4X2XA

Crystal structure of the murine norovirus ns6 protease (inactive c139a mutant) with a c-terminal extension to include residues p1 prime - p4 prime of ns7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
176
structure length
166
Chain Sequence
SIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTGGTIPGDAGCPYVYKKGNTWVVIGVHVAATGNTVIAATHGEPTLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NS6 protease
publication title Structure determination of Murine Norovirus NS6 proteases with C-terminal extensions designed to probe protease-substrate interactions.
pubmed doi rcsb
source organism Murine norovirus 1
total genus 28
structure length 166
sequence length 176
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2xA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2xA01
1DT2A 1LHFH 4E7RG 2ZCKP 2ZZUH 1LDTT 1O3GA 2OBOA 2D26C 4IGDA 3U1IB 3VEQB 1O2JA 4AFQA 1N8OB 3D65E 1UCYK 2ZG0H 1TPPA 2BDBA 2FWWA 4Y11E 1TMBH 2SNVA 1FAKH 3LJJA 1G3CA 1Y5AT 2SGQE 3A7ZA 3RXGA 1QY6A 1GHAG 1V3XA 4K8BA 1BMMH 2QCYA 1NESE 1BHXF 1CT4E 3D23A 1GHWH 3JZ1B 3A80A 1W0ZU 2V3OH 4WMEA 3A84A 2VIPA 1CGHA 2FM2A 3LGVA 1GDNA 5FXLA 2CMYA 1ESAA 3UWJH 2BDCA 1EPTB 1TRYA 1Z71A 1EPTA 2A5KA 4JYTA 3M3SA 2ZO3H 4BOHA 1XXFA 2H6MA 2ZGJA 1YCPM 1V2NT 2A7CA 2HRVA 4LZ4B 1Y3VA 1W12U 5L2YH 2HPQH 1SMFE 1DITH 1FDPA 1MU6B 1A2CH 3AVZA 1GPZA 1QB9A 1BRUP 1ELVA 4DCDA 4ZMAH 4XBBA 3F68H 1B0EA 4D9RA 3MO9A 1O39A 4ZKRU 1ZHMA 3ENSB 1FN8A 3BG4C 5A0CA 2EI6A 2TBSA 4DURA 1FJSA 3M61U 1TNIA 4LOYH 1CHOF 3L33A 1NROH 2UUKB 3MI4A 5T6FA 1V2RT 2HNTC 2TRMA 3A8DA 4AFSA 1SOTA 3SV9A 1GBHA 1RTFB 1BMNH 1UCYH 1Y8TA 4K2YA 1ELCA 3TNSA 5A8XA 1XUJA 3PB1E 2VIQA 1OX1A 1LVBA 4BTUB 1IQIA 1OP8A 1ACBE 2A31A 3OY6U 1Z6JH 1W11U 2Z9KA 5EXLA 1Y59T 3BIVH 3UFAA 2J34A 1BTXA 2P16A 1QBOA 1XKAC 4CHAC 3QO6A 1RIWC 4IN2A 1WYKA 3Q3YA 3EGKH 1HXEH 4FUCA 2HALA 3FANA 2GZ8A 1FLEE 3STJA 4ZAEA 2R3YA 4I8LA 4SGBE 3M5LA 4Y0YE 4YTAA 3TGKE 1FPCH 2PKSB 2WINI 1RD3B 3LDXH 4WH8A 3RM2H 1PPEE 1WTHD 4Q7XA 1PPHE 1JBUH 2G5VA 5DP3A 4TWYA 4MDSA 2C90B 1B0FA 1NT1A 2ZEBA 2C8ZB 3BTEE 2UWOA 1CO7E 1ZJKA 1W2KH 1NU9A 4ZHMU 3H7OA 1C5MD 1AY6H 4CRDA 2BQ6B 2G5NA 3MTYA 5DP7A 3PM3A 1P2OA 2FPZA 4NWKA 3SHAH 1JOUB 2Q6DA 1TNLA 1NRPH 5HM2A 1J14A 1VZQH 2O8UA 2HNTF 3VGCC 1GI6A 1S84A 2FI5E 4X8VH 3SBKA 1BMLA 5FCRA 3BSQA 3T28A 2ODQA 3FFGA 4H6SB 2B9LA 1GI5A 1SG8B 4Y10E 2XTTB 3BV9B 2Q6GA 1QBVH 3BG8A 5K7RA 4RSPA 2XC0A 2BLOA 1FY3A 2OC1A 1O2QA 3ATIA 1ZTKA 1NFXA 3HK6B 1O2OA 3FP6E 5L30H 1MBQA 1C5UA 1O5AB 1SGTA 3Q76A 1ZMNA 3DHKH 1G3EA 2BM2A 1ARBA 4KP0A 1AIXH 1DY9A 3MU4A 3NUMA 4A1XA 3BG4B 2FYRA 4OS7A 1FIWA 1VJAU 3Q3KA 1C2MA 1V2MT 1TNJA 3ZVAA 2GZ9A 2JKHA 4YESB 1SGYE 1N1LA 3GDSA 1P04A 1HYLA 3RC5A 1MH0A 1C2LA 1J15A 5AVDA 1MAXA 1GMDF 2A4OA 2WPMS 1D6RA 5EOKA 3TH2H 3AAUA 2FIRH 1YPMH 1AGJA 3A7YA 4WXVA 3RXAA 1O3LA 2V3HH 1AVWA 1Y5BT 4Y7BA 3QUMP 4NA7A 1ANBA 4H4FA 4BAMB 3UPEA 4JZ1A 1RGQA 1J16A 2OQUA 1GI1A 1H8DH 2QA9E 1K28D 1T32A 3EQ0H 5DK1A 2VVVA 4CHAB 5A2MH 3UIRA 5FX5A 9LPRA 3H5CB 2FOEA 1LVYA 3F9FA 1OKXA 3A7TA 3K65B 1GWAA 1UTNA 2DE8A 5E2OA 1GHXH 1DOJA 2BVRH 2BD4A 4CH8B 1LKAA 2XW9A 2JH6D 2PSXA 1QGFA 1TA6A 5F8TA 3M7QA 1SPJA 1HAYB 2A4GA 1YPHC 2ULLA 2CJIA 3ZZ8A 1TNHA 3RXTA 2C4FH 1GMHF 5EU8A 3HPTB 1G30B 1SBWA 1GJ8B 3RXDA 4NIYA 5J4QA 1GVLA 1O3DA 2Z7FE 4QT8C 1OYTH 1XM1A 5GWZA 5BRRE 1TGBA 1V2OT 2A4QA 3I77A 4DOQA 3VGCB 3LKWA 4HGCA 4ZHLU 3KNXA 1RRKA 2HGTH 1SGFG 2AERH 1P12E 1HAIH 1MZDA 1FQ3A 5LH8A 1O3FA 1CHGA 1O2HA 2Y82A 4F4OC 2FTMA 5DKMA 2GCTB 3TGIE 3GY3A 1SB1H 3LT3A 5JBCS 3SNDA 3ZZBA 4Y6DA 4CREA 1A1RA 1SFIA 1D3QB 2WPHS 1TAWA 5C67A 1LMWB 4ZKOU 1K1LA 5IDKA 3A7XA 4X8TH 2VWNA 2WUBA 4OGXA 2OINA 1UTPA 1HCGA 3ZZ4A 3URDA 1WSSH 4DJZB 2JETC 3RXPA 5T6DA 3KGPA 2Z3DA 3PMHB 1ELBA 1H1BA 1QB6A 1SLWB 1E38B 1V2LT 1NRQH 4LK4A 2NU4E 2PTCE 2D1JA 4IN1A 1P57B 1BQYA 3UUZA 3QTOH 1P2KA 2I6QA 4F49A 3W94A 4ABDA 1PJPA 1G2MA 2GVFA 2CHAB 2OC8A 2UWLA 4Y7AA 3RXVA 1BBRK 2G8TA 1HJAB 1INCA 1OP0A 1LO6A 3PTNA 1HIAB 3L6PA 3T2NA 4DY7B 1P2NA 3LGTA 4DW2U 4D9QA 1A0JA 1HIAA 2Y5GA 1A7SA 1K2I1 1AZZA 2SGPE 1MD7A 4BNRA 3EYDA 4CRAA 2Z9JA 1VITF 4ABEA 3HK3B 5EQSA 4R0IA 4ZXYH 4CRBA 2FOAA 3FVFB 5EPNA 1HAPH 5FX6A 3MMGA 3BEFB 3TK9A 4RKOB 4IS5A 1FNIA 1EJNA 1D6WA 1FAXA 4U30A 1O2NA 1G36A 4CRCA 1A3EH 1HBTH 1GHBG 4IMZA 3FP8E 4K5ZA 4MQAA 4WH6A 2BY7X 3SORA 3V7TA 5HGGA 1F0RA 2H2ZA 4CBOA 1C2FA 3QGJA 3SHCH 1VR1H 1QQUA 2HNTE 4MNXA 3LGYA 3SJOA 1G9IE 3PMJA 2FOHA 4GCHG 1DSTA 1L4DA 4TY6A 1O2KA 1AMHA 2F9BH 5AFYH 3SUEA 2C8YB 3MU0A 4NIWA 2VH0A 3E1XB 1ESTA 1BDAA 3RXCA 2BLVA 2VIOA 3GY6A 4CBNA 1UVSH 1P01A 2BD8A 1HAOH 3ATMA 1QBNA 1IQNA 2P8OB 4LZ1H 1GJ4H 1ZGIA 2IN2A 5DJ7A 1F7ZA 1UK2A 3PYHA 3F9HA 1Z1IA 1KXAA 3C27B 5C1UA 1OWIA 2F9NA 1C1OA 3DFLA 1C2HA 1J9CH 2OXSA 4K69A 3UNRA 1LKBA 4XOJA 1P3EA 1FPHH 4WMFA 2VGCC 2Y5FA 2QXHA 1GHYH 1OPHB 4U01A 4AB8A 2BHGA 1BBRH 4GLYA 5JB9S 4H42U 3SU5A 1T4VH 2ZFFH 1Z8RA 3T5FH 3KQBA 1O2YA 2AMDA 1RFNA 3BTHE 2F3CE 3MH4A 4ABBA 4AN7A 3GICB 5E0GA 2Z3CA 1PPZA 3M35A 4ABAA 1N6XA 1Z8GA 4KGAA 1EQ9A 4MPWA 1C1QA 3U8RH 1CGIE 2KAIB 3FZDA 1N8OC 5A8ZA 2KAIA 3CS0A 3BTDE 2BY9X 1FIZA 1K9OE 1CSOE 3RMMH 2GV7A 2EEKA 1S0QA 1TB6H 1PYTC 4ASHA 2GKVE 2BY8X 2FX6A 2XC4A 3M36A 1C5SA 4AFUA 5J4SA 3GY2A 2VVUA 3GCHB 2BQWB 3PROA 1E37B 1DM4B 4D8NA 1NTPA 2ZFQH 3CP7A 1TONA 1ZTJA 2F83A 1FXYA 2P94A 8GCHG 4WJG2 1GDQA 1DUAA 2GCHG 1O2SA 1SVPA 1EPTC 1GG6C 1MTWA 1Q31A 4RN6A 3ELAH 3RC6A 2XC5A 1F0SA 1PQ5A 2GZ7A 2ZTYA 1C2DA 2B8OH 2V6NA 4K8YA 2P59A 1BTZA 2FYQA 1A3BH 1D3PB 2J95A 4WXIA 5EQRA 1SGNE 1QA0A 4Y8XA 3UY9A 4ABHA 4GHQA 4FVBA 2H9HA 1YKTA 3VB3A 4JZDH 1CE5A 2M5TA 1ZMLA 2CF9H 1AVGH 1EAWA 4ABJA 4JCNA 1TBQH 1SSXA 1C5VA 6LPRA 3P92A 1AHTH 4I8HA 1E0FD 3OX7U 3FZZA 1O3BA 1C5NH 1C9TA 1ZPBA 3ATWA 1YP9A 1YPKH 1SLUB 4DIHH 3E16B 1HJ9A 4ZXXH 3QK1A 2SGFE 1AUTC 1E34B 1P03A 5CHAB 2VGCB 1PYTD 2ZDVH 4YLUA 1SQTA 3CS7A 1HV7A 2BDYA 4IW4E 1HLTH 3HATH 3MU1A 1DLEA 1A4WH 3KF2A 1YPHE 1AWHB 1OWJA 5T3HA 1O2ZA 1C9PA 2VJ1A 4ABFA 3KCGH 2VWOA 3UOPA 1ABIH 3RXBA 3RXMA 2PKSC 3SJIA 2V35A 4ZUHA 1A5HA 6ESTA 1GHAF 1K22H 5FHTA 2B5TB 1DFPA 1FN6A 5DGJA 1YPGH 2BVXH 2AIPA 1LPGB 2J2UA 2H5CA 3ZZ3A 3RXKA 1O2LA 1B7XB 1VGCB 2FTLE 2F9PA 1K1OA 2AGGX 3P8NA 1WAYB 3PLPA 3DA9B 3K2UA 2Q6FA 5FBIA 2BVSH 3RU4D 5FPTA 3MH5A 1DDJA 1IAUA 5EXMA 2ZGBH 1GL0E 2O9QA 5F8XA 2AH4X 5EQQA 3SQEE 2H1UA 3BN9A 4FUGA 2VU8E 4O97A 1GG6B 1YBWA 3QZRA 2ZA5A 3DD2H 4K1TA 1GL1A 3TJVA 1ELEE 2ZDAH 1C5PA 2XRCA 2XYAA 4NSYA 1PPGE 3LC5A 2PKAB 3MHWU 2PKAA 4MG3A 1MU8B 1EZSC 1T7CA 4K3JA 1LHGH 1C1WH 1O3NA 1S81A 1CT2E 3W95A 2FOMB 3E91A 4FU8A 1SQOA 1TALA 1YLCA 3PWBA 1O36A 1YM0A 4K1SA 1SOZA 1FUJA 1IOEA 3SJKA 3TNTA 3A8CA 2VB0A 1Y5UT 3ZVBA 3EA9A 3SI4H 3LH3A 1C1RA 1UVPA 1V2UT 2AFQB 2FOCA 1XUFA 4XDEA 3TLOA 2XCFA 1GMCG 3GISB 3TK6A 1ANEA 1O3MA 2A2QH 1O35A 5GJ4B 3PLKA 1O0DH 1M9UA 2SFAA 3MWIU 1QL9A 2EC9H 2GT8A 2O8LA 2THFB 3T62A 1GBIA 3PV4A 1D9IA 3BTTE 1EKBB 3MH7A 1GI4A 1CA0B 4XSKU 1T8OA 3T29A 2NU3E 4B73A 1YLDA 2FOBA 1BTHH 5FAHA 3ZZ5A 1LCYA 1G37A 1ABJH 1O3EA 1TLDA 2BX4A 5TCAA 3QLPH 2GV6A 1O2WA 4MTBA 1BTWA 5TJXA 1TGCA 1TX8A 3TJNA 1O5FH 3RMLH 4AZ2B 3SZNA 2BDIA 2BD5A 1BB0B 3MNXA 3I78A 1BJUA 3UTUH 1KIGH 3B9FH 1EZUC 4KTCA 2CN0H 1C5RA 1BOQA 1NU7B 4AGJA 4ISHH 1GVKB 4TPIZ 4B2AA 1PPBH 3LPRA 4VGCB 3TK5A 1DLKB 4ISLA 2CGAA 3ZZ6A 3GCTG 2PGQB 5H4IB 3MNCA 3BEUA 4JZIA 2ZU1A 3P8GA 4UFEH 3RXHA 1GJBB 1HAXB 4E06H 1O3PB 1W3CA 1XXDA 4UFGH 1V2ST 3E8LA 1OWKA 1QL7A 2A32A 2EA3A 5ESBA 3RXIA 4A7IB 1F5KU 1EXFA 5C3NA 2FOGA 2ANMH 3ZZCA 3ZVFA 2OUAA 3V13A 4Y8ZA 1SLVB 1SL3A 3RUOA 7GCHG 1TQ7B 2GCTC 3E0NB 1IQFA 1QL8A 2V0BA 3KQDA 5GDSH 1TFXA 3M5NA 5HXFA 2FI3E 4E7NA 1DSUA 4AOQA 2G00A 3S9BA 2Y6TA 1B5GH 1UTKA 1JRSA 2G4UA 4X6OA 5F6MA 3SNAA 1CBWB 2BLQA 2RCEA 1UMAH 3GY7A 1O3KA 1ELTA 1NZQH 4B2BA 1P02A 1SFQB 3ZZAA 1TQ0B 4D7FA 2TGDA 1EP6A 1AN1E 2G4TA 3AW1A 3ODFA 3SU4A 3TH3H 1W0YH 1SGPE 4NA8A 2FODA 2SGEE 2ZQ1A 3PLBA 3SNCA 4Q7ZA 2Z9GA 5EG4A 2ZFRH 1ELFA 3MU8A 3U9AH 1OYQA 2LNCA 3STIA 4K60A 3ZV8A 1YPJH 1QIXB 1NC6A 1YPEH 1W8BH 2CHAC 2A0QB 3BTFE 2WPLS 1HJAC 2A7JA 2PSYA 3BTGE 5DP4A 2OD3B 4JK6A 1EASA 3BTWE 4M7GA 1LQDB 3P8FA 2FS8A 2ZIQH 2XWAA 4XBDA 3RU4E 5C5NA 2BDHA 4FU9A 2G55A 5GIBA 7KMEH 1MTVA 2A5AA 3RDZA 1GI9B 1S83A 4Q80A 1E36B 4Q2KA 2VINA 1C5OH 1PQ7A 1XUHA 5T6GA 4MNYA 1H9HE 3ZZ7A 3EDXB 1XUGA 3M3VA 1ZPZA 5DP8A 1UTJA 1RXPA 5C20A 1P0SH 2BMGB 1TBRH 2VIVA 1IQGA 1ELGA 1THSH 4WWYA 4ZKSU 1L1NA 3RXLA 1LHDH 3UR6A 1BTPA 2ODPA 2BY6X 5GPIB 3MYWA 2SGDE 3C1KA 1VCWA 1WUNH 6GCHG 3IWMA 1F0TA 5PTPA 1MCVA 1V2JT 5C2ZA 5E8EH 3B23B 3AW0A 3U8TH 8ESTE 2P8OC 2Y7XA 2F91A 3T26A 5C5OA 1QB1A 2AIQA 2FLRH 1Z8JB 4O03A 1GBEA 4IMQA 1AD8H 4X8UH 3K9XB 1GJ6A 2ZHQH 1ESBA 2Q1JA 3GCNA 1RTLA 1Y3WA 2G52A 3SV2H 2ZGCA 2XXLA 2HOBA 1WBGB 1TGTA 3DT0H 2YOLA 1UTMA 1Z6EA 8KME2 1AWFH 3GY4A 4Z6AH 2STBE 4ISIH 3M3TA 1A5GH 1GCDA 4DGJA 1F2SE 1ANDA 1C1MA 4IC6A 1NY22 3E90B 4CRGA 2H5DA 1C4V2 4GHTA 1ZSKA 1HAHH 1KSNA 1UCYE 1P9UA 4GPGA 1DXWA 3B8JA 1ELAA 1AVXA 1EATA 2W3IA 4CH2B 1BA8B 3SNBA 3JZ2B 4ZROA 1G3DA 2YNAA 3ZVDA 1OP2A 3GCHC 4NFFA 2VWMA 2A1DB 1DVAH 5CMXH 1O3JA 1V6DA 1DY8A 1XMNB 1PPFE 4HZHA 4B71A 4Y8YA 3QX5H 4XFQA 3UQVA 1GHBF 2FEQH 1DXPA 5DP9A 1BT7A 2QF0A 1KLTA 2ZDLA 1Y3YA 2Y81A 2QY0B 5DG6A 1VJ9U 3QGNB 3KQEA 2HLCA 1O2PA 2VNTA 1K1NA 2IJOB 1KXCA 2IOTA 4AYVB 3SV6A 1C5XB 1BRAA 5ABWA 1JIRA 3ESTA 3S69A 1QJ6B 3I29A 2R3UA 4GCHF 1MTSA 5A0BA 4BAKB 2ZU2A 1O32A 3BIUH 1O3CA 2O8WA 3IITA 2AMPA 1UHBB 1UHBA 3SOSA 1UK3A 1S6FA 1O5GH 4AG2A 1A5IA 4LXBH 1EB1H 4FUBA 1YCPK 2XBVA 3P70B 4R8TB 1MTUA 1H4WA 3SN8A 1BUIA 3LC3A 3SUDA 1T31A 1DWBH 4MVNA 3A86A 1WQVH 4BXSA 2DE9A 5CHAC 1ZLRA 3OTJE 1HFDA 1GCTB 1CT0E 2GDEH 4ZKNU 3SO3A 4ZHAA 2BOKA 1KXDA 3F6UH 4GVUA 3QTVH 5AHGH 2AEIH 3V3MA 2FLBH 1CQQA 4JZEH 5FCKA 1AFQB 2PLXA 3ODDA 1V2VT 3A8AA 3SJ8A 2A2XH 4ISOA 4X1QU 1T8MA 3F9GA 3A81A 2W5EA 4YOGA 2ZECA 3NKKA 1P2QA 2R0LA 4ISNA 3VXFH 2ZHEH 3UR9A 1RS0A 1Y3XA 4DIIH 2P3FH 3DFJA 5LPEA 1S82A 1V2QT 1JXPA 4X2XA 4I31A 1VGCC 1ID5H 2SNWA 2WUCA 4H6TA 1P10A 1UTQA 4UD9H 1QFKH 5F03A 2NU2E 8GCHF 2ZU3A 3E0PB 1NRRH 2GCHF 1IQJA 2TGAA 2F9OA 5L6NH 4A5TS 1GJCB 4INHA 2Y5HA 1KTTB 1AB9B 1ORFA 1C1VH 3QDZB 3KL6A 1FY1A 4INLA 1ZSLA 4TWWA 3MOCA 3GY5A 1IQKA 4YOIA 1GBBA 4THNH 3EAJA 5I25A 1P9SA 1YCPH 3LGWA 2TIOA 5GCHG 3ZV9A 3ZVCA 1TBZH 5JBAS 5JDUB 1SHHB 1MZAA 1TA2A 3RXSA 3RXRA 1LTOA 1OWDA 1EOJA 2FDAA 2PFEA 2FZZA 3LIWA 3F1SB 4NZLA 3RMOH 1F0UA 3LJOA 1LPZB 1C1PA 2BY5X 4J1YA 3RXJA 3V12A 4D7GA 3M7UA 1HAVA 1A46H 2FP7B 3HKJB 1O38A 2HWLB 1ZPCA 4TPYA 2TPIZ 1O5DH 1TX7A 2YNBA 1P2JA 1ZTLA 2CF8H 1DWCH 1O34A 2RA3A 3HGPA 1DS2E 1GBAA 1C2JA 2RA0A 2ZDKA 4GAWA 1J17T 1HAGE 2W7UA 3RM0H 3ZZDA 1OS8A 3LGUA 3KQCA 1BJVA 4MNVA 2Z6BD 1Q2WA 1EJAA 4WVPE 1BRCE 2BDAA 1D3DB 1YPLH 2ZQ2A 2ZPSA 4D76A 1EUFA 2OBQA 3NCLA 1CA0C 6CHAB 1A0LA 5F8ZA 1GGDB 1MQ5A 1TIOA 2D2DA 1FI8A 3ZVEA 2ZGXH 3URCA 5A09A 1TOCB 1NFYA 3VB4A 1Z1JA 4DT7B 3A88A 1KLJH 4AX9H 1KLIH 1AKSA 1CA8B 2R0KA 2FI4E 2A4RA 1KYNA 3TVJB 2BDGA 1ZRBA 3SJ9A 1F5LA 1TYNA 2GDDA 2W7SA 3SV8A 1G2LA 2ZTZA 4FUHA 2EI8A 3S9AA 1UK4A 1TPAE 4OS2A 3PMBB 3TH4H 3P17H 1MQ6A 3KHVA 1UVUH 2QGRA 1UO6A 4GUXA 5CE1A 3IG6B 4X0WU 2GTBA 5DP5A 1O3AA 1YC0A 4VGCC 2ANKH 1G32B 2BD3A 2OC0A 4A1VA 1KTSB 4Y76A 1GBJA 3UNQA 3Q77A 3KN2A 1XX9A 5EODA 3D62A 4X6MA 1NFWA 3H7TA 4A1TA 4U32A 3P6ZB 4XBCA 3RMNH 5C1YA 2CV3A 1SGQE 2FOFA 1P09A 1O31A 2EI7A 1TPSA 1O30A 4AYYB 1P2IA 4B1TA 1C1SA 2B0FA 2FS9A 3TITA 4UE7H 3TJUA 2TGTA 1C2KA 1T4UH 3SQHE 9ESTA 1EOLA 1UTOA 2QIQA 4IC5A 1DWDH 1QRWA 4NFEA 2R2WU 4MNWA 1PQAA 1TRNA 3TGJE 1K1PA 2ZFTA 3S9CA 1F5RA 1GJAB 2VVCA 2ZKSA 1C1UH 1QA7A 2O8TA 1QR3E 3NXPA 1SGEE 4X6PA 1GBMA 2UWPA 4OGYA 2ALVA 2ODYB 1DICA 1Z7KA 1QNJA 1BZXE 1GBCA 1L1GA 2C93B 1CBWC 1GMCF 5G4BA 4RKJB 1U6QA 1NFUA 3EA7A 2J4IA 2G81E 5JYIA 1BHXB 3FAOA 4BANB 4K1EA 1SGCA 2PWXA 1QQ4A 1QJ1B 4TY7A 1IHTH 2QC2A 1W7GH 1L4ZA 1XVOA 1DWEH 1MTNB 3O8RA 2ZDMA 2PUQH 2BZAA 3GOVB 1O2MA 3SU1A 5SGAE 3EE0B 4OS1A 4IBLH 1DUEA 4NG9H 3RXEA 1BBRE 3GDVA 2GGVB 1MMJN 3LU9B 1LHCH 1GBFA 3O8DA 1OSSA 1OWHA 1CHOG 2ASUB 3ATLA 4ZH8A 3DUXH 2Y80A 2BXUH 2FXRA 2BXTH 1C1TA 3UWIA 3LONA 1ZZZA 2VIDA 3SUFA 1XUKA 2LPRA 2ZI2H 2A45B 2ZCHP 3BTME 3PMAB 5JBTA 1ELDE 1O2RA 4I8JA 4FUFA 2BD7A 4ABGA 2QAAA 4HTCH 2PGBB 3KIDU 4YO9A 3RU4T 5AF9H 1K1JA 1P8VC 2ALPA 3NK8A 2BX3A 5FBEA 3TU7H 4B76A 3S0NA 1TGSZ 3MNSA 2ZP0H 3GCTF 3QN7A 1A61H 1TOMH 4JYUH 5L2ZH 1BTYA 1N6YA 1RJXB 1VCPA 1THRH 1TRMA 3LGIA 1BRBE 5GXPA 1JWTA 4AG1A 5HM9A 1GVZA 3RXUA 5ESTE 3M37A 2ZHWH 1TMUH 1GBLA 7GCHF 4A6LA 2ESTE 4AB9A 1S85A 4MPVA 1SHYA 5EXNA 1C4Y2 1V2KT 1IQMA 3SUGA 1HAZB 1GI2A 4NCYA 2ZFPH 2BD9A 3PTBA 1NRSH 1MAYA 1ZYOA 4YZUA 3U8OH 1HPGA 1HRTH 2FX4A 2Z3EA 2GMTC 1GI0A 4CR5A 1HDTH 2Z9IA 1NN6A 1HB0B 2B7DH 5A8YA 2ZF0H 1JMOH 1TPOA 3EA8A 5B6OA 1JIMA 1HJ8A 3SU0A 1ZJDA 4WY3A 1PPCE 3A7VA 3U1JB 2AS9A 2QF3A 1G3BA 2UUYA 1SC8U 4X2YA 4FUEA 4FXGH 2WPKS 1F92A 2BB4A 2P95A 2ZPQA 2C8WB 3ITIA 4B75A 4KTUA 3RXQA 2BZ6H 4FUIA 2HPPH 1WQSA 1FMGA 1NS3A 1XKBC 1CVWH 1L0ZA 1EJMA 3SNEA 1ETTH 4I32A 1C1NA 4A92A 1GJDB 2QXJA 2NWNA 2PTNA 4NIVA 1O3IA 1EP5A 4YOJA 1FY5A 2OCVB 3LH1A 1C5TA 3Q3XA 4Y0ZE 8LPRA 1ANCA 1LHEH 1P11E 4O3UA 1EZXC 3VXEH 1T8NA 1V2PT 3GDUA 4X1PU 2ZWLH 1GMDG 1MKWK 3M5OA 5JBBS 4JMYA 3VB7A 1D4PB 3HGNA 3O8BA 4X2WA 1W7XH 1W14U 1TX6A 5I46H 3MH6A 1LVOA 5JB8S 4E05H 1AE5A 1GJ9B 3MO6A 4FU7A 3M7TA 1RIWB 2GD4B 1YYY1 1O3OA 5HYOA 1NO9H 1BTUA 2J38A 3SU3A 3K6ZA 3NWUA 4NSVA 1AFEH 3K6YA 2NU0E 6GCHF 1O2IA 4WMDA 4JZFH 1C5QA 1FZZA 2UUFB 1LVMA 4YT6H 3PO1C 1O33A 1TNKA 3ZYEA 4MLFB 4BTTB 2ZPRA 1DANH 2GT7A 1GI7B 4XE4A 5HMAA 4TYDA 1P05A 3GY8A 2O8MA 2BTCE 2OQ5A 3S7KB 4CR9A 4AGKA 2AMQA 1FY4A 4BAQB 3TPIZ 4X1NU 4SGAE 2UUJB 1O5EH 2FMJA 4JYVH 1GMHG 1KXBA 2XBWA 2K1QA 4FVDA 1O5CB 2GMTB 5E0HA 4NA9H 1PFXC 3VB5A 1ZR0A 3SW2B 3S7HB 1GCTC 1C5ZB 2QXGA 1AZ8A 3SU6A 3QWCH 1TABE 3A85A 3MU5A 4YM9A 1P06A 3OSYA 1IQLA 2BYAX 3LOXA 1AFQC 2W26A 1HNEE 1RTKA 2AGIX 2H9TH 2QV1A 3SGBE 5DO4H 1L2EA 1X7AC 1K1IA 3GYLB 2ZU5A 1WTGH 1WOFA 1C5LH 1MKWH 4O9VA 1E35B 2VH6A 3GYMA 3NZIA 1S6HA 3M5MA 1AO5A 2BD2A 2HVXA 3ZVGA 1CU1A 3WY8A 1ZHRA 1UJ1A 4KTSA 2VWLA 5C1XA 2GP9B 2C3SA 5EGMA 1KXEA 1H9LB 2C8XB 4UEHH 1TGNA 1YF4A 2XCNA 3MFJA 3NPSA 1IHSH 1SGFA 1Y3UA 2QYIA 4MPUA 2VIWA 3RXFA 4Y79A 1EAIA 1AQ7A 4J2YB 5E2PA 3SI3H 2ANYA 1QJ7B 2ZC9H 1VITH 7LPRA 2JH5D 4KELA 1QHRB 3BTQE 5FPYA 1AB9C 4BAOB 1K1MA 1QURH 1ZRKA 4NZQA 1EB2A 1MUEB 1KY9A 1O2TA 3HKIB 4ABIA 3A83A 3A87A 1TNGA 2Y7ZA 3AASA 1AI8H 3VPKA 3U98H 5EW1H 1UVOA 2P3UB 2ZGHA 1SGIB 1FY8E 3L3TA 4HFPB 5E0JA 1SR5C 1BIOA 1VITG 2WYGA 4NWLA 4UFFH 3GCOA 1IQHA 1W10U 4Q7YA 1WV7H 2QN5T 1ZHPA 2R9PA 2F9UA 5LGOA 3PO1B 1ZGVA 1DX5M 4NGAH 3RP2A 2STAE 1ZMJA 1EAXA 2FESH 3Q00A 1QRXA 1O2VA 2BOHB 3PWCA 4HI3A 1VCQA 5EW2H 1IQEA 3BF6H 5BPEA 2AGEX 1K21H 1O5BB 2JH0D 3E6PH 3RC4A 1WCZA 1QCPA 5AFZH 1MBMA 3F9EA 1SGRE 2FO9A 5EPYA 1AUJA 1SGDE 2OP9A 2J9NA 1THPB 3MNBA 7ESTE 5LPRA 2WV4A 3BTKE 1OWEA 3P8OA 4DVAU 1ETSH 2PV9B 4FUJA 3SGQE 1GBTA 4I8KA 4X8SH 4X1RU 5IYTA 4B74A 2WV5A 2PR3A 4U2WA 1GDUA 1GI3A 2R2MB 5JPMH 2XNIA 1GHZA 1O2UA 1W13U 1XUIA 5FPSA 6CHAC 4YT7H 1GGDC 3UOUA 2CXVA 3O8CA 3A89A 2G51A 1MKXK 2WPIS 1O3HA 1C5WB 1NRNH 2A5IA 1HXFH 4AFZA 2XWBI 1GBKA 1P2MA 1FV9A 1J8AA 1JRTA 1KDQB 1SLXB 1WU1A 2J94A 4OS6A 1T8LA 1HGTH 1KDQA 3U69H 1MD8A 4UDWH 4ESTE 5K0HA 2OC7A 3R3GB 1C2GA 1O37A 5DPAA 1GJ7B 1AE8H 1QRZA 1UVTH 2JETB 4GSOA 2OTVA 3SGAE 2ZFSA 1EZQA 2Z9LA 3TIUA 1S5SA 4FUDA 3VFEA 1A0HB 1TMTH 2F9VA 2P3TB 1H8IH 1BITA 3P95A 1V2WT 1TE0A 3A8BA 2RG3A 1PQ8A 4BXWA 1OOKB 2BLWA 4AORA 4KKDA 1KXFA 4UONA 1AU8A 1SQAA 2ZNKH 4Z0KA 3OYPA 5ETXA 4Y71A 4I7YH 5GCHF 1GI8B 3V0XA 2ILNA 4WF8A 3T25A 2PUXB 4O3TA 2ZHDA 4I33A 4X2VA 2D8WA 1UTLM 5A0AE 1H9IE 1XVMA 2P93A 1ETRH 3MO3A 4BAHB 3G01A 4NIXA 1QTFA 3UNSA 2TGPZ 2DUCA 3N7OA 2ZCLP 2SGAA 1LPKB 1BCUH 2WYJA 2IPHA 3ATKA 4YLQH 2QXIA 3RLWH 3A7WA 3SV7A 1C2IA 1BMAA 3T27A 3RLYH 1MCTA 2H9EH 1HAVB 1D3TB 3QZQA 4I8GA 2ZDNA 4BTIB 2XBXA 1NM6A 1DPOA 1EX3A 4MPXA 3A82A 1NPMA 4CRFA 1HUTH 1C5YB 3OU0A 4OS5A 1MKXH 2WPJS 3D49H 1YGCH 1ZOMA 4B2CA 2BQ7B 1S0RA 1EAUA 2ZHFH 3BEIB 3SU2A 4DG4A 3OY5U 1L1JA 3CENA 1ZSJA 2W3KA 1MTNC 3RXOA 4INKA 2ANWA 1GBDA 1LQEA 1TWXB 1OXGA 2Z94A 2GX4A 2J92A 4X1SU 1Z8IB 3UREA 2A7HA 1Q3XA 2ZU4A 3AAVA 1V2TT 4OS4A 3R0FA 3VB6A 4UFDH 2AYWA 3KEEA 3TJOA 2I6SA 1C2EA 3UQOA 4JK5A 5LPFA 1ARCA 1DE7H 3ZYDA 1AKSB 2PHBA 1GJ5H 3E3TA 3ZZ9A 2NU1E 1P3CA 1GHVH 1SI5H 2RDLA 3FP7E 1O2GH 1CGJE 2XBYA 2OLGA 2ZTXA 4X6NA 1FONA 4PROA 1C4U2 5TCCA 5DP6A 1O2XA 2PW8H
chains in the Genus database with same CATH superfamily
5HIZA 1DT2A 1LHFH 4E7RG 2ZCKP 2ZZUH 1LDTT 1O3GA 2OBOA 2D26C 4IGDA 3U1IB 3VEQB 1O2JA 4AFQA 1N8OB 3D65E 1UCYK 2ZG0H 1TPPA 2BDBA 2FWWA 5C0UA 2EQNA 4Y11E 1TMBH 2SNVA 1FAKH 3LJJA 1G3CA 1Y5AT 2EY4C 2SGQE 3CNRA 3A7ZA 1YY3A 3RXGA 1QY6A 1GHAG 1V3XA 3PRDA 4K8BA 1BMMH 2QCYA 3W1EA 1NESE 1BHXF 1CT4E 3D23A 1GHWH 3JZ1B 2IJD1 2KM0A 3A80A 1W0ZU 2V3OH 4WMEA 2XOKD 2VIPA 3A84A 1CGHA 2FM2A 3LGVA 5C0TA 1GDNA 5FXLA 2CMYA 1ESAA 3UWJH 2BDCA 1EPTB 1TRYA 1Z71A 5DSFA 1EPTA 2A5KA 3OFND 4JYTA 3M3SA 2ZO3H 4BOHA 1XXFA 2H6MA 2ZGJA 1YCPM 1V2NT 2A7CA 2HRVA 4LZ4B 1Y3VA 1W12U 5L2YH 2HPQH 1SMFE 1DITH 1FDPA 1MU6B 1A2CH 1EFRD 3AVZA 1GPZA 1QB9A 1BRUP 1ELVA 4DCDA 4ZMAH 4XBBA 3F68H 1B0EA 4D9RA 3MO9A 1O39A 4ZKRU 1ZHMA 3ENSB 1FN8A 3BG4C 5A0CA 2EI6A 2TBSA 4DURA 1FJSA 3M61U 1TNIA 4LOYH 1CHOF 3L33A 1NROH 2UUKB 3MI4A 5T6FA 1V2RT 2HNTC 2TRMA 3A8DA 4AFSA 1SOTA 3SV9A 1GBHA 1RTFB 1BMNH 1UCYH 1Y8TA 4K2YA 1ELCA 3TNSA 2GJGA 5A8XA 1XUJA 3PB1E 2VIQA 1OX1A 1LVBA 4BTUB 1IQIA 1H8HD 1OP8A 1ACBE 2A31A 3OY6U 2LELA 1Z6JH 1W11U 2Z9KA 5EXLA 3OAAD 1Y59T 3BIVH 3UFAA 2J34A 1BTXA 2P16A 3FO8D 1QBOA 1XKAC 4CHAC 3QO6A 1RIWC 4IN2A 2W6JD 5C17A 5EJ1A 1WYKA 3Q3YA 3EGKH 1HXEH 4FUCA 2HALA 3FANA 2GZ8A 1FLEE 3STJA 4ZAEA 2R3YA 4I8LA 4SGBE 3M5LA 4Y0YE 4YTAA 3TGKE 1FPCH 2PKSB 2WINI 1RD3B 3LDXH 4WH8A 3RM2H 1PPEE 3F2FA 1WTHD 4Q7XA 1PPHE 1JBUH 2G5VA 5DP3A 4TWYA 4MDSA 3FN8A 2C90B 1B0FA 1NT1A 2ZEBA 2C8ZB 3BTEE 2UWOA 1CO7E 2W6ID 1ZJKA 1W2KH 1NU9A 4ZHMU 3H7OA 1C5MD 1AY6H 4CRDA 2BQ6B 2G5NA 3MTYA 5DP7A 3PM3A 1P2OA 2FPZA 4NWKA 3SHAH 1JOUB 4FOUC 2Q6DA 1TNLA 1NRPH 3OEHD 5HM2A 1J14A 1VZQH 2O8UA 2HNTF 3VGCC 1GI6A 1S84A 2FI5E 4X8VH 3SBKA 1BMLA 5FCRA 3BSQA 3T28A 2ODQA 3FFGA 4H6SB 2B9LA 1GI5A 1SG8B 4Y10E 4RI0A 2XTTB 3BV9B 2Q6GA 1QBVH 3BG8A 5K7RA 4RSPA 2XC0A 4Q63A 5KECA 2BLOA 1FY3A 2OC1A 1O2QA 3ATIA 1ZTKA 1NFXA 3HK6B 1O2OA 3FP6E 5L30H 3DSOA 1MBQA 1C5UA 1O5AB 1SGTA 3Q76A 1ZMNA 4DT4A 3DHKH 1G3EA 2BM2A 1ARBA 4KP0A 1AIXH 1DY9A 3MU4A 3NUMA 4A1XA 3BG4B 2FYRA 4OS7A 1FIWA 1VJAU 4F48B 3Q3KA 1C2MA 1V2MT 1TNJA 3ZVAA 2GZ9A 2JKHA 4YESB 1SGYE 1N1LA 4XRNA 3GDSA 1P04A 1HYLA 3RC5A 5FL7D 1MH0A 1C2LA 1J15A 5AVDA 1MAXA 1GMDF 2A4OA 2WPMS 1D6RA 5EOKA 3TH2H 3AAUA 2FIRH 1YPMH 3WWBA 1AGJA 3A7YA 4WXVA 3RXAA 1O3LA 2V3HH 1AVWA 1Y5BT 4Y7BA 3QUMP 4NA7A 1ANBA 4H4FA 4BAMB 3UPEA 4JZ1A 2HVYB 1RGQA 1J16A 2OQUA 1GI1A 1H8DH 2QA9E 3PRBA 1K28D 1T32A 3EQ0H 5DK1A 2VVVA 4CHAB 5A2MH 3UIRA 5FX5A 9LPRA 3H5CB 2FOEA 1LVYA 3F9FA 1OKXA 3KYGA 3A7TA 3K65B 1GWAA 1UTNA 2DE8A 5E2OA 1GHXH 1DOJA 2BVRH 2BD4A 4CH8B 1LKAA 2XW9A 2JH6D 2PSXA 1QGFA 1TA6A 5F8TA 3M7QA 1SPJA 1HAYB 2A4GA 1YPHC 1NBMD 2ULLA 2CJIA 3ZZ8A 1TNHA 3RXTA 2C4FH 1GMHF 5EU8A 3HPTB 1G30B 1SBWA 3PV5A 1GJ8B 3RXDA 4NIYA 5J4QA 1GVLA 1O3DA 2Z7FE 4QT8C 1OYTH 1XM1A 5GWZA 5BRRE 1E1RD 1TGBA 1V2OT 2A4QA 3I77A 4DOQA 3VGCB 3LKWA 4HGCA 4ZHLU 3KNXA 1RRKA 2HGTH 1SGFG 2AERH 1P12E 1HAIH 1MZDA 1FQ3A 5LH8A 1O3FA 3KQ5A 1CHGA 1O2HA 2Y82A 4F4OC 2FTMA 5DKMA 2GCTB 3TGIE 3GY3A 1SB1H 3LT3A 5JBCS 3SNDA 3ZZBA 4Y6DA 4CREA 1A1RA 1SFIA 1D3QB 2WPHS 1TAWA 5C67A 1LMWB 4ZKOU 1K1LA 5IDKA 3A7XA 4X8TH 2VWNA 2WUBA 4OGXA 2OINA 1UTPA 1HCGA 5EIYA 3ZZ4A 3URDA 1WSSH 4P02A 4DJZB 2JETC 3RXPA 5T6DA 3KGPA 2Z3DA 3PMHB 1ELBA 1H1BA 1QB6A 1SLWB 1E38B 1V2LT 1NRQH 4LK4A 2NU4E 2PTCE 2D1JA 4IN1A 1P57B 1BQYA 3UUZA 3QTOH 1P2KA 2I6QA 4F49A 3W94A 4ABDA 1PJPA 1G2MA 2GVFA 2CHAB 2OC8A 2UWLA 4Y7AA 3RXVA 1BBRK 2G8TA 1HJAB 1INCA 1OP0A 1LO6A 3PTNA 1HIAB 3L6PA 3T2NA 4DY7B 1P2NA 3LGTA 4DW2U 4D9QA 1A0JA 1HIAA 2Y5GA 1A7SA 1K2I1 1AZZA 2SGPE 3AK5A 1MD7A 4BNRA 3EYDA 4CRAA 2Z9JA 1VITF 4ABEA 3HK3B 5EQSA 4R0IA 4ZXYH 4CRBA 2FOAA 3FVFB 5EPNA 1HAPH 5FX6A 3MMGA 3BEFB 3TK9A 4RKOB 4IS5A 1FNIA 5IK2D 1EJNA 1D6WA 1FAXA 4U30A 1O2NA 1G36A 2M2AA 4CRCA 1A3EH 1HBTH 1GHBG 4IMZA 3FP8E 4K5ZA 4MQAA 1S6LA 4WH6A 2BY7X 3SORA 3V7TA 5HGGA 1F0RA 2H2ZA 4CBOA 1C2FA 3QGJA 3SHCH 1VR1H 1QQUA 2HNTE 4MNXA 3LGYA 3SJOA 1G9IE 3PMJA 2FOHA 4GCHG 4ACBA 1DSTA 1L4DA 4TY6A 1O2KA 1AMHA 2F9BH 5AFYH 3SUEA 2C8YB 3MU0A 4NIWA 5C94A 2VH0A 3E1XB 1ESTA 1BDAA 3RXCA 2BLVA 2VIOA 3GY6A 4CBNA 1UVSH 1P01A 2BD8A 1HAOH 3ATMA 1QBNA 2JDID 1IQNA 2P8OB 4LZ1H 1GJ4H 1ZGIA 2IN2A 5DJ7A 1F7ZA 1UK2A 3PYHA 3UAIC 3F9HA 1Z1IA 1KXAA 3C27B 5C1UA 1OWIA 2F9NA 1C1OA 3DFLA 1C2HA 1J9CH 2OXSA 4K69A 3UNRA 1LKBA 4XOJA 1P3EA 1FPHH 4WMFA 2VGCC 2Y5FA 2QXHA 1GHYH 1OPHB 4U01A 4AB8A 2BHGA 1BBRH 4GLYA 5JB9S 4H42U 3SU5A 1T4VH 2ZFFH 1Z8RA 3T5FH 4Q4LA 3KQBA 4YXWD 1O2YA 2AMDA 1RFNA 3BTHE 2F3CE 3MH4A 4ABBA 4AN7A 4P00A 3GICB 5E0GA 2Z3CA 1PPZA 3M35A 4ABAA 1N6XA 1Z8GA 4KGAA 1EQ9A 4MPWA 1C1QA 3U8RH 1CGIE 2KAIB 3FZDA 1N8OC 5A8ZA 2KAIA 3CS0A 3BTDE 2BY9X 1FIZA 1K9OE 1CSOE 3RMMH 2GV7A 2EEKA 1S0QA 3ZIAD 1TB6H 1PYTC 4ASHA 2GKVE 2BY8X 2FX6A 2XC4A 3M36A 1C5SA 4AFUA 5J4SA 3GY2A 2VVUA 3GCHB 2BQWB 2JJ1D 1E37B 1DM4B 3PROA 4D8NA 1NTPA 1NBME 2ZFQH 3CP7A 1TONA 1ZTJA 2F83A 1FXYA 2P94A 8GCHG 4WJG2 1GDQA 1DUAA 2GCHG 1O2SA 1SVPA 1EPTC 1GG6C 1MTWA 1Q31A 4RN6A 5B6LA 3ELAH 3RC6A 2XC5A 2OK5A 1F0SA 1PQ5A 2GZ7A 2ZTYA 1C2DA 2B8OH 2V6NA 4K8YA 2P59A 1BTZA 2FYQA 1A3BH 1D3PB 2J95A 4WXIA 5EQRA 1SGNE 1QA0A 4Y8XA 3UY9A 4ABHA 4GHQA 4FVBA 2H9HA 1YKTA 3VB3A 4JZDH 1CE5A 2M5TA 1ZMLA 2CF9H 1AVGH 1EAWA 4ABJA 4JCNA 1TBQH 1SSXA 1C5VA 6LPRA 3P92A 1AHTH 4I8HA 1E0FD 3OX7U 3FZZA 1O3BA 1C5NH 1C9TA 1SQRA 1ZPBA 3ATWA 2HLDD 1YP9A 1YPKH 1SLUB 4DIHH 3E16B 1HJ9A 4ZXXH 3QK1A 2SGFE 1AUTC 1E34B 1P03A 5CHAB 2VGCB 3F3BA 1PYTD 2ZDVH 4YLUA 1SQTA 3CS7A 1HV7A 2BDYA 4IW4E 1HLTH 3HATH 3SZEA 3MU1A 1DLEA 1A4WH 3KF2A 1YPHE 1AWHB 1OWJA 5T3HA 1O2ZA 1C9PA 2VJ1A 4ABFA 3KCGH 2VWOA 3UOPA 2KFWA 1ABIH 3RXBA 3RXMA 2PKSC 3SJIA 2V35A 4ZUHA 1A5HA 6ESTA 1GHAF 1K22H 5FHTA 2B5TB 1DFPA 1FN6A 5DGJA 1YPGH 2BVXH 2AIPA 1LPGB 2J2UA 2H5CA 3ZZ3A 2KCOA 3RXKA 1O2LA 1B7XB 1VGCB 2FTLE 2F9PA 1K1OA 2AGGX 3P8NA 1WAYB 3PLPA 3DA9B 3K2UA 2Q6FA 5FBIA 2BVSH 3RU4D 5FPTA 3MH5A 1DDJA 1IAUA 5EXMA 2ZGBH 1GL0E 2O9QA 5F8XA 2AH4X 5CHBA 5EQQA 3SQEE 2H1UA 3BN9A 4FUGA 2VU8E 4O97A 1GG6B 1YBWA 3QZRA 2ZA5A 3DD2H 4K1TA 3WWFA 1GL1A 3TJVA 1ELEE 2ZDAH 1C5PA 2XRCA 2XYAA 4NSYA 1PPGE 3LC5A 2PKAB 3MHWU 2PKAA 4MG3A 1MU8B 1EZSC 1T7CA 4K3JA 1LHGH 1C1WH 1O3NA 1S81A 1CT2E 3W95A 2FOMB 3E91A 4FU8A 1SQOA 1TALA 1YLCA 3PWBA 1O36A 1YM0A 4K1SA 1SOZA 1FUJA 1IOEA 3SJKA 3TNTA 3A8CA 2VB0A 1YWUA 1Y5UT 3ZVBA 3EA9A 3SI4H 3LH3A 1C1RA 1UVPA 1V2UT 2AFQB 2FOCA 1XUFA 4XDEA 3TLOA 2XCFA 1GMCG 3GISB 3TK6A 1ANEA 1O3MA 2A2QH 3KYFA 1O35A 5GJ4B 3PLKA 1O0DH 1M9UA 2SFAA 3MWIU 1QL9A 2EC9H 2GT8A 2O8LA 2THFB 3T62A 1GBIA 3PV4A 1D9IA 3BTTE 1EKBB 3MH7A 1GI4A 1CA0B 4XSKU 1T8OA 3T29A 2NU3E 4B73A 1YLDA 2FOBA 1BTHH 5FAHA 3ZZ5A 1LCYA 1G37A 1ABJH 1O3EA 1TLDA 2BX4A 5HKKD 5TCAA 3QLPH 2GV6A 1O2WA 4MTBA 1BTWA 5TJXA 1TGCA 1TX8A 3TJNA 1O5FH 3RMLH 4AZ2B 3SZNA 2BDIA 2BD5A 1BB0B 3MNXA 3I78A 1BJUA 3UTUH 1KIGH 3B9FH 1EZUC 4KTCA 2CN0H 1C5RA 1BOQA 1NU7B 4AGJA 4ISHH 1GVKB 4TPIZ 4B2AA 1PPBH 3LPRA 4VGCB 3TK5A 1DLKB 4ISLA 2CGAA 3ZZ6A 3GCTG 2PGQB 5H4IB 3MNCA 3BEUA 4JZIA 2ZU1A 3P8GA 4UFEH 3RXHA 1GJBB 1HAXB 4E06H 1O3PB 1W3CA 1XXDA 4UFGH 1V2ST 3E8LA 3GS9A 1OWKA 1QL7A 2A32A 2EA3A 5ESBA 3RXIA 4A7IB 1F5KU 1EXFA 5C3NA 2FOGA 2ANMH 3ZZCA 3ZVFA 2OUAA 3V13A 4Y8ZA 1SLVB 1SL3A 3RUOA 3OTPA 7GCHG 1TQ7B 2GCTC 5T1VA 3E0NB 1IQFA 1QL8A 2V0BA 3KQDA 5GDSH 1TFXA 3M5NA 5HXFA 2FI3E 4E7NA 1COWD 1DSUA 4AOQA 2G00A 3S9BA 2Y6TA 1B5GH 1UTKA 1JRSA 2G4UA 4X6OA 5F6MA 3SNAA 1CBWB 2BLQA 2RCEA 1UMAH 3GY7A 1O3KA 1ELTA 1NZQH 4B2BA 1P02A 1SFQB 3ZZAA 1TQ0B 4D7FA 2TGDA 1EP6A 1AN1E 2G4TA 3AW1A 3ODFA 3SU4A 3TH3H 1W0YH 1SGPE 4NA8A 2FODA 2SGEE 2ZQ1A 3PLBA 3SNCA 4Q7ZA 2Z9GA 5EG4A 2ZFRH 1ELFA 3MU8A 3U9AH 1OYQA 2LNCA 3STIA 4K60A 3ZV8A 1YPJH 1QIXB 1NC6A 2QE7D 1YPEH 1W8BH 2CHAC 1BMFD 2A0QB 3BTFE 2WPLS 5HIYA 1HJAC 4FETA 2A7JA 2PSYA 3BTGE 5DP4A 2OD3B 4JK6A 1EASA 3BTWE 2WHXA 4M7GA 1LQDB 3P8FA 2FS8A 2ZIQH 2XWAA 1OHHD 4TSFD 4XBDA 3RU4E 5C5NA 2BDHA 4FU9A 2G55A 5GIBA 7KMEH 1MTVA 2A5AA 3RDZA 1GI9B 1S83A 4Q80A 1E36B 4Q2KA 2VINA 1C5OH 1PQ7A 1XUHA 5T6GA 4MNYA 1H9HE 3ZZ7A 3EDXB 1XUGA 3M3VA 1ZPZA 5DP8A 5F53A 1UTJA 1RXPA 5C20A 1P0SH 2BMGB 1TBRH 2VIVA 1IQGA 1ELGA 1THSH 4WWYA 4ZKSU 1L1NA 3RXLA 1LHDH 3UR6A 1BTPA 2ODPA 2BY6X 5GPIB 3MYWA 2SGDE 3C1KA 1VCWA 1WUNH 6GCHG 3IWMA 1F0TA 5PTPA 1MCVA 3FKSD 1V2JT 5C2ZA 3UB0A 5E8EH 4B6FA 3B23B 3AW0A 4B6EA 3U8TH 8ESTE 1UW7A 2P8OC 2Y7XA 2F91A 3T26A 5C5OA 1QB1A 4OM9A 2AIQA 2FLRH 1Z8JB 4O03A 1GBEA 5DN6D 4IMQA 1AD8H 4X8UH 3K9XB 1GJ6A 2ZHQH 1ESBA 2Q1JA 4ZCNA 3GCNA 1RTLA 1Y3WA 2G52A 3SV2H 2ZGCA 2XXLA 2HOBA 1WBGB 1TGTA 3DT0H 2YOLA 1UTMA 1Z6EA 3DSGA 8KME2 1AWFH 3GY4A 4Z6AH 2STBE 4ISIH 3M3TA 1A5GH 4F55A 1GCDA 3N7EA 4DGJA 1F2SE 1ANDA 1C1MA 4IC6A 1NY22 3E90B 4CRGA 2RFKC 2H5DA 1C4V2 4GHTA 1ZSKA 1HAHH 1KSNA 1UCYE 1P9UA 4GPGA 1DXWA 3B8JA 1ELAA 3OE7D 1AVXA 1EATA 2W3IA 4CH2B 1BA8B 1E1QD 3SNBA 3JZ2B 4ZROA 1G3DA 2YNAA 3ZVDA 1OP2A 3GCHC 4NFFA 2VWMA 2A1DB 1DVAH 5CMXH 1O3JA 1V6DA 1DY8A 1XMNB 1K0HA 1PPFE 4HZHA 4B71A 4Y8YA 3QX5H 4XFQA 3UQVA 1GHBF 2FEQH 1DXPA 5DP9A 1BT7A 2QF0A 1KLTA 2ZDLA 1Y3YA 2Y81A 2QY0B 5DG6A 1VJ9U 3QGNB 3KQEA 2HLCA 1O2PA 2VNTA 1K1NA 2IJOB 1KXCA 2IOTA 4AYVB 3SV6A 1C5XB 1BRAA 5ABWA 1JIRA 3ESTA 3S69A 1QJ6B 3I29A 2R3UA 4GCHF 1MTSA 5A0BA 4BAKB 3NRLA 2ZU2A 1O32A 3BIUH 1O3CA 2O8WA 1SKYE 3IITA 2AMPA 1UHBB 2KR7A 1UHBA 3SOSA 1UK3A 1S6FA 1O5GH 4AG2A 1A5IA 2K8IA 4LXBH 1EB1H 4FUBA 1YCPK 2XBVA 3P70B 4R8TB 1MTUA 1H4WA 3SN8A 1BUIA 3LC3A 3SUDA 1T31A 1DWBH 3F2GA 4MVNA 3A86A 1WQVH 4BXSA 2DE9A 5CHAC 1ZLRA 3OTJE 1HFDA 1GCTB 1CT0E 2GDEH 4ZKNU 3SO3A 4ZHAA 2BOKA 1KXDA 3F6UH 4GVUA 3QTVH 5AHGH 2AEIH 5EJZA 3V3MA 2FLBH 1CQQA 5EJLA 4JZEH 5FCKA 1AFQB 2PLXA 3ODDA 1V2VT 3A8AA 3SJ8A 2A2XH 4ISOA 4X1QU 1T8MA 3F9GA 2IPQX 3A81A 2W5EA 4YOGA 2ZECA 3NKKA 1P2QA 4I86A 2R0LA 4ISNA 3VXFH 2ZHEH 3UR9A 1RS0A 1Y3XA 4DIIH 2P3FH 3DFJA 5LPEA 1S82A 1V2QT 1JXPA 4X2XA 4I31A 1VGCC 1ID5H 2F4LA 2SNWA 2WUCA 4H6TA 2K0QA 1P10A 1UTQA 4UD9H 1QFKH 5F03A 2NU2E 8GCHF 2ZU3A 3E0PB 1NRRH 2GCHF 2YMSD 1IQJA 2TGAA 2F9OA 5L6NH 4A5TS 1GJCB 4INHA 2Y5HA 1KTTB 5GNDA 1AB9B 1ORFA 4RT0A 1C1VH 3QDZB 3KL6A 1FY1A 4INLA 1ZSLA 4TWWA 3MOCA 3GY5A 1IQKA 4YOIA 1GBBA 3DCLA 3EAJA 4THNH 5I25A 1P9SA 1YCPH 3LGWA 2TIOA 5GCHG 3ZV9A 3ZVCA 1TBZH 5JBAS 5JDUB 1SHHB 1MZAA 1TA2A 3RXSA 3N99A 3RXRA 1LTOA 1OWDA 1EOJA 2FDAA 2PFEA 2FZZA 2YMSB 3LIWA 3F1SB 4NZLA 3RMOH 1F0UA 3LJOA 1LPZB 1C1PA 2BY5X 4TT3D 4J1YA 3RXJA 3V12A 4D7GA 3M7UA 1HAVA 1A46H 2FP7B 3HKJB 1O38A 2HWLB 1ZPCA 4TPYA 2TPIZ 1O5DH 1TX7A 2YNBA 1P2JA 1ZTLA 2CF8H 2WSSD 1DWCH 2RDEA 1O34A 2RA3A 3HGPA 1DS2E 1GBAA 1C2JA 2RA0A 2ZDKA 4GAWA 2XNDD 1J17T 1HAGE 2W7UA 3RM0H 3ZZDA 1OS8A 3LGUA 3KQCA 1BJVA 4MNVA 2Z6BD 1Q2WA 1EJAA 4WVPE 1BRCE 2BDAA 1D3DB 1YPLH 2ZQ2A 2ZPSA 4D76A 1EUFA 2OBQA 3NCLA 2QF5A 1CA0C 6CHAB 1A0LA 5F8ZA 1GGDB 1MQ5A 1TIOA 2D2DA 1FI8A 3ZVEA 2ZGXH 3URCA 5A09A 1TOCB 1NFYA 3VB4A 1Z1JA 4DT7B 3A88A 1KLJH 4AX9H 1KLIH 1AKSA 1CA8B 2KZ4A 2R0KA 2FI4E 2A4RA 1KYNA 3TVJB 2BDGA 1ZRBA 3SJ9A 1F5LA 1TYNA 2GDDA 2W7SA 3SV8A 1G2LA 2ZTZA 4FUHA 2EI8A 3S9AA 1UK4A 1TPAE 4OS2A 3PMBB 3TH4H 3P17H 1MQ6A 3KHVA 1UVUH 2QGRA 1UO6A 4GUXA 5CE1A 3IG6B 4X0WU 2GTBA 5DP5A 1O3AA 1YC0A 4VGCC 2ANKH 1G32B 2V7QD 2BD3A 2OC0A 4A1VA 1KTSB 4Y76A 1GBJA 3UNQA 3Q77A 3KN2A 1XX9A 5EODA 3D62A 4M9FA 4X6MA 1NFWA 3H7TA 4A1TA 4U32A 3P6ZB 4XBCA 3RMNH 5C1YA 2CV3A 1SGQE 2FOFA 2PP6A 1P09A 1O31A 2EI7A 1TPSA 1O30A 4AYYB 1P2IA 4B1TA 1C1SA 2B0FA 2FS9A 4AC9A 3TITA 4UE7H 3TJUA 2TGTA 1C2KA 1T4UH 3SQHE 9ESTA 1EOLA 1UTOA 2QIQA 4IC5A 1DWDH 1QRWA 4NFEA 2R2WU 4MNWA 1PQAA 1TRNA 3TGJE 1K1PA 2J97A 2ZFTA 3S9CA 1F5RA 1GJAB 2VVCA 2ZKSA 1C1UH 1QA7A 2O8TA 1QR3E 3NXPA 1SGEE 4X6PA 1GBMA 2UWPA 4OGYA 2ALVA 2ODYB 1DICA 1Z7KA 1QNJA 1BZXE 1GBCA 1L1GA 2C93B 1CBWC 1GMCF 5G4BA 4RKJB 1U6QA 1NFUA 3EA7A 2J4IA 2G81E 5JYIA 1BHXB 3FAOA 4BANB 4K1EA 1SGCA 2PWXA 1QQ4A 1QJ1B 4TY7A 1IHTH 2QC2A 1W7GH 1L4ZA 1XVOA 1DWEH 1MTNB 3O8RA 2ZDMA 2PUQH 2BZAA 3GOVB 1O2MA 3SU1A 5SGAE 3EE0B 4OS1A 4IBLH 1DUEA 4NG9H 3RXEA 1BBRE 3GDVA 2GGVB 1MMJN 3LU9B 1LHCH 1GBFA 3O8DA 1OSSA 1OWHA 1CHOG 2ASUB 3ATLA 4ZH8A 3DUXH 2Y80A 2BXUH 2FXRA 2BXTH 1C1TA 1KMHB 3FOAA 3UWIA 3LONA 1ZZZA 2VIDA 3SUFA 1XUKA 2LPRA 2ZI2H 2A45B 2ZCHP 3BTME 3PMAB 5JBTA 1ELDE 1O2RA 4I8JA 4FUFA 2BD7A 2LP6A 4ABGA 2QAAA 4HTCH 2PGBB 3KIDU 4YO9A 3RU4T 5AF9H 1K1JA 1P8VC 2ALPA 3NK8A 2BX3A 5FBEA 3TU7H 4B76A 3S0NA 1TGSZ 3MNSA 2ZP0H 3GCTF 3QN7A 1A61H 2KCAA 1TOMH 4JYUH 5L2ZH 1BTYA 1N6YA 1RJXB 1VCPA 1THRH 1TRMA 3LGIA 5KGOA 1BRBE 3F0OA 5GXPA 1JWTA 4AG1A 5HM9A 1GVZA 3RXUA 5ESTE 3M37A 2ZHWH 3VG8A 1TMUH 1GBLA 7GCHF 4A6LA 1VKYA 2ESTE 4AB9A 1S85A 4MPVA 1SHYA 5EXNA 1C4Y2 1V2KT 1IQMA 3SUGA 1HAZB 1GI2A 4NCYA 2ZFPH 2BD9A 3PTBA 3PV2A 1NRSH 1MAYA 5CDFE 1ZYOA 4YZUA 3U8OH 1HPGA 1HRTH 2FX4A 2Z3EA 2GMTC 1GI0A 4CR5A 1HDTH 2Z9IA 1NN6A 1HB0B 2B7DH 5A8YA 2ZF0H 1JMOH 1TPOA 3EA8A 5B6OA 1JIMA 1HJ8A 3SU0A 1ZJDA 4WY3A 2QF4A 1PPCE 3A7VA 3WW7A 3U1JB 1E79D 2AS9A 2QF3A 1G3BA 2UUYA 1SC8U 4X2YA 4FUEA 4FXGH 2WPKS 1F92A 3EE7A 2BB4A 3F0PA 2P95A 2ZPQA 2AHME 2C8WB 3ITIA 4B75A 4KTUA 3RXQA 2BZ6H 4FUIA 2HPPH 1WQSA 1FMGA 1NS3A 1XKBC 1CVWH 1L0ZA 1EJMA 3SNEA 1ETTH 4I32A 1C1NA 4A92A 1GJDB 2QXJA 2NWNA 2PTNA 4NIVA 1O3IA 1EP5A 4YOJA 1FY5A 2OCVB 3LH1A 1C5TA 3Q3XA 4Y0ZE 8LPRA 1ANCA 1LHEH 1P11E 4O3UA 1EZXC 3VXEH 1T8NA 1V2PT 3GDUA 4X1PU 2ZWLH 1GMDG 2JJ2D 1MKWK 3M5OA 5JBBS 4JMYA 3VB7A 2J98B 1D4PB 3HGNA 3O8BA 2J98A 1W7XH 1W14U 4X2WA 3H09A 1TX6A 5I46H 3MH6A 1LVOA 5JB8S 1W0KD 1AE5A 4E05H 1GJ9B 3MO6A 4FU7A 3M7TA 1RIWB 2GD4B 1YYY1 1O3OA 4RT1A 1YLNA 5HYOA 1NO9H 1BTUA 1W0JD 2J38A 3SU3A 3K6ZA 3NWUA 4NSVA 1AFEH 3K6YA 2NU0E 6GCHF 1O2IA 4WMDA 2KCYA 4JZFH 1C5QA 1FZZA 2UUFB 1LVMA 4YT6H 3PO1C 1O33A 1TNKA 3ZYEA 4MLFB 4BTTB 2ZPRA 1DANH 2GT7A 1GI7B 4XE4A 5HMAA 4TYDA 1P05A 3GY8A 3MQKC 2V3MA 2O8MA 2BTCE 2OQ5A 2WPDD 3S7KB 4AGKA 4CR9A 2AMQA 1FY4A 4BAQB 3TPIZ 4X1NU 4SGAE 2UUJB 1O5EH 2FMJA 4JYVH 1GMHG 1KXBA 2XBWA 2K1QA 4FVDA 1O5CB 2GMTB 5E0HA 4NA9H 1PFXC 3VB5A 1ZR0A 3SW2B 3S7HB 1GCTC 1C5ZB 2QXGA 1AZ8A 4HG6A 3SU6A 3QWCH 1TABE 3A85A 5KEDA 3MU5A 4YM9A 1P06A 3OSYA 1IQLA 2BYAX 3LOXA 1AFQC 2W26A 1HNEE 1RTKA 2AGIX 2H9TH 2QV1A 3SGBE 5DO4H 1L2EA 1X7AC 1K1IA 3GYLB 2ZU5A 1WTGH 1WOFA 1C5LH 1MKWH 4O9VA 1E35B 2VH6A 3GYMA 3NZIA 1S6HA 3M5MA 1AO5A 2BD2A 2HVXA 3ZVGA 1CU1A 3WY8A 1ZHRA 1UJ1A 4KTSA 2VWLA 5C1XA 2GP9B 2C3SA 2VBCA 5EGMA 1KXEA 1H9LB 2C8XB 4UEHH 1TGNA 1YF4A 2XCNA 4ASUD 3MFJA 3NPSA 1IHSH 1SGFA 1Y3UA 2QYIA 4MPUA 2VIWA 1WDIA 3RXFA 4Y79A 1EAIA 1AQ7A 4J2YB 5E2PA 1QZ8A 3SI3H 2ANYA 1QJ7B 2ZC9H 1VITH 7LPRA 2JH5D 4KELA 1QHRB 3BTQE 5FPYA 1AB9C 4BAOB 1K1MA 1QURH 1ZRKA 4NZQA 1EB2A 1MUEB 1KY9A 1O2TA 3HKIB 4ABIA 3A83A 3A87A 1TNGA 2Y7ZA 3AASA 1AI8H 3VPKA 3U98H 5EW1H 2F43B 1UVOA 2P3UB 2ZGHA 1SGIB 1FY8E 3L3TA 4HFPB 5E0JA 1SR5C 1BIOA 1VITG 2WYGA 4NWLA 4UFFH 3GCOA 1IQHA 1W10U 4Q7YA 1WV7H 1FX0B 2QN5T 1ZHPA 2R9PA 2F9UA 5LGOA 2L74A 3PO1B 1ZGVA 1DX5M 2YMSC 3DSPA 4NGAH 3RP2A 2STAE 1ZMJA 1EAXA 2FESH 3Q00A 1QRXA 1O2VA 2BOHB 3PWCA 4HI3A 1VCQA 5EW2H 1IQEA 3BF6H 5BPEA 2AGEX 2KX4A 1K21H 1O5BB 2JH0D 2KCPA 3E6PH 3RC4A 1WCZA 1QCPA 5AFZH 1MBMA 3F9EA 1SGRE 2FO9A 5EPYA 1AUJA 1SGDE 2OP9A 2J9NA 1THPB 3MNBA 7ESTE 5LPRA 2WV4A 3BTKE 3SYJA 2JIZD 1OWEA 3P8OA 4DVAU 1ETSH 2PV9B 4FUJA 3SGQE 1GBTA 4I8KA 4X8SH 4X1RU 5IYTA 4B74A 2WV5A 2PR3A 4U2WA 1GDUA 1GI3A 2R2MB 5JPMH 2XNIA 4XD7D 1GHZA 1O2UA 1W13U 1XUIA 5FPSA 6CHAC 4YT7H 1GGDC 3UOUA 2CK3D 2CXVA 3O8CA 3A89A 2G51A 1MKXK 2WPIS 1O3HA 1C5WB 1NRNH 2A5IA 1HXFH 4AFZA 2XWBI 1GBKA 1P2MA 1FV9A 1J8AA 1JRTA 1KDQB 1SLXB 1WU1A 2J94A 4OS6A 1T8LA 1HGTH 1KDQA 3U69H 1MD8A 4UDWH 4ESTE 5K0HA 2OC7A 3R3GB 1C2GA 1O37A 5DPAA 2L6OA 1GJ7B 1AE8H 1QRZA 1UVTH 2JETB 4GSOA 2OTVA 3SGAE 2ZFSA 1EZQA 2Z9LA 3TIUA 1S5SA 4FUDA 3VFEA 1A0HB 1TMTH 2F9VA 2P3TB 1H8IH 1BITA 3P95A 1V2WT 1TE0A 3A8BA 2RG3A 1PQ8A 4BXWA 1OOKB 2BLWA 4AORA 4KKDA 1KXFA 4UONA 1AU8A 1SQAA 2ZNKH 4Z0KA 1H8ED 3OYPA 5ETXA 4Y71A 2WV9A 4I7YH 5GCHF 1GI8B 3V0XA 2ILNA 4WF8A 3T25A 2PUXB 4O3TA 2ZHDA 4I33A 4X2VA 2D8WA 1UTLM 5A0AE 1H9IE 1XVMA 2P93A 4ACAA 1ETRH 3MO3A 4BAHB 3G01A 4NIXA 1QTFA 3UNSA 2TGPZ 2DUCA 3N7OA 2ZCLP 2SGAA 1WXRA 1LPKB 1BCUH 2WYJA 2IPHA 3ATKA 4YLQH 2QXIA 3RLWH 3A7WA 3SV7A 1C2IA 1BMAA 3T27A 3OEED 3RLYH 1MCTA 2H9EH 1HAVB 1D3TB 3QZQA 4I8GA 2ZDNA 4BTIB 2XBXA 1NM6A 1DPOA 1EX3A 4MPXA 3A82A 1NPMA 4CRFA 1HUTH 1C5YB 3OU0A 4OS5A 1MKXH 2WPJS 3D49H 1YGCH 1ZOMA 2WZQA 2BQ7B 4B2CA 4Z1MD 1S0RA 1EAUA 2ZHFH 3BEIB 2J5UA 3SU2A 4DG4A 3OY5U 1L1JA 3CENA 1ZSJA 2W3KA 1MTNC 3RXOA 4INKA 2ANWA 1GBDA 1LQEA 1TWXB 1OXGA 2Z94A 2GX4A 2J92A 4X1SU 1Z8IB 3UREA 2A7HA 1Q3XA 2ZU4A 3AAVA 1V2TT 4OS4A 1MABB 3R0FA 3VB6A 4UFDH 2AYWA 3KEEA 3TJOA 2I6SA 1C2EA 3UQOA 4JK5A 5LPFA 1ARCA 3N7DA 1DE7H 3ZYDA 1AKSB 2PHBA 3F2HA 1GJ5H 3U28C 3E3TA 3ZZ9A 2NU1E 1P3CA 1GHVH 1SI5H 2RDLA 3FP7E 1O2GH 1CGJE 2XBYA 2OLGA 2ZTXA 4X6NA 1FONA 4PROA 1C4U2 5TCCA 5DP6A 1O2XA 2PW8H
chains in the Genus database with same CATH topology
1DT2A 1LHFH 4E7RG 2ZCKP 2ZZUH 1LDTT 1O3GA 2OBOA 2D26C 4IGDA 3U1IB 3VEQB 1O2JA 4AFQA 1N8OB 3D65E 1UCYK 2ZG0H 1TPPA 2BDBA 2FWWA 4Y11E 1TMBH 2SNVA 1FAKH 3LJJA 1G3CA 1Y5AT 2SGQE 3A7ZA 3RXGA 1QY6A 1GHAG 1V3XA 4K8BA 1BMMH 2QCYA 1NESE 1BHXF 1CT4E 3D23A 1GHWH 3JZ1B 3A80A 1W0ZU 2V3OH 4WMEA 3A84A 2VIPA 1CGHA 2FM2A 3LGVA 1GDNA 5FXLA 2CMYA 1ESAA 3UWJH 2BDCA 1EPTB 1TRYA 1Z71A 1EPTA 2A5KA 4JYTA 3M3SA 2ZO3H 4BOHA 1XXFA 2H6MA 2ZGJA 1YCPM 1V2NT 2A7CA 2HRVA 4LZ4B 1Y3VA 1W12U 5L2YH 2HPQH 1SMFE 1DITH 1FDPA 1MU6B 1A2CH 3AVZA 1GPZA 1QB9A 1BRUP 1ELVA 4DCDA 4ZMAH 4XBBA 3F68H 1B0EA 4D9RA 3MO9A 1O39A 4ZKRU 1ZHMA 3ENSB 1FN8A 3BG4C 5A0CA 2EI6A 2TBSA 4DURA 1FJSA 3M61U 1TNIA 4LOYH 1CHOF 3L33A 1NROH 2UUKB 3MI4A 5T6FA 1V2RT 2HNTC 2TRMA 3A8DA 4AFSA 1SOTA 3SV9A 1GBHA 1RTFB 1BMNH 1UCYH 1Y8TA 4K2YA 1ELCA 3TNSA 5A8XA 1XUJA 3PB1E 2VIQA 1OX1A 1LVBA 4BTUB 1IQIA 1OP8A 1ACBE 2A31A 3OY6U 1Z6JH 1W11U 2Z9KA 5EXLA 1Y59T 3BIVH 3UFAA 2J34A 1BTXA 2P16A 1QBOA 1XKAC 4CHAC 3QO6A 1RIWC 4IN2A 1WYKA 3Q3YA 3EGKH 1HXEH 4FUCA 2HALA 3FANA 2GZ8A 1FLEE 3STJA 4ZAEA 2R3YA 4I8LA 4SGBE 3M5LA 4Y0YE 4YTAA 3TGKE 1FPCH 2PKSB 2WINI 1RD3B 3LDXH 4WH8A 3RM2H 1PPEE 1WTHD 4Q7XA 1PPHE 1JBUH 2G5VA 5DP3A 4TWYA 4MDSA 2C90B 1B0FA 1NT1A 2ZEBA 2C8ZB 3BTEE 2UWOA 1CO7E 1ZJKA 1W2KH 1NU9A 4ZHMU 3H7OA 1C5MD 1AY6H 4CRDA 2BQ6B 2G5NA 3MTYA 5DP7A 3PM3A 1P2OA 2FPZA 4NWKA 3SHAH 1JOUB 2Q6DA 1TNLA 1NRPH 5HM2A 1J14A 1VZQH 2O8UA 2HNTF 3VGCC 1GI6A 1S84A 2FI5E 4X8VH 3SBKA 1BMLA 5FCRA 3BSQA 3T28A 2ODQA 3FFGA 4H6SB 2B9LA 1GI5A 1SG8B 4Y10E 2XTTB 3BV9B 2Q6GA 1QBVH 3BG8A 5K7RA 4RSPA 2XC0A 2BLOA 1FY3A 2OC1A 1O2QA 3ATIA 1ZTKA 1NFXA 3HK6B 1O2OA 3FP6E 5L30H 1MBQA 1C5UA 1O5AB 1SGTA 3Q76A 1ZMNA 3DHKH 1G3EA 2BM2A 1ARBA 4KP0A 1AIXH 1DY9A 3MU4A 3NUMA 4A1XA 3BG4B 2FYRA 4OS7A 1FIWA 1VJAU 3Q3KA 1C2MA 1V2MT 1TNJA 3ZVAA 2GZ9A 2JKHA 4YESB 1SGYE 1N1LA 3GDSA 1P04A 1HYLA 3RC5A 1MH0A 1C2LA 1J15A 5AVDA 1MAXA 1GMDF 2A4OA 2WPMS 1D6RA 5EOKA 3TH2H 3AAUA 2FIRH 1YPMH 1AGJA 3A7YA 4WXVA 3RXAA 1O3LA 2V3HH 1AVWA 1Y5BT 4Y7BA 3QUMP 4NA7A 1ANBA 4H4FA 4BAMB 3UPEA 4JZ1A 1RGQA 1J16A 2OQUA 1GI1A 1H8DH 2QA9E 1K28D 1T32A 3EQ0H 5DK1A 2VVVA 4CHAB 5A2MH 3UIRA 5FX5A 9LPRA 3H5CB 2FOEA 1LVYA 3F9FA 1OKXA 3A7TA 3K65B 1GWAA 1UTNA 2DE8A 5E2OA 1GHXH 1DOJA 2BVRH 2BD4A 4CH8B 1LKAA 2XW9A 2JH6D 2PSXA 1QGFA 1TA6A 5F8TA 3M7QA 1SPJA 1HAYB 2A4GA 1YPHC 2ULLA 2CJIA 3ZZ8A 1TNHA 3RXTA 2C4FH 1GMHF 5EU8A 3HPTB 1G30B 1SBWA 1GJ8B 3RXDA 4NIYA 5J4QA 1GVLA 1O3DA 2Z7FE 4QT8C 1OYTH 1XM1A 5GWZA 5BRRE 1TGBA 1V2OT 2A4QA 3I77A 4DOQA 3VGCB 3LKWA 4HGCA 4ZHLU 3KNXA 1RRKA 2HGTH 1SGFG 2AERH 1P12E 1HAIH 1MZDA 1FQ3A 5LH8A 1O3FA 1CHGA 1O2HA 2Y82A 4F4OC 2FTMA 5DKMA 2GCTB 3TGIE 3GY3A 1SB1H 3LT3A 5JBCS 3SNDA 3ZZBA 4Y6DA 4CREA 1A1RA 1SFIA 1D3QB 2WPHS 1TAWA 5C67A 1LMWB 4ZKOU 1K1LA 5IDKA 3A7XA 4X8TH 2VWNA 2WUBA 4OGXA 2OINA 1UTPA 1HCGA 3ZZ4A 3URDA 1WSSH 4DJZB 2JETC 3RXPA 5T6DA 3KGPA 2Z3DA 3PMHB 1ELBA 1H1BA 1QB6A 1SLWB 1E38B 1V2LT 1NRQH 4LK4A 2NU4E 2PTCE 2D1JA 4IN1A 1P57B 1BQYA 3UUZA 3QTOH 1P2KA 2I6QA 4F49A 3W94A 4ABDA 1PJPA 1G2MA 2GVFA 2CHAB 2OC8A 2UWLA 4Y7AA 3RXVA 1BBRK 2G8TA 1HJAB 1INCA 1OP0A 1LO6A 3PTNA 1HIAB 3L6PA 3T2NA 4DY7B 1P2NA 3LGTA 4DW2U 4D9QA 1A0JA 1HIAA 2Y5GA 1A7SA 1K2I1 1AZZA 2SGPE 1MD7A 4BNRA 3EYDA 4CRAA 2Z9JA 1VITF 4ABEA 3HK3B 5EQSA 4R0IA 4ZXYH 4CRBA 2FOAA 3FVFB 5EPNA 1HAPH 5FX6A 3MMGA 3BEFB 3TK9A 4RKOB 4IS5A 1FNIA 1EJNA 1D6WA 1FAXA 4U30A 1O2NA 1G36A 4CRCA 1A3EH 1HBTH 1GHBG 4IMZA 3FP8E 4K5ZA 4MQAA 4WH6A 2BY7X 3SORA 3V7TA 5HGGA 1F0RA 2H2ZA 4CBOA 1C2FA 3QGJA 3SHCH 1VR1H 1QQUA 2HNTE 4MNXA 3LGYA 3SJOA 1G9IE 3PMJA 2FOHA 4GCHG 1DSTA 1L4DA 4TY6A 1O2KA 1AMHA 2F9BH 5AFYH 3SUEA 2C8YB 3MU0A 4NIWA 2VH0A 3E1XB 1ESTA 1BDAA 3RXCA 2BLVA 2VIOA 3GY6A 4CBNA 1UVSH 1P01A 2BD8A 1HAOH 3ATMA 1QBNA 1IQNA 2P8OB 4LZ1H 1GJ4H 1ZGIA 2IN2A 5DJ7A 1F7ZA 1UK2A 3PYHA 3F9HA 1Z1IA 1KXAA 3C27B 5C1UA 1OWIA 2F9NA 1C1OA 3DFLA 1C2HA 1J9CH 2OXSA 4K69A 3UNRA 1LKBA 4XOJA 1P3EA 1FPHH 4WMFA 2VGCC 2Y5FA 2QXHA 1GHYH 1OPHB 4U01A 4AB8A 2BHGA 1BBRH 4GLYA 5JB9S 4H42U 3SU5A 1T4VH 2ZFFH 1Z8RA 3T5FH 3KQBA 1O2YA 2AMDA 1RFNA 3BTHE 2F3CE 3MH4A 4ABBA 4AN7A 3GICB 5E0GA 2Z3CA 1PPZA 3M35A 4ABAA 1N6XA 1Z8GA 4KGAA 1EQ9A 4MPWA 1C1QA 3U8RH 1CGIE 2KAIB 3FZDA 1N8OC 5A8ZA 2KAIA 3CS0A 3BTDE 2BY9X 1FIZA 1K9OE 1CSOE 3RMMH 2GV7A 2EEKA 1S0QA 1TB6H 1PYTC 4ASHA 2GKVE 2BY8X 2FX6A 2XC4A 3M36A 1C5SA 4AFUA 5J4SA 3GY2A 2VVUA 3GCHB 2BQWB 3PROA 1E37B 1DM4B 4D8NA 1NTPA 2ZFQH 3CP7A 1TONA 1ZTJA 2F83A 1FXYA 2P94A 8GCHG 4WJG2 1GDQA 1DUAA 2GCHG 1O2SA 1SVPA 1EPTC 1GG6C 1MTWA 1Q31A 4RN6A 3ELAH 3RC6A 2XC5A 1F0SA 1PQ5A 2GZ7A 2ZTYA 1C2DA 2B8OH 2V6NA 4K8YA 2P59A 1BTZA 2FYQA 1A3BH 1D3PB 2J95A 4WXIA 5EQRA 1SGNE 1QA0A 4Y8XA 3UY9A 4ABHA 4GHQA 4FVBA 2H9HA 1YKTA 3VB3A 4JZDH 1CE5A 2M5TA 1ZMLA 2CF9H 1AVGH 1EAWA 4ABJA 4JCNA 1TBQH 1SSXA 1C5VA 6LPRA 3P92A 1AHTH 4I8HA 1E0FD 3OX7U 3FZZA 1O3BA 1C5NH 1C9TA 1ZPBA 3ATWA 1YP9A 1YPKH 1SLUB 4DIHH 3E16B 1HJ9A 4ZXXH 3QK1A 2SGFE 1AUTC 1E34B 1P03A 5CHAB 2VGCB 1PYTD 2ZDVH 4YLUA 1SQTA 3CS7A 1HV7A 2BDYA 4IW4E 1HLTH 3HATH 3MU1A 1DLEA 1A4WH 3KF2A 1YPHE 1AWHB 1OWJA 5T3HA 1O2ZA 1C9PA 2VJ1A 4ABFA 3KCGH 2VWOA 3UOPA 1ABIH 3RXBA 3RXMA 2PKSC 3SJIA 2V35A 4ZUHA 1A5HA 6ESTA 1GHAF 1K22H 5FHTA 2B5TB 1DFPA 1FN6A 5DGJA 1YPGH 2BVXH 2AIPA 1LPGB 2J2UA 2H5CA 3ZZ3A 3RXKA 1O2LA 1B7XB 1VGCB 2FTLE 2F9PA 1K1OA 2AGGX 3P8NA 1WAYB 3PLPA 3DA9B 3K2UA 2Q6FA 5FBIA 2BVSH 3RU4D 5FPTA 3MH5A 1DDJA 1IAUA 5EXMA 2ZGBH 1GL0E 2O9QA 5F8XA 2AH4X 5EQQA 3SQEE 2H1UA 3BN9A 4FUGA 2VU8E 4O97A 1GG6B 1YBWA 3QZRA 2ZA5A 3DD2H 4K1TA 1GL1A 3TJVA 1ELEE 2ZDAH 1C5PA 2XRCA 2XYAA 4NSYA 1PPGE 3LC5A 2PKAB 3MHWU 2PKAA 4MG3A 1MU8B 1EZSC 1T7CA 4K3JA 1LHGH 1C1WH 1O3NA 1S81A 1CT2E 3W95A 2FOMB 3E91A 4FU8A 1SQOA 1TALA 1YLCA 3PWBA 1O36A 1YM0A 4K1SA 1SOZA 1FUJA 1IOEA 3SJKA 3TNTA 3A8CA 2VB0A 1Y5UT 3ZVBA 3EA9A 3SI4H 3LH3A 1C1RA 1UVPA 1V2UT 2AFQB 2FOCA 1XUFA 4XDEA 3TLOA 2XCFA 1GMCG 3GISB 3TK6A 1ANEA 1O3MA 2A2QH 1O35A 5GJ4B 3PLKA 1O0DH 1M9UA 2SFAA 3MWIU 1QL9A 2EC9H 2GT8A 2O8LA 2THFB 3T62A 1GBIA 3PV4A 1D9IA 3BTTE 1EKBB 3MH7A 1GI4A 1CA0B 4XSKU 1T8OA 3T29A 2NU3E 4B73A 1YLDA 2FOBA 1BTHH 5FAHA 3ZZ5A 1LCYA 1G37A 1ABJH 1O3EA 1TLDA 2BX4A 5TCAA 3QLPH 2GV6A 1O2WA 4MTBA 1BTWA 5TJXA 1TGCA 1TX8A 3TJNA 1O5FH 3RMLH 4AZ2B 3SZNA 2BDIA 2BD5A 1BB0B 3MNXA 3I78A 1BJUA 3UTUH 1KIGH 3B9FH 1EZUC 4KTCA 2CN0H 1C5RA 1BOQA 1NU7B 4AGJA 4ISHH 1GVKB 4TPIZ 4B2AA 1PPBH 3LPRA 4VGCB 3TK5A 1DLKB 4ISLA 2CGAA 3ZZ6A 3GCTG 2PGQB 5H4IB 3MNCA 3BEUA 4JZIA 2ZU1A 3P8GA 4UFEH 3RXHA 1GJBB 1HAXB 4E06H 1O3PB 1W3CA 1XXDA 4UFGH 1V2ST 3E8LA 1OWKA 1QL7A 2A32A 2EA3A 5ESBA 3RXIA 4A7IB 1F5KU 1EXFA 5C3NA 2FOGA 2ANMH 3ZZCA 3ZVFA 2OUAA 3V13A 4Y8ZA 1SLVB 1SL3A 3RUOA 7GCHG 1TQ7B 2GCTC 3E0NB 1IQFA 1QL8A 2V0BA 3KQDA 5GDSH 1TFXA 3M5NA 5HXFA 2FI3E 4E7NA 1DSUA 4AOQA 2G00A 3S9BA 2Y6TA 1B5GH 1UTKA 1JRSA 2G4UA 4X6OA 5F6MA 3SNAA 1CBWB 2BLQA 2RCEA 1UMAH 3GY7A 1O3KA 1ELTA 1NZQH 4B2BA 1P02A 1SFQB 3ZZAA 1TQ0B 4D7FA 2TGDA 1EP6A 1AN1E 2G4TA 3AW1A 3ODFA 3SU4A 3TH3H 1W0YH 1SGPE 4NA8A 2FODA 2SGEE 2ZQ1A 3PLBA 3SNCA 4Q7ZA 2Z9GA 5EG4A 2ZFRH 1ELFA 3MU8A 3U9AH 1OYQA 2LNCA 3STIA 4K60A 3ZV8A 1YPJH 1QIXB 1NC6A 1YPEH 1W8BH 2CHAC 2A0QB 3BTFE 2WPLS 1HJAC 2A7JA 2PSYA 3BTGE 5DP4A 2OD3B 4JK6A 1EASA 3BTWE 4M7GA 1LQDB 3P8FA 2FS8A 2ZIQH 2XWAA 4XBDA 3RU4E 5C5NA 2BDHA 4FU9A 2G55A 5GIBA 7KMEH 1MTVA 2A5AA 3RDZA 1GI9B 1S83A 4Q80A 1E36B 4Q2KA 2VINA 1C5OH 1PQ7A 1XUHA 5T6GA 4MNYA 1H9HE 3ZZ7A 3EDXB 1XUGA 3M3VA 1ZPZA 5DP8A 1UTJA 1RXPA 5C20A 1P0SH 2BMGB 1TBRH 2VIVA 1IQGA 1ELGA 1THSH 4WWYA 4ZKSU 1L1NA 3RXLA 1LHDH 3UR6A 1BTPA 2ODPA 2BY6X 5GPIB 3MYWA 2SGDE 3C1KA 1VCWA 1WUNH 6GCHG 3IWMA 1F0TA 5PTPA 1MCVA 1V2JT 5C2ZA 5E8EH 3B23B 3AW0A 3U8TH 8ESTE 2P8OC 2Y7XA 2F91A 3T26A 5C5OA 1QB1A 2AIQA 2FLRH 1Z8JB 4O03A 1GBEA 4IMQA 1AD8H 4X8UH 3K9XB 1GJ6A 2ZHQH 1ESBA 2Q1JA 3GCNA 1RTLA 1Y3WA 2G52A 3SV2H 2ZGCA 2XXLA 2HOBA 1WBGB 1TGTA 3DT0H 2YOLA 1UTMA 1Z6EA 8KME2 1AWFH 3GY4A 4Z6AH 2STBE 4ISIH 3M3TA 1A5GH 1GCDA 4DGJA 1F2SE 1ANDA 1C1MA