 1TQ0B 5F8XA 3HK3B 3AW1A 4X2WA 4ZKNU 1C2KA 1GJ4H 3RXAA 2GDEH 1PPHE 1O5FH 1GBIA 2O8UA 1QL7A 1KXAA 2ZHWH 1Z8RA 1QRZA 2VH0A 3ATKA 1GVKB 2G81E 2Z7FE 2AGGX 4X6OA 2J95A 1G36A 1GL1A 2VU8E 4K5ZA 1GHAG 3PM3A 2PUXB 1OXGA 4CRBA 2Y81A 5JBTA 2A4RA 3JZ2B 2ZPSA 3MNSA 3A85A 1HJAB 1NFXA 3AAUA 2XCFA 4NG9H 1ELAA 1BBRH 4ISIH 5DPAA 1EAUA 3RXCA 5EW2H 2ULLA 5T3HA 5ESBA 3EA9A 4IGDA 5A8YA 3O8BA 5A0BA 4R0IA 1TFXA 2FI3E 4KTCA 1BIOA 1AN1E 1UVOA 3G01A 1O3DA 2PSYA 5EPYA 3OY6U 2AGIX 3ZZ5A 1YLDA 2GVFA 2ZTYA 4ZUHA 2ZFSA 4WWYA 6LPRA 1P57B 1CGHA 2VWLA 1O3GA 1G3DA 3LOXA 3F9EA 1A5IA 4ISLA 4O9VA 1NU9A 1GMHF 2F9UA 1C1OA 2ZA5A 2A45B 2ODPA 9LPRA 1C5YB 4D8NA 1HAYB 1HNEE 3PYHA 5JBCS 2FOHA 2VIPA 2ZDKA 3Q3YA 4QT8C 2HNTE 1LHEH 1DX5M 1J14A 4K1EA 4CH8B 1CBWB 1P06A 4Q7XA 2ZIQH 4HGCA 2A7CA 2WPMS 4YT6H 1BQYA 4NSYA 7LPRA 3A7ZA 3M3VA 1GJAB 1QCPA 5FXLA 2QGRA 4GUXA 1BMMH 4J2YB 1SHHB 2R2MB 1C2GA 2CHAC 3PMHB 1A3EH 1SG8B 3FANA 1IQJA 4IC6A 2Y5HA 2BXTH 4HFPB 3U8OH 1AQ7A 1MKXK 3SHCH 1FMGA 2OLGA 4XBDA 1CO7E 2EI8A 9ESTA 3E0PB 2OUAA 1L1JA 2BD3A 3F1SB 1QB9A 1O2TA 3NCLA 2W3KA 3ELAH 3N7OA 2A4OA 1D3QB 1P9SA 1QGFA 2ZEBA 2VJ1A 3ZVBA 2SGQE 3ZV9A 2OXSA 1C1TA 1RXPA 1TOCB 2BY8X 3GICB 4XDEA 1CT4E 3BIVH 3LC3A 1HAVB 2FI4E 1GI2A 3ODFA 5BPEA 4DOQA 4Y6DA 2XRCA 2GX4A 1GJDB 1P3CA 1FY4A 1GCDA 3ZVDA 1P0SH 3UNQA 5JB8S 1C2EA 3SQHE 3FP7E 4U30A 4UFEH 3SV6A 4FU9A 1C9PA 1HYLA 2P94A 3CS0A 1QURH 3LGTA 1GHXH 1MAYA 4JZ1A 1XXFA 3SN8A 1HFDA 1SGQE 1AB9B 4AB8A 3A8BA 1CGIE 1NFUA 2W7SA 3A86A 2C8ZB 2OC0A 2O8WA 4I32A 4ZXXH 2PKAB 1N8OB 1LKAA 3EA8A 3KN2A 4UONA 5L6NH 5DP5A 3GY8A 1TGTA 3DFLA 4MNYA 1F0RA 4FUIA 1YPEH 4OS6A 4B73A 1FV9A 1Y3VA 1NO9H 8LPRA 2PLXA 1V2RT 3L6PA 1CU1A 1M9UA 1O3KA 3BIUH 2XBYA 3I77A 1O3CA 3R3GB 4AORA 1O37A 2ZPRA 1C1PA 4HTCH 5JBAS 3T2NA 1GBDA 1V2LT 1GJ7B 1JBUH 2P3TB 1O5AB 5DP4A 4BAHB 2QC2A 1FJSA 4GLYA 5A0AE 1C5RA 4OS7A 4D9RA 2BLOA 1GI4A 3UY9A 5JPMH 2Z6BD 1IAUA 1NU7B
chains in the Genus database with same CATH superfamily
1DITH 2PGQB 4E7NA 4I7YH 4ABJA 2KFWA 3I29A 4K60A 3TITA 1HJ9A 3SYJA 3PV4A 1BBRK 3HKJB 5EW1H 5FBEA 1IQKA 2CMYA 4U32A 4YT7H 2OD3B 1C2JA 3VB4A 1H8DH 2BD7A 1BRAA 1C2IA 2BY6X 3HPTB 1Y3UA 2F91A 1PYTC 1TBRH 3OTPA 3N99A 2BTCE 1D3TB 5H4IB 1OWEA 1O2RA 2WINI 3ZVEA 5K7RA 2QY0B 1K1IA 5GCHF 5GWZA 3U1JB 3KQBA 2HLCA 1GMDG 1FAKH 5C2ZA 3RXLA 1FY8E 1GI9B 2WYJA 1F0SA 4DGJA 2F9BH 3QN7A 4OS2A 1FIWA 1H9LB 2Z3CA 4JZIA 1GDNA 3A80A 4CHAB 1F7ZA 1FAXA 7GCHG 1TABE 2H2ZA 1C5TA 2XWAA 2VWNA 1MAXA 4GHTA 5L30H 1TPSA 2G51A 5DP7A 4ZHLU 2ANWA 3ZZ3A 5CHBA 1T8MA 4Q63A 1XKAC 1GHZA 2ZPQA 1N6YA 4FETA 5T6FA 3MU8A 1GI3A 2WPKS 5EQQA 4E06H 3ESTA 5HIYA 1SFQB 1YLNA 2R3YA 2P8OB 1J17T 1C2LA 3M7TA 4RSPA 5AFZH 1QQUA 3SNDA 1AVGH 2Y5GA 3M5OA 1T8LA 2ZDMA 3RMMH 3PWCA 2ZDVH 3SU0A 2JH6D 2QF5A 1AE8H 1DXPA 1OSSA 2BVSH 1SOTA 3DCLA 2M5TA 1PPEE 2FODA 1C1RA 3DFJA 4IN1A 5FCKA 1HB0B 1SGFG 3P70B 1ABIH 3NZIA 1WU1A 2B5TB 1OP8A 1O30A 1SGIB 1CHOF 1TX6A 1S5SA 1E38B 1AFQC 1O5GH 2WSSD 3GY6A 3F2GA 4UE7H 4GVUA 2CJIA 1O3BA 4YTAA 2EA3A 1FPCH 3TH3H 3KF2A 4D7GA 2BYAX 1THSH 1YPLH 1QZ8A 1GBKA 3M3SA 4NA7A 1BBRE 2PWXA 3IWMA 1D3PB 4MPVA 4NIXA 3RLYH 5J4QA 2BB4A 2IPHA 5B6OA 4FXGH 1P2QA 1GDQA 2F43B 2H9HA 1MBMA 1BTZA 4X1RU 3LT3A 2GDDA 2BHGA 2ALVA 2FS9A 1P2JA 4BXWA 2LELA 4ABEA 2ANYA 1B7XB 2AYWA 1P04A 2WPJS 5DO4H 5AF9H 2J4IA 4M7GA 5JBBS 4XFQA 2BX3A 3BEIB 1IQMA 1ANBA 1YP9A 4BAQB 3QTVH 5EXLA 2J2UA 4FUDA 3SHAH 3V13A 1ZOMA 1NZQH 1OWKA 1WTHD 1HAPH 1O3LA 2OP9A 2QXIA 3JZ1B 3K2UA 2BD4A 2PGBB 3WW7A 2FOFA 1QIXB 3KYFA 2A1DB 3DSGA 1GHVH 2ESTE 4NWKA 2ZFTA 5JYIA 2UUFB 2FYQA 2V35A 1MTVA 1RIWC 1O34A 1QRXA 3C27B 1V2WT 1TB6H 1EZXC 1Q31A 1TX8A 3KEEA 4A1XA 1KTTB 4X2YA 2I6QA 2Z3EA 5F03A 1GJBB 1MH0A 1Y3WA 1ZJKA 4UD9H 1Z8IB 2RFKC 1C2HA 1BT7A 3E1XB 3PV2A 1KXBA 1KIGH 5C0TA 2BLQA 3OX7U 3GDUA 4AYYB 1LHDH 1KMHB 3GCHB 1UVSH 3FP6E 2A5IA 2ILNA 5DN6D 3ZIAD 1EATA 3MU0A 4F4OC 1C5XB 1RGQA 3SOSA 1ZSKA 2XYAA 2Q6FA 4IN2A 2TRMA 1QJ7B 5FBIA 3STIA 1MZAA 1SGEE 3M7QA 1E34B 1P11E 1ZSLA 1A3BH 4CRFA 4VGCC 3BTHE 3TVJB 2PUQH 3SUDA 5GXPA 3QTOH 2RDLA 3RXBA 3SU1A 6GCHF 4CHAC 4CRAA 1K1JA 3SNCA 1C1QA 1G2LA 1PPCE 3ZYDA 1EPTB 2IJOB 1P01A 1O3PB 3NWUA 1TNKA 4DG4A 3RC5A 2FPZA 3MO6A 3SORA 1TNHA 3RMOH 3A7YA 3P8GA 1NROH 1XUHA 2XBWA 3OAAD 2FX6A 3SNBA 1YCPM 4ABGA 2A2QH 2ZU5A 1FY1A 4FUGA 4CRGA 1HLTH 3RUOA 3EE7A 2C90B 2J98A 2QAAA 3LC5A 1HJ8A 1MU6B 4DVAU 2VNTA 4AGJA 1FY3A 1V2QT 2G5VA 2R0KA 3OTJE 2KAIA 2GCTC 1QJ1B 1MTUA 3UFAA 1CA0B 4CH2B 1A1RA 4JYVH 4GSOA 2ZHEH 3MNXA 1HAHH 3F6UH 2VINA 3OEED 5KECA 3S69A 3ZZDA 1AMHA 1OOKB 1P3EA 3AVZA 4H6TA 2BLWA 5C1YA 3K9XB 4NIVA 5ETXA 1GI7B 1AWHB 4ABHA 5E2PA 1BDAA 1CE5A 4MLFB 3GY4A 2HPQH 1HV7A 4B1TA 5CDFE 1OS8A 1KXCA 4D9QA 5DP9A 4O97A 2FOMB 1A2CH 1C5ZB 1FDPA 1VITH 1NRRH 1SQRA 2LP6A 2P95A 1QRWA 3PO1B 3UTUH 1V2UT 3SQEE 3D23A 5CHAC 1VJ9U 3F9HA 3HKIB 1ZSJA 4X1PU 3T27A 1KDQB 2J94A 1IQNA 2W3IA 3ZZ8A 1PJPA 1ARCA 4Q2KA 3UAIC 2A7HA 5C0UA 1ELCA 2VBCA 1NT1A 4ZMAH 3QZRA 1VGCC 2YMSB 4TWYA 5BRRE 1UMAH 1YPHE 1NBME 2G4TA 2XOKD 2ZP0H 5A2MH 1FPHH 3LU9B 1O0DH 3MHWU 2W6JD 4K2YA 1P2KA 1G3BA 2BD2A 1C5UA 1UTKA 1ZGVA 4A92A 1SPJA 4ZAEA 5EJZA 1O2UA 2ZGJA 1C4U2 1TPAE 1S83A 3KL6A 1O32A 3LJOA 5K0HA 2A32A 1IQHA 3FN8A 4OM9A 2OQ5A 3P8NA 1BUIA 2ZU4A 2K1QA 1CQQA 3ODDA 4CR9A 2BDIA 1UK3A 1TQ7B 1YPMH 2FLRH 3DUXH 2VH6A 1QBOA 3BEUA 1RTLA 3PV5A 2GGVB 4KGAA 1LVYA 1AD8H 2G52A 3LONA 3A84A 2H5DA 3QK1A 2VVVA 1SVPA 1HCGA 3A7VA 3OSYA 3TK5A 4IW4E 4D76A 1O3OA 1WQVH 3SZEA 1WDIA 3VG8A 2F9PA 3TGJE 2VWMA 4ZCNA 4OS4A 1HUTH 2ANKH 3B8JA 2KX4A 3UQOA 2QCYA 2BQWB 2TGAA 4BOHA 3PRBA 1YPGH 1MTNB 1K1NA 1EPTC 2F9NA 2HVXA 5GPIB 3U8TH 5HMAA 2F3CE 4Y71A 2ZC9H 1ZMLA 1GBAA 4F49A 4K1SA 1C1WH 4DJZB 1AIXH 1UHBA 3RXTA 1LMWB 1AY6H 3O8CA 2Q1JA 1ZHPA 1SGTA 3ZZ6A 1O5DH 3SV2H 3BTFE 2G00A 4IC5A 4JYTA 1F92A 2AS9A 1KLJH 1EX3A 1K2I1 2VVCA 1HIAB 3LIWA 1ELGA 2C93B 2NU2E 2G4UA 5TCAA 1GBHA 1GBBA 5HXFA 1EAXA 3EQ0H 1N6XA 8GCHF 5A8XA 1TWXB 1MABB 3OYPA 1BRUP 5FCRA 4TPIZ 1KXDA 5T6GA 6ESTA 3VGCB 1F5LA 1EJMA 1AI8H 1FUJA 1GWAA 2BVXH 3NXPA 2J5UA 3BF6H 1W0ZU 2FIRH 1GBCA 5C20A 1PYTD 2BOHB 1LTOA 3PMAB 1Z1JA 2FM2A 3MU4A 3LJJA 1O2VA 2K8IA 3F0OA 3SJ8A 3KIDU 3ZVAA 4X8UH 2OQUA 1G37A 3RXIA 3ATIA 1EOJA 3A87A 1IQEA 1GHWH 2VIQA 3BTME 2CF9H 3FZDA 4Y8XA 1O33A 4Y7AA 3PO1C 4D7FA 4KELA 1FI8A 1E1RD 2V3HH 2A7JA 4B75A 4BAOB 3TLOA 4ZROA 2ZQ2A 5C17A 1CVWH 2A4QA 1O38A 2KCOA 1S84A 1WYKA 1YC0A 2FYRA 2AFQB 3SU5A 1K1LA 2J9NA 2ZECA 3VB6A 4MNWA 1IQIA 3RXDA 3AAVA 4TPYA 1LCYA 4LZ4B 3ZZ9A 1NS3A 1GJ5H 1YBWA 3KQ5A 1YY3A 1C5MD 1GBEA 5EU8A 1J8AA 1AFEH 1SQAA 1S0QA 3E16B 3RLWH 2Z9GA 1P03A 1CSOE 2WPHS 2BDCA 5KGOA 2W5EA 4KP0A 3T29A 4ZHAA 1WAYB 3RXFA 2A0QB 1O3FA 4AB9A 2HNTF 3H5CB 1C2FA 3LGYA 2BZAA 1ZR0A 4JK5A 2ZG0H 1OYQA 1C1VH 1TNIA 1FY5A 6CHAC 1VCQA 4NGAH 1SR5C 1AWFH 1G3EA 2XBXA 4YLQH 5A8ZA 3GYMA 4ASHA 1C4V2 2JJ2D 4AFSA 4IS5A 1HAOH 2B7DH 1VJAU 1AKSA 1LHCH 1LDTT 2ZGXH 4I8HA 1MQ6A 3OE7D 3PTBA 5GDSH 3C1KA 2PKSC 1EZUC 1DUAA 1YF4A 1ZJDA 1LVMA 1A4WH 2Z9JA 1O3JA 4H6SB 1DXWA 3SNEA 3ZZ4A 1SLVB 2FOCA 3UOPA 1UTOA 4AZ2B 2XTTB 1MCVA 3A88A 1AVWA 2WHXA 3A8DA 1X7AC 1LQEA 4ZHMU 3NK8A 2OC1A 1G9IE 3Q3XA 1BCUH 1T31A 3U8RH 1GI6A 1S6HA 2JETB 4Z0KA 2BD9A 3P92A 1KLTA 3QDZB 3SGAE 3KQEA 1TYNA 3RXSA 2QN5T 1V3XA 1Y5AT 1MD8A 3MOCA 1YM0A 3PLKA 1W7GH 3DSOA 1BTPA 1C4Y2 1UK2A 1GMHG 3P6ZB 5EJ1A 1JIRA 1V2MT 3TPIZ 1ID5H 1S6LA 1MMJN 1HJAC 2BD8A 4UFFH 1ELVA 1JIMA 3SUGA 1T32A 1QA7A 2R0LA 3V0XA 1QBVH 1AGJA 3LKWA 4MPXA 4DURA 2C3SA 3TH2H 1AE5A 1UVUH 1T7CA 4WXIA 1DS2E 1XVMA 2BQ7B 1GHYH 1ZMJA 2OTVA 3ENSB 3RU4D 1MD7A 3SU2A 1GBMA 3E6PH 4LXBH 4KTSA 3PMBB 2BVRH 4RKJB 4FVBA 1L2EA 1GHBF 2OBOA 3UR6A 1SLXB 1C5SA 4O3TA 1TLDA 2GV6A 3STJA 3MTYA 4WJG2 1PQAA 1DWBH 1L4DA 1NRPH 2V6NA 4K8BA 1CHGA 3TU7H 3WWFA 3TNSA 1GG6B 1GDUA 1HBTH 3UQVA 3MH7A 1GJ6A 2ODYB 1IHTH 1KTSB 1GVLA 3DT0H 2H6MA 1AVXA 3W94A 1TALA 2WPDD 2C8WB 3O8DA 1UTMA 1CBWC 3RXKA 1VITF 2WPLS 4Z6AH 2UUYA 3GDSA 4CRDA 1KXEA 1O3AA 1NRNH 5HIZA 5EGMA 1V2KT 5FAHA 4B6EA 1ZTJA 4NWLA 1NN6A 1PQ7A 2GCHF 4X2VA 1E36B 4AYVB 4PROA 1OWIA 3M37A 3Q00A 3SO3A 4YOJA 5GJ4B 3BTDE 3TGIE 1W0YH 2ZI2H 3R0FA 3RXMA 1HAGE 4TT3D 1LQDB 2AMPA 5F53A 2ALPA 3DHKH 1Z8JB 1O5CB 1O2KA 5TJXA 2R2WU 4RN6A 1A0HB 2FESH 2GMTB 3HATH 2HLDD 3MU5A 1A7SA 4DW2U 3U1IB 5L2ZH 2LPRA 3T62A 1EZSC 1H8IH 2QXHA 2O9QA 1BZXE 1O39A 1F0TA 4B6FA 3ZYEA 4TSFD 1WUNH 1AZ8A 2RA0A 4MPWA 4YO9A 3SUFA 1ORFA 1AZZA 3E8LA 1C1SA 1AU8A 2KCYA 4MTBA 1LHFH 2ZNKH 3M61U 4NFFA 4BAMB 2NU3E 1XUGA 1DT2A 1UTLM 1Y3YA 2ODQA 3SGQE 4K3JA 1HDTH 4DCDA 2BD5A 3QUMP 3P17H 1Z71A 2SGDE 3BN9A 3RU4T 5B6LA 2F9VA 2YOLA 1UTPA 2AEIH 5FPTA 3E0NB 3FO8D 4ABFA 4U2WA 1AB9C 1T8OA 2GT8A 1ZTKA 3MMGA 1OWHA 1QR3E 1SQOA 1VCPA 2YNAA 1Z6JH 1RTFB 3PLPA 3RM0H 2CF8H 3KGPA 3GCNA 4ABAA 1N8OC 3SI4H 2BQ6B 1EKBB 4LK4A 2SGPE 1VCWA 1RD3B 4DT4A 1GJ8B 4NFEA 4RKOB 4I31A 3BEFB 1SFIA 1EP5A 2ZCKP 1GMCF 3BG4B 4RI0A 4AFZA 2EEKA 1MKWH 2RG3A 5GCHG 5LPFA 8KME2 3A7XA 1NTPA 1DWCH 3GDVA 4TY6A 1J15A 4Y0ZE 1FNIA 1HAZB 3D49H 2A31A 3GCTF 3PB1E 2BXUH 3SJIA 3BTEE 1B0FA 5ABWA 1GG6C 4YXWD 1QTFA 2I6SA 3A83A 1W11U 5HKKD 1SLWB 1GCTB 1MUEB 2Y5FA 5EXMA 4AG1A 3L33A 1H8ED 1P02A 2Q6GA 1P10A 3F9FA 1DUEA 1TRNA 3URDA 2FTMA 3KQCA 1PQ5A 1UCYH 2BLVA 2ZTXA 2H9TH 3QLPH 2FI5E 1ZPBA 4AG2A 1MU8B 1NPMA 3VB3A 5I46H 4K1TA 1HRTH 3CS7A 5EG4A 2XC5A 2CGAA 4NSVA 3M5NA 2A5AA 4JZDH 1DVAH 2AMDA 4CBOA 2BDBA 3CENA 3SBKA 4CRCA 4ESTE 3HK6B 1Q3XA 1RJXB 4Q4LA 1GPZA 1CHOG 1H9IE 2ZGHA 4OS5A 1FIZA 1ZRKA 1GBTA 3ATMA 4J1YA 1E79D 2KZ4A 3UOUA 1BOQA 1W0JD 2SGFE 1EASA 1SGNE 2SNVA 1C9TA 1EP6A 5HM2A 2FLBH 2EQNA 1BRBE 3RXVA 5C5NA 3H7TA 4BAKB 1LPZB 1WCZA 2W7UA 1LPGB 4IMZA 4MDSA 4ISOA 5EOKA 1LVOA 3MU1A 3DD2H 2P8OC 1A5GH 1YPKH 1J16A 2Z9KA 4HI3A 2ZFPH 1SHYA 3NKKA 4THNH 5A09A 4GCHF 3ZZ7A 2W26A 3VFEA 3TK6A 2OBQA 5CMXH 3A89A 2QXJA 3OEHD 1SGCA 1D3DB 1GL0E 2KCPA 4B71A 3SJ9A 4TWWA 1C2DA 4KTUA 1V2TT 3EYDA 1SGFA 3EE0B 1EAWA 1MBQA 1TOMH 1UJ1A 1O2GH 4IBLH 2FXRA 1S6FA 3RMLH 2GZ7A 1THPB 2FS8A 2B9LA 2EI7A 2JJ1D 2UWLA 1YPJH 4X2XA 1S85A 2F9OA 1Y5BT 5EXNA 5SGAE 2WV9A 4MPUA 4AFUA 3PTNA 2KCAA 2FOGA 3MH4A 4AX9H 2GTBA 3UWJH 1VR1H 5EPNA 4Z1MD 1O2HA 1FN8A 5FPSA 4YLUA 3QZQA 1LO6A 2A2XH 2EC9H 1OWDA 1OX1A 2DUCA 4UDWH 2FX4A 5F8ZA 5AHGH 4K8YA 2BDGA 2HVYB 1W8BH 2ZHQH 2J98B 2Z9LA 2WYGA 2ANMH 2HRVA 5I25A 1MKXH 3BG4C 3RU4E 1GHAF 2KAIB 4LZ1H 2J34A 3UNSA 4IMQA 1GBLA 1YCPH 1H9HE 3S7HB 1O35A 2STAE 1O2YA 2B8OH 3S7KB 3RXUA 1ZGIA 1DM4B 6GCHG 1BITA 3VPKA 1QQ4A 1ZTLA 1FN6A 4E7RG 1AHTH 4F48B 4NCYA 2J92A 1B5GH 2OK5A 3T26A 2WUBA 2DE8A 2GP9B 3QGNB 1RFNA 3NUMA 1K1MA 1NM6A 5PTPA 1JRSA 1O2MA 3ZZCA 2BZ6H 2CHAB 3KQDA 5IK2D 4MG3A 1TNLA 4B2AA 4TY7A 3P8FA 3DA9B 4P00A 2VIOA 1ELEE 3QWCH 4X6NA 3ZZBA 2QV1A 2XC0A 5FX6A 1N1LA 1NFWA 3GCHC 3BG8A 5AVDA 4SGBE 1EQ9A 1MKWK 2GKVE 4CREA 2HNTC 2Y7XA 3FAOA 8ESTE 2NWNA 4NA8A 1D6RA 1OP0A 3M5LA 1T8NA 2ZF0H 3LGUA 1FLEE 4FU8A 3U9AH 4A1TA 1T4UH 3CNRA 2Y82A 3TJNA 1QBNA 2DE9A 5HYOA 1EB1H 3K6ZA 2J38A 3U98H 4SGAE 1SGPE 3GOVB 4K69A 3E90B 3UR9A 2QF3A 1WV7H 1BTYA 3Q77A 2ZU3A 1JRTA 2BX4A 3PROA 1MQ5A 4Q7YA 1LKBA 3B23B 2O8MA 3A8AA 2JKHA 1TGNA 1UCYK 1GGDB 2NU1E 1ETSH 3N7EA 4X0WU 3BTGE 3TJOA 1PPFE 2QYIA 1EAIA 2TGTA 3SV9A 1F5KU 2ZDAH 2ZZUH 4AOQA 5FL7D 1BTXA 1DSUA 4Y8YA 2C4FH 1PPBH 1CA0C 2JIZD 1SQTA 2F4LA 3E91A 5EIYA 1TE0A 2P59A 1Y8TA 2G8TA 3M5MA 3PRDA 2ZDLA 3MO9A 1J9CH 1DY8A 4WVPE 4GAWA 1XX9A 2BDHA 1OPHB 1FXYA 1QL9A 1O3MA 1Q2WA 1C5VA 2FOAA 4JK6A 4XD7D 1BTWA 1O3IA 1ZHMA 1S0RA 3Q3KA 2BM2A 3T5FH 3SNAA 3F9GA 3LDXH 1ELFA 4GHQA 2GT7A 2ZU1A 1RRKA 1DICA 2QIQA 2UWOA 1XUFA 4GPGA 1UHBB 3MWIU 2HGTH 1ESAA 4O03A 2RA3A 3HGNA 3SU3A 1P2NA 5G4BA 2PHBA 3BV9B 1U6QA 1DDJA 2TBSA 3WY8A 4AGKA 1F5RA 2XXLA 1BJVA 3KYGA 3RP2A 4Y0YE 1O3NA 4FUJA 1O2XA 3FFGA 4ABDA 1ARBA 1THRH 4X1SU 1W14U 5KEDA 1IOEA 1BHXB 5DKMA 2YMSC 4XE4A 1P12E 2O8LA 1A0LA 2VWOA 3RC4A 5E2OA 1Z7KA 2XNIA 3EDXB 2VGCB 1GVZA 2QF0A 4H42U 3B9FH 1FONA 4XBCA 1XUKA 2QE7D 1EZQA 1CT0E 1SGRE 4NIWA 2LNCA 4AN7A 1DE7H 1BA8B 1DSTA 1HAVA 5CE1A 1ACBE 1VZQH 1EOLA 1WBGB 3RDZA 1UCYE 1UW7A 4NZQA 3SJKA 1W10U 2VVUA 2BMGB 4JYUH 3AK5A 3D65E 3A7WA 3I78A 1CA8B 1EB2A 1W7XH 1DANH 2HPPH 4A5TS 3F2HA 1XMNB 3ITIA 2GZ9A 2HOBA 1LPKB 1O5EH 3TH4H 1C1UH 1W3CA 2JH5D 1H1BA 2J97A 4WXVA 2Y80A 2AMQA 4BXSA 1O2SA 2ZDNA 1KSNA 4WY3A 1EUFA 1G32B 1ZPZA 4ISHH 1YCPK 4X8TH 1UO6A 4X6MA 3BTTE 3K65B 4ZKOU 4FU7A 3GS9A 3NPSA 8GCHG 5JDUB 2CK3D 2VIVA 1V2ST 2PKAA 3A82A 1CT2E 4XSKU 1E35B 4P02A 1MTNC 1F2SE 1DLKB 1ABJH 2GD4B 3EAJA 4HZHA 4YZUA 3A81A 2Z94A 1OWJA 2O8TA 2ZCHP 5DSFA 1ELTA 3UREA 4ABIA 2UWPA 3GYLB 1TGBA 2SFAA 2UUJB 3OY5U 1TPPA 3LH3A 3PLBA 1QHRB 5A0CA 1GMDF 2ZHDA 3V12A 1E1QD 1GGDC 4DIHH 5GNDA 1ELDE 3H7OA 1GJCB 1TA6A 3MFJA 5DK1A 1AFQB 2AGEX 2ZCLP 1A5HA 1G2MA 1O2PA 1OP2A 7GCHF 2GZ8A 3BTWE 4RT0A 1AKSB 1QL8A 1A46H 3MNBA 5EQRA 4OGXA 1TNGA 1UTNA 1WQSA 2Y7ZA 1P05A 5E0HA 1IQLA 1JWTA 1NY22 1WOFA 1HAXB 2OINA 4HG6A 3VGCC 3H09A 5HGGA 3QX5H 3URCA 2PV9B 4WMFA 4U01A 2SNWA 1K0HA 1TIOA 1TONA 1IQGA 2P3FH 2OCVB 3MNCA 4H4FA 4AFQA 2G55A 1TGCA 1YGCH 5AFYH 2WPIS 1P2OA 3LGIA 5DGJA 2CV3A 5GIBA 2WUCA 1MZDA 5LPRA 4X1QU 5T6DA 1GI5A 4YM9A 3F3BA 3RM2H 2NU4E 2XC4A 3P8OA 2AHME 2FP7B 4BNRA 1YLCA 1ESBA 1IHSH 2AERH 5F8TA 1SSXA 3UPEA 3V3MA 2AH4X 3RXHA 4I8KA 3FOAA 2ZFRH 1TBQH 2D2DA 1C5NH 2FDAA 2ZQ1A 3AASA 2D8WA 3BTKE 5L2YH 4JZEH 2ZO3H 2FEQH 2C8YB 1RIWB 3F2FA 1KLIH 3ZV8A 2GV7A 4B76A 3RC6A 7KMEH 2VGCC 1H4WA 1QB6A 1EJNA 1ESTA 1QFKH 4INKA 2P16A 2Z9IA 5FX5A 1DLEA 3E3TA 3S9BA 2V0BA 1TPOA 4NZLA 1K22H 1NC6A 1ZZZA 1P09A 3W1EA 5LPEA 1DY9A 1O3HA 3QO6A 1BB0B 4TYDA 3VB7A 1XUIA 1IQFA 4ASUD 4NA9H 1O2WA 3RXGA 2FZZA 1TRMA 2Q6DA 1GJ9B 1O2LA 5EODA 2SGAA 3IITA 2B0FA 2BY5X 1QY6A 2ZGCA 1Y3XA 1YWUA 5E0JA 4VGCB 1AUTC 2WV4A 2OC8A 4Y10E 4YOIA 2OC7A 4OS1A 5EJLA 3HGPA 1TNJA 1UK4A 2EI6A 1C5QA 5C3NA 4FUCA 1XXDA 1OHHD 1YKTA 1BJUA 2PSXA 1G30B 3M35A 3P95A 1DWEH 4BTUB 1WTGH 3S9CA 3UB0A 3MO3A 2FO9A 1ETTH 1F0UA 1G3CA 4YESB 1GI8B 1HAIH 4B2BA 4ZKRU 5C1XA 4MNXA 2W6ID 5IDKA 1C2MA 1SBWA 1Z6EA 3GY2A 1GHBG 5DP6A 1QJ6B 4X8SH 4KKDA 5LH8A 5HM9A 2JETC 3LGVA 3OU0A 2ZFFH 2PFEA 3MI4A 4I8GA 1P9UA 4OGYA 4E05H 1YYY1 1V2VT 4JZFH 1K21H 2BY9X 2GCTB 2NU0E 3F68H 3SV8A 2WV5A 2Z3DA 4ZKSU 3UUZA 1P8VC 4FUBA 2FOBA 1BTUA 1XM1A 1UVTH 3LH1A 1ETRH 2FTLE 4F55A 3U69H 1TGSZ 2QXGA 1TMTH 4ABBA 3SU4A 2AIPA 1O2JA 2ZGBH 5C5OA 4ZH8A 3GISB 1VITG 3ZVCA 4ACBA 3EA7A 3SW2B 3RXPA 1O36A 1KY9A 4Q80A 1ZHRA 2P93A 4A6LA 4JCNA 1XKBC 3ZZAA 3KHVA 2THFB 2CN0H 2TPIZ 2D1JA 4CBNA 2PTCE 4M9FA 3ZVFA 2GCHG 1A61H 1SOZA 1TRYA 1NRQH 5FPYA 1L1GA 1INCA 3KCGH 1ELBA 1V2NT 4CR5A 5CHAB 1AUJA 1W2KH 1BHXF 4FVDA 1V6DA 1MTWA 1DWDH 1XVOA 2TIOA 1C1NA 2ZWLH 1ZPCA 1HPGA 2CXVA 1E0FD 2C8XB 4MNVA 1TBZH 2IN2A 2F83A 1VGCB 4FUFA 2IJD1 3RXQA 3BSQA 2H1UA 1O2ZA 1TMUH 1C5LH 3TIUA 3VB5A 3UIRA 3IG6B 2FMJA 4WMDA 1H8HD 1EPTA 2VIWA 5JB9S 5TCCA 1D4PB 1K1PA 3FVFB 4WH6A 1SGDE 1Z1IA 3CP7A 2P3UB 2UUKB 5E8EH 2XCNA 2H5CA 1K1OA 1C1MA 2JDID 5ESTE 3TJVA 4LOYH 5DP3A 1ZYOA 1O3EA 3EGKH 1TX7A 2XBVA 3ATLA 1V2OT 1BMLA 1BRCE 4DIIH 2H9EH 3LPRA 3RMNH 1NFYA 4UFDH 3V7TA 1L0ZA 1OYTH 1SLUB 2M2AA 1YPHC 3FZZA 4JMYA 1JOUB 2R9PA 1P2IA 1ANEA 3SGBE 1UTJA 1ANDA 1C5WB 3VEQB 1C5PA 1SKYE 3DSPA 3NRLA 5EQSA 3TNTA 4X8VH 1SL3A 3VXFH 3FP8E 1P2MA 1PQ8A 2EY4C 4DY7B 1HXFH 2GMTC 4Y8ZA 3SI3H 4I33A 1CGJE 3K6YA 3SZNA 1MCTA 1W13U 5DP8A 4MVNA 3SJOA 2BDAA 2ZFQH 1E37B 3TGKE 1T4VH 1OKXA 2KR7A 3LGWA 3MH5A 1GBJA 5C94A 5LGOA 3VXEH 4ZXYH 1SI5H 2A5KA 1EFRD 2ASUB 1TAWA 1O5BB 4A1VA 3MYWA 4NIYA 2SGEE 4Q7ZA 1GMCG 5DG6A 1JMOH 1L1NA 3L3TA 3PMJA 3Q76A 1KDQA 1ZLRA 2BY7X 1B0EA 1SMFE 2PTNA 1MTSA 3AW0A 3M3TA 5T1VA 1D6WA 1GBFA 3GCTG 2PW8H 3ATWA 3F0PA 2TGPZ 1UTQA 1PPZA 2D26C 2YMSD 4XOJA 4FUEA 2ZKSA 1PPGE 1KYNA 1Z8GA 2Y6TA 3BTQE 1SGYE 3KNXA 3TK9A 1JXPA 2BOKA 4X1NU 2YNBA 4INLA 4UFGH 4ISNA 1FX0B 2ZTZA 2BDYA 1TMBH 2ZHFH 1GI1A 2FWWA 1HGTH 1K9OE 1RTKA 4Y76A 2FOEA 3QGJA 4UEHH 3M36A 1BMAA 3RXRA 1EXFA 1O2OA 4MQAA 2TGDA 1V2PT 3SU6A 4O3UA 3GCOA 2RCEA 4WMEA 4Y11E 4DT7B 4BANB 4Y79A 2QA9E 1LHGH 1WSSH 4X6PA 4B2CA 1O31A 3RXJA 5C67A 3UWIA 3T25A 5J4SA 1Y5UT 1C5OH 2R3UA 3PWBA 3MH6A 1W12U 1W0KD 1NESE 2V3OH 1QA0A 3S9AA 1DFPA 3ZVGA 1ANCA 1GCTC 3GY7A 1RS0A 2ZU2A 1DPOA 2IOTA 3S0NA 1LVBA 1SC8U 1DOJA 4BTIB 1TA2A 2XWBI 1ZMNA 2STBE 1PFXC 4INHA 5DJ7A 3SUEA 5IYTA 3SV7A 3O8RA 1O2QA 4I8LA 4FOUC 3A8CA 3RXEA 1QB1A 1GI0A 3D62A 2A4GA 1NRSH 4GCHG 1V2JT 1XUJA 1EJAA 4FUHA 5FHTA 4I8JA 5C1UA 4R8TB 1S81A 1L4ZA 3UNRA 1A0JA 3A7TA 6CHAB 2AIQA 3T28A 2XW9A 4A7IB 1S82A 3GY3A 4XBBA 1O2NA 2VB0A 3FKSD 1FQ3A 1Y59T 3W95A 4BTTB 1HIAA 2HALA 1AO5A 1BTHH 1UVPA 1QNJA 1ZRBA 3GY5A 1SB1H 2HWLB 3RXOA 1KXFA 4WF8A 4WH8A 4YOGA 2PKSB 2VIDA 1O2IA 2G5NA 5F6MA 4Y7BA 5E0GA 7ESTE 1BMNH 1K28D 3WWBA 1FZZA 3TJUA 1D9IA 3M7UA 4B74A 2JH0D 1HXEH 2PR3A 2IPQX 1TQ0B 5F8XA 3HK3B 3AW1A 4X2WA 4ZKNU 1C2KA 1GJ4H 3RXAA 2GDEH 1PPHE 1O5FH 1GBIA 2O8UA 1QL7A 1KXAA 2QF4A 1Z8RA 2RDEA 2ZHWH 1QRZA 4AC9A 2VH0A 3ATKA 1GVKB 2G81E 2Z7FE 2AGGX 4X6OA 2J95A 1G36A 1GL1A 2VU8E 4K5ZA 1GHAG 3PM3A 2PUXB 2L74A 1OXGA 4CRBA 2Y81A 5JBTA 2A4RA 3JZ2B 2ZPSA 3MNSA 3A85A 1HJAB 1NFXA 3AAUA 2XCFA 4NG9H 1ELAA 1BBRH 4ISIH 5DPAA 1EAUA 3RXCA 5EW2H 2ULLA 5T3HA 5ESBA 3EA9A 2GJGA 4IGDA 5A8YA 3O8BA 5A0BA 4R0IA 1TFXA 2FI3E 4KTCA 1BIOA 1AN1E 1UVOA 3G01A 1O3DA 2PP6A 2PSYA 5EPYA 3OY6U 2AGIX 3ZZ5A 1YLDA 2GVFA 2ZTYA 4ZUHA 2ZFSA 4WWYA 6LPRA 1P57B 3OFND 3MQKC 1CGHA 2VWLA 1O3GA 1G3DA 3LOXA 3F9EA 1A5IA 2L6OA 4ISLA 4I86A 4O9VA 1NU9A 1GMHF 2F9UA 1C1OA 2ZA5A 2A45B 2ODPA 9LPRA 1C5YB 4D8NA 1HAYB 1HNEE 3PYHA 5JBCS 2FOHA 2VIPA 2ZDKA 3Q3YA 1BMFD 2HNTE 1LHEH 4QT8C 1DX5M 1J14A 4K1EA 4CH8B 1CBWB 4XRNA 1P06A 4Q7XA 2ZIQH 4HGCA 2A7CA 2WPMS 4YT6H 1BQYA 4NSYA 7LPRA 3A7ZA 3M3VA 1GJAB 1QCPA 5FXLA 2QGRA 4GUXA 1BMMH 4J2YB 1SHHB 2R2MB 1C2GA 2CHAC 3PMHB 1A3EH 1SG8B 3FANA 1IQJA 4IC6A 2Y5HA 2BXTH 4HFPB 3U8OH 1AQ7A 1MKXK 3SHCH 1FMGA 2OLGA 4XBDA 1CO7E 2EI8A 9ESTA 3E0PB 2OUAA 1L1JA 2BD3A 3F1SB 1QB9A 1O2TA 3NCLA 4ACAA 2W3KA 3ELAH 3N7OA 2A4OA 1D3QB 1P9SA 1QGFA 2ZEBA 2VJ1A 3ZVBA 2SGQE 3ZV9A 2OXSA 1C1TA 1RXPA 2V3MA 2WZQA 1TOCB 2BY8X 3GICB 4XDEA 1CT4E 3BIVH 2KM0A 3LC3A 1HAVB 2FI4E 1GI2A 3ODFA 1WXRA 5BPEA 4DOQA 4Y6DA 2XRCA 2GX4A 1GJDB 1P3CA 1FY4A 1GCDA 3ZVDA 1P0SH 2K0QA 3UNQA 5JB8S 3N7DA 1C2EA 3SQHE 4RT1A 3FP7E 4U30A 4UFEH 3SV6A 4FU9A 1C9PA 1HYLA 2P94A 3CS0A 1QURH 3LGTA 1GHXH 1MAYA 4JZ1A 1XXFA 3SN8A 1COWD 1HFDA 1SGQE 2V7QD 1AB9B 1VKYA 4AB8A 3A8BA 1CGIE 1NFUA 2W7SA 3A86A 2C8ZB 2OC0A 2O8WA 4I32A 4ZXXH 2PKAB 1N8OB 1LKAA 3EA8A 3KN2A 4UONA 5L6NH 5DP5A 3GY8A 1TGTA 3DFLA 4MNYA 1F0RA 4FUIA 1YPEH 4OS6A 2XNDD 4B73A 1FV9A 1Y3VA 1NO9H 8LPRA 2PLXA 1V2RT 3L6PA 1CU1A 1M9UA 1O3KA 3BIUH 2XBYA 3I77A 1O3CA 3R3GB 4AORA 1O37A 2ZPRA 1C1PA 4HTCH 5JBAS 3T2NA 1GBDA 1V2LT 1GJ7B 1JBUH 2P3TB 1O5AB 5DP4A 3U28C 1NBMD 4BAHB 2QC2A 1FJSA 4GLYA 5A0AE 1C5RA 4OS7A 4D9RA 2BLOA 1GI4A 3UY9A 5JPMH 2Z6BD 1IAUA 1NU7B
chains in the Genus database with same CATH topology
1DITH 2PGQB 4E7NA 4I7YH 4ABJA 3I29A 4K60A 3TITA 1HJ9A 3PV4A 1BBRK 3HKJB 5EW1H 5FBEA 1IQKA 2CMYA 4U32A 4YT7H 2OD3B 1C2JA 3VB4A 1H8DH 2BD7A 1BRAA 1C2IA 2BY6X 3HPTB 1Y3UA 2F91A 1PYTC 1TBRH 2BTCE 1D3TB 5H4IB 1OWEA 1O2RA 2WINI 3ZVEA 5K7RA 2QY0B 1K1IA 5GCHF 5GWZA 3U1JB 3KQBA 2HLCA 1GMDG 1FAKH 5C2ZA 3RXLA 1FY8E 1GI9B 2WYJA 1F0SA 4DGJA 2F9BH 3QN7A 4OS2A 1FIWA 1H9LB 2Z3CA 4JZIA 1GDNA 3A80A 4CHAB 1F7ZA 1FAXA 7GCHG 1TABE 2H2ZA 1C5TA 2XWAA 2VWNA 1MAXA 4GHTA 5L30H 1TPSA 2G51A 5DP7A 4ZHLU 2ANWA 3ZZ3A 1T8MA 1XKAC 1GHZA 2ZPQA 1N6YA 5T6FA 3MU8A 1GI3A 2WPKS 5EQQA 4E06H 3ESTA 1SFQB 2R3YA 2P8OB 1J17T 1C2LA 3M7TA 4RSPA 5AFZH 1QQUA 3SNDA 1AVGH 2Y5GA 3M5OA 1T8LA 2ZDMA 3RMMH 3PWCA 2ZDVH 3SU0A 2JH6D 1AE8H 1DXPA 1OSSA 2BVSH 1SOTA 2M5TA 1PPEE 2FODA 1C1RA 3DFJA 4IN1A 5FCKA 1HB0B 1SGFG 3P70B 1ABIH 3NZIA 1WU1A 2B5TB 1OP8A 1O30A 1SGIB 1CHOF 1TX6A 1S5SA 1E38B 1AFQC 1O5GH 3GY6A 4UE7H 4GVUA 2CJIA 1O3BA 4YTAA 2EA3A 1FPCH 3TH3H 3KF2A 4D7GA 2BYAX 1THSH 1YPLH 1GBKA 3M3SA 4NA7A 1BBRE 2PWXA 3IWMA 1D3PB 4MPVA 4NIXA 3RLYH 5J4QA 2BB4A 2IPHA 5B6OA 4FXGH 1P2QA 1GDQA 2H9HA 1MBMA 1BTZA 4X1RU 3LT3A 2GDDA 2BHGA 2ALVA 2FS9A 1P2JA 4BXWA 4ABEA 2ANYA 1B7XB 2AYWA 1P04A 2WPJS 5DO4H 5AF9H 2J4IA 4M7GA 5JBBS 4XFQA 2BX3A 3BEIB 1IQMA 1ANBA 1YP9A 4BAQB 3QTVH 5EXLA 2J2UA 4FUDA 3SHAH 3V13A 1ZOMA 1NZQH 1OWKA 1WTHD 1HAPH 1O3LA 2OP9A 2QXIA 3JZ1B 3K2UA 2BD4A 2PGBB 2FOFA 1QIXB 2A1DB 1GHVH 2ESTE 4NWKA 2ZFTA 5JYIA 2UUFB 2FYQA 2V35A 1MTVA 1RIWC 1O34A 1QRXA 3C27B 1V2WT 1TB6H 1EZXC 1Q31A 1TX8A 3KEEA 4A1XA 1KTTB 4X2YA 2I6QA 2Z3EA 5F03A 1GJBB 1MH0A 1Y3WA 1ZJKA 4UD9H 1Z8IB 1C2HA 1BT7A 3E1XB 1KXBA 1KIGH 2BLQA 3OX7U 3GDUA 4AYYB 1LHDH 3GCHB 1UVSH 3FP6E 2A5IA 2ILNA 1EATA 3MU0A 4F4OC 1C5XB 1RGQA 3SOSA 1ZSKA 2XYAA 2Q6FA 4IN2A 2TRMA 1QJ7B 5FBIA 3STIA 1MZAA 1SGEE 3M7QA 1E34B 1P11E 1ZSLA 1A3BH 4CRFA 4VGCC 3BTHE 3TVJB 2PUQH 3SUDA 5GXPA 3QTOH 2RDLA 3RXBA 3SU1A 6GCHF 4CHAC 4CRAA 1K1JA 3SNCA 1C1QA 1G2LA 1PPCE 3ZYDA 1EPTB 2IJOB 1P01A 1O3PB 3NWUA 1TNKA 4DG4A 3RC5A 2FPZA 3MO6A 3SORA 1TNHA 3RMOH 3A7YA 3P8GA 1NROH 1XUHA 2XBWA 2FX6A 3SNBA 1YCPM 4ABGA 2A2QH 2ZU5A 1FY1A 4FUGA 4CRGA 1HLTH 3RUOA 2C90B 2QAAA 3LC5A 1HJ8A 1MU6B 4DVAU 2VNTA 4AGJA 1FY3A 1V2QT 2G5VA 2R0KA 3OTJE 2KAIA 2GCTC 1QJ1B 1MTUA 3UFAA 1CA0B 4CH2B 1A1RA 4JYVH 4GSOA 2ZHEH 3MNXA 1HAHH 3F6UH 2VINA 3S69A 3ZZDA 1AMHA 1OOKB 1P3EA 3AVZA 4H6TA 2BLWA 5C1YA 3K9XB 4NIVA 5ETXA 1GI7B 1AWHB 4ABHA 5E2PA 1BDAA 1CE5A 4MLFB 3GY4A 2HPQH 1HV7A 4B1TA 1OS8A 1KXCA 4D9QA 5DP9A 4O97A 2FOMB 1A2CH 1C5ZB 1FDPA 1VITH 1NRRH 2P95A 1QRWA 3PO1B 3UTUH 1V2UT 3SQEE 3D23A 5CHAC 1VJ9U 3F9HA 3HKIB 1ZSJA 4X1PU 3T27A 1KDQB 2J94A 1IQNA 2W3IA 3ZZ8A 1PJPA 1ARCA 4Q2KA 2A7HA 1ELCA 1NT1A 4ZMAH 3QZRA 1VGCC 4TWYA 5BRRE 1UMAH 1YPHE 2G4TA 2ZP0H 5A2MH 1FPHH 3LU9B 1O0DH 3MHWU 4K2YA 1P2KA 1G3BA 2BD2A 1C5UA 1UTKA 1ZGVA 4A92A 1SPJA 4ZAEA 1O2UA 2ZGJA 1C4U2 1TPAE 1S83A 3KL6A 1O32A 3LJOA 5K0HA 2A32A 1IQHA 2OQ5A 3P8NA 1BUIA 2ZU4A 2K1QA 1CQQA 3ODDA 4CR9A 2BDIA 1UK3A 1TQ7B 1YPMH 2FLRH 3DUXH 2VH6A 1QBOA 3BEUA 1RTLA 2GGVB 4KGAA 1LVYA 1AD8H 2G52A 3LONA 3A84A 2H5DA 3QK1A 2VVVA 1SVPA 1HCGA 3A7VA 3OSYA 3TK5A 4IW4E 4D76A 1O3OA 1WQVH 3TGJE 2F9PA 2VWMA 4OS4A 1HUTH 2ANKH 3B8JA 3UQOA 2QCYA 2BQWB 2TGAA 4BOHA 1YPGH 1MTNB 1K1NA 1EPTC 2F9NA 2HVXA 5GPIB 3U8TH 5HMAA 2F3CE 4Y71A 2ZC9H 1ZMLA 1GBAA 4F49A 4K1SA 1C1WH 4DJZB 1AIXH 1UHBA 3RXTA 1LMWB 1AY6H 3O8CA 2Q1JA 1ZHPA 1SGTA 3ZZ6A 1O5DH 3SV2H 3BTFE 2G00A 4IC5A 4JYTA 1F92A 2AS9A 1KLJH 1EX3A 1K2I1 2VVCA 1HIAB 3LIWA 1ELGA 2C93B 2NU2E 2G4UA 5TCAA 1GBHA 1GBBA 5HXFA 1EAXA 3EQ0H 1N6XA 8GCHF 5A8XA 1TWXB 3OYPA 1BRUP 5FCRA 4TPIZ 1KXDA 5T6GA 6ESTA 3VGCB 1F5LA 1EJMA 1AI8H 1FUJA 1GWAA 2BVXH 3NXPA 3BF6H 1W0ZU 2FIRH 1GBCA 5C20A 1PYTD 2BOHB 1LTOA 3PMAB 1Z1JA 2FM2A 3MU4A 3LJJA 1O2VA 3SJ8A 3KIDU 3ZVAA 4X8UH 2OQUA 1G37A 3RXIA 3ATIA 1EOJA 3A87A 1IQEA 1GHWH 2VIQA 3BTME 2CF9H 3FZDA 4Y8XA 1O33A 4Y7AA 3PO1C 4D7FA 4KELA 1FI8A 2V3HH 2A7JA 4B75A 4BAOB 3TLOA 4ZROA 2ZQ2A 1CVWH 2A4QA 1O38A 1S84A 1WYKA 1YC0A 2FYRA 2AFQB 3SU5A 1K1LA 2J9NA 2ZECA 3VB6A 4MNWA 1IQIA 3RXDA 3AAVA 4TPYA 1LCYA 4LZ4B 3ZZ9A 1NS3A 1GJ5H 1YBWA 1C5MD 1GBEA 5EU8A 1J8AA 1AFEH 1SQAA 1S0QA 3E16B 3RLWH 2Z9GA 1P03A 1CSOE 2WPHS 2BDCA 2W5EA 4KP0A 3T29A 4ZHAA 1WAYB 3RXFA 2A0QB 1O3FA 4AB9A 2HNTF 3H5CB 1C2FA 3LGYA 2BZAA 1ZR0A 4JK5A 2ZG0H 1OYQA 1C1VH 1TNIA 1FY5A 6CHAC 1VCQA 4NGAH 1SR5C 1AWFH 1G3EA 2XBXA 4YLQH 5A8ZA 3GYMA 4ASHA 1C4V2 4AFSA 4IS5A 1HAOH 2B7DH 1VJAU 1AKSA 1LHCH 1LDTT 2ZGXH 4I8HA 1MQ6A 3PTBA 5GDSH 3C1KA 2PKSC 1EZUC 1DUAA 1YF4A 1ZJDA 1LVMA 1A4WH 2Z9JA 1O3JA 4H6SB 1DXWA 3SNEA 3ZZ4A 1SLVB 2FOCA 3UOPA 1UTOA 4AZ2B 2XTTB 1MCVA 3A88A 1AVWA 3A8DA 1X7AC 1LQEA 4ZHMU 3NK8A 2OC1A 1G9IE 3Q3XA 1BCUH 1T31A 3U8RH 1GI6A 1S6HA 2JETB 4Z0KA 2BD9A 3P92A 1KLTA 3QDZB 3SGAE 3KQEA 1TYNA 3RXSA 2QN5T 1V3XA 1Y5AT 1MD8A 3MOCA 1YM0A 3PLKA 1W7GH 1BTPA 1C4Y2 1UK2A 1GMHG 3P6ZB 1JIRA 1V2MT 3TPIZ 1ID5H 1MMJN 1HJAC 2BD8A 4UFFH 1ELVA 1JIMA 3SUGA 1T32A 1QA7A 2R0LA 3V0XA 1QBVH 1AGJA 3LKWA 4MPXA 4DURA 2C3SA 3TH2H 1AE5A 1UVUH 1T7CA 4WXIA 1DS2E 1XVMA 2BQ7B 1GHYH 1ZMJA 2OTVA 3ENSB 3RU4D 1MD7A 3SU2A 1GBMA 3E6PH 4LXBH 4KTSA 3PMBB 2BVRH 4RKJB 4FVBA 1L2EA 1GHBF 2OBOA 3UR6A 1SLXB 1C5SA 4O3TA 1TLDA 2GV6A 3STJA 3MTYA 4WJG2 1PQAA 1DWBH 1L4DA 1NRPH 2V6NA 4K8BA 1CHGA 3TU7H 3TNSA 1GG6B 1GDUA 1HBTH 3UQVA 3MH7A 1GJ6A 2ODYB 1IHTH 1KTSB 1GVLA 3DT0H 2H6MA 1AVXA 3W94A 1TALA 2C8WB 3O8DA 1UTMA 1CBWC 3RXKA 1VITF 2WPLS 4Z6AH 2UUYA 3GDSA 4CRDA 1KXEA 1O3AA 1NRNH 5EGMA 1V2KT 5FAHA 1ZTJA 4NWLA 1NN6A 1PQ7A 2GCHF 4X2VA 1E36B 4AYVB 4PROA 1OWIA 3M37A 3Q00A 3SO3A 4YOJA 5GJ4B 3BTDE 3TGIE 1W0YH 2ZI2H 3R0FA 3RXMA 1HAGE 1LQDB 2AMPA 2ALPA 3DHKH 1Z8JB 1O5CB 1O2KA 5TJXA 2R2WU 4RN6A 1A0HB 2FESH 2GMTB 3HATH 3MU5A 1A7SA 4DW2U 3U1IB 5L2ZH 2LPRA 3T62A 1EZSC 1H8IH 2QXHA 2O9QA 1BZXE 1O39A 1F0TA 3ZYEA 1WUNH 1AZ8A 2RA0A 4MPWA 4YO9A 3SUFA 1ORFA 1AZZA 3E8LA 1C1SA 1AU8A 4MTBA 1LHFH 2ZNKH 3M61U 4NFFA 4BAMB 2NU3E 1XUGA 1DT2A 1UTLM 1Y3YA 2ODQA 3SGQE 4K3JA 1HDTH 4DCDA 2BD5A 3QUMP 3P17H 1Z71A 2SGDE 3BN9A 3RU4T 2F9VA 2YOLA 1UTPA 2AEIH 5FPTA 3E0NB 4ABFA 4U2WA 1AB9C 1T8OA 2GT8A 1ZTKA 3MMGA 1OWHA 1QR3E 1SQOA 1VCPA 2YNAA 1Z6JH 1RTFB 3PLPA 3RM0H 2CF8H 3KGPA 3GCNA 4ABAA 1N8OC 3SI4H 2BQ6B 1EKBB 4LK4A 2SGPE 1VCWA 1RD3B 1GJ8B 4NFEA 4RKOB 4I31A 3BEFB 1SFIA 1EP5A 2ZCKP 1GMCF 3BG4B 4AFZA 2EEKA 1MKWH 2RG3A 5GCHG 5LPFA 8KME2 3A7XA 1NTPA 1DWCH 3GDVA 4TY6A 1J15A 4Y0ZE 1FNIA 1HAZB 3D49H 2A31A 3GCTF 3PB1E 2BXUH 3SJIA 3BTEE 1B0FA 5ABWA 1GG6C 1QTFA 2I6SA 3A83A 1W11U 1SLWB 1GCTB 1MUEB 2Y5FA 5EXMA 4AG1A 3L33A 1P02A 2Q6GA 1P10A 3F9FA 1DUEA 1TRNA 3URDA 2FTMA 3KQCA 1PQ5A 1UCYH 2BLVA 2ZTXA 2H9TH 3QLPH 2FI5E 1ZPBA 4AG2A 1MU8B 1NPMA 3VB3A 5I46H 4K1TA 1HRTH 3CS7A 5EG4A 2XC5A 2CGAA 4NSVA 3M5NA 2A5AA 4JZDH 1DVAH 2AMDA 4CBOA 2BDBA 3CENA 3SBKA 4CRCA 4ESTE 3HK6B 1Q3XA 1RJXB 1GPZA 1CHOG 1H9IE 2ZGHA 4OS5A 1FIZA 1ZRKA 1GBTA 3ATMA 4J1YA 3UOUA 1BOQA 2SGFE 1EASA 1SGNE 2SNVA 1C9TA 1EP6A 5HM2A 2FLBH 3RXVA 1BRBE 5C5NA 3H7TA 4BAKB 1LPZB 1WCZA 2W7UA 1LPGB 4IMZA 4MDSA 4ISOA 5EOKA 1LVOA 3MU1A 3DD2H 2P8OC 1A5GH 1YPKH 1J16A 2Z9KA 4HI3A 2ZFPH 1SHYA 3NKKA 4THNH 5A09A 4GCHF 3ZZ7A 2W26A 3VFEA 3TK6A 2OBQA 5CMXH 3A89A 2QXJA 1SGCA 1D3DB 1GL0E 4B71A 3SJ9A 4TWWA 1C2DA 4KTUA 1V2TT 3EYDA 1SGFA 3EE0B 1EAWA 1MBQA 1TOMH 1UJ1A 1O2GH 4IBLH 2FXRA 1S6FA 3RMLH 2GZ7A 1THPB 2EI7A 2B9LA 2FS8A 2UWLA 1YPJH 4X2XA 1S85A 2F9OA 1Y5BT 5EXNA 5SGAE 4MPUA 4AFUA 3PTNA 2FOGA 3MH4A 4AX9H 2GTBA 3UWJH 1VR1H 5EPNA 1O2HA 1FN8A 5FPSA 4YLUA 3QZQA 1LO6A 2A2XH 2EC9H 1OWDA 1OX1A 2DUCA 4UDWH 2FX4A 5F8ZA 5AHGH 4K8YA 2BDGA 1W8BH 2ZHQH 2Z9LA 2WYGA 2ANMH 2HRVA 5I25A 1MKXH 3BG4C 3RU4E 1GHAF 2KAIB 4LZ1H 2J34A 3UNSA 4IMQA 1GBLA 1YCPH 1H9HE 3S7HB 1O35A 2STAE 1O2YA 2B8OH 3S7KB 3RXUA 1ZGIA 1DM4B 6GCHG 1BITA 3VPKA 1QQ4A 1ZTLA 1FN6A 4E7RG 1AHTH 4NCYA 2J92A 1B5GH 3T26A 2WUBA 2DE8A 2GP9B 3QGNB 1RFNA 3NUMA 1K1MA 1NM6A 5PTPA 1JRSA 1O2MA 3ZZCA 2BZ6H 2CHAB 3KQDA 4MG3A 1TNLA 4B2AA 4TY7A 3P8FA 3DA9B <