1EZUC

Ecotin y69f, d70p bound to d102n trypsin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords ECOTIN
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
total genus 52
structure length 223
sequence length 223
chains with identical sequence D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezuC01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezuC02
3ZZ5A 4X0WU 2TIOA 1DVAH 1BA8B 1TGCA 1D6RA 1DSTA 3UFAA 1O2LA 1HAPH 1OWKA 2H9EH 2QN5T 1MD7A 4CREA 1DS2E 1MQ6A 1QQUA 1SQTA 2FS9A 1Q31A 3VB6A 3BEFB 2D26C 1DOJA 2Q6FA 1JMOH 3SNDA 1IQIA 1JRSA 2LNCA 4NA8A 2ANMH 3V0XA 5CE1A 2OD3B 1BTHH 4U32A 3M7TA 3TJVA 4ZKOU 4INLA 2ZCHP 4E06H 2O9QA 3NXPA 3OYPA 3EA7A 4TWYA 1KTSB 1AE5A 2H1UA 1K1LA 4E7NA 1O5FH 1ZJKA 2O8WA 1CGIE 3SNAA 4AB9A 2XCNA 4O97A 5E2OA 1SGFA 2P3FH 3U9AH 4TY7A 2F9PA 2OCVB 3M3SA 5I46H 1SLUB 1AMHA 4RN6A 1ZMLA 2D8WA 3DFJA 1OKXA 1ANCA 2DE8A 2ANKH 3TH3H 1V2UT 4GCHF 2A7JA 1HIAB 3QZQA 1E0FD 5CHAB 3PLPA 1GBTA 1O34A 1C2EA 1DXWA 2AIQA 1FQ3A 3RC4A 1T32A 3MH5A 2ODYB 3A7ZA 1WQVH 1H4WA 3BG4B 7KMEH 3RXBA 1UO6A 4IMQA 3BIUH 1BTWA 1O3HA 3HKIB 3S9CA 1GBBA 1C2MA 3GY2A 3PMJA 4JYVH 3LGIA 4ZMAH 5FCKA 3UWIA 1KDQA 1EKBB 3AW0A 1N6YA 1G30B 5C67A 3C27B 1GBAA 5FPSA 1TAWA 4Y10E 3KL6A 4DJZB 3RXUA 2UUKB 1SG8B 2WUBA 5FCRA 2YNAA 3EGKH 1BJUA 1ZHRA 2ZO3H 6GCHG 2W5EA 3KNXA 3MYWA 2ZFPH 4AG1A 1ZYOA 1GWAA 1O2TA 3IG6B 4Y8YA 4YESB 3PROA 2G52A 4YOIA 2A2XH 4WH6A 3SU0A 1F5RA 2GCTC 3M7QA 1B0FA 5F03A 4FUCA 3ENSB 1O30A 5L30H 5T6DA 1O2HA 2GGVB 1O35A 2F9BH 3ELAH 2HWLB 1AO5A 1IQHA 2K1QA 3A85A 3T5FH 1IQFA 1O3AA 1SQOA 4NZLA 5ETXA 2CJIA 1LTOA 2R0LA 3T25A 1RGQA 1W0ZU 1E36B 1AKSA 1QQ4A 3BTWE 3RXDA 2QF0A 3ODFA 5DO4H 2XBWA 1BRBE 2PKSC 1A46H 2ZTXA 1EP6A 1GMHG 3GCHC 2A4GA 4O9VA 1PPZA 2HRVA 3BN9A 3MMGA 3U8OH 2GTBA 4AFSA 3LJJA 3GCTG 4DG4A 1A2CH 4I31A 1ANEA 3ZVDA 1C1VH 3ZYDA 4DOQA 3UNSA 1CHGA 1CQQA 1X7AC 3EYDA 3H7TA 2ZU4A 2OP9A 1SHHB 3RXJA 2FOHA 4XBDA 3A84A 3TJOA 3QDZB 1XUIA 1Y3WA 2NU3E 2OC0A 3UOUA 3FZDA 2Z3CA 1FN8A 4Q7YA 2ZGCA 1HAOH 3A82A 2G55A 5E2PA 1ETSH 2XXLA 2O8UA 1Z8IB 4AYYB 3RLYH 1HJAB 1NT1A 1OWDA 3SQHE 4IC5A 1ZSJA 1XUFA 1TOCB 2A5KA 2GCHF 3OX7U 3K65B 3BTEE 4Y7BA 3ODDA 4TPIZ 4YO9A 3F68H 1AFEH 1C2IA 2A0QB 2G51A 3SU1A 1GMDF 5GIBA 1W13U 5FHTA 4CHAC 1O2WA 2C8ZB 4K69A 4LK4A 3EA8A 4FUJA 1O2ZA 2QXIA 1AWHB 1WSSH 5JB8S 3T29A 1N6XA 5JBTA 1JOUB 3MU4A 1SFIA 5DKMA 3RXGA 2PWXA 1S5SA 1MZDA 2J4IA 1V2RT 1RD3B 1CA8B 2P93A 2F9UA 2Y7ZA 1K1MA 4AFZA 1WV7H 2GV6A 1GJBB 3VXEH 5IDKA 3SUEA 1TNLA 3ZVBA 2ODQA 4WWYA 3RXOA 2ZHEH 1D6WA 3GYMA 1C5MD 4X8UH 4MNYA 2RG3A 1DUEA 6GCHF 1V2QT 2BXUH 3FP8E 1BRAA 1TFXA 1IHTH 3ATKA 1TRMA 2BZ6H 2ZU3A 3MH6A 3QGJA 4TYDA 2RA0A 1MKXK 1TNKA 1ETRH 2XNIA 3ZZ9A 1D4PB 2VIOA 2HOBA 4BOHA 1V2WT 3I78A 1SI5H 1ELBA 1OS8A 3A8CA 1UJ1A 1V2OT 1MTUA 1O3CA 1VGCC 3RU4E 2GZ8A 1SLVB 1W14U 1O3KA 1GBJA 1C1QA 1RJXB 2PKAA 1GHAG 2ZU5A 1CA0B 4FVBA 1KLIH 2BDYA 2WPLS 5F8XA 2B5TB 3RXCA 3SUFA 1MQ5A 1KSNA 2VIQA 2ZFFH 3RXIA 4LZ4B 2PTNA 1KY9A 1W8BH 4K5ZA 1E37B 4Y8XA 1ELGA 3PO1C 3LGVA 1O2JA 3OU0A 2CV3A 1TYNA 1PQ7A 3AAVA 1QA7A 1P2KA 4WXIA 1GMHF 2H5CA 2BY8X 2WYGA 1HAVA 3KF2A 1W7XH 1TB6H 5EQRA 1Z6JH 5F8TA 2ZI2H 2RDLA 1P0SH 2NU4E 3SO3A 1KXDA 1AB9B 1AFQB 1HFDA 2B7DH 3ATMA 3E91A 1UHBA 2JETB 3MOCA 2BDAA 3LDXH 5CHAC 5LGOA 1GI2A 1UVPA 1THRH 1ELFA 4NIVA 3S9AA 5DP4A 1BHXF 1G3CA 4YM9A 1VCQA 3KQBA 1P09A 3RXHA 4A92A 1NZQH 3QZRA 3TGJE 1M9UA 1ZSLA 2EI7A 3BEUA 1QL7A 1T4VH 1C4U2 1RRKA 2ZG0H 4ASHA 1GL0E 2KAIA 2SGQE 1UK2A 4I33A 1GI4A 1SGQE 4D7FA 1P9SA 2AGEX 5TJXA 1SGNE 2D2DA 5HXFA 1O3OA 1AE8H 4X8VH 3OTJE 2Q1JA 4VGCC 1DSUA 1HAHH 1FONA 3SV9A 1GDNA 1ID5H 4HGCA 2FESH 5ESBA 2R2WU 1C2HA 2FX6A 5JYIA 9LPRA 1XUKA 4BTUB 3SBKA 5AF9H 4DIIH 1V2TT 2F91A 1Y5BT 4YTAA 3A8BA 2BY5X 3W95A 2PGQB 1ABIH 1LO6A 1HIAA 3LU9B 1BTPA 1SGDE 2AGIX 1ZTLA 4J1YA 2JH0D 1BB0B 2AGGX 1MU6B 2AMPA 1GL1A 3E90B 4NWLA 5L2YH 1XM1A 1GI3A 3RMMH 2VJ1A 5C1UA 1TGTA 2C4FH 1O2XA 3GICB 2PV9B 4OS4A 5JDUB 1PJPA 2VB0A 3S9BA 3ZVFA 2AFQB 1EXFA 2P8OC 1H9LB 1EB1H 3VGCC 2R2MB 2VVVA 2J38A 1ZPZA 4FXGH 4AFQA 2GT7A 4IC6A 2TGPZ 1GHAF 3AVZA 1SC8U 4B75A 5FAHA 3ATLA 4A7IB 3T28A 3ZVEA 2YNBA 1RIWC 2WV5A 3SHAH 1C5PA 2GCTB 1BJVA 1YP9A 1H1BA 1N8OC 2F83A 4ISNA 1GJAB 2AYWA 2ZFQH 4I8GA 1W11U 2F9OA 1GBMA 3S69A 1C4V2 3LGYA 1CHOG 2TPIZ 1UTNA 3BSQA 1HJ8A 3K6ZA 1SOTA 1BBRH 2GZ7A 1PFXC 3P70B 1PPCE 1H9IE 3F9GA 1QB9A 2ZDMA 3MI4A 4YT7H 3SV2H 4BAMB 1LVOA 2QV1A 1CE5A 1O2OA 3MNXA 4IGDA 4X2VA 2BQWB 2STAE 1LVMA 3FVFB 1P01A 8GCHF 5DP5A 4R8TB 1A3BH 2Y6TA 4MDSA 2VINA 3Q00A 8LPRA 1MKWH 2BQ7B 1P06A 4AFUA 2PKSB 1CBWB 4Q7ZA 4AX9H 4F4OC 3RP2A 1FNIA 4BXWA 1QBNA 3GCHB 5EW2H 1UVOA 4D8NA 1VR1H 1UCYE 2ZC9H 2BD8A 3SOSA 1EJMA 1WUNH 2C3SA 1GHZA 2XBYA 5A0AE 4U01A 1TGBA 3E16B 1KXFA 1A5IA 3O8BA 1ABJH 9ESTA 1O5AB 4DIHH 1OWIA 3ZVAA 2VWMA 2BD4A 1J15A 3RXVA 1O5CB 1MBQA 2ZDLA 1V2ST 4FUDA 3STJA 5B6OA 4WXVA 4CBOA 2ZKSA 5LPEA 2JH5D 1XVMA 4ABEA 4X8SH 1LPGB 2BX3A 3F9FA 3TJNA 1BMAA 1GHXH 4BTTB 5C5NA 6LPRA 1TGSZ 3NKKA 3UY9A 3MWIU 3LJOA 3OY5U 1NRNH 1SFQB 4K60A 3SJIA 3IITA 1TRNA 3B8JA 1THSH 3DHKH 1CVWH 5LPRA 1T8MA 3UR9A 3MU8A 1P03A 3SJKA 2AH4X 5AFYH 1OWEA 1EPTC 3BTDE 1Y3UA 3HGNA 4KTSA 4AB8A 1SGRE 4OGXA 4UDWH 4BXSA 3GY8A 1AI8H 4I7YH 4GAWA 2R0KA 3KCGH 1C5WB 4ZHAA 5K0HA 2PSYA 3E0NB 4NCYA 4CH2B 4HTCH 4AYVB 1DY9A 1NFUA 1FY1A 1T4UH 1EZUC 2C93B 1XVOA 3PMAB 1K21H 1ZHMA 1P2IA 1DANH 4X6OA 2Z9KA 3NZIA 1YBWA 1C5UA 4YLUA 2Z7FE 3P8OA 4NA9H 1VJAU 4ABIA 1O2NA 2ZGJA 1O36A 1S83A 1GI9B 1EOLA 1YLDA 5FPYA 2WPIS 1KXEA 1TOMH 2OQUA 1V2JT 2AEIH 3ESTA 1KLTA 4WMDA 3VPKA 1FJSA 2JETC 3UNQA 4WJG2 3P8GA 1VGCB 3A8DA 5EOKA 1PQ8A 4F49A 5GJ4B 2HVXA 3ZZAA 1CHOF 1Z1JA 1XUJA 4YOGA 3TNSA 4AGKA 1WOFA 3E1XB 3EE0B 4JZFH 1FPHH 4CRCA 2PLXA 2ZQ2A 1S0RA 4KTCA 1KXCA 2PFEA 3NWUA 1GHYH 3PO1B 1Z7KA 1C5VA 3MNBA 3TK9A 1C1NA 2BD2A 1SHYA 1UTQA 2YOLA 1UTOA 1A3EH 1C2KA 1IHSH 3SJ9A 3TLOA 2SFAA 2SNVA 1C2JA 3P17H 1P2MA 4NA7A 4AG2A 3T27A 1TNHA 4I32A 2DE9A 1QGFA 6ESTA 1GJ8B 3OY6U 1HLTH 1GJ5H 1C9PA 2A31A 4JYTA 4OS7A 1GI1A 1AZ8A 1DY8A 2GCHG 1QRWA 1LPKB 2BHGA 4ABBA 1DICA 2FTMA 4BAOB 2B8OH 1BMLA 1O3PB 2ASUB 1GMDG 1OSSA 2HNTE 3VB5A 1TNIA 1CGHA 2BB4A 2XWAA 1P11E 2GV7A 1TONA 5DP9A 4BAKB 2GD4B 3A7WA 1EB2A 3QTOH 4IN2A 2B0FA 3UPEA 3FZZA 3VB3A 6CHAC 4Y11E 1TQ7B 1MUEB 2XWBI 3SQEE 1BTYA 5EXMA 1Y3YA 3PWBA 1KIGH 5C1YA 1TBQH 1J16A 4VGCB 3RC5A 1ELDE 4GHTA 4MPUA 1OWJA 1Z6EA 3BTHE 3PYHA 1C2FA 3BF6H 1ZTKA 4FUHA 1MH0A 1O3BA 4UEHH 1NN6A 5G4BA 1SGPE 1TGNA 4GVUA 5EQSA 1EASA 1FI8A 2Z3DA 1D9IA 1V2NT 2XTTB 1G37A 4LOYH 5K7RA 2J94A 1NU7B 1Y8TA 4DT7B 4A5TS 1G3EA 1QL8A 7ESTE 4TY6A 1V2PT 1YPLH 4NIXA 1FDPA 1BMMH 1OX1A 5EQQA 2VGCB 3SI3H 1CT2E 5TCAA 1A0LA 5SGAE 1G32B 1KYNA 3KEEA 4MPWA 3BIVH 1O0DH 2FX4A 1GG6B 1HAYB 3KQDA 3ZZBA 4ZXXH 4I8LA 3PLBA 1ELAA 1TBZH 1HNEE 1GDUA 1PQAA 4H6SB 4Y7AA 1O2IA 3RXEA 3KHVA 1VCWA 1ZMNA 1O3JA 4I8JA 4XFQA 1O3DA 4NZQA 4SGAE 1HAZB 1PPBH 2AIPA 4GPGA 4XSKU 1XMNB 2NWNA 4X2YA 4ZHMU 3A81A 1C5TA 4JK6A 2HNTC 2ZECA 2CF8H 3RMLH 2P8OB 1MKXH 3NPSA 5H4IB 3SGAE 3VGCB 1O5BB 5L2ZH 1TPSA 1CBWC 1GJ4H 5FBIA 3RXLA 4MTBA 4GHQA 4OGYA 4FUEA 1K22H 1A5HA 3RMOH 3URDA 1YPMH 3FAOA 1RIWB 4Y0YE 1PPGE 1O5GH 1N8OB 1DWCH 4DCDA 1A0JA 1FLEE 3QN7A 1Z1IA 3GCOA 1BITA 1LDTT 2ZQ1A 2QIQA 2P3TB 3P6ZB 2HALA 3UNRA 2W7SA 3GISB 1J8AA 3V12A 1ZR0A 5FX6A 4FUGA 1LVBA 1V2KT 2A2QH 3V13A 3A80A 1D3TB 3EQ0H 1GBLA 1FUJA 1SR5C 4AZ2B 1F0SA 1HV7A 3FP6E 3M5NA 4D9QA 3U69H 1TIOA 3MU5A 1GPZA 1TX8A 2Z9JA 2ZPQA 3A7XA 3I29A 1ZMJA 4NIYA 1G2LA 2EC9H 2ZF0H 3SV6A 3SV8A 1JIRA 1W3CA 1P57B 1UTLM 1HPGA 1BZXE 3SU6A 1ZLRA 3E0PB 1XX9A 3M35A 1TA6A 1ZOMA 3SHCH 4KP0A 2BQ6B 3DT0H 2G00A 1O2MA 1NFXA 3EAJA 3TU7H 4E7RG 3MFJA 1OOKB 2UUYA 2C8YB 5DGJA 3S0NA 3P95A 2G5NA 3TIUA 3UWJH 1QFKH 3SUDA 1T7CA 1D3PB 1ETTH 1SOZA 3MH4A 1W7GH 4UONA 2CXVA 2FS8A 1C1PA 3QLPH 1Z8GA 1OXGA 2H5DA 1GBDA 1EATA 2F3CE 4I8HA 4U2WA 4H6TA 5LPFA 3KN2A 4BAHB 1MAXA 2ZGBH 1C5RA 2F9VA 3RXMA 1JWTA 1A7SA 3LH3A 3V3MA 4ZROA 1EPTB 2V6NA 1ANDA 2QCYA 1IOEA 2BXTH 3PMBB 1O38A 1TLDA 1AIXH 2ZTZA 1WBGB 3UQOA 3BTGE 4B74A 3QO6A 1HXEH 2CN0H 1MMJN 1HAGE 4X1RU 5BPEA 2FI4E 3RC6A 1EQ9A 1HYLA 4K3JA 1IQLA 2QXJA 1H8DH 5GCHF 4INHA 1BTZA 1QURH 4ZHLU 4J2YB 3M3TA 3RMNH 1SMFE 5ABWA 1SGIB 4OS1A 1NFYA 1FZZA 3MTYA 1YKTA 1GHWH 4JZEH 3M5MA 1F92A 1C9TA 1GJ9B 1DWEH 1C4Y2 1O32A 2O8LA 4YT6H 2QAAA 1AQ7A 2XC5A 3SN8A 4JCNA 3QWCH 1MCTA 4B76A 8GCHG 4RKOB 4UFFH 4HFPB 1EZQA 1O2RA 5JBBS 3GY6A 8ESTE 1W10U 5FBEA 1SBWA 4JMYA 1O2QA 1L1JA 1ELTA 2IPHA 2FLBH 2XYAA 1JRTA 5C3NA 1FMGA 1GCTC 3T62A 2J92A 2J95A 4NG9H 1JBUH 2BD3A 1Y3VA 2Y7XA 3BG8A 3PM3A 3PWCA 1VZQH 5GDSH 2UWOA 1FIZA 4ABDA 3TNTA 1QA0A 1QB6A 4Y79A 5EG4A 2P59A 2NU2E 1WU1A 2XC0A 1KDQB 5C5OA 1LMWB 2SGAA 3BV9B 2ANYA 1TBRH 3D23A 2OQ5A 5T6FA 1HAXB 5BRRE 2Y82A 3NCLA 2ZHDA 2VWLA 2UUJB 3E8LA 1TPAE 2Z3EA 2WINI 1Y5UT 1J14A 1UVSH 1A0HB 2VH6A 1EUFA 4ZKRU 2FTLE 4FUIA 1Y5AT 2OBOA 2Z6BD 3R0FA 3OSYA 5TCCA 3HK3B 3RXTA 2UWLA 3B23B 1C2GA 2BZAA 2A4RA 2VGCC 1YCPH 3MHWU 4ZKSU 4ABHA 3QX5H 2ALVA 1GG6C 1BUIA 2STBE 4MPXA 4Q7XA 2R9PA 3U8TH 1AVXA 4NFEA 1OP2A 1J9CH 1DPOA 2BVSH 2XBVA 2EA3A 6CHAB 1HCGA 2BMGB 3SNBA 2PUQH 4XBBA 3CENA 4X1SU 3VEQB 3DFLA 2FPZA 4ZUHA 3VB4A 5ESTE 4XDEA 3WY8A 1MZAA 2BD7A 1ZZZA 1P2QA 1ZRBA 5JBAS 3SV7A 1MTNC 2GDDA 2BOKA 2FI3E 3QUMP 3D49H 1C2DA 3A7YA 1AKSB 1FXYA 4ABJA 3RUOA 1S6FA 2FYQA 1Q2WA 1YPHE 2EEKA 3LC5A 1K1OA 5I25A 3M5OA 2BTCE 3LGUA 3MU0A 2WV4A 1HBTH 3BEIB 5HM2A 3STIA 1S6HA 1VITF 3RXSA 1HRTH 1GI7B 1LKBA 5DG6A 3VB7A 2FDAA 2QYIA 1UTKA 2Z9GA 1C1UH 2EI8A 2ZPSA 5DJ7A 1NFWA 4O3UA 1EAUA 3RXRA 1O33A 1EAXA 1IQGA 3LIWA 1DITH 1LHDH 2XC4A 1E34B 2R3YA 1LQDB 1A61H 2BDHA 1O3NA 3LGWA 3GY4A 1F0TA 3A8AA 4ZH8A 2VIVA 1GJDB 1XUHA 8KME2 1TX6A 4MNWA 1EZXC 2XBXA 3QTVH 3RXAA 1FV9A 1UTPA 1TPOA 1SGCA 1UVTH 2VNTA 1XKAC 1GHBF 4MLFB 2UUFB 1AGJA 1IQMA 3D62A 1TQ0B 1F0RA 2BVXH 1OPHB 3SI4H 1V2VT 3SZNA 1TNJA 2OC8A 2RA3A 1UCYK 2Z9LA 5A0CA 2BY6X 5T6GA 4LZ1H 1G2MA 2BVRH 4NSVA 1T8LA 1SB1H 3F9HA 3C1KA 3V7TA 1GDQA 4CRDA 1K1IA 5DP6A 1GBCA 3SU5A 4CRAA 2ZFRH 1P8VC 4JZDH 4BNRA 2F9NA 2A4OA 1L4ZA 1Z8RA 4X6NA 3ZV9A 1CT4E 1O37A 3P8FA 2AMQA 2VH0A 1YPHC 2PTCE 3U1JB 1GJCB 2JKHA 1GBKA 1YC0A 4YLQH 1BMNH 3ZZDA 2WYJA 1FIWA 4Z6AH 1NRSH 3UQVA 1A4WH 1FY8E 1HB0B 2W3KA 5JPMH 3E3TA 3ZV8A 4O3TA 3URCA 1ZRKA 5FPTA 1G36A 2HNTF 3M7UA 5HM9A 4ISOA 2GKVE 4X6PA 1S84A 1BRUP 2ZTYA 1TMBH 2ILNA 2J9NA 1DWBH 2J2UA 1LCYA 2VWNA 2A5IA 3KIDU 4GUXA 2Q6DA 4K1SA 1P2OA 1XUGA 1OP0A 1SGTA 2G8TA 5EXNA 1K2I1 4B1TA 1J17T 1IQNA 1JXPA 1CU1A 2SGEE 1O3MA 3HPTB 1TALA 2PKAB 2FOFA 3A7VA 2FODA 3RM0H 3ZZ6A 2TGTA 1K1JA 1YPJH 5CMXH 1K9OE 1UTJA 1U6QA 3NK8A 3S7HB 1UVUH 4DURA 1FY4A 1F7ZA 1TA2A 2FZZA 2OTVA 1AHTH 2PHBA 5E0GA 5DPAA 2XCFA 3L3TA 1V2LT 3ZZ3A 3MH7A 2Z9IA 1K1NA 2TGDA 4CH8B 3ITIA 2O8TA 1BBRE 1QBVH 1VJ9U 2FWWA 3TK5A 4YOJA 1NO9H 1HAVB 1ELCA 1DE7H 4UFEH 1T31A 1YF4A 3UTUH 1UHBB 1P2NA 1XKBC 1THPB 1Y59T 4X1QU 1EPTA 1QL9A 2WPHS 1C1RA 3O8CA 1C2LA 2FOGA 2BYAX 2BLWA 1P04A 1O2PA 1FAKH 2DUCA 1NRRH 2VU8E 4ESTE 4FU9A 2KAIB 1MBMA 1OYTH 1WCZA 1ZGIA 3A83A 1GBHA 2VWOA 1MTSA 1Z8JB 2C8WB 4DW2U 2VIDA 1NROH 3TVJB 1YPEH 3SJ8A 1QJ6B 3JZ1B 1AY6H 2GMTC 1N1LA 1PPHE 4JYUH 3EA9A 4Y76A 3HKJB 1LHCH 2ZGHA 3P8NA 3ZYEA 2Y81A 3HGPA 4X6MA 1YYY1 2G4UA 2ANWA 3L33A 3RXPA 1W0YH 4IN1A 3H7OA 1PQ5A 3N7OA 1TPPA 1SGEE 2WPJS 1ZHPA 2FLRH 1C5YB 1NESE 3MO9A 3F9EA 1GCTB 1QY6A 1HXFH 2QA9E 4NWKA 1P12E 1S81A 1EAWA 1JIMA 2LPRA 3RXFA 1G3BA 4THNH 2IOTA 2A32A 4K2YA 2Y80A 1S0QA 2THFB 1F5KU 3SGBE 2OC1A 1W12U 4ISLA 4D9RA 2R3UA 4R0IA 4ABAA 3Q76A 1A5GH 4ISHH 2HGTH 3PB1E 2P95A 2M5TA 4WF8A 1F5LA 3KQCA 2OC7A 5L6NH 4KKDA 1C5ZB 2W3IA 2NU0E 1ZPCA 3G01A 4ABFA 1RTFB 1F2SE 2HPQH 1EP5A 3RDZA 1EOJA 1DX5M 4Y8ZA 2ULLA 5EU8A 1WTHD 2QXHA 3SU2A 5E8EH 2CF9H 5DP7A 4X2XA 2AS9A 1ARCA 1BT7A 3MU1A 2TBSA 2GT8A 3SJOA 3BTTE 2XRCA 1DDJA 4ISIH 2J34A 3MNSA 4ABGA 1C1SA 4DY7B 2A1DB 3VFEA 1O3LA 5A09A 2B9LA 4H4FA 4OS5A 1C1OA 3LPRA 3JZ2B 2Q6GA 1MCVA 2BY7X 4HI3A 1IQEA 1C5SA 5A2MH 3TPIZ 1O5EH 1GVLA 1ESTA 5GCHG 1O3FA 4XE4A 2ZHQH 2OLGA 5JB9S 4BANB 2BM2A 4NIWA 2ZIQH 5LH8A 1E35B 1DUAA 2UWPA 4NFFA 2JH6D 1MD8A 1AVWA 1MTNB 2QF3A 3ZZCA 3A89A 1GBIA 1L4DA 3LOXA 3M3VA 1INCA 3T26A 1E38B 3QK1A 5EXLA 3AASA 1BCUH 1VCPA 4A1XA 1HGTH 1GHVH 3DD2H 1MTWA 2IN2A 2P3UB 2GVFA 4Y6DA 4FU7A 3TJUA 2ZU2A 1HAIH 3S7KB 1FAXA 2FOBA 1P10A 3TGIE 2D1JA 3UOPA 1QNJA 2W26A 3QGNB 5HGGA 3W94A 1P2JA 1H8IH 1EJAA 1TE0A 2GZ9A 1GI6A 1RFNA 1ZGVA 1GGDC 1ESBA 1T8OA 4DGJA 4X8TH 2FOMB 2FIRH 4AGJA 1C5OH 2ZHFH 3K6YA 3AW1A 3TITA 1V3XA 1IQJA 3HK6B 2SGPE 1DM4B 2FEQH 3LH1A 4KELA 5EODA 4CR9A 4B2CA 2ZFSA 2BDGA 1TX7A 5HMAA 3I77A 3NUMA 1HJ9A 2AERH 4FUBA 1BRCE 2FO9A 3VXFH 4AOQA 3LC3A 5IYTA 2H9TH 1LKAA 3A7TA 1FN6A 2ZPRA 2PSXA 3TH2H 3F1SB 4KTUA 2BD9A 3TGKE 3PMHB 3O8RA 1AU8A 4GSOA 2PR3A 1YPGH 1SGFG 4NGAH 1ACBE 3BTQE 4TWWA 3K2UA 1LPZB 1D3DB 2H6MA 4CRGA 2SGFE 4MNXA 2G81E 2C8XB 4DVAU 1BDAA 4AN7A 2V3HH 1BQYA 1MU8B 1NPMA 1AUTC 5FX5A 4IS5A 1CO7E 3Q77A 1KLJH 3L6PA 4OS2A 4Y71A 4B2BA 1QRXA 5A8XA 1O31A 3LKWA 1NS3A 2GX4A 2CHAC 2ZDAH 4Q2KA 2BDBA 2OXSA 3E6PH 1ESAA 4RKJB 1QCPA 1SLWB 1QIXB 1WQSA 3LT3A 3IWMA 4K1EA 1NY22 3M5LA 1LVYA 2WPMS 1BOQA 3FFGA 4SGBE 4ZKNU 3SUGA 5DP3A 5PTPA 3SORA 3SU4A 2BX4A 3RXKA 1UTMA 2OBQA 4A6LA 4NSYA 1DT2A 5FXLA 1C5XB 1QB1A 1AWFH 1GBEA 2V0BA 1C1TA 1DFPA 1O39A 4YZUA 2ZDNA 1NC6A 1ZTJA 1WTGH 5C2ZA 1VITG 1BHXB 1FY3A 1EX3A 1GBFA 2FOCA 3T2NA 1AN1E 1QHRB 5DP8A 3TK6A 2V3OH 1Q3XA 3DUXH 1ZPBA 4A1VA 3FANA 2PW8H 3HATH 4JZ1A 1GVZA 1YPKH 1G9IE 1DWDH 2EI6A 4D7GA 3EDXB 1F0UA 5AHGH 4KGAA 1V6DA 1GMCG 4ZAEA 2I6QA 3ZZ7A 2QC2A 2QGRA 1EJNA 4K8YA 1YLCA 1S82A 5AVDA 1RTLA 3M61U 4CRFA 2Y5HA 1TRYA 5A8YA 3A87A 4BTIB 1GHBG 1QJ7B 4TPYA 2VIPA 1GI8B 4O03A 2ZCLP 1O2YA 1KXBA 1ZJDA 3U1IB 4E05H 2HLCA 3P92A 5GWZA 3GCTF 3U8RH 1MAYA 1K28D 5T3HA 2ZEBA 5A8ZA 1SL3A 3A86A 4WVPE 2FMJA 1LHEH 3B9FH 4OS6A 1PPFE 2A7CA 3GCNA 4AORA 3Q3XA 2GP9B 1DLKB 2FI5E 3BG4C 1ARBA 1AD8H 1GI0A 2A7HA 7GCHG 4IW4E 4Z0KA 5A0BA 3D65E 5F6MA 2V35A 1D3QB 1O2SA 4CR5A 1LQEA 1Z71A 2GMTB 1NM6A 1RXPA 1CSOE 1EAIA 2ALPA 3ATWA 1UCYH 4UD9H 1P9UA 2TGAA 1OWHA 1BIOA 3GDUA 3SGQE 2Y5FA 2CGAA 1SVPA 1SQAA 4Y0ZE 1MTVA 3RU4D 4U30A 2CMYA 3SNCA 5C1XA 1DLEA 1ANBA 1GCDA 1UMAH 2BLQA 4XOJA 4MQAA 3KGPA 2OINA 1TNGA 1P3EA 1KTTB 4X1PU 2ZHWH 5AFZH 4FUFA 4MPVA 1QBOA 1IAUA 2ZCKP 2SNWA 4A1TA 2BDCA 4PROA 2VVCA 1C5NH 1OP8A 1O2KA 1UK3A 2BD5A 4MVNA 4WY3A 1B5GH 1K1PA 1AVGH 1CGJE 2ZZUH 2BOHB 1L2EA 3GDVA 1QTFA 1Y3XA 3RXQA 3SU3A 3UIRA 5EGMA 1AZZA 2BLOA 2WPKS 2C90B 5J4QA 1G3DA 2ZP0H 4IMZA 1YCPM 1CT0E 2SGDE 4WH8A 3M36A 2GDEH 3CS7A 2FXRA 3GYLB 1SLXB 1XXFA 2ZFTA 1L0ZA 3MNCA 1IQKA 1T8NA 1B7XB 1QRZA 3K9XB 1H9HE 5EPYA 3ZVCA 3SNEA 1EZSC 4UE7H 4K8BA 2ESTE 2G4TA 3TH4H 4CBNA 1NRPH 1L1NA 2TRMA 3FP7E 2ZA5A 1VITH 2ZDKA 3ZZ4A 4M7GA 3AAUA 2G5VA 1GMCF 3ZVGA 1AUJA 1QJ1B 3BTFE 2A4QA 1P05A 1YGCH 3GY3A 5E0JA 1P3CA 4K1TA 2ZWLH 1GJ7B 2PGBB 1GI5A 1O5DH 2BLVA 1KXAA 2FOAA 1TMTH 4I8KA 4D76A 1A1RA 1FY5A 4H42U 2FP7B 5DK1A 5GXPA 2ZNKH 4IBLH 3PLKA 2RCEA 2VIWA 2ZDVH 2ZU1A 1NU9A 1OYQA 4FU8A 1HJAC 3CS0A 2H9HA 2ZGXH 5EW1H 3RU4T 3PV4A 1PYTC 3M37A 3Q3KA 1C5QA 1O3GA 1TWXB 3A88A 1BTUA 3GY7A 1B0EA 4GLYA 3R3GB 1PYTD 2Z94A 3MO6A 7GCHF 3GOVB 4ZXYH 1V2MT 2I6SA 4UFDH 2FOEA 1PPEE 1GGDB 2P94A 1FPCH 2WUCA 3PTNA 1WAYB 4GCHG 1O3IA 1BTXA 4JK5A 2AMDA 4FVDA 1C1MA 1QR3E 1YCPK 2FM2A 1HDTH 2OUAA 1DXPA 1L1GA 4HZHA 3DA9B 1WYKA 3BTME 4UFGH 4WMFA 2HPPH 3LONA 3Q3YA 3RM2H 3LGTA 4B73A 5EPNA 2BDIA 1C1WH 4MG3A 4X1NU 3F6UH 5HYOA 3H5CB 1HUTH 1TABE 3KQEA 4JZIA 1S85A 4B71A 5J4SA 2QXGA 4XBCA 1ELEE 2PUXB 1LHFH 3O8DA 3CP7A 2W7UA 5GPIB 3ATIA 1O2VA 1GJ6A 2XW9A 3GDSA 4CHAB 1SSXA 1SPJA 1ZSKA 1ELVA 1NRQH 1O2GH 2A45B 2O8MA 4BAQB 1NTPA 1O2UA 3MO3A 3UREA 1CA0C 1RTKA 2H2ZA 4WMEA 1GVKB 2IJOB 5E0HA 1YM0A 5JBCS 2VVUA 2BY9X 4MNVA 4Q80A 3UUZA 7LPRA 1UK4A 2CHAB 2FYRA 2QY0B 3SW2B 3UR6A 4CRBA 1BBRK 3ZZ8A 1TMUH 3BTKE 3PTBA 2ODPA 4X2WA 1LHGH 1SGYE 4RSPA 4QT8C 4B2AA 1XXDA 3RLWH 1C5LH 3U98H 1MKWK 2P16A 5F8ZA 4INKA 1O3EA 1RS0A 3GY5A 2A5AA 5C20A 2NU1E 4LXBH 1W2KH 1AB9C 1AFQC 1P02A 1ORFA 2Y5GA
chains in the Genus database with same CATH superfamily
3ZZ5A 4X0WU 1E79D 2TIOA 1DVAH 1BA8B 1TGCA 1D6RA 1DSTA 3UFAA 1O2LA 1HAPH 1OWKA 2H9EH 2QN5T 1MD7A 4RI0A 1DS2E 4CREA 1MQ6A 1QQUA 1SQTA 3AK5A 2FS9A 1Q31A 3VB6A 3BEFB 2D26C 1DOJA 1E1QD 2Q6FA 1JMOH 3SNDA 1IQIA 5EIYA 1JRSA 2LNCA 4NA8A 2ANMH 3V0XA 4P02A 5CE1A 2OD3B 2J5UA 1BTHH 4U32A 3M7TA 3TJVA 4ZKOU 4INLA 2ZCHP 4E06H 2O9QA 3NXPA 3OYPA 3EA7A 4TWYA 1KTSB 1AE5A 2H1UA 1K1LA 4E7NA 1O5FH 1ZJKA 2O8WA 1CGIE 3SNAA 4AB9A 2XCNA 4O97A 5E2OA 1SGFA 2P3FH 3U9AH 4TY7A 2F9PA 2OCVB 3M3SA 5I46H 1SLUB 1AMHA 4RN6A 1ZMLA 2D8WA 3DFJA 1OKXA 1ANCA 2DE8A 2ANKH 3N99A 3TH3H 1V2UT 4GCHF 2A7JA 4XRNA 1HIAB 3QZQA 1E0FD 5CHAB 3PLPA 1GBTA 1O34A 1C2EA 1DXWA 2AIQA 1FQ3A 3RC4A 1T32A 3MH5A 2ODYB 3A7ZA 1WQVH 1H4WA 3BG4B 7KMEH 3RXBA 1UO6A 4IMQA 3BIUH 2LP6A 1BTWA 1O3HA 3HKIB 3S9CA 1GBBA 1C2MA 3GY2A 3PMJA 4JYVH 3LGIA 4ZMAH 5FCKA 3UWIA 1KDQA 1EKBB 3AW0A 1N6YA 1G30B 5C67A 3C27B 1GBAA 5FPSA 1TAWA 4Y10E 3KL6A 4DJZB 3RXUA 2UUKB 1SG8B 2WUBA 5FCRA 2YNAA 3EGKH 1BJUA 3F0PA 1ZHRA 2ZO3H 6GCHG 2W5EA 3KNXA 3MYWA 2ZFPH 4AG1A 1ZYOA 2KX4A 1GWAA 1O2TA 2CK3D 3IG6B 4Y8YA 4YESB 3PROA 2G52A 4YOIA 2A2XH 4WH6A 3SU0A 1F5RA 2GCTC 3M7QA 1B0FA 5F03A 4FUCA 1YY3A 3ENSB 1O30A 3OTPA 5T6DA 5L30H 1O2HA 2GGVB 1O35A 2F9BH 3ELAH 2HWLB 1AO5A 1IQHA 2K1QA 3A85A 3T5FH 1IQFA 1O3AA 1SQOA 4NZLA 3MQKC 1S6LA 5ETXA 2CJIA 1LTOA 2R0LA 3T25A 1RGQA 1W0ZU 1E36B 1AKSA 1QQ4A 3BTWE 3RXDA 2QF0A 3ODFA 5DO4H 2XBWA 1BRBE 2PKSC 1A46H 2ZTXA 1EP6A 1GMHG 1UW7A 3GCHC 2A4GA 4O9VA 1PPZA 2HRVA 3BN9A 3MMGA 3U8OH 2GTBA 4AFSA 3LJJA 3GCTG 4DG4A 1A2CH 4I31A 2KCOA 1ANEA 3ZVDA 1C1VH 3ZYDA 4DOQA 3UNSA 1CHGA 1CQQA 1X7AC 3EYDA 3H7TA 2ZU4A 2OP9A 1SHHB 3SZEA 5DSFA 3RXJA 2FOHA 4XBDA 3A84A 3TJOA 3QDZB 1XUIA 1Y3WA 2NU3E 2OC0A 3UOUA 3FZDA 2Z3CA 1FN8A 4Q7YA 2ZGCA 1HAOH 3A82A 2G55A 5E2PA 1ETSH 2XXLA 2O8UA 1Z8IB 4AYYB 3RLYH 1HJAB 1NT1A 3F2FA 1OWDA 4B6FA 3SQHE 4IC5A 1ZSJA 1XUFA 1TOCB 2GCHF 2A5KA 3OX7U 3K65B 3BTEE 4Y7BA 3ODDA 4TPIZ 4YO9A 3F68H 1AFEH 1C2IA 2A0QB 2G51A 3SU1A 1GMDF 5GIBA 1W13U 3DSOA 5FHTA 4CHAC 1O2WA 3EE7A 2C8ZB 4K69A 4LK4A 3EA8A 4FUJA 1O2ZA 3U28C 2QXIA 1AWHB 1WSSH 5JB8S 3T29A 1N6XA 5JBTA 1JOUB 3MU4A 1SFIA 5DKMA 3RXGA 2PWXA 1S5SA 1MZDA 2J4IA 1V2RT 1RD3B 1CA8B 2P93A 2F9UA 2Y7ZA 1K1MA 4AFZA 1WV7H 2GV6A 1GJBB 3VXEH 5IDKA 3SUEA 1TNLA 3ZVBA 2ODQA 4WWYA 3RXOA 2ZHEH 1D6WA 3GYMA 2K8IA 1C5MD 4X8UH 5HIZA 4MNYA 2RG3A 1DUEA 6GCHF 1V2QT 2BXUH 3FP8E 1BRAA 1TFXA 1IHTH 3ATKA 1TRMA 2BZ6H 2ZU3A 3MH6A 3QGJA 4TYDA 2RA0A 1MKXK 1TNKA 1ETRH 2XNIA 3ZZ9A 1D4PB 2VIOA 2HOBA 4BOHA 1V2WT 3I78A 1SI5H 1ELBA 1OS8A 3A8CA 1UJ1A 1V2OT 3OFND 3H09A 1MTUA 1O3CA 1VGCC 3RU4E 2GZ8A 1SLVB 1W14U 1O3KA 1GBJA 1C1QA 1RJXB 2PKAA 1GHAG 2ZU5A 1CA0B 4FVBA 1KLIH 2BDYA 2WPLS 5F8XA 2B5TB 3RXCA 3SUFA 1MQ5A 1KSNA 1E1RD 2VIQA 2ZFFH 3RXIA 4LZ4B 2PTNA 1KY9A 1W8BH 4K5ZA 1E37B 4Y8XA 1ELGA 3PO1C 3LGVA 1O2JA 3OU0A 2CV3A 1TYNA 1PQ7A 3AAVA 1QA7A 1P2KA 5CDFE 4WXIA 1GMHF 2H5CA 2BY8X 2WYGA 1HAVA 3KF2A 1W7XH 1TB6H 5EQRA 1Z6JH 5F8TA 2ZI2H 2RDLA 1P0SH 2NU4E 5C17A 3SO3A 1KXDA 1AB9B 1AFQB 1HFDA 2B7DH 3ATMA 3E91A 1UHBA 3OE7D 2JETB 3MOCA 2XOKD 2BDAA 3LDXH 5CHAC 5LGOA 1GI2A 1UVPA 1THRH 1ELFA 4NIVA 3S9AA 5DP4A 1BHXF 1G3CA 4YM9A 1VCQA 3KQBA 1P09A 3RXHA 4A92A 1NZQH 3QZRA 3TGJE 1M9UA 1ZSLA 2EI7A 3BEUA 1QL7A 1T4VH 1C4U2 1RRKA 2ZG0H 4ASHA 1GL0E 2KAIA 2SGQE 1UK2A 4I33A 1GI4A 1SGQE 4D7FA 1P9SA 2AGEX 5TJXA 1SGNE 2D2DA 5HXFA 1O3OA 1AE8H 4X8VH 3OTJE 2Q1JA 4VGCC 1DSUA 1HAHH 1FONA 3SV9A 1GDNA 1ID5H 4HGCA 2FESH 5ESBA 2R2WU 1C2HA 2FX6A 5JYIA 9LPRA 1XUKA 4BTUB 3SBKA 5AF9H 4DIIH 1V2TT 2F91A 1Y5BT 4YTAA 3A8BA 2BY5X 3W95A 2PGQB 1ABIH 1LO6A 1HIAA 3LU9B 1BTPA 1SGDE 2AGIX 1ZTLA 4J1YA 2JH0D 1BB0B 2AGGX 1MU6B 2AMPA 1GL1A 3E90B 4NWLA 5L2YH 5C0UA 1XM1A 1GI3A 3RMMH 2J98A 2VJ1A 5C1UA 1TGTA 2C4FH 1O2XA 3GICB 2PV9B 4OS4A 5JDUB 1PJPA 2VB0A 3S9BA 3ZVFA 2AFQB 1EXFA 2P8OC 1H9LB 1EB1H 3VGCC 2R2MB 2VVVA 2J38A 1ZPZA 4FXGH 4AFQA 2GT7A 4IC6A 2TGPZ 1GHAF 3AVZA 1SC8U 4B75A 5FAHA 3ATLA 3N7DA 4A7IB 3T28A 3ZVEA 2YNBA 1RIWC 2WV5A 3SHAH 4B6EA 1W0JD 1C5PA 2GCTB 1BJVA 1YP9A 1H1BA 3KYGA 1N8OC 2F83A 4ISNA 1GJAB 2AYWA 2ZFQH 4I8GA 1W11U 2F9OA 1GBMA 3S69A 1C4V2 3LGYA 1CHOG 2TPIZ 1UTNA 3BSQA 1HJ8A 3K6ZA 2RFKC 1SOTA 1BBRH 2GZ7A 1PFXC 3P70B 1PPCE 1H9IE 3F9GA 1QB9A 2ZDMA 3MI4A 4YT7H 3SV2H 4BAMB 1LVOA 2QV1A 1CE5A 1O2OA 3MNXA 4IGDA 4X2VA 2BQWB 2STAE 1LVMA 3FVFB 1P01A 2KCAA 8GCHF 5DP5A 4R8TB 1A3BH 2Y6TA 4MDSA 2VINA 3Q00A 8LPRA 1MKWH 2BQ7B 1P06A 4AFUA 2PKSB 1CBWB 4Q7ZA 4AX9H 4F4OC 3RP2A 1FNIA 4BXWA 1QBNA 3GCHB 5EW2H 1UVOA 4D8NA 1VR1H 1UCYE 2VBCA 2BD8A 2ZC9H 3SOSA 1EJMA 1WUNH 2C3SA 1GHZA 2XBYA 5A0AE 2L74A 4U01A 1TGBA 3E16B 1KXFA 1A5IA 3O8BA 1ABJH 9ESTA 1O5AB 4DIHH 1OWIA 3ZVAA 2VWMA 2BD4A 1J15A 3RXVA 1O5CB 1MBQA 2ZDLA 1V2ST 4FUDA 3STJA 5B6OA 4WXVA 1OHHD 4CBOA 2ZKSA 5LPEA 2JH5D 1XVMA 4ABEA 4X8SH 1LPGB 2BX3A 3F9FA 3TJNA 1BMAA 1GHXH 4BTTB 5C5NA 6LPRA 1TGSZ 3NKKA 3UY9A 3MWIU 3LJOA 3OY5U 1NRNH 1SFQB 4K60A 3SJIA 3IITA 1TRNA 3B8JA 1THSH 3DHKH 1CVWH 5LPRA 1T8MA 3UR9A 3MU8A 1P03A 3WWFA 3SJKA 2AH4X 5AFYH 1OWEA 1EPTC 3BTDE 1Y3UA 3HGNA 4KTSA 4AB8A 1SGRE 4OGXA 4UDWH 4BXSA 3GY8A 1AI8H 4I7YH 2KR7A 4HG6A 3W1EA 4GAWA 2R0KA 3KCGH 1C5WB 4ZHAA 5K0HA 2PSYA 3E0NB 4NCYA 4CH2B 4HTCH 4AYVB 1DY9A 1NFUA 3FKSD 1FY1A 1T4UH 1EZUC 2C93B 1XVOA 3PMAB 1K21H 1ZHMA 1P2IA 1DANH 4X6OA 2Z9KA 2W6JD 3NZIA 1YBWA 1C5UA 4YLUA 2Z7FE 3P8OA 4NA9H 1VJAU 4ABIA 1O2NA 2ZGJA 5C94A 2AHME 1O36A 1S83A 2WPDD 1GI9B 1EOLA 4YXWD 1YLDA 5FPYA 2WPIS 1KXEA 1TOMH 2OQUA 1V2JT 2AEIH 3ESTA 1KLTA 4WMDA 3VPKA 1FJSA 2JETC 3UNQA 4WJG2 3P8GA 1VGCB 3A8DA 5EOKA 1PQ8A 4F49A 5GJ4B 2HVXA 3ZZAA 1CHOF 1Z1JA 1XUJA 4YOGA 3TNSA 4AGKA 1WOFA 3E1XB 3EE0B 4JZFH 1FPHH 4CRCA 2PLXA 2F43B 2ZQ2A 1S0RA 4KTCA 1KXCA 2PFEA 3NWUA 1GHYH 3PO1B 1Z7KA 1C5VA 3MNBA 3TK9A 1C1NA 2BD2A 1SHYA 1UTQA 2YOLA 1UTOA 1A3EH 1C2KA 1IHSH 3SJ9A 3TLOA 2SFAA 2SNVA 1C2JA 3P17H 1P2MA 4NA7A 4AG2A 3T27A 1TNHA 4I32A 2DE9A 5HIYA 1QGFA 6ESTA 1GJ8B 3OY6U 1HLTH 1GJ5H 1C9PA 2A31A 4JYTA 4OS7A 1GI1A 1AZ8A 1DY8A 2GCHG 1QRWA 1LPKB 2BHGA 4ABBA 1DICA 4AC9A 2FTMA 4BAOB 2B8OH 1BMLA 1O3PB 2ASUB 1GMDG 1OSSA 1YLNA 1YWUA 2HNTE 3VB5A 3SYJA 1TNIA 1CGHA 2BB4A 2XWAA 1P11E 2GV7A 1TONA 5DP9A 4BAKB 2GD4B 3A7WA 1EB2A 3QTOH 4IN2A 3PRDA 2B0FA 3UPEA 3FZZA 3VB3A 6CHAC 4Y11E 1TQ7B 3UB0A 1MUEB 2KFWA 2XWBI 3SQEE 1BTYA 5EXMA 1Y3YA 3PWBA 1KIGH 5C1YA 1TBQH 1J16A 4VGCB 3RC5A 1ELDE 4GHTA 4MPUA 1OWJA 1Z6EA 3BTHE 3PYHA 1C2FA 3BF6H 1ZTKA 4FUHA 1MH0A 1O3BA 4UEHH 1NN6A 5G4BA 1SGPE 1TGNA 4GVUA 5EQSA 1EASA 1FI8A 2Z3DA 1D9IA 1V2NT 2XNDD 2XTTB 1G37A 4LOYH 5K7RA 2J94A 3KQ5A 1NU7B 1Y8TA 4DT7B 5EJ1A 4A5TS 1G3EA 1QL8A 7ESTE 4TY6A 1V2PT 1YPLH 4NIXA 1FDPA 1BMMH 1OX1A 5EQQA 2VGCB 3SI3H 1CT2E 3UAIC 5TCAA 1A0LA 5SGAE 1G32B 1KYNA 3KEEA 4MPWA 3BIVH 1O0DH 2FX4A 1GG6B 1HAYB 3KQDA 3ZZBA 3GS9A 4ZXXH 4I8LA 3PLBA 1ELAA 1TBZH 1HNEE 1GDUA 1PQAA 2WSSD 4H6SB 4Y7AA 1O2IA 3RXEA 3KHVA 1VCWA 1ZMNA 1O3JA 4I8JA 4XFQA 1O3DA 4NZQA 4SGAE 1HAZB 1PPBH 2AIPA 4GPGA 4XSKU 5HKKD 1XMNB 2NWNA 4X2YA 4ZHMU 3A81A 1C5TA 4JK6A 2HNTC 2ZECA 2CF8H 3RMLH 2P8OB 1MKXH 3NPSA 5H4IB 3SGAE 3VGCB 1O5BB 5L2ZH 1TPSA 1CBWC 1GJ4H 5FBIA 3RXLA 4MTBA 4FETA 4GHQA 4OGYA 4FUEA 1K22H 1A5HA 3RMOH 3URDA 1YPMH 3FAOA 1RIWB 2JDID 4Y0YE 1PPGE 1O5GH 1N8OB 1DWCH 4DCDA 1A0JA 1FLEE 2EQNA 3QN7A 1Z1IA 3GCOA 1BITA 1LDTT 2ZQ1A 2QIQA 2P3TB 3P6ZB 2HALA 3UNRA 2W7SA 3GISB 1J8AA 3V12A 1ZR0A 5FX6A 4FUGA 1LVBA 1V2KT 2A2QH 3V13A 3A80A 1D3TB 3EQ0H 1GBLA 1FUJA 1SR5C 4AZ2B 1F0SA 1HV7A 3FP6E 3M5NA 4D9QA 3U69H 1TIOA 3MU5A 1GPZA 1TX8A 2Z9JA 2ZPQA 3A7XA 3I29A 1ZMJA 4NIYA 1G2LA 2EC9H 2ZF0H 3SV6A 3SV8A 1JIRA 1W3CA 1P57B 1UTLM 2WHXA 1HPGA 1BZXE 2JIZD 3SU6A 3N7EA 1ZLRA 3E0PB 1XX9A 3M35A 1TA6A 1ZOMA 3SHCH 4KP0A 2BQ6B 3DT0H 2G00A 1O2MA 1NFXA 3F2GA 3EAJA 3TU7H 4E7RG 5KECA 3MFJA 1OOKB 2UUYA 2C8YB 5DGJA 3S0NA 3P95A 2G5NA 5EJZA 3TIUA 2EY4C 3UWJH 1QFKH 3SUDA 1T7CA 1D3PB 1ETTH 1SOZA 3MH4A 1W7GH 4UONA 2CXVA 2FS8A 1C1PA 3QLPH 1Z8GA 1OXGA 2H5DA 1GBDA 1EATA 2F3CE 4I8HA 4U2WA 4H6TA 5LPFA 3KN2A 4BAHB 1MAXA 2QF4A 2ZGBH 1C5RA 2F9VA 3RXMA 1JWTA 1A7SA 3LH3A 3V3MA 1COWD 2W6ID 4ZROA 1EPTB 2V6NA 1ANDA 2QCYA 1IOEA 2BXTH 3PMBB 1O38A 1TLDA 1AIXH 2ZTZA 1WBGB 3UQOA 3BTGE 4B74A 3QO6A 1HXEH 3PV5A 2CN0H 2PP6A 1MMJN 1HAGE 4X1RU 5BPEA 2FI4E 3RC6A 1EQ9A 2OK5A 1HYLA 4K3JA 1IQLA 2QXJA 1H8DH 5GCHF 4INHA 1BTZA 1QURH 4ZHLU 4J2YB 3M3TA 3RMNH 1SMFE 3FO8D 1QZ8A 5ABWA 1SGIB 4OS1A 1NFYA 1FZZA 3MTYA 1YKTA 1GHWH 4JZEH 3M5MA 3OAAD 1F92A 1C9TA 1GJ9B 1DWEH 1C4Y2 1O32A 2O8LA 4YT6H 2QAAA 1AQ7A 2XC5A 3SN8A 4JCNA 3QWCH 1MCTA 4B76A 8GCHG 4RKOB 4TT3D 4UFFH 4HFPB 1EZQA 1O2RA 5JBBS 3GY6A 8ESTE 1W10U 5FBEA 1SBWA 4JMYA 1O2QA 1L1JA 1ELTA 1W0KD 2IPHA 2FLBH 2XYAA 4ASUD 1JRTA 5C3NA 5DN6D 1FMGA 1GCTC 3T62A 2J92A 2J95A 4NG9H 1JBUH 2BD3A 1Y3VA 2Y7XA 3BG8A 3PM3A 3CNRA 3PWCA 1VZQH 5GDSH 2UWOA 1FIZA 4ZCNA 4ABDA 3TNTA 1QA0A 1QB6A 4Y79A 5EG4A 2P59A 2NU2E 1WU1A 2XC0A 1KDQB 5C5OA 1LMWB 2SGAA 3BV9B 2ANYA 1TBRH 3D23A 2OQ5A 5T6FA 1HAXB 5BRRE 2Y82A 3NCLA 2ZHDA 2VWLA 2UUJB 3E8LA 1TPAE 2Z3EA 2WINI 1Y5UT 1J14A 1UVSH 1A0HB 2VH6A 1EUFA 4ZKRU 2FTLE 4FUIA 1Y5AT 2OBOA 2Z6BD 3R0FA 3OSYA 5TCCA 3HK3B 3RXTA 2UWLA 3B23B 1FX0B 1C2GA 2BZAA 2A4RA 2VGCC 1YCPH 3MHWU 4ZKSU 4ABHA 3QX5H 2ALVA 1GG6C 1BUIA 2STBE 4MPXA 4Q7XA 2R9PA 3U8TH 1AVXA 4NFEA 1OP2A 1J9CH 3KYFA 1DPOA 2BVSH 2XBVA 2EA3A 6CHAB 1HCGA 2BMGB 3SNBA 2PUQH 4XBBA 3CENA 4X1SU 3VEQB 3DFLA 2F4LA 2FPZA 4ZUHA 3VB4A 5ESTE 4XDEA 5EJLA 3WY8A 1MZAA 2BD7A 1ZZZA 1P2QA 1ZRBA 5JBAS 3SV7A 1MTNC 2GDDA 2BOKA 2FI3E 3QUMP 3D49H 1C2DA 3A7YA 1AKSB 1FXYA 4ABJA 3RUOA 1S6FA 2FYQA 1Q2WA 1YPHE 2EEKA 3LC5A 1K1OA 5I25A 3M5OA 2BTCE 3LGUA 3MU0A 2WV4A 1HBTH 3BEIB 5HM2A 3STIA 1S6HA 1VITF 3RXSA 1HRTH 1GI7B 1LKBA 5DG6A 3VB7A 2FDAA 2QYIA 1UTKA 2Z9GA 1C1UH 2EI8A 2ZPSA 2WZQA 5DJ7A 1NFWA 4O3UA 1EAUA 3RXRA 1O33A 1EAXA 1IQGA 3LIWA 1DITH 1LHDH 2KCYA 2XC4A 1E34B 2R3YA 1LQDB 1A61H 2BDHA 1O3NA 3LGWA 3GY4A 1F0TA 3A8AA 4ZH8A 2VIVA 1GJDB 1XUHA 8KME2 1TX6A 4MNWA 1EZXC 2XBXA 3QTVH 3RXAA 1FV9A 2Y5GA 1UTPA 1TPOA 1SGCA 1UVTH 2VNTA 1XKAC 1GHBF 4MLFB 2UUFB 1AGJA 1IQMA 3FOAA 3D62A 1TQ0B 1F0RA 2BVXH 1OPHB 3SI4H 1V2VT 3SZNA 1TNJA 2OC8A 2RA3A 1UCYK 2Z9LA 2KZ4A 2BY6X 5A0CA 5T6GA 4LZ1H 1G2MA 2BVRH 4NSVA 1T8LA 1SB1H 3F9HA 3C1KA 3V7TA 1GDQA 4CRDA 1K1IA 5DP6A 1GBCA 3SU5A 4CRAA 2ZFRH 1P8VC 4Z1MD 4JZDH 4BNRA 2F9NA 2A4OA 1L4ZA 1Z8RA 4X6NA 3ZV9A 1CT4E 1O37A 3P8FA 5IK2D 2AMQA 2VH0A 1YPHC 2PTCE 3U1JB 1GJCB 2JKHA 1GBKA 1YC0A 4YLQH 1BMNH 3ZZDA 2WYJA 1FIWA 4Z6AH 1NRSH 3UQVA 1A4WH 1FY8E 1HB0B 2W3KA 5JPMH 3E3TA 3ZV8A 4O3TA 3URCA 1ZRKA 5FPTA 1G36A 2HNTF 3M7UA 5HM9A 4ISOA 2GKVE 4X6PA 1S84A 1BRUP 2ZTYA 1TMBH 2ILNA 2J9NA 1DWBH 2J2UA 1LCYA 2VWNA 2A5IA 3KIDU 4GUXA 2Q6DA 4K1SA 1P2OA 1XUGA 1OP0A 1SGTA 2G8TA 5EXNA 1K2I1 4B1TA 1J17T 1IQNA 1JXPA 1CU1A 2SGEE 1O3MA 3HPTB 1TALA 2WV9A 2PKAB 2FOFA 3A7VA 2FODA 3RM0H 3ZZ6A 2TGTA 1K1JA 1YPJH 5CMXH 2J97A 1K9OE 2V7QD 1UTJA 1U6QA 5F53A 3NK8A 3S7HB 1UVUH 4DURA 5C0TA 1FY4A 1F7ZA 1TA2A 2FZZA 2OTVA 1AHTH 2PHBA 5E0GA 2YMSC 5DPAA 2XCFA 3L3TA 1V2LT 3ZZ3A 4P00A 3MH7A 2Z9IA 1K1NA 2TGDA 4CH8B 3ITIA 1BBRE 1QBVH 1VJ9U 2FWWA 2O8TA 3TK5A 4YOJA 1NO9H 3F2HA 1HAVB 2YMSD 1ELCA 1DE7H 4UFEH 1T31A 2KM0A 1YF4A 3UTUH 1UHBB 1P2NA 1H8ED 1XKBC 1THPB 1Y59T 4X1QU 5T1VA 1EPTA 1QL9A 2WPHS 1C1RA 3O8CA 1C2LA 2FOGA 2BYAX 2BLWA 1P04A 1O2PA 1FAKH 2DUCA 1NRRH 2VU8E 4ESTE 3OEED 4FU9A 2KAIB 1MBMA 1OYTH 1WCZA 1ZGIA 3A83A 1GBHA 2VWOA 1MTSA 1Z8JB 2C8WB 4DW2U 2VIDA 1NROH 3TVJB 1YPEH 3SJ8A 1QJ6B 3JZ1B 1NBMD 1AY6H 2GMTC 1N1LA 1PPHE 4JYUH 3EA9A 4F55A 4Y76A 3HKJB 1LHCH 2ZGHA 3P8NA 3ZYEA 2Y81A 3HGPA 4X6MA 1YYY1 2G4UA 2ANWA 3L33A 3RXPA 1W0YH 4IN1A 3H7OA 1PQ5A 3N7OA 1TPPA 1SGEE 2WPJS 1ZHPA 2FLRH 1C5YB 1NESE 3MO9A 3F9EA 1GCTB 2QF5A 1QY6A 3PRBA 1HXFH 2QA9E 4NWKA 1P12E 1S81A 1EAWA 1JIMA 2LPRA 3RXFA 1G3BA 4THNH 2IOTA 2A32A 4K2YA 2Y80A 1S0QA 2THFB 1F5KU 2LELA 3SGBE 2OC1A 1W12U 4ISLA 4D9RA 2R3UA 4R0IA 4ABAA 3Q76A 1A5GH 4ISHH 2HGTH 2L6OA 2P95A 2M5TA 3PB1E 1F5LA 4WF8A 3KQCA 3ZIAD 2J98B 2OC7A 5L6NH 4KKDA 1C5ZB 2W3IA 2NU0E 1ZPCA 3G01A 4ABFA 1RTFB 1F2SE 2KCPA 2HPQH 1EP5A 3RDZA 3WW7A 1EOJA 2V3MA 1DX5M 1KMHB 4Y8ZA 2ULLA 5EU8A 1WTHD 2QXHA 3SU2A 5E8EH 2CF9H 5DP7A 4X2XA 2AS9A 1ARCA 1BT7A 3MU1A 2TBSA 2GT8A 3SJOA 3BTTE 2XRCA 1DDJA 4ISIH 2J34A 3MNSA 4ABGA 1C1SA 4DY7B 2A1DB 3VFEA 1O3LA 5A09A 3PV2A 2B9LA 4ACAA 5KGOA 4H4FA 4OS5A 1C1OA 3LPRA 3JZ2B 2Q6GA 1MCVA 2BY7X 4HI3A 1IQEA 1C5SA 5A2MH 3TPIZ 1O5EH 1GVLA 1ESTA 5GCHG 1O3FA 4XE4A 2ZHQH 3VG8A 2OLGA 5JB9S 4BANB 2BM2A 4NIWA 2ZIQH 5LH8A 1E35B 1DUAA 2UWPA 4NFFA 2JH6D 1MD8A 1AVWA 1MTNB 2QF3A 3F3BA 3ZZCA 2HVYB 3A89A 1GBIA 1L4DA 3LOXA 3M3VA 1INCA 3T26A 1E38B 3QK1A 5EXLA 3AASA 1BCUH 1VCPA 4A1XA 1HGTH 1GHVH 3DD2H 1MTWA 2IN2A 2P3UB 2GVFA 4Y6DA 4FU7A 3TJUA 2ZU2A 1HAIH 3S7KB 1FAXA 2FOBA 1P10A 3TGIE 2D1JA 3UOPA 1QNJA 2W26A 3QGNB 5HGGA 3W94A 1P2JA 1H8IH 1EJAA 1TE0A 2GZ9A 1GI6A 1RFNA 1ZGVA 1GGDC 1ESBA 1T8OA 4DGJA 4X8TH 2FOMB 2FIRH 4AGJA 1C5OH 2ZHFH 3K6YA 3AW1A 3TITA 1V3XA 1IQJA 3HK6B 1EFRD 2SGPE 1DM4B 2FEQH 3LH1A 4KELA 5EODA 4CR9A 4B2CA 2ZFSA 2BDGA 1TX7A 5HMAA 3I77A 3NUMA 1HJ9A 2AERH 4FUBA 1BRCE 2FO9A 3VXFH 4AOQA 3LC3A 5IYTA 2H9TH 1LKAA 3A7TA 1FN6A 2ZPRA 2PSXA 3TH2H 3F1SB 4KTUA 2BD9A 3TGKE 3PMHB 3O8RA 1AU8A 4GSOA 2PR3A 1YPGH 1SGFG 4NGAH 1ACBE 3BTQE 4TWWA 3K2UA 5FL7D 1LPZB 1D3DB 2H6MA 4CRGA 3DSPA 2SGFE 4MNXA 2G81E 2C8XB 4DVAU 1BDAA 4AN7A 2V3HH 1BQYA 1MU8B 2GJGA 1NPMA 1AUTC 5FX5A 4IS5A 1CO7E 3Q77A 1KLJH 3L6PA 4OS2A 1WDIA 4Y71A 4B2BA 1QRXA 5A8XA 1O31A 3LKWA 1NS3A 2GX4A 2CHAC 2ZDAH 4Q2KA 2BDBA 2OXSA 1SKYE 3E6PH 1K0HA 1ESAA 4RKJB 1QCPA 1SLWB 1QIXB 1BMFD 3NRLA 1WQSA 2IPQX 3LT3A 3IWMA 4K1EA 1NY22 3M5LA 1LVYA 2WPMS 1BOQA 3FFGA 2IJD1 4SGBE 4ZKNU 3SUGA 5DP3A 5PTPA 3SORA 3SU4A 2BX4A 3RXKA 1UTMA 2OBQA 4A6LA 4NSYA 1DT2A 5FXLA 1C5XB 1QB1A 1AWFH 1GBEA 2V0BA 1C1TA 1DFPA 1O39A 4YZUA 2ZDNA 1NC6A 1ZTJA 1WTGH 5C2ZA 1VITG 1BHXB 1FY3A 1EX3A 1GBFA 2FOCA 3T2NA 1AN1E 1QHRB 5DP8A 3TK6A 2V3OH 1Q3XA 3DUXH 1ZPBA 4A1VA 3FANA 2PW8H 3HATH 2YMSB 4JZ1A 1GVZA 1YPKH 1G9IE 1DWDH 2EI6A 4D7GA 3EDXB 1F0UA 5AHGH 4KGAA 1V6DA 1GMCG 4ZAEA 2I6QA 3ZZ7A 2QC2A 2QGRA 1EJNA 4K8YA 1YLCA 1S82A 5AVDA 1RTLA 3M61U 4CRFA 2Y5HA 1TRYA 5A8YA 3A87A 4M9FA 4BTIB 1GHBG 1QJ7B 4TPYA 2VIPA 1GI8B 4F48B 4O03A 2ZCLP 4XD7D 1O2YA 1KXBA 1ZJDA 3U1IB 4E05H 2HLCA 3P92A 5GWZA 3GCTF 3U8RH 1MAYA 2M2AA 1K28D 5T3HA 2ZEBA 5A8ZA 1SL3A 3A86A 4WVPE 2FMJA 1LHEH 3B9FH 4OS6A 1PPFE 2A7CA 3GCNA 4AORA 3Q3XA 2GP9B 1DLKB 2FI5E 3BG4C 1ARBA 1AD8H 1GI0A 2A7HA 7GCHG 4IW4E 4Z0KA 5A0BA 3D65E 5F6MA 2V35A 1D3QB 1O2SA 4CR5A 1LQEA 4ACBA 1Z71A 2GMTB 1NM6A 1RXPA 1CSOE 1EAIA 2ALPA 3ATWA 1UCYH 4UD9H 1P9UA 2TGAA 1OWHA 1BIOA 3GDUA 3SGQE 2Y5FA 2CGAA 1SVPA 1SQAA 4Y0ZE 1MTVA 3RU4D 4U30A 2CMYA 3SNCA 5C1XA 1DLEA 1ANBA 1GCDA 1UMAH 2K0QA 1SQRA 2BLQA 3F0OA 4XOJA 4MQAA 3KGPA 2OINA 1TNGA 1P3EA 1KTTB 4X1PU 2ZHWH 5AFZH 4FUFA 4MPVA 1QBOA 1IAUA 2ZCKP 3DSGA 2SNWA 4A1TA 1H8HD 2BDCA 4PROA 2VVCA 1C5NH 1OP8A 1O2KA 1UK3A 2BD5A 4MVNA 4WY3A 1B5GH 1K1PA 1AVGH 1CGJE 4FOUC 2ZZUH 2BOHB 1L2EA 3GDVA 1QTFA 1Y3XA 3RXQA 3SU3A 3UIRA 5EGMA 1AZZA 2BLOA 2WPKS 2C90B 5J4QA 1G3DA 2JJ2D 2ZP0H 4IMZA 1YCPM 1CT0E 2SGDE 4WH8A 3M36A 2GDEH 3CS7A 2FXRA 3GYLB 1SLXB 1XXFA 2ZFTA 1L0ZA 3MNCA 1IQKA 1T8NA 1B7XB 1QRZA 3K9XB 1H9HE 5EPYA 3ZVCA 3SNEA 3FN8A 1EZSC 4UE7H 4K8BA 2ESTE 2G4TA 3TH4H 4DT4A 4CBNA 1NRPH 1L1NA 4Q63A 2TRMA 3FP7E 2ZA5A 1VITH 2ZDKA 3ZZ4A 4M7GA 3AAUA 2G5VA 1GMCF 3ZVGA 1AUJA 1QJ1B 3BTFE 1WXRA 2A4QA 1P05A 4TSFD 1YGCH 3GY3A 5E0JA 1P3CA 4K1TA 2ZWLH 1GJ7B 2PGBB 1GI5A 1O5DH 2BLVA 1KXAA 2FOAA 1TMTH 4I8KA 4Q4LA 4D76A 1A1RA 1FY5A 4H42U 2FP7B 5DK1A 2RDEA 2HLDD 5GXPA 2ZNKH 4IBLH 3PLKA 2RCEA 2VIWA 2ZDVH 2ZU1A 1NU9A 1OYQA 4FU8A 1HJAC 3CS0A 2H9HA 2ZGXH 5EW1H 3RU4T 3PV4A 1PYTC 3M37A 3Q3KA 1C5QA 1O3GA 1TWXB 2JJ1D 3A88A 1BTUA 3GY7A 1B0EA 2QE7D 4GLYA 3R3GB 1PYTD 2Z94A 3MO6A 7GCHF 3GOVB 4ZXYH 1V2MT 2I6SA 4UFDH 2FOEA 1PPEE 1GGDB 1FPCH 2P94A 2WUCA 3PTNA 1WAYB 4GCHG 1O3IA 1BTXA 4JK5A 2AMDA 4FVDA 3OEHD 1C1MA 1QR3E 1YCPK 2FM2A 1HDTH 2OUAA 1DXPA 1L1GA 4HZHA 3DA9B 1WYKA 3BTME 4UFGH 4WMFA 2HPPH 3LONA 3Q3YA 3RM2H 3LGTA 4B73A 4RT0A 5EPNA 2BDIA 1NBME 1C1WH 4MG3A 4X1NU 3F6UH 5HYOA 3H5CB 1HUTH 1TABE 3KQEA 1MABB 4JZIA 5B6LA 1S85A 5GNDA 4B71A 5J4SA 2QXGA 4XBCA 1ELEE 4OM9A 2PUXB 1LHFH 3O8DA 3CP7A 2W7UA 5GPIB 3ATIA 1O2VA 1GJ6A 2XW9A 3GDSA 4CHAB 1SSXA 1SPJA 1ZSKA 1ELVA 1NRQH 1O2GH 2A45B 2O8MA 4BAQB 1NTPA 1O2UA 3MO3A 3UREA 1CA0C 1RTKA 2H2ZA 4WMEA 1GVKB 2IJOB 5E0HA 1YM0A 5JBCS 2VVUA 2BY9X 4MNVA 5CHBA 4Q80A 3UUZA 7LPRA 1UK4A 2CHAB 2FYRA 2QY0B 3SW2B 3UR6A 4CRBA 1BBRK 4I86A 3ZZ8A 1TMUH 3BTKE 3PTBA 4RT1A 2ODPA 4X2WA 1LHGH 1SGYE 4RSPA 4QT8C 4B2AA 1XXDA 3RLWH 1C5LH 3DCLA 3U98H 1MKWK 2P16A 5F8ZA 5KEDA 4INKA 1O3EA 1RS0A 3GY5A 2A5AA 5C20A 3WWBA 2NU1E 4LXBH 1W2KH 1AB9C 1AFQC 1P02A 1ORFA 1VKYA
chains in the Genus database with same CATH topology
3ZZ5A 4X0WU 2TIOA 1DVAH 1BA8B 1TGCA 1D6RA 1DSTA 3UFAA 1O2LA 1HAPH 1OWKA 2H9EH 2QN5T 1MD7A 4CREA 1DS2E 1MQ6A 1QQUA 1SQTA 2FS9A 1Q31A 3VB6A 3BEFB 2D26C 1DOJA 2Q6FA 1JMOH 3SNDA 1IQIA 1JRSA 2LNCA 4NA8A 2ANMH 3V0XA 5CE1A 2OD3B 1BTHH 4U32A 3M7TA 3TJVA 4ZKOU 4INLA 2ZCHP 4E06H 2O9QA 3NXPA 3OYPA 3EA7A 4TWYA 1KTSB 1AE5A 2H1UA 1K1LA 4E7NA 1O5FH 1ZJKA 2O8WA 1CGIE 3SNAA 4AB9A 2XCNA 4O97A 5E2OA 1SGFA 2P3FH 3U9AH 4TY7A 2F9PA 2OCVB 3M3SA 5I46H 1SLUB 1AMHA 4RN6A 1ZMLA 2D8WA 3DFJA 1OKXA 1ANCA 2DE8A 2ANKH 3TH3H 1V2UT 4GCHF 2A7JA 1HIAB 3QZQA 1E0FD 5CHAB 3PLPA 1GBTA 1O34A 1C2EA 1DXWA 2AIQA 1FQ3A 3RC4A 1T32A 3MH5A 2ODYB 3A7ZA 1WQVH 1H4WA 3BG4B 7KMEH 3RXBA 1UO6A 4IMQA 3BIUH 1BTWA 1O3HA 3HKIB 3S9CA 1GBBA 1C2MA 3GY2A 3PMJA 4JYVH 3LGIA 4ZMAH 5FCKA 3UWIA 1KDQA 1EKBB 3AW0A 1N6YA 1G30B 5C67A 3C27B 1GBAA 5FPSA 1TAWA 4Y10E 3KL6A 4DJZB 3RXUA 2UUKB 1SG8B 2WUBA 5FCRA 2YNAA 3EGKH 1BJUA 1ZHRA 2ZO3H 6GCHG 2W5EA 3KNXA 3MYWA 2ZFPH 4AG1A 1ZYOA 1GWAA 1O2TA 3IG6B 4Y8YA 4YESB 3PROA 2G52A 4YOIA 2A2XH 4WH6A 3SU0A 1F5RA 2GCTC 3M7QA 1B0FA 5F03A 4FUCA 3ENSB 1O30A 5L30H 5T6DA 1O2HA 2GGVB 1O35A 2F9BH 3ELAH 2HWLB 1AO5A 1IQHA 2K1QA 3A85A 3T5FH 1IQFA 1O3AA 1SQOA 4NZLA 5ETXA 2CJIA 1LTOA 2R0LA 3T25A 1RGQA 1W0ZU 1E36B 1AKSA 1QQ4A 3BTWE 3RXDA 2QF0A 3ODFA 5DO4H 2XBWA 1BRBE 2PKSC 1A46H 2ZTXA 1EP6A 1GMHG 3GCHC 2A4GA 4O9VA 1PPZA 2HRVA 3BN9A 3MMGA 3U8OH 2GTBA 4AFSA 3LJJA 3GCTG 4DG4A 1A2CH 4I31A 1ANEA 3ZVDA 1C1VH 3ZYDA 4DOQA 3UNSA 1CHGA 1CQQA 1X7AC 3EYDA 3H7TA 2ZU4A 2OP9A 1SHHB 3RXJA 2FOHA 4XBDA 3A84A 3TJOA 3QDZB 1XUIA 1Y3WA 2NU3E 2OC0A 3UOUA 3FZDA 2Z3CA 1FN8A 4Q7YA 2ZGCA 1HAOH 3A82A 2G55A 5E2PA 1ETSH 2XXLA 2O8UA 1Z8IB 4AYYB 3RLYH 1HJAB 1NT1A 1OWDA 3SQHE 4IC5A 1ZSJA 1XUFA 1TOCB 2A5KA 2GCHF 3OX7U 3K65B 3BTEE 4Y7BA 3ODDA 4TPIZ 4YO9A 3F68H 1AFEH 1C2IA 2A0QB 2G51A 3SU1A 1GMDF 5GIBA 1W13U 5FHTA 4CHAC 1O2WA 2C8ZB 4K69A 4LK4A 3EA8A 4FUJA 1O2ZA 2QXIA 1AWHB 1WSSH 5JB8S 3T29A 1N6XA 5JBTA 1JOUB 3MU4A 1SFIA 5DKMA 3RXGA 2PWXA 1S5SA 1MZDA 2J4IA 1V2RT 1RD3B 1CA8B 2P93A 2F9UA 2Y7ZA 1K1MA 4AFZA 1WV7H 2GV6A 1GJBB 3VXEH 5IDKA 3SUEA 1TNLA 3ZVBA 2ODQA 4WWYA 3RXOA 2ZHEH 1D6WA 3GYMA 1C5MD 4X8UH 4MNYA 2RG3A 1DUEA 6GCHF 1V2QT 2BXUH 3FP8E 1BRAA 1TFXA 1IHTH 3ATKA 1TRMA 2BZ6H 2ZU3A 3MH6A 3QGJA 4TYDA 2RA0A 1MKXK 1TNKA 1ETRH 2XNIA 3ZZ9A 1D4PB 2VIOA 2HOBA 4BOHA 1V2WT 3I78A 1SI5H 1ELBA 1OS8A 3A8CA 1UJ1A 1V2OT 1MTUA 1O3CA 1VGCC 3RU4E 2GZ8A 1SLVB 1W14U 1O3KA 1GBJA 1C1QA 1RJXB 2PKAA 1GHAG 2ZU5A 1CA0B 4FVBA 1KLIH 2BDYA 2WPLS 5F8XA 2B5TB 3RXCA 3SUFA 1MQ5A 1KSNA 2VIQA 2ZFFH 3RXIA 4LZ4B 2PTNA 1KY9A 1W8BH 4K5ZA 1E37B 4Y8XA 1ELGA 3PO1C 3LGVA 1O2JA 3OU0A 2CV3A 1TYNA 1PQ7A 3AAVA 1QA7A 1P2KA 4WXIA 1GMHF 2H5CA 2BY8X 2WYGA 1HAVA 3KF2A 1W7XH 1TB6H 5EQRA 1Z6JH 5F8TA 2ZI2H 2RDLA 1P0SH 2NU4E 3SO3A 1KXDA 1AB9B 1AFQB 1HFDA 2B7DH 3ATMA 3E91A 1UHBA 2JETB 3MOCA 2BDAA 3LDXH 5CHAC 5LGOA 1GI2A 1UVPA 1THRH 1ELFA 4NIVA 3S9AA 5DP4A 1BHXF 1G3CA 4YM9A 1VCQA 3KQBA 1P09A 3RXHA 4A92A 1NZQH 3QZRA 3TGJE 1M9UA 1ZSLA 2EI7A 3BEUA 1QL7A 1T4VH 1C4U2 1RRKA 2ZG0H 4ASHA 1GL0E 2KAIA 2SGQE 1UK2A 4I33A 1GI4A 1SGQE 4D7FA 1P9SA 2AGEX 5TJXA 1SGNE 2D2DA 5HXFA 1O3OA 1AE8H 4X8VH 3OTJE 2Q1JA 4VGCC 1DSUA 1HAHH 1FONA 3SV9A 1GDNA 1ID5H 4HGCA 2FESH 5ESBA 2R2WU 1C2HA 2FX6A 5JYIA 9LPRA 1XUKA 4BTUB 3SBKA 5AF9H 4DIIH 1V2TT 2F91A 1Y5BT 4YTAA 3A8BA 2BY5X 3W95A 2PGQB 1ABIH 1LO6A 1HIAA 3LU9B 1BTPA 1SGDE 2AGIX 1ZTLA 4J1YA 2JH0D 1BB0B 2AGGX 1MU6B 2AMPA 1GL1A 3E90B 4NWLA 5L2YH 1XM1A 1GI3A 3RMMH 2VJ1A 5C1UA 1TGTA 2C4FH 1O2XA 3GICB 2PV9B 4OS4A 5JDUB 1PJPA 2VB0A 3S9BA 3ZVFA 2AFQB 1EXFA 2P8OC 1H9LB 1EB1H 3VGCC 2R2MB 2VVVA 2J38A 1ZPZA 4FXGH 4AFQA 2GT7A 4IC6A 2TGPZ 1GHAF 3AVZA 1SC8U 4B75A 5FAHA 3ATLA 4A7IB 3T28A 3ZVEA 2YNBA 1RIWC 2WV5A 3SHAH 1C5PA 2GCTB 1BJVA 1YP9A 1H1BA 1N8OC 2F83A 4ISNA 1GJAB 2AYWA 2ZFQH 4I8GA 1W11U 2F9OA 1GBMA 3S69A 1C4V2 3LGYA 1CHOG 2TPIZ 1UTNA 3BSQA 1HJ8A 3K6ZA 1SOTA 1BBRH 2GZ7A 1PFXC 3P70B 1PPCE 1H9IE 3F9GA 1QB9A 2ZDMA 3MI4A 4YT7H 3SV2H 4BAMB 1LVOA 2QV1A 1CE5A 1O2OA 3MNXA 4IGDA 4X2VA 2BQWB 2STAE 1LVMA 3FVFB 1P01A 8GCHF 5DP5A 4R8TB 1A3BH 2Y6TA 4MDSA 2VINA 3Q00A 8LPRA 1MKWH 2BQ7B 1P06A 4AFUA 2PKSB 1CBWB 4Q7ZA 4AX9H 4F4OC 3RP2A 1FNIA 4BXWA 1QBNA 3GCHB 5EW2H 1UVOA 4D8NA 1VR1H 1UCYE 2ZC9H 2BD8A 3SOSA 1EJMA 1WUNH 2C3SA 1GHZA 2XBYA 5A0AE 4U01A 1TGBA 3E16B 1KXFA 1A5IA 3O8BA 1ABJH 9ESTA 1O5AB 4DIHH 1OWIA 3ZVAA 2VWMA 2BD4A 1J15A 3RXVA 1O5CB 1MBQA 2ZDLA 1V2ST 4FUDA 3STJA 5B6OA 4WXVA 4CBOA 2ZKSA 5LPEA 2JH5D 1XVMA 4ABEA 4X8SH 1LPGB 2BX3A 3F9FA 3TJNA 1BMAA 1GHXH 4BTTB 5C5NA 6LPRA 1TGSZ 3NKKA 3UY9A 3MWIU 3LJOA 3OY5U 1NRNH 1SFQB 4K60A 3SJIA 3IITA 1TRNA 3B8JA 1THSH 3DHKH 1CVWH 5LPRA 1T8MA 3UR9A 3MU8A 1P03A 3SJKA 2AH4X 5AFYH 1OWEA 1EPTC 3BTDE 1Y3UA 3HGNA 4KTSA 4AB8A 1SGRE 4OGXA 4UDWH 4BXSA 3GY8A 1AI8H 4I7YH 4GAWA 2R0KA 3KCGH 1C5WB 4ZHAA 5K0HA 2PSYA 3E0NB 4NCYA 4CH2B 4HTCH 4AYVB 1DY9A 1NFUA 1FY1A 1T4UH 1EZUC 2C93B 1XVOA 3PMAB 1K21H 1ZHMA 1P2IA 1DANH 4X6OA 2Z9KA 3NZIA 1YBWA 1C5UA 4YLUA 2Z7FE 3P8OA 4NA9H 1VJAU 4ABIA 1O2NA 2ZGJA 1O36A 1S83A 1GI9B 1EOLA 1YLDA 5FPYA 2WPIS 1KXEA 1TOMH 2OQUA 1V2JT 2AEIH 3ESTA 1KLTA 4WMDA 3VPKA 1FJSA 2JETC 3UNQA 4WJG2 3P8GA 1VGCB 3A8DA 5EOKA 1PQ8A 4F49A 5GJ4B 2HVXA 3ZZAA 1CHOF 1Z1JA 1XUJA 4YOGA 3TNSA 4AGKA 1WOFA 3E1XB 3EE0B 4JZFH 1FPHH 4CRCA 2PLXA 2ZQ2A 1S0RA 4KTCA 1KXCA 2PFEA 3NWUA 1GHYH 3PO1B 1Z7KA 1C5VA 3MNBA 3TK9A 1C1NA 2BD2A 1SHYA 1UTQA 2YOLA 1UTOA 1A3EH 1C2KA 1IHSH 3SJ9A 3TLOA 2SFAA 2SNVA 1C2JA 3P17H 1P2MA 4NA7A 4AG2A 3T27A 1TNHA 4I32A 2DE9A 1QGFA 6ESTA 1GJ8B 3OY6U 1HLTH 1GJ5H 1C9PA 2A31A 4JYTA 4OS7A 1GI1A 1AZ8A 1DY8A 2GCHG 1QRWA 1LPKB 2BHGA 4ABBA 1DICA 2FTMA 4BAOB 2B8OH 1BMLA 1O3PB 2ASUB 1GMDG 1OSSA 2HNTE 3VB5A 1TNIA 1CGHA 2BB4A 2XWAA 1P11E 2GV7A 1TONA 5DP9A 4BAKB 2GD4B 3A7WA 1EB2A 3QTOH 4IN2A 2B0FA 3UPEA 3FZZA 3VB3A 6CHAC 4Y11E 1TQ7B 1MUEB 2XWBI 3SQEE 1BTYA 5EXMA 1Y3YA 3PWBA 1KIGH 5C1YA 1TBQH 1J16A 4VGCB 3RC5A 1ELDE 4GHTA 4MPUA 1OWJA 1Z6EA 3BTHE 3PYHA 1C2FA 3BF6H 1ZTKA 4FUHA 1MH0A 1O3BA 4UEHH 1NN6A 5G4BA 1SGPE 1TGNA 4GVUA 5EQSA 1EASA 1FI8A 2Z3DA 1D9IA 1V2NT 2XTTB 1G37A 4LOYH 5K7RA 2J94A 1NU7B 1Y8TA 4DT7B 4A5TS 1G3EA 1QL8A 7ESTE 4TY6A 1V2PT 1YPLH 4NIXA 1FDPA 1BMMH 1OX1A 5EQQA 2VGCB 3SI3H 1CT2E 5TCAA 1A0LA 5SGAE 1G32B 1KYNA 3KEEA 4MPWA 3BIVH 1O0DH 2FX4A 1GG6B 1HAYB 3KQDA 3ZZBA 4ZXXH 4I8LA 3PLBA 1ELAA 1TBZH 1HNEE 1GDUA 1PQAA 4H6SB 4Y7AA 1O2IA 3RXEA 3KHVA 1VCWA 1ZMNA 1O3JA 4I8JA 4XFQA 1O3DA 4NZQA 4SGAE 1HAZB 1PPBH 2AIPA 4GPGA 4XSKU 1XMNB 2NWNA 4X2YA 4ZHMU 3A81A 1C5TA 4JK6A 2HNTC 2ZECA 2CF8H 3RMLH 2P8OB 1MKXH 3NPSA 5H4IB 3SGAE 3VGCB 1O5BB 5L2ZH 1TPSA 1CBWC 1GJ4H 5FBIA 3RXLA 4MTBA 4GHQA 4OGYA 4FUEA 1K22H 1A5HA 3RMOH 3URDA 1YPMH 3FAOA 1RIWB 4Y0YE 1PPGE 1O5GH 1N8OB 1DWCH 4DCDA 1A0JA 1FLEE 3QN7A 1Z1IA 3GCOA 1BITA 1LDTT 2ZQ1A 2QIQA 2P3TB 3P6ZB 2HALA 3UNRA 2W7SA 3GISB 1J8AA 3V12A 1ZR0A 5FX6A 4FUGA 1LVBA 1V2KT 2A2QH 3V13A 3A80A 1D3TB 3EQ0H 1GBLA 1FUJA 1SR5C 4AZ2B 1F0SA 1HV7A 3FP6E 3M5NA 4D9QA 3U69H 1TIOA 3MU5A 1GPZA 1TX8A 2Z9JA 2ZPQA 3A7XA 3I29A 1ZMJA 4NIYA 1G2LA 2EC9H 2ZF0H 3SV6A 3SV8A 1JIRA 1W3CA 1P57B 1UTLM 1HPGA 1BZXE 3SU6A 1ZLRA 3E0PB 1XX9A 3M35A 1TA6A 1ZOMA 3SHCH 4KP0A 2BQ6B 3DT0H 2G00A 1O2MA 1NFXA 3EAJA 3TU7H 4E7RG 3MFJA 1OOKB 2UUYA 2C8YB 5DGJA 3S0NA 3P95A 2G5NA 3TIUA 3UWJH 1QFKH 3SUDA 1T7CA 1D3PB 1ETTH 1SOZA 3MH4A 1W7GH 4UONA 2CXVA 2FS8A 1C1PA 3QLPH 1Z8GA 1OXGA 2H5DA 1GBDA 1EATA 2F3CE 4I8HA 4U2WA 4H6TA 5LPFA 3KN2A 4BAHB 1MAXA 2ZGBH 1C5RA 2F9VA 3RXMA 1JWTA 1A7SA 3LH3A 3V3MA 4ZROA 1EPTB 2V6NA 1ANDA 2QCYA 1IOEA 2BXTH 3PMBB 1O38A 1TLDA 1AIXH 2ZTZA 1WBGB 3UQOA 3BTGE 4B74A 3QO6A 1HXEH 2CN0H 1MMJN 1HAGE 4X1RU 5BPEA 2FI4E 3RC6A 1EQ9A 1HYLA 4K3JA 1IQLA 2QXJA 1H8DH 5GCHF 4INHA 1BTZA 1QURH 4ZHLU 4J2YB 3M3TA 3RMNH 1SMFE 5ABWA 1SGIB 4OS1A 1NFYA 1FZZA 3MTYA 1YKTA 1GHWH 4JZEH 3M5MA 1F92A 1C9TA 1GJ9B 1DWEH 1C4Y2 1O32A 2O8LA 4YT6H 2QAAA 1AQ7A 2XC5A 3SN8A 4JCNA 3QWCH 1MCTA 4B76A 8GCHG