3RXEA

Crystal structure of trypsin complexed with benzamide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxeA02
4MNVA 3GCHB 3NXPA 4ESTE 1TONA 2ZNKH 1PYTD 2A1DB 2GZ9A 2XWBI 1F0TA 2CJIA 2K1QA 3LOXA 1O2PA 4JYTA 3RXFA 4ABAA 2CGAA 1MAYA 1YP9A 4J2YB 1O3MA 1TBRH 2ZTXA 4A5TS 5ESTE 1NFWA 4MG3A 3FANA 5GIBA 1CSOE 5FX6A 4ZUHA 3KQCA 1WYKA 1F2SE 1HRTH 3ZVAA 1BMLA 3JZ2B 1XUIA 3M61U 1BMAA 2ZDVH 2ZDAH 1GI7B 1AQ7A 2R3YA 1XKAC 1MD7A 1JBUH 1UTKA 4K3JA 4RN6A 5EQRA 2BD2A 3RUOA 2OC8A 1HJ9A 3NK8A 1SHYA 2XBWA 2M5TA 5C1YA 3F6UH 4DURA 3FP8E 4K8YA 1ELBA 1F0UA 1ZGVA 2WPIS 3U8TH 1QNJA 2ZWLH 4UFDH 1SSXA 1TLDA 4WY3A 1KXCA 3SQEE 1MBMA 3QZQA 3LDXH 1NRQH 1T4UH 3GY8A 1GMCG 1GG6B 2HALA 1Q31A 2HNTC 1C1SA 4AN7A 1Y8TA 1TWXB 4ISIH 5GXPA 1C4V2 1H9LB 1RIWB 1Z71A 4X0WU 1P12E 1O2SA 1KLIH 4Q80A 2UWOA 4ABHA 1MZAA 1C2FA 1G2LA 1S0QA 1QR3E 3BIUH 1C1VH 2VIOA 2IJOB 1BTYA 2ZTZA 3QLPH 2NU1E 1DY9A 3ZZ9A 1ELAA 3SZNA 1V2WT 1O5AB 3L33A 2FDAA 1FPCH 2ZGJA 3MNXA 3GCTF 1SFQB 1ABJH 3RMMH 1HAOH 3M5LA 1C1RA 4BTIB 1LHCH 1A3EH 1O5GH 4TPIZ 1THPB 1GBMA 1TA2A 4Y0YE 4YOIA 2DE9A 3HGPA 1H4WA 3OU0A 2ZQ2A 1VITF 1JXPA 4IBLH 3MYWA 1YF4A 4NFFA 5JB8S 3TLOA 2BY7X 5T3HA 3TIUA 1L1JA 1FAKH 3R0FA 3A85A 4BAMB 1UTNA 2P8OB 1AN1E 1RTLA 1YYY1 1ZSKA 3DA9B 1AUTC 2J95A 1QB9A 4WMEA 2SFAA 1O3EA 2SNVA 2AGEX 1P06A 3OY6U 1C5MD 1O2IA 1T32A 3A8CA 1TIOA 1OWHA 2XTTB 4CRFA 2FOEA 1L2EA 3P6ZB 1Z1IA 4UEHH 1J14A 4MDSA 1DXPA 3RMLH 4YOGA 1PQ7A 2W3KA 1ESAA 2G55A 1XVMA 1G3DA 3U9AH 1BT7A 2BD7A 1MUEB 3LONA 3MMGA 4B2AA 5EW2H 5HM2A 2OQ5A 3NPSA 1AMHA 1E36B 3SU4A 1B0EA 1YCPK 2OUAA 2IN2A 1OWIA 1K1OA 1BITA 1TRNA 3OTJE 1C2GA 1TBZH 4UONA 2A2QH 5JBTA 2ZHEH 1DSTA 3MO3A 2NU0E 1AKSA 1ZR0A 3ZZ7A 1BMNH 1RRKA 4B76A 5EXNA 1UMAH 2BB4A 1HYLA 4X2YA 1OYQA 3GYMA 3IG6B 1K9OE 4DJZB 5GCHG 1HV7A 4X2VA 2BLOA 1HAXB 3Q76A 1MKXH 1K1JA 2GVFA 1L1NA 3CP7A 3F9HA 3P17H 5F6MA 2ZDNA 4INLA 1O2GH 2CN0H 2W3IA 1GHZA 1CT2E 1SGCA 1CA8B 3VXEH 1AB9B 2QAAA 1GI4A 1FQ3A 1NFUA 1W2KH 4K5ZA 1WUNH 2WYJA 1DM4B 1TABE 2H5CA 4GUXA 1C5TA 1UK4A 1H1BA 3MH5A 1AVWA 1MCTA 4I8JA 1O34A 3EDXB 1TOCB 5EQQA 1FY1A 2BY9X 1A5HA 3T26A 5DP8A 1H8DH 3PMJA 3FVFB 4O03A 4X6PA 1F0SA 1GCTC 2R2MB 2FTMA 5L2ZH 1MAXA 3VFEA 1MKWK 2OCVB 1EAXA 3VXFH 3MI4A 4NWKA 1AE5A 3PTBA 2C93B 4YO9A 5CE1A 1NN6A 3EQ0H 1UHBA 4X1PU 4AB8A 3UR6A 2ZO3H 3A81A 3LIWA 1O2JA 1O5BB 4DG4A 3K2UA 2QIQA 1TRYA 2PR3A 2ZIQH 2PKAB 3SGQE 3UNSA 2JETB 3R3GB 2ZU4A 2B0FA 1K1PA 1MBQA 3VB6A 4MPWA 3SU1A 3UNQA 1WSSH 1BTPA 4FXGH 2Z9KA 4IN2A 1O3FA 1HXFH 3VEQB 1DDJA 2F9UA 2FM2A 1RD3B 1P10A 1FIWA 3BG4C 1E34B 2C90B 5IDKA 3TGKE 2FOHA 1PPCE 1GHXH 4ZXXH 1A4WH 1BTZA 5EU8A 4OGXA 7GCHF 1EZSC 3HKIB 1CGHA 3PWCA 1JWTA 1S6FA 3GOVB 1SQTA 1BUIA 3M5MA 1BBRE 1N8OB 1TMUH 1C5SA 3LC3A 2RA3A 1GJ9B 2BDGA 2ODYB 5LPEA 3UPEA 1O2UA 1XM1A 1QFKH 1YC0A 1P2KA 2LPRA 1VGCC 2PLXA 4B75A 1EJMA 1CBWC 2V3HH 1RFNA 2WYGA 3A80A 3DUXH 4AZ2B 2ANWA 2CMYA 2O8WA 2WUCA 1SGYE 2R9PA 1FY5A 4YOJA 1K1NA 2BXTH 3MNSA 4D9RA 1SHHB 2ZKSA 1RIWC 1EJNA 3TVJB 1LKBA 1NY22 1QTFA 1MMJN 2FOBA 2ZFQH 1PPFE 4ZKSU 5EW1H 5EOKA 4K69A 5JBAS 2O8TA 3A8BA 1G3EA 2DE8A 1FXYA 4TPYA 3LGUA 2ZDMA 1GG6C 1V2QT 5JB9S 2XCFA 2Q1JA 2FYQA 1ZOMA 5JBBS 3RXKA 2G4TA 1GBFA 3RU4D 1AIXH 1MU6B 2FLBH 1IQFA 1TGBA 1ELTA 4WH8A 2VIVA 4WF8A 4X8VH 1ELDE 2ZQ1A 4BXWA 3SV6A 2ZFTA 3V12A 4MPXA 4NA8A 1LVBA 1GHAG 1SGEE 1XXFA 2BYAX 4XBBA 5AVDA 1P05A 1Y3WA 1P9UA 1ABIH 3GYLB 1DWDH 4GCHG 4IGDA 8KME2 1SC8U 4A1VA 3NZIA 1A2CH 1JMOH 3UFAA 3GDVA 1C2IA 1B0FA 1ZPZA 4CRAA 2OBQA 1KYNA 5L30H 2ZC9H 1T7CA 1A0JA 3OX7U 1A0HB 3RXUA 3NUMA 1W13U 1AI8H 1VZQH 3E3TA 3E1XB 2FWWA 4IC6A 2VVCA 1HAVA 1XMNB 1Z6JH 1EOJA 1GI9B 1UTLM 1X7AC 1IQKA 1UCYH 1C9TA 1GMCF 4ABJA 2GMTC 1ZGIA 3GCHC 4K1EA 3GDUA 2Q6FA 3FZDA 1UHBB 2ILNA 5FPSA 4OS2A 1RGQA 1TNHA 2H6MA 5DO4H 5C1UA 2UUYA 4X2WA 5CHAB 4NWLA 2PKSC 2QN5T 4B73A 4GHTA 1S84A 5JBCS 5PTPA 1HUTH 4X2XA 1EAUA 1M9UA 4XE4A 3MNCA 3LJJA 1PFXC 3QDZB 2GCTB 1IQMA 3G01A 3HGNA 2BD3A 4H6TA 2Y80A 3UOUA 3PO1B 1DWBH 1FIZA 1LCYA 2VNTA 5C20A 3OSYA 4HZHA 4JMYA 3O8CA 3BSQA 2ALVA 2ANMH 1XUFA 5AF9H 1E35B 5LGOA 2ESTE 2ZGXH 4Q2KA 1AFQC 1XX9A 3LH1A 1NESE 2PFEA 2B9LA 4FU7A 3BTHE 1E38B 1P03A 1NRRH 3BF6H 2TBSA 1GBIA 5C67A 4FVDA 1KDQB 2QF0A 4OS6A 1O5EH 1GBHA 3H5CB 4WMFA 3BTQE 4X8TH 2BVSH 3DFJA 2VH6A 3EAJA 4BTUB 2Z7FE 4FU9A 1G2MA 2QC2A 1O2LA 1VITH 2Z3EA 3F9FA 1K1IA 2W7SA 5DP6A 1GJAB 1O3NA 1V2MT 2SGPE 1AUJA 1BIOA 3BN9A 1H8IH 1LQDB 7KMEH 2ZDKA 2PUXB 1TNKA 3ZYEA 1F7ZA 4Y79A 5F8XA 1Y59T 3ATMA 3SO3A 2ZHWH 1GJCB 1BQYA 1O0DH 8ESTE 1WQSA 4CH2B 1NTPA 1TNLA 1QURH 3SHCH 5E2PA 3F9EA 3GY6A 1WTHD 4FUHA 1EPTC 2RCEA 1V2KT 3GY7A 3HKJB 2XYAA 4TWYA 4X8UH 3QZRA 3PYHA 2ASUB 3H7OA 4K2YA 1OKXA 4JZFH 3UWJH 1WU1A 3MU8A 2A4QA 1UTPA 3QTVH 3MFJA 1DITH 2BMGB 1FDPA 4Q7XA 2GDDA 4DIHH 1AFQB 1SGPE 3TPIZ 2SGEE 2XRCA 4WVPE 1KTSB 4CBNA 1DT2A 1MQ6A 3A7XA 1C2MA 3P8GA 2Q6DA 4O9VA 3SI3H 1O3BA 1LPZB 1OYTH 2VWOA 1C5OH 1QL7A 4J1YA 1GHVH 3V3MA 3HK3B 2PW8H 1W0YH 1EXFA 1GBJA 4NCYA 1UO6A 4Y8YA 3VGCC 1THRH 4AG2A 5FPTA 2J92A 1OSSA 2FI5E 1Q2WA 2ODPA 1TX6A 1OX1A 1GI0A 2QCYA 2FP7B 3U1IB 8GCHF 5J4QA 1OXGA 1NO9H 4NZQA 5CHAC 2BDHA 3MU1A 4NIXA 1IQHA 2R0LA 3LJOA 3A7TA 3U69H 1BTHH 3PM3A 1O3PB 2G00A 3U1JB 3RC4A 1GJ8B 3P8NA 1QIXB 1HBTH 3PMHB 2H2ZA 3ZZ3A 1F5RA 4F4OC 4NG9H 5GPIB 2XWAA 2ZHFH 4FUBA 1XUJA 4NSVA 1A46H 1RTKA 1FV9A 1TGSZ 1C1NA 1MTUA 2QF3A 2H9TH 1SVPA 1SQAA 1DWCH 4DVAU 3M5NA 1SBWA 1QJ1B 1TNIA 3V0XA 2ZDLA 3M3SA 1Z8GA 1H9IE 1TNGA 3I78A 3T28A 6CHAC 1XVOA 1ESTA 1HAVB 1NFYA 2BDCA 2VGCB 1FMGA 2P3TB 2SGQE 1N1LA 1TMTH 1FI8A 3M7UA 3MWIU 1P8VC 4TY7A 1DXWA 1DWEH 2BY5X 3A7WA 4IS5A 3SUGA 4GAWA 1GI2A 1Y5AT 1AD8H 4AFQA 4CRCA 3KGPA 3SU6A 1ACBE 2A4OA 1C5PA 4UFEH 1P9SA 2BOKA 3LH3A 1P02A 4YLQH 4OS7A 3TITA 3GDSA 3ZVFA 3EGKH 3T29A 2AFQB 4CR9A 2V35A 4X6OA 2Y5GA 3PTNA 5EG4A 3RC6A 1C1WH 3MNBA 3F1SB 3GY2A 3KNXA 1DE7H 3IITA 1GJ6A 3S7HB 4AGKA 1B7XB 1QBNA 3KQBA 1TA6A 1L4DA 3SU3A 1GBTA 1O33A 2D2DA 3T27A 3SJ9A 4BOHA 2A7HA 1HAHH 2HNTE 1S5SA 2HLCA 1G3CA 1TRMA 5GJ4B 1MU8B 3STJA 1UTMA 1SGFG 1GJDB 2VIWA 2GZ8A 1QL8A 4F49A 1PQ5A 1A7SA 4K1SA 3S7KB 3DD2H 1TX7A 1BRUP 4NSYA 2BD4A 3A86A 5DGJA 4BNRA 1AU8A 2A5KA 1FLEE 2Z9JA 5FBIA 1HJ8A 4M7GA 1V2NT 4B1TA 1WAYB 3LT3A 4E7RG 1KLTA 1ELFA 2FTLE 1GCDA 2XXLA 4NGAH 2OQUA 5T6GA 1GJ7B 1O30A 1TMBH 3M7QA 4I8GA 4IMZA 3MTYA 3O8RA 1YPMH 2CF9H 2FOCA 2CF8H 2BVRH 3SQHE 3SJKA 5ESBA 3SNEA 5I25A 1BA8B 1OS8A 4I7YH 1F5KU 2EA3A 3UTUH 1HPGA 2JETC 3M3VA 4CRGA 1O2KA 4X1NU 1T8NA 1DPOA 1J9CH 4VGCC 4LZ1H 2Y5FA 3P92A 1OP8A 2UUJB 1C2DA 2FO9A 1TPAE 3I77A 1SI5H 3AAVA 2SGAA 1JRSA 1V2PT 5TCCA 1Z8RA 2BDIA 1V2UT 3ZV8A 2EEKA 4Y11E 8GCHG 1KY9A 1J17T 5A8YA 1O2RA 1AO5A 2JH0D 5DPAA 2ZPSA 1GGDC 2A7CA 1FN8A 1W10U 1UTOA 2XC5A 5HYOA 2NWNA 4I8HA 2ZFFH 5A0BA 2Z94A 2BOHB 2VWNA 1NPMA 1Z7KA 4U32A 1J15A 3TJNA 2UUFB 2AEIH 4UFFH 1YGCH 1IAUA 6ESTA 4D9QA 3W95A 1UVPA 1YBWA 1AWHB 2WPKS 2XC4A 1C4U2 2VIDA 3MU5A 4AOQA 1LMWB 2PUQH 1D3PB 1GI8B 4YM9A 1GMDF 4ASHA 2FMJA 4NIVA 3S9AA 3W94A 3M36A 3AW1A 1QHRB 1C5WB 1MTNC 2BLQA 2G51A 1O39A 1O5FH 1O2QA 2HPPH 4NZLA 2GCHF 1O5DH 1EZQA 1S0RA 1D9IA 3LGVA 2TIOA 1DLKB 1W3CA 1KXAA 1SGDE 3QX5H 4LK4A 3P8OA 2QV1A 1ELGA 2OD3B 2V3OH 3GCNA 3CS7A 5K0HA 1YPHE 4K8BA 1GI6A 3S0NA 4I8KA 2P16A 1O2MA 1Y3XA 1A3BH 5A2MH 3P95A 1MTSA 3RDZA 1JIMA 3E16B 2G4UA 1TPSA 2ZCHP 5DP5A 5CMXH 1GDUA 1TYNA 5FXLA 2W5EA 2EI8A 4A1TA 5JPMH 2P59A 4XOJA 2BDBA 1TB6H 1UVOA 3KQDA 1GBCA 1YPHC 3RXTA 2A4GA 1VJ9U 3Q3KA 1WQVH 1W8BH 5T6FA 3H7TA 4B2CA 5E2OA 3U8RH 1O2OA 2TGPZ 4WXVA 4AB9A 6LPRA 1BOQA 4HTCH 3JZ1B 4U2WA 4JK6A 1BBRH 1ANCA 1ZJKA 2BLVA 1FONA 1AY6H 4AFSA 1DANH 1SGTA 3ATIA 5A09A 3UQOA 2XBVA 4D7GA 1S85A 2ANYA 1L0ZA 1CVWH 1TAWA 4X1SU 1ARCA 1TE0A 2Y82A 1ETRH 5BPEA 2GV6A 4KP0A 4AYVB 1V2ST 1S83A 1NC6A 2ZF0H 1SLWB 3TJUA 3F68H 1ANBA 1K2I1 1O3DA 2H1UA 3A88A 1KLJH 2A32A 4DIIH 1C2LA 1GHWH 2WV4A 3URCA 1K21H 2QY0B 2V0BA 1PPZA 4AYYB 2BM2A 3A84A 1NRPH 2OC1A 4E06H 4BTTB 3EYDA 3RXSA 1O3OA 4Y0ZE 5HXFA 1YLDA 1KXDA 1P0SH 1V2TT 1K22H 4JYUH 2J34A 3RXPA 3KN2A 2H9HA 4Q7ZA 1ZMNA 4FU8A 4MPUA 2GDEH 1AWFH 2FZZA 3ZZCA 1LPGB 3PROA 5FAHA 3RXBA 3RLYH 3BTME 1QRZA 1SGRE 2F9VA 5F8ZA 4JK5A 2BY6X 1QY6A 4WWYA 1GJBB 2AIQA 2JH5D 2SGDE 3A7YA 3TU7H 3N7OA 5DJ7A 1SGNE 4CRDA 1FY8E 3VGCB 2ZA5A 5FX5A 4BAOB 1BTXA 1UVUH 2ZZUH 3TNTA 3ATLA 4YESB 1CHOF 1HLTH 1GI1A 1IQGA 3MHWU 3BTKE 2WPLS 5TJXA 1AVGH 3ITIA 4FUJA 3D49H 3Q3XA 1C5ZB 1GBAA 3RMNH 2A2XH 3E8LA 3SU2A 3DHKH 1RJXB 3KF2A 3E91A 2VIQA 2VJ1A 3A89A 2A31A 1P2QA 4X1RU 2BQ7B 4LZ4B 1XUGA 5IYTA 3O8BA 2HWLB 2BLWA 5GCHF 2NU2E 1SGFA 1EPTB 2ZFPH 3B9FH 1TGNA 4UD9H 2P94A 3VB5A 2KAIB 1ELEE 2FX6A 3SORA 5FPYA 1OWEA 1O35A 1GBDA 1K28D 1EZXC 1V2RT 3ZZBA 1HJAB 4YTAA 4Y71A 2F9NA 1QA7A 1VCQA 2ZEBA 3SV8A 3AW0A 2XBYA 4GVUA 1ZHRA 4FUDA 4Q7YA 3RXEA 3NCLA 4IMQA 1GBBA 5HMAA 4JZ1A 5C5NA 1S82A 1AHTH 2HNTF 3TNSA 1ESBA 4ABEA 1EX3A 4CH8B 1MQ5A 2ZFRH 1ELVA 1D3DB 4BANB 1CHOG 4LXBH 4PROA 3UREA 1AKSB 3ZZ8A 1HIAA 4AGJA 3ZVEA 1HDTH 2GV7A 2OLGA 4NA9H 3LGIA 1WTGH 1ZHPA 2F9BH 3RXRA 5DP9A 1GHBF 4GSOA 1RTFB 2EI7A 1SLXB 3UWIA 2ZPRA 4RSPA 3SI4H 4BAKB 2QXJA 4KGAA 1JOUB 3PLBA 2BQWB 2D1JA 3SNBA 2F3CE 1H9HE 1BMMH 2Z9IA 2WPJS 1CE5A 2BZ6H 1C2HA 2I6QA 4SGBE 2GTBA 3BEIB 5F8TA 1ANDA 3RXGA 1C5XB 2AS9A 1B5GH 3LC5A 3KQEA 1ARBA 2C8ZB 2OP9A 3GISB 1DOJA 2FOMB 4I32A 3RXLA 4KKDA 1N6XA 1VITG 3K6YA 1ZPBA 2WV5A 4YZUA 1HJAC 2ODQA 2D26C 2O8LA 3V13A 3ZZ6A 4A6LA 1N6YA 2BZAA 4H4FA 4ZHMU 1TQ0B 2GMTB 3ZVDA 3UUZA 7LPRA 2CHAC 3OY5U 1HAGE 1ID5H 1OP2A 2JKHA 6GCHG 3SU5A 2ULLA 3RM2H 1BZXE 1HCGA 2OC0A 1CA0C 1IOEA 3BG8A 2BD8A 5EXMA 3Q77A 3TJOA 4WMDA 3D65E 1C1PA 1QBVH 1DS2E 2OTVA 2BX4A 4AX9H 4ZROA 1C2KA 1NROH 3A8DA 2HOBA 2O8MA 1KXFA 3SUEA 1O2WA 3FP7E 2TRMA 3P70B 1MCVA 2B7DH 4JZDH 3LGWA 2Z9GA 3C27B 4Z6AH 4MQAA 4Y7AA 4THNH 2BDAA 4DY7B 3SOSA 1NU7B 3A83A 3RLWH 1P2MA 3SJOA 1IQJA 1SB1H 1YCPM 2F91A 1V6DA 4D8NA 2P93A 1C2JA 1FZZA 4H42U 3K9XB 1EPTA 1HGTH 2PTNA 3S69A 1OWKA 4KTCA 2AERH 4IN1A 2FODA 1YPEH 5GWZA 4QT8C 7ESTE 1FY3A 1FUJA 1ETSH 2GKVE 2XW9A 2QXHA 2ALPA 2O8UA 5LH8A 5H4IB 1UVSH 5AFYH 1BRAA 4DCDA 1FJSA 5SGAE 2B5TB 2LNCA 1CBWB 2PKAA 1BDAA 2A4RA 5AFZH 2STBE 4JZEH 1GBLA 3KHVA 1ZPCA 1BTWA 1GVZA 2ZGCA 1QL9A 5FCRA 2J2UA 3BEUA 1W14U 3SJ8A 3LKWA 4CRBA 5EODA 5TCAA 1QCPA 1VR1H 1N8OC 1FNIA 2R3UA 1IQNA 1JIRA 1P2NA 3SV9A 4FVBA 4RKOB 3DFLA 4TWWA 1WOFA 3QGNB 2H5DA 1EQ9A 5GDSH 1TX8A 3B23B 2CHAB 1SPJA 2FI4E 2THFB 3BG4B 1QQ4A 2ZP0H 1O2YA 3M7TA 1ZSLA 4AG1A 2ZGBH 4XDEA 4UE7H 2G8TA 3MOCA 1O37A 2G81E 9LPRA 4I33A 1T31A 2OC7A 2GX4A 3U98H 5C1XA 2BVXH 1KTTB 2ZU3A 1VCWA 1QBOA 2XBXA 2Z9LA 1MD8A 4TYDA 2ZHQH 2F9OA 4D7FA 3SNDA 3D23A 1EOLA 1HNEE 3M3TA 3A8AA 4ISHH 3UNRA 2ZHDA 1GCTB 5BRRE 2ZCKP 3MO9A 1Q3XA 4UFGH 4XFQA 1DLEA 1EAIA 2P3FH 2IOTA 1D3QB 4GPGA 1XUHA 4A7IB 1UCYE 5L2YH 5DKMA 3PMAB 1V2LT 1P3EA 1SFIA 2NU4E 5LPFA 3GY5A 2XCNA 1MTNB 3EA8A 1U6QA 3ATKA 2AIPA 4X8SH 4B74A 4GCHF 1GDNA 1SG8B 5K7RA 3E6PH 3RXAA 3RXOA 4INKA 1P57B 1V2OT 1A5GH 2F83A 3O8DA 5C5OA 1E37B 1Y3VA 1O38A 2GT8A 5DK1A 3SUFA 4E7NA 2ANKH 4KTUA 3SUDA 3KL6A 5A8XA 1O3IA 2VU8E 1G32B 2ZFSA 1EP5A 1O2NA 3S9BA 2HVXA 1HB0B 5EPYA 1GDQA 3U8OH 1W0ZU 1WCZA 1GWAA 1O2VA 4UDWH 3ZVBA 4HGCA 3MU0A 2Y5HA 3RM0H 2Y6TA 1T4VH 1EAWA 3PLPA 3BTEE 1GGDB 4MLFB 3QGJA 2VWLA 2J9NA 1O2TA 1NS3A 3WY8A 3C1KA 1P11E 1BRCE 3RC5A 1DUAA 3QTOH 3GICB 3TK6A 2OINA 2F9PA 1KXBA 1MTVA 1OWDA 1QQUA 1PJPA 1BBRK 1LHDH 1O2XA 1P01A 5E0JA 3BTWE 1LKAA 1AFEH 1T8LA 3GY3A 4YT6H 1AE8H 1QA0A 3T62A 2Z3DA 1GL0E 2FYRA 1O3GA 1ZJDA 2EC9H 5DP3A 4VGCB 1F0RA 1E0FD 3E0NB 3UY9A 1O3LA 2A7JA 1C5LH 1VJAU 2P3UB 1Z8IB 3GY4A 2QXGA 1Y5BT 1EZUC 1ZTJA 3FP6E 1BHXB 2BDYA 2P8OC 1DFPA 2STAE 4Y76A 3UOPA 1C1OA 1P2IA 2FX4A 2YNAA 4ISNA 1G36A 3RXJA 2FESH 4CHAB 1CU1A 1S81A 1AZZA 5C3NA 3PV4A 1P2OA 2PGBB 2ZG0H 1O3CA 3IWMA 1PPEE 4FUFA 4MNWA 4ISLA 1TPOA 4DT7B 5JYIA 1O3JA 1W11U 2FEQH 3SNAA 1DX5M 2TPIZ 4ZAEA 4BAHB 1MKXK 3UQVA 1TGCA 1P04A 2ZTYA 2SGFE 3Q3YA 3MH7A 2SNWA 3QK1A 4MVNA 3Q00A 1UJ1A 2ZECA 3PMBB 1QRXA 1JRTA 3GCTG 1W12U 2BX3A 5ETXA 1TALA 1LVYA 1YPJH 1CO7E 1OP0A 3A7ZA 2Y7ZA 5DG6A 1C1UH 4X6NA 5JDUB 1F5LA 1A61H 1CGIE 2TGTA 3B8JA 3HPTB 1LHFH 4OS5A 3M5OA 1TPPA 5E8EH 1IQIA 4A92A 4ABIA 1BTUA 1A0LA 4ABDA 3RXCA 4FUCA 1ORFA 3ZZAA 4NIYA 2DUCA 2FOFA 1GMDG 1D3TB 2VH0A 4NIWA 2HPQH 1DUEA 4I31A 3E90B 1W7GH 1LO6A 2QGRA 1RS0A 1LPKB 2AMQA 3STIA 4ABGA 4I8LA 4FUGA 4JZIA 4ZHLU 2UWPA 2C8WB 4JYVH 1FN6A 3E0PB 3ZZ4A 1ZSJA 2BY8X 1EP6A 3OYPA 1TBQH 1BCUH 4YLUA 2AH4X 1YPGH 4TY6A 4X1QU 3TK5A 3FZZA 1HAPH 1EB2A 2OXSA 3LGYA 2P95A 1DY8A 3I29A 3ESTA 4FUEA 3SGBE 1UTJA 4CHAC 3EA9A 4RKJB 1NZQH 2RA0A 2PWXA 1SOTA 3TH3H 1QRWA 1O3AA 1KXEA 4OGYA 1P09A 4ZKRU 1AZ8A 1HAZB 3RXQA 3EA7A 5F03A 1NM6A 1CGJE 2JH6D 3BV9B 4Y8XA 2AYWA 1PPBH 4X6MA 1GBKA 2ZGHA 1GVKB 5ABWA 5HGGA 1KSNA 5EPNA 4WXIA 2H9EH 3ZYDA 3A87A 1GMHG 3MH4A 4KELA 2FOGA 1ZMLA 2PGQB 2BD5A 1PPGE 2BTCE 1D4PB 2QA9E 3SV2H 1ZZZA 3BTDE 1W7XH 2HRVA 1BHXF 1SMFE 3SV7A 2ZPQA 1O2ZA 1L1GA 4XBCA 5A8ZA 1EB1H 3URDA 4XBDA 3TJVA 2WPMS 3SN8A 4H6SB 1AGJA 3T2NA 1UK3A 3TK9A 1Z8JB 2AMDA 2PHBA 2FXRA 1Z6EA 2J4IA 3SGAE 1MTWA 4LOYH 4MNXA 3EE0B 1TQ7B 3VB3A 1BJVA 1ELCA 1CT4E 1Y3YA 1OOKB 3V7TA 4AORA 1BRBE 1TNJA 4WJG2 1A1RA 5AHGH 3D62A 3NWUA 1HXEH 1J8AA 3RU4T 2RG3A 2YOLA 3K6ZA 1C5YB 3SNCA 2GGVB 3AAUA 1HIAB 1QJ6B 5E0HA 4ZKNU 1LVOA 1Z1JA 4Z0KA 5A0CA 1DICA 2B8OH 1EATA 3TGJE 2GCHG 1YKTA 3TH2H 1MZDA 2UUKB 2VVVA 5I46H 2O9QA 5G4BA 2ZU2A 3SHAH 1PYTC 4OS4A 1Y3UA 2VINA 3F9GA 2D8WA 1IQEA 1SGQE 2C8XB 1SLVB 2XNIA 3QN7A 1GHYH 3SU0A 3QO6A 1NRSH 2G5NA 4CREA 2WINI 1QB1A 1TGTA 4NFEA 4YT7H 1YM0A 3AASA 1ZTLA 4Y10E 1GI3A 5L6NH 1DVAH 3SW2B 1FPHH 1LVMA 6GCHF 1WV7H 4CR5A 4B71A 1O3HA 2VB0A 1O2HA 3RMOH 1NRNH 1O36A 4ZH8A 4HFPB 4DW2U 3PO1C 4CBOA 1EASA 4IW4E 4R8TB 1ETTH 2FPZA 1VCPA 1IHSH 3M35A 4ISOA 1GL1A 2TGDA 1GPZA 4U01A 4WH6A 1K1MA 1XUKA 2GT7A 3KCGH 4BXSA 3T5FH 1PQAA 3FAOA 2C3SA 2J38A 2ZI2H 3TH4H 2C4FH 2ZU5A 2AMPA 2XC0A 1BB0B 1ZLRA 1P3CA 1SGIB 2GD4B 1MH0A 4Y6DA 1SLUB 4D76A 3QWCH 1NU9A 1PPHE 1D6RA 1EJAA 3HATH 5EGMA 1MKWH 3BIVH 1F92A 3DT0H 2PSYA 3RXIA 2R0KA 2WUBA 1TFXA 3RXDA 2VIPA 5J4SA 3PWBA 1CHGA 1IHTH 1GI5A 8LPRA 3RP2A 3LU9B 2KAIA 3BTGE 2A5AA 3SBKA 4GLYA 3ELAH 1V2JT 2ZU1A 5FHTA 2VGCC 2FLRH 2FIRH 1C9PA 6CHAB 3NKKA 1SR5C 2WPHS 3M37A 4K60A 4Y8ZA 4ZMAH 4NA7A 3HK6B 2FOAA 4GHQA 1QJ7B 2BD9A 4AFZA 2PTCE 2W7UA 5T6DA 4ABFA 1LTOA 2AGGX 2IPHA 4ZXYH 2G5VA 1INCA 1GJ4H 1QGFA 1C1TA 3K65B 4E05H 2R2WU 4ABBA 2FI3E 9ESTA 4BAQB 3MU4A 1C1QA 1SL3A 2OBOA 3PLKA 4O97A 2Y81A 1PQ8A 1C5UA 1EUFA 5FBEA 4HI3A 2RDLA 4INHA 4O3TA 4DOQA 2G52A 3ZVGA 1G9IE 3ZVCA 2QYIA 2HGTH 4MPVA 3VPKA 2VWMA 1C5NH 2Z3CA 1J16A 2CV3A 4K1TA 2UWLA 3ATWA 4AFUA 2FS9A 5E0GA 5C2ZA 3A7VA 1UTQA 4MTBA 1O5CB 2PV9B 1C5QA 2A45B 1OPHB 1ANEA 1YLCA 4JCNA 2PSXA 1C5RA 1LHEH 3RXMA 2BQ6B 1LQEA 1SQOA 1YPLH 1VGCB 1ZHMA 1WBGB 3ODFA 5FCKA 4DGJA 2VVUA 4SGAE 1GBEA 2BXUH 1GVLA 1HAIH 1XXDA 1L4ZA 1ZYOA 5A0AE 3QUMP 5EQSA 3CENA 3ENSB 3CS0A 2GP9B 1CA0B 3A82A 2Q6GA 1GJ5H 1CT0E 1HAYB 1V3XA 3PB1E 1EKBB 1O32A 2W26A 2EI6A 4R0IA 3RU4E 4XSKU 3T25A 1LHGH 1YPKH 1D6WA 1T8MA 3ZZDA 1G37A 2ZCLP 1TOMH 1LDTT 1T8OA 3KIDU 1DSUA 3LPRA 3SJIA 3KEEA 3P8FA 1BJUA 1C5VA 1NFXA 2V6NA 3L6PA 1ZRBA 1G30B 3LGTA 3S9CA 1C2EA 3AVZA 3MH6A 2FS8A 1Y5UT 3UIRA 1IQLA 1QB6A 1V2VT 1YCPH 2NU3E 2A5IA 2A0QB 3TGIE 1GHBG 4ZHAA 1O3KA 1CQQA 2AGIX 3RXHA 3BTTE 1KIGH 3ZZ5A 5B6OA 5LPRA 7GCHG 1RXPA 1NT1A 3MO6A 1UVTH 1K1LA 4B2BA 4ZKOU 4Y7BA 4U30A 1O31A 3FFGA 3UR9A 1XKBC 1UK2A 1G3BA 2YNBA 5DP7A 1UCYK 2CXVA 1OWJA 3BTFE 4FUIA 5EXLA 1ZMJA 2BHGA 2C8YB 2GZ7A 3VB4A 1S6HA 3VB7A 1SOZA 3GCOA 2QXIA 4OS1A 1C1MA 4IC5A 2J94A 2GCTC 5HM9A 1AB9C 1P2JA 1ZRKA 2TGAA 4O3UA 1THSH 3L3TA 3RXVA 1C4Y2 1A5IA 2Z6BD 1HFDA 2PKSB 2I6SA 1GHAF 4A1XA 3ODDA 3BEFB 1KDQA 4MNYA 1FY4A 1FAXA 2Y7XA 4KTSA 1ZTKA 1AVXA 3ZV9A 5DP4A 1GMHF
chains in the Genus database with same CATH superfamily
4MNVA 3GCHB 2KFWA 3NXPA 4ESTE 1TONA 2ZNKH 1PYTD 2A1DB 2GZ9A 2XWBI 1F0TA 2CJIA 2K1QA 3LOXA 1O2PA 4JYTA 3RXFA 2QF5A 4ABAA 2CGAA 1MAYA 1YP9A 4J2YB 4XD7D 5B6LA 1O3MA 1TBRH 2ZTXA 4A5TS 5ESTE 1NFWA 3FOAA 3FANA 4MG3A 5GIBA 1CSOE 5FX6A 4ZUHA 3KQCA 1WYKA 1S6LA 1F2SE 1HRTH 3ZVAA 1BMLA 3JZ2B 1XUIA 3M61U 1BMAA 2ZDVH 2ZDAH 1GI7B 1AQ7A 2R3YA 1XKAC 1MD7A 1JBUH 1UTKA 4K3JA 4RN6A 5EQRA 2BD2A 3RUOA 2OC8A 1HJ9A 3FKSD 3NK8A 1SHYA 2XBWA 2M5TA 5C1YA 4P02A 3F6UH 4DURA 3FP8E 4K8YA 1ELBA 1F0UA 1ZGVA 2WPIS 3F2HA 3U8TH 1QNJA 2ZWLH 4UFDH 1SSXA 1TLDA 4WY3A 1KXCA 3SQEE 4AC9A 1MBMA 1NBME 3QZQA 3LDXH 1NRQH 1T4UH 3GY8A 1GMCG 1GG6B 2HALA 1Q31A 2HNTC 1C1SA 4AN7A 1Y8TA 1TWXB 4ISIH 5GXPA 1C4V2 1H9LB 1RIWB 1Z71A 4X0WU 1P12E 1O2SA 1KLIH 4Q80A 2UWOA 4ABHA 1MZAA 1C2FA 1G2LA 1S0QA 1QR3E 1BMFD 3BIUH 1C1VH 2VIOA 5DSFA 2IJOB 1BTYA 2ZTZA 3QLPH 2NU1E 1DY9A 3ZZ9A 1ELAA 3OEHD 3SZNA 1V2WT 1O5AB 3L33A 3DSPA 2FDAA 1FPCH 2J5UA 2ZGJA 3MNXA 3GCTF 1SFQB 1ABJH 3RMMH 1HAOH 3M5LA 1C1RA 3PV2A 4BTIB 1LHCH 1A3EH 1O5GH 4TPIZ 1THPB 1GBMA 1TA2A 4Y0YE 4YOIA 2DE9A 3HGPA 1H4WA 3OU0A 2ZQ2A 1VITF 1JXPA 4IBLH 3MYWA 1YF4A 2QE7D 4NFFA 5JB8S 3TLOA 2BY7X 5T3HA 3TIUA 1L1JA 1FAKH 3R0FA 3A85A 4BAMB 1UTNA 2P8OB 1AN1E 2K0QA 4YXWD 1RTLA 2WPDD 1YYY1 1ZSKA 1SQRA 3DA9B 1AUTC 2J95A 1QB9A 4WMEA 2SFAA 1O3EA 2SNVA 2AGEX 1P06A 3OY6U 1C5MD 1O2IA 1T32A 3A8CA 1TIOA 1OWHA 2XTTB 4CRFA 2FOEA 1L2EA 3P6ZB 1Z1IA 4UEHH 1J14A 4MDSA 1DXPA 3RMLH 4YOGA 1PQ7A 2W3KA 1ESAA 2G55A 1XVMA 1G3DA 3U9AH 1BT7A 2BD7A 1MUEB 3LONA 3MMGA 4B2AA 5EW2H 5HM2A 2OQ5A 3NPSA 5EIYA 1AMHA 1E36B 3SU4A 1B0EA 1YCPK 2OUAA 2IN2A 1OWIA 1K1OA 5KGOA 1BITA 2F43B 1TRNA 3OTJE 1C2GA 1TBZH 4UONA 2A2QH 5JBTA 2ZHEH 1DSTA 3MO3A 2NU0E 1AKSA 1ZR0A 3ZZ7A 1BMNH 1RRKA 4B76A 5EXNA 1UMAH 2BB4A 1HYLA 4X2YA 1OYQA 2WV9A 3GYMA 3IG6B 2KR7A 1K9OE 4DJZB 5GCHG 1HV7A 4X2VA 2BLOA 1YWUA 1HAXB 3Q76A 1MKXH 1K1JA 2GVFA 1L1NA 3CP7A 3F9HA 3P17H 5F6MA 2ZDNA 4INLA 1O2GH 5HKKD 2CN0H 2W3IA 4F48B 1GHZA 1CT2E 1SGCA 1CA8B 3VXEH 1AB9B 2QAAA 1GI4A 1FQ3A 1NFUA 1W2KH 4K5ZA 1WUNH 2WYJA 1DM4B 1TABE 2H5CA 4GUXA 1C5TA 1UK4A 1H1BA 3MH5A 1AVWA 1MCTA 4I8JA 1O34A 3EDXB 1TOCB 5EQQA 1FY1A 2BY9X 1A5HA 3T26A 5DP8A 1H8DH 3PMJA 3FVFB 4O03A 4X6PA 1F0SA 1GCTC 2R2MB 2FTMA 5L2ZH 1MAXA 3VFEA 1MKWK 2OCVB 1EAXA 3VXFH 3MI4A 4NWKA 1AE5A 3PTBA 2C93B 4YO9A 5CE1A 1NN6A 3EQ0H 1UHBA 4X1PU 4AB8A 3UR6A 2ZO3H 3A81A 3LIWA 1O2JA 1O5BB 4DG4A 3K2UA 2QIQA 1TRYA 2PR3A 2ZIQH 2PKAB 3SGQE 3UNSA 2JETB 3R3GB 2ZU4A 2B0FA 1K1PA 1MBQA 3VB6A 4MPWA 3SU1A 3UNQA 1WSSH 1BTPA 4FXGH 2Z9KA 4IN2A 1O3FA 1HXFH 3VEQB 1DDJA 2F9UA 2FM2A 1YLNA 1RD3B 1YY3A 1P10A 1FIWA 3BG4C 1E34B 2C90B 5IDKA 3TGKE 2FOHA 1PPCE 1GHXH 4ZXXH 1A4WH 1BTZA 2L74A 5EU8A 3KYGA 4OGXA 7GCHF 1EZSC 3HKIB 1CGHA 3PWCA 1JWTA 1S6FA 3GOVB 1SQTA 1BUIA 3M5MA 1BBRE 1N8OB 1TMUH 1C5SA 5FL7D 3LC3A 2RA3A 1GJ9B 2BDGA 1WXRA 2ODYB 5LPEA 3UPEA 1O2UA 1XM1A 1QFKH 1YC0A 1P2KA 2LPRA 4ZCNA 1VGCC 2PLXA 4B75A 1EJMA 1CBWC 2V3HH 1RFNA 3U28C 2WYGA 3A80A 3DUXH 4AZ2B 2ANWA 2CMYA 2O8WA 2WUCA 1SGYE 2R9PA 1FY5A 4YOJA 3DCLA 1K1NA 2BXTH 3MNSA 4D9RA 1SHHB 2ZKSA 1RIWC 1EJNA 3TVJB 1LKBA 1NY22 1QTFA 1MMJN 2FOBA 2ZFQH 1PPFE 4ZKSU 5EW1H 5EOKA 4K69A 5JBAS 2O8TA 3A8BA 1G3EA 1COWD 2DE8A 1FXYA 4TPYA 3LGUA 2ZDMA 4ACBA 1GG6C 1V2QT 5JB9S 2XCFA 2Q1JA 2FYQA 1ZOMA 5JBBS 3RXKA 2G4TA 1GBFA 3RU4D 1AIXH 1MU6B 2FLBH 1IQFA 1TGBA 1ELTA 4WH8A 2VIVA 4WF8A 4X8VH 1ELDE 2ZQ1A 4BXWA 3SV6A 2ZFTA 3V12A 4MPXA 4NA8A 1LVBA 1GHAG 1SGEE 1XXFA 2BYAX 4XBBA 5AVDA 1P05A 1Y3WA 1P9UA 1ABIH 3GYLB 1DWDH 4GCHG 4IGDA 8KME2 1SC8U 4A1VA 3NZIA 1A2CH 1VKYA 1JMOH 3UFAA 3GDVA 1C2IA 1B0FA 1ZPZA 4CRAA 2OBQA 1KYNA 5L30H 2ZC9H 1T7CA 1A0JA 3OX7U 1A0HB 3RXUA 3NUMA 1QZ8A 1W13U 2HVYB 1AI8H 1VZQH 3E3TA 3E1XB 2FWWA 4IC6A 2VVCA 1HAVA 1XMNB 1Z6JH 1EOJA 1GI9B 1UTLM 1X7AC 1IQKA 1FX0B 1UCYH 1C9TA 1GMCF 4ABJA 2GMTC 1ZGIA 3GCHC 4K1EA 3GDUA 2Q6FA 3FZDA 1UHBB 2ILNA 5FPSA 4OS2A 1RGQA 1TNHA 2H6MA 5DO4H 5C1UA 2UUYA 4X2WA 5CHAB 4NWLA 2PKSC 2QN5T 4B73A 4GHTA 1S84A 5JBCS 5PTPA 1HUTH 4X2XA 1EAUA 1M9UA 4XE4A 3MNCA 3LJJA 1PFXC 3QDZB 2GCTB 1IQMA 3G01A 3HGNA 2BD3A 4H6TA 2Y80A 3UOUA 3PO1B 1DWBH 1FIZA 1LCYA 2VNTA 5C20A 3OSYA 4HZHA 4JMYA 3O8CA 3BSQA 2ALVA 2ANMH 1XUFA 5AF9H 1E35B 5LGOA 2ESTE 2ZGXH 4Q2KA 1AFQC 1XX9A 3LH1A 1NESE 2PFEA 2B9LA 4FU7A 3BTHE 1E38B 1P03A 1NRRH 3BF6H 2TBSA 2WHXA 1GBIA 5C67A 4FVDA 1KDQB 2QF0A 4OS6A 1O5EH 1GBHA 3H5CB 4WMFA 3BTQE 4X8TH 2BVSH 3DFJA 2VH6A 3EAJA 4BTUB 2Z7FE 4FU9A 1G2MA 2QC2A 1O2LA 1VITH 2Z3EA 3F9FA 1K1IA 2YMSC 5DP6A 2W7SA 1GJAB 1O3NA 1V2MT 2SGPE 4XRNA 1AUJA 1BIOA 3BN9A 1H8IH 1LQDB 1W0JD 7KMEH 2ZDKA 2M2AA 2PUXB 1TNKA 3ZYEA 1F7ZA 4Y79A 5F8XA 2KCYA 1Y59T 3ATMA 3SO3A 1OHHD 2ZHWH 1GJCB 1BQYA 1O0DH 8ESTE 1WQSA 4CH2B 1NTPA 2YMSB 1TNLA 1QURH 3SHCH 5E2PA 3F9EA 3GY6A 1WTHD 4FUHA 1EPTC 2RCEA 1V2KT 3GY7A 3HKJB 2XYAA 4TWYA 4TT3D 3QZRA 3PYHA 4X8UH 2ASUB 3H7OA 4K2YA 1OKXA 4JZFH 3UWJH 1WU1A 3MU8A 2A4QA 1UTPA 3QTVH 3MFJA 1DITH 2BMGB 1FDPA 4Q7XA 2GDDA 4DIHH 1AFQB 1SGPE 3TPIZ 2SGEE 2XRCA 3DSGA 4WVPE 1KTSB 4CBNA 1DT2A 1MQ6A 3A7XA 1C2MA 3P8GA 2Q6DA 4O9VA 3SI3H 1O3BA 1LPZB 1OYTH 2VWOA 1C5OH 1QL7A 4J1YA 1GHVH 3V3MA 3HK3B 2PW8H 3F3BA 1W0YH 1EXFA 1GBJA 4NCYA 1UO6A 4Y8YA 3VGCC 1THRH 4AG2A 5FPTA 2J92A 1OSSA 2FI5E 1Q2WA 2ODPA 1TX6A 1OX1A 1GI0A 2QCYA 2FP7B 3U1IB 8GCHF 5J4QA 1OXGA 1NO9H 4NZQA 5CHAC 2BDHA 3MU1A 4NIXA 1IQHA 2R0LA 3LJOA 3A7TA 3U69H 1BTHH 3PM3A 1O3PB 2G00A 3U1JB 3RC4A 1GJ8B 3P8NA 1QIXB 1HBTH 3PMHB 2H2ZA 3ZZ3A 1F5RA 4F4OC 4NG9H 5GPIB 2XWAA 2ZHFH 4FUBA 1XUJA 4NSVA 1A46H 1RTKA 1FV9A 1TGSZ 1C1NA 1MTUA 2QF3A 2H9TH 1SVPA 1SQAA 1DWCH 4DVAU 2KM0A 3M5NA 1SBWA 4I86A 1QJ1B 1TNIA 3V0XA 2ZDLA 3M3SA 1Z8GA 1H9IE 1TNGA 3I78A 1MABB 3T28A 6CHAC 1XVOA 1ESTA 1HAVB 1NFYA 2BDCA 2VGCB 1FMGA 3SZEA 2P3TB 2SGQE 1N1LA 1TMTH 1FI8A 3M7UA 3MWIU 3WWBA 1P8VC 4TY7A 1DXWA 1DWEH 2BY5X 3A7WA 4IS5A 3SUGA 4GAWA 1GI2A 1Y5AT 1AD8H 4AFQA 4CRCA 3KGPA 3SU6A 1ACBE 2A4OA 1C5PA 2AHME 4UFEH 1P9SA 2BOKA 3LH3A 1P02A 4YLQH 4OS7A 4RI0A 3TITA 3GDSA 3ZVFA 3EGKH 3T29A 2AFQB 4CR9A 2V35A 4X6OA 2Y5GA 3PTNA 5EG4A 3RC6A 1C1WH 2KCPA 3MNBA 3F1SB 3GY2A 3KNXA 1DE7H 3IITA 1GJ6A 3S7HB 4AGKA 1B7XB 1QBNA 3KQBA 1TA6A 1L4DA 3SU3A 5CDFE 1GBTA 1O33A 2D2DA 3T27A 3SJ9A 4BOHA 2A7HA 1HAHH 2HNTE 1S5SA 2HLCA 1G3CA 1TRMA 5GJ4B 1MU8B 3STJA 5C0UA 1UTMA 1SGFG 1GJDB 2VIWA 2GZ8A 1QL8A 4F49A 1PQ5A 1A7SA 4K1SA 3S7KB 3N7DA 3DD2H 1TX7A 4F55A 1BRUP 4NSYA 2BD4A 3A86A 5DGJA 4BNRA 1AU8A 2A5KA 1FLEE 2Z9JA 5FBIA 1HJ8A 4M7GA 1V2NT 4B1TA 1WAYB 3LT3A 4E7RG 1KLTA 1ELFA 2FTLE 1GCDA 2XXLA 4NGAH 2OQUA 4RT0A 5T6GA 1GJ7B 1O30A 1TMBH 3M7QA 4I8GA 4IMZA 3MTYA 3O8RA 1YPMH 2CF9H 2FOCA 2CF8H 2BVRH 3F0PA 3SQHE 3SJKA 5ESBA 3SNEA 5I25A 1BA8B 3FO8D 1OS8A 4I7YH 1F5KU 2EA3A 4FETA 5HIYA 3UTUH 1HPGA 2JETC 3M3VA 4CRGA 1O2KA 4X1NU 1T8NA 1DPOA 1J9CH 4VGCC 4LZ1H 2Y5FA 3P92A 1OP8A 2UUJB 1C2DA 1WDIA 2FO9A 1TPAE 3I77A 1SI5H 3AAVA 2SGAA 1JRSA 1V2PT 5TCCA 1Z8RA 2BDIA 1V2UT 3ZV8A 2EEKA 4Y11E 8GCHG 1KY9A 1J17T 5A8YA 1O2RA 1AO5A 2JH0D 5DPAA 2ZPSA 1GGDC 2A7CA 1FN8A 1W10U 1UTOA 2XC5A 5HYOA 2NWNA 4I8HA 2ZFFH 5A0BA 2Z94A 2BOHB 2VWNA 1NPMA 1Z7KA 4U32A 1J15A 3TJNA 2UUFB 2AEIH 4UFFH 1YGCH 1IAUA 6ESTA 4D9QA 5HIZA 3W95A 1UVPA 1YBWA 1AWHB 2WPKS 2XC4A 1C4U2 2VIDA 3MU5A 4AOQA 1LMWB 2PUQH 1D3PB 1GI8B 4YM9A 1GMDF 4ASHA 2FMJA 4NIVA 3S9AA 3W94A 3M36A 3AW1A 1QHRB 1C5WB 1MTNC 2BLQA 2G51A 1O39A 1O5FH 1O2QA 2HPPH 4NZLA 2GCHF 1O5DH 1EZQA 1S0RA 1D9IA 3LGVA 2TIOA 1DLKB 1W3CA 1KXAA 1SGDE 3QX5H 4LK4A 3P8OA 2QV1A 1ELGA 4ACAA 2OD3B 2V3OH 3GCNA 3CS7A 5K0HA 1YPHE 4K8BA 1GI6A 3S0NA 4I8KA 2P16A 1O2MA 1Y3XA 1A3BH 5A2MH 3P95A 1MTSA 3RDZA 1JIMA 3E16B 2G4UA 1TPSA 2ZCHP 5DP5A 5CMXH 1GDUA 1TYNA 5FXLA 2W5EA 2EI8A 4A1TA 5JPMH 2P59A 4XOJA 2BDBA 1TB6H 1UVOA 3KQDA 1GBCA 1YPHC 3RXTA 2A4GA 1VJ9U 3Q3KA 1WQVH 1W8BH 5T6FA 2PP6A 3H7TA 4B2CA 5E2OA 3U8RH 1O2OA 2TGPZ 4WXVA 4AB9A 6LPRA 1BOQA 4HTCH 3JZ1B 4U2WA 4JK6A 1BBRH 1ANCA 1ZJKA 2BLVA 1FONA 1AY6H 4AFSA 1DANH 1SGTA 3ATIA 5A09A 3UQOA 2XBVA 4D7GA 1S85A 2ANYA 1L0ZA 1CVWH 1TAWA 4X1SU 1ARCA 1TE0A 2Y82A 1ETRH 5BPEA 2GV6A 4KP0A 4AYVB 1V2ST 1S83A 1NC6A 2ZF0H 1SLWB 3TJUA 3F68H 1ANBA 1K2I1 1O3DA 2H1UA 3A88A 1KLJH 2A32A 4DIIH 1C2LA 1GHWH 2GJGA 2WV4A 3URCA 1K21H 2QY0B 2V0BA 1PPZA 4AYYB 2BM2A 3A84A 1NRPH 2OC1A 4E06H 4BTTB 3EYDA 3RXSA 1O3OA 4Y0ZE 2KCAA 5HXFA 1YLDA 4Z1MD 1KXDA 1P0SH 1V2TT 1K22H 4JYUH 2J34A 3RXPA 3KN2A 2H9HA 1H8ED 4Q7ZA 1ZMNA 3GS9A 4FU8A 4MPUA 2GDEH 1AWFH 2FZZA 3ZZCA 1LPGB 3PROA 5FAHA 3RXBA 3RLYH 3BTME 5C0TA 1QRZA 1SGRE 2F9VA 5F8ZA 4JK5A 2BY6X 1QY6A 4WWYA 1GJBB 2AIQA 3N7EA 2JH5D 2SGDE 3A7YA 3TU7H 3N7OA 5DJ7A 1SGNE 4CRDA 1FY8E 3VGCB 2ZA5A 5FX5A 4BAOB 1BTXA 1UVUH 2ZZUH 3TNTA 3ATLA 4YESB 1CHOF 1HLTH 4P00A 1GI1A 1IQGA 3MHWU 3BTKE 3F2FA 2WPLS 5TJXA 1AVGH 3ITIA 4FUJA 3D49H 3Q3XA 1C5ZB 2KCOA 1GBAA 3RMNH 2A2XH 3OAAD 3E8LA 3SU2A 3DHKH 1RJXB 3KF2A 3E91A 2VIQA 2VJ1A 3A89A 2A31A 1P2QA 4X1RU 2BQ7B 4LZ4B 1XUGA 5IYTA 3O8BA 2HWLB 2BLWA 3OE7D 2W6ID 5GCHF 2NU2E 1SGFA 1EPTB 2ZFPH 2OK5A 3KYFA 3B9FH 1TGNA 4UD9H 3MQKC 2P94A 2WZQA 3VB5A 2KAIB 1ELEE 2FX6A 2RDEA 3SORA 5FPYA 1OWEA 1O35A 1GBDA 1K28D 1EZXC 1V2RT 3ZZBA 1HJAB 4YTAA 4Y71A 2F9NA 1QA7A 1VCQA 2ZEBA 3SV8A 3AW0A 2XBYA 4GVUA 1ZHRA 4FUDA 4Q7YA 3RXEA 3NCLA 4IMQA 1GBBA 5HMAA 4JZ1A 5C5NA 1S82A 1AHTH 2HNTF 3TNSA 1ESBA 4ABEA 1EX3A 4CH8B 1MQ5A 2ZFRH 1ELVA 1D3DB 4BANB 1CHOG 4LXBH 2CK3D 4PROA 3UREA 1AKSB 3ZZ8A 1HIAA 4AGJA 3ZVEA 1HDTH 2GV7A 2OLGA 4NA9H 3LGIA 1WTGH 1ZHPA 2F9BH 3RXRA 5DP9A 1GHBF 4GSOA 1RTFB 2EI7A 1SLXB 3UWIA 2ZPRA 4RSPA 3SI4H 4BAKB 2QXJA 4KGAA 1JOUB 3PLBA 2BQWB 2D1JA 3SNBA 2F3CE 1H9HE 1BMMH 2Z9IA 3DSOA 2WPJS 1CE5A 2KX4A 2BZ6H 1C2HA 2I6QA 1UW7A 4SGBE 2GTBA 3BEIB 5F8TA 1ANDA 3RXGA 1C5XB 2AS9A 1B5GH 3LC5A 3KQEA 1ARBA 2C8ZB 2OP9A 3GISB 1DOJA 2FOMB 4I32A 3RXLA 4KKDA 1N6XA 1VITG 3K6YA 1ZPBA 2WV5A 4YZUA 1HJAC 2ODQA 2D26C 2O8LA 3V13A 3ZZ6A 4A6LA 1N6YA 2BZAA 4H4FA 4ZHMU 1TQ0B 2GMTB 3ZVDA 3UUZA 7LPRA 2CHAC 3OY5U 1HAGE 1ID5H 1OP2A 2JKHA 6GCHG 3SU5A 2ULLA 3RM2H 1BZXE 1HCGA 2OC0A 1CA0C 1IOEA 3BG8A 2BD8A 5EXMA 3Q77A 3TJOA 4WMDA 3D65E 1C1PA 1QBVH 1DS2E 2OTVA 2BX4A 4AX9H 4ZROA 1K0HA 1C2KA 1NROH 3A8DA 2HOBA 2O8MA 5EJLA 1KXFA 1NBMD 3SUEA 1O2WA 3FP7E 2TRMA 3P70B 1MCVA 2B7DH 4JZDH 3LGWA 2Z9GA 3C27B 4Z6AH 4MQAA 4Y7AA 4THNH 2BDAA 4DY7B 3SOSA 1NU7B 3A83A 3RLWH 1P2MA 3SJOA 1IQJA 1SB1H 1YCPM 2F91A 1V6DA 4D8NA 2P93A 1C2JA 1FZZA 4H42U 3K9XB 1EPTA 1HGTH 2PTNA 3S69A 1OWKA 4KTCA 2AERH 4IN1A 2FODA 1YPEH 5GWZA 4QT8C 7ESTE 2RFKC 1FY3A 1FUJA 1ETSH 2GKVE 2XW9A 2QXHA 2ALPA 2O8UA 5LH8A 5H4IB 1UVSH 5AFYH 1BRAA 4DCDA 1FJSA 5SGAE 2B5TB 2LNCA 1CBWB 2PKAA 1BDAA 2A4RA 5AFZH 2STBE 4JZEH 1GBLA 3KHVA 1ZPCA 1BTWA 1GVZA 2QF4A 2ZGCA 1QL9A 5FCRA 2J2UA 3BEUA 1W14U 3SJ8A 3LKWA 4CRBA 5EODA 5TCAA 1QCPA 1VR1H 1N8OC 1FNIA 2R3UA 1IQNA 1JIRA 1P2NA 3SV9A 4FVBA 4RKOB 3DFLA 4TWWA 1WOFA 3QGNB 2H5DA 1EQ9A 1EFRD 5GDSH 1TX8A 3B23B 2CHAB 1SPJA 2FI4E 1E79D 2THFB 3BG4B 1QQ4A 2ZP0H 1O2YA 3M7TA 1ZSLA 4AG1A 2ZGBH 4XDEA 4UE7H 3AK5A 2KZ4A 2G8TA 3MOCA 1O37A 2G81E 9LPRA 4I33A 1T31A 2OC7A 2GX4A 3U98H 5C1XA 2BVXH 3CNRA 1KTTB 2ZU3A 1VCWA 1QBOA 2XBXA 2Z9LA 1MD8A 4TYDA 2ZHQH 2F9OA 4D7FA 3SNDA 3D23A 1EOLA 1HNEE 3M3TA 3A8AA 3PV5A 4ISHH 3UNRA 2ZHDA 1GCTB 5BRRE 2ZCKP 3MO9A 1Q3XA 4UFGH 4XFQA 1DLEA 1EAIA 2P3FH 2IOTA 4FOUC 1D3QB 4GPGA 1XUHA 4A7IB 1UCYE 5L2YH 5DKMA 3PMAB 1V2LT 1P3EA 1SFIA 2NU4E 5LPFA 2F4LA 5IK2D 3GY5A 2XCNA 1MTNB 3EA8A 1U6QA 3ATKA 2AIPA 4X8SH 4B74A 4GCHF 1GDNA 1SG8B 5K7RA 3E6PH 3RXAA 3RXOA 4INKA 1P57B 1V2OT 1A5GH 2F83A 3O8DA 2XNDD 5C5OA 1E37B 1Y3VA 1O38A 2GT8A 5DK1A 3SUFA 4E7NA 2ANKH 4KTUA 3SUDA 3KL6A 5A8XA 1O3IA 2VU8E 1G32B 2ZFSA 1EP5A 1O2NA 3S9BA 2HVXA 1HB0B 5EPYA 1GDQA 3U8OH 1W0ZU 1WCZA 1GWAA 1O2VA 4UDWH 3ZVBA 4HGCA 3MU0A 2VBCA 5F53A 2Y5HA 3RM0H 2Y6TA 1T4VH 1EAWA 3PLPA 3BTEE 1GGDB 4MLFB 3QGJA 2VWLA 5KECA 2J9NA 5CHBA 1O2TA 1KMHB 1NS3A 3WY8A 3C1KA 1P11E 1BRCE 3RC5A 1DUAA 3QTOH 3GICB 3TK6A 2OINA 2F9PA 1KXBA 1MTVA 1OWDA 1QQUA 1PJPA 1BBRK 1LHDH 1O2XA 1P01A 5E0JA 3BTWE 2JDID 1LKAA 1AFEH 1T8LA 3GY3A 4YT6H 1AE8H 1QA0A 3T62A 2Z3DA 1GL0E 2FYRA 1O3GA 1ZJDA 2EC9H 5DP3A 4VGCB 1F0RA 1E0FD 3E0NB 3UY9A 1O3LA 2A7JA 1C5LH 2P3UB 1VJAU 1Z8IB 3GY4A 2QXGA 1Y5BT 1EZUC 1ZTJA 3FP6E 1BHXB 2BDYA 2P8OC 1DFPA 2STAE 4Y76A 3UOPA 1C1OA 3N99A 1P2IA 2EQNA 2FX4A 2YNAA 4ISNA 1G36A 3RXJA 2FESH 4CHAB 1CU1A 1S81A 1AZZA 5C3NA 3PV4A 2J98A 1P2OA 2PGBB 2ZG0H 1O3CA 3IWMA 1PPEE 4FUFA 4MNWA 4ISLA 1TPOA 4DT7B 3F2GA 5JYIA 1O3JA 1W11U 2FEQH 3SNAA 1DX5M 2TPIZ 4ZAEA 4BAHB 1MKXK 3UQVA 1TGCA 1P04A 2ZTYA 2SGFE 3Q3YA 3MH7A 2SNWA 3QK1A 2V3MA 4MVNA 4OM9A 3Q00A 1UJ1A 1H8HD 2ZECA 3PMBB 1QRXA 1JRTA 3GCTG 2V7QD 1W12U 2BX3A 5ETXA 1TALA 1LVYA 1YPJH 1CO7E 1OP0A 3A7ZA 2Y7ZA 5DG6A 1C1UH 4X6NA 5JDUB 2TGTA 1A61H 1CGIE 1F5LA 3B8JA 3HPTB 3UAIC 1LHFH 4M9FA 4OS5A 3M5OA 1TPPA 4RT1A 5E8EH 1IQIA 4A92A 4ABIA 1BTUA 1A0LA 4ABDA 3RXCA 4FUCA 1ORFA 3ZZAA 4NIYA 2DUCA 2FOFA 1GMDG 1D3TB 2VH0A 4NIWA 2HPQH 1DUEA 4I31A 3E90B 1W7GH 1LO6A 4Q63A 2QGRA 1RS0A 1LPKB 2AMQA 3STIA 4ABGA 4I8LA 4FUGA 4JZIA 4ZHLU 2UWPA 2C8WB 4JYVH 1FN6A 3E0PB 3ZZ4A 1ZSJA 2BY8X 1EP6A 3OYPA 1TBQH 1BCUH 4YLUA 2AH4X 1YPGH 4TY6A 4X1QU 3TK5A 3FZZA 1HAPH 1EB2A 2OXSA 3LGYA 2P95A 1DY8A 3I29A 3ESTA 4FUEA 3SGBE 1UTJA 4CHAC 3EA9A 4RKJB 1NZQH 2RA0A 2PWXA 1SOTA 3TH3H 1QRWA 1O3AA 1KXEA 4OGYA 1P09A 4ZKRU 4Q4LA 1AZ8A 1HAZB 3RXQA 3EA7A 5F03A 1NM6A 1CGJE 2JH6D 3BV9B 4Y8XA 2AYWA 1PPBH 4X6MA 1GBKA 2ZGHA 1GVKB 5ABWA 5HGGA 1KSNA 5EPNA 4WXIA 2H9EH 3PRBA 3ZYDA 3A87A 2YMSD 1GMHG 3MH4A 4KELA 2FOGA 1ZMLA 2PGQB 4B6EA 2BD5A 1PPGE 2BTCE 1D4PB 2QA9E 3SV2H 1ZZZA 3BTDE 1W7XH 2HRVA 1BHXF 1SMFE 3SV7A 2ZPQA 1O2ZA 1L1GA 4XBCA 5A8ZA 1EB1H 3URDA 4XBDA 3TJVA 2WPMS 3SN8A 3WWFA 4H6SB 1AGJA 3T2NA 1UK3A 3TK9A 1Z8JB 2AMDA 2IJD1 2PHBA 2FXRA 1Z6EA 2J4IA 3SGAE 1MTWA 4LOYH 4MNXA 3EE0B 3OTPA 1TQ7B 3VB3A 1BJVA 1ELCA 1CT4E 5C17A 1Y3YA 1OOKB 3V7TA 4AORA 1BRBE 1TNJA 4WJG2 1A1RA 5AHGH 3D62A 3NWUA 1HXEH 1J8AA 3RU4T 2RG3A 2YOLA 3K6ZA 1C5YB 3SNCA 2GGVB 3AAUA 1HIAB 1QJ6B 5E0HA 4ZKNU 1LVOA 2J98B 1Z1JA 2L6OA 4Z0KA 5A0CA 1DICA 2B8OH 1EATA 3TGJE 2GCHG 1YKTA 3TH2H 1MZDA 2UUKB 2VVVA 2W6JD 5I46H 2O9QA 5G4BA 2ZU2A 3SHAH 1PYTC 4OS4A 1Y3UA 2VINA 3FN8A 3F9GA 2D8WA 1IQEA 5DN6D 3NRLA 1SGQE 2JIZD 2C8XB 1SLVB 2XNIA 3QN7A 1GHYH 3SU0A 3QO6A 1NRSH 3KQ5A 2G5NA 4CREA 2WINI 1QB1A 1TGTA 4NFEA 4YT7H 1YM0A 3AASA 1ZTLA 4Y10E 1GI3A 5L6NH 1DVAH 3SW2B 1FPHH 1LVMA 6GCHF 3OEED 1WV7H 4CR5A 4B71A 1O3HA 2VB0A 4DT4A 1O2HA 3RMOH 1NRNH 1O36A 2LP6A 4ZH8A 4HFPB 4DW2U 3PO1C 4CBOA 1EASA 4IW4E 4R8TB 1ETTH 1W0KD 2FPZA 1VCPA 1IHSH 2WSSD 3M35A 4ISOA 1GL1A 2TGDA 1GPZA 4U01A 4WH6A 1K1MA 1XUKA 2GT7A 3KCGH 3OFND 3F0OA 4BXSA 3T5FH 1PQAA 3FAOA 2C3SA 2J38A 2LELA 2ZI2H 2C4FH 3TH4H 2ZU5A 2AMPA 2XC0A 1BB0B 1ZLRA 1P3CA 3ZIAD 1SGIB 2GD4B 1MH0A 2K8IA 1E1RD 4Y6DA 1SLUB 4D76A 3QWCH 1NU9A 1PPHE 1D6RA 1EJAA 3W1EA 3HATH 5EGMA 1MKWH 3BIVH 1F92A 3DT0H 2PSYA 3RXIA 2R0KA 2WUBA 1TFXA 3RXDA 2VIPA 5J4SA 3PWBA 1CHGA 1IHTH 1GI5A 8LPRA 3RP2A 3LU9B 2KAIA 3BTGE 2A5AA 3SBKA 4GLYA 4ASUD 3ELAH 1V2JT 2ZU1A 5FHTA 2VGCC 2FLRH 2FIRH 2JJ2D 1C9PA 6CHAB 3NKKA 1SR5C 2WPHS 3M37A 4K60A 4Y8ZA 4ZMAH 4NA7A 3HK6B 1SKYE 2FOAA 4GHQA 1QJ7B 2BD9A 4AFZA 2PTCE 2W7UA 5T6DA 4ABFA 1LTOA 2AGGX 2IPHA 4ZXYH 2G5VA 1INCA 1GJ4H 1QGFA 1C1TA 3K65B 4E05H 2R2WU 4ABBA 2FI3E 9ESTA 4BAQB 3MU4A 1C1QA 1SL3A 2OBOA 3PLKA 4O97A 2Y81A 1PQ8A 1C5UA 1EUFA 5FBEA 3H09A 4HI3A 2RDLA 4INHA 4O3TA 4DOQA 2G52A 3ZVGA 1G9IE 3ZVCA 2QYIA 2HGTH 2EY4C 4MPVA 3VPKA 2JJ1D 2VWMA 1C5NH 2Z3CA 1J16A 2CV3A 3VG8A 4K1TA 2UWLA 2IPQX 3ATWA 4AFUA 2FS9A 5E0GA 5C2ZA 3A7VA 1UTQA 4MTBA 1O5CB 5EJ1A 2PV9B 1C5QA 2A45B 1OPHB 1ANEA 1YLCA 4JCNA 2PSXA 1C5RA 1LHEH 3RXMA 2BQ6B 1LQEA 1SQOA 1YPLH 1VGCB 1ZHMA 1WBGB 3ODFA 5FCKA 4DGJA 2VVUA 4SGAE 1GBEA 2BXUH 5C94A 1GVLA 1HAIH 1XXDA 1L4ZA 1ZYOA 3UB0A 5A0AE 3QUMP 5EQSA 3CENA 4TSFD 5T1VA 3ENSB 3CS0A 2GP9B 1CA0B 3A82A 2Q6GA 1GJ5H 1CT0E 1HAYB 1V3XA 3PB1E 1EKBB 1O32A 2W26A 2EI6A 4R0IA 3RU4E 4XSKU 3T25A 1LHGH 1YPKH 1D6WA 1T8MA 3ZZDA 1G37A 2ZCLP 1TOMH 1LDTT 1T8OA 3KIDU 1DSUA 3LPRA 3SJIA 3KEEA 2XOKD 3P8FA 1BJUA 1C5VA 1NFXA 2V6NA 3L6PA 1ZRBA 1G30B 3LGTA 3S9CA 1C2EA 3AVZA 3MH6A 4HG6A 2FS8A 1Y5UT 3EE7A 3UIRA 1IQLA 1QB6A 1V2VT 3PRDA 1YCPH 5EJZA 2NU3E 2A5IA 2A0QB 3TGIE 1GHBG 3SYJA 4ZHAA 1O3KA 1CQQA 2AGIX 3RXHA 1E1QD 3BTTE 2HLDD 1KIGH 3ZZ5A 5B6OA 5LPRA 7GCHG 1RXPA 1NT1A 5GNDA 3MO6A 1UVTH 1K1LA 4B2BA 4ZKOU 4Y7BA 4U30A 1O31A 3FFGA 3UR9A 1XKBC 1UK2A 1G3BA 2J97A 2YNBA 5DP7A 1UCYK 2CXVA 1OWJA 3BTFE 4FUIA 5EXLA 1ZMJA 2BHGA 2C8YB 2GZ7A 3VB4A 1S6HA 3VB7A 1SOZA 3GCOA 2QXIA 4OS1A 1C1MA 4IC5A 2J94A 2GCTC 5HM9A 1AB9C 1P2JA 1ZRKA 2TGAA 4O3UA 1THSH 3L3TA 3RXVA 3WW7A 1C4Y2 1A5IA 2Z6BD 4B6FA 1HFDA 2PKSB 2I6SA 5KEDA 1GHAF 4A1XA 3ODDA 3BEFB 1KDQA 4MNYA 1FY4A 1FAXA 2Y7XA 4KTSA 1ZTKA 1AVXA 3ZV9A 5DP4A 1GMHF
chains in the Genus database with same CATH topology
4MNVA 3GCHB 3NXPA 4ESTE 1TONA 2ZNKH 1PYTD 2A1DB 2GZ9A 2XWBI 1F0TA 2CJIA 2K1QA 3LOXA 1O2PA 4JYTA 3RXFA 4ABAA 2CGAA 1MAYA 1YP9A 4J2YB 1O3MA 1TBRH 2ZTXA 4A5TS 5ESTE 1NFWA 4MG3A 3FANA 5GIBA 1CSOE 5FX6A 4ZUHA 3KQCA 1WYKA 1F2SE 1HRTH 3ZVAA 1BMLA 3JZ2B 1XUIA 3M61U 1BMAA 2ZDVH 2ZDAH 1GI7B 1AQ7A 2R3YA 1XKAC 1MD7A 1JBUH 1UTKA 4K3JA 4RN6A 5EQRA 2BD2A 3RUOA 2OC8A 1HJ9A 3NK8A 1SHYA 2XBWA 2M5TA 5C1YA 3F6UH 4DURA 3FP8E 4K8YA 1ELBA 1F0UA 1ZGVA 2WPIS 3U8TH 1QNJA 2ZWLH 4UFDH 1SSXA 1TLDA 4WY3A 1KXCA 3SQEE 1MBMA 3QZQA 3LDXH 1NRQH 1T4UH 3GY8A 1GMCG 1GG6B 2HALA 1Q31A 2HNTC 1C1SA 4AN7A 1Y8TA 1TWXB 4ISIH 5GXPA 1C4V2 1H9LB 1RIWB 1Z71A 4X0WU 1P12E 1O2SA 1KLIH 4Q80A 2UWOA 4ABHA 1MZAA 1C2FA 1G2LA 1S0QA 1QR3E 3BIUH 1C1VH 2VIOA 2IJOB 1BTYA 2ZTZA 3QLPH 2NU1E 1DY9A 3ZZ9A 1ELAA 3SZNA 1V2WT 1O5AB 3L33A 2FDAA 1FPCH 2ZGJA 3MNXA 3GCTF 1SFQB 1ABJH 3RMMH 1HAOH 3M5LA 1C1RA 4BTIB 1LHCH 1A3EH 1O5GH 4TPIZ 1THPB 1GBMA 1TA2A 4Y0YE 4YOIA 2DE9A 3HGPA 1H4WA 3OU0A 2ZQ2A 1VITF 1JXPA 4IBLH 3MYWA 1YF4A 4NFFA 5JB8S 3TLOA 2BY7X 5T3HA 3TIUA 1L1JA 1FAKH 3R0FA 3A85A 4BAMB 1UTNA 2P8OB 1AN1E 1RTLA 1YYY1 1ZSKA 3DA9B 1AUTC 2J95A 1QB9A 4WMEA 2SFAA 1O3EA 2SNVA 2AGEX 1P06A 3OY6U 1C5MD 1O2IA 1T32A 3A8CA 1TIOA 1OWHA 2XTTB 4CRFA 2FOEA 1L2EA 3P6ZB 1Z1IA 4UEHH 1J14A 4MDSA 1DXPA 3RMLH 4YOGA 1PQ7A 2W3KA 1ESAA 2G55A 1XVMA 1G3DA 3U9AH 1BT7A 2BD7A 1MUEB 3LONA 3MMGA 4B2AA 5EW2H 5HM2A 2OQ5A 3NPSA 1AMHA 1E36B 3SU4A 1B0EA 1YCPK 2OUAA 2IN2A 1OWIA 1K1OA 1BITA 1TRNA 3OTJE 1C2GA 1TBZH 4UONA 2A2QH 5JBTA 2ZHEH 1DSTA 3MO3A 2NU0E 1AKSA 1ZR0A 3ZZ7A 1BMNH 1RRKA 4B76A 5EXNA 1UMAH 2BB4A 1HYLA 4X2YA 1OYQA 3GYMA 3IG6B 1K9OE 4DJZB 5GCHG 1HV7A 4X2VA 2BLOA 1HAXB 3Q76A 1MKXH 1K1JA 2GVFA 1L1NA 3CP7A 3F9HA 3P17H 5F6MA 2ZDNA 4INLA 1O2GH 2CN0H 2W3IA 1GHZA 1CT2E 1SGCA 1CA8B 3VXEH 1AB9B 2QAAA 1GI4A 1FQ3A 1NFUA 1W2KH 4K5ZA 1WUNH 2WYJA 1DM4B 1TABE 2H5CA 4GUXA 1C5TA 1UK4A 1H1BA 3MH5A 1AVWA 1MCTA 4I8JA 1O34A 3EDXB 1TOCB 5EQQA 1FY1A 2BY9X 1A5HA 3T26A 5DP8A 1H8DH 3PMJA 3FVFB 4O03A 4X6PA 1F0SA 1GCTC 2R2MB 2FTMA 5L2ZH 1MAXA 3VFEA 1MKWK 2OCVB 1EAXA 3VXFH 3MI4A 4NWKA 1AE5A 3PTBA 2C93B 4YO9A 5CE1A 1NN6A 3EQ0H 1UHBA 4X1PU 4AB8A 3UR6A 2ZO3H 3A81A 3LIWA 1O2JA 1O5BB 4DG4A 3K2UA 2QIQA 1TRYA 2PR3A 2ZIQH 2PKAB 3SGQE 3UNSA 2JETB 3R3GB 2ZU4A 2B0FA 1K1PA 1MBQA 3VB6A 4MPWA 3SU1A 3UNQA 1WSSH 1BTPA 4FXGH 2Z9KA 4IN2A 1O3FA 1HXFH 3VEQB 1DDJA 2F9UA 2FM2A 1RD3B 1P10A 1FIWA 3BG4C 1E34B 2C90B 5IDKA 3TGKE 2FOHA 1PPCE 1GHXH 4ZXXH 1A4WH 1BTZA 5EU8A 4OGXA 7GCHF 1EZSC 3HKIB 1CGHA 3PWCA 1JWTA 1S6FA 3GOVB 1SQTA 1BUIA 3M5MA 1BBRE 1N8OB 1TMUH 1C5SA 3LC3A 2RA3A 1GJ9B 2BDGA 2ODYB 5LPEA 3UPEA 1O2UA 1XM1A 1QFKH 1YC0A 1P2KA 2LPRA 1VGCC 2PLXA 4B75A 1EJMA 1CBWC 2V3HH 1RFNA 2WYGA 3A80A 3DUXH 4AZ2B 2ANWA 2CMYA 2O8WA 2WUCA 1SGYE 2R9PA 1FY5A 4YOJA 1K1NA 2BXTH 3MNSA 4D9RA 1SHHB 2ZKSA 1RIWC 1EJNA 3TVJB 1LKBA 1NY22 1QTFA 1MMJN 2FOBA 2ZFQH 1PPFE 4ZKSU 5EW1H 5EOKA 4K69A 5JBAS 2O8TA 3A8BA 1G3EA 2DE8A 1FXYA 4TPYA 3LGUA 2ZDMA 1GG6C 1V2QT 5JB9S 2XCFA 2Q1JA 2FYQA 1ZOMA 5JBBS 3RXKA 2G4TA 1GBFA 3RU4D 1AIXH 1MU6B 2FLBH 1IQFA 1TGBA 1ELTA 4WH8A 2VIVA 4WF8A 4X8VH 1ELDE 2ZQ1A 4BXWA 3SV6A 2ZFTA 3V12A 4MPXA 4NA8A 1LVBA 1GHAG 1SGEE 1XXFA 2BYAX 4XBBA 5AVDA 1P05A 1Y3WA 1P9UA 1ABIH 3GYLB 1DWDH 4GCHG 4IGDA 8KME2 1SC8U 4A1VA 3NZIA 1A2CH 1JMOH 3UFAA 3GDVA 1C2IA 1B0FA 1ZPZA 4CRAA 2OBQA 1KYNA 5L30H 2ZC9H 1T7CA 1A0JA 3OX7U 1A0HB 3RXUA 3NUMA 1W13U 1AI8H 1VZQH 3E3TA 3E1XB 2FWWA 4IC6A 2VVCA 1HAVA 1XMNB 1Z6JH 1EOJA 1GI9B 1UTLM 1X7AC 1IQKA 1UCYH 1C9TA 1GMCF 4ABJA 2GMTC 1ZGIA 3GCHC 4K1EA 3GDUA 2Q6FA 3FZDA 1UHBB 2ILNA 5FPSA 4OS2A 1RGQA 1TNHA 2H6MA 5DO4H 5C1UA 2UUYA 4X2WA 5CHAB 4NWLA 2PKSC 2QN5T 4B73A 4GHTA 1S84A 5JBCS 5PTPA 1HUTH 4X2XA 1EAUA 1M9UA 4XE4A 3MNCA 3LJJA 1PFXC 3QDZB 2GCTB 1IQMA 3G01A 3HGNA 2BD3A 4H6TA 2Y80A 3UOUA 3PO1B 1DWBH 1FIZA 1LCYA 2VNTA 5C20A 3OSYA 4HZHA 4JMYA 3O8CA 3BSQA 2ALVA 2ANMH 1XUFA 5AF9H 1E35B 5LGOA 2ESTE 2ZGXH 4Q2KA 1AFQC 1XX9A 3LH1A 1NESE 2PFEA 2B9LA 4FU7A 3BTHE 1E38B 1P03A 1NRRH 3BF6H 2TBSA 1GBIA 5C67A 4FVDA 1KDQB 2QF0A 4OS6A 1O5EH 1GBHA 3H5CB 4WMFA 3BTQE 4X8TH 2BVSH 3DFJA 2VH6A 3EAJA 4BTUB 2Z7FE 4FU9A 1G2MA 2QC2A 1O2LA 1VITH 2Z3EA 3F9FA 1K1IA 2W7SA 5DP6A 1GJAB 1O3NA 1V2MT 2SGPE 1AUJA 1BIOA 3BN9A 1H8IH 1LQDB 7KMEH 2ZDKA 2PUXB 1TNKA 3ZYEA 1F7ZA 4Y79A 5F8XA 1Y59T 3ATMA 3SO3A 2ZHWH 1GJCB 1BQYA 1O0DH 8ESTE 1WQSA 4CH2B 1NTPA 1TNLA 1QURH 3SHCH 5E2PA 3F9EA 3GY6A 1WTHD 4FUHA 1EPTC 2RCEA 1V2KT 3GY7A 3HKJB 2XYAA 4TWYA 4X8UH 3QZRA 3PYHA 2ASUB 3H7OA 4K2YA 1OKXA 4JZFH 3UWJH 1WU1A 3MU8A 2A4QA 1UTPA 3QTVH 3MFJA 1DITH 2BMGB 1FDPA 4Q7XA 2GDDA 4DIHH 1AFQB 1SGPE 3TPIZ 2SGEE 2XRCA 4WVPE 1KTSB 4CBNA 1DT2A 1MQ6A 3A7XA 1C2MA 3P8GA 2Q6DA 4O9VA 3SI3H 1O3BA 1LPZB 1OYTH 2VWOA 1C5OH 1QL7A 4J1YA 1GHVH 3V3MA 3HK3B 2PW8H 1W0YH 1EXFA 1GBJA 4NCYA 1UO6A 4Y8YA 3VGCC 1THRH 4AG2A 5FPTA 2J92A 1OSSA 2FI5E 1Q2WA 2ODPA 1TX6A 1OX1A 1GI0A 2QCYA 2FP7B 3U1IB 8GCHF 5J4QA 1OXGA 1NO9H 4NZQA 5CHAC 2BDHA 3MU1A 4NIXA 1IQHA 2R0LA 3LJOA 3A7TA 3U69H 1BTHH 3PM3A 1O3PB 2G00A 3U1JB 3RC4A 1GJ8B 3P8NA 1QIXB 1HBTH 3PMHB 2H2ZA 3ZZ3A 1F5RA 4F4OC 4NG9H 5GPIB 2XWAA 2ZHFH 4FUBA 1XUJA 4NSVA 1A46H 1RTKA 1FV9A 1TGSZ 1C1NA 1MTUA 2QF3A 2H9TH 1SVPA 1SQAA 1DWCH 4DVAU 3M5NA 1SBWA 1QJ1B 1TNIA 3V0XA 2ZDLA 3M3SA 1Z8GA 1H9IE 1TNGA 3I78A 3T28A 6CHAC 1XVOA 1ESTA 1HAVB 1NFYA 2BDCA 2VGCB 1FMGA 2P3TB 2SGQE 1N1LA 1TMTH 1FI8A 3M7UA 3MWIU 1P8VC 4TY7A 1DXWA 1DWEH 2BY5X 3A7WA 4IS5A 3SUGA 4GAWA 1GI2A 1Y5AT 1AD8H 4AFQA 4CRCA 3KGPA 3SU6A 1ACBE 2A4OA 1C5PA 4UFEH 1P9SA 2BOKA 3LH3A 1P02A 4YLQH 4OS7A 3TITA 3GDSA 3ZVFA 3EGKH 3T29A 2AFQB 4CR9A 2V35A 4X6OA 2Y5GA 3PTNA 5EG4A 3RC6A 1C1WH 3MNBA 3F1SB 3GY2A 3KNXA 1DE7H 3IITA 1GJ6A 3S7HB 4AGKA 1B7XB 1QBNA 3KQBA 1TA6A 1L4DA 3SU3A 1GBTA 1O33A 2D2DA 3T27A 3SJ9A 4BOHA 2A7HA 1HAHH 2HNTE 1S5SA 2HLCA 1G3CA 1TRMA 5GJ4B 1MU8B 3STJA 1UTMA 1SGFG 1GJDB 2VIWA 2GZ8A 1QL8A 4F49A 1PQ5A 1A7SA 4K1SA 3S7KB 3DD2H 1TX7A 1BRUP 4NSYA 2BD4A 3A86A 5DGJA 4BNRA 1AU8A 2A5KA 1FLEE 2Z9JA 5FBIA 1HJ8A 4M7GA 1V2NT 4B1TA 1WAYB 3LT3A 4E7RG 1KLTA 1ELFA 2FTLE 1GCDA 2XXLA 4NGAH 2OQUA 5T6GA 1GJ7B 1O30A 1TMBH 3M7QA 4I8GA 4IMZA 3MTYA 3O8RA 1YPMH 2CF9H 2FOCA 2CF8H 2BVRH 3SQHE 3SJKA 5ESBA 3SNEA 5I25A 1BA8B 1OS8A 4I7YH 1F5KU 2EA3A 3UTUH 1HPGA 2JETC 3M3VA 4CRGA 1O2KA 4X1NU 1T8NA 1DPOA 1J9CH 4VGCC 4LZ1H 2Y5FA 3P92A 1OP8A 2UUJB 1C2DA 2FO9A 1TPAE 3I77A 1SI5H 3AAVA 2SGAA 1JRSA 1V2PT 5TCCA 1Z8RA 2BDIA 1V2UT 3ZV8A 2EEKA 4Y11E 8GCHG 1KY9A 1J17T 5A8YA 1O2RA 1AO5A 2JH0D 5DPAA 2ZPSA 1GGDC 2A7CA 1FN8A 1W10U 1UTOA 2XC5A 5HYOA 2NWNA 4I8HA 2ZFFH 5A0BA 2Z94A 2BOHB 2VWNA 1NPMA 1Z7KA 4U32A 1J15A 3TJNA 2UUFB 2AEIH 4UFFH 1YGCH 1IAUA 6ESTA 4D9QA 3W95A 1UVPA 1YBWA 1AWHB 2WPKS 2XC4A 1C4U2 2VIDA 3MU5A 4AOQA 1LMWB 2PUQH 1D3PB 1GI8B 4YM9A 1GMDF 4ASHA 2FMJA 4NIVA 3S9AA 3W94A 3M36A 3AW1A 1QHRB 1C5WB 1MTNC 2BLQA 2G51A 1O39A 1O5FH 1O2QA 2HPPH 4NZLA 2GCHF 1O5DH 1EZQA 1S0RA 1D9IA 3LGVA 2TIOA 1DLKB 1W3CA 1KXAA 1SGDE 3QX5H 4LK4A 3P8OA 2QV1A 1ELGA 2OD3B 2V3OH 3GCNA 3CS7A 5K0HA 1YPHE 4K8BA 1GI6A 3S0NA 4I8KA 2P16A 1O2MA 1Y3XA 1A3BH 5A2MH 3P95A 1MTSA 3RDZA 1JIMA 3E16B 2G4UA 1TPSA 2ZCHP 5DP5A 5CMXH 1GDUA 1TYNA 5FXLA 2W5EA 2EI8A 4A1TA 5JPMH 2P59A 4XOJA 2BDBA 1TB6H 1UVOA 3KQDA 1GBCA 1YPHC 3RXTA 2A4GA 1VJ9U 3Q3KA 1WQVH 1W8BH 5T6FA 3H7TA 4B2CA 5E2OA 3U8RH 1O2OA 2TGPZ 4WXVA 4AB9A 6LPRA 1BOQA 4HTCH 3JZ1B 4U2WA 4JK6A 1BBRH 1ANCA 1ZJKA 2BLVA 1FONA 1AY6H 4AFSA 1DANH 1SGTA 3ATIA 5A09A 3UQOA 2XBVA 4D7GA 1S85A 2ANYA 1L0ZA 1CVWH 1TAWA 4X1SU 1ARCA 1TE0A 2Y82A 1ETRH 5BPEA 2GV6A 4KP0A 4AYVB 1V2ST 1S83A 1NC6A 2ZF0H 1SLWB 3TJUA 3F68H 1ANBA 1K2I1 1O3DA 2H1UA 3A88A 1KLJH 2A32A 4DIIH 1C2LA 1GHWH 2WV4A 3URCA 1K21H 2QY0B 2V0BA 1PPZA 4AYYB 2BM2A 3A84A 1NRPH 2OC1A 4E06H 4BTTB 3EYDA 3RXSA 1O3OA 4Y0ZE 5HXFA 1YLDA 1KXDA 1P0SH 1V2TT 1K22H 4JYUH 2J34A 3RXPA 3KN2A 2H9HA 4Q7ZA 1ZMNA 4FU8A 4MPUA 2GDEH 1AWFH 2FZZA 3ZZCA 1LPGB 3PROA 5FAHA 3RXBA 3RLYH 3BTME 1QRZA 1SGRE 2F9VA 5F8ZA 4JK5A 2BY6X 1QY6A