1EZUC

Ecotin y69f, d70p bound to d102n trypsin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNNIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title Compromise and accommodation in ecotin, a dimeric macromolecular inhibitor of serine proteases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
total genus 52
structure length 223
sequence length 223
chains with identical sequence D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezuC01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezuC02
1MKWK 3MI4A 1TX6A 1QJ7B 5A2MH 2BM2A 4TY7A 1CU1A 1W7XH 1XUFA 1C5QA 1BRCE 5EG4A 5C5OA 2DE8A 2BXTH 4ESTE 2NWNA 1IQFA 1TRNA 2EI7A 3GCHB 1UCYK 1O3MA 1J16A 5EW1H 1GDUA 1YGCH 3C1KA 2A7HA 1P06A 1Z1JA 3TGKE 4BOHA 1WQSA 1BJUA 1C2JA 4UFFH 2OLGA 2Z3EA 1C2FA 3MU0A 2WPHS 1MTSA 3TK9A 5DP4A 2ZGJA 2ZGBH 3GCNA 1LPZB 1N8OB 2TGDA 3ZZ5A 4GHQA 4BAMB 1DWBH 2PW8H 1O0DH 2Z9KA 5GWZA 3QWCH 5F03A 4ISOA 2FO9A 1YPMH 3SNEA 1S0RA 1O2VA 2AH4X 3OSYA 1RXPA 4Y8XA 1KTSB 5TCAA 1Z8JB 3P70B 3F9EA 4F49A 1C1PA 4LOYH 3D62A 4K2YA 2A2XH 2BX3A 4I7YH 1GBEA 3M5NA 3SV9A 2PTNA 3KQDA 3GY8A 1AFQB 3P8GA 3F1SB 2UWPA 4AG1A 4JZEH 2FTLE 4K1SA 1CSOE 1VITH 1T8OA 1T4UH 3R0FA 2O9QA 1ZTLA 1O2YA 4NA7A 3URDA 2O8WA 2OQUA 1RTFB 4NIYA 3ZYEA 4RKOB 1G3BA 1ELAA 1W2KH 2W26A 2IPHA 5E0GA 4YM9A 1P10A 1SGCA 3EQ0H 1FMGA 1IQHA 1O2NA 2ZDMA 1GBIA 4IBLH 2ZFFH 2A1DB 1T8MA 4NA8A 1MUEB 1EPTA 1TBRH 1XUKA 2FX6A 2GZ7A 2Q6FA 3PLKA 4JZ1A 4OS6A 1LVOA 2PLXA 4AFZA 1TALA 2FP7B 1UVTH 6LPRA 1DXPA 2B0FA 4Y6DA 2HPPH 1C5ZB 4Y7BA 3DHKH 4WJG2 3DD2H 1U6QA 3DA9B 4DOQA 2EI6A 2JKHA 1GJAB 2ZI2H 1HGTH 3LIWA 2OD3B 1KIGH 1BHXF 3GY5A 3GISB 3RC4A 4VGCB 3SJ8A 3SNAA 1V2WT 3U8RH 1TX7A 2ALVA 1ELTA 2HOBA 2WPIS 4YESB 1PFXC 4MDSA 4Y0ZE 1ZMJA 2VNTA 1P01A 2D8WA 4IGDA 3UR9A 2ZPRA 4I8LA 3M5OA 2TRMA 3SNCA 1QIXB 2FOFA 4UFEH 3T62A 3S69A 4K8BA 2AGEX 2WPKS 4LZ1H 3RXJA 2BY9X 4X1NU 2ZFRH 1F0UA 3U8OH 1F0TA 1KXCA 3QZQA 4ZXYH 1JMOH 1SLVB 1GMDF 3UNRA 1TGTA 4YOIA 1MTUA 3ATIA 2HVXA 2ZU1A 1DOJA 4K1TA 2B5TB 4FUHA 1BDAA 3SI4H 1MAYA 2BD4A 2B9LA 1SHYA 5L30H 5HMAA 3SW2B 4ZHLU 2ZZUH 3OTJE 4D76A 4DCDA 3A81A 1PYTD 1CA0B 1O5CB 1LKAA 3RM2H 1VGCB 2J94A 1JIMA 3VGCB 1N6YA 3TU7H 4AZ2B 1Y5BT 4ASHA 1O2TA 1E38B 1IAUA 1TNGA 4UFGH 1O3BA 1HB0B 9LPRA 3GCHC 1OS8A 3E6PH 3K2UA 3M7QA 1QB9A 4O3UA 1O30A 1DUAA 1PJPA 2RG3A 4DGJA 4THNH 1GHWH 1MQ5A 5DKMA 3ZVEA 2QA9E 2ZA5A 4Y8YA 1Q2WA 2XC4A 2CHAC 1LTOA 1CT2E 5FX5A 1MTWA 1O37A 1LO6A 1EPTC 3EAJA 1PPEE 1N8OC 1TMTH 2R2WU 2V35A 5A8ZA 1KLIH 2G81E 3CS0A 1ORFA 4ABBA 5C67A 4FUFA 3UQVA 2Z9IA 3D23A 2P3UB 4TY6A 1WYKA 2ASUB 2J2UA 1SL3A 2QN5T 3T2NA 1C2LA 2VINA 1DSTA 4JZDH 1L4DA 1AGJA 1O3GA 3MNSA 3LH3A 5ESBA 3SUFA 1BQYA 4YTAA 1UTJA 2R2MB 1ZSJA 1ZYOA 4OS2A 1AFQC 2FPZA 1L1GA 2V3HH 1C1OA 1F0RA 5A0AE 3ATLA 3M5MA 1GDQA 2XXLA 1IQKA 3BV9B 1XMNB 2BYAX 2GP9B 2UUKB 1N1LA 3A7ZA 1ZTKA 1ZPBA 2ZGHA 1D3TB 4AX9H 1SOZA 3FANA 1BRAA 2CN0H 1IQIA 2G5VA 2CJIA 2FOHA 3EE0B 1Z8GA 2R3UA 1LDTT 1P2MA 1K1NA 1SGNE 1FONA 1V6DA 1Z6EA 4FVDA 1GI1A 1WAYB 3GYLB 4SGBE 4ABDA 7ESTE 1W11U 3RXUA 1LVYA 1EOLA 1C1NA 1O2GH 2JETB 2SNWA 4NFFA 5T6FA 4K1EA 3PB1E 2AMPA 4HTCH 1AKSA 2FWWA 2UUYA 4WMDA 2Z7FE 1O38A 3UPEA 4F4OC 1P3EA 1TONA 1AIXH 1DX5M 1CA8B 2OC0A 1JXPA 1NS3A 4VGCC 4CBOA 4YT7H 2C90B 2Y7XA 1QQ4A 1DDJA 4J1YA 1B5GH 2PFEA 1RFNA 1LCYA 3RMMH 3MNBA 3TH4H 1EJMA 2FZZA 1AO5A 2XC0A 3KEEA 1PPZA 1NN6A 3O8BA 1GBDA 4X1RU 2VIPA 1TAWA 3A7YA 1TGNA 1V2JT 1GPZA 2VVUA 1FAKH 1TX8A 4MNVA 1DFPA 2HRVA 1JWTA 1ANCA 1C5RA 1PPGE 4A1VA 2VIWA 3SZNA 3A8DA 1SPJA 4INLA 2FYQA 4K5ZA 3RP2A 3S9AA 1DS2E 1JOUB 3NWUA 3Q3KA 5HGGA 1ZHRA 2ZHQH 1IQMA 2ZEBA 1ID5H 1D3PB 4K60A 4KP0A 4BAKB 4JCNA 1TE0A 4B2AA 4HFPB 1AI8H 1ACBE 3PV4A 1XUHA 4BNRA 3K6YA 1T8LA 1C5PA 1ZSKA 3BIVH 1HAYB 2O8LA 4WY3A 4ZKOU 2AYWA 5FCKA 2C8XB 1ESAA 2Z94A 4OGXA 2WUBA 3W95A 1HAPH 1RRKA 5FAHA 2C93B 5A09A 1YF4A 3FFGA 3K65B 3SV8A 1ZMLA 4JZFH 1NC6A 2ZECA 2VH0A 1QL8A 1ZRKA 5C20A 3V13A 1ANEA 2F9UA 4I8JA 1O3NA 1T4VH 2FLBH 1YPEH 2ZHEH 3VB3A 2IOTA 2J95A 3MWIU 1SQTA 3BEFB 2XYAA 1IQGA 3ATKA 4GVUA 1D6RA 2PHBA 2XRCA 2NU2E 3ODDA 1E36B 1O2QA 4U2WA 1TA2A 3URCA 2VIVA 3RXVA 1ANBA 5I46H 8GCHG 4RN6A 5A0CA 3S7KB 1FI8A 4M7GA 4ABHA 1C5YB 2ESTE 3B8JA 5C1XA 3TJUA 1ZOMA 3A86A 3H7OA 1O33A 2JH5D 1GBLA 3EGKH 3A82A 1TNKA 1SGEE 2G52A 1QCPA 2P59A 2VWMA 3A8BA 2RDLA 1P9SA 1BA8B 1EX3A 1QBNA 4HGCA 3BN9A 3M3SA 4NG9H 1GBAA 1PPFE 3T25A 2ZFPH 2QXJA 1DY9A 1HAGE 2W3KA 5HXFA 1CGIE 3VPKA 8GCHF 3O8RA 4ABAA 2GDEH 3RXLA 3K9XB 2WUCA 1EB2A 1P3CA 3P8NA 3ESTA 1S5SA 1AUTC 1AWHB 4DIHH 1SMFE 3AW1A 5GCHF 1QGFA 3PMBB 1EASA 1HJAB 3QGNB 2XBXA 2O8TA 1X7AC 2BY5X 3LGYA 5H4IB 1IHSH 3RXGA 1O2OA 1SHHB 3KGPA 1C5UA 1FJSA 3BTWE 2JETC 4B1TA 1O35A 1J9CH 1G37A 4CRAA 3RU4E 4CRBA 4D7FA 2ZTZA 2ZC9H 1C2GA 1FN6A 3U1JB 3LGVA 1FAXA 1CQQA 3P95A 2O8MA 2A5AA 4ISLA 2H9HA 1Q3XA 4ABEA 1EP5A 1SQAA 4Y79A 1T31A 3QUMP 2Y80A 1FNIA 5BRRE 3R3GB 2BQ7B 5EGMA 3LGWA 3MTYA 5F8ZA 4BAHB 2C3SA 2BY6X 1O39A 1TBQH 3SOSA 1XVOA 1V2VT 2OC8A 2PKSC 2AFQB 1LMWB 3BTME 1A3BH 1MKWH 2PGBB 1AB9B 1VCQA 3FZDA 2FESH 2K1QA 2ZFSA 2C8WB 2BDGA 5C1UA 2Z3CA 4KTUA 2FYRA 4D7GA 1GJ9B 3FAOA 4R0IA 3MO3A 1C2DA 3SHCH 4Q7ZA 1G2LA 1HAXB 1FY8E 1UHBB 5C3NA 1SFQB 4LK4A 2VJ1A 3NUMA 5EPNA 4AB8A 4BTUB 1BMAA 1WU1A 1LHGH 1GL0E 2H5DA 2D26C 2QF0A 4GCHG 1OWJA 1TB6H 1VJ9U 1ZSLA 1ARCA 3ZYDA 8ESTE 1SR5C 5AFYH 3BTKE 4JK6A 3PTNA 3TJOA 5J4SA 3AVZA 4A1TA 1BITA 3FP8E 1TPPA 7KMEH 1O31A 1MTNB 1AZ8A 1E0FD 1KYNA 4ZHMU 2FS8A 1BTWA 4H4FA 3TH3H 2Z9GA 3GY2A 4KTSA 2OBQA 1LPKB 4ISHH 5T6DA 4CHAC 4X0WU 4E06H 4NCYA 2UUFB 1BJVA 1IQLA 4Y10E 4MNXA 4O3TA 1QB6A 6GCHF 1O5AB 1Y59T 4FU8A 4X6NA 3ATMA 2QY0B 1T8NA 1W13U 1SGDE 2AS9A 2BDBA 3N7OA 2QXHA 3SU5A 1SVPA 2P16A 2CMYA 1IHTH 2WV4A 4A5TS 3T28A 1YM0A 2ZU5A 1ESTA 1O2MA 1YCPM 1GHVH 1KXBA 3PLPA 4AYVB 5DP7A 1TNHA 3GY6A 1GBFA 1ELEE 2OC1A 3ZV8A 2VGCB 1PQ5A 3RMLH 3ZZ4A 1P05A 3OY6U 1TNJA 1TA6A 5A0BA 2GT7A 2BVSH 2W7UA 3SU6A 1JBUH 2PKAB 3LH1A 1GHBF 2STBE 2PGQB 4AGJA 2ZU2A 1S84A 4AFUA 2F9BH 2UUJB 3EA9A 3RDZA 3UIRA 2VWNA 1F5LA 1S6HA 1Z8RA 1GMHF 4YLUA 3BTTE 5EU8A 2Q6GA 1OWKA 2G4UA 1W0ZU 1RTLA 1OP8A 1GI9B 4Q7XA 3SQHE 4B73A 2A7JA 4FUGA 1BIOA 1S6FA 1HRTH 3BIUH 5BPEA 3QO6A 3ZZ6A 3JZ1B 1FPHH 2F9OA 1O5EH 5EQQA 3ZVFA 1A5HA 3MU8A 2W7SA 1XXDA 1P12E 1EP6A 3KQBA 3KQEA 3PYHA 2PUXB 1HV7A 1XKBC 1DITH 1CVWH 1G3CA 3AASA 3MHWU 3NKKA 1L4ZA 3SU2A 3L33A 3P17H 5L2ZH 3JZ2B 1P02A 5J4QA 5CHAB 1P2IA 1W8BH 1TGCA 2YNAA 1O3LA 2OCVB 3F9GA 4FUJA 1NY22 4YT6H 4UEHH 1GHAG 3E90B 3LJOA 1GJ6A 1K1OA 2SGFE 1EAXA 2GMTB 3LPRA 1O3AA 1XUJA 2H9EH 5I25A 2CF8H 3H5CB 1QNJA 1WSSH 5IYTA 4TPYA 3E0PB 1HDTH 2BD7A 3NCLA 2PTCE 2A31A 3GY7A 2BLOA 2EC9H 2J4IA 1DSUA 1PPBH 1GMDG 1UMAH 4Z6AH 2BB4A 3E1XB 2XNIA 3FVFB 1AB9C 3NK8A 1W10U 4MNWA 2BMGB 2TPIZ 1YKTA 2ZHDA 5TJXA 1YPHC 1QA7A 3STJA 3SUEA 1CE5A 4U32A 1DANH 1K1PA 1CT0E 2WPMS 4NGAH 1SLXB 1GHAF 2A45B 1ELGA 1TPSA 1HLTH 3QGJA 2XCNA 4OS4A 2FODA 1WUNH 1C5MD 2BD3A 4NZQA 1GI6A 3SJIA 2F91A 1DPOA 4MQAA 3S9BA 2ZTYA 1FZZA 4ZUHA 4I8HA 1J17T 3SNBA 1ABJH 2HWLB 4ZKRU 3SI3H 1TLDA 1C1UH 1LQDB 3DT0H 1P11E 2QXIA 1YP9A 2LNCA 3RXIA 1A0HB 1OX1A 3HGNA 1QRWA 2HLCA 2ZQ1A 3RXSA 4WMEA 2ANMH 1Z7KA 1C5XB 1GVKB 1VZQH 1SLWB 2BZ6H 1K1LA 3RMNH 3UY9A 1AVGH 3UOUA 2FOCA 1NROH 1K1IA 4NIVA 4DIIH 4X1QU 3V12A 1EATA 1EKBB 4ZKNU 2FOBA 2BOHB 4AFSA 2BQ6B 2Y6TA 3TNSA 3I77A 1A0LA 3UTUH 3ATWA 1YCPH 3K6ZA 1EZUC 1GI4A 4JYTA 3GYMA 3MYWA 2A4RA 1QJ6B 5JBAS 1CHOF 2EI8A 1MCVA 3ZZCA 1K22H 1Y5UT 4H6TA 2XW9A 1GI3A 5LPEA 4IW4E 3UNQA 2VWLA 2D2DA 3TH2H 3I29A 2ZCHP 1T7CA 3RXBA 3RMOH 1TGSZ 3RLWH 2ZFTA 2QYIA 2AGIX 1HIAB 1BUIA 1CO7E 1EOJA 2XCFA 5A8XA 3W94A 3MH5A 4BANB 1NM6A 4MVNA 2B7DH 1J14A 1K2I1 3CENA 1HAZB 2VVVA 3QX5H 2ZGCA 3RXTA 1ELFA 3A85A 4BAQB 2VH6A 1ZTJA 3H7TA 3BTDE 3M36A 3T27A 2RA0A 3UOPA 1QBVH 2JH0D 2VIDA 1D3DB 4AG2A 2TGPZ 1EAUA 3PROA 3S9CA 1Z71A 3LC5A 2ZO3H 1A2CH 2FI4E 1GBMA 2QIQA 4JYUH 2BVRH 2QV1A 4FVBA 1THRH 2XC5A 1Q31A 3ZZ8A 2OUAA 4I32A 1O3KA 3VXEH 1YCPK 2GD4B 1AN1E 2BY7X 1YPLH 2BOKA 4CR9A 2P8OB 1ZR0A 3GICB 1H1BA 2J34A 4ZROA 3P92A 1CBWB 1TNIA 1AVWA 3DFJA 3P8OA 4IMQA 5CHAC 2J9NA 4UFDH 1EZXC 4CH2B 2QF3A 2Z6BD 5L2YH 1BRBE 5T3HA 4DW2U 2GMTC 1UJ1A 2ZDAH 4XBCA 1GHYH 2ANKH 1O2IA 3P8FA 1TGBA 1GHXH 1BCUH 3BTQE 5GJ4B 2QGRA 1GCDA 1NESE 1MTVA 2QXGA 2HPQH 3T29A 1NZQH 4XBBA 4CRDA 2ZPSA 4AN7A 5DK1A 3RM0H 3SU4A 1SGPE 1UTPA 1KSNA 2F83A 4BTIB 1XVMA 1XKAC 1GJ4H 1ZLRA 2A2QH 2H1UA 3D65E 3QZRA 2LPRA 1F2SE 2PUQH 5F8TA 2THFB 1OOKB 4WH8A 5C1YA 3ZZ9A 4FUIA 3ZZ3A 3LOXA 1GI2A 1SGTA 4AYYB 5HM9A 1S0QA 1QL9A 4NWLA 4X2VA 4CH8B 2AGGX 2TIOA 2ZP0H 3MMGA 2DUCA 4MPVA 5A8YA 1C2EA 1J8AA 2GTBA 1PYTC 3LGUA 1QRXA 1H4WA 1A61H 1QHRB 5EW2H 3V7TA 2BLVA 3RXHA 2XWBI 2FOAA 3ZVBA 3SHAH 1QTFA 1TYNA 3DUXH 5DP5A 2GV6A 1GCTB 2BX4A 1S85A 2BQWB 4XBDA 2GCHF 1BHXB 2STAE 4RSPA 3MOCA 1QURH 2OQ5A 2WINI 1GG6B 3TIUA 3HK3B 5DP8A 1ZJDA 1MKXH 1PPCE 1FQ3A 3TLOA 4NZLA 4X2XA 2OC7A 3ZVDA 2ZDLA 1CA0C 4MPWA 3LU9B 1XM1A 4X6PA 4OS7A 1VGCC 2TBSA 1AD8H 1NT1A 1OWIA 2V6NA 3VGCC 1KDQB 1TQ7B 2Q6DA 1O2SA 3E8LA 1LHEH 4GPGA 2GV7A 2IN2A 1HUTH 5FPTA 2BY8X 4A6LA 1XUIA 1HAHH 2HNTC 1PQ7A 4OS5A 3TJVA 3LGIA 1ZJKA 3RXAA 4Y76A 1NU9A 1P2NA 2OINA 1DLKB 1V2ST 1G32B 3EYDA 3F68H 5FBEA 2FMJA 3ENSB 1C5SA 3BG4B 2Z9JA 4J2YB 3SUGA 1IQJA 3SV7A 1BTHH 3HK6B 1GI5A 1THSH 2P95A 1TIOA 2CGAA 4UONA 4DY7B 1UK4A 5JBTA 1C1QA 1S81A 4KGAA 3GDUA 1CHGA 4TWYA 1SI5H 3UNSA 1AQ7A 1IOEA 4NFEA 3VXFH 3LONA 3SU0A 5GCHG 1K1JA 4FUCA 1H9IE 4AFQA 2SGQE 8LPRA 4I8KA 1F7ZA 1SB1H 1MKXK 1KDQA 1HXFH 1AY6H 1YPKH 3M61U 3ZVCA 1ETRH 1HJ9A 2VIQA 1QJ1B 3KHVA 5FPYA 3I78A 2BD5A 1H8DH 2ODPA 1AE5A 2ZDNA 3MH7A 1J15A 2XWAA 1FN8A 3T26A 5EXNA 3BEIB 3VB7A 1XXFA 2XTTB 5GIBA 2FEQH 1H9LB 2TGAA 4O03A 3GDVA 2ZQ2A 1GBKA 3TNTA 5GPIB 4X6OA 1H8IH 3SUDA 1Z6JH 1RD3B 2GZ9A 1HYLA 1DE7H 1L2EA 1W14U 5PTPA 4IC5A 1O32A 1BTUA 1C1RA 2F3CE 4X8UH 1CBWC 1FY1A 1F5KU 3MNCA 2JH6D 3M7TA 5AFZH 1CGHA 3D49H 3HGPA 1NRNH 4JZIA 2AIPA 1GWAA 3E91A 3STIA 1BBRH 1BBRE 5FXLA 2P94A 1UVSH 2ZU4A 5E0JA 1AZZA 2BD2A 1MD8A 2Z9LA 1NFYA 4MPXA 2R0LA 1AWFH 1D4PB 3MFJA 3RLYH 1LQEA 1VCPA 1VITF 5FCRA 4UDWH 5LGOA 1QL7A 2QAAA 3Q3XA 4BTTB 2Y5GA 1FLEE 1W0YH 2GZ8A 1EJAA 4WH6A 1NO9H 1UTKA 1QFKH 1QR3E 3MU1A 5AF9H 3ZZDA 1ZZZA 3OY5U 1V2RT 1L1JA 2W3IA 1G3DA 2G5NA 3ZZ7A 1UVPA 3RXOA 4DURA 2G8TA 3FZZA 5E8EH 3U69H 1HAOH 4NIWA 1TBZH 1SGQE 5LH8A 5EQRA 1K28D 4ZMAH 5HM2A 5K0HA 2P3TB 1Z8IB 3RUOA 1C2HA 1GCTC 1C2KA 1P2OA 3B9FH 1O3FA 3EA8A 4AGKA 4Y11E 1HAVB 3BTFE 1UTOA 4GUXA 3MNXA 2FOGA 2FTMA 6GCHG 1KLTA 4OGYA 1V2UT 3BF6H 1E37B 2M5TA 1GJ8B 4Q7YA 4D9QA 1O2HA 1UCYE 1BBRK 2HALA 1BMNH 5GXPA 3SQEE 3RU4D 4CBNA 2A7CA 1GVZA 4Y7AA 3RXQA 4NSVA 1C4Y2 2SGEE 1JRTA 1AVXA 1ELBA 2XBVA 1SGFA 1OYQA 2G55A 1D9IA 2HNTF 4Y71A 4ABFA 5HYOA 2A4QA 4B2CA 1TQ0B 5DO4H 4X8TH 1PQ8A 1A46H 4H6SB 1NFWA 2OP9A 5DPAA 1INCA 1EAIA 2OTVA 2FLRH 1C4V2 5DP9A 6ESTA 4D8NA 3BG4C 3E0NB 1UHBA 1MZAA 1GHBG 2P93A 2PSXA 4HZHA 2C8YB 1TWXB 1TNLA 3OX7U 2Y5HA 2HGTH 1G36A 1HAVA 4WXIA 2G4TA 1FV9A 1AMHA 4AB9A 3A83A 2IJOB 1GMHG 1TMBH 5F8XA 1SQOA 1RIWB 1WTGH 3SV6A 2FM2A 1AE8H 3UFAA 5AHGH 1FDPA 4MLFB 4YOGA 3M3TA 4R8TB 1A1RA 4FXGH 1O34A 4X2YA 1AFEH 1GJDB 4INHA 4INKA 1BRUP 1M9UA 1BTPA 1D3QB 4I8GA 3KQCA 5JB9S 3NPSA 1OP0A 3SV2H 3KCGH 4I33A 2WPJS 2CHAB 3T5FH 2WYGA 7GCHG 5JPMH 4A1XA 1BOQA 2GT8A 4TYDA 2FOEA 1P09A 2V3OH 1EPTB 1FIZA 1NU7B 4FU9A 4X6MA 5EXMA 3RXFA 1S82A 1A5GH 3SGAE 2CXVA 4CRFA 1ELVA 1HJAC 4MNYA 5JYIA 1LHCH 1SLUB 1P04A 1MQ6A 1P9UA 3QTOH 3SGBE 4KKDA 2KAIB 1HFDA 4Q80A 1DLEA 1O3JA 3SN8A 1MBMA 2A0QB 2D1JA 2B8OH 2BLWA 1HCGA 1MH0A 3SORA 5AVDA 3S7HB 4JYVH 5FX6A 5FPSA 1O3EA 3O8CA 3MO9A 4CREA 1DICA 1OYTH 4ZAEA 7GCHF 2OXSA 1XX9A 1CGJE 1JRSA 3VEQB 1SFIA 1DXWA 4AORA 1FIWA 1DT2A 1F92A 1O5GH 2F9NA 3ITIA 4IS5A 3EDXB 1GBBA 1B0EA 2PKAA 3A7WA 2NU0E 2SGAA 1A5IA 1C1VH 4X8SH 3TK5A 1GI7B 4ZXXH 1B7XB 2Y5FA 2SGPE 4FUDA 3MH6A 2BDCA 2VWOA 1GBTA 1C9PA 1GI0A 3SO3A 3A89A 4ZHAA 1WV7H 3PO1B 3VB5A 4QT8C 2SFAA 1PPHE 2BXUH 4B2BA 5ABWA 3A84A 4ABIA 5C2ZA 4IN1A 1UVOA 2ZHWH 1MCTA 5B6OA 4WF8A 1EZQA 4CRCA 2BDIA 2ZG0H 3FP7E 1QBOA 5DJ7A 2KAIA 1WQVH 1PQAA 2FDAA 2H5CA 2R9PA 3U98H 1MZDA 4XE4A 4KTCA 2ZKSA 3GY3A 3MU4A 4FUBA 4X1PU 4B71A 1LPGB 2WYJA 3PMJA 2ZGXH 4IMZA 4A92A 4ISNA 3O8DA 4DVAU 1HPGA 1V2LT 1NRPH 1WTHD 3ZVGA 1EUFA 3ZZAA 5G4BA 1SGIB 4DJZB 3GDSA 2UWLA 4YZUA 1ZRBA 1OWDA 1MTNC 4D9RA 1C1TA 5GDSH 4YO9A 1CHOG 3UWIA 4I31A 4BXSA 2BD8A 1LHFH 2HNTE 2VIOA 6CHAB 3KL6A 3KNXA 2BD9A 4CR5A 1O2XA 1MMJN 1P2JA 1SGRE 1C5NH 3TPIZ 3BTEE 3QLPH 2GKVE 1Y3XA 2ZFQH 4MPUA 2ANWA 1C9TA 1GJCB 3TK6A 5EXLA 2NU4E 3TGIE 1F5RA 1V3XA 7LPRA 1O3IA 1W7GH 3HKJB 2C4FH 3NXPA 5DP6A 4K69A 1RJXB 2Y82A 1FXYA 3M35A 3Q00A 4AOQA 3KIDU 1YPGH 1Y3YA 2AERH 1EJNA 3HKIB 1GJBB 4ISIH 3U9AH 1KLJH 1ESBA 2ZCKP 3E16B 1ZPCA 2BZAA 2RA3A 3RC5A 3SJOA 1OWEA 1RIWC 1G9IE 4O9VA 1Y3UA 2VGCC 1O3CA 3RXEA 1C5TA 2ODYB 1BZXE 1UTMA 3MH4A 3TGJE 2A5IA 4TPIZ 1C5LH 1D6WA 2FOMB 3F9HA 1O2RA 5CMXH 1V2PT 3M3VA 3U8TH 1Y5AT 3OYPA 1UO6A 1ELDE 3SU3A 3A87A 4YLQH 2G00A 1BT7A 1TRMA 2ANYA 2Q1JA 2XBYA 1KTTB 1GGDB 3S0NA 1EB1H 2A5KA 1C4U2 2YOLA 1W12U 3A88A 3MO6A 2PR3A 3RXDA 1A3EH 3Q76A 3A80A 1E34B 3M37A 4JMYA 2FI3E 5JB8S 1YLCA 1GBJA 1C5OH 4K3JA 5IDKA 3A7XA 3QTVH 3ZV9A 4BAOB 3RXRA 1T32A 3GCOA 1O3PB 1TOCB 4IC6A 1AKSB 3SU1A 4B75A 1OSSA 1SGFG 4GAWA 2AIQA 4IN2A 2SNVA 1GMCG 3AAUA 1TFXA 1O5DH 4SGAE 1SC8U 2GCTB 1O2ZA 1TABE 1WOFA 2XBWA 1BB0B 3HPTB 1K1MA 5ESTE 4O97A 4WMFA 4NSYA 1YYY1 4NA9H 4KELA 2F9VA 3KF2A 3SBKA 5C5NA 1V2QT 4Y8ZA 1P03A 5EOKA 1Y3WA 1FPCH 1KXDA 1HIAA 1O2LA 2ZTXA 2RCEA 1P57B 2OBOA 1DUEA 2H2ZA 1IQNA 1BTZA 3LDXH 1F0SA 2UWOA 1ARBA 4GLYA 2VVCA 1TMUH 3B23B 3PMHB 3PO1C 1P8VC 3HATH 4FUEA 3PWCA 1GMCF 2DE9A 1C2IA 3BG8A 3TVJB 1VR1H 3UREA 2ZDKA 1FUJA 3LGTA 2I6SA 1JIRA 1HBTH 4DG4A 2GCHG 1NFUA 2Y81A 3ELAH 2BDAA 3SJKA 3BTHE 1UK3A 1K9OE 1C2MA 1Z1IA 2TGTA 4MG3A 1O3DA 4K8YA 4ABJA 4XOJA 3IG6B 1VJAU 2FS9A 1ZMNA 1K21H 3NZIA 1ZGVA 1G2MA 3IITA 4X1SU 2ZWLH 1V2NT 3OU0A 1THPB 3PTBA 1O2WA 2ZDVH 2GX4A 1UK2A 3RXMA 3U1IB 1AHTH 5DP3A 5JDUB 4YOJA 2QC2A 1E35B 5JBCS 2PKSB 1ZGIA 2J38A 1O2UA 1VCWA 1OPHB 1YLDA 2ULLA 1BTYA 3SNDA 2V0BA 1MBQA 1ETSH 1G3EA 4BXWA 3F9FA 2ZCLP 1LKBA 1S83A 2EEKA 3QN7A 4B74A 3SGQE 6CHAC 4X2WA 1WBGB 2G51A 1GVLA 1FY4A 1V2TT 4XDEA 1MU8B 2FIRH 1NPMA 1SBWA 1DWEH 5E0HA 1LVMA 1OKXA 3VB6A 1GJ7B 1QQUA 3UWJH 1LVBA 3CS7A 3V0XA 2SGDE 3P6ZB 3BSQA 3PLBA 2AMDA 1GHZA 2R0KA 3BTGE 1DVAH 4X8VH 5EQSA 3UQOA 2BTCE 3VFEA 2BHGA 1SGYE 2PV9B 3VB4A 2F9PA 4WXVA 1GDNA 3A7TA 1TRYA 1ETTH 1UVUH 1HXEH 1RGQA 5T6GA 3UR6A 1ABIH 1TOMH 3GOVB 2I6QA 1W3CA 1WCZA 3L3TA 3KN2A 3CP7A 2ZIQH 3RC6A 1GI8B 1Y3VA 2BLQA 4PROA 1L1NA 4CHAB 2H6MA 3A8AA 4UE7H 1FY3A 4HI3A 1GJ5H 2A4OA 1LHDH 4Z0KA 1C1SA 1RTKA 2WPLS 1HAIH 1QRZA 2FX4A 1YBWA 1GGDC 1HNEE 2YNBA 1O5BB 2R3YA 3IWMA 1IQEA 1QB1A 1EAWA 2ZNKH 3SJ9A 3A7VA 1V2MT 3QDZB 3GCTG 2FI5E 4OS1A 2C8ZB 1Y8TA 2NU3E 3DFLA 1C1MA 1NRSH 3WY8A 1O2JA 2GDDA 1AU8A 4MTBA 1GL1A 1ANDA 2QCYA 2GCTC 5SGAE 1VITG 3Q77A 1C5WB 1SG8B 1DWDH 1YC0A 2P8OC 1O3HA 2AMQA 1MD7A 1O5FH 2J92A 4U01A 4U30A 4GHTA 1KXFA 4ZH8A 4DT7B 1ZPZA 3RU4T 4B76A 1P0SH 1H9HE 2Y7ZA 3ZZBA 4WWYA 1UTNA 4Q2KA 1DY8A 2FXRA 1MU6B 5EODA 3GCTF 1OWHA 1NTPA 3RXKA 2H9TH 1P2QA 3C27B 3PWBA 2AEIH 1EZSC 1C5VA 1A4WH 1ELCA 3QK1A 4XSKU 3M7UA 2CV3A 2ZU3A 5DG6A 1V2OT 5FHTA 1OP2A 1UTQA 1QA0A 4GSOA 4XFQA 1NRRH 1YPHE 2PWXA 3G01A 1O2PA 1QY6A 2VB0A 1C1WH 1GBCA 3A8CA 1FY5A 4UD9H 1ZHMA 1CT4E 2VU8E 2BVXH 1O3OA 3ZVAA 5JBBS 3TITA 3EA7A 3F6UH 3TJNA 1DM4B 4H42U 3ODFA 1OXGA 4E7RG 1UTLM 1G30B 4TWWA 2CF9H 2EA3A 2ZPQA 3AAVA 3Q3YA 1DWCH 4NIXA 5FBIA 2ZHFH 5LPRA 1AUJA 4E7NA 4JK5A 1BMLA 1SSXA 3M5LA 4LXBH 1GG6C 2ILNA 2ODQA 1RS0A 2BDHA 4RKJB 4A7IB 5LPFA 1UCYH 1KXAA 1EQ9A 1A0JA 1XUGA 5TCCA 1HJ8A 1NFXA 1NRQH 1BMMH 1A7SA 5ETXA 1ZHPA 1P2KA 1TPOA 5K7RA 1TPAE 2BDYA 3LT3A 1B0FA 2O8UA 2NU1E 3GY4A 3PM3A 3V3MA 2PSYA 8KME2 3LKWA 5E2OA 4ABGA 4Y0YE 3UUZA 1EXFA 4NWKA 1YPJH 4FU7A 3FP6E 1L0ZA 4LZ4B 3RXCA 5CE1A 2Z3DA 1MAXA 4ZKSU 3PMAB 5L6NH 2GGVB 3AW0A 2A4GA 1N6XA 1O36A 1KY9A 2GVFA 9ESTA 1GBHA 4WVPE 3E3TA 2ALPA 3LJJA 4CRGA 3BEUA 2WV5A 1V2KT 2ZF0H 3MU5A 2W5EA 2P3FH 3LC3A 5DGJA 1BTXA 1O2KA 1SOTA 1KXEA 3RXPA 4GCHF 5EPYA 5E2PA 4E05H 3L6PA 2A32A 5F6MA
chains in the Genus database with same CATH superfamily
1MKWK 3MI4A 1TX6A 1QJ7B 5A2MH 2BM2A 4TY7A 1CU1A 1W7XH 1XUFA 1C5QA 1BRCE 5EG4A 5C5OA 2DE8A 2BXTH 4ESTE 2NWNA 1IQFA 1TRNA 2EI7A 3GCHB 1UCYK 1O3MA 1J16A 5EW1H 1GDUA 1YGCH 3C1KA 2A7HA 1P06A 1Z1JA 3TGKE 4BOHA 1WQSA 1BJUA 1C2JA 4UFFH 2OLGA 2WHXA 2Z3EA 1C2FA 3MU0A 2WPHS 1MTSA 3TK9A 5DP4A 2ZGJA 2ZGBH 3GCNA 1LPZB 1N8OB 2TGDA 3ZZ5A 4GHQA 4BAMB 1DWBH 2PW8H 1O0DH 2Z9KA 5GWZA 3QWCH 5F03A 2OK5A 4ISOA 2FO9A 1YPMH 3SNEA 1S0RA 1O2VA 2AH4X 3OSYA 1RXPA 4Y8XA 1KTSB 5TCAA 1COWD 1Z8JB 3P70B 3F9EA 4F49A 1C1PA 4LOYH 3D62A 4K2YA 2A2XH 2BX3A 4I7YH 1GBEA 3M5NA 3SV9A 2PTNA 3KQDA 3GY8A 1AFQB 3P8GA 3F1SB 2UWPA 4AG1A 4JZEH 2HLDD 2FTLE 4K1SA 1CSOE 1VITH 1T8OA 1T4UH 3R0FA 2O9QA 4HG6A 1ZTLA 1O2YA 4NA7A 3DSGA 3URDA 2O8WA 2OQUA 1RTFB 4NIYA 3ZYEA 4RKOB 1G3BA 1ELAA 1W2KH 2W26A 2IPHA 5E0GA 4YM9A 1P10A 1SGCA 3EQ0H 1FMGA 1IQHA 1O2NA 2ZDMA 1GBIA 4IBLH 2ZFFH 2A1DB 2IJD1 1T8MA 4NA8A 1MUEB 1EPTA 1TBRH 1YY3A 1XUKA 2FX6A 2GZ7A 2Q6FA 3PLKA 4JZ1A 4OS6A 1LVOA 2PLXA 4AFZA 1TALA 2FP7B 1UVTH 6LPRA 1DXPA 2B0FA 4Y6DA 2HPPH 1H8HD 1C5ZB 4Y7BA 3DHKH 4WJG2 3DD2H 1U6QA 3DA9B 4DOQA 2EI6A 2JKHA 1GJAB 2ZI2H 3F0OA 1HGTH 3LIWA 2OD3B 1KIGH 1BHXF 3GY5A 3GISB 3RC4A 4VGCB 3SJ8A 3SNAA 1V2WT 3U8RH 1TX7A 2ALVA 2RDEA 1ELTA 2HOBA 2WPIS 4YESB 1PFXC 4MDSA 4Y0ZE 1ZMJA 2VNTA 1P01A 2D8WA 4IGDA 3UR9A 2ZPRA 4I8LA 3M5OA 2TRMA 3SNCA 1QIXB 2FOFA 4UFEH 3T62A 3S69A 4I86A 4K8BA 2AGEX 2WPKS 3OFND 4LZ1H 3RXJA 2BY9X 4X1NU 2ZFRH 1F0UA 3U8OH 1F0TA 1KXCA 5EJLA 3QZQA 4ZXYH 1JMOH 1SLVB 1GMDF 3UNRA 1TGTA 4YOIA 1MTUA 3ATIA 1SKYE 2HVXA 1WXRA 2ZU1A 1DOJA 4K1TA 2M2AA 2B5TB 4FUHA 1BDAA 3SI4H 1MAYA 2BD4A 2B9LA 1SHYA 5L30H 5HMAA 3SW2B 4ZHLU 2ZZUH 2WPDD 3OTJE 4D76A 4DCDA 3A81A 1PYTD 1CA0B 1O5CB 1LKAA 3RM2H 1VGCB 2J94A 3MQKC 1JIMA 3VGCB 1N6YA 3TU7H 3F2GA 4AZ2B 1Y5BT 4ASHA 1O2TA 1E38B 1IAUA 1TNGA 4UFGH 1O3BA 1HB0B 9LPRA 3GCHC 1OS8A 3E6PH 3K2UA 3M7QA 1QB9A 4O3UA 1O30A 3PV5A 1DUAA 1PJPA 2RG3A 4DGJA 4THNH 1GHWH 1MQ5A 5DKMA 3ZVEA 2QA9E 2ZA5A 4Y8YA 1Q2WA 2XC4A 2CHAC 1H8ED 5HIZA 1LTOA 3OAAD 1CT2E 5FX5A 1MTWA 1O37A 1LO6A 1EPTC 3EAJA 1PPEE 1N8OC 1TMTH 2R2WU 2V35A 5A8ZA 1KLIH 2G81E 3CS0A 1SQRA 1ORFA 4ABBA 5C67A 4FUFA 3UQVA 2Z9IA 3D23A 2P3UB 4TY6A 4Z1MD 1WYKA 2ASUB 2J2UA 1SL3A 2QN5T 3T2NA 1C2LA 2VINA 4F55A 1DSTA 4JZDH 4F48B 1L4DA 1AGJA 1O3GA 3MNSA 3LH3A 5ESBA 3SUFA 1BQYA 4YTAA 1UTJA 2R2MB 1ZSJA 1ZYOA 4OS2A 1AFQC 2FPZA 1L1GA 2V3HH 1C1OA 1F0RA 5A0AE 3ATLA 3M5MA 1GDQA 2XXLA 1IQKA 3BV9B 1XMNB 2BYAX 3SYJA 2GP9B 2UUKB 1N1LA 3A7ZA 1ZTKA 1ZPBA 2ZGHA 1D3TB 3DSPA 4AX9H 1SOZA 3FANA 1BRAA 2CN0H 1IQIA 2G5VA 2CJIA 2FOHA 3EE0B 1Z8GA 2R3UA 1LDTT 1P2MA 1K1NA 2HVYB 1SGNE 1FONA 1V6DA 1Z6EA 2W6JD 4FVDA 1GI1A 1WAYB 3GYLB 1W0KD 4SGBE 4ABDA 7ESTE 1W11U 3RXUA 1LVYA 3UB0A 1EOLA 1C1NA 1O2GH 2JETB 2SNWA 3F2HA 4Q4LA 2F43B 4NFFA 4K1EA 5T6FA 3PB1E 2AMPA 4HTCH 1AKSA 2FWWA 2UUYA 4WMDA 2Z7FE 1O38A 3UPEA 4F4OC 1P3EA 1TONA 1AIXH 1DX5M 1YWUA 1CA8B 2OC0A 1JXPA 1NS3A 4VGCC 4CBOA 4YT7H 2C90B 2Y7XA 1QQ4A 1DDJA 4J1YA 1B5GH 2PFEA 1RFNA 1LCYA 3RMMH 3MNBA 3TH4H 1EJMA 2FZZA 1AO5A 2XC0A 3KEEA 1PPZA 1NN6A 3O8BA 1GBDA 4X1RU 2VIPA 1TAWA 3A7YA 1TGNA 1V2JT 1GPZA 2VVUA 1FAKH 1TX8A 4MNVA 1DFPA 2HRVA 2KCOA 1JWTA 1ANCA 1C5RA 1PPGE 4A1VA 2VIWA 3SZNA 3A8DA 1SPJA 4INLA 2FYQA 4K5ZA 4RT0A 3RP2A 3S9AA 1DS2E 1JOUB 3NWUA 3Q3KA 5HGGA 1ZHRA 2ZHQH 1IQMA 3KYGA 2ZEBA 1ID5H 1D3PB 4K60A 1EFRD 3GS9A 4KP0A 4BAKB 4JCNA 1TE0A 4B2AA 4HFPB 1AI8H 1ACBE 3PV4A 5HKKD 1XUHA 4BNRA 3K6YA 1T8LA 1C5PA 1ZSKA 2J97A 3BIVH 1HAYB 2O8LA 4WY3A 4ZKOU 2AYWA 5FCKA 2C8XB 1ESAA 2Z94A 4OGXA 2WUBA 3H09A 3W95A 1RRKA 1HAPH 5FAHA 2C93B 5A09A 1YF4A 3FFGA 3K65B 3PRDA 3SV8A 1ZMLA 4JZFH 1NC6A 2ZECA 2VH0A 1QL8A 1ZRKA 5C20A 3V13A 1ANEA 2F9UA 4I8JA 1O3NA 1T4VH 2FLBH 1YPEH 2ZHEH 3VB3A 2IOTA 2J95A 3MWIU 1SQTA 3BEFB 2XYAA 3N7EA 1IQGA 3ATKA 4GVUA 1D6RA 2PHBA 2XRCA 2NU2E 3ODDA 1E36B 1O2QA 4U2WA 1TA2A 3URCA 2VIVA 3RXVA 1ANBA 5I46H 8GCHG 4RN6A 5A0CA 3S7KB 1FI8A 4M7GA 4ABHA 1C5YB 2ESTE 3B8JA 5C1XA 3TJUA 3FOAA 1ZOMA 3A86A 3H7OA 3F2FA 1O33A 5KGOA 1KMHB 2JH5D 1GBLA 4Q63A 3EGKH 3A82A 1TNKA 1SGEE 2G52A 1QCPA 2P59A 2VWMA 2WSSD 2PP6A 3A8BA 2RDLA 1P9SA 1BA8B 1EX3A 1QBNA 4HGCA 3BN9A 3M3SA 4NG9H 1GBAA 1PPFE 3T25A 2ZFPH 2QXJA 1DY9A 1HAGE 2W3KA 5HXFA 1CGIE 3VPKA 3N7DA 8GCHF 3O8RA 4ABAA 2GDEH 3RXLA 3K9XB 2WUCA 1EB2A 1P3CA 3P8NA 3ESTA 1S5SA 1AUTC 1QZ8A 1AWHB 4DIHH 1SMFE 3AW1A 5GCHF 1QGFA 3PMBB 1EASA 1HJAB 3N99A 3QGNB 2XBXA 2O8TA 1X7AC 2BY5X 3LGYA 5H4IB 1IHSH 3RXGA 1O2OA 1SHHB 3KGPA 1C5UA 1FJSA 3BTWE 2JETC 4B1TA 1O35A 1J9CH 1G37A 4CRAA 3RU4E 4CRBA 4D7FA 2ZTZA 2ZC9H 1C2GA 1FN6A 3U1JB 3LGVA 3AK5A 1FAXA 1CQQA 3P95A 2O8MA 2A5AA 4ISLA 2H9HA 1Q3XA 4ABEA 1EP5A 1SQAA 4Y79A 1T31A 3QUMP 2Y80A 1FNIA 5BRRE 3R3GB 2BQ7B 5EGMA 3LGWA 3MTYA 5F8ZA 4BAHB 2C3SA 2BY6X 1O39A 1TBQH 3SOSA 1XVOA 1V2VT 2OC8A 2PKSC 2AFQB 1LMWB 3BTME 1A3BH 1MKWH 2PGBB 1AB9B 1VCQA 3FZDA 2FESH 2K1QA 2ZFSA 2C8WB 2BDGA 5C1UA 2Z3CA 4KTUA 2FYRA 4D7GA 1GJ9B 3FAOA 4R0IA 3MO3A 1C2DA 3SHCH 2CK3D 4Q7ZA 1G2LA 1HAXB 1FY8E 1NBMD 1UHBB 5C3NA 1SFQB 4LK4A 2VJ1A 3NUMA 5EPNA 4AB8A 4BTUB 1BMAA 1WU1A 1LHGH 1GL0E 2H5DA 2D26C 2QF0A 4GCHG 1OWJA 1TB6H 1VJ9U 1ZSLA 1ARCA 3ZYDA 8ESTE 1SR5C 5AFYH 3BTKE 4JK6A 3PTNA 3TJOA 5J4SA 3AVZA 4A1TA 4TSFD 1BITA 3FP8E 1TPPA 7KMEH 1O31A 1MTNB 1AZ8A 1E0FD 1KYNA 4ZHMU 2FS8A 1BTWA 4H4FA 3TH3H 2Z9GA 3GY2A 2EY4C 4KTSA 2OBQA 1LPKB 4ISHH 5T6DA 4CHAC 4X0WU 4E06H 4NCYA 2UUFB 1BJVA 1IQLA 4Y10E 5C0TA 4TT3D 4MNXA 2F4LA 1QB6A 4O3TA 6GCHF 1O5AB 1Y59T 4FU8A 4X6NA 3ATMA 2QY0B 1T8NA 1W13U 1SGDE 2AS9A 2BDBA 3N7OA 2QXHA 3SU5A 4XD7D 1SVPA 2P16A 2CMYA 1IHTH 2WV4A 4A5TS 3T28A 1YM0A 5DN6D 2ZU5A 1ESTA 1O2MA 1YCPM 1GHVH 1KXBA 3PLPA 4AYVB 5DP7A 1TNHA 3GY6A 1GBFA 1ELEE 2OC1A 3ZV8A 2VGCB 1PQ5A 3RMLH 3ZZ4A 1P05A 3OY6U 1TNJA 1TA6A 5A0BA 2GT7A 2BVSH 2W7UA 3SU6A 1JBUH 2PKAB 3LH1A 1E1RD 1GHBF 2STBE 2PGQB 5GNDA 4AGJA 2ZU2A 1S84A 4AFUA 2F9BH 2UUJB 3EA9A 3RDZA 3UIRA 2VWNA 1F5LA 1S6HA 1Z8RA 1GMHF 4YLUA 3BTTE 5EU8A 2Q6GA 1OWKA 2G4UA 1W0ZU 1RTLA 1OP8A 1GI9B 4Q7XA 3SQHE 4B73A 2A7JA 4FUGA 1BIOA 1S6FA 1HRTH 3BIUH 3FO8D 3QO6A 5BPEA 3ZZ6A 3JZ1B 1FPHH 2F9OA 1O5EH 5EQQA 3ZVFA 1A5HA 3MU8A 2W7SA 1XXDA 1P12E 1EP6A 3KQBA 3KQEA 3PYHA 2PUXB 1HV7A 1XKBC 1DITH 1CVWH 1G3CA 3AASA 3MHWU 3NKKA 1L4ZA 3SU2A 3L33A 3P17H 5L2ZH 3JZ2B 1P02A 5J4QA 5CHAB 1P2IA 1W8BH 1TGCA 2YNAA 1O3LA 2OCVB 3F9GA 4FUJA 1NY22 4YT6H 4UEHH 1GHAG 3E90B 3LJOA 1GJ6A 1K1OA 2SGFE 2GMTB 1EAXA 3LPRA 2AHME 2WV9A 1O3AA 1XUJA 2H9EH 5I25A 2CF8H 3H5CB 4P02A 1QNJA 1WSSH 4RT1A 5IYTA 4TPYA 4AC9A 3E0PB 1HDTH 2BD7A 3NCLA 2PTCE 2A31A 3GY7A 2BLOA 2EC9H 2V3MA 1E1QD 2J4IA 1DSUA 1PPBH 1GMDG 1UMAH 4Z6AH 2BB4A 3E1XB 2XNIA 3FVFB 1AB9C 3NK8A 1W10U 4MNWA 2BMGB 2TPIZ 1VKYA 1YKTA 2ZHDA 5TJXA 3W1EA 1YPHC 1QA7A 5C94A 3STJA 3SUEA 1CE5A 4U32A 1DANH 1K1PA 2J98B 1CT0E 2WPMS 4NGAH 1SLXB 1GHAF 2A45B 1ELGA 1TPSA 1HLTH 3QGJA 2XCNA 4OS4A 2FODA 1WUNH 1C5MD 2BD3A 4NZQA 1GI6A 3SJIA 2F91A 1DPOA 4MQAA 3S9BA 2ZTYA 1FZZA 4ZUHA 4I8HA 1J17T 3SNBA 1ABJH 2HWLB 4ZKRU 3SI3H 1TLDA 2KM0A 1C1UH 1LQDB 3DT0H 1P11E 2QXIA 1YP9A 2LNCA 3RXIA 1A0HB 1OX1A 3HGNA 1QRWA 2HLCA 2ZQ1A 3RXSA 4WMEA 2ANMH 1Z7KA 1K0HA 1C5XB 1GVKB 1VZQH 2QF4A 1SLWB 2BZ6H 2JIZD 1K1LA 1MABB 3RMNH 3UY9A 1AVGH 3UOUA 2FOCA 1E79D 1NROH 1K1IA 4NIVA 4DIIH 4X1QU 3V12A 1EATA 1EKBB 4ZKNU 2FOBA 1OHHD 2BOHB 2BQ6B 4AFSA 2Y6TA 3TNSA 2J98A 3I77A 1A0LA 3UTUH 3ATWA 1YCPH 3K6ZA 1EZUC 1GI4A 4JYTA 3GYMA 3MYWA 2A4RA 1QJ6B 5KECA 5JBAS 1CHOF 2EI8A 1MCVA 3ZZCA 1K22H 1Y5UT 4H6TA 2XW9A 1GI3A 5LPEA 4IW4E 3UNQA 2VWLA 2D2DA 3TH2H 3I29A 2ZCHP 1T7CA 3RXBA 3RMOH 1TGSZ 2RFKC 3RLWH 2ZFTA 2QYIA 2AGIX 1HIAB 1BUIA 1CO7E 1EOJA 2XCFA 5A8XA 3W94A 3MH5A 4BANB 1NM6A 3CNRA 4MVNA 2B7DH 1J14A 1K2I1 3CENA 1HAZB 2VVVA 3QX5H 2ZGCA 3RXTA 1ELFA 3A85A 4BAQB 2VH6A 1ZTJA 3H7TA 3BTDE 4M9FA 3M36A 3T27A 2RA0A 3UOPA 1QBVH 2JH0D 2VIDA 1D3DB 4AG2A 2TGPZ 1EAUA 3PROA 3S9CA 1Z71A 3LC5A 2ZO3H 1A2CH 2IPQX 2FI4E 1GBMA 2QIQA 4JYUH 2BVRH 2QV1A 4FVBA 1THRH 2XC5A 1Q31A 3ZZ8A 2OUAA 4I32A 1O3KA 2V7QD 3VXEH 1YCPK 2GD4B 1AN1E 2BY7X 1YPLH 2BOKA 4CR9A 2L74A 2P8OB 1ZR0A 3GICB 1H1BA 2J34A 4ZROA 3P92A 1CBWB 1TNIA 1AVWA 3DFJA 3P8OA 4IMQA 5CHAC 3VG8A 2J9NA 4UFDH 1EZXC 4CH2B 2QF3A 2Z6BD 5L2YH 1BRBE 5T3HA 4DW2U 2KX4A 2GMTC 1UJ1A 2ZDAH 4XBCA 1GHYH 2ANKH 1O2IA 3P8FA 1TGBA 1GHXH 1BCUH 3BTQE 5GJ4B 2QGRA 1GCDA 1NESE 1MTVA 2QXGA 2HPQH 3T29A 1NZQH 2K8IA 4XBBA 4CRDA 2ZPSA 4AN7A 5DK1A 3RM0H 3SU4A 1SGPE 1UTPA 1KSNA 2F83A 4BTIB 1XVMA 1XKAC 1GJ4H 1ZLRA 2A2QH 2H1UA 3D65E 3QZRA 2LPRA 1F2SE 2PUQH 5F8TA 2THFB 1OOKB 4WH8A 5C1YA 3ZZ9A 4FUIA 3ZZ3A 3LOXA 1GI2A 1SGTA 4AYYB 5HM9A 1S0QA 1QL9A 4NWLA 4X2VA 4CH8B 2AGGX 4B6EA 2TIOA 2ZP0H 3MMGA 2DUCA 3PRBA 4MPVA 5A8YA 1C2EA 1J8AA 2GTBA 1PYTC 3LGUA 1QRXA 1H4WA 1A61H 1QHRB 5EW2H 3V7TA 2BLVA 3RXHA 2XWBI 2FOAA 3ZVBA 3SHAH 1QTFA 1TYNA 3DUXH 5DP5A 2GV6A 1GCTB 2BX4A 1S85A 2BQWB 2VBCA 4OM9A 4XBDA 2GCHF 1BHXB 2STAE 4RSPA 3MOCA 1QURH 2OQ5A 2WINI 1GG6B 3TIUA 3HK3B 5DP8A 1ZJDA 1MKXH 1PPCE 1FQ3A 3TLOA 4NZLA 4X2XA 2OC7A 3ZVDA 3WWBA 2ZDLA 1CA0C 4MPWA 3LU9B 1XM1A 4X6PA 4OS7A 1VGCC 2TBSA 1AD8H 1NT1A 1OWIA 2V6NA 3VGCC 1KDQB 1TQ7B 2Q6DA 1O2SA 3E8LA 1LHEH 4GPGA 2GV7A 2IN2A 1HUTH 5FPTA 2BY8X 4A6LA 1XUIA 1HAHH 2HNTC 1PQ7A 4OS5A 3TJVA 3LGIA 1ZJKA 3RXAA 4Y76A 1NU9A 1P2NA 2OINA 1DLKB 1V2ST 1G32B 2YMSD 3EYDA 3F68H 5FBEA 2FMJA 3ENSB 1C5SA 3BG4B 4ASUD 2Z9JA 4J2YB 3SUGA 1IQJA 3SV7A 1BTHH 3HK6B 1GI5A 1THSH 2P95A 5FL7D 5HIYA 1TIOA 2CGAA 4UONA 4DY7B 1UK4A 5JBTA 1C1QA 1S81A 4KGAA 3GDUA 1CHGA 4TWYA 1SI5H 3UNSA 1AQ7A 1IOEA 4NFEA 3VXFH 3LONA 3SU0A 5GCHG 1K1JA 4FUCA 1H9IE 5EIYA 4AFQA 2SGQE 8LPRA 4I8KA 1F7ZA 4FOUC 1SB1H 1MKXK 1KDQA 1HXFH 1AY6H 1YPKH 3M61U 3ZVCA 1ETRH 1HJ9A 1YLNA 2VIQA 1QJ1B 3KHVA 5FPYA 3I78A 2BD5A 1H8DH 2ODPA 1AE5A 2ZDNA 3MH7A 1J15A 2XWAA 1FN8A 3T26A 5EXNA 1BMFD 3BEIB 3VB7A 1XXFA 2XTTB 5GIBA 2FEQH 1H9LB 2TGAA 4O03A 3GDVA 2ZQ2A 1GBKA 3TNTA 5GPIB 4X6OA 1H8IH 3SUDA 1Z6JH 1RD3B 4DT4A 2GZ9A 1HYLA 1DE7H 1L2EA 1W14U 5PTPA 4IC5A 1O32A 1BTUA 1C1RA 2F3CE 4X8UH 1CBWC 1FY1A 1F5KU 3MNCA 2JH6D 3M7TA 2KR7A 5AFZH 1CGHA 3D49H 3HGPA 1NRNH 4JZIA 2AIPA 1GWAA 3E91A 3STIA 1BBRH 1BBRE 5FXLA 2P94A 1UVSH 2ZU4A 5E0JA 1AZZA 2BD2A 1MD8A 2Z9LA 1NFYA 4MPXA 2R0LA 1AWFH 1D4PB 3MFJA 3RLYH 1LQEA 1VCPA 3SZEA 1VITF 5FCRA 4UDWH 5LGOA 1QL7A 2QAAA 3Q3XA 4BTTB 2Y5GA 1FLEE 1W0YH 2GZ8A 1EJAA 4WH6A 3U28C 1NO9H 1UTKA 1QFKH 1QR3E 3MU1A 5AF9H 3ZZDA 1ZZZA 3OY5U 1V2RT 1L1JA 2W3IA 1G3DA 2G5NA 3ZZ7A 1UVPA 3RXOA 4DURA 2G8TA 3FZZA 5E8EH 3U69H 1HAOH 4NIWA 1TBZH 1SGQE 5LH8A 5EQRA 1K28D 4ZMAH 5HM2A 5K0HA 2P3TB 1Z8IB 3RUOA 1C2HA 1GCTC 1C2KA 1P2OA 3B9FH 1O3FA 3EA8A 4AGKA 4Y11E 1HAVB 3BTFE 1UTOA 4GUXA 3OEED 3MNXA 2FOGA 2FTMA 6GCHG 1KLTA 4OGYA 1V2UT 3BF6H 1E37B 2M5TA 1GJ8B 2QF5A 4Q7YA 1O2HA 1UCYE 1BBRK 4D9QA 2HALA 1BMNH 5GXPA 3SQEE 3RU4D 4CBNA 2A7CA 1GVZA 4Y7AA 3RXQA 4NSVA 1C4Y2 2SGEE 1JRTA 1AVXA 1ELBA 2XBVA 1SGFA 1OYQA 3OEHD 2G55A 1D9IA 2HNTF 4Y71A 4ABFA 5HYOA 2A4QA 4B2CA 1TQ0B 5DO4H 4X8TH 1PQ8A 1A46H 4H6SB 1NFWA 2OP9A 5DPAA 1INCA 1EAIA 4ACAA 2OTVA 2FLRH 2J5UA 1C4V2 5DP9A 6ESTA 4D8NA 3BG4C 3E0NB 5C17A 1UHBA 1MZAA 1GHBG 2P93A 2PSXA 4HZHA 2C8YB 1TWXB 1TNLA 3OX7U 2Y5HA 2HGTH 1G36A 1HAVA 4WXIA 2G4TA 3DCLA 1FV9A 1AMHA 4AB9A 3A83A 2IJOB 1GMHG 1TMBH 5F8XA 5CHBA 1SQOA 1RIWB 1WTGH 3SV6A 2FM2A 1AE8H 3UFAA 5AHGH 1FDPA 4MLFB 4YOGA 3M3TA 4R8TB 1A1RA 4FXGH 1O34A 4X2YA 1AFEH 1GJDB 4INHA 3F0PA 4INKA 1BRUP 1M9UA 1BTPA 2EQNA 1D3QB 4I8GA 3KQCA 5JB9S 3NPSA 1OP0A 3SV2H 3KCGH 4I33A 2WPJS 2CHAB 3T5FH 2WYGA 7GCHG 5C0UA 5JPMH 4A1XA 1BOQA 2GT8A 4TYDA 2FOEA 1P09A 2V3OH 1EPTB 1FIZA 1NU7B 4FU9A 4X6MA 5EXMA 3RXFA 1S82A 1A5GH 3SGAE 2CXVA 4CRFA 1ELVA 1HJAC 4MNYA 4P00A 5JYIA 1LHCH 1SLUB 1P04A 1MQ6A 1P9UA 3QTOH 3SGBE 5CDFE 4KKDA 2KAIB 1HFDA 4Q80A 1DLEA 1O3JA 5EJZA 3SN8A 3F3BA 1MBMA 2A0QB 2D1JA 2B8OH 2BLWA 1HCGA 1MH0A 3SORA 5AVDA 3S7HB 4JYVH 5FX6A 5FPSA 1O3EA 3O8CA 3MO9A 4CREA 1DICA 1OYTH 4ZAEA 7GCHF 2OXSA 1XX9A 1CGJE 1JRSA 3VEQB 1SFIA 1DXWA 4AORA 1FIWA 1DT2A 1F92A 1O5GH 2F9NA 3ITIA 4IS5A 3EDXB 1GBBA 1B0EA 2PKAA 3A7WA 2NU0E 2SGAA 1A5IA 1C1VH 4X8SH 3TK5A 1GI7B 4ZXXH 1B7XB 2Y5FA 2SGPE 4FUDA 3MH6A 2BDCA 2VWOA 1GBTA 1C9PA 1GI0A 3SO3A 3A89A 4ZHAA 1WV7H 3PO1B 3VB5A 4QT8C 2SFAA 1PPHE 2BXUH 4B2BA 5ABWA 3A84A 4ABIA 5C2ZA 4IN1A 1UVOA 2ZHWH 1MCTA 5B6OA 4WF8A 1EZQA 4CRCA 2BDIA 2ZG0H 3PV2A 3FP7E 1QBOA 5DJ7A 2KAIA 1WQVH 1PQAA 2FDAA 2H5CA 2R9PA 3U98H 1MZDA 4XE4A 5T1VA 4KTCA 2ZKSA 3GY3A 3MU4A 3NRLA 4FUBA 4X1PU 4B71A 1LPGB 2WYJA 3PMJA 3KQ5A 2ZGXH 4IMZA 4A92A 4ISNA 3O8DA 5EJ1A 4DVAU 1HPGA 1V2LT 1NRPH 4YXWD 1WTHD 3ZVGA 1EUFA 3ZZAA 5G4BA 1SGIB 4DJZB 3GDSA 2UWLA 4YZUA 1ZRBA 1OWDA 1MTNC 3WWFA 4D9RA 1C1TA 5GDSH 4YO9A 1CHOG 3UWIA 4I31A 4BXSA 2BD8A 1LHFH 2HNTE 2VIOA 6CHAB 3KL6A 3KNXA 2BD9A 4CR5A 1O2XA 1MMJN 1P2JA 1SGRE 1C5NH 3TPIZ 3BTEE 3QLPH 2GKVE 1Y3XA 2ZFQH 4MPUA 2ANWA 1C9TA 1GJCB 3TK6A 5EXLA 2NU4E 3TGIE 1F5RA 1V3XA 7LPRA 1O3IA 1W7GH 3HKJB 2C4FH 3NXPA 5DP6A 4K69A 1RJXB 2Y82A 1FXYA 3M35A 3Q00A 4AOQA 3KIDU 1YPGH 1Y3YA 2AERH 1EJNA 3HKIB 1GJBB 4RI0A 4ISIH 3U9AH 4ZCNA 1KLJH 1ESBA 2ZCKP 3E16B 1ZPCA 2BZAA 2RA3A 3RC5A 3SJOA 1OWEA 1RIWC 1G9IE 4O9VA 1Y3UA 2VGCC 1O3CA 3OE7D 3RXEA 1C5TA 2ODYB 1BZXE 1UTMA 3MH4A 3TGJE 2A5IA 4TPIZ 1C5LH 1D6WA 2FOMB 3F9HA 1O2RA 5CMXH 1V2PT 3M3VA 3U8TH 1Y5AT 3OYPA 1UO6A 1ELDE 3KYFA 3SU3A 3A87A 4YLQH 2G00A 1BT7A 1TRMA 2ANYA 2Q1JA 2XBYA 1KTTB 1GGDB 3S0NA 1EB1H 2A5KA 1C4U2 2YOLA 1W12U 3A88A 3MO6A 2PR3A 3RXDA 1A3EH 3Q76A 3A80A 1E34B 3M37A 2WZQA 4JMYA 2FI3E 5JB8S 1YLCA 1GBJA 1C5OH 4K3JA 5IDKA 3A7XA 3QTVH 3ZV9A 4BAOB 3RXRA 1T32A 3GCOA 1O3PB 1TOCB 4IC6A 1AKSB 3SU1A 4B75A 1OSSA 1SGFG 4GAWA 2AIQA 4IN2A 2SNVA 1GMCG 1FX0B 1TFXA 1O5DH 3AAUA 4SGAE 1SC8U 2GCTB 1O2ZA 2KCPA 1TABE 1WOFA 2XBWA 1BB0B 3HPTB 1K1MA 2XOKD 5ESTE 4O97A 4WMFA 4NSYA 1YYY1 4NA9H 2L6OA 4KELA 2F9VA 3KF2A 4ACBA 3SBKA 5C5NA 1V2QT 4Y8ZA 1P03A 4FETA 5EOKA 1Y3WA 1FPCH 1KXDA 1HIAA 1O2LA 2ZTXA 2RCEA 1P57B 2OBOA 1DUEA 2H2ZA 1IQNA 1BTZA 3LDXH 5IK2D 1F0SA 2UWOA 1S6LA 1ARBA 4GLYA 2VVCA 1TMUH 3B23B 3PMHB 3PO1C 1P8VC 3HATH 4FUEA 3PWCA 1GMCF 2DE9A 1C2IA 3BG8A 3TVJB 1VR1H 3OTPA 3UREA 2ZDKA 1FUJA 3LGTA 2I6SA 1JIRA 1HBTH 4DG4A 2GCHG 1NFUA 2Y81A 3ELAH 2BDAA 3SJKA 3BTHE 1UK3A 1K9OE 1C2MA 1Z1IA 2JDID 2TGTA 4MG3A 1O3DA 4K8YA 4ABJA 4XOJA 3IG6B 1VJAU 2FS9A 1ZMNA 1K21H 2KCAA 3NZIA 1ZGVA 1G2MA 3IITA 4X1SU 2ZWLH 1V2NT 3OU0A 1THPB 3PTBA 1O2WA 2ZDVH 2GX4A 1UK2A 3RXMA 3U1IB 1AHTH 5DP3A 5JDUB 4YOJA 2QC2A 1E35B 5JBCS 2PKSB 1ZGIA 2J38A 1O2UA 1VCWA 1OPHB 1YLDA 2KZ4A 2ULLA 1BTYA 3SNDA 2V0BA 1MBQA 1ETSH 1G3EA 4BXWA 3F9FA 2ZCLP 1LKBA 1S83A 2EEKA 3QN7A 4B74A 3SGQE 6CHAC 4X2WA 1WBGB 2YMSB 2G51A 1GVLA 4XRNA 1FY4A 1V2TT 4XDEA 1MU8B 3EE7A 2FIRH 5F53A 1NPMA 1SBWA 1DWEH 5E0HA 1LVMA 1OKXA 3VB6A 1GJ7B 1QQUA 3UWJH 1LVBA 3CS7A 3V0XA 2SGDE 3P6ZB 3BSQA 3PLBA 2AMDA 1GHZA 2R0KA 3BTGE 1DVAH 2JJ2D 4X8VH 5EQSA 3UQOA 2BTCE 3VFEA 2BHGA 1SGYE 2PV9B 3VB4A 2F9PA 4WXVA 1GDNA 3A7TA 1TRYA 1ETTH 1UVUH 1HXEH 1RGQA 5T6GA 3UR6A 1ABIH 1TOMH 3GOVB 2I6QA 1W3CA 1WCZA 3L3TA 3ZIAD 3KN2A 3CP7A 2ZIQH 3RC6A 1GI8B 1Y3VA 2BLQA 4PROA 1L1NA 4CHAB 2H6MA 3A8AA 4UE7H 1FY3A 4HI3A 1GJ5H 2A4OA 1LHDH 4Z0KA 1C1SA 1RTKA 2WPLS 1HAIH 1QRZA 2FX4A 2GJGA 1YBWA 1GGDC 1HNEE 2YNBA 1O5BB 2R3YA 2K0QA 3IWMA 1IQEA 1QB1A 1EAWA 2ZNKH 3SJ9A 3A7VA 1V2MT 2LP6A 3QDZB 3GCTG 2FI5E 4OS1A 2C8ZB 1Y8TA 2NU3E 3DFLA 1C1MA 1NRSH 3WY8A 1O2JA 2GDDA 1AU8A 2W6ID 4MTBA 2KFWA 1GL1A 1ANDA 2QCYA 2GCTC 5SGAE 1VITG 3Q77A 1C5WB 1SG8B 1DWDH 1YC0A 1O3HA 2AMQA 2P8OC 1MD7A 1O5FH 2J92A 2QE7D 3FN8A 4U30A 4GHTA 4U01A 1KXFA 4ZH8A 4DT7B 1ZPZA 3RU4T 2JJ1D 4B76A 1P0SH 1H9HE 2Y7ZA 3ZZBA 4WWYA 1UTNA 4Q2KA 1DY8A 2FXRA 1MU6B 5EODA 3GCTF 1OWHA 1NBME 1NTPA 3RXKA 2H9TH 1P2QA 3C27B 3PWBA 2AEIH 1EZSC 1C5VA 1A4WH 1ELCA 3QK1A 4XSKU 3M7UA 3FKSD 2XNDD 2CV3A 2ZU3A 5DG6A 1V2OT 5FHTA 1OP2A 1UTQA 1QA0A 4GSOA 4XFQA 1NRRH 1YPHE 2PWXA 3G01A 1O2PA 1QY6A 2VB0A 1C1WH 1GBCA 3A8CA 1FY5A 4UD9H 1ZHMA 1CT4E 2VU8E 5DSFA 2BVXH 1O3OA 3ZVAA 5JBBS 3TITA 3EA7A 3F6UH 3WW7A 3TJNA 1DM4B 4H42U 3DSOA 3ODFA 1OXGA 4E7RG 1UTLM 1G30B 4TWWA 2CF9H 2EA3A 2ZPQA 3AAVA 3Q3YA 1DWCH 4NIXA 5FBIA 2ZHFH 5LPRA 1AUJA 4E7NA 4JK5A 4B6FA 1BMLA 1SSXA 3M5LA 4LXBH 1GG6C 2ILNA 2ODQA 1RS0A 2BDHA 4RKJB 4A7IB 2YMSC 2LELA 5LPFA 1UCYH 5B6LA 1KXAA 1EQ9A 1A0JA 1XUGA 5TCCA 1HJ8A 1NFXA 1NRQH 1BMMH 1A7SA 5ETXA 1ZHPA 1P2KA 1TPOA 5K7RA 1TPAE 1UW7A 5KEDA 2BDYA 3LT3A 1B0FA 2O8UA 2NU1E 3GY4A 3PM3A 3V3MA 2PSYA 8KME2 3LKWA 5E2OA 4ABGA 4Y0YE 3UUZA 1EXFA 4NWKA 1YPJH 4FU7A 3FP6E 1L0ZA 1W0JD 4LZ4B 3RXCA 5CE1A 2Z3DA 1MAXA 4ZKSU 3PMAB 5L6NH 2GGVB 3AW0A 2A4GA 1N6XA 1O36A 1KY9A 2GVFA 9ESTA 1GBHA 4WVPE 3E3TA 2ALPA 3LJJA 4CRGA 3BEUA 2WV5A 1V2KT 2KCYA 2ZF0H 3MU5A 2W5EA 2P3FH 3LC3A 5DGJA 1BTXA 1O2KA 1SOTA 1KXEA 3RXPA 1WDIA 4GCHF 3UAIC 5EPYA 5E2PA 4E05H 3L6PA 2A32A 5F6MA
chains in the Genus database with same CATH topology
1MKWK 3MI4A 1TX6A 1QJ7B 5A2MH 2BM2A 4TY7A 1CU1A 1W7XH 1XUFA 1C5QA 1BRCE 5EG4A 5C5OA 2DE8A 2BXTH 4ESTE 2NWNA 1IQFA 1TRNA 2EI7A 3GCHB 1UCYK 1O3MA 1J16A 5EW1H 1GDUA 1YGCH 3C1KA 2A7HA 1P06A 1Z1JA 3TGKE 4BOHA 1WQSA 1BJUA 1C2JA 4UFFH 2OLGA 2Z3EA 1C2FA 3MU0A 2WPHS 1MTSA 3TK9A 5DP4A 2ZGJA 2ZGBH 3GCNA 1LPZB 1N8OB 2TGDA 3ZZ5A 4GHQA 4BAMB 1DWBH 2PW8H 1O0DH 2Z9KA 5GWZA 3QWCH 5F03A 4ISOA 2FO9A 1YPMH 3SNEA 1S0RA 1O2VA 2AH4X 3OSYA 1RXPA 4Y8XA 1KTSB 5TCAA 1Z8JB 3P70B 3F9EA 4F49A 1C1PA 4LOYH 3D62A 4K2YA 2A2XH 2BX3A 4I7YH 1GBEA 3M5NA 3SV9A 2PTNA 3KQDA 3GY8A 1AFQB 3P8GA 3F1SB 2UWPA 4AG1A 4JZEH 2FTLE 4K1SA 1CSOE 1VITH 1T8OA 1T4UH 3R0FA 2O9QA 1ZTLA 1O2YA 4NA7A 3URDA 2O8WA 2OQUA 1RTFB 4NIYA 3ZYEA 4RKOB 1G3BA 1ELAA 1W2KH 2W26A 2IPHA 5E0GA 4YM9A 1P10A 1SGCA 3EQ0H 1FMGA 1IQHA 1O2NA 2ZDMA 1GBIA 4IBLH 2ZFFH 2A1DB 1T8MA 4NA8A 1MUEB 1EPTA 1TBRH 1XUKA 2FX6A 2GZ7A 2Q6FA 3PLKA 4JZ1A 4OS6A 1LVOA 2PLXA 4AFZA 1TALA 2FP7B 1UVTH 6LPRA 1DXPA 2B0FA 4Y6DA 2HPPH 1C5ZB 4Y7BA 3DHKH 4WJG2 3DD2H 1U6QA 3DA9B 4DOQA 2EI6A 2JKHA 1GJAB 2ZI2H 1HGTH 3LIWA 2OD3B 1KIGH 1BHXF 3GY5A 3GISB 3RC4A 4VGCB 3SJ8A 3SNAA 1V2WT 3U8RH 1TX7A 2ALVA 1ELTA 2HOBA 2WPIS 4YESB 1PFXC 4MDSA 4Y0ZE 1ZMJA 2VNTA 1P01A 2D8WA 4IGDA 3UR9A 2ZPRA 4I8LA 3M5OA 2TRMA 3SNCA 1QIXB 2FOFA 4UFEH 3T62A 3S69A 4K8BA 2AGEX 2WPKS 4LZ1H 3RXJA 2BY9X 4X1NU 2ZFRH 1F0UA 3U8OH 1F0TA 1KXCA 3QZQA 4ZXYH 1JMOH 1SLVB 1GMDF 3UNRA 1TGTA 4YOIA 1MTUA 3ATIA 2HVXA 2ZU1A 1DOJA 4K1TA 2B5TB 4FUHA 1BDAA 3SI4H 1MAYA 2BD4A 2B9LA 1SHYA 5L30H 5HMAA 3SW2B 4ZHLU 2ZZUH 3OTJE 4D76A 4DCDA 3A81A 1PYTD 1CA0B 1O5CB 1LKAA 3RM2H 1VGCB 2J94A 1JIMA 3VGCB 1N6YA 3TU7H 4AZ2B 1Y5BT 4ASHA 1O2TA 1E38B 1IAUA 1TNGA 4UFGH 1O3BA 1HB0B 9LPRA 3GCHC 1OS8A 3E6PH 3K2UA 3M7QA 1QB9A 4O3UA 1O30A 1DUAA 1PJPA 2RG3A 4DGJA 4THNH 1GHWH 1MQ5A 5DKMA 3ZVEA 2QA9E 2ZA5A 4Y8YA 1Q2WA 2XC4A 2CHAC 1LTOA 1CT2E 5FX5A 1MTWA 1O37A 1LO6A 1EPTC 3EAJA 1PPEE 1N8OC 1TMTH 2R2WU 2V35A 5A8ZA 1KLIH 2G81E 3CS0A 1ORFA 4ABBA 5C67A 4FUFA 3UQVA 2Z9IA 3D23A 2P3UB 4TY6A 1WYKA 2ASUB 2J2UA 1SL3A 2QN5T 3T2NA 1C2LA 2VINA 1DSTA 4JZDH 1L4DA 1AGJA 1O3GA 3MNSA 3LH3A 5ESBA 3SUFA 1BQYA 4YTAA 1UTJA 2R2MB 1ZSJA 1ZYOA 4OS2A 1AFQC 2FPZA 1L1GA 2V3HH 1C1OA 1F0RA 5A0AE 3ATLA 3M5MA 1GDQA 2XXLA 1IQKA 3BV9B 1XMNB 2BYAX 2GP9B 2UUKB 1N1LA 3A7ZA 1ZTKA 1ZPBA 2ZGHA 1D3TB 4AX9H 1SOZA 3FANA 1BRAA 2CN0H 1IQIA 2G5VA 2CJIA 2FOHA 3EE0B 1Z8GA 2R3UA 1LDTT 1P2MA 1K1NA 1SGNE 1FONA 1V6DA 1Z6EA 4FVDA 1GI1A 1WAYB 3GYLB 4SGBE 4ABDA 7ESTE 1W11U 3RXUA 1LVYA 1EOLA 1C1NA 1O2GH 2JETB 2SNWA 4NFFA 5T6FA 4K1EA 3PB1E 2AMPA 4HTCH 1AKSA 2FWWA 2UUYA 4WMDA 2Z7FE 1O38A 3UPEA 4F4OC 1P3EA 1TONA 1AIXH 1DX5M 1CA8B 2OC0A 1JXPA 1NS3A 4VGCC 4CBOA 4YT7H 2C90B 2Y7XA 1QQ4A 1DDJA 4J1YA 1B5GH 2PFEA 1RFNA 1LCYA 3RMMH 3MNBA 3TH4H 1EJMA 2FZZA 1AO5A 2XC0A 3KEEA 1PPZA 1NN6A 3O8BA 1GBDA 4X1RU 2VIPA 1TAWA 3A7YA 1TGNA 1V2JT 1GPZA 2VVUA 1FAKH 1TX8A 4MNVA 1DFPA 2HRVA 1JWTA 1ANCA 1C5RA 1PPGE 4A1VA 2VIWA 3SZNA 3A8DA 1SPJA 4INLA 2FYQA 4K5ZA 3RP2A 3S9AA 1DS2E 1JOUB 3NWUA 3Q3KA 5HGGA 1ZHRA 2ZHQH 1IQMA 2ZEBA 1ID5H 1D3PB 4K60A 4KP0A 4BAKB 4JCNA 1TE0A 4B2AA 4HFPB 1AI8H 1ACBE 3PV4A 1XUHA 4BNRA 3K6YA 1T8LA 1C5PA 1ZSKA 3BIVH 1HAYB 2O8LA 4WY3A 4ZKOU 2AYWA 5FCKA 2C8XB 1ESAA 2Z94A 4OGXA 2WUBA 3W95A 1HAPH 1RRKA 5FAHA 2C93B 5A09A 1YF4A 3FFGA 3K65B 3SV8A 1ZMLA 4JZFH 1NC6A 2ZECA 2VH0A 1QL8A 1ZRKA 5C20A 3V13A 1ANEA 2F9UA 4I8JA 1O3NA 1T4VH 2FLBH 1YPEH 2ZHEH 3VB3A 2IOTA 2J95A 3MWIU 1SQTA 3BEFB 2XYAA 1IQGA 3ATKA 4GVUA 1D6RA 2PHBA 2XRCA 2NU2E 3ODDA 1E36B 1O2QA 4U2WA 1TA2A 3URCA 2VIVA 3RXVA 1ANBA 5I46H 8GCHG 4RN6A 5A0CA 3S7KB 1FI8A 4M7GA 4ABHA 1C5YB 2ESTE 3B8JA 5C1XA 3TJUA 1ZOMA 3A86A 3H7OA 1O33A 2JH5D 1GBLA 3EGKH 3A82A 1TNKA 1SGEE 2G52A 1QCPA 2P59A 2VWMA 3A8BA 2RDLA 1P9SA 1BA8B 1EX3A 1QBNA 4HGCA 3BN9A 3M3SA 4NG9H 1GBAA 1PPFE 3T25A 2ZFPH 2QXJA 1DY9A 1HAGE 2W3KA 5HXFA 1CGIE 3VPKA 8GCHF 3O8RA 4ABAA 2GDEH 3RXLA 3K9XB 2WUCA 1EB2A 1P3CA 3P8NA 3ESTA 1S5SA 1AUTC 1AWHB 4DIHH 1SMFE 3AW1A 5GCHF 1QGFA 3PMBB 1EASA 1HJAB 3QGNB 2XBXA 2O8TA 1X7AC 2BY5X 3LGYA 5H4IB 1IHSH 3RXGA 1O2OA 1SHHB 3KGPA 1C5UA 1FJSA 3BTWE 2JETC 4B1TA 1O35A 1J9CH 1G37A 4CRAA 3RU4E 4CRBA 4D7FA 2ZTZA 2ZC9H 1C2GA 1FN6A 3U1JB 3LGVA 1FAXA 1CQQA 3P95A 2O8MA 2A5AA 4ISLA 2H9HA 1Q3XA 4ABEA 1EP5A 1SQAA 4Y79A 1T31A 3QUMP 2Y80A 1FNIA 5BRRE 3R3GB 2BQ7B 5EGMA 3LGWA 3MTYA 5F8ZA 4BAHB 2C3SA 2BY6X 1O39A 1TBQH 3SOSA 1XVOA 1V2VT 2OC8A 2PKSC 2AFQB 1LMWB 3BTME 1A3BH 1MKWH 2PGBB 1AB9B 1VCQA 3FZDA 2FESH 2K1QA 2ZFSA 2C8WB 2BDGA 5C1UA 2Z3CA 4KTUA 2FYRA 4D7GA 1GJ9B 3FAOA 4R0IA 3MO3A 1C2DA 3SHCH 4Q7ZA 1G2LA 1HAXB 1FY8E 1UHBB 5C3NA 1SFQB 4LK4A 2VJ1A 3NUMA 5EPNA 4AB8A 4BTUB 1BMAA 1WU1A 1LHGH 1GL0E 2H5DA 2D26C 2QF0A 4GCHG 1OWJA 1TB6H 1VJ9U 1ZSLA 1ARCA 3ZYDA 8ESTE 1SR5C 5AFYH 3BTKE 4JK6A 3PTNA 3TJOA 5J4SA 3AVZA 4A1TA 1BITA 3FP8E 1TPPA 7KMEH 1O31A 1MTNB 1AZ8A 1E0FD 1KYNA 4ZHMU 2FS8A 1BTWA 4H4FA 3TH3H 2Z9GA 3GY2A 4KTSA 2OBQA 1LPKB 4ISHH 5T6DA 4CHAC 4X0WU 4E06H 4NCYA 2UUFB 1BJVA 1IQLA 4Y10E 4MNXA 4O3TA 1QB6A 6GCHF 1O5AB 1Y59T 4FU8A 4X6NA 3ATMA 2QY0B 1T8NA 1W13U 1SGDE 2AS9A 2BDBA 3N7OA 2QXHA 3SU5A 1SVPA 2P16A 2CMYA 1IHTH 2WV4A 4A5TS 3T28A 1YM0A 2ZU5A 1ESTA 1O2MA 1YCPM 1GHVH 1KXBA 3PLPA 4AYVB 5DP7A 1TNHA 3GY6A 1GBFA 1ELEE 2OC1A 3ZV8A 2VGCB 1PQ5A 3RMLH 3ZZ4A 1P05A 3OY6U 1TNJA 1TA6A 5A0BA 2GT7A 2BVSH 2W7UA 3SU6A 1JBUH 2PKAB 3LH1A 1GHBF 2STBE 2PGQB 4AGJA 2ZU2A 1S84A 4AFUA 2F9BH 2UUJB 3EA9A 3RDZA 3UIRA 2VWNA 1F5LA 1S6HA 1Z8RA 1GMHF 4YLUA 3BTTE 5EU8A 2Q6GA 1OWKA 2G4UA 1W0ZU 1RTLA 1OP8A 1GI9B 4Q7XA 3SQHE 4B73A 2A7JA 4FUGA 1BIOA 1S6FA 1HRTH 3BIUH 5BPEA 3QO6A 3ZZ6A 3JZ1B 1FPHH 2F9OA 1O5EH 5EQQA 3ZVFA 1A5HA 3MU8A 2W7SA 1XXDA 1P12E 1EP6A 3KQBA 3KQEA 3PYHA 2PUXB 1HV7A 1XKBC 1DITH 1CVWH 1G3CA 3AASA 3MHWU 3NKKA 1L4ZA 3SU2A 3L33A 3P17H 5L2ZH 3JZ2B 1P02A 5J4QA 5CHAB 1P2IA 1W8BH 1TGCA 2YNAA 1O3LA 2OCVB 3F9GA 4FUJA 1NY22 4YT6H 4UEHH 1GHAG 3E90B 3LJOA 1GJ6A 1K1OA 2SGFE 1EAXA 2GMTB 3LPRA 1O3AA 1XUJA 2H9EH 5I25A 2CF8H 3H5CB 1QNJA 1WSSH 5IYTA 4TPYA 3E0PB 1HDTH 2BD7A 3NCLA 2PTCE 2A31A 3GY7A 2BLOA 2EC9H 2J4IA 1DSUA 1PPBH 1GMDG 1UMAH 4Z6AH 2BB4A 3E1XB 2XNIA 3FVFB 1AB9C 3NK8A 1W10U 4MNWA 2BMGB 2TPIZ 1YKTA 2ZHDA 5TJXA 1YPHC 1QA7A 3STJA 3SUEA 1CE5A 4U32A 1DANH 1K1PA 1CT0E 2WPMS 4NGAH 1SLXB 1GHAF 2A45B 1ELGA 1TPSA 1HLTH 3QGJA 2XCNA 4OS4A 2FODA 1WUNH 1C5MD 2BD3A 4NZQA 1GI6A 3SJIA 2F91A 1DPOA 4MQAA 3S9BA 2ZTYA 1FZZA 4ZUHA 4I8HA 1J17T 3SNBA 1ABJH 2HWLB 4ZKRU 3SI3H 1TLDA 1C1UH 1LQDB 3DT0H 1P11E 2QXIA 1YP9A 2LNCA 3RXIA 1A0HB 1OX1A 3HGNA 1QRWA 2HLCA 2ZQ1A 3RXSA 4WMEA 2ANMH 1Z7KA 1C5XB 1GVKB 1VZQH 1SLWB 2BZ6H 1K1LA 3RMNH 3UY9A 1AVGH 3UOUA 2FOCA 1NROH 1K1IA 4NIVA 4DIIH 4X1QU 3V12A 1EATA 1EKBB 4ZKNU 2FOBA 2BOHB 4AFSA 2BQ6B 2Y6TA 3TNSA 3I77A 1A0LA 3UTUH 3ATWA 1YCPH 3K6ZA 1EZUC 1GI4A 4JYTA 3GYMA 3MYWA 2A4RA 1QJ6B 5JBAS 1CHOF 2EI8A 1MCVA 3ZZCA 1K22H 1Y5UT 4H6TA 2XW9A 1GI3A 5LPEA 4IW4E 3UNQA 2VWLA 2D2DA 3TH2H 3I29A 2ZCHP 1T7CA 3RXBA 3RMOH 1TGSZ 3RLWH 2ZFTA 2QYIA 2AGIX 1HIAB 1BUIA 1CO7E 1EOJA 2XCFA 5A8XA 3W94A 3MH5A 4BANB 1NM6A 4MVNA 2B7DH 1J14A 1K2I1 3CENA 1HAZB 2VVVA 3QX5H 2ZGCA 3RXTA 1ELFA 3A85A 4BAQB 2VH6A 1ZTJA 3H7TA 3BTDE 3M36A 3T27A 2RA0A 3UOPA 1QBVH 2JH0D 2VIDA 1D3DB 4AG2A 2TGPZ 1EAUA 3PROA 3S9CA 1Z71A 3LC5A 2ZO3H 1A2CH 2FI4E 1GBMA 2QIQA 4JYUH 2BVRH 2QV1A 4FVBA 1THRH 2XC5A 1Q31A 3ZZ8A 2OUAA 4I32A 1O3KA 3VXEH 1YCPK 2GD4B 1AN1E 2BY7X 1YPLH 2BOKA 4CR9A 2P8OB 1ZR0A 3GICB 1H1BA 2J34A 4ZROA 3P92A 1CBWB 1TNIA 1AVWA 3DFJA 3P8OA 4IMQA 5CHAC 2J9NA 4UFDH 1EZXC 4CH2B 2QF3A 2Z6BD 5L2YH 1BRBE 5T3HA 4DW2U 2GMTC 1UJ1A 2ZDAH 4XBCA 1GHYH 2ANKH 1O2IA 3P8FA 1TGBA 1GHXH 1BCUH 3BTQE 5GJ4B 2QGRA 1GCDA 1NESE 1MTVA 2QXGA 2HPQH 3T29A 1NZQH 4XBBA 4CRDA 2ZPSA 4AN7A 5DK1A 3RM0H 3SU4A 1SGPE 1UTPA 1KSNA 2F83A 4BTIB 1XVMA 1XKAC 1GJ4H 1ZLRA 2A2QH 2H1UA 3D65E 3QZRA 2LPRA 1F2SE 2PUQH 5F8TA 2THFB 1OOKB 4WH8A 5C1YA 3ZZ9A 4FUIA 3ZZ3A 3LOXA 1GI2A 1SGTA 4AYYB 5HM9A