4X2XA

Crystal structure of the murine norovirus ns6 protease (inactive c139a mutant) with a c-terminal extension to include residues p1 prime - p4 prime of ns7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
176
structure length
166
Chain Sequence
SIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTGGTIPGDAGCPYVYKKGNTWVVIGVHVAATGNTVIAATHGEPTLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of Murine Norovirus NS6 proteases with C-terminal extensions designed to probe protease-substrate interactions.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Viral protein
molecule keywords NS6 protease
total genus 28
structure length 166
sequence length 176
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2xA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2xA01
1BTHH 1T8MA 1ETRH 1C4U2 1LHEH 1TPAE 1SC8U 4THNH 4YT6H 4BTUB 3RXEA 1G30B 4NWLA 2FS9A 3UNQA 1BMMH 1SGQE 3ATIA 1SGRE 5FPYA 1JXPA 4X2VA 1O2TA 1TX7A 3V12A 3FANA 4ZHLU 3ZZ7A 3HATH 1QL8A 3PB1E 1SFIA 2D26C 2HRVA 2ANMH 3B9FH 1CA0B 2ASUB 3Q77A 3PO1B 2ZCHP 1HFDA 3U98H 2WYGA 5DJ7A 2WPLS 1MU6B 1O39A 3LGUA 3ZVAA 1ELFA 1W2KH 1D9IA 1LQDB 1EXFA 4D7GA 1J9CH 1PPFE 1CGJE 4I33A 1HNEE 1RIWB 2BDCA 4BAHB 5A09A 2XNIA 4Y8XA 1TGSZ 2XW9A 3RXVA 1JRTA 2BLWA 4JZDH 4E7NA 1C9TA 3QDZB 2FEQH 5EQQA 3VGCB 5HXFA 3ATMA 5F03A 1W7XH 4UDWH 2BY5X 5DPAA 3RC5A 2Y81A 4OGXA 2Q1JA 1AWHB 3SNDA 4UEHH 1INCA 3DFLA 1GMCF 1GBHA 4WWYA 2P8OC 1MD8A 3VB7A 1WAYB 4B76A 4M7GA 2BXTH 5C2ZA 3MO9A 4I8LA 1O3JA 5A8YA 7GCHG 1SSXA 1NROH 1G37A 2KAIB 1RRKA 4U01A 1UK2A 3MO3A 2VIDA 5BRRE 1ZMNA 2R0LA 1TNIA 2RG3A 2BD7A 1N6YA 4ZHAA 1MTSA 4A1TA 4CBOA 1RTFB 2FESH 1XXFA 3E16B 4X8SH 1D6WA 1BA8B 3R0FA 3HPTB 4D9RA 1O5FH 1CT2E 1FAKH 3BTGE 3CP7A 2H2ZA 1S81A 3QWCH 1ELVA 2HOBA 2FXRA 4K1SA 4DCDA 1O5EH 1C2IA 1OWIA 4ZKOU 4AB9A 4VGCC 1BTZA 5JB8S 2BD4A 1LO6A 1TABE 3S7KB 3GY5A 1ZYOA 2ZHDA 1HBTH 2ZCLP 2Y7ZA 3RXAA 5C1UA 5JPMH 1B0EA 3MU1A 1WTGH 2QA9E 4O9VA 3QN7A 2NU3E 3PMHB 1LQEA 4Q80A 2SFAA 1F5RA 4CH2B 3BTTE 2ZU3A 1E38B 2QYIA 1BJUA 1E34B 4NZLA 1FUJA 2ANWA 2BTCE 3LU9B 2WPMS 1QURH 1ZMJA 3A88A 4NWKA 1QQUA 1HAPH 1T4VH 1KIGH 3D23A 1P04A 1SGFG 4DJZB 1C2HA 4FUGA 3RLWH 1O2JA 2XBXA 1O3OA 1MTWA 2WV5A 3BG8A 3V0XA 1UVOA 3SV2H 2ZHQH 5A0AE 3GCHB 2Y5FA 1P8VC 2CF8H 5FX6A 2GT7A 1LPGB 1GBLA 2LNCA 1BT7A 3A7XA 4BXSA 4XE4A 1KXCA 1UVTH 3S0NA 1YBWA 4GVUA 1H9LB 1O3BA 1S84A 3AW1A 1QQ4A 4TPIZ 1K1OA 1P01A 3RUOA 3LGWA 5HM9A 4YM9A 1ESBA 5E8EH 1IQLA 5FBIA 5E2OA 4OS1A 1K21H 4U30A 1THRH 2KAIA 1BMAA 4BNRA 4BTIB 1OWHA 1GWAA 2FI5E 1C5QA 3CS7A 3P8FA 4WF8A 1MCVA 3JZ1B 4XFQA 5DK1A 3VXEH 5JB9S 1TX8A 4AYYB 1AUJA 4FUIA 1DWEH 1AIXH 2W3KA 2GCTB 3ATWA 2O8TA 5DP9A 1EKBB 1EASA 2ZG0H 3RLYH 1TRNA 3TK6A 3Q00A 1YM0A 1FIZA 1Y3VA 2BLOA 2DE9A 3EAJA 1E0FD 2F83A 4KELA 4NA9H 3QGNB 3S9AA 5F6MA 1D3DB 5L2YH 1HAZB 4ABFA 3P8OA 3DD2H 3FP6E 4Q7ZA 3URDA 9LPRA 1W3CA 4FUBA 1NU7B 4GSOA 1F5KU 4CRAA 2GZ9A 1F0TA 4D7FA 1BTYA 2V0BA 1O2LA 5JYIA 2YNAA 2A2XH 1BRBE 4AORA 4KTSA 4KP0A 1V2TT 2G52A 2XYAA 1HAVA 4CRFA 1IOEA 2ZCKP 1K1JA 1ZHPA 2FWWA 1C1OA 3C27B 3Q3YA 1QB6A 1Z8IB 3GY4A 1FPCH 1NZQH 2PR3A 2Z9IA 1NFYA 1PFXC 1Q3XA 1GVZA 1G3CA 3O8BA 1GHWH 1MQ6A 4DVAU 4MPUA 1PYTC 2GZ8A 3TJOA 3TK5A 2ANKH 1ELGA 3RMNH 1HRTH 4WJG2 3DFJA 4X1RU 2PGQB 1QHRB 2Q6FA 4YOIA 4A7IB 3F9GA 1QCPA 2VVUA 1C1VH 1F0SA 1G2LA 1C1PA 1W14U 1D6RA 1F5LA 1L2EA 4NA7A 3ZV8A 3HK3B 4AFUA 1P09A 3P8NA 3RC4A 2BX4A 3GDSA 1P2QA 1N8OB 5FPSA 1BHXF 1DS2E 1V6DA 2A5KA 1SOZA 1DWBH 1IHTH 2A45B 2GGVB 1VCWA 3RC6A 1A0LA 2ZZUH 3PYHA 1KYNA 2G51A 1V2MT 1FY4A 8LPRA 1ZPCA 4FU7A 5JBBS 1NS3A 1Y3YA 3TJNA 4NA8A 4O3TA 1RGQA 1C1RA 2Y80A 3PROA 1K1IA 1D4PB 1SGFA 4F4OC 6CHAB 2OC1A 4QT8C 4ZKNU 2BQ7B 5EPNA 1D3PB 4NCYA 1Y3XA 1T32A 3UNRA 1S6HA 3RXGA 1BB0B 1MMJN 1XKAC 1P11E 2ZDLA 3LJOA 3A8CA 1LDTT 1BZXE 4YLQH 1EQ9A 2ZDKA 4JZEH 5PTPA 3WY8A 5AVDA 5C3NA 3MU5A 4ZROA 1BMLA 1O2OA 1XUIA 3SJ8A 1ZHMA 2ZPRA 1KDQA 4KKDA 2BY6X 2GKVE 4K5ZA 5LH8A 3N7OA 3RM2H 4Y8ZA 2FX4A 1AN1E 3QZRA 3A80A 1BTXA 1O32A 2BVRH 3M36A 1GMHF 3STJA 5A8ZA 2Z3CA 3GCOA 4IW4E 4R8TB 3U1JB 1SVPA 5HGGA 1DLKB 2EI7A 2R3YA 1RS0A 3U1IB 1GBMA 3MH7A 5E2PA 2QV1A 1TLDA 2IN2A 1AZ8A 3BTQE 1NRNH 3FZDA 1GJCB 1GHBF 3SI3H 4UD9H 1AFQB 1O3PB 2OINA 1YGCH 4KTUA 3BV9B 1T8NA 2Q6DA 1YCPH 3QTOH 2PHBA 3RXMA 1G3BA 4X1NU 1AE8H 1EPTC 1GMHG 3NZIA 1O33A 1YCPK 2ZFQH 3KQCA 4Y7AA 2BY8X 1KTSB 3BEUA 3URCA 1NTPA 4HFPB 1GHAG 2V3HH 5LPRA 3F1SB 1YP9A 1GBDA 4I31A 2PUXB 1DXWA 2ZPSA 4Y8YA 4CRDA 1GHXH 3UPEA 3RU4E 4A6LA 3UREA 1ZOMA 8KME2 2H9EH 3BG4C 1XVMA 4YOGA 5JBTA 1QJ7B 1BJVA 4INKA 3KEEA 1TNHA 4Q7YA 2B7DH 2FOHA 2WV4A 1ZRBA 2G55A 2PGBB 1SB1H 2XC5A 5FCRA 2ZGXH 1TFXA 1JOUB 2QF3A 2ZA5A 2ZPQA 1ZPZA 1F2SE 1PPCE 3A7WA 1K1PA 3VGCC 5EXMA 1C1TA 4ZKSU 1NFXA 1E37B 1ELAA 3MNBA 1GJBB 1O3LA 3S7HB 1Z8RA 1KSNA 1YPJH 2STBE 4JYUH 4MVNA 2OC0A 3ZZBA 1V3XA 1HGTH 1ZPBA 3EDXB 3HKIB 1CHOF 1AO5A 5C5NA 5C1YA 1C5VA 1F0RA 2B9LA 3L6PA 3V13A 3ZVCA 2D8WA 1KXAA 4HI3A 4GAWA 1EB1H 5A0BA 4X8VH 1K1LA 3EQ0H 3ODDA 2EEKA 2ALPA 3BEIB 1DVAH 4B71A 4I8JA 2C8YB 5HMAA 4JZ1A 1YLDA 1P2MA 1DUAA 4X2XA 4Y7BA 3MNXA 2FLBH 1TRMA 4OS7A 3MO6A 2Y82A 1HUTH 4E06H 3E1XB 3M3TA 1KXDA 1PYTD 2VWMA 3M61U 1TNJA 3DHKH 1NN6A 5IDKA 3BN9A 2QXJA 3SU0A 2BOHB 3VB3A 3RXLA 1CVWH 1O2ZA 1P0SH 2C3SA 2VIQA 3NWUA 3EA7A 2QAAA 3OY5U 5EPYA 1P02A 1H4WA 2FM2A 4ABBA 1SQAA 5K7RA 1HAXB 5GJ4B 1DY8A 1V2LT 3DUXH 2DUCA 2FOEA 5CMXH 2OXSA 1CA8B 3O8DA 4U2WA 3SNCA 3UY9A 1LMWB 2G4UA 1RD3B 1YCPM 4NZQA 1Y5UT 1GJ8B 1MKWH 1GI6A 1CGHA 3KCGH 1DUEA 2VGCB 1C5LH 2VIOA 2Y6TA 2D2DA 1SPJA 4NSVA 1QB9A 5BPEA 2A4GA 5EQRA 2FP7B 1LVBA 3AAUA 5L6NH 3ZZ5A 4FUCA 4FUEA 4MG3A 1HV7A 1GGDC 2FZZA 2OCVB 4IC5A 2P93A 1C1NA 3TH4H 1PQ8A 1G9IE 1O31A 2NU1E 3PWCA 4GCHF 2ZDNA 3RU4D 1ZTLA 2JETC 3KL6A 1GG6C 1TGNA 4PROA 2GMTB 2ZFSA 3LIWA 8GCHG 1P05A 1XMNB 5CE1A 2BB4A 2QXGA 2FOGA 1J14A 3TPIZ 1MBMA 3HK6B 3EE0B 2QC2A 3ZVDA 1GDQA 3TNTA 3SUFA 3KF2A 2ZGBH 2IJOB 2CV3A 1TOMH 1UTMA 3U8TH 1HB0B 2J9NA 5AFZH 2FLRH 2QIQA 2QN5T 3ITIA 1EAXA 1OSSA 3D65E 3ENSB 5EU8A 3A82A 3P17H 3ZYEA 2JH5D 1P2NA 3A7TA 1KXBA 5C20A 4ZHMU 1P10A 2A7CA 4CRCA 3FFGA 5EG4A 1Z1IA 3GY6A 1V2RT 4OS5A 1AQ7A 2SGQE 1K28D 2AEIH 4K1TA 1CO7E 1Z8GA 3GICB 1WTHD 3O8RA 1DDJA 1FY8E 1BOQA 1GI9B 2OD3B 1B5GH 2BD9A 1Z71A 3LKWA 2PUQH 1WSSH 3C1KA 1LHFH 1UK4A 3A87A 3UFAA 2Z9LA 3ATLA 1S5SA 1TWXB 4NSYA 4JK5A 2ZP0H 1DY9A 4TPYA 4K60A 2VIPA 1C5PA 1O38A 1YKTA 2A7HA 1C5RA 1C5WB 3MNSA 1CU1A 3QO6A 3ZYDA 3O8CA 1GVLA 3M5LA 1W8BH 4B73A 1MTVA 2K1QA 1H8IH 1QGFA 1HJ9A 4CRBA 1LVOA 5FXLA 2WINI 3M5NA 1SGCA 2V35A 3RXKA 3SI4H 3OU0A 4ISOA 1W7GH 1MTUA 2SNVA 1O30A 5IYTA 2R3UA 1MBQA 2B8OH 1SLXB 1NRQH 1UVSH 1ELCA 1EAUA 1C2JA 1QRXA 1SQTA 4FUHA 2W7SA 1LCYA 1FLEE 5A2MH 4ISLA 1TE0A 3GCTF 4NG9H 1C5UA 1EUFA 1TB6H 1TMTH 1Y3WA 4HZHA 4ZXXH 1HXEH 1A3EH 2F91A 2JH6D 4U32A 3GDUA 1ETSH 1UJ1A 4NFEA 4OS6A 1UVUH 1TMBH 4ASHA 2BDBA 4XBDA 3SU3A 4DGJA 2OC7A 4UONA 2F9PA 3FZZA 1W12U 4FU8A 1MUEB 1V2VT 5E0HA 1GBTA 2G8TA 3RXPA 2AIQA 1EP6A 2GD4B 1OP0A 2C8ZB 5J4SA 1BUIA 3RXIA 1CT4E 1NC6A 4UFEH 1ZSKA 3T27A 2PLXA 1GI3A 4Y0ZE 4NFFA 4ZMAH 1UTOA 3SU4A 3ZZDA 1UCYH 1L1GA 1WBGB 2UUYA 2BDAA 1MKXK 1XKBC 1DM4B 3GCHC 3OSYA 7ESTE 3PLBA 1JRSA 1CHGA 3AVZA 6LPRA 4OS2A 4E05H 1UHBB 4X2WA 1CBWB 2BYAX 3H7TA 4CHAB 1ZHRA 3E6PH 3SN8A 2D1JA 2H6MA 1ANBA 2GDEH 1VZQH 1FDPA 1RTKA 3E8LA 3VB6A 1UTJA 2VWOA 1LPZB 2P95A 3GY3A 2ZNKH 2HWLB 4A1VA 4B75A 1P2OA 1CA0C 1HJAC 1XX9A 1QL9A 3MNCA 3OYPA 1SG8B 2SNWA 1DT2A 3I29A 1XM1A 3MTYA 3UTUH 3MH4A 1RFNA 1MTNB 2XC0A 3PMBB 1ELBA 1BRCE 3SORA 1HAOH 1M9UA 3SO3A 2XCNA 1IQGA 1SGEE 2PKSC 1W10U 3A86A 4X6NA 2OC8A 1BBRK 1KDQB 1AVGH 3FVFB 2YNBA 1QRWA 3PWBA 2TRMA 4UFGH 1AB9C 1AVXA 1UTQA 2H5DA 1CGIE 2F9OA 4BTTB 1QTFA 2OBQA 4AFQA 2G00A 1N6XA 3SU1A 4MNXA 2Y5HA 1AE5A 5CHAC 1CQQA 1O2KA 1TIOA 1GJ4H 5DG6A 5GDSH 2PWXA 3TGIE 4WH8A 3SGAE 1WU1A 1ANCA 2SGEE 3DA9B 1LHGH 1V2ST 4CREA 1SFQB 3T2NA 2ZDVH 1O2GH 1TBRH 3FAOA 3ZZ3A 2BQ6B 1C5ZB 3RP2A 3QGJA 4LOYH 1OYQA 5EQSA 3MOCA 3A7VA 4B2CA 1MTNC 2J34A 3A8BA 1FY3A 1A61H 5F8XA 1BMNH 2ZECA 1O3KA 2R2WU 2TPIZ 7LPRA 3PV4A 2XCFA 5EXNA 3MU0A 1NESE 5AF9H 3LT3A 1K1MA 1GJAB 1H1BA 4NIYA 2FOCA 1W0YH 2SGPE 1O2RA 3JZ2B 2ZFTA 1ARBA 1C5NH 2R2MB 3LDXH 1BBRH 1AKSB 2PKAB 4K8YA 1RXPA 2BZAA 1P2IA 1GG6B 2NU2E 3PTNA 3PMJA 3EA9A 2WPKS 1CBWC 3ZVEA 4TWYA 2UUFB 3I78A 3BSQA 1VGCC 1AUTC 3A8AA 4IS5A 3SGQE 2QY0B 2HALA 2GT8A 1UCYK 4DG4A 1B7XB 1TONA 2R0KA 1OP8A 1VJ9U 1C2KA 1P2JA 1SQOA 1T8LA 4ESTE 4KGAA 4LZ1H 1V2KT 3E90B 8ESTE 4X8TH 2BX3A 3SUGA 2G5VA 2NWNA 4XSKU 4AOQA 6ESTA 2G5NA 1FONA 3SJKA 5GWZA 3S9CA 1F92A 3F9EA 1MH0A 1GL1A 3UWIA 1O3IA 3T28A 1RIWC 1O2MA 3P6ZB 2FOBA 2I6QA 1PQAA 4YO9A 1AFEH 2THFB 2BDHA 3RMLH 6GCHF 1WUNH 3OTJE 3GY8A 2AS9A 2GVFA 2ODYB 4AN7A 1O2PA 2ESTE 2FMJA 1ACBE 1EOJA 3UUZA 5TCCA 2H5CA 1P9SA 3SJOA 3GY2A 2GTBA 2A4RA 4MNYA 3M37A 3PLPA 1AVWA 1NRRH 2B0FA 1XVOA 4JCNA 4MDSA 2H9TH 2ANYA 4GPGA 1VGCB 1THSH 1S83A 1GHYH 1HAGE 1SBWA 3KQDA 1V2NT 1NFWA 1GBCA 1FV9A 1V2QT 4DW2U 1EJAA 1ESTA 3RXOA 4BANB 3IG6B 2WPJS 2V6NA 2A4OA 1FXYA 1DICA 4R0IA 3IITA 3ZZ9A 1AI8H 1UMAH 2I6SA 1O36A 1GHAF 3UR6A 1KLIH 1GCTC 1PJPA 4Y0YE 1HAIH 3QUMP 5F8TA 1P06A 1J16A 1X7AC 3BTKE 2EI8A 4NIVA 1SMFE 4GCHG 1ABJH 5SGAE 3RXUA 2ZHFH 2P3FH 3FP7E 2QXIA 3LC3A 4SGBE 9ESTA 1T7CA 2EI6A 3U8RH 3G01A 2ZFRH 2ZDMA 3OX7U 1C2GA 1P57B 1S82A 1HPGA 2BD5A 3QZQA 4CR9A 1NRSH 1A3BH 1VCPA 1O3CA 4Y76A 4WH6A 1P2KA 1PPGE 2W3IA 1O2UA 1O3EA 1TRYA 1DFPA 3MWIU 4ISIH 1IQIA 3M5MA 2XWBI 1HYLA 2ZEBA 3UNSA 4IC6A 5JBCS 1J8AA 4LXBH 1H8DH 2HPQH 5C67A 1BQYA 1O2IA 3P8GA 1FJSA 4XBCA 3AAVA 1OOKB 2W26A 3GISB 1WQVH 3D62A 4X0WU 4X2YA 1GMCG 1FAXA 1MCTA 3SU2A 1O2QA 2BLVA 2Z3DA 2ZF0H 2BZ6H 1TX6A 1O2SA 2WPIS 1CE5A 5JDUB 2J4IA 1O2WA 1G3EA 5EGMA 5J4QA 1QB1A 2SGFE 2FDAA 4YTAA 1LKBA 4D8NA 1FN8A 1GL0E 1G2MA 1FMGA 3K6YA 3PTBA 3MMGA 2VJ1A 4FUDA 5FCKA 3TITA 5LGOA 5T6FA 1N1LA 2BMGB 1G36A 3F68H 1P03A 3TVJB 3A8DA 1J15A 1VITG 3VEQB 5ABWA 1FNIA 4DIIH 2FTLE 1TPPA 1ELDE 4WMDA 3RXFA 3TLOA 1O2XA 3U69H 3M7QA 5K0HA 1PPBH 3CS0A 2BDIA 3AW0A 1K1NA 3E91A 3LC5A 4JYVH 1BTWA 3QTVH 2ZU2A 3BG4B 4ABEA 2CHAC 1XUFA 2O8MA 4YOJA 3SHCH 4KTCA 4X1SU 2YOLA 3SQHE 2O9QA 2AFQB 3ZZCA 1GHBG 1W0ZU 1KLTA 3PLKA 1GBBA 2VU8E 1TNGA 1BTPA 1SGIB 1PQ7A 1J17T 1Y59T 1NU9A 3A7YA 4MNVA 1YLCA 1V2OT 4I7YH 4A1XA 3A89A 5GXPA 1GDNA 1YPLH 1V2UT 4BXWA 1O37A 1FQ3A 3NPSA 2PW8H 5A8XA 4ABIA 3GDVA 1A2CH 4AGKA 3TH2H 3K65B 4BOHA 1THPB 2F9BH 2Z94A 1TA6A 2Z9JA 3LH1A 3SNBA 2VWLA 3SHAH 1A46H 2VVCA 2P94A 4IBLH 3PMAB 1UTNA 2UUKB 3PO1C 2OQUA 3TJVA 1TGTA 3H5CB 3T62A 4CRGA 3A7ZA 2VGCC 1FPHH 1NM6A 2HLCA 4TYDA 3VPKA 1WV7H 3RXRA 2F9UA 3KGPA 4ABGA 1AZZA 1Z7KA 3HGPA 1A5GH 2G81E 1O3HA 2AMPA 3DT0H 1D3TB 1GJ5H 3OY6U 1YC0A 4A92A 2RDLA 1NY22 3MHWU 2RA3A 1XUGA 1S85A 2G4TA 3TJUA 2AMDA 3NUMA 3CENA 1UVPA 1GBKA 2A5AA 4CHAC 3MU4A 1ZSLA 1BRUP 1GI0A 2FI4E 1G3DA 2TGAA 2TBSA 1AWFH 2WUCA 2ZU4A 4OGYA 3P95A 3SOSA 3LGVA 3NCLA 2H9HA 3ODFA 2UUJB 1HJAB 1OWKA 2CF9H 4A5TS 1QJ6B 1OYTH 4DOQA 4AGJA 1EATA 3H7OA 4IMZA 1O3AA 4YZUA 1YF4A 2CN0H 3KNXA 6CHAC 5LPFA 1NFUA 3LH3A 3A83A 2TIOA 3K6ZA 1GI2A 3Q3KA 1GJ7B 1OWJA 1EAWA 5C5OA 3P92A 1GJ9B 1GCDA 1FY5A 2ZO3H 1L4ZA 3QX5H 5TJXA 3LJJA 1C2EA 1S0QA 1KXFA 1LPKB 1O3GA 1NRPH 1QIXB 3L3TA 1Q2WA 1O2HA 2M5TA 3Q3XA 4AX9H 1IQHA 4Q2KA 3UOPA 1SHYA 3SUDA 1O2NA 1ZJDA 2ZIQH 2VVVA 1MKXH 1C5MD 1QBOA 1C2MA 4RN6A 1OPHB 2A4QA 2GDDA 3TNSA 1EZQA 1SL3A 1LVYA 1QR3E 3A81A 3M5OA 1N8OC 1TGBA 3M35A 3T5FH 5FX5A 1C5XB 1TNKA 1O3FA 1ELTA 1O3MA 1QA0A 3VXFH 3RXHA 1YPHE 2O8WA 3TH3H 4JYTA 3T26A 3SV9A 1VCQA 4YT7H 4K69A 2HNTF 2F3CE 3KHVA 3SJIA 5GCHG 1LVMA 5DP4A 3MYWA 2PFEA 1GI8B 1Y5AT 1IQMA 3A84A 3BEFB 2R9PA 4NIXA 2BY9X 2A1DB 4I8KA 5DP5A 5A0CA 2PKSB 1GBIA 1K2I1 4B74A 2J2UA 1XXDA 3D49H 1U6QA 1C1QA 2J38A 4YESB 3UOUA 1TGCA 5HYOA 3B8JA 2PTNA 2VNTA 2J94A 3TK9A 4IMQA 2FTMA 2AH4X 2FX6A 4H42U 1YPEH 5CHAB 1QRZA 1BIOA 1GI7B 1CT0E 2OP9A 4JK6A 5T6DA 2Q6GA 1IAUA 1HAHH 3Q76A 3V7TA 2ZHEH 1ANEA 1JIMA 1CHOG 1YPKH 1ANDA 2HGTH 2RCEA 3EGKH 4BAKB 4AFZA 2O8LA 3RXBA 5L30H 1UTPA 1SLUB 3F9FA 1SGNE 4AYVB 1B0FA 2VWNA 4MTBA 1SOTA 1ZRKA 1P9UA 4Z6AH 1FY1A 1FZZA 2NU0E 1O2VA 2W5EA 5JBAS 3ZZ8A 6GCHG 3UWJH 1BITA 3U9AH 5HM2A 5EODA 1ZR0A 4X6MA 2AMQA 5EW2H 4ABJA 2UWLA 4FVBA 1GGDB 1C5OH 1OKXA 3EA8A 2OQ5A 1OXGA 2SGAA 1HJ8A 1PQ5A 4MQAA 1BCUH 2OUAA 1BBRE 3QLPH 2P8OB 8GCHF 1EZXC 1VITF 2Z3EA 4SGAE 2HNTC 2STAE 5DO4H 1C1WH 4WVPE 4J1YA 5DP3A 4WMFA 1A4WH 1DE7H 2FYRA 3GCTG 1C5YB 1UTKA 3HGNA 2VIVA 1P3EA 2PSYA 5FAHA 1NO9H 1QBVH 4JZFH 1A0JA 4MPWA 1QA7A 1YPGH 2GCTC 2VH6A 3RMMH 3W95A 1AHTH 4FVDA 1TALA 3F6UH 2ZTYA 3LGYA 2BVSH 1L4DA 1K9OE 1UK3A 2Z7FE 5C1XA 2AGEX 1GPZA 4CR5A 4UFDH 4WMEA 3RXCA 1JMOH 1T31A 1F0UA 4H6TA 3MFJA 4GUXA 5DP6A 1T8OA 4JMYA 2C90B 4X6OA 4DIHH 5LPEA 5EW1H 1A5IA 1AFQC 4XOJA 4ABDA 4AG2A 1SLWB 4WXIA 1RTLA 5GCHF 5DGJA 3P70B 4E7RG 1ZZZA 1IHSH 3BIUH 1EPTB 2C4FH 5I25A 3B23B 2P3TB 1PPHE 2ZTZA 4H4FA 3HKJB 4K8BA 2XTTB 2ZGCA 1IQKA 1GI5A 1Y5BT 2ZTXA 1TBQH 1MD7A 1QNJA 2WYJA 2XBWA 3LGIA 1HCGA 3S9BA 1KXEA 5I46H 4TY7A 1AKSA 1IQNA 2ZC9H 1A5HA 1EP5A 5DKMA 2ZFFH 1L0ZA 2SGDE 1GBFA 4IN2A 3TU7H 2B5TB 5EXLA 1GJ6A 1XUKA 3GYMA 1GVKB 2ZFPH 2GZ7A 2LPRA 1DSUA 4O03A 3K2UA 1K22H 1TPSA 3BF6H 3ZV9A 3GYLB 3RDZA 3GOVB 1TQ0B 5AHGH 2Y7XA 1P12E 1YYY1 2H1UA 1TYNA 1TPOA 1O3NA 2AGGX 2ZI2H 1JIRA 3SBKA 4O97A 5EOKA 1PPEE 1VR1H 2F9NA 4MPVA 2ZQ2A 2ZGJA 1UTLM 1DOJA 2OLGA 4WY3A 3STIA 3V3MA 5GIBA 1SR5C 4Y10E 1EZUC 1WQSA 3NKKA 1BTUA 4O3UA 4K1EA 2BY7X 3UQVA 1ZLRA 3MH5A 4XDEA 3ZZ4A 4X6PA 4IN1A 2TGDA 2V3OH 4AZ2B 2ZWLH 1OWEA 2BXUH 3KQEA 2FIRH 2GP9B 1DANH 4VGCB 1TA2A 1MZAA 1TAWA 2ZGHA 1PPZA 1OWDA 1C5TA 2AIPA 1WYKA 3RMOH 5DP8A 2JETB 4Y11E 2ILNA 1S0RA 2GV7A 3RU4T 2FODA 3VB5A 1AD8H 2NU4E 3PM3A 1EAIA 4IGDA 1VJAU 1Z1JA 5F8ZA 1DWDH 1OP2A 4DT7B 2BDYA 3EYDA 4NGAH 4D9QA 1JBUH 4K3JA 2A0QB 2GX4A 1O5BB 5ESTE 1ZSJA 1GI1A 1MZDA 1LHDH 4X1QU 4RKOB 3SNEA 2F9VA 4B1TA 1SI5H 1D3QB 1MAYA 7GCHF 1C4V2 4H6SB 4NIWA 4X8UH 5FHTA 1AU8A 1ZMLA 2BOKA 3SV8A 1UO6A 5GPIB 4ABAA 4Y71A 1ETTH 1EOLA 2UWOA 1T4UH 4INLA 1WCZA 1AB9B 1A1RA 2O8UA 2VINA 3I77A 3LONA 1NT1A 4ISHH 3UR9A 2GCHG 4WXVA 5E0GA 2GV6A 1TBZH 4BAOB 4FUJA 3ATKA 1SGYE 1ID5H 5H4IB 2J95A 4LK4A 4TWWA 1H9HE 1JWTA 2FPZA 2EC9H 3RXDA 1GBJA 2ALVA 1OS8A 4HGCA 4GHTA 3BTDE 2CMYA 1UHBA 1O5CB 1RJXB 2A7JA 1Y8TA 4J2YB 5T3HA 3TGJE 4CBNA 2BVXH 1C1MA 1C1SA 1GBAA 2FO9A 2A2QH 1E36B 4Y79A 3M7TA 1KY9A 1LHCH 3KIDU 3U8OH 3SV6A 2P16A 3SNAA 4INHA 2Z9GA 2XRCA 1IQJA 4FU9A 3SU6A 2PTCE 3ZVFA 1C2FA 2FOFA 2QF0A 1L1JA 2FOAA 1Z6EA 4CH8B 1W11U 1HIAB 5TCAA 5ETXA 1ELEE 2WPHS 2XBVA 1EPTA 3ELAH 2DE8A 3TIUA 2RA0A 4RKJB 2ODQA 2P59A 1DSTA 1C4Y2 2TGPZ 2BM2A 2QGRA 3M7UA 3GCNA 1MKWK 1XUJA 2PKAA 1A0HB 3MH6A 1TMUH 1BRAA 3T25A 4B2BA 3UIRA 3MI4A 1ORFA 1C9PA 2GCHF 3ZZAA 1GI4A 1LTOA 3KQBA 1GDUA 1HLTH 1QFKH 3SUEA 4Y6DA 1TNLA 1W13U 1IQEA 1NPMA 1GJDB 2CXVA 1O34A 4UFFH 3R3GB 2IOTA 1GHVH 2OBOA 3QK1A 1ABIH 2ZKSA 3VB4A 1GCTB 2C8WB 2CHAB 1SGDE 1F7ZA 5B6OA 1EZSC 1HIAA 3SQEE 4BAQB 3BTWE 5DP7A 2BHGA 3BIVH 3UQOA 1MQ5A 1AY6H 1KLJH 1TOCB 2VH0A 2XC4A 4YLUA 1YPMH 3K9XB 4I32A 4I8HA 1MAXA 1GBEA 1HXFH 2JKHA 2GMTC 3ESTA 1EX3A 2ZDAH 3LGTA 2IPHA 4F49A 2BLQA 4X1PU 5ESBA 2VB0A 4AG1A 2OTVA 2HPPH 3A85A 2ZHWH 1P3CA 4FUFA 1Z6JH 3SJ9A 1FN6A 2C93B 4TY6A 4ZKRU 3SW2B 2A32A 4LZ4B 2ZU5A 1HAVB 1Q31A 3LOXA 1HAYB 4FXGH 4BAMB 4MPXA 3MU8A 4Q7XA 1IQFA 1KTTB 4ZUHA 1UCYE 2BQWB 4K2YA 5E0JA 4RSPA 1GHZA 1O0DH 1C2LA 2HVXA 1V2JT 2FOMB 3BTFE 1C1UH 1V2WT 2QXHA 2Z9KA 1VITH 1TQ7B 3S69A 2VIWA 2AYWA 2FI3E 4ZH8A 3ZZ6A 1DWCH 1SGTA 3SV7A 3T29A 4DY7B 2W7UA 2WUBA 3RXSA 1GMDF 4I8GA 4UE7H 2XBYA 4JZIA 1ZTJA 3SGBE 1O3DA 5G4BA 2BD3A 3BTEE 1C2DA 1EJMA 2A5IA 1SGPE 4OS4A 4MLFB 2Z6BD 1XUHA 1ESAA 1WOFA 2CJIA 3KN2A 1DITH 1H9IE 3RXQA 1HDTH 1EJNA 1YPHC 1L1NA 3BTHE 3ZVGA 3E3TA 4ZXYH 3IWMA 3F9HA 2UWPA 1G32B 2FS8A 1ZGVA 2C8XB 2BDGA 1BDAA 4HTCH 2A31A 2AERH 1DLEA 3RM0H 2JH0D 3M3VA 1E35B 3GY7A 5FPTA 3E0PB 1QBNA 1AGJA 3LPRA 1QL7A 2ODPA 4D76A 3VFEA 1ARCA 1ZGIA 7KMEH 1DXPA 3SZNA 4AFSA 1Y3UA 1QJ1B 3L33A 3E0NB 4B2AA 1FI8A 1O5DH 4XBBA 2XWAA 1DX5M 1SLVB 1DPOA 2AGIX 2TGTA 1LKAA 1Z8JB 4ISNA 1MU8B 2Y5GA 1QY6A 1CSOE 2ZU1A 3TGKE 1O2YA 1O5AB 1O5GH 4ABHA 2XXLA 1V2PT 2EA3A 2HNTE 2ZQ1A 4Z0KA 4MNWA 3BTME 3NXPA 3RXTA 4DURA 1C5SA 2CGAA 2P3UB 2FYQA 2J92A 4GHQA 2BD8A 3FP8E 2BD2A 4GLYA 2PSXA 3W94A 1EB2A 1BHXB 5AFYH 3SU5A 2PV9B 3ZVBA 4AB8A 5T6GA 3NK8A 1SHHB 1AMHA 1FIWA 1ZTKA 1GMDG 1S6FA 3AASA 2QCYA 3RXJA 3M3SA 4ZAEA 1ZJKA 1OX1A 5FBEA 1A7SA 2ULLA 5L2ZH 1O35A
chains in the Genus database with same CATH superfamily
1BTHH 1T8MA 2W6ID 1ETRH 1C4U2 1LHEH 1TPAE 1SC8U 4THNH 4YT6H 4BTUB 3RXEA 1G30B 4NWLA 2FS9A 3UNQA 1BMMH 1SGQE 3ATIA 1SGRE 5FPYA 1JXPA 1OHHD 4X2VA 1O2TA 1TX7A 3V12A 5HKKD 3FANA 4ZHLU 3ZZ7A 3HATH 1QL8A 3PB1E 1SFIA 2D26C 2HRVA 2ANMH 4B6EA 3B9FH 1CA0B 2ASUB 3Q77A 3PO1B 2ZCHP 1HFDA 3U98H 2J98B 2WYGA 5DJ7A 2WPLS 1MU6B 1O39A 3LGUA 3ZVAA 1ELFA 1W2KH 1D9IA 1LQDB 1EXFA 4D7GA 1J9CH 1PPFE 1CGJE 4I33A 1HNEE 1RIWB 2BDCA 4BAHB 5A09A 2XNIA 2VBCA 4Y8XA 1TGSZ 2XW9A 3RXVA 1JRTA 2BLWA 4JZDH 4E7NA 1C9TA 3QDZB 2FEQH 5EQQA 3VGCB 5HXFA 1VKYA 3ATMA 5F03A 1W7XH 4UDWH 2BY5X 5DPAA 3RC5A 2Y81A 4OGXA 2Q1JA 1AWHB 3SNDA 4UEHH 1INCA 3DFLA 1GMCF 1GBHA 4WWYA 2P8OC 1MD8A 3VB7A 1WAYB 4B76A 4M7GA 2BXTH 5C2ZA 3MO9A 4I8LA 1O3JA 5A8YA 7GCHG 1SSXA 1NROH 1G37A 2KAIB 1RRKA 4U01A 1UK2A 3MO3A 2VIDA 5BRRE 1ZMNA 2R0LA 1TNIA 2RG3A 2BD7A 1N6YA 4ZHAA 1MTSA 4A1TA 4CBOA 1RTFB 2FESH 1XXFA 3E16B 4X8SH 1D6WA 1BA8B 3R0FA 3HPTB 4D9RA 1O5FH 1CT2E 1FAKH 3BTGE 3CP7A 2H2ZA 1S81A 3QWCH 1ELVA 2HOBA 2FXRA 4K1SA 4DCDA 1O5EH 1C2IA 1OWIA 4ZKOU 4AB9A 4VGCC 1BTZA 4RT0A 2BD4A 5JB8S 1LO6A 1TABE 3S7KB 3GY5A 1ZYOA 2ZHDA 1HBTH 2XNDD 2ZCLP 2Y7ZA 3RXAA 5C1UA 5JPMH 1B0EA 3MU1A 1WTGH 2QA9E 4O9VA 3QN7A 2NU3E 3PMHB 1LQEA 4Q80A 2SFAA 1F5RA 4CH2B 3BTTE 1QZ8A 2ZU3A 1E38B 2QYIA 1BJUA 1E34B 2YMSB 4NZLA 1FUJA 2ANWA 2BTCE 3LU9B 2WPMS 1QURH 1ZMJA 3A88A 4NWKA 1QQUA 1HAPH 1T4VH 1KIGH 3D23A 1P04A 1SGFG 4DJZB 2M2AA 1C2HA 4FUGA 3RLWH 1O2JA 2XBXA 1O3OA 4XD7D 1MTWA 2WV5A 3BG8A 3V0XA 1UVOA 3SV2H 2ZHQH 5A0AE 3GCHB 2Y5FA 1P8VC 2CF8H 5FX6A 2GT7A 1E79D 1GBLA 1LPGB 2LNCA 1BT7A 3A7XA 4BXSA 4XE4A 1KXCA 1UVTH 3S0NA 1YBWA 4GVUA 1H9LB 1O3BA 1S84A 3AW1A 1QQ4A 4TPIZ 1K1OA 1P01A 3RUOA 3LGWA 4B6FA 5HM9A 4YM9A 1ESBA 5E8EH 1IQLA 5FBIA 5E2OA 4OS1A 1K21H 4U30A 1THRH 2KAIA 1BMAA 4BNRA 4BTIB 1OWHA 1GWAA 2FI5E 1C5QA 3CS7A 3P8FA 4WF8A 1MCVA 3JZ1B 4XFQA 5DK1A 4RI0A 3VXEH 5JB9S 1TX8A 4AYYB 1AUJA 4FUIA 1DWEH 1AIXH 2W3KA 5C0TA 2GCTB 3ATWA 1WXRA 3OAAD 2O8TA 5DP9A 1EKBB 1EASA 2ZG0H 3RLYH 1TRNA 3TK6A 3Q00A 1YM0A 1FIZA 1E1RD 1Y3VA 2BLOA 2DE9A 3EAJA 1E0FD 2F83A 4KELA 4NA9H 3QGNB 3S9AA 5F6MA 1D3DB 5L2YH 1HAZB 4ABFA 3P8OA 3DD2H 4RT1A 3FP6E 4Q7ZA 3URDA 9LPRA 1W3CA 4FUBA 1NU7B 4GSOA 1F5KU 4CRAA 2GZ9A 1F0TA 4D7FA 4M9FA 1BTYA 2V0BA 1O2LA 5JYIA 2YNAA 2PP6A 2A2XH 1BRBE 4AORA 4KTSA 4KP0A 4ACBA 1V2TT 2G52A 4XRNA 2XYAA 1HAVA 4CRFA 1IOEA 2ZCKP 1K1JA 1ZHPA 2FWWA 1C1OA 3C27B 3Q3YA 1QB6A 1Z8IB 3GY4A 1FPCH 1NZQH 2PR3A 1H8HD 2Z9IA 1NFYA 1PFXC 1Q3XA 1GVZA 1G3CA 3O8BA 1GHWH 1MQ6A 4DVAU 4MPUA 1PYTC 2GZ8A 3TJOA 3TK5A 2KZ4A 2ANKH 1ELGA 3RMNH 1HRTH 4WJG2 3DFJA 4X1RU 2PGQB 1QHRB 2Q6FA 4YOIA 4A7IB 3F9GA 1QCPA 2VVUA 1C1VH 1F0SA 1G2LA 5CHBA 1C1PA 1W14U 3U28C 1D6RA 1F5LA 1L2EA 4NA7A 3ZV8A 3HK3B 4AFUA 1P09A 3P8NA 3RC4A 2CK3D 2BX4A 3GDSA 1P2QA 1N8OB 5FPSA 1BHXF 1DS2E 1V6DA 2A5KA 1SOZA 1DWBH 1IHTH 2A45B 2GGVB 1VCWA 3RC6A 1A0LA 2ZZUH 3PYHA 1KYNA 2G51A 1V2MT 1FY4A 4AX9H 8LPRA 1ZPCA 4FU7A 5JBBS 1NS3A 1Y3YA 3TJNA 4NA8A 4O3TA 1RGQA 1C1RA 2Y80A 3PROA 1K1IA 1D4PB 1SGFA 4F4OC 6CHAB 2OC1A 4QT8C 4ZKNU 2BQ7B 5EPNA 1COWD 1D3PB 2L6OA 4NCYA 1Y3XA 1T32A 3UNRA 1S6HA 3RXGA 1BB0B 1MMJN 1XKAC 1P11E 2ZDLA 3LJOA 3A8CA 1LDTT 1BZXE 4YLQH 1EQ9A 2ZDKA 1NBMD 2WV9A 4JZEH 5PTPA 3WY8A 5AVDA 5C3NA 3MU5A 4ZROA 1BMLA 1O2OA 1XUIA 2K8IA 3SJ8A 1ZHMA 2ZPRA 1KDQA 2RFKC 4KKDA 2BY6X 2GKVE 4K5ZA 5LH8A 3N7OA 3RM2H 4Y8ZA 2FX4A 1AN1E 3QZRA 3A80A 1BTXA 1O32A 2BVRH 3M36A 1GMHF 3STJA 5A8ZA 2Z3CA 3GCOA 4IW4E 4R8TB 3U1JB 1SVPA 5HGGA 1DLKB 2EI7A 2R3YA 1RS0A 3U1IB 1GBMA 3MH7A 5E2PA 2QV1A 1TLDA 2IN2A 1AZ8A 3BTQE 1NRNH 3FZDA 1GJCB 1GHBF 3SI3H 4UD9H 1AFQB 1O3PB 2OINA 1YGCH 4KTUA 3BV9B 1T8NA 2Q6DA 1YCPH 3QTOH 2PHBA 3RXMA 1G3BA 4X1NU 1AE8H 1EPTC 1GMHG 3NZIA 1O33A 1YCPK 2ZFQH 3KQCA 3F0PA 4Y7AA 2BY8X 1KTSB 3BEUA 3URCA 1NTPA 4HFPB 3DSOA 1GHAG 2V3HH 5LPRA 3F1SB 1YP9A 1GBDA 4I31A 2PUXB 1DXWA 2ZPSA 3PRBA 4Y8YA 4CRDA 1GHXH 3UPEA 3RU4E 4A6LA 3UREA 1ZOMA 8KME2 2H9EH 3BG4C 1XVMA 4YOGA 5JBTA 1QJ7B 1BJVA 2L74A 3KEEA 1TNHA 4INKA 4Q7YA 2B7DH 2FOHA 2WV4A 1ZRBA 2G55A 2PGBB 1SB1H 2XC5A 5FCRA 2ZGXH 1TFXA 1JOUB 2QF3A 2ZA5A 2ZPQA 1ZPZA 1F2SE 1PPCE 3A7WA 1K1PA 3VGCC 5HIZA 5C17A 5EXMA 1C1TA 4ZKSU 1NFXA 1E37B 1ELAA 3MNBA 1GJBB 1O3LA 3S7HB 1Z8RA 1KSNA 1YPJH 2STBE 4JYUH 4MVNA 2OC0A 5DSFA 1V3XA 3ZZBA 1HGTH 1ZPBA 3EDXB 3HKIB 1CHOF 1AO5A 5C5NA 5C1YA 1W0JD 1C5VA 1F0RA 2B9LA 3L6PA 3V13A 3ZVCA 2D8WA 3F2HA 1KXAA 4HI3A 4GAWA 1EB1H 5A0BA 4X8VH 1K1LA 3EQ0H 3ODDA 2EEKA 2ALPA 3BEIB 1DVAH 4B71A 4I8JA 2C8YB 5HMAA 4JZ1A 1YLDA 1P2MA 1DUAA 4X2XA 4Y7BA 2JJ2D 3MNXA 2FLBH 1TRMA 4OS7A 3MO6A 2Y82A 1HUTH 4E06H 3E1XB 3M3TA 1KXDA 1PYTD 2VWMA 3M61U 1TNJA 3DHKH 1NN6A 5IDKA 3BN9A 2QXJA 3SU0A 2BOHB 3VB3A 3RXLA 1CVWH 5KECA 1O2ZA 1P0SH 2C3SA 2VIQA 3NWUA 3EA7A 2QAAA 3OY5U 5EPYA 1P02A 1H4WA 2FM2A 4ABBA 1SQAA 2HVYB 5K7RA 1HAXB 5GJ4B 1DY8A 1V2LT 3DUXH 2DUCA 2FOEA 5CMXH 2OXSA 1CA8B 3O8DA 4U2WA 3SNCA 3UY9A 1LMWB 2G4UA 1RD3B 1YCPM 4NZQA 1Y5UT 1GJ8B 1MKWH 1GI6A 1CGHA 3KCGH 1DUEA 2VGCB 1C5LH 2VIOA 2Y6TA 2D2DA 1SPJA 4NSVA 1QB9A 5BPEA 2A4GA 5EQRA 2FP7B 1LVBA 3AAUA 5L6NH 3ZZ5A 4FUCA 4FUEA 4MG3A 1HV7A 1GGDC 2FZZA 2OCVB 4IC5A 2P93A 1C1NA 3TH4H 1PQ8A 1G9IE 1O31A 2NU1E 3PWCA 4GCHF 2ZDNA 3RU4D 1ZTLA 2JETC 3KL6A 1GG6C 1TGNA 4PROA 2GMTB 2ZFSA 3LIWA 8GCHG 1P05A 1H8ED 1XMNB 5CE1A 2BB4A 2QXGA 2FOGA 1J14A 3TPIZ 1MBMA 3HK6B 3EE0B 2QC2A 3ZVDA 1GDQA 3TNTA 3SUFA 3KF2A 2ZGBH 2IJOB 4TT3D 2CV3A 1TOMH 1UTMA 3U8TH 1HB0B 2J9NA 5AFZH 2FLRH 2QIQA 2QN5T 3ITIA 3KYGA 1EAXA 1OSSA 3D65E 3ENSB 5EU8A 4F48B 3A82A 3P17H 3ZYEA 2JH5D 1P2NA 3OEED 5EIYA 3A7TA 1KXBA 5C20A 4ZHMU 1P10A 2A7CA 4CRCA 3FFGA 5EG4A 1Z1IA 3GY6A 1V2RT 4OS5A 1AQ7A 2SGQE 1K28D 2AEIH 4K1TA 1CO7E 1Z8GA 3GICB 1WTHD 3O8RA 1DDJA 1FY8E 5KEDA 1BOQA 1GI9B 2OD3B 1B5GH 2BD9A 1Z71A 5T1VA 3LKWA 2PUQH 1WSSH 3C1KA 1LHFH 1UK4A 3A87A 3UFAA 2Z9LA 3ATLA 3SZEA 1WDIA 1S5SA 2IJD1 2W6JD 3WWBA 1TWXB 4NSYA 4JK5A 2ZP0H 1DY9A 4TPYA 4K60A 4F55A 2VIPA 1C5PA 1O38A 1YKTA 2A7HA 1C5RA 1C5WB 3MNSA 1CU1A 3QO6A 3ZYDA 3O8CA 1GVLA 3M5LA 1KMHB 1W8BH 4B73A 1MTVA 4ZCNA 2K1QA 1H8IH 1QGFA 1HJ9A 4CRBA 1LVOA 5FXLA 2WINI 3M5NA 1SGCA 2V35A 3RXKA 3SI4H 3OU0A 4ISOA 1W7GH 1MTUA 2SNVA 1O30A 5IYTA 2WZQA 2R3UA 1MBQA 2B8OH 1SLXB 1NRQH 1UVSH 1ELCA 1EAUA 1C2JA 1QRXA 1SQTA 4FUHA 2W7SA 1LCYA 1FLEE 5A2MH 4ISLA 1TE0A 3GCTF 4NG9H 1C5UA 1EUFA 1TB6H 1TMTH 1Y3WA 4HZHA 4ZXXH 1HXEH 2KCPA 1A3EH 2F91A 2JH6D 4U32A 3GDUA 1ETSH 1UJ1A 4NFEA 4OS6A 1UVUH 3PV5A 1TMBH 4ASHA 2BDBA 4XBDA 3SU3A 4DGJA 2OC7A 4UONA 2F9PA 3FZZA 1W12U 4FU8A 1MUEB 1V2VT 5E0HA 1GBTA 2G8TA 3RXPA 2AIQA 1EP6A 2GD4B 1OP0A 2C8ZB 5J4SA 1BUIA 3RXIA 1CT4E 1NC6A 4UFEH 1ZSKA 3T27A 2PLXA 1GI3A 4Y0ZE 4NFFA 4ZMAH 1UTOA 3SU4A 3ZZDA 1UCYH 1L1GA 1WBGB 2UUYA 2BDAA 1MKXK 1XKBC 1DM4B 3GCHC 3OSYA 7ESTE 2V3MA 3PLBA 1JRSA 3W1EA 1CHGA 2J5UA 3AVZA 6LPRA 5IK2D 4OS2A 4E05H 1UHBB 4X2WA 1CBWB 2BYAX 3H7TA 4CHAB 1ZHRA 3E6PH 3SN8A 2D1JA 2H6MA 1ANBA 2GDEH 1VZQH 1FDPA 1RTKA 3E8LA 3VB6A 1UTJA 2VWOA 1LPZB 2P95A 3GY3A 2RDEA 2ZNKH 2HWLB 4A1VA 4B75A 1P2OA 1CA0C 1HJAC 1XX9A 1QL9A 3MNCA 3OYPA 1SG8B 1YLNA 2SNWA 1DT2A 3I29A 1XM1A 3MTYA 3UTUH 3MH4A 1RFNA 1MTNB 2XC0A 3PMBB 1ELBA 1BRCE 3SORA 3WW7A 1HAOH 1M9UA 3SO3A 2XCNA 1IQGA 1SGEE 2PKSC 1W10U 3A86A 4X6NA 2OC8A 1BBRK 1KDQB 1AVGH 3FVFB 2YNBA 1QRWA 3PWBA 2TRMA 4UFGH 1AB9C 1AVXA 1UTQA 2H5DA 1CGIE 2F9OA 4BTTB 1QTFA 2OBQA 4AFQA 2G00A 1N6XA 2KCYA 4FOUC 3SU1A 4MNXA 1UW7A 1AE5A 2Y5HA 5CHAC 1CQQA 1O2KA 1TIOA 1GJ4H 5DG6A 5GDSH 2PWXA 3TGIE 3DSPA 4WH8A 2JDID 3SGAE 1WU1A 1ANCA 2SGEE 3DA9B 1LHGH 1V2ST 4CREA 1SFQB 3CNRA 3T2NA 2ZDVH 1O2GH 1TBRH 3FAOA 4I86A 3ZZ3A 2BQ6B 1C5ZB 3RP2A 3QGJA 4LOYH 1OYQA 5EQSA 3MOCA 3A7VA 4B2CA 5EJ1A 1MTNC 2J34A 3A8BA 1FY3A 1A61H 5F8XA 1BMNH 2ZECA 1O3KA 2R2WU 2TPIZ 7LPRA 3PV4A 2XCFA 5EXNA 3MU0A 1NESE 5AF9H 3LT3A 1K1MA 1GJAB 1H1BA 3OTPA 4NIYA 2FOCA 1W0YH 2SGPE 1O2RA 3JZ2B 2ZFTA 1ARBA 2KCAA 1C5NH 2R2MB 3LDXH 1BBRH 1AKSB 2PKAB 4K8YA 1RXPA 4AC9A 2BZAA 1P2IA 2YMSD 1GG6B 2NU2E 3PTNA 3PMJA 3EA9A 2WPKS 1CBWC 3ZVEA 4TWYA 2UUFB 3I78A 3DSGA 3BSQA 1VGCC 1AUTC 3A8AA 4IS5A 3SGQE 2QY0B 2HALA 2GT8A 1UCYK 4DG4A 1B7XB 1TONA 2R0KA 1OP8A 1VJ9U 1C2KA 1P2JA 1SQOA 1T8LA 4ESTE 4KGAA 4LZ1H 1V2KT 3E90B 8ESTE 4X8TH 2BX3A 3SUGA 2G5VA 2NWNA 4XSKU 4AOQA 6ESTA 2G5NA 2WPDD 1FONA 3SJKA 5GWZA 3S9CA 5C94A 1F92A 3F9EA 1MH0A 1GL1A 3UWIA 1O3IA 3T28A 1RIWC 1O2MA 3P6ZB 2FOBA 2I6QA 1PQAA 4YO9A 2KCOA 1AFEH 2THFB 2BDHA 3RMLH 6GCHF 1WUNH 3OTJE 3GY8A 2AS9A 2GVFA 2ODYB 4AN7A 1O2PA 2ESTE 2FMJA 1ACBE 1EOJA 3UUZA 1YWUA 5TCCA 2H5CA 1P9SA 3SJOA 3GY2A 2GTBA 2A4RA 4MNYA 3M37A 3PLPA 5GNDA 1AVWA 1NRRH 2B0FA 1XVOA 4JCNA 4MDSA 4Q63A 2H9TH 2ANYA 4GPGA 1VGCB 1THSH 1S83A 1GHYH 1HAGE 1SBWA 3KQDA 1V2NT 1NFWA 1GBCA 1FV9A 1V2QT 4DW2U 1EJAA 1ESTA 3RXOA 4BANB 3IG6B 2WPJS 2V6NA 2A4OA 1FXYA 1DICA 1W0KD 3IITA 4R0IA 3ZZ9A 1AI8H 1UMAH 3UAIC 2I6SA 1O36A 1GHAF 3UR6A 1KLIH 1GCTC 1PJPA 4Y0YE 1HAIH 3QUMP 5F8TA 1P06A 1J16A 1X7AC 3BTKE 2EI8A 4NIVA 1SMFE 4GCHG 1ABJH 5SGAE 3RXUA 2ZHFH 2P3FH 3FP7E 2QXIA 3LC3A 4SGBE 9ESTA 1T7CA 2EI6A 3U8RH 3G01A 2ZFRH 2ZDMA 3OX7U 1C2GA 1P57B 1S82A 1HPGA 2BD5A 3QZQA 3F3BA 4CR9A 1NRSH 1A3BH 1VCPA 1O3CA 4Y76A 4WH6A 1P2KA 1PPGE 2W3IA 1O2UA 2OK5A 2JJ1D 1O3EA 1TRYA 1DFPA 3MWIU 4ISIH 1IQIA 3M5MA 2XWBI 1HYLA 2ZEBA 3UNSA 4IC6A 5JBCS 1J8AA 4LXBH 1H8DH 2HPQH 5C67A 1BQYA 1O2IA 3P8GA 1FJSA 4TSFD 3AAVA 4XBCA 1OOKB 2W26A 3GISB 1WQVH 3D62A 4X0WU 4X2YA 1GMCG 1FAXA 1MCTA 3SU2A 1O2QA 2BLVA 2Z3DA 2ZF0H 3ZIAD 2BZ6H 1TX6A 1O2SA 2WPIS 1CE5A 5JDUB 2J4IA 1O2WA 2F4LA 1G3EA 5EGMA 5J4QA 1QB1A 2SGFE 2FDAA 4YTAA 1LKBA 4D8NA 1FN8A 1GL0E 1G2MA 1FMGA 3K6YA 3PTBA 3MMGA 2VJ1A 4FUDA 5FCKA 3TITA 5LGOA 5T6FA 1N1LA 2BMGB 1G36A 3F68H 1P03A 3TVJB 3A8DA 1J15A 1VITG 3VEQB 5ABWA 1FNIA 4DIIH 2FTLE 1TPPA 1ELDE 5EJZA 4WMDA 4ACAA 3RXFA 3TLOA 1O2XA 3U69H 3FKSD 3M7QA 5K0HA 1PPBH 2QE7D 3CS0A 2BDIA 3AW0A 1K1NA 3E91A 3LC5A 4JYVH 1BTWA 3QTVH 2ZU2A 5EJLA 3BG4B 4ABEA 2CHAC 1XUFA 2O8MA 4YOJA 3SHCH 4KTCA 4X1SU 2YOLA 3SQHE 2O9QA 2AFQB 3PRDA 3ZZCA 1GHBG 1W0ZU 1KLTA 3PLKA 1GBBA 3GS9A 2VU8E 1TNGA 1BTPA 1SGIB 1PQ7A 1J17T 1Y59T 1NU9A 3A7YA 4MNVA 2V7QD 1YLCA 1V2OT 4I7YH 4A1XA 3A89A 5GXPA 1GDNA 1YPLH 3NRLA 1V2UT 4BXWA 1O37A 4FETA 1FQ3A 3NPSA 2PW8H 5A8XA 4ABIA 3GDVA 2LP6A 1A2CH 4AGKA 3TH2H 3K65B 4BOHA 1THPB 2F9BH 2Z94A 1TA6A 2Z9JA 3LH1A 3SNBA 2VWLA 3SHAH 1A46H 2VVCA 2P94A 4IBLH 5HIYA 3PMAB 1UTNA 2EY4C 2UUKB 3PO1C 2OQUA 3TJVA 1TGTA 3H5CB 3T62A 4CRGA 3A7ZA 3UB0A 2VGCC 1FPHH 1NM6A 2HLCA 4TYDA 3OE7D 3VPKA 1WV7H 3RXRA 2F9UA 3KGPA 4ABGA 1AZZA 1Z7KA 3HGPA 1A5GH 2G81E 1O3HA 2AMPA 3DT0H 1D3TB 1GJ5H 3OY6U 1YC0A 3DCLA 2RDLA 1NY22 3MHWU 2RA3A 1XUGA 1S85A 4A92A 2G4TA 3TJUA 2AMDA 3NUMA 3CENA 1UVPA 1GBKA 2A5AA 4CHAC 3MU4A 1ZSLA 1BRUP 1GI0A 2FI4E 1G3DA 2TGAA 2TBSA 3KQ5A 1AWFH 2WUCA 2ZU4A 4OGYA 3P95A 3SOSA 3LGVA 3NCLA 2H9HA 3ODFA 2UUJB 1HJAB 1OWKA 2CF9H 4A5TS 1QJ6B 1OYTH 4DOQA 4AGJA 1EATA 3H7OA 4IMZA 4OM9A 1O3AA 4YZUA 1YF4A 2CN0H 3KNXA 6CHAC 5LPFA 3OFND 1NFUA 3LH3A 3A83A 2TIOA 4Q4LA 3K6ZA 1GI2A 3Q3KA 1GJ7B 1OWJA 1EAWA 5C5OA 3P92A 1GJ9B 1GCDA 1FY5A 2ZO3H 1L4ZA 3QX5H 5TJXA 3LJJA 1C2EA 1S0QA 1KXFA 1LPKB 1O3GA 1NRPH 1QIXB 3L3TA 1Q2WA 1O2HA 2M5TA 3Q3XA 1E1QD 1IQHA 4Q2KA 3UOPA 1SHYA 3SUDA 1O2NA 1ZJDA 2ZIQH 2VVVA 1MKXH 1C5MD 1QBOA 1C2MA 4RN6A 1OPHB 2A4QA 2GDDA 3TNSA 1EZQA 1SL3A 1LVYA 1QR3E 2HLDD 3A81A 3M5OA 1N8OC 1TGBA 3M35A 3T5FH 5FX5A 1C5XB 1TNKA 1O3FA 1ELTA 1O3MA 1QA0A 3VXFH 3RXHA 1YPHE 2O8WA 3MQKC 3TH3H 4JYTA 3T26A 3SV9A 1VCQA 4YT7H 4K69A 2HNTF 2F3CE 3KHVA 3SJIA 5GCHG 1LVMA 5DP4A 3MYWA 2PFEA 1GI8B 1Y5AT 1IQMA 3A84A 3BEFB 2R9PA 4NIXA 2BY9X 2A1DB 2J97A 4I8KA 5DP5A 5A0CA 2PKSB 1GBIA 1K2I1 4B74A 2J2UA 1XXDA 3D49H 1U6QA 1C1QA 2J38A 4YESB 3UOUA 1TGCA 5HYOA 3B8JA 2PTNA 2VNTA 2J94A 3TK9A 4IMQA 2FTMA 2AH4X 2FX6A 4H42U 1YPEH 5CHAB 1QRZA 1BIOA 1GI7B 5FL7D 1CT0E 2OP9A 4JK6A 5T6DA 2Q6GA 1IAUA 1HAHH 3Q76A 3V7TA 2ZHEH 4P02A 1ANEA 1JIMA 3SYJA 1CHOG 1YPKH 1ANDA 2HGTH 2RCEA 3EGKH 4BAKB 4AFZA 2O8LA 3RXBA 5L30H 1FX0B 1UTPA 1SLUB 3F9FA 1SGNE 4AYVB 1B0FA 2VWNA 4MTBA 1SOTA 1ZRKA 1P9UA 4Z6AH 1FY1A 1FZZA 2NU0E 1O2VA 2W5EA 5JBAS 3ZZ8A 6GCHG 3UWJH 2WSSD 1BITA 3U9AH 5HM2A 5EODA 1ZR0A 4X6MA 2AMQA 5EW2H 4ABJA 2UWLA 4FVBA 1GGDB 1C5OH 1OKXA 3EA8A 2OQ5A 1OXGA 2SGAA 1HJ8A 1PQ5A 4MQAA 1BCUH 2OUAA 1BBRE 3QLPH 2P8OB 3F0OA 8GCHF 1EZXC 1VITF 2Z3EA 4SGAE 2HNTC 2STAE 5DO4H 1C1WH 4WVPE 4J1YA 5DP3A 4WMFA 1A4WH 1DE7H 2FYRA 3GCTG 3AK5A 1C5YB 2KR7A 2F43B 1UTKA 3HGNA 2VIVA 1P3EA 2PSYA 5FAHA 1NO9H 1QBVH 4JZFH 4DT4A 1A0JA 4MPWA 1QA7A 2IPQX 1YPGH 2GCTC 2VH6A 3RMMH 3W95A 1AHTH 4FVDA 1TALA 3F6UH 2ZTYA 3LGYA 2BVSH 2QF5A 1L4DA 1K9OE 2QF4A 3F2FA 3OEHD 1UK3A 2Z7FE 5C1XA 2AGEX 1GPZA 4CR5A 4UFDH 4WMEA 3RXCA 1JMOH 3VG8A 1T31A 1F0UA 4H6TA 3MFJA 4GUXA 5DP6A 1T8OA 4JMYA 2C90B 4X6OA 4DIHH 5LPEA 5EW1H 1A5IA 1AFQC 2JIZD 4XOJA 4ABDA 4AG2A 1SLWB 4WXIA 1RTLA 5GCHF 5DGJA 2GJGA 2EQNA 3P70B 4E7RG 1ZZZA 1IHSH 3BIUH 1EPTB 2C4FH 5I25A 3N99A 3B23B 2P3TB 1SKYE 1PPHE 2ZTZA 4H4FA 3HKJB 4K8BA 2XTTB 2ZGCA 1IQKA 1GI5A 1Y5BT 2ZTXA 1TBQH 1MD7A 1QNJA 2WYJA 2XBWA 3LGIA 1HCGA 3FN8A 3S9BA 1KXEA 5I46H 4TY7A 1AKSA 1IQNA 2ZC9H 1A5HA 1EP5A 1YY3A 5DKMA 2ZFFH 1L0ZA 2SGDE 1GBFA 4IN2A 3TU7H 2B5TB 5EXLA 3WWFA 1GJ6A 1XUKA 3GYMA 1GVKB 2ZFPH 2GZ7A 2LPRA 1DSUA 4O03A 3K2UA 1K22H 1TPSA 3BF6H 3ZV9A 3GYLB 3RDZA 3GOVB 1TQ0B 5AHGH 2Y7XA 1P12E 1YYY1 3FO8D 2H1UA 1TYNA 1TPOA 1O3NA 2AGGX 2ZI2H 1JIRA 3SBKA 4O97A 5EOKA 1PPEE 1VR1H 2F9NA 4MPVA 2ZQ2A 2ZGJA 1UTLM 2LELA 1DOJA 2OLGA 2AHME 4WY3A 3STIA 5F53A 3V3MA 5GIBA 5C0UA 1SR5C 4Y10E 1EZUC 1WQSA 3NKKA 1BTUA 4O3UA 4K1EA 2BY7X 3UQVA 1ZLRA 3MH5A 4XDEA 3ZZ4A 4X6PA 4IN1A 2TGDA 2V3OH 4AZ2B 2ZWLH 1OWEA 2BXUH 5B6LA 3KQEA 2FIRH 2GP9B 3F2GA 1DANH 4VGCB 1TA2A 1MZAA 1TAWA 2ZGHA 1PPZA 3KYFA 1OWDA 1C5TA 2AIPA 1WYKA 3RMOH 5DP8A 2JETB 4Y11E 2ILNA 1SQRA 1S0RA 2GV7A 3RU4T 2FODA 3VB5A 1MABB 1AD8H 2NU4E 3PM3A 1EAIA 2KM0A 4IGDA 1VJAU 1Z1JA 5F8ZA 1DWDH 1OP2A 4DT7B 2BDYA 3EYDA 4NGAH 4D9QA 1JBUH 1BMFD 2A0QB 4K3JA 2GX4A 1O5BB 5ESTE 1ZSJA 1GI1A 1MZDA 1LHDH 4X1QU 4RKOB 3SNEA 2F9VA 4B1TA 1SI5H 1D3QB 1MAYA 7GCHF 1C4V2 4H6SB 4NIWA 4X8UH 5FHTA 1AU8A 1ZMLA 2BOKA 3SV8A 1UO6A 5GPIB 4ABAA 4Y71A 1ETTH 1EOLA 2UWOA 1T4UH 4INLA 1WCZA 3H09A 1AB9B 1A1RA 2O8UA 2VINA 3I77A 3LONA 1NT1A 5DN6D 4ISHH 3UR9A 2GCHG 4WXVA 5E0GA 2GV6A 1TBZH 4BAOB 4FUJA 3ATKA 1SGYE 1ID5H 5H4IB 2J95A 4LK4A 4TWWA 1H9HE 1JWTA 2FPZA 2EC9H 3RXDA 1GBJA 2ALVA 1OS8A 4HGCA 4GHTA 3BTDE 2CMYA 1UHBA 1O5CB 1RJXB 2A7JA 1Y8TA 4J2YB 5T3HA 3TGJE 4CBNA 2BVXH 1C1MA 1C1SA 1GBAA 2FO9A 2A2QH 1E36B 4Y79A 3M7TA 1KY9A 1LHCH 3KIDU 3U8OH 3SV6A 2P16A 3SNAA 4INHA 2Z9GA 2XRCA 1IQJA 4FU9A 3SU6A 2PTCE 3ZVFA 1C2FA 2FOFA 2QF0A 1L1JA 2FOAA 1Z6EA 4CH8B 1W11U 1HIAB 5TCAA 5ETXA 1ELEE 2WPHS 2XBVA 1EPTA 3ELAH 2DE8A 3TIUA 2RA0A 4RKJB 2KX4A 2ODQA 2P59A 1NBME 1DSTA 1C4Y2 2TGPZ 2BM2A 2QGRA 3M7UA 3GCNA 1MKWK 1XUJA 2PKAA 1S6LA 1A0HB 3MH6A 1TMUH 1BRAA 3T25A 4B2BA 3UIRA 3PV2A 3MI4A 1ORFA 1C9PA 2GCHF 3ZZAA 1GI4A 1LTOA 3KQBA 1GDUA 1HLTH 1QFKH 3SUEA 4Y6DA 1TNLA 1W13U 1IQEA 1NPMA 1GJDB 2CXVA 1O34A 4UFFH 3R3GB 2IOTA 1GHVH 2OBOA 3QK1A 1ABIH 2XOKD 2ZKSA 3VB4A 1GCTB 2C8WB 2CHAB 1SGDE 1F7ZA 5B6OA 1EZSC 1HIAA 3SQEE 4BAQB 3BTWE 4P00A 5DP7A 2BHGA 3BIVH 3UQOA 1MQ5A 1AY6H 1KLJH 1TOCB 2VH0A 2XC4A 4YLUA 2K0QA 1YPMH 3K9XB 4I32A 4I8HA 1MAXA 1GBEA 1HXFH 2JKHA 2GMTC 3ESTA 1EX3A 2ZDAH 3LGTA 2IPHA 4F49A 2BLQA 4X1PU 5ESBA 2VB0A 4AG1A 2OTVA 2HPPH 3A85A 2ZHWH 1P3CA 4FUFA 2WHXA 1Z6JH 3SJ9A 1FN6A 2C93B 4TY6A 4ZKRU 3SW2B 2A32A 4LZ4B 2ZU5A 1HAVB 1Q31A 3LOXA 1HAYB 4FXGH 4BAMB 4MPXA 3MU8A 4Q7XA 1IQFA 1KTTB 3EE7A 4ZUHA 1UCYE 2BQWB 4K2YA 5E0JA 4RSPA 1GHZA 1O0DH 1C2LA 2HVXA 1V2JT 2FOMB 3BTFE 1C1UH 1V2WT 2QXHA 2Z9KA 1VITH 1TQ7B 3S69A 2VIWA 2AYWA 2FI3E 4ZH8A 3ZZ6A 1DWCH 1SGTA 3SV7A 3T29A 4DY7B 2W7UA 2WUBA 3RXSA 1GMDF 4I8GA 4UE7H 2XBYA 4JZIA 1ZTJA 3SGBE 1O3DA 5G4BA 2BD3A 3BTEE 1C2DA 1EJMA 2A5IA 1SGPE 4OS4A 4MLFB 2Z6BD 1XUHA 1ESAA 1WOFA 2CJIA 3KN2A 1DITH 1H9IE 3RXQA 1HDTH 1EJNA 1YPHC 1L1NA 1EFRD 3BTHE 3ZVGA 3E3TA 4ZXYH 3IWMA 2YMSC 3F9HA 2UWPA 1G32B 2FS8A 3N7DA 1ZGVA 2C8XB 2BDGA 1BDAA 4HTCH 4YXWD 2A31A 2AERH 1DLEA 3RM0H 2JH0D 3M3VA 1E35B 3GY7A 5FPTA 3E0PB 1QBNA 1AGJA 3LPRA 1QL7A 2ODPA 4D76A 3VFEA 1ARCA 1ZGIA 2J98A 7KMEH 1DXPA 3SZNA 4AFSA 1Y3UA 1QJ1B 3L33A 3E0NB 4B2AA 4ASUD 1FI8A 1O5DH 4XBBA 2XWAA 1DX5M 1SLVB 1DPOA 1K0HA 2AGIX 2TGTA 1LKAA 1Z8JB 4ISNA 1MU8B 5CDFE 2KFWA 2Y5GA 3N7EA 1QY6A 1CSOE 2ZU1A 3TGKE 1O2YA 1O5AB 1O5GH 4ABHA 2XXLA 1V2PT 2EA3A 2HNTE 2ZQ1A 4Z0KA 4MNWA 3BTME 3NXPA 4HG6A 3RXTA 4DURA 1C5SA 2CGAA 2P3UB 2FYQA 2J92A 5KGOA 4GHQA 2BD8A 3FP8E 3FOAA 2BD2A 4GLYA 2PSXA 3W94A 1EB2A 1BHXB 5AFYH 3SU5A 2PV9B 3ZVBA 4AB8A 5T6GA 3NK8A 1SHHB 1AMHA 1FIWA 1ZTKA 1GMDG 1S6FA 3AASA 2QCYA 3RXJA 3M3SA 4ZAEA 1ZJKA 1OX1A 5FBEA 1A7SA 2ULLA 5L2ZH 1O35A 4Z1MD
chains in the Genus database with same CATH topology
1BTHH 1T8MA 1ETRH 1C4U2 1LHEH 1TPAE 1SC8U 4THNH 4YT6H 4BTUB 3RXEA 1G30B 4NWLA 2FS9A 3UNQA 1BMMH 1SGQE 3ATIA 1SGRE 5FPYA 1JXPA 4X2VA 1O2TA 1TX7A 3V12A 3FANA 4ZHLU 3ZZ7A 3HATH 1QL8A 3PB1E 1SFIA 2D26C 2HRVA 2ANMH 3B9FH 1CA0B 2ASUB 3Q77A 3PO1B 2ZCHP 1HFDA 3U98H 2WYGA 5DJ7A 2WPLS 1MU6B 1O39A 3LGUA 3ZVAA 1ELFA 1W2KH 1D9IA 1LQDB 1EXFA 4D7GA 1J9CH 1PPFE 1CGJE 4I33A 1HNEE 1RIWB 2BDCA 4BAHB 5A09A 2XNIA 4Y8XA 1TGSZ 2XW9A 3RXVA 1JRTA 2BLWA 4JZDH 4E7NA 1C9TA 3QDZB 2FEQH 5EQQA 3VGCB 5HXFA 3ATMA 5F03A 1W7XH 4UDWH 2BY5X 5DPAA 3RC5A 2Y81A 4OGXA 2Q1JA 1AWHB 3SNDA 4UEHH 1INCA 3DFLA 1GMCF 1GBHA 4WWYA 2P8OC 1MD8A 3VB7A 1WAYB 4B76A 4M7GA 2BXTH 5C2ZA 3MO9A 4I8LA 1O3JA 5A8YA 7GCHG 1SSXA 1NROH 1G37A 2KAIB 1RRKA 4U01A 1UK2A 3MO3A 2VIDA 5BRRE 1ZMNA 2R0LA 1TNIA 2RG3A 2BD7A 1N6YA 4ZHAA 1MTSA 4A1TA 4CBOA 1RTFB 2FESH 1XXFA 3E16B 4X8SH 1D6WA 1BA8B 3R0FA 3HPTB 4D9RA 1O5FH 1CT2E 1FAKH 3BTGE 3CP7A 2H2ZA 1S81A 3QWCH 1ELVA 2HOBA 2FXRA 4K1SA 4DCDA 1O5EH 1C2IA 1OWIA 4ZKOU 4AB9A 4VGCC 1BTZA 5JB8S 2BD4A 1LO6A 1TABE 3S7KB 3GY5A 1ZYOA 2ZHDA 1HBTH 2ZCLP 2Y7ZA 3RXAA 5C1UA 5JPMH 1B0EA 3MU1A 1WTGH 2QA9E 4O9VA 3QN7A 2NU3E 3PMHB 1LQEA 4Q80A 2SFAA 1F5RA 4CH2B 3BTTE 2ZU3A 1E38B 2QYIA 1BJUA 1E34B 4NZLA 1FUJA 2ANWA 2BTCE 3LU9B 2WPMS 1QURH 1ZMJA 3A88A 4NWKA 1QQUA 1HAPH 1T4VH 1KIGH 3D23A 1P04A 1SGFG 4DJZB 1C2HA 4FUGA 3RLWH 1O2JA 2XBXA 1O3OA 1MTWA 2WV5A 3BG8A 3V0XA 1UVOA 3SV2H 2ZHQH 5A0AE 3GCHB 2Y5FA 1P8VC 2CF8H 5FX6A 2GT7A 1LPGB 1GBLA 2LNCA 1BT7A 3A7XA 4BXSA 4XE4A 1KXCA 1UVTH 3S0NA 1YBWA 4GVUA 1H9LB 1O3BA 1S84A 3AW1A 1QQ4A 4TPIZ 1K1OA 1P01A 3RUOA 3LGWA 5HM9A 4YM9A 1ESBA 5E8EH 1IQLA 5FBIA 5E2OA 4OS1A 1K21H 4U30A 1THRH 2KAIA 1BMAA 4BNRA 4BTIB 1OWHA 1GWAA 2FI5E 1C5QA 3CS7A 3P8FA 4WF8A 1MCVA 3JZ1B 4XFQA 5DK1A 3VXEH 5JB9S 1TX8A 4AYYB 1AUJA 4FUIA 1DWEH 1AIXH 2W3KA 2GCTB 3ATWA 2O8TA 5DP9A 1EKBB 1EASA 2ZG0H 3RLYH 1TRNA 3TK6A 3Q00A 1YM0A 1FIZA 1Y3VA 2BLOA 2DE9A 3EAJA 1E0FD 2F83A 4KELA 4NA9H 3QGNB 3S9AA 5F6MA 1D3DB 5L2YH 1HAZB 4ABFA 3P8OA 3DD2H 3FP6E 4Q7ZA 3URDA 9LPRA 1W3CA 4FUBA 1NU7B 4GSOA 1F5KU 4CRAA 2GZ9A 1F0TA 4D7FA 1BTYA 2V0BA 1O2LA 5JYIA 2YNAA 2A2XH 1BRBE 4AORA 4KTSA 4KP0A 1V2TT 2G52A 2XYAA 1HAVA 4CRFA 1IOEA 2ZCKP 1K1JA 1ZHPA 2FWWA 1C1OA 3C27B 3Q3YA 1QB6A 1Z8IB 3GY4A 1FPCH 1NZQH 2PR3A 2Z9IA 1NFYA 1PFXC 1Q3XA 1GVZA 1G3CA 3O8BA 1GHWH 1MQ6A 4DVAU 4MPUA 1PYTC 2GZ8A 3TJOA 3TK5A 2ANKH 1ELGA 3RMNH 1HRTH 4WJG2 3DFJA 4X1RU 2PGQB 1QHRB 2Q6FA 4YOIA 4A7IB 3F9GA 1QCPA 2VVUA 1C1VH 1F0SA 1G2LA 1C1PA 1W14U 1D6RA 1F5LA 1L2EA 4NA7A 3ZV8A 3HK3B 4AFUA 1P09A 3P8NA 3RC4A 2BX4A 3GDSA 1P2QA 1N8OB 5FPSA 1BHXF 1DS2E 1V6DA 2A5KA 1SOZA 1DWBH 1IHTH 2A45B 2GGVB 1VCWA 3RC6A 1A0LA 2ZZUH 3PYHA 1KYNA 2G51A 1V2MT 1FY4A 8LPRA 1ZPCA 4FU7A 5JBBS 1NS3A 1Y3YA 3TJNA 4NA8A 4O3TA 1RGQA 1C1RA 2Y80A 3PROA 1K1IA 1D4PB 1SGFA 4F4OC 6CHAB 2OC1A 4QT8C 4ZKNU 2BQ7B 5EPNA 1D3PB 4NCYA 1Y3XA 1T32A 3UNRA 1S6HA 3RXGA 1BB0B 1MMJN 1XKAC 1P11E 2ZDLA 3LJOA 3A8CA 1LDTT 1BZXE 4YLQH 1EQ9A 2ZDKA 4JZEH 5PTPA 3WY8A 5AVDA 5C3NA 3MU5A 4ZROA 1BMLA 1O2OA 1XUIA 3SJ8A 1ZHMA 2ZPRA 1KDQA 4KKDA 2BY6X 2GKVE 4K5ZA 5LH8A 3N7OA 3RM2H 4Y8ZA 2FX4A 1AN1E 3QZRA 3A80A 1BTXA 1O32A 2BVRH 3M36A 1GMHF 3STJA 5A8ZA 2Z3CA 3GCOA 4IW4E 4R8TB 3U1JB 1SVPA 5HGGA 1DLKB 2EI7A 2R3YA 1RS0A 3U1IB 1GBMA 3MH7A 5E2PA 2QV1A 1TLDA 2IN2A 1AZ8A 3BTQE 1NRNH 3FZDA 1GJCB 1GHBF 3SI3H 4UD9H 1AFQB 1O3PB 2OINA 1YGCH 4KTUA 3BV9B 1T8NA 2Q6DA 1YCPH 3QTOH 2PHBA 3RXMA 1G3BA 4X1NU 1AE8H 1EPTC 1GMHG 3NZIA 1O33A 1YCPK 2ZFQH 3KQCA 4Y7AA 2BY8X 1KTSB 3BEUA 3URCA 1NTPA 4HFPB 1GHAG 2V3HH 5LPRA 3F1SB 1YP9A 1GBDA 4I31A 2PUXB 1DXWA 2ZPSA 4Y8YA 4CRDA 1GHXH 3UPEA 3RU4E 4A6LA 3UREA 1ZOMA 8KME2 2H9EH 3BG4C 1XVMA 4YOGA 5JBTA 1QJ7B 1BJVA 4INKA 3KEEA 1TNHA 4Q7YA 2B7DH 2FOHA 2WV4A 1ZRBA 2G55A 2PGBB 1SB1H 2XC5A 5FCRA 2ZGXH 1TFXA 1JOUB 2QF3A 2ZA5A 2ZPQA 1ZPZA 1F2SE 1PPCE 3A7WA 1K1PA 3VGCC 5EXMA 1C1TA 4ZKSU 1NFXA 1E37B 1ELAA 3MNBA 1GJBB 1O3LA 3S7HB 1Z8RA 1KSNA 1YPJH 2STBE 4JYUH 4MVNA 2OC0A 3ZZBA 1V3XA 1HGTH 1ZPBA 3EDXB 3HKIB 1CHOF 1AO5A 5C5NA 5C1YA 1C5VA 1F0RA 2B9LA 3L6PA 3V13A 3ZVCA 2D8WA 1KXAA 4HI3A 4GAWA 1EB1H 5A0BA 4X8VH 1K1LA 3EQ0H 3ODDA 2EEKA 2ALPA 3BEIB 1DVAH 4B71A 4I8JA 2C8YB 5HMAA 4JZ1A 1YLDA 1P2MA 1DUAA 4X2XA 4Y7BA 3MNXA 2FLBH 1TRMA 4OS7A 3MO6A 2Y82A 1HUTH 4E06H 3E1XB 3M3TA 1KXDA 1PYTD 2VWMA 3M61U 1TNJA 3DHKH 1NN6A 5IDKA 3BN9A 2QXJA 3SU0A 2BOHB 3VB3A 3RXLA 1CVWH 1O2ZA 1P0SH 2C3SA 2VIQA 3NWUA 3EA7A 2QAAA 3OY5U 5EPYA 1P02A 1H4WA 2FM2A 4ABBA 1SQAA 5K7RA 1HAXB 5GJ4B 1DY8A 1V2LT 3DUXH 2DUCA 2FOEA 5CMXH 2OXSA 1CA8B 3O8DA 4U2WA 3SNCA 3UY9A 1LMWB 2G4UA 1RD3B 1YCPM 4NZQA 1Y5UT 1GJ8B 1MKWH 1GI6A 1CGHA 3KCGH 1DUEA 2VGCB 1C5LH 2VIOA 2Y6TA 2D2DA 1SPJA 4NSVA 1QB9A 5BPEA 2A4GA 5EQRA 2FP7B 1LVBA 3AAUA 5L6NH 3ZZ5A 4FUCA 4FUEA 4MG3A 1HV7A 1GGDC 2FZZA 2OCVB 4IC5A 2P93A 1C1NA 3TH4H 1PQ8A 1G9IE 1O31A 2NU1E 3PWCA 4GCHF 2ZDNA 3RU4D 1ZTLA 2JETC 3KL6A 1GG6C 1TGNA 4PROA 2GMTB 2ZFSA 3LIWA 8GCHG 1P05A 1XMNB 5CE1A 2BB4A 2QXGA 2FOGA 1J14A 3TPIZ 1MBMA 3HK6B 3EE0B 2QC2A 3ZVDA 1GDQA 3TNTA 3SUFA 3KF2A 2ZGBH 2IJOB 2CV3A 1TOMH 1UTMA 3U8TH 1HB0B 2J9NA 5AFZH 2FLRH 2QIQA 2QN5T 3ITIA 1EAXA 1OSSA 3D65E 3ENSB 5EU8A 3A82A 3P17H 3ZYEA 2JH5D 1P2NA 3A7TA 1KXBA 5C20A 4ZHMU 1P10A 2A7CA 4CRCA 3FFGA 5EG4A 1Z1IA 3GY6A 1V2RT 4OS5A 1AQ7A 2SGQE 1K28D 2AEIH 4K1TA 1CO7E 1Z8GA 3GICB 1WTHD 3O8RA 1DDJA 1FY8E 1BOQA 1GI9B 2OD3B 1B5GH 2BD9A 1Z71A 3LKWA 2PUQH 1WSSH 3C1KA 1LHFH 1UK4A 3A87A 3UFAA 2Z9LA 3ATLA 1S5SA 1TWXB 4NSYA 4JK5A 2ZP0H 1DY9A 4TPYA 4K60A 2VIPA 1C5PA 1O38A 1YKTA 2A7HA 1C5RA 1C5WB 3MNSA 1CU1A 3QO6A 3ZYDA 3O8CA 1GVLA 3M5LA 1W8BH 4B73A 1MTVA 2K1QA 1H8IH 1QGFA 1HJ9A 4CRBA 1LVOA 5FXLA 2WINI 3M5NA 1SGCA 2V35A 3RXKA 3SI4H 3OU0A 4ISOA 1W7GH 1MTUA 2SNVA 1O30A 5IYTA 2R3UA 1MBQA 2B8OH 1SLXB 1NRQH 1UVSH 1ELCA 1EAUA 1C2JA 1QRXA 1SQTA 4FUHA 2W7SA 1LCYA 1FLEE 5A2MH 4ISLA 1TE0A 3GCTF 4NG9H 1C5UA 1EUFA 1TB6H 1TMTH 1Y3WA 4HZHA 4ZXXH 1HXEH 1A3EH 2F91A 2JH6D 4U32A 3GDUA 1ETSH 1UJ1A 4NFEA 4OS6A 1UVUH 1TMBH 4ASHA 2BDBA 4XBDA 3SU3A 4DGJA 2OC7A 4UONA 2F9PA 3FZZA 1W12U 4FU8A 1MUEB 1V2VT 5E0HA 1GBTA 2G8TA 3RXPA 2AIQA 1EP6A 2GD4B 1OP0A 2C8ZB 5J4SA 1BUIA 3RXIA 1CT4E 1NC6A 4UFEH 1ZSKA 3T27A 2PLXA 1GI3A 4Y0ZE 4NFFA 4ZMAH 1UTOA 3SU4A 3ZZDA 1UCYH 1L1GA 1WBGB 2UUYA 2BDAA 1MKXK 1XKBC 1DM4B 3GCHC 3OSYA 7ESTE 3PLBA 1JRSA 1CHGA 3AVZA 6LPRA 4OS2A 4E05H 1UHBB 4X2WA 1CBWB 2BYAX 3H7TA 4CHAB 1ZHRA 3E6PH 3SN8A 2D1JA 2H6MA 1ANBA 2GDEH 1VZQH 1FDPA 1RTKA 3E8LA 3VB6A 1UTJA 2VWOA 1LPZB 2P95A 3GY3A 2ZNKH 2HWLB 4A1VA 4B75A 1P2OA 1CA0C 1HJAC 1XX9A 1QL9A 3MNCA 3OYPA 1SG8B 2SNWA 1DT2A 3I29A 1XM1A 3MTYA 3UTUH 3MH4A 1RFNA 1MTNB 2XC0A 3PMBB 1ELBA 1BRCE 3SORA 1HAOH 1M9UA 3SO3A 2XCNA 1IQGA 1SGEE 2PKSC 1W10U 3A86A 4X6NA 2OC8A 1BBRK 1KDQB 1AVGH 3FVFB 2YNBA 1QRWA 3PWBA 2TRMA 4UFGH 1AB9C 1AVXA 1UTQA 2H5DA 1CGIE 2F9OA 4BTTB 1QTFA 2OBQA 4AFQA 2G00A 1N6XA 3SU1A 4MNXA 2Y5HA 1AE5A 5CHAC 1CQQA 1O2KA 1TIOA 1GJ4H 5DG6A 5GDSH 2PWXA 3TGIE 4WH8A 3SGAE 1WU1A 1ANCA 2SGEE 3DA9B 1LHGH 1V2ST 4CREA 1SFQB 3T2NA 2ZDVH 1O2GH 1TBRH 3FAOA 3ZZ3A 2BQ6B 1C5ZB 3RP2A 3QGJA 4LOYH 1OYQA 5EQSA 3MOCA 3A7VA 4B2CA 1MTNC 2J34A 3A8BA 1FY3A 1A61H 5F8XA 1BMNH 2ZECA 1O3KA 2R2WU 2TPIZ 7LPRA 3PV4A 2XCFA 5EXNA 3MU0A 1NESE 5AF9H 3LT3A 1K1MA 1GJAB 1H1BA 4NIYA 2FOCA 1W0YH 2SGPE 1O2RA 3JZ2B 2ZFTA 1ARBA 1C5NH 2R2MB 3LDXH 1BBRH 1AKSB 2PKAB 4K8YA 1RXPA 2BZAA 1P2IA 1GG6B 2NU2E 3PTNA 3PMJA 3EA9A 2WPKS 1CBWC 3ZVEA 4TWYA 2UUFB 3I78A 3BSQA 1VGCC 1AUTC 3A8AA 4IS5A 3SGQE 2QY0B 2HALA 2GT8A 1UCYK 4DG4A 1B7XB 1TONA 2R0KA 1OP8A 1VJ9U 1C2KA 1P2JA 1SQOA 1T8LA 4ESTE 4KGAA 4LZ1H 1V2KT 3E90B 8ESTE 4X8TH 2BX3A 3SUGA 2G5VA 2NWNA 4XSKU 4AOQA 6ESTA 2G5NA 1FONA 3SJKA 5GWZA 3S9CA 1F92A 3F9EA 1MH0A 1GL1A 3UWIA 1O3IA 3T28A 1RIWC 1O2MA 3P6ZB 2FOBA 2I6QA 1PQAA 4YO9A 1AFEH 2THFB 2BDHA 3RMLH 6GCHF 1WUNH 3OTJE 3GY8A 2AS9A 2GVFA 2ODYB 4AN7A 1O2PA 2ESTE 2FMJA 1ACBE 1EOJA 3UUZA 5TCCA 2H5CA 1P9SA 3SJOA 3GY2A 2GTBA 2A4RA 4MNYA 3M37A 3PLPA 1AVWA 1NRRH 2B0FA 1XVOA