1EZUC

Ecotin y69f, d70p bound to d102n trypsin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
molecule keywords ECOTIN
total genus 52
structure length 223
sequence length 223
chains with identical sequence D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezuC01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezuC02
3M5NA 4Y71A 4BTIB 1A2CH 1GMCG 4IC5A 1GWAA 1ZPCA 1LO6A 2CGAA 4ISLA 1C1MA 1O2WA 3TU7H 4A1TA 1A5IA 3K65B 1SBWA 4UONA 1EP5A 4NIYA 1RRKA 1AY6H 2FIRH 1GBIA 2FZZA 4I8KA 4I8GA 2ZFQH 3TNSA 5C1XA 2EI8A 2AYWA 4X1NU 4J2YB 1J9CH 1OKXA 1JMOH 1LKAA 4JZIA 2PR3A 4X8TH 5B6OA 5DP5A 1ELFA 2PGBB 1IQKA 3UOPA 2PLXA 4Q2KA 1K2I1 1H4WA 1LVYA 3UQOA 2BXTH 2H9TH 1AFEH 1ZSJA 1NU9A 1ESTA 2WYGA 4JYTA 1P2QA 1K21H 1P2KA 1E35B 1O2TA 2P3TB 2WYJA 2XBVA 1P09A 2XBYA 5F8ZA 2DUCA 1K1IA 4NA8A 1GVKB 4MDSA 2ILNA 3I29A 1F0RA 3VB4A 1W13U 3QWCH 1ELCA 4O9VA 1TNKA 2VIPA 3EDXB 1O3CA 2R2MB 1JOUB 2AIQA 4ABHA 1GI6A 5JBCS 2V3OH 4YO9A 1J16A 1GMHG 4IS5A 2FDAA 1BIOA 2ZHWH 3RM0H 3LU9B 1LTOA 1SHHB 5A8YA 3LOXA 2P3FH 4OS2A 1BBRE 3D49H 1V2WT 2B0FA 1BA8B 5DP6A 1TBQH 1MKWK 3IITA 3B9FH 1PPEE 1EATA 5I46H 3BG4B 4ZXXH 2NU2E 1GBHA 3RM2H 2XNIA 1TFXA 1V2UT 1SGNE 1K1OA 1YPHC 4GPGA 1G3DA 1SSXA 3HGPA 3GISB 1HYLA 2WPJS 1LPZB 4H6SB 1XUIA 2XBXA 4Y10E 1DXWA 8LPRA 1LHEH 2NU1E 2ESTE 4XE4A 1W8BH 1RTFB 1P2MA 1BHXB 1O37A 2IOTA 3RXJA 5HXFA 3T62A 2ZTYA 2QC2A 4Q7YA 1SOZA 2Y7XA 3S9AA 3UTUH 4Y6DA 3LT3A 3D23A 1P05A 1OYTH 2A1DB 1O3AA 1UMAH 2VINA 1ZTLA 3F9FA 1HLTH 3L6PA 3MWIU 2VGCC 2ZU1A 4B73A 5DP7A 1HAHH 3RXFA 2FEQH 1NRRH 1FY3A 3SU1A 8GCHF 2Z9GA 1BITA 1A7SA 2M5TA 4BANB 1GBCA 2XXLA 5C67A 1O2IA 1UO6A 3M7TA 3UQVA 1ELEE 2RA3A 1OWKA 1C1UH 5J4SA 1XUFA 5A8ZA 3NK8A 3W94A 1S5SA 2LNCA 1IQNA 1QBNA 1E37B 4MPWA 4AB8A 2P3UB 5AFZH 2GGVB 1GBBA 2OLGA 3TVJB 1GJ8B 1O34A 3UIRA 1DM4B 1GHBF 2BLWA 2GV7A 1O3DA 4IMQA 2GCHF 4THNH 3HPTB 4XFQA 4FUFA 2ZPRA 3KNXA 1HUTH 3SORA 1YPGH 1PYTD 2ZGHA 1UCYH 4JZ1A 1YYY1 1XXFA 3RC4A 1OWHA 1ID5H 4OS1A 1P02A 3RU4D 4IMZA 2VB0A 1XUGA 4ABFA 1AVXA 5E0JA 1X7AC 4YOIA 3S9CA 4WXVA 4Y8YA 2BD5A 1SGDE 4ABJA 4FUBA 1MD7A 1O2SA 5LGOA 3RC5A 1L4DA 3A85A 4J1YA 1K9OE 4BAQB 3LH3A 4K8YA 4Y76A 2GDEH 1T8OA 1FIZA 4AYYB 3QO6A 1YC0A 3O8CA 1K28D 1IQFA 1WOFA 3OY6U 3RXGA 2XC5A 3LC5A 4I7YH 2HALA 3PV4A 4NG9H 3RLYH 1AZ8A 1KYNA 1QBVH 4ZH8A 1GBMA 2R9PA 5LH8A 2UUKB 1C2HA 1K1JA 5CHAC 1WAYB 3P8GA 2ANWA 3SU6A 3KQDA 3A7WA 1SL3A 1AE8H 1GMDF 1V2ST 3M37A 3PO1B 3SOSA 1ARCA 3T26A 1ZPBA 2FODA 1O5FH 1KLJH 1YPMH 2AMDA 1H9LB 1QB1A 1FDPA 1PYTC 1UCYE 2ZFTA 2BD2A 2BDYA 2D2DA 1C2MA 3PB1E 2A4QA 1F2SE 2Q6DA 4FUDA 4HFPB 4INKA 3NXPA 2R3YA 1S6HA 1IQMA 2VIWA 3QZQA 3A8CA 1D9IA 1MZDA 4GCHF 4E7RG 1J8AA 1AWFH 2ZHEH 1ARBA 1Q2WA 6GCHG 2FOBA 2IJOB 4Y8XA 1TX8A 1T8LA 3VB6A 3SHCH 1OS8A 1C1NA 1L4ZA 3EQ0H 1P2OA 1CVWH 1CA8B 1C5VA 3D62A 2NU0E 3RXEA 4BOHA 1YLCA 3E16B 2STAE 1N8OB 1EASA 2CHAC 3RXSA 3LJOA 1OX1A 2GZ8A 2A32A 5K0HA 2Q1JA 3BEFB 2UUFB 3BIUH 5JYIA 1DUEA 2HNTE 4ZKRU 7LPRA 2PHBA 1OSSA 1YP9A 2BQ6B 2ZFPH 5G4BA 1TNJA 2P8OB 2UWPA 1HAGE 4ASHA 1ZMNA 1AVWA 1CSOE 2QA9E 2VU8E 1TNHA 2ZU5A 3Q3YA 2OTVA 5F8TA 4INHA 3TJOA 5IYTA 1C9PA 4CRCA 1JXPA 4YZUA 1D3DB 1RS0A 4ZKNU 2ZNKH 1O5DH 2AEIH 3P6ZB 1T8MA 1DWCH 2AMQA 1HRTH 1BRBE 4UDWH 3CS7A 2PUXB 1THPB 3MH7A 2QIQA 1BTUA 2ZTXA 1ZYOA 3ZVBA 3ATLA 2UUYA 5EG4A 1B0FA 1UTPA 1LVMA 3L3TA 1AKSB 1DY8A 1C1WH 1DFPA 1EOJA 1G2LA 3ATWA 2ZC9H 1BTPA 1ELTA 3ATMA 4MNYA 3OY5U 4JK6A 3GY4A 4K1TA 1GHAG 4AYVB 3VB7A 4K1SA 1WCZA 3OYPA 2B5TB 1TPSA 4DJZB 1ZZZA 1Y5UT 1C5WB 4BXSA 1RFNA 3QTVH 1SB1H 1L1JA 1C4U2 1SG8B 2BDCA 2VVVA 3GCOA 3RMNH 3M61U 3TH3H 1O35A 1F0TA 1GJ9B 2FESH 5C2ZA 1GG6C 5HYOA 3MNSA 2JETB 1EX3A 1UTLM 3DFLA 2PSYA 1BMNH 1TABE 1ANBA 2BHGA 1SQTA 1A5GH 1DDJA 1F7ZA 3HGNA 1UJ1A 3IWMA 3F9HA 1AWHB 4VGCB 4ABIA 1IQEA 1LHFH 4I8LA 1AHTH 1DSTA 4AOQA 3F68H 1C5UA 3VB3A 1ELGA 1Z8IB 5LPFA 3IG6B 1CO7E 2Y82A 2Z3CA 4DVAU 1RJXB 1YCPH 3KEEA 1PPHE 4DT7B 1C5OH 2J4IA 5IDKA 4H6TA 1J14A 3E8LA 1EZUC 3RP2A 1XX9A 1V2KT 1FY4A 5AVDA 1XUHA 3BTFE 2W5EA 1CBWB 1HJAB 3MMGA 5JPMH 2QXIA 1GPZA 1D3TB 1ZLRA 1MKXK 4AFQA 3K6YA 2P94A 1MU8B 3ZVDA 1JBUH 1O3NA 1GDNA 2YOLA 2WPHS 1D3QB 3E0NB 3A87A 1AUTC 3ZZCA 4AFUA 1O39A 1P10A 2BB4A 2F9NA 2C3SA 3CS0A 3P95A 3S9BA 3FFGA 2FO9A 2Y81A 3MU1A 5FBEA 1T4UH 4WVPE 2A0QB 1BTZA 2C93B 2RCEA 1O2YA 3VFEA 5FCRA 4AGKA 2WUCA 1DVAH 2XRCA 5DK1A 2EEKA 4X6MA 4IC6A 3SJ8A 5DP9A 1FJSA 1TNLA 4IW4E 5FAHA 1FMGA 1UVUH 1O2KA 3EA7A 5JDUB 5C5NA 5F6MA 3UNQA 1XVMA 2FI3E 2GCHG 1FLEE 2GKVE 3RDZA 5JBTA 2VWNA 3PMBB 3M5LA 1XXDA 1TGTA 4CRDA 1KXAA 3I78A 4Y7BA 2CV3A 4ZUHA 2FXRA 1NRQH 2FMJA 4O03A 1V2RT 1DICA 2FP7B 3GY8A 7GCHF 3BEUA 1C2LA 2G55A 2DE8A 3VXEH 3AW0A 4ISIH 3T25A 1ANCA 2JH6D 2JKHA 2HVXA 1C5ZB 1YKTA 1TMBH 2VH6A 2FX6A 5J4QA 3V7TA 4KKDA 1F5LA 1TX6A 4X6NA 1O33A 4FUJA 2J34A 3HKIB 3F1SB 1Y3YA 5DP8A 1THSH 3QGNB 4YLQH 4B76A 4MQAA 6LPRA 2XYAA 3SGAE 3P70B 1GI3A 1BMLA 1OP0A 2ZFSA 4TPYA 4YOJA 4X8UH 1V6DA 1P06A 3R3GB 1SOTA 1TQ0B 3ZZ6A 3LGWA 3AAVA 1VITH 1C1OA 3ZVCA 1O5BB 1VCPA 5EXLA 4O3UA 3TJNA 2GCTB 2XWBI 3RXBA 5CE1A 2A4OA 3ODFA 1GGDB 1WUNH 2BXUH 3DD2H 1AMHA 2HOBA 1HAVB 1A3BH 1KXCA 3GYMA 3PMJA 1O2GH 1JWTA 3SJKA 4B2AA 2XC0A 3BTDE 1GHWH 2J9NA 1BTYA 5CHAB 4GCHG 1C1PA 7KMEH 1DXPA 5K7RA 1SGEE 2GX4A 1XM1A 2WUBA 2VNTA 1FNIA 3N7OA 4ABEA 4TWWA 2FOAA 3T27A 1C4V2 3OU0A 1BTHH 2YNBA 1MTNC 2A5KA 1Y8TA 2PV9B 1IHTH 1XKAC 1V2OT 3PYHA 1C1QA 1GBLA 2FOGA 2RA0A 4DOQA 3P8FA 2A4RA 4CRGA 1GI9B 1Q31A 4RN6A 1ZRBA 3RXDA 4ZHAA 3P8OA 4X2VA 1PPZA 4R8TB 3M3SA 2XWAA 1DITH 4TY6A 3MO6A 1GI0A 2GT8A 3ZV8A 3KGPA 2ZIQH 1IAUA 1P2JA 1TWXB 2BLOA 3A7VA 4CREA 2GZ9A 1K1MA 1J17T 4ZMAH 3ITIA 3PWBA 3U9AH 2AH4X 1V2NT 1PFXC 4WXIA 3V3MA 3LONA 1AGJA 3SZNA 1LHDH 3ZZDA 1Z6JH 1NM6A 1BUIA 1AE5A 1TPOA 4DURA 1FAXA 4PROA 1HAIH 3GYLB 4X8VH 1LVBA 1W7XH 3Q00A 4Z6AH 4FXGH 1LMWB 4ZROA 2F9OA 3TK5A 1HXEH 1UVTH 4UFGH 4ZKOU 4MNWA 4MPUA 3M5OA 4TY7A 3MU4A 1B0EA 2FOEA 4XSKU 1YCPM 1EKBB 1VJAU 1G3CA 1BJUA 5E2OA 5EXMA 5T6FA 2TBSA 3RUOA 5HMAA 4YM9A 5T3HA 1LHGH 2ULLA 1MTUA 1ZGVA 3KHVA 4CR5A 3KN2A 3ZV9A 3BTQE 1GI8B 1AN1E 1ABJH 3TJVA 5E2PA 3TK6A 2BX4A 2QF0A 2BVXH 3RMLH 1DLKB 1RD3B 1EPTC 3QK1A 4X2YA 5TJXA 1EB2A 1C5LH 2ZTZA 1ACBE 1HAXB 2W3KA 1SLXB 3MFJA 1GDQA 3UWIA 3UR6A 2Q6FA 1P9UA 4FUCA 2GP9B 1GI5A 1QA7A 5PTPA 2FOHA 4CBOA 4Y0ZE 4ISOA 4XDEA 1EZXC 1TGNA 2NU4E 7ESTE 2ANKH 1GGDC 4I8JA 1GJBB 4MPXA 1OWJA 2O8UA 3TK9A 1AZZA 5EPNA 1EAUA 4B74A 3PROA 2VWOA 3A7ZA 1TMUH 1F0SA 1E38B 1DOJA 1T4VH 3TH2H 1YM0A 2ZGJA 3U1IB 1PPCE 1O2XA 4HGCA 2D1JA 4MVNA 5EODA 3SU0A 3RXQA 1GL1A 3SW2B 2FYRA 2BMGB 1SMFE 4SGBE 1SVPA 1JRSA 2V6NA 2VWLA 5C5OA 4D9RA 1O2VA 1LKBA 1P3CA 1C1TA 4UFEH 1CU1A 2BLVA 2VIQA 3SNAA 1V2PT 1SI5H 2H5DA 3M36A 3TGJE 3E90B 1AQ7A 1AVGH 2OUAA 5JBBS 2ZHFH 3HATH 4F4OC 3PLPA 1L2EA 2V0BA 1GI2A 1A61H 1FY8E 1BB0B 2W7UA 4NFEA 3UUZA 1DS2E 3GICB 4IN2A 2UUJB 2J92A 1O2RA 1HV7A 1A4WH 4O97A 3FP6E 3PTNA 3GCTF 2ODYB 1SGCA 4X0WU 2ASUB 4B75A 2XCFA 3M7UA 1NRSH 2BY6X 3GCHB 4NA7A 4NZLA 1S85A 3LGTA 3UFAA 3FAOA 3STJA 4U2WA 1O3FA 5HM2A 1O5GH 5GJ4B 2A31A 1O3HA 4B2BA 1XUJA 1TNGA 1OWDA 3ZZ3A 3QUMP 2AIPA 3K6ZA 6CHAC 3ZVAA 3SI4H 1H8IH 2OBOA 6CHAB 1L1NA 2J2UA 1G36A 2R0KA 3C1KA 1FZZA 5FPTA 5F03A 2P8OC 2PGQB 2P16A 2ZU2A 4RKOB 4KELA 1A0HB 3RMOH 1O2HA 3RXAA 3BTEE 3UR9A 1QL7A 1MBQA 1NY22 3FP7E 1TLDA 5LPRA 4K60A 4ABGA 3F9EA 1LPGB 4CBNA 4WMFA 4GLYA 2CF9H 2GCTC 3LGIA 1BOQA 2ANYA 3FZZA 2JH0D 3E91A 2FI5E 1MQ6A 4DY7B 2OQUA 3TIUA 3MO9A 2Z9KA 2XC4A 1G30B 4JYUH 1GDUA 1V3XA 1BDAA 1UK3A 3NCLA 1O2JA 3D65E 4CRBA 1P2NA 2BY9X 3SN8A 1XUKA 5TCAA 2FS9A 1IOEA 2JETC 2BVSH 3P92A 4YOGA 1NN6A 2BOHB 4TWYA 1NROH 3GOVB 2STBE 2NWNA 1Y3WA 1G32B 1TYNA 1UTQA 1HFDA 1SGYE 2C8XB 4I8HA 1VJ9U 2H9EH 2IN2A 3MH5A 2BYAX 1MU6B 1P03A 3AW1A 2AGGX 1NPMA 3RXCA 4CH8B 5TCCA 4KTUA 1IQGA 1KSNA 3GY6A 2FPZA 3HKJB 3P17H 3EE0B 1NRNH 8ESTE 3FZDA 3H5CB 1GBDA 1HAOH 1TAWA 4GAWA 2ZPQA 4WH8A 3PMAB 1BJVA 2OC7A 2G5VA 3T29A 5LPEA 1BBRK 5EW1H 1ELBA 1O3MA 4LZ1H 1GJ5H 1AUJA 2OINA 4NCYA 2A2QH 1TE0A 1P57B 2ZA5A 1RIWB 5A2MH 1VR1H 1QJ6B 3VEQB 1UTNA 4GSOA 2ZECA 3O8DA 2QXHA 1UK4A 3MH4A 1DWBH 4HI3A 5GCHG 8KME2 1ZTKA 1RIWC 1C5MD 2G81E 3HK3B 2ZQ1A 4ZHMU 2K1QA 2WINI 1YPKH 2CXVA 2QY0B 1GBEA 1SC8U 1C5PA 1FQ3A 3TNTA 2A7HA 4NZQA 2Z3EA 1VCQA 2Y6TA 1O5AB 2H1UA 3A89A 4AB9A 1QTFA 5C3NA 9LPRA 3SUDA 2F9PA 3DT0H 4X2XA 2WV4A 5F8XA 2G52A 4MTBA 1HIAA 2A5IA 3MNBA 1CT4E 1BRUP 1T8NA 5HGGA 3S69A 1RTKA 4OS4A 3RXMA 1C5TA 3W95A 1KTSB 5CMXH 4YT7H 2ZCKP 1HPGA 1TGSZ 3RXHA 1FONA 3TITA 4INLA 1KXEA 3AAUA 1LQEA 1QHRB 1VZQH 2W3IA 3EAJA 3KIDU 3SJIA 1TGBA 2Y80A 3SJOA 4CHAB 2ZFRH 2ZDLA 1Z7KA 3RXIA 1QRWA 2B9LA 5E8EH 1AU8A 3NWUA 1LDTT 3BTME 1AKSA 3JZ1B 1D3PB 1SGFG 4KP0A 2BD3A 3A8BA 3BEIB 1ETSH 1QQUA 1MH0A 3EA8A 1KXDA 1EJNA 3SU4A 2TRMA 2F9BH 2BDAA 4IN1A 3UNRA 2R3UA 1KLIH 3WY8A 3LC3A 4A5TS 1FUJA 4D8NA 1OP2A 5FX5A 3SGBE 4YESB 1K22H 3MNCA 1BCUH 2FTLE 2H6MA 3G01A 1LQDB 4KTCA 4ABBA 4D9QA 4E06H 3ZVFA 3TGKE 2BD9A 2J94A 1C1VH 1O31A 2ZDNA 4NSVA 3MU5A 4CRFA 3BG4C 1AIXH 1O5EH 1OWIA 1K1PA 1OWEA 3BTTE 1BRCE 1P04A 2TPIZ 2WPKS 1E36B 1QB6A 1RGQA 5GCHF 2BY8X 2ZO3H 4YTAA 1YF4A 1TQ7B 3MTYA 3M3TA 1VGCC 3GY3A 1GBFA 2QF3A 3TPIZ 5L30H 2QXGA 1O38A 2O8TA 5FCKA 1YGCH 2BD8A 1MD8A 3SUFA 1O3OA 2ODPA 3SNDA 1BBRH 1M9UA 1W12U 1UVSH 5EPYA 4H42U 1EAXA 2ALPA 1H9IE 2BM2A 5EW2H 1TONA 4FVDA 2GV6A 4MPVA 1O30A 1QA0A 2F9UA 3PWCA 1MAXA 1MAYA 1BTWA 5JBAS 2BQWB 1W14U 4K2YA 2QXJA 3RMMH 1CA0B 3H7OA 1EZQA 4X6PA 4AX9H 1JIMA 2CHAB 2VWMA 3QDZB 4FU9A 1BHXF 5H4IB 1JIRA 1FN8A 5HM9A 5EGMA 4DG4A 1GJDB 1GJAB 1K1NA 1O3IA 1P12E 1BRAA 4BNRA 2F91A 4JK5A 1W0ZU 3SGQE 5EXNA 3UOUA 3U98H 1O2MA 4F49A 3U8TH 1TRYA 1MMJN 1TA6A 1FY1A 1TPAE 2FOFA 1WTGH 2A45B 3LGUA 3SHAH 4AG2A 2W7SA 1IQLA 4OS7A 2J95A 4NIVA 1WBGB 4NFFA 4IGDA 1NZQH 2THFB 5FXLA 2BZ6H 1GJCB 1ZRKA 3C27B 1FV9A 3NKKA 3T28A 1ZJKA 4XBBA 1QY6A 2BZAA 3T5FH 3MHWU 2ZGBH 1NRPH 1VITF 4HZHA 2ALVA 2QAAA 3LKWA 1PPGE 1TMTH 1S84A 1O0DH 1Y3XA 3V12A 1PQ7A 1O32A 4YLUA 4CH2B 1O3EA 1WTHD 3SUGA 4FVBA 3M3VA 1PQ5A 1FN6A 1PPFE 5ABWA 1YPJH 4X2WA 3SU5A 1FPCH 4Y11E 1SGQE 3RU4T 1C4Y2 4HTCH 2BDGA 2HNTC 2ZGCA 4RKJB 5FPSA 3UNSA 1C2DA 2ZG0H 4NIXA 1EP6A 1QB9A 2LPRA 3RXUA 1MTWA 3GY5A 3GCTG 4VGCC 4I33A 4ISHH 1ZSKA 4X1PU 5A0AE 1Z1IA 1L1GA 1QIXB 1A1RA 3A7TA 5EQQA 1GVLA 1FY5A 1MCTA 2SGQE 1CT0E 2BX3A 2SFAA 4LK4A 1G3EA 2FI4E 4NWLA 1P01A 3KL6A 4I31A 4ZXYH 1GG6B 1MKXH 5AFYH 1O3JA 1INCA 1SR5C 3QN7A 3A8AA 4OS6A 1A5HA 2ZF0H 4BTTB 1C1SA 1YPEH 1OOKB 1ANDA 1L0ZA 2SGAA 1DSUA 2R0LA 4DW2U 5C20A 3Q76A 5FX6A 3BG8A 1AO5A 1SFQB 2XCNA 2ZCLP 5A0BA 3NPSA 1UVOA 2C90B 2KAIA 5BRRE 3QLPH 3B8JA 2QN5T 3PLKA 1HAPH 1CGIE 1IQHA 3QZRA 2AERH 5L2YH 1D6RA 3BIVH 4FUIA 3SQHE 3U1JB 1Y59T 3VGCB 2OC1A 5DG6A 1BT7A 1GJ7B 2PW8H 1GHAF 4MG3A 3RXKA 4FUGA 4A6LA 2TGTA 3V0XA 4LOYH 1VCWA 1ZTJA 1ELVA 2QCYA 1XMNB 5AHGH 2ZHQH 1S82A 4AZ2B 2HRVA 3Q77A 2OC8A 2PFEA 3F6UH 4CRAA 4MNVA 1TBRH 1SLWB 5C1YA 1Z8JB 2P93A 3B23B 3ZZ4A 2GDDA 2HNTF 3A7XA 2CN0H 2HGTH 1LPKB 4K1EA 3Q3KA 2FYQA 2Y5GA 4CR9A 5I25A 1ZHRA 2Z6BD 1YPHE 2XTTB 1GMCF 1FXYA 5L2ZH 1TOCB 2O8WA 4OS5A 2A4GA 2O8LA 4Q7XA 3SNCA 4BXWA 4NIWA 4BTUB 1P3EA 1ANEA 2FLBH 1D4PB 1NFXA 2GD4B 1DUAA 3MYWA 3PM3A 1P11E 1CGHA 1TBZH 1O2LA 3A80A 4DGJA 3JZ2B 4KTSA 1LVOA 4GUXA 4WWYA 4OGYA 4LXBH 4NGAH 3BTHE 1F92A 4BAMB 5ESTE 3ZYDA 2PSXA 3UWJH 2AFQB 2C8ZB 3LIWA 1Z8GA 2ZGXH 3EGKH 5A09A 3DUXH 4Y8ZA 4FUHA 3ZZAA 3SV8A 1Q3XA 2Z9JA 3BN9A 3UY9A 1OYQA 4BAOB 2SNWA 2ZP0H 4JCNA 1KLTA 1C2KA 4TPIZ 2YNAA 3R0FA 3LDXH 5EOKA 1NC6A 2Z3DA 1O3PB 1NO9H 4JZFH 3SI3H 1QJ7B 3TJUA 1ZR0A 1N1LA 1C5YB 2UWOA 1ETTH 1QURH 1UHBB 2Y7ZA 1QNJA 6ESTA 1C5SA 2PKSC 2ZFFH 3K2UA 2EI7A 1EQ9A 1GI7B 1T32A 2GT7A 1TB6H 3GY2A 2CJIA 1SPJA 1UTKA 2Z7FE 1C9TA 1SLUB 1EPTA 1S81A 3PMHB 3S0NA 4DCDA 1TALA 1KY9A 1B5GH 1TGCA 4JYVH 1G2MA 5FBIA 3MO3A 1ZGIA 1EJAA 1VITG 1UTMA 2VIVA 4LZ4B 1Y3UA 5A8XA 1MBMA 4E05H 1NFYA 2PWXA 4E7NA 1N6XA 1W7GH 1GCDA 1HAVA 4Z0KA 1TIOA 7GCHG 3QGJA 1SGFA 1TRMA 3GCHC 3NUMA 1DT2A 4K3JA 1S0RA 3LJJA 8GCHG 5A0CA 5SGAE 4U01A 3MOCA 1LCYA 2D26C 1N8OC 1PQ8A 3O8RA 4K5ZA 4Y7AA 2VVUA 2ZU3A 5DJ7A 2H2ZA 3T2NA 1V2MT 3ENSB 3AVZA 2ZPSA 3A83A 3H7TA 2Y5FA 2OQ5A 4YT6H 2XW9A 5C1UA 5JB8S 4UEHH 1DWDH 2C8YB 4UFDH 2I6QA 1TX7A 1TNIA 2H9HA 2A2XH 1C2IA 2TGPZ 1A0LA 3OSYA 2ZDMA 4JZEH 1CGJE 1GMHF 4XBDA 2Y5HA 1V2VT 3U8OH 1O2OA 1GHXH 1UVPA 2Z9LA 1GHZA 3CP7A 2BD4A 2OD3B 1KXBA 2WPMS 1GI1A 4WY3A 1W3CA 2F83A 1A46H 1UTOA 2ZU4A 4IBLH 1Y5AT 3SNBA 1QGFA 3PO1C 5DGJA 2VGCB 1UCYK 1O2PA 3TH4H 4A1XA 1EB1H 1SGTA 3SBKA 1WQVH 3BTKE 3ZZ9A 3A7YA 1NU7B 1P0SH 1GJ4H 1XVOA 1F5KU 1YCPK 2SGEE 3UREA 5T6GA 1AD8H 2ZKSA 1U6QA 3GDSA 2V35A 1W0YH 2IPHA 1ORFA 4FU8A 2VJ1A 1C5XB 2W26A 5BPEA 4ESTE 2FOMB 3FANA 1D6WA 3K9XB 2GMTC 4A92A 4UE7H 2BDHA 2BQ7B 2B8OH 4X8SH 3RXRA 1Y5BT 3A86A 1HAZB 3MH6A 4ZAEA 3PLBA 1DE7H 1ELDE 1DANH 3DA9B 3SU3A 3RXVA 1FIWA 4A7IB 3SQEE 4K69A 1NS3A 2OP9A 1CHGA 3A88A 1DPOA 4DIIH 1KXFA 3ZZ5A 2BY7X 1GJ6A 1F0UA 4I32A 3ATIA 2NU3E 4X1SU 1GL0E 1TA2A 2G4TA 2KAIB 2VIOA 1QRXA 3SV6A 2ZCHP 2ZI2H 4JZDH 5FHTA 2O8MA 3BTWE 5DP4A 1C5NH 1TPPA 2SGDE 2QYIA 1BTXA 3TLOA 1QL9A 1ETRH 1KTTB 1OP8A 1V2TT 4WMDA 2ZEBA 1EUFA 3SV9A 4GHQA 2B7DH 2BVRH 1EPTB 1T7CA 1ZOMA 1AFQC 3U69H 1CE5A 3F9GA 1W11U 2CMYA 5E0HA 1YBWA 1MTSA 1IQJA 1MUEB 3RXTA 4GHTA 3PTBA 3FVFB 2V3HH 2PTNA 4D7FA 1ABIH 1C1RA 2FWWA 2VVCA 2WPIS 1A0JA 2PKAA 1H9HE 1ZMLA 2BDIA 3ATKA 2PKAB 4NSYA 4ZHLU 3U8RH 3QX5H 2J38A 3KF2A 1CA0C 1WU1A 4K8BA 3VB5A 3RU4E 1GCTB 2FX4A 3URCA 3OTJE 5DP3A 3VPKA 1KDQA 4QT8C 5DKMA 3DHKH 1KDQB 3STIA 2G5NA 3RC6A 3KQCA 1TRNA 1SHYA 1E0FD 2ZHDA 2EI6A 1JRTA 4X1RU 2F9VA 2G00A 1CT2E 3TGIE 4BAKB 3SJ9A 1J15A 4XOJA 1ZHPA 1RXPA 4A1VA 3SUEA 3GDVA 1Z71A 2JH5D 1ZJDA 2AGEX 2GZ7A 1P2IA 1DLEA 2BY5X 4X1QU 4XBCA 3BSQA 3ZZ7A 2FM2A 1G9IE 1QFKH 4AORA 1AFQB 4BAHB 1S6FA 1SFIA 3ELAH 2GVFA 1Z6EA 3URDA 5DO4H 2TGAA 3GY7A 1DX5M 3LGVA 3RXOA 2P95A 3HK6B 1Z8RA 1AB9C 1MTNB 1O2ZA 3O8BA 2GMTB 2P59A 5EQSA 3BV9B 1SQAA 1ELAA 3P8NA 1C2FA 1O3BA 4GVUA 1C2JA 3ZYEA 2ZDVH 3A84A 1BMAA 1DWEH 2ANMH 1AB9B 1VGCB 3RXPA 3LGYA 1HJ8A 1HB0B 3ESTA 2AS9A 4FUEA 4NA9H 1O36A 1OPHB 4Y0YE 3CENA 2O9QA 2TGDA 3MU0A 2OC0A 2EC9H 5GIBA 2HPQH 3I77A 1H1BA 2AGIX 2FS8A 1LHCH 1MCVA 1C2GA 1KIGH 1WV7H 3BF6H 5FPYA 3MNXA 1O3KA 1W10U 3V13A 4CHAC 3RXLA 1O3LA 1QR3E 2HPPH 1PJPA 2DE9A 3ZZ8A 1F5RA 1EZSC 1WSSH 1ZHMA 5E0GA 3AASA 4U32A 2G51A 2SGFE 4UFFH 4TYDA 1HCGA 1O2NA 1P9SA 1QQ4A 1EAIA 3Q3XA 1EAWA 1SLVB 4WMEA 1NFWA 3E6PH 1HXFH 4JMYA 2VIDA 5GPIB 3ZZBA 1Y3VA 1GCTC 1CHOG 1HDTH 1HIAB 2G8TA 2I6SA 1TOMH 1C5QA 1UHBA 2H5CA 3NZIA 3GCNA 4OGXA 1ZSLA 4WF8A 2G4UA 2R2WU 2Z9IA 5ETXA 5AF9H 4X6OA 3KCGH 4SGAE 2OBQA 2PUQH 1T31A 4DIHH 1NESE 2WPLS 1MTVA 2XBWA 1QL8A 2SGPE 4AG1A 1PPBH 2BDBA 2SNVA 1Z1JA 2BTCE 4ABAA 3BTGE 2RDLA 3LH1A 3S7HB 4B71A 1DY9A 9ESTA 2AMPA 1HAYB 4ISNA 2QV1A 1SGRE 1W2KH 2WV5A 4MLFB 2FLRH 3E3TA 1H8DH 1V2LT 1GBKA 1A3EH 1MQ5A 1N6YA 2QGRA 1GBAA 3M5MA 3OX7U 3MI4A 1E34B 3FP8E 3E1XB 2ZZUH 1WYKA 4Q80A 4H4FA 1BQYA 4MNXA 5ESBA 2Q6GA 4AFZA 2A7JA 5EQRA 1GBJA 3E0PB 2D8WA 3A81A 2A5AA 1YPLH 1S0QA 2OCVB 4Q7ZA 1P8VC 4AGJA 1RTLA 2HWLB 1WQSA 3A82A 1O2UA 3SU2A 1QJ1B 2GTBA 1HBTH 4NWKA 3ZVGA 1FPHH 1QBOA 3DFJA 1ESAA 1CBWC 1HJAC 1YLDA 2BLQA 3ZVEA 3MU8A 4FU7A 1HGTH 1CQQA 4ZKSU 3M35A 4WJG2 1IQIA 1SGIB 1HNEE 1AI8H 1XKBC 1NTPA 2ZQ2A 4Y79A 1SQOA 4D76A 1THRH 1GHVH 3SV7A 1FI8A 3GDUA 4UD9H 2ODQA 4KGAA 4WH6A 4O3TA 1V2JT 1IHSH 3QTOH 2ZDKA 2PTCE 2TIOA 3UPEA 4R0IA 3SO3A 3A8DA 2Z94A 2VH0A 1GI4A 4AN7A 4M7GA 1EXFA 2HLCA 6GCHF 4D7GA 1G3BA 1B7XB 1K1LA 2FOCA 4B1TA 1HJ9A 2UWLA 1G37A 1ZPZA 5JB9S 1PQAA 3KQEA 1GHBG 3SV2H 2EA3A 5GWZA 1MZAA 5T6DA 4B2CA 2BD7A 1CHOF 1O3GA 3ODDA 1V2QT 5GDSH 2C8WB 1NFUA 2F3CE 1C5RA 1OXGA 4AFSA 1QRZA 3VXFH 1O5CB 1EJMA 1GVZA 5DPAA 1BZXE 1GBTA 2ZDAH 2RG3A 4ABDA 2CF8H 2BOKA 3RLWH 2A7CA 1SGPE 2OXSA 1EOLA 1NT1A 1UTJA 3SNEA 1GMDG 2ZWLH 3LPRA 3S7KB 3M7QA 5GXPA 2C4FH 1FAKH 1UK2A 1C2EA 1O2QA 1QCPA 2FTMA 5EU8A 1MKWH 3KQBA 1BMMH 1ZMJA 3EA9A 4U30A 4RSPA 3VGCC 1S83A 3EYDA 2PKSB 3L33A 5L6NH 1GHYH 1ESBA
chains in the Genus database with same CATH superfamily
3M5NA 3NRLA 4Y71A 4BTIB 1A2CH 1GMCG 4IC5A 1GWAA 1ZPCA 1LO6A 2CGAA 4ISLA 1C1MA 1O2WA 3TU7H 4A1TA 1A5IA 1E1RD 3K65B 1SBWA 4UONA 1EP5A 2KR7A 4NIYA 1RRKA 1AY6H 2FIRH 1GBIA 2FZZA 4I8KA 4I8GA 2ZFQH 3TNSA 5C1XA 2EI8A 2AYWA 4X1NU 4J2YB 1J9CH 1OKXA 1JMOH 1LKAA 4JZIA 2PR3A 4X8TH 2JJ1D 5B6OA 5DSFA 5DP5A 1ELFA 2PGBB 1IQKA 3UOPA 2PLXA 4Q2KA 1K2I1 1H4WA 1LVYA 3UQOA 2BXTH 2H9TH 1AFEH 1ZSJA 1NU9A 1ESTA 2WYGA 4JYTA 1P2QA 1K21H 1P2KA 1E35B 1O2TA 2P3TB 2WYJA 2XBVA 1P09A 2XBYA 5F8ZA 2DUCA 1K1IA 4NA8A 1GVKB 2J98B 4MDSA 2ILNA 3I29A 1F0RA 3VB4A 1W13U 3QWCH 1ELCA 4O9VA 1TNKA 2VIPA 3EDXB 3AK5A 1O3CA 2R2MB 1JOUB 2AIQA 4ABHA 1GI6A 5JBCS 2KCYA 2V3OH 4YO9A 1J16A 1GMHG 4IS5A 2FDAA 1BIOA 2ZHWH 4YXWD 3RM0H 3LU9B 1LTOA 1SHHB 5A8YA 3MQKC 3LOXA 2P3FH 4OS2A 1BBRE 3D49H 1V2WT 2B0FA 1BA8B 5DP6A 1TBQH 3FKSD 1MKWK 3IITA 3B9FH 1PPEE 1EATA 5I46H 3BG4B 2V3MA 4ZXXH 2NU2E 2K8IA 1GBHA 3RM2H 2XNIA 1TFXA 1V2UT 1SGNE 1K1OA 1YPHC 4GPGA 1G3DA 1SSXA 3HGPA 3GISB 1HYLA 2WPJS 1MABB 1LPZB 4H6SB 1XUIA 2XBXA 4Y10E 1DXWA 4Q4LA 3N7EA 2F43B 8LPRA 1LHEH 2NU1E 2ESTE 4XE4A 1W8BH 1RTFB 1P2MA 1BHXB 1O37A 2IOTA 3RXJA 5HXFA 3T62A 2ZTYA 2QC2A 4Q7YA 1SOZA 2Y7XA 3S9AA 3UTUH 4Y6DA 1COWD 3LT3A 3D23A 1P05A 1OYTH 2A1DB 1H8HD 1O3AA 1UMAH 2VINA 1ZTLA 3F9FA 1HLTH 1H8ED 3L6PA 3MWIU 2VGCC 5CDFE 2ZU1A 4B73A 4ZCNA 5DP7A 5KEDA 1HAHH 5T1VA 3RXFA 2FEQH 1NRRH 1FY3A 3SU1A 8GCHF 2Z9GA 1BITA 1A7SA 2M5TA 4BANB 1GBCA 2XXLA 5C67A 1O2IA 1UO6A 3M7TA 3UQVA 1ELEE 2RA3A 1OWKA 1C1UH 5J4SA 1XUFA 5A8ZA 3NK8A 3W94A 1S5SA 2LNCA 1IQNA 1QBNA 1E37B 4MPWA 4AB8A 2P3UB 5AFZH 2GGVB 1GBBA 2OLGA 3F0PA 3TVJB 1GJ8B 1O34A 3UIRA 1DM4B 1GHBF 2BLWA 2GV7A 1O3DA 4IMQA 2GCHF 4THNH 3HPTB 4XFQA 4FUFA 2ZPRA 3KNXA 1HUTH 3SORA 1YPGH 4Q63A 1PYTD 2ZGHA 1UCYH 4JZ1A 1YYY1 1XXFA 3RC4A 1OWHA 1ID5H 4OS1A 1P02A 3RU4D 4IMZA 1XUGA 2VB0A 4ABFA 1AVXA 5E0JA 1X7AC 4YOIA 3S9CA 4WXVA 4Y8YA 2BD5A 1SGDE 4ABJA 4FUBA 1MD7A 1O2SA 5LGOA 3RC5A 3F2GA 4TT3D 1L4DA 3A85A 4J1YA 1K9OE 4BAQB 3LH3A 4K8YA 4Y76A 2GDEH 1T8OA 1FIZA 4AYYB 3QO6A 4DT4A 1YC0A 3O8CA 1K28D 3SYJA 1IQFA 1WOFA 3OY6U 3RXGA 2XC5A 3LC5A 4I7YH 2HALA 3PV4A 4NG9H 3RLYH 1AZ8A 1KYNA 1QBVH 2KX4A 4ZH8A 1GBMA 2R9PA 5LH8A 2UUKB 1C2HA 1K1JA 5CHAC 1WAYB 2JJ2D 3P8GA 2ANWA 3SU6A 3KQDA 3A7WA 1SL3A 1AE8H 1GMDF 1V2ST 3M37A 3PO1B 3SOSA 1ARCA 3T26A 1ZPBA 2FODA 1O5FH 1KLJH 1YPMH 2AMDA 1H9LB 1QB1A 1FDPA 1PYTC 1UCYE 2ZFTA 2BD2A 2BDYA 2D2DA 1C2MA 3PB1E 2A4QA 1F2SE 2Q6DA 4FUDA 4HFPB 4INKA 3NXPA 2R3YA 1S6HA 1IQMA 2VIWA 3QZQA 3A8CA 1D9IA 1MZDA 4GCHF 4E7RG 1J8AA 1AWFH 2ZHEH 1ARBA 1Q2WA 6GCHG 2FOBA 2IJOB 4Y8XA 1TX8A 1T8LA 3VB6A 3SHCH 1OS8A 1C1NA 1L4ZA 3EQ0H 1P2OA 1CVWH 1CA8B 1C5VA 3D62A 2NU0E 3RXEA 3UB0A 4BOHA 2WPDD 1YLCA 3E16B 2STAE 1N8OB 1EASA 2CHAC 3RXSA 3LJOA 1OX1A 2GZ8A 2A32A 5K0HA 2Q1JA 3BEFB 2UUFB 3BIUH 5JYIA 1DUEA 2HNTE 4ZKRU 4RT1A 7LPRA 2PHBA 5FL7D 1OSSA 1YP9A 2BQ6B 2ZFPH 5G4BA 1TNJA 2P8OB 2UWPA 1HAGE 2F4LA 4ASHA 1ZMNA 1AVWA 1CSOE 2QA9E 2VU8E 2LELA 1TNHA 2ZU5A 3Q3YA 2OTVA 5F8TA 4INHA 3TJOA 5IYTA 1C9PA 4CRCA 1JXPA 4YZUA 1D3DB 1RS0A 3H09A 4ZKNU 2ZNKH 1O5DH 2AEIH 3P6ZB 1T8MA 1DWCH 2AMQA 1HRTH 1BRBE 4UDWH 3CS7A 2LP6A 2PUXB 1THPB 3MH7A 2QIQA 1BTUA 4FOUC 2ZTXA 1ZYOA 3ZVBA 3ATLA 2UUYA 5EG4A 1B0FA 1UTPA 1LVMA 3L3TA 1AKSB 1DY8A 1C1WH 1DFPA 1EOJA 1G2LA 3ATWA 2ZC9H 1BTPA 1ELTA 3ATMA 4MNYA 3OY5U 4JK6A 3GY4A 4K1TA 1GHAG 4AYVB 3VB7A 4K1SA 1WCZA 3OYPA 2B5TB 1TPSA 4DJZB 2V7QD 1ZZZA 1Y5UT 1C5WB 4BXSA 1RFNA 2XNDD 1SB1H 3QTVH 1L1JA 1C4U2 1SG8B 2BDCA 2VVVA 3GCOA 3RMNH 3M61U 3TH3H 2KCAA 1O35A 1F0TA 1GJ9B 2FESH 5C2ZA 1GG6C 5HYOA 2GJGA 3MNSA 2JETB 1EX3A 1UTLM 3DFLA 2PSYA 1BMNH 1TABE 2EQNA 1ANBA 2BHGA 1SQTA 1A5GH 1DDJA 1F7ZA 3HGNA 1UJ1A 3IWMA 3F9HA 1AWHB 4VGCB 4ABIA 1IQEA 1LHFH 4I8LA 1AHTH 1DSTA 4AOQA 3F68H 1C5UA 3VB3A 1ELGA 1Z8IB 5LPFA 3IG6B 1CO7E 2Y82A 2Z3CA 4DVAU 1RJXB 1YCPH 3KEEA 1PPHE 4DT7B 1C5OH 2J4IA 5IDKA 4H6TA 1J14A 3E8LA 1EZUC 3RP2A 1XX9A 4ACAA 1V2KT 1FY4A 5AVDA 1XUHA 3BTFE 1YY3A 2W5EA 1CBWB 1HJAB 3MMGA 5JPMH 2QXIA 1GPZA 1D3TB 1ZLRA 1MKXK 4AFQA 3K6YA 2P94A 1MU8B 4RT0A 3ZVDA 1JBUH 1O3NA 1GDNA 2YOLA 2WPHS 1D3QB 3E0NB 3A87A 1AUTC 3ZZCA 4AFUA 1O39A 1P10A 2BB4A 2F9NA 2C3SA 3CS0A 1K0HA 1QZ8A 3P95A 3S9BA 3FFGA 2M2AA 2FO9A 2Y81A 3MU1A 5FBEA 1T4UH 4WVPE 2A0QB 1BTZA 2C93B 2RCEA 1O2YA 3VFEA 5FCRA 4AGKA 2WUCA 1DVAH 2XRCA 5DK1A 2EEKA 4X6MA 4IC6A 3SJ8A 2YMSC 5DP9A 1FJSA 1TNLA 4IW4E 5FAHA 3WWFA 1FMGA 1UVUH 1O2KA 3EA7A 1WDIA 5JDUB 5C5NA 5F6MA 3UNQA 1XVMA 2FI3E 2GCHG 1FLEE 2GKVE 3RDZA 5JBTA 2VWNA 3PMBB 3M5LA 1XXDA 1TGTA 4CRDA 1KXAA 3I78A 4Y7BA 2CV3A 4ZUHA 2FXRA 4I86A 1NRQH 2FMJA 4O03A 1VKYA 1V2RT 1DICA 2FP7B 3GY8A 7GCHF 3BEUA 1C2LA 2G55A 2DE8A 3VXEH 3AW0A 4ISIH 3T25A 1ANCA 2JH6D 2JKHA 2HVXA 1C5ZB 3KQ5A 1YKTA 1TMBH 2VH6A 2FX6A 5J4QA 3V7TA 4KKDA 1F5LA 1TX6A 4X6NA 1O33A 4FUJA 2J34A 3HKIB 3F1SB 1Y3YA 5DP8A 1THSH 3QGNB 4YLQH 4B76A 4MQAA 6LPRA 2XYAA 3SGAE 3P70B 1GI3A 1BMLA 1OP0A 2ZFSA 4TPYA 4YOJA 4X8UH 1V6DA 1P06A 3R3GB 1SOTA 1TQ0B 3ZZ6A 3LGWA 3AAVA 1VITH 1C1OA 2HVYB 3ZVCA 1O5BB 1VCPA 5EXLA 4O3UA 3TJNA 2GCTB 2XWBI 3RXBA 5CE1A 2A4OA 3ODFA 1GGDB 1WUNH 2BXUH 3DD2H 1AMHA 2HOBA 1HAVB 1A3BH 1KXCA 3GYMA 3PMJA 1O2GH 1JWTA 3SJKA 4B2AA 2XC0A 3BTDE 1GHWH 2J9NA 1BTYA 5CHAB 4GCHG 1C1PA 7KMEH 1DXPA 5K7RA 1SGEE 2GX4A 1XM1A 2WUBA 2VNTA 1FNIA 3N7OA 4ABEA 4TWWA 2FOAA 3T27A 1C4V2 3OU0A 1BTHH 2YNBA 1MTNC 2A5KA 1Y8TA 2PV9B 1IHTH 1XKAC 1V2OT 3PYHA 1C1QA 1GBLA 2FOGA 2RA0A 4DOQA 3P8FA 2A4RA 4CRGA 1GI9B 1Q31A 4RN6A 1ZRBA 3RXDA 4ZHAA 3P8OA 4X2VA 1SQRA 1PPZA 4R8TB 3M3SA 2XWAA 1DITH 4TY6A 1NBME 3MO6A 1GI0A 2GT8A 3ZV8A 3KGPA 2ZIQH 1IAUA 1P2JA 1TWXB 2BLOA 3A7VA 4CREA 2GZ9A 1K1MA 1J17T 4ZMAH 3ITIA 3PWBA 3U9AH 2AH4X 1V2NT 1PFXC 4WXIA 3V3MA 3LONA 1AGJA 3SZNA 1LHDH 3ZZDA 1Z6JH 1NM6A 5HIYA 2XOKD 1BUIA 1AE5A 1TPOA 4DURA 1FAXA 4PROA 1HAIH 3GYLB 4X8VH 1LVBA 1W7XH 3Q00A 4Z6AH 4FXGH 1LMWB 4ZROA 2F9OA 3TK5A 1HXEH 1UVTH 2L6OA 4UFGH 4ZKOU 4MNWA 4MPUA 3M5OA 4TY7A 3MU4A 1B0EA 2FOEA 4XSKU 1YCPM 1EKBB 1VJAU 1G3CA 1BJUA 5E2OA 5EXMA 5T6FA 2TBSA 3RUOA 5HMAA 3U28C 4YM9A 5T3HA 1LHGH 2ULLA 1MTUA 1ZGVA 3KHVA 4CR5A 3KN2A 3ZV9A 3BTQE 1GI8B 1AN1E 1ABJH 3TJVA 5E2PA 3TK6A 2BX4A 2QF0A 2BVXH 3DSGA 3FO8D 1DLKB 3RMLH 1RD3B 1EPTC 3QK1A 4X2YA 5TJXA 1EB2A 1C5LH 2ZTZA 1ACBE 1HAXB 2W3KA 1SLXB 3MFJA 1GDQA 3UWIA 5HIZA 3UR6A 2Q6FA 1P9UA 4FUCA 2GP9B 1GI5A 1E1QD 1QA7A 5PTPA 2FOHA 4CBOA 4Y0ZE 4ISOA 4XDEA 1EZXC 1TGNA 2NU4E 7ESTE 2ANKH 1GGDC 4I8JA 1GJBB 4MPXA 1OWJA 2O8UA 5EIYA 3TK9A 1AZZA 5EPNA 1EAUA 4B74A 3PROA 2VWOA 3A7ZA 1TMUH 1F0SA 1E38B 1DOJA 2WHXA 1T4VH 3TH2H 1YM0A 2ZGJA 3U1IB 1PPCE 1O2XA 4HGCA 2D1JA 4MVNA 5EODA 3SU0A 3RXQA 1GL1A 3SW2B 2FYRA 2BMGB 4F55A 1SMFE 4SGBE 1SVPA 1JRSA 2V6NA 2VWLA 5C5OA 4D9RA 1O2VA 1YWUA 1LKBA 1P3CA 1C1TA 4UFEH 1CU1A 2BLVA 2VIQA 3SNAA 1V2PT 1SI5H 2H5DA 3M36A 3TGJE 3E90B 1AQ7A 1AVGH 2OUAA 5JBBS 2ZHFH 3HATH 4F4OC 3PLPA 1L2EA 2V0BA 1GI2A 3DSOA 1A61H 1FY8E 1BB0B 2W7UA 4NFEA 3UUZA 1DS2E 3GICB 4IN2A 2UUJB 2J92A 1O2RA 1HV7A 3WW7A 1A4WH 4O97A 3FP6E 3PTNA 3GCTF 2ODYB 1SGCA 4X0WU 2ASUB 4B75A 2XCFA 3M7UA 1NRSH 2BY6X 3GCHB 4NA7A 4NZLA 1S85A 3LGTA 2KM0A 3UFAA 3FAOA 3STJA 4U2WA 1O3FA 5HM2A 1O5GH 5GJ4B 2A31A 1O3HA 4B2BA 1XUJA 1TNGA 1OWDA 3ZZ3A 3QUMP 2AIPA 3K6ZA 6CHAC 3ZVAA 3SI4H 1H8IH 2QF5A 2OBOA 3F0OA 6CHAB 1L1NA 2J2UA 2YMSB 1G36A 2R0KA 3C1KA 1FZZA 5FPTA 5F03A 2P8OC 2PGQB 2PP6A 2P16A 2ZU2A 4RKOB 4KELA 1A0HB 3RMOH 2HLDD 3OAAD 1O2HA 3RXAA 3BTEE 3UAIC 3UR9A 1QL7A 1MBQA 1NY22 3FP7E 1TLDA 5LPRA 4K60A 4ABGA 3F9EA 3N99A 1LPGB 4CBNA 4WMFA 2OK5A 4GLYA 2CF9H 2GCTC 3LGIA 1BOQA 2ANYA 3FZZA 2JH0D 3E91A 2FI5E 1MQ6A 5EJ1A 4DY7B 1E79D 2OQUA 3TIUA 3MO9A 2Z9KA 2XC4A 1G30B 4JYUH 1GDUA 1V3XA 1BDAA 1UK3A 3NCLA 1O2JA 3D65E 4CRBA 1P2NA 2BY9X 3SN8A 1XUKA 2W6ID 5TCAA 2FS9A 1IOEA 2JETC 2BVSH 3P92A 4YOGA 1NN6A 2BOHB 4TWYA 5B6LA 1NROH 3GOVB 2STBE 2NWNA 1Y3WA 1G32B 1TYNA 1UTQA 1HFDA 1SGYE 2C8XB 4I8HA 1VJ9U 2H9EH 2IN2A 3MH5A 2BYAX 1MU6B 1P03A 3AW1A 2AGGX 1NPMA 3RXCA 4CH8B 5TCCA 4KTUA 2WV9A 1IQGA 1KSNA 3GY6A 2FPZA 3HKJB 3OFND 3P17H 3EE0B 1NRNH 8ESTE 3FZDA 3H5CB 1GBDA 1HAOH 1TAWA 4GAWA 2ZPQA 4WH8A 3PMAB 1BJVA 2OC7A 2G5VA 3T29A 5LPEA 1BBRK 5EW1H 1ELBA 1O3MA 4LZ1H 1GJ5H 1AUJA 2OINA 4NCYA 2A2QH 1TE0A 1P57B 2ZA5A 1RIWB 5A2MH 1VR1H 1QJ6B 3VEQB 1UTNA 4GSOA 2ZECA 3O8DA 2K0QA 2QXHA 1UK4A 3MH4A 1DWBH 4HI3A 5GCHG 8KME2 1ZTKA 1RIWC 1C5MD 2G81E 3HK3B 2ZQ1A 3FN8A 4FETA 4ZHMU 2K1QA 2VBCA 2WINI 1YPKH 2CXVA 2QY0B 1GBEA 1SC8U 1C5PA 1FQ3A 3TNTA 2A7HA 4NZQA 2Z3EA 1VCQA 2Y6TA 1O5AB 2H1UA 3A89A 4ACBA 4AB9A 1QTFA 3F2FA 5C3NA 9LPRA 3SUDA 2F9PA 3DT0H 4X2XA 2WV4A 5F8XA 2G52A 4MTBA 1UW7A 1HIAA 2A5IA 3MNBA 1CT4E 1BRUP 1T8NA 5HGGA 3S69A 1RTKA 4OS4A 3RXMA 1C5TA 3W95A 1KTSB 5CMXH 4YT7H 2ZCKP 1HPGA 1TGSZ 3RXHA 1FONA 3TITA 4INLA 1KXEA 3AAUA 1LQEA 2IJD1 1QHRB 1VZQH 2W3IA 3EAJA 3KIDU 3SJIA 1TGBA 2Y80A 3SJOA 4CHAB 2ZFRH 5C0UA 2ZDLA 1Z7KA 3RXIA 1QRWA 2B9LA 5E8EH 1AU8A 3NWUA 1LDTT 3BTME 1AKSA 3JZ1B 3PRBA 1D3PB 3OE7D 3OEED 1SGFG 4KP0A 2BD3A 3A8BA 3BEIB 1ETSH 2WSSD 1QQUA 1MH0A 3EA8A 1KXDA 1EJNA 3SU4A 2TRMA 2F9BH 2BDAA 4IN1A 3UNRA 2R3UA 1KLIH 3WY8A 3LC3A 4A5TS 1FUJA 4D8NA 1OP2A 5FX5A 3SGBE 4YESB 1K22H 3MNCA 1BCUH 2FTLE 2H6MA 3G01A 1LQDB 4KTCA 4ABBA 4D9QA 4E06H 3ZVFA 3TGKE 2BD9A 2J94A 1C1VH 3FOAA 1O31A 2ZDNA 2W6JD 4NSVA 3MU5A 4CRFA 3BG4C 1AIXH 1O5EH 1OWIA 1K1PA 1OWEA 3BTTE 1BRCE 1P04A 2TPIZ 2WPKS 1E36B 1QB6A 1RGQA 5GCHF 2BY8X 2ZO3H 4YTAA 1YF4A 1TQ7B 4B6EA 1WXRA 3MTYA 3M3TA 1VGCC 3GY3A 1GBFA 3KYGA 2QF3A 1S6LA 3TPIZ 5L30H 1SKYE 2QXGA 1O38A 2O8TA 5FCKA 1YGCH 2BD8A 1MD8A 3SUFA 1O3OA 2ODPA 3SNDA 1BBRH 1M9UA 1W12U 1UVSH 5EPYA 4H42U 1EAXA 4OM9A 2ALPA 1H9IE 2BM2A 5EW2H 1TONA 4FVDA 2GV6A 4MPVA 1QA0A 1O30A 2F9UA 3PWCA 1MAXA 1MAYA 1BTWA 5JBAS 2BQWB 1W14U 4K2YA 2QXJA 3RMMH 1CA0B 3H7OA 1EZQA 4X6PA 4AX9H 1JIMA 2CHAB 2VWMA 3QDZB 4FU9A 5KGOA 1BHXF 4M9FA 5H4IB 1JIRA 1FN8A 5HM9A 5EGMA 4DG4A 1GJDB 1GJAB 1K1NA 3W1EA 1O3IA 1P12E 1BRAA 4BNRA 2F91A 4JK5A 1W0ZU 3SGQE 5EXNA 3UOUA 3U98H 1O2MA 4F49A 3U8TH 1TRYA 1MMJN 1TA6A 1FY1A 1TPAE 2FOFA 1WTGH 2A45B 3LGUA 3SHAH 4AG2A 5GNDA 2W7SA 1IQLA 1FX0B 4OS7A 2J95A 4NIVA 1WBGB 4NFFA 4IGDA 1NZQH 2THFB 5FXLA 2BZ6H 1GJCB 1ZRKA 3C27B 1FV9A 3NKKA 3T28A 1ZJKA 4XBBA 1QY6A 2BZAA 3T5FH 3MHWU 2ZGBH 1NRPH 1VITF 3PV2A 4HZHA 2ALVA 2QAAA 3LKWA 1PPGE 1TMTH 1S84A 1O0DH 1Y3XA 3V12A 1PQ7A 1O32A 4YLUA 4CH2B 1O3EA 1WTHD 3SUGA 4FVBA 3M3VA 1PQ5A 1FN6A 1PPFE 5ABWA 1YPJH 4X2WA 3SU5A 1FPCH 4Y11E 1SGQE 3RU4T 1C4Y2 4HTCH 2BDGA 2HNTC 2ZGCA 4RKJB 5FPSA 3UNSA 1C2DA 2ZG0H 3VG8A 4NIXA 5EJLA 4RI0A 1EP6A 1QB9A 2LPRA 3RXUA 1MTWA 3GY5A 3GCTG 4VGCC 4I33A 4ISHH 1ZSKA 4X1PU 5A0AE 1Z1IA 1L1GA 1QIXB 1A1RA 3A7TA 5EQQA 1GVLA 1FY5A 3PV5A 1MCTA 2SGQE 1CT0E 2BX3A 2SFAA 4LK4A 1G3EA 2FI4E 4NWLA 1P01A 3KL6A 4I31A 4ZXYH 1GG6B 1MKXH 5AFYH 1O3JA 1INCA 1SR5C 3QN7A 3A8AA 4OS6A 1A5HA 2ZF0H 4BTTB 1C1SA 1YPEH 1OOKB 1ANDA 1L0ZA 2SGAA 1DSUA 2R0LA 4DW2U 5C20A 3Q76A 5FX6A 3BG8A 1AO5A 1SFQB 2XCNA 2ZCLP 5A0BA 3NPSA 1UVOA 2C90B 2KAIA 5BRRE 3QLPH 3B8JA 2QN5T 3PLKA 1HAPH 1CGIE 1IQHA 3QZRA 2AERH 5L2YH 1D6RA 3BIVH 4FUIA 3SQHE 3U1JB 1Y59T 3VGCB 2OC1A 5DG6A 1BT7A 1GJ7B 2PW8H 1GHAF 4MG3A 2IPQX 3RXKA 4FUGA 4A6LA 2TGTA 3V0XA 4LOYH 1VCWA 1ZTJA 1ELVA 2QCYA 1XMNB 5AHGH 2ZHQH 1S82A 4AZ2B 2HRVA 3Q77A 2OC8A 2PFEA 3F6UH 4CRAA 4MNVA 1TBRH 1SLWB 5C1YA 1Z8JB 2P93A 3B23B 3ZZ4A 2GDDA 2HNTF 3A7XA 2CN0H 2HGTH 1LPKB 4K1EA 3Q3KA 2FYQA 2Y5GA 4CR9A 5I25A 3OEHD 1ZHRA 2Z6BD 1YPHE 2XTTB 1GMCF 1FXYA 5L2ZH 1TOCB 2O8WA 4OS5A 1BMFD 2A4GA 2O8LA 4Q7XA 3SNCA 4BXWA 4NIWA 4P02A 4BTUB 1P3EA 1ANEA 2FLBH 1D4PB 1NFXA 2GD4B 4ASUD 1DUAA 3MYWA 3PM3A 1P11E 1CGHA 1TBZH 1O2LA 3A80A 5HKKD 4DGJA 2JIZD 3JZ2B 4KTSA 1LVOA 4GUXA 4WWYA 4OGYA 4LXBH 4NGAH 3BTHE 1F92A 4BAMB 5ESTE 3ZYDA 2PSXA 3UWJH 2AFQB 2C8ZB 3LIWA 1Z8GA 2ZGXH 3EGKH 5A09A 3DUXH 4Y8ZA 4FUHA 3ZZAA 2RDEA 3SV8A 1Q3XA 2Z9JA 3BN9A 3UY9A 1OYQA 3PRDA 4BAOB 2SNWA 2ZP0H 2AHME 4JCNA 1KLTA 1C2KA 4TPIZ 2YNAA 3R0FA 3LDXH 5EOKA 1NC6A 2Z3DA 1O3PB 1NO9H 4JZFH 3SI3H 1QJ7B 3TJUA 1ZR0A 1N1LA 1C5YB 2UWOA 1ETTH 1QURH 1UHBB 2Y7ZA 1QNJA 6ESTA 1C5SA 2PKSC 2ZFFH 3K2UA 2EI7A 1EQ9A 1GI7B 1T32A 2GT7A 1TB6H 3GY2A 2CJIA 1SPJA 1UTKA 2Z7FE 1C9TA 1SLUB 1EPTA 1S81A 3PMHB 3S0NA 4DCDA 4F48B 1TALA 1KY9A 1B5GH 1TGCA 4JYVH 5CHBA 1G2MA 5FBIA 3MO3A 1ZGIA 1EJAA 1VITG 1UTMA 2VIVA 4LZ4B 1Y3UA 5A8XA 1MBMA 4E05H 1NFYA 2PWXA 4E7NA 1N6XA 1W7GH 1GCDA 1HAVA 4Z0KA 1TIOA 7GCHG 3QGJA 1SGFA 1TRMA 3DSPA 3GCHC 3NUMA 1DT2A 4K3JA 1S0RA 2CK3D 3LJJA 8GCHG 5A0CA 5SGAE 4U01A 3MOCA 1LCYA 2D26C 1N8OC 3N7DA 1PQ8A 3O8RA 4K5ZA 4Y7AA 3F3BA 2VVUA 2ZU3A 5DJ7A 2H2ZA 3T2NA 1V2MT 3ENSB 3AVZA 3DCLA 2ZPSA 3A83A 3H7TA 2Y5FA 2OQ5A 4YT6H 2XW9A 5C1UA 5JB8S 4UEHH 1DWDH 2C8YB 2J97A 4UFDH 2I6QA 1TX7A 1TNIA 2H9HA 2A2XH 1C2IA 2TGPZ 1A0LA 3OSYA 2ZDMA 4JZEH 1CGJE 1GMHF 4XBDA 2Y5HA 1V2VT 3U8OH 1O2OA 1GHXH 1UVPA 2Z9LA 1GHZA 3CP7A 2BD4A 2OD3B 1KXBA 2WPMS 1GI1A 4WY3A 1W3CA 2F83A 1A46H 1UTOA 2ZU4A 4IBLH 1Y5AT 3SNBA 1QGFA 3PO1C 5DGJA 2VGCB 1UCYK 3EE7A 1O2PA 3TH4H 4A1XA 1EB1H 1SGTA 3SBKA 1WQVH 3BTKE 3ZZ9A 3A7YA 1NU7B 1P0SH 1GJ4H 1XVOA 1F5KU 1YCPK 2SGEE 3UREA 5T6GA 1AD8H 2ZKSA 1U6QA 3GDSA 2L74A 2V35A 1W0YH 2IPHA 1ORFA 4FU8A 2VJ1A 1C5XB 5DN6D 2W26A 5BPEA 4ESTE 2FOMB 3FANA 1D6WA 3K9XB 2GMTC 4A92A 4UE7H 2BDHA 2BQ7B 5EJZA 2B8OH 4X8SH 3RXRA 1Y5BT 1KMHB 3A86A 2JDID 1HAZB 3MH6A 4TSFD 4ZAEA 3PLBA 1DE7H 1ELDE 1DANH 3DA9B 3SU3A 3RXVA 1FIWA 4A7IB 3KYFA 3SQEE 1W0KD 4K69A 1NS3A 2OP9A 1CHGA 3A88A 1DPOA 4DIIH 3F2HA 1KXFA 3ZZ5A 2BY7X 1GJ6A 1F0UA 4I32A 3GS9A 3ATIA 2NU3E 4X1SU 1GL0E 1TA2A 3CNRA 2G4TA 2KAIB 2VIOA 1QRXA 3SV6A 2ZCHP 2ZI2H 4JZDH 5FHTA 2O8MA 3BTWE 5DP4A 1C5NH 4P00A 1TPPA 2SGDE 2QYIA 1BTXA 3TLOA 1QL9A 1ETRH 1KTTB 1OP8A 1V2TT 4WMDA 2ZEBA 1EUFA 3SV9A 4GHQA 2B7DH 2BVRH 5F53A 1EPTB 1T7CA 1ZOMA 1AFQC 3U69H 1CE5A 3F9GA 1W11U 2CMYA 5E0HA 1YBWA 1MTSA 2J98A 1IQJA 1MUEB 3RXTA 4GHTA 3PTBA 3SZEA 3FVFB 2V3HH 2PTNA 4D7FA 1ABIH 1C1RA 2FWWA 2VVCA 2WPIS 1A0JA 2PKAA 1H9HE 1ZMLA 2BDIA 3ATKA 2PKAB 4NSYA 4ZHLU 3U8RH 3QX5H 2J38A 3KF2A 1CA0C 1WU1A 4K8BA 3VB5A 5KECA 3RU4E 1GCTB 2FX4A 3URCA 3OTJE 5DP3A 3VPKA 1KDQA 4QT8C 5DKMA 3DHKH 1KDQB 3STIA 2G5NA 3RC6A 3KQCA 1TRNA 1SHYA 1E0FD 2ZHDA 2J5UA 2EI6A 1JRTA 4X1RU 2F9VA 2G00A 1CT2E 3TGIE 4BAKB 5C0TA 5IK2D 3SJ9A 1J15A 4XOJA 1ZHPA 1RXPA 4A1VA 3SUEA 3GDVA 1Z71A 2JH5D 1ZJDA 2AGEX 2GZ7A 1P2IA 1DLEA 2BY5X 4X1QU 4XBCA 3BSQA 3ZZ7A 2FM2A 1G9IE 2KCOA 1QFKH 4AORA 1AFQB 4BAHB 4Z1MD 1S6FA 1SFIA 3ELAH 2GVFA 1Z6EA 3URDA 5DO4H 2TGAA 3GY7A 1DX5M 3LGVA 3RXOA 2P95A 3HK6B 1Z8RA 1AB9C 1MTNB 1O2ZA 3O8BA 2GMTB 2P59A 5EQSA 3BV9B 1SQAA 1ELAA 3P8NA 4B6FA 1C2FA 1O3BA 4GVUA 1C2JA 3ZYEA 2ZDVH 3A84A 1BMAA 1DWEH 2ANMH 1AB9B 1VGCB 3RXPA 3LGYA 1HJ8A 1HB0B 3ESTA 2AS9A 4FUEA 4NA9H 1O36A 1OPHB 4Y0YE 3CENA 2O9QA 2TGDA 3MU0A 2OC0A 2QF4A 2EC9H 5GIBA 2HPQH 3I77A 1H1BA 2AGIX 2FS8A 1LHCH 1MCVA 1C2GA 1KIGH 1WV7H 3BF6H 5FPYA 3MNXA 1O3KA 1W10U 3V13A 4CHAC 3RXLA 1O3LA 1QR3E 2HPPH 1PJPA 2DE9A 3ZZ8A 1F5RA 1EZSC 1WSSH 1ZHMA 5E0GA 2EY4C 3AASA 4U32A 2G51A 2SGFE 4UFFH 4TYDA 4AC9A 1HCGA 1W0JD 1O2NA 1P9SA 1QQ4A 1EAIA 3Q3XA 1EAWA 1SLVB 4WMEA 1NFWA 3E6PH 1HXFH 4JMYA 2VIDA 5GPIB 3ZZBA 1Y3VA 1GCTC 1CHOG 1HDTH 1HIAB 2G8TA 2I6SA 1TOMH 1C5QA 1UHBA 2H5CA 3NZIA 3GCNA 4OGXA 2RFKC 1ZSLA 4WF8A 4HG6A 2G4UA 2R2WU 2Z9IA 5ETXA 5AF9H 4X6OA 3KCGH 4SGAE 2OBQA 2PUQH 1T31A 4DIHH 1NESE 2WPLS 2WZQA 1MTVA 2XBWA 1QL8A 2SGPE 4AG1A 1PPBH 2BDBA 2SNVA 1Z1JA 2BTCE 4ABAA 3BTGE 2RDLA 3LH1A 3S7HB 4B71A 1DY9A 9ESTA 2AMPA 1HAYB 4ISNA 2QV1A 1SGRE 1W2KH 2WV5A 2KFWA 4MLFB 2FLRH 3E3TA 1H8DH 1V2LT 1GBKA 1A3EH 1MQ5A 1N6YA 2QGRA 1GBAA 3M5MA 3OX7U 3MI4A 1E34B 3FP8E 3ZIAD 3E1XB 2ZZUH 1WYKA 4Q80A 4H4FA 1BQYA 4MNXA 5ESBA 2Q6GA 4AFZA 2KZ4A 2A7JA 5EQRA 1GBJA 3E0PB 2D8WA 3A81A 2A5AA 1YPLH 1S0QA 5C94A 2OCVB 4Q7ZA 1P8VC 4AGJA 1RTLA 2HWLB 1WQSA 3A82A 1O2UA 3SU2A 1QJ1B 2GTBA 1HBTH 4XD7D 4NWKA 3ZVGA 1FPHH 1QBOA 3DFJA 1ESAA 1CBWC 1HJAC 1YLDA 2BLQA 3ZVEA 3MU8A 4FU7A 1HGTH 1CQQA 4ZKSU 3M35A 4WJG2 1IQIA 1SGIB 1HNEE 1AI8H 1XKBC 1NTPA 2ZQ2A 4Y79A 1SQOA 4D76A 3OTPA 1THRH 1GHVH 3SV7A 4XRNA 1FI8A 3GDUA 4UD9H 2ODQA 4KGAA 4WH6A 4O3TA 1V2JT 1IHSH 3QTOH 2ZDKA 2PTCE 2TIOA 3UPEA 4R0IA 3SO3A 3A8DA 2Z94A 2VH0A 1GI4A 4AN7A 4M7GA 1OHHD 1EXFA 2HLCA 6GCHF 4D7GA 1G3BA 1B7XB 1K1LA 2FOCA 4B1TA 1HJ9A 2UWLA 1G37A 1ZPZA 5JB9S 1PQAA 3KQEA 1GHBG 1NBMD 2EA3A 3SV2H 2YMSD 5GWZA 1MZAA 1EFRD 5T6DA 4B2CA 5C17A 2BD7A 1CHOF 1O3GA 3ODDA 1V2QT 5GDSH 2C8WB 1NFUA 2KCPA 2F3CE 1C5RA 1OXGA 4AFSA 1QRZA 3VXFH 1O5CB 1EJMA 1YLNA 1GVZA 5DPAA 1BZXE 1GBTA 2ZDAH 2RG3A 4ABDA 2CF8H 2BOKA 3RLWH 2A7CA 1SGPE 2OXSA 1EOLA 1NT1A 1UTJA 2QE7D 3SNEA 1GMDG 2ZWLH 3LPRA 3S7KB 3M7QA 5GXPA 2C4FH 1FAKH 1UK2A 1C2EA 1O2QA 1QCPA 2FTMA 5EU8A 3WWBA 1MKWH 3KQBA 1BMMH 1ZMJA 3EA9A 4U30A 4RSPA 3VGCC 1S83A 3EYDA 2PKSB 3L33A 5L6NH 1GHYH 1ESBA
chains in the Genus database with same CATH topology
3M5NA 4Y71A 4BTIB 1A2CH 1GMCG 4IC5A 1GWAA 1ZPCA 1LO6A 2CGAA 4ISLA 1C1MA 1O2WA 3TU7H 4A1TA 1A5IA 3K65B 1SBWA 4UONA 1EP5A 4NIYA 1RRKA 1AY6H 2FIRH 1GBIA 2FZZA 4I8KA 4I8GA 2ZFQH 3TNSA 5C1XA 2EI8A 2AYWA 4X1NU 4J2YB 1J9CH 1OKXA 1JMOH 1LKAA 4JZIA 2PR3A 4X8TH 5B6OA 5DP5A 1ELFA 2PGBB 1IQKA 3UOPA 2PLXA 4Q2KA 1K2I1 1H4WA 1LVYA 3UQOA 2BXTH 2H9TH 1AFEH 1ZSJA 1NU9A 1ESTA 2WYGA 4JYTA 1P2QA 1K21H 1P2KA 1E35B 1O2TA 2P3TB 2WYJA 2XBVA 1P09A 2XBYA 5F8ZA 2DUCA 1K1IA 4NA8A 1GVKB 4MDSA 2ILNA 3I29A 1F0RA 3VB4A 1W13U 3QWCH 1ELCA 4O9VA 1TNKA 2VIPA 3EDXB 1O3CA 2R2MB 1JOUB 2AIQA 4ABHA 1GI6A 5JBCS 2V3OH 4YO9A 1J16A 1GMHG 4IS5A 2FDAA 1BIOA 2ZHWH 3RM0H 3LU9B 1LTOA 1SHHB 5A8YA 3LOXA 2P3FH 4OS2A 1BBRE 3D49H 1V2WT 2B0FA 1BA8B 5DP6A 1TBQH 1MKWK 3IITA 3B9FH 1PPEE 1EATA 5I46H 3BG4B 4ZXXH 2NU2E 1GBHA 3RM2H 2XNIA 1TFXA 1V2UT 1SGNE 1K1OA 1YPHC 4GPGA 1G3DA 1SSXA 3HGPA 3GISB 1HYLA 2WPJS 1LPZB 4H6SB 1XUIA 2XBXA 4Y10E 1DXWA 8LPRA 1LHEH 2NU1E 2ESTE 4XE4A 1W8BH 1RTFB 1P2MA 1BHXB 1O37A 2IOTA 3RXJA 5HXFA 3T62A 2ZTYA 2QC2A 4Q7YA 1SOZA 2Y7XA 3S9AA 3UTUH 4Y6DA 3LT3A 3D23A 1P05A 1OYTH 2A1DB 1O3AA 1UMAH 2VINA 1ZTLA 3F9FA 1HLTH 3L6PA 3MWIU 2VGCC 2ZU1A 4B73A 5DP7A 1HAHH 3RXFA 2FEQH 1NRRH 1FY3A 3SU1A 8GCHF 2Z9GA 1BITA 1A7SA 2M5TA 4BANB 1GBCA 2XXLA 5C67A 1O2IA 1UO6A 3M7TA 3UQVA 1ELEE 2RA3A 1OWKA 1C1UH 5J4SA 1XUFA 5A8ZA 3NK8A 3W94A 1S5SA 2LNCA 1IQNA 1QBNA 1E37B 4MPWA 4AB8A 2P3UB 5AFZH 2GGVB 1GBBA 2OLGA 3TVJB 1GJ8B 1O34A 3UIRA 1DM4B 1GHBF 2BLWA 2GV7A 1O3DA 4IMQA 2GCHF 4THNH 3HPTB 4XFQA 4FUFA 2ZPRA 3KNXA 1HUTH 3SORA 1YPGH 1PYTD 2ZGHA 1UCYH 4JZ1A 1YYY1 1XXFA 3RC4A 1OWHA 1ID5H 4OS1A 1P02A 3RU4D 4IMZA 2VB0A 1XUGA 4ABFA 1AVXA 5E0JA 1X7AC 4YOIA 3S9CA 4WXVA 4Y8YA 2BD5A 1SGDE 4ABJA 4FUBA 1MD7A 1O2SA 5LGOA 3RC5A 1L4DA 3A85A 4J1YA 1K9OE 4BAQB 3LH3A 4K8YA 4Y76A 2GDEH 1T8OA 1FIZA 4AYYB 3QO6A 1YC0A 3O8CA 1K28D 1IQFA 1WOFA 3OY6U 3RXGA 2XC5A 3LC5A 4I7YH 2HALA 3PV4A 4NG9H 3RLYH 1AZ8A 1KYNA 1QBVH 4ZH8A 1GBMA 2R9PA 5LH8A 2UUKB 1C2HA 1K1JA 5CHAC 1WAYB 3P8GA 2ANWA 3SU6A 3KQDA 3A7WA 1SL3A 1AE8H 1GMDF 1V2ST 3M37A 3PO1B 3SOSA 1ARCA 3T26A 1ZPBA 2FODA 1O5FH 1KLJH 1YPMH 2AMDA 1H9LB 1QB1A 1FDPA 1PYTC 1UCYE 2ZFTA 2BD2A 2BDYA 2D2DA 1C2MA 3PB1E 2A4QA 1F2SE 2Q6DA 4FUDA 4HFPB 4INKA 3NXPA 2R3YA 1S6HA 1IQMA 2VIWA 3QZQA 3A8CA 1D9IA 1MZDA 4GCHF 4E7RG 1J8AA 1AWFH 2ZHEH 1ARBA 1Q2WA 6GCHG 2FOBA 2IJOB 4Y8XA 1TX8A 1T8LA 3VB6A 3SHCH 1OS8A 1C1NA 1L4ZA 3EQ0H 1P2OA 1CVWH 1CA8B 1C5VA 3D62A 2NU0E 3RXEA 4BOHA 1YLCA 3E16B 2STAE 1N8OB 1EASA 2CHAC 3RXSA 3LJOA 1OX1A 2GZ8A 2A32A 5K0HA 2Q1JA 3BEFB 2UUFB 3BIUH 5JYIA 1DUEA 2HNTE 4ZKRU 7LPRA 2PHBA 1OSSA 1YP9A 2BQ6B 2ZFPH 5G4BA 1TNJA 2P8OB 2UWPA 1HAGE 4ASHA 1ZMNA 1AVWA 1CSOE 2QA9E 2VU8E 1TNHA 2ZU5A 3Q3YA 2OTVA 5F8TA 4INHA 3TJOA 5IYTA 1C9PA 4CRCA 1JXPA 4YZUA 1D3DB 1RS0A 4ZKNU 2ZNKH 1O5DH 2AEIH 3P6ZB 1T8MA 1DWCH 2AMQA 1HRTH 1BRBE 4UDWH 3CS7A 2PUXB 1THPB 3MH7A 2QIQA 1BTUA 2ZTXA 1ZYOA 3ZVBA 3ATLA 2UUYA 5EG4A 1B0FA 1UTPA 1LVMA 3L3TA 1AKSB 1DY8A 1C1WH 1DFPA 1EOJA 1G2LA 3ATWA 2ZC9H 1BTPA 1ELTA 3ATMA 4MNYA 3OY5U 4JK6A 3GY4A 4K1TA 1GHAG 4AYVB 3VB7A 4K1SA 1WCZA 3OYPA 2B5TB 1TPSA 4DJZB 1ZZZA 1Y5UT 1C5WB 4BXSA 1RFNA 3QTVH 1SB1H 1L1JA 1C4U2 1SG8B 2BDCA 2VVVA 3GCOA 3RMNH 3M61U 3TH3H 1O35A 1F0TA 1GJ9B 2FESH 5C2ZA 1GG6C 5HYOA 3MNSA 2JETB 1EX3A 1UTLM 3DFLA 2PSYA 1BMNH 1TABE 1ANBA 2BHGA 1SQTA 1A5GH 1DDJA 1F7ZA 3HGNA 1UJ1A 3IWMA 3F9HA 1AWHB 4VGCB 4ABIA 1IQEA 1LHFH 4I8LA 1AHTH 1DSTA 4AOQA 3F68H 1C5UA 3VB3A 1ELGA 1Z8IB 5LPFA 3IG6B 1CO7E 2Y82A 2Z3CA 4DVAU 1RJXB 1YCPH 3KEEA 1PPHE 4DT7B 1C5OH 2J4IA 5IDKA 4H6TA 1J14A 3E8LA 1EZUC 3RP2A 1XX9A 1V2KT 1FY4A 5AVDA 1XUHA 3BTFE 2W5EA 1CBWB 1HJAB 3MMGA 5JPMH 2QXIA 1GPZA 1D3TB 1ZLRA 1MKXK 4AFQA 3K6YA 2P94A 1MU8B 3ZVDA 1JBUH 1O3NA 1GDNA 2YOLA 2WPHS 1D3QB 3E0NB 3A87A 1AUTC 3ZZCA 4AFUA 1O39A 1P10A 2BB4A 2F9NA 2C3SA 3CS0A 3P95A 3S9BA 3FFGA 2FO9A 2Y81A 3MU1A 5FBEA 1T4UH 4WVPE 2A0QB 1BTZA 2C93B 2RCEA 1O2YA 3VFEA 5FCRA 4AGKA 2WUCA 1DVAH 2XRCA 5DK1A 2EEKA 4X6MA 4IC6A 3SJ8A 5DP9A 1FJSA 1TNLA 4IW4E 5FAHA 1FMGA 1UVUH 1O2KA 3EA7A 5JDUB 5C5NA 5F6MA 3UNQA 1XVMA 2FI3E 2GCHG 1FLEE 2GKVE 3RDZA 5JBTA 2VWNA 3PMBB 3M5LA 1XXDA 1TGTA 4CRDA 1KXAA 3I78A 4Y7BA 2CV3A 4ZUHA 2FXRA 1NRQH 2FMJA 4O03A 1V2RT 1DICA 2FP7B 3GY8A 7GCHF 3BEUA 1C2LA 2G55A 2DE8A 3VXEH 3AW0A 4ISIH 3T25A 1ANCA 2JH6D 2JKHA 2HVXA 1C5ZB 1YKTA 1TMBH 2VH6A 2FX6A 5J4QA 3V7TA 4KKDA 1F5LA 1TX6A 4X6NA 1O33A 4FUJA 2J34A 3HKIB 3F1SB 1Y3YA 5DP8A 1THSH 3QGNB 4YLQH 4B76A 4MQAA 6LPRA 2XYAA 3SGAE 3P70B 1GI3A 1BMLA 1OP0A 2ZFSA 4TPYA 4YOJA 4X8UH 1V6DA 1P06A 3R3GB 1SOTA 1TQ0B 3ZZ6A 3LGWA 3AAVA 1VITH 1C1OA 3ZVCA 1O5BB 1VCPA 5EXLA 4O3UA 3TJNA 2GCTB 2XWBI 3RXBA 5CE1A 2A4OA 3ODFA 1GGDB 1WUNH 2BXUH 3DD2H 1AMHA 2HOBA 1HAVB 1A3BH 1KXCA 3GYMA 3PMJA 1O2GH 1JWTA 3SJKA 4B2AA 2XC0A 3BTDE 1GHWH 2J9NA 1BTYA 5CHAB 4GCHG 1C1PA 7KMEH 1DXPA 5K7RA 1SGEE 2GX4A 1XM1A 2WUBA 2VNTA 1FNIA 3N7OA 4ABEA 4TWWA 2FOAA 3T27A 1C4V2 3OU0A 1BTHH 2YNBA 1MTNC 2A5KA 1Y8TA 2PV9B 1IHTH 1XKAC 1V2OT 3PYHA 1C1QA 1GBLA 2FOGA 2RA0A 4DOQA 3P8FA 2A4RA 4CRGA 1GI9B 1Q31A 4RN6A 1ZRBA 3RXDA 4ZHAA 3P8OA 4X2VA 1PPZA 4R8TB 3M3SA 2XWAA 1DITH 4TY6A 3MO6A 1GI0A 2GT8A 3ZV8A 3KGPA 2ZIQH 1IAUA 1P2JA 1TWXB 2BLOA 3A7VA 4CREA 2GZ9A 1K1MA 1J17T 4ZMAH 3ITIA 3PWBA 3U9AH 2AH4X 1V2NT 1PFXC 4WXIA 3V3MA 3LONA 1AGJA 3SZNA 1LHDH 3ZZDA 1Z6JH 1NM6A 1BUIA 1AE5A 1TPOA 4DURA 1FAXA 4PROA 1HAIH 3GYLB 4X8VH 1LVBA 1W7XH 3Q00A 4Z6AH 4FXGH 1LMWB 4ZROA 2F9OA 3TK5A 1HXEH 1UVTH 4UFGH 4ZKOU 4MNWA 4MPUA 3M5OA 4TY7A 3MU4A 1B0EA 2FOEA 4XSKU 1YCPM 1EKBB 1VJAU 1G3CA 1BJUA 5E2OA 5EXMA 5T6FA 2TBSA 3RUOA 5HMAA 4YM9A 5T3HA 1LHGH 2ULLA 1MTUA 1ZGVA 3KHVA 4CR5A 3KN2A 3ZV9A 3BTQE 1GI8B 1AN1E 1ABJH 3TJVA 5E2PA 3TK6A 2BX4A 2QF0A 2BVXH 3RMLH 1DLKB 1RD3B 1EPTC 3QK1A 4X2YA 5TJXA 1EB2A 1C5LH 2ZTZA 1ACBE 1HAXB 2W3KA 1SLXB 3MFJA 1GDQA 3UWIA 3UR6A 2Q6FA 1P9UA 4FUCA 2GP9B 1GI5A 1QA7A 5PTPA 2FOHA 4CBOA 4Y0ZE 4ISOA 4XDEA 1EZXC 1TGNA 2NU4E 7ESTE 2ANKH 1GGDC 4I8JA 1GJBB 4MPXA 1OWJA 2O8UA 3TK9A 1AZZA 5EPNA 1EAUA 4B74A 3PROA 2VWOA 3A7ZA 1TMUH 1F0SA 1E38B 1DOJA 1T4VH 3TH2H 1YM0A 2ZGJA 3U1IB 1PPCE 1O2XA 4HGCA 2D1JA 4MVNA 5EODA 3SU0A 3RXQA 1GL1A 3SW2B 2FYRA 2BMGB 1SMFE 4SGBE 1SVPA 1JRSA 2V6NA 2VWLA 5C5OA 4D9RA 1O2VA 1LKBA 1P3CA 1C1TA 4UFEH 1CU1A 2BLVA 2VIQA 3SNAA 1V2PT 1SI5H 2H5DA 3M36A 3TGJE 3E90B 1AQ7A 1AVGH 2OUAA 5JBBS 2ZHFH 3HATH 4F4OC 3PLPA 1L2EA 2V0BA 1GI2A 1A61H 1FY8E 1BB0B 2W7UA 4NFEA 3UUZA 1DS2E 3GICB 4IN2A 2UUJB 2J92A 1O2RA 1HV7A 1A4WH 4O97A 3FP6E 3PTNA 3GCTF 2ODYB 1SGCA 4X0WU 2ASUB 4B75A 2XCFA 3M7UA 1NRSH 2BY6X 3GCHB 4NA7A 4NZLA 1S85A 3LGTA 3UFAA 3FAOA 3STJA 4U2WA 1O3FA 5HM2A 1O5GH 5GJ4B 2A31A 1O3HA 4B2BA 1XUJA 1TNGA 1OWDA 3ZZ3A 3QUMP 2AIPA 3K6ZA 6CHAC 3ZVAA 3SI4H 1H8IH 2OBOA 6CHAB 1L1NA 2J2UA 1G36A 2R0KA 3C1KA 1FZZA 5FPTA 5F03A 2P8OC 2PGQB 2P16A 2ZU2A 4RKOB 4KELA 1A0HB 3RMOH 1O2HA 3RXAA 3BTEE 3UR9A 1QL7A 1MBQA 1NY22 3FP7E 1TLDA 5LPRA 4K60A 4ABGA 3F9EA 1LPGB 4CBNA 4WMFA 4GLYA 2CF9H 2GCTC 3LGIA 1BOQA 2ANYA 3FZZA 2JH0D 3E91A 2FI5E 1MQ6A 4DY7B 2OQUA 3TIUA 3MO9A 2Z9KA 2XC4A 1G30B 4JYUH 1GDUA 1V3XA 1BDAA 1UK3A 3NCLA 1O2JA 3D65E 4CRBA 1P2NA 2BY9X 3SN8A 1XUKA 5TCAA 2FS9A 1IOEA 2JETC 2BVSH 3P92A 4YOGA 1NN6A 2BOHB 4TWYA 1NROH 3GOVB 2STBE 2NWNA 1Y3WA 1G32B 1TYNA 1UTQA 1HFDA 1SGYE 2C8XB 4I8HA 1VJ9U 2H9EH 2IN2A 3MH5A 2BYAX 1MU6B 1P03A 3AW1A 2AGGX 1NPMA 3RXCA 4CH8B 5TCCA 4KTUA 1IQGA 1KSNA 3GY6A 2FPZA 3HKJB 3P17H 3EE0B 1NRNH 8ESTE 3FZDA 3H5CB 1GBDA 1HAOH 1TAWA 4GAWA 2ZPQA 4WH8A 3PMAB 1BJVA 2OC7A 2G5VA 3T29A 5LPEA 1BBRK 5EW1H 1ELBA 1O3MA 4LZ1H 1GJ5H 1AUJA 2OINA 4NCYA 2A2QH 1TE0A 1P57B 2ZA5A 1RIWB 5A2MH 1VR1H 1QJ6B 3VEQB 1UTNA 4GSOA 2ZECA 3O8DA 2QXHA 1UK4A 3MH4A 1DWBH 4HI3A 5GCHG 8KME2 1ZTKA 1RIWC 1C5MD 2G81E 3HK3B 2ZQ1A 4ZHMU 2K1QA 2WINI 1YPKH 2CXVA 2QY0B 1GBEA 1SC8U 1C5PA 1FQ3A 3TNTA 2A7HA 4NZQA 2Z3EA 1VCQA 2Y6TA 1O5AB 2H1UA 3A89A 4AB9A 1QTFA 5C3NA 9LPRA 3SUDA 2F9PA 3DT0H 4X2XA