2HALA

An episulfide cation (thiiranium ring) trapped in the active site of hav 3c proteinase inactivated by peptide-based ketone inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Hepatitis A Protease 3C
publication title An Episulfide Cation (Thiiranium Ring) Trapped in the Active Site of HAV 3C Proteinase Inactivated by Peptide-based Ketone Inhibitors.
pubmed doi rcsb
source organism Hepatitis a virus
total genus 52
structure length 212
sequence length 212
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2halA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2halA02
1O3MA 1MQ6A 1NU9A 2OLGA 1PPCE 4IBLH 1HDTH 1GHYH 3O8RA 4WMEA 3ZZDA 1JRTA 4DW2U 2WPHS 2OC0A 4XBDA 2FI3E 2Q6DA 3RXRA 2ASUB 2A2QH 4UEHH 2ZGXH 2WPLS 3HK6B 2WUBA 4AGJA 4FU9A 9LPRA 1BDAA 2P8OC 1M9UA 1RS0A 3MH5A 4JZFH 3ZZAA 4X8VH 3V13A 1H8IH 3KIDU 4HZHA 3A8DA 4R0IA 3A89A 3I29A 2M5TA 1GJDB 3GDSA 1TMBH 5JDUB 3ESTA 2C90B 4OS5A 2PW8H 4CH8B 2G55A 3EA8A 3VB4A 1WCZA 1KTTB 3RXLA 3DFLA 1ZOMA 3OYPA 4X1NU 1HRTH 5CMXH 5L6NH 4OS1A 1SGFA 5HM2A 4AOQA 1OWDA 3MH7A 4I8GA 3M3SA 3TK6A 1EAWA 4NIYA 1HBTH 4NG9H 2VU8E 4KGAA 2C4FH 1IOEA 1DUEA 1EAUA 1N6XA 4YLUA 4FUBA 1NFUA 1O3AA 1NU7B 2GDDA 4D76A 2P16A 4ZH8A 1F0TA 3SNAA 1C1WH 3A85A 1D3PB 2H6MA 2ODQA 3FP6E 4TWWA 1O2SA 3RXGA 2F9VA 1EXFA 3LC3A 1S5SA 2ZECA 5GIBA 2GV7A 4BTTB 2QAAA 1FN8A 1MTWA 1O0DH 1S6FA 1HYLA 2H5CA 3HPTB 1UK2A 4OS2A 4AGKA 1GG6B 2BLVA 1DY8A 4ABDA 2ZFQH 1EAIA 4INLA 1PYTC 4R8TB 4UD9H 1C1QA 2ZTZA 2AGIX 3ODFA 2A0QB 2FOHA 1TAWA 4GCHF 2OXSA 1DE7H 5DG6A 4FUCA 7ESTE 2SGPE 3CS0A 4ABJA 1GG6C 1NTPA 2VWMA 1SQTA 1V2VT 5A0BA 1QA7A 3A7YA 1V2RT 2XWBI 3SNEA 4Y71A 1KDQA 3MU4A 1C1MA 4I8JA 3PLBA 1GCTB 2ZDKA 2D26C 2O8LA 4IS5A 1IQGA 2QYIA 1ZTJA 2G5NA 4AG2A 4HFPB 4J1YA 1KTSB 1S84A 3PYHA 1MBQA 3LGTA 2V35A 2BOHB 1J15A 1SOTA 1GCTC 4YM9A 1Y3XA 1EKBB 2RCEA 3SI4H 1FY8E 1UTKA 4FUGA 3M37A 1Z7KA 3MMGA 1D3QB 1TGCA 3W95A 3NXPA 1BJVA 1GI0A 1EOJA 4X8UH 3NPSA 5ESBA 1Y3WA 4NZLA 1YC0A 1O2OA 4GSOA 3TPIZ 2C93B 2THFB 1V2JT 1PPBH 4RN6A 1AD8H 5ETXA 3RC4A 2B8OH 1LDTT 5AF9H 1GBHA 1OX1A 3GY7A 1C2GA 1F92A 1GCDA 4BTIB 1IQJA 1VCWA 1N8OC 2J9NA 3UOPA 8GCHG 1K1MA 1SGYE 2ZDVH 2PFEA 4K1SA 2DE8A 3RLYH 1AB9C 1ELTA 1QRXA 4F49A 3RM0H 3BF6H 4IMZA 1RIWB 4B2CA 1TMTH 3MU8A 3TLOA 1MD7A 2ZFPH 3F6UH 4KTCA 2JH0D 1PPEE 3NCLA 2F83A 3U69H 2F9NA 1AZZA 1E0FD 3P8GA 2HNTF 1MBMA 1O37A 1F5LA 1UTJA 5EODA 4AFZA 1RIWC 2QC2A 1GBLA 4O03A 1TX8A 4FUFA 1HNEE 1W8BH 2C8XB 1BUIA 4Y0YE 1SGFG 2F3CE 2FYQA 5FPYA 3KN2A 1ZSJA 4JYTA 2HALA 3SQHE 1SGDE 2FM2A 1TGTA 2FWWA 4THNH 1BJUA 1CHGA 4JYUH 4A6LA 1FIZA 1MTUA 1P2JA 2AS9A 4NSYA 3SJOA 1K1NA 1LHCH 1PQ7A 3PV4A 3MNXA 1Z8JB 1UVSH 4TPIZ 5K7RA 1TA6A 3EAJA 4ZKNU 1GI1A 5C20A 3ZVCA 3E0PB 3QWCH 3ATWA 2GD4B 1O2KA 1FN6A 3UNSA 4AG1A 1MTVA 2BLQA 3ITIA 2ZNKH 4Y79A 1D3DB 3SOSA 2BD2A 2W3KA 4Q7YA 5T3HA 2OQUA 1AVWA 4MNWA 1C5OH 1LPKB 3Q76A 2J2UA 2XC0A 1FV9A 1TBZH 1ETTH 1C5ZB 2R9PA 4OS7A 4MVNA 2Z3CA 3MTYA 1OWJA 1E36B 2BX3A 1EASA 3A88A 5EQRA 4ZUHA 3ZVFA 1SOZA 1OWEA 3R0FA 1S81A 2XC4A 1HAIH 1OP0A 1IAUA 1P11E 3UWJH 1G37A 1W11U 4KELA 1OOKB 1Y3UA 1LQEA 2F9UA 3ZYEA 2Z3EA 3D49H 1FUJA 3A8AA 3E3TA 1AGJA 1CGIE 1A7SA 1F5KU 2FMJA 3SGAE 5HM9A 3P70B 1QY6A 2R2WU 1QB6A 3GDUA 1IHSH 3SU5A 4CRBA 1UTNA 4AYYB 3A86A 4MTBA 1CBWB 2BYAX 3SHAH 1T8NA 2G4TA 5C5NA 4VGCB 1C2EA 3RDZA 3M36A 4E06H 1WUNH 4RSPA 1XKAC 1SSXA 1C1VH 4UFEH 1CBWC 3RXKA 1MU6B 2A4RA 1JIMA 1YBWA 3MHWU 5CHAC 4VGCC 3D65E 1O5GH 2ZGBH 2BM2A 1L4ZA 2PKAB 3SV8A 2VWLA 1BTUA 1V2NT 1EP5A 3TIUA 2BMGB 4E7NA 3A7XA 1C1RA 1N6YA 1TONA 3Q00A 1YCPK 3UIRA 3BTQE 1GVZA 1P12E 5JYIA 3UQOA 1XMNB 5AFYH 1GHVH 1BBRE 1QFKH 3F9HA 3T62A 2VWOA 4AFQA 5L2ZH 2FI4E 3RUOA 1Q2WA 3BTFE 4GPGA 1CA0C 1O35A 1Z8GA 4CBOA 4NA7A 1NRNH 3WY8A 5JBCS 1OKXA 3MU1A 3S7KB 1NRSH 1P9SA 4B73A 1W13U 3M7QA 1P06A 1DSUA 3ZZ5A 4YT7H 1JWTA 1LPZB 2R2MB 5DJ7A 1AVGH 3HGPA 2PGBB 3JZ2B 2I6QA 4IMQA 1O2RA 1FY4A 1P2NA 1UHBA 4XE4A 1AMHA 3IWMA 4X8SH 1O3FA 1C5WB 2P3FH 3TJVA 3UFAA 1AKSB 2V6NA 1GI8B 1UVTH 3UREA 2BDGA 1CVWH 1Y3YA 2D1JA 3M3TA 3A84A 4INKA 1GJ9B 1P03A 3L33A 1TRMA 2W3IA 1VCPA 1K22H 3MNCA 4YESB 3ZZ9A 1O2GH 1YCPM 5C1XA 4MPXA 1A3EH 1HAVB 2QA9E 3GY2A 2W5EA 1GPZA 1QNJA 1YLCA 1DVAH 1O2YA 4B1TA 4BAQB 1QGFA 1MH0A 2G4UA 2BXTH 1Z6JH 2ZFFH 2F9PA 1VJAU 4NFEA 2STBE 4ABIA 1SGTA 2G52A 2XNIA 4U32A 2VGCC 3OU0A 1AUTC 1JIRA 1JXPA 3SNBA 1NESE 5DP5A 2AIQA 2PV9B 2Y5FA 4JZDH 2ZA5A 4LZ4B 1EPTB 4MG3A 1RJXB 1N1LA 2JKHA 1W2KH 2BQ6B 1Y3VA 2D2DA 2A7HA 2J38A 4Y11E 2O8TA 2ZFTA 2Y5GA 3LU9B 1EPTC 1V2TT 1YCPH 3BIVH 1SR5C 1G3BA 1SPJA 1UJ1A 1KIGH 1F0UA 2A32A 1BHXF 5F8TA 5C5OA 1J9CH 4DOQA 1J14A 1SLUB 4YOGA 1GBAA 2VIVA 2VIDA 2XXLA 1P9UA 3NKKA 5JB9S 2FYRA 2RG3A 3F9FA 2A45B 4DIHH 1HXEH 3LGIA 3BV9B 1O3KA 3RXFA 2VIPA 1AIXH 6CHAB 1O3IA 1FAXA 3RC5A 3O8DA 3F9GA 3PLPA 1ACBE 4YLQH 3AASA 1YPKH 2ZKSA 2SGQE 2ZFSA 6CHAC 1G2LA 2GZ9A 3BTME 1W10U 2ZPSA 5E8EH 1C1OA 1DUAA 2PLXA 5F8XA 1HAPH 1O3DA 2ZHEH 4NFFA 1ZJKA 1V2PT 1O3JA 2ZDNA 4AFSA 1WOFA 1P04A 2FTLE 1GHAG 2VIQA 2FPZA 2K1QA 1WTGH 1GWAA 5C3NA 1IQNA 1O3GA 5EXNA 1MAXA 3SU2A 5DP8A 1VZQH 1C9TA 3NUMA 2FOGA 2NWNA 2JH6D 2BY8X 2YOLA 3BTDE 3ENSB 5EQQA 1GBEA 2VWNA 3PB1E 4IC5A 2LNCA 1VCQA 1TNKA 2WINI 1ELEE 2CXVA 1ZPBA 2OBOA 4ISOA 2ZC9H 4WJG2 2BTCE 2BVRH 3HGNA 5CE1A 3AW1A 3M5MA 4ASHA 1O3PB 3G01A 1ABJH 2GTBA 2BOKA 1K1PA 1ZGIA 1VITF 2FZZA 1QHRB 3I78A 3RXDA 1MMJN 4CREA 1ESBA 3M7TA 1GHZA 2ILNA 2XW9A 2QN5T 2AMQA 1C1PA 2F9BH 3BTTE 3QO6A 1AQ7A 2A4OA 1ELFA 1YKTA 2P95A 4KTSA 4Q7ZA 1DANH 3SNCA 2ZP0H 4Y76A 3HATH 1GJ5H 1ZJDA 1AE5A 3BTWE 2ZDMA 3R3GB 1A0JA 2BD3A 2PSXA 2PUQH 3LT3A 2BD8A 1IQEA 4TY6A 4BXWA 3U9AH 2BZAA 4Y8YA 1GBIA 1PPZA 3E90B 1CE5A 3RP2A 2R3UA 1SFQB 1MU8B 1O2HA 1C5QA 5FXLA 1YYY1 3SJKA 3E16B 1S0QA 3GYMA 3B23B 4I8KA 1C2MA 1A4WH 2BD9A 1BZXE 1LPGB 2UUKB 4XFQA 5GCHF 1TOCB 1G9IE 3BEUA 1GDUA 5H4IB 1P2QA 1QBVH 2A2XH 1P01A 4ZKRU 2GT7A 4Q2KA 1KLJH 1P3EA 4ESTE 1EOLA 3BIUH 4A1TA 1C2FA 1TPPA 1MZAA 3GY5A 3W94A 4B75A 2QXJA 4LK4A 2SGAA 5I25A 5C2ZA 1T8LA 2Z9GA 4YT6H 2GT8A 3RXAA 3E8LA 1CQQA 4A5TS 3RM2H 3GY4A 2VVVA 1XX9A 2GCTB 2WPJS 3RXMA 2KAIB 3TVJB 4X2WA 4MLFB 4UE7H 8LPRA 1NFWA 1GJ7B 3IG6B 2B7DH 2AGGX 3DFJA 1H1BA 3STJA 1W0YH 2AGEX 1VGCB 1MD8A 2UUJB 3M5LA 1SBWA 1CU1A 1P3CA 3SGBE 1VITG 1GBMA 1O2WA 2Q6GA 1CO7E 1HJAB 2EI6A 3GCOA 4ISHH 1P2IA 3IITA 1VGCC 3AAUA 3RC6A 4IN2A 5L2YH 4WY3A 3A83A 3PMAB 4CBNA 1P09A 2P3UB 2ZFRH 4K8BA 3TU7H 3MOCA 1EZUC 4ZHAA 1RTFB 1FI8A 1V2MT 3K2UA 5EOKA 1QJ1B 3P95A 1B7XB 4PROA 1TWXB 1ELGA 2XRCA 4O3TA 1V6DA 1XKBC 2J92A 1AY6H 4AYVB 1XVOA 1ELCA 1FPHH 3BSQA 2ZHDA 1IQKA 1B0FA 2BZ6H 2ZU4A 8GCHF 3C1KA 2BB4A 4GAWA 2FOAA 2HPQH 4IGDA 4XBBA 4AB8A 4U2WA 2F9OA 2AIPA 1ELAA 5FBIA 3A8BA 2C8ZB 5GCHG 3ZZBA 3S0NA 1AZ8A 1BRUP 1Z6EA 1E37B 1QB9A 4GVUA 3BG4B 1YLDA 1KXFA 3ZVEA 1AO5A 3M3VA 3SW2B 1C4Y2 3GCNA 2PKAA 1C1SA 2NU2E 1HJ8A 1EZXC 1P8VC 4FUEA 3EDXB 1C5RA 1C2KA 3ZVDA 1L2EA 2BD5A 2CJIA 5A0AE 1DM4B 3BG4C 2CF9H 1PFXC 1V2UT 4BAMB 1O34A 1ZSKA 5J4QA 2FOBA 1TPSA 2WV4A 3PMHB 3RU4D 2Y6TA 3F9EA 3ELAH 1G3CA 3T2NA 3MFJA 3A87A 3PROA 4X1SU 3V7TA 3T27A 1O2IA 3DA9B 3OY5U 1Y8TA 4UFDH 1K21H 1K2I1 3MNBA 1SLXB 2FLBH 1GI9B 2JETB 2VB0A 3E91A 5LH8A 4A1XA 1KXBA 1A1RA 2Y82A 1AKSA 1O2ZA 1SHYA 1F0SA 3LGUA 4OS6A 3MI4A 3VXFH 5FCKA 2Y81A 1AI8H 2HPPH 1NN6A 4XSKU 2BXUH 1TQ0B 2GDEH 1LHDH 3A7ZA 1QTFA 1HAVA 2OTVA 1BRAA 2SGDE 4BANB 1CGJE 4Y8ZA 1ELVA 1FAKH 4I32A 8ESTE 1GMHG 1W0ZU 1O5BB 2ALVA 2CF8H 2CHAB 1TNHA 1GDNA 1YF4A 4BAHB 2CGAA 2SNVA 4ABFA 2JH5D 3P8NA 3T5FH 2EI7A 1TPAE 2P3TB 2IN2A 2ODPA 4NZQA 1IQIA 2CHAC 1H4WA 8KME2 1CHOG 2Q1JA 3QX5H 3MH6A 2ZPQA 1EPTA 1P2KA 4X1RU 4WXIA 1T4UH 1BRBE 1WQVH 3Q77A 5FX6A 5GPIB 2G8TA 3KCGH 3TJOA 4MPVA 1E35B 1FQ3A 4F4OC 1THRH 1ZTLA 1ETRH 2CMYA 1O2XA 2OP9A 3U1IB 3GOVB 4Y7AA 1AUJA 2ZEBA 1EB1H 1TBQH 2AH4X 2GVFA 1D9IA 1C5LH 3S69A 1O2NA 1ZRKA 2TGAA 5LPEA 4CRDA 1Z1IA 1XM1A 3LH1A 1HXFH 3QGJA 2WYGA 4WWYA 3V0XA 2BY6X 5C1YA 4ISNA 1SC8U 3UUZA 3RXIA 1DWDH 3PTNA 2XCFA 4O97A 4DG4A 3TGKE 3NZIA 1O5FH 1EJMA 2GZ7A 4Q80A 3S9CA 3LONA 1D6WA 3LIWA 4NA9H 1GI3A 3TGIE 4D7GA 1O2MA 3SU0A 3QGNB 1NFYA 1TIOA 1UTPA 1DX5M 4BTUB 3HKJB 3OY6U 1C5XB 2IJOB 1W7GH 1A2CH 3HKIB 4J2YB 3QTVH 5DP9A 1DDJA 4BAOB 1RFNA 2A5AA 5I46H 1K1JA 3VB5A 3ATKA 4IC6A 1DY9A 3ZVBA 3LC5A 1BTZA 3BEFB 2XBXA 3U8OH 1QA0A 2WPMS 1B5GH 1C2DA 4JYVH 2ZHWH 1HV7A 1OPHB 7GCHG 4X8TH 2F91A 4JK6A 1INCA 3KQBA 4JCNA 7KMEH 1TQ7B 5T6GA 4DY7B 2B9LA 3LGWA 3LJOA 2AMDA 1T8MA 1B0EA 2ZQ2A 3B9FH 1DFPA 1L1GA 2LPRA 5DPAA 1TOMH 5T6FA 1O3NA 5HXFA 2W7SA 1PQ8A 3SU6A 1QRWA 4Y8XA 4TPYA 3SGQE 1DLKB 3U98H 1EJNA 1YPMH 4Z6AH 2HOBA 3PO1B 1QQ4A 3D23A 2QXHA 4YOJA 2AFQB 1O2PA 1OSSA 2Q6FA 4ZHMU 1TNLA 3SU3A 3EA9A 5BPEA 3PO1C 5GDSH 2GP9B 1GI4A 5F6MA 3U8RH 5GXPA 3K9XB 4FUJA 1DWCH 1EATA 1GJ6A 4NWLA 3TJUA 1ESAA 2VINA 3BN9A 3QZRA 2ZCHP 1ZPZA 5EQSA 1EAXA 1XXDA 3SORA 1O32A 2ULLA 5HGGA 5C67A 1GDQA 1EZSC 1HAOH 5EW2H 3TK9A 2FLRH 4ZHLU 2VH0A 1ZLRA 3SN8A 4BAKB 1GMCF 2Z3DA 3MO9A 1BCUH 3ZVGA 4OGXA 1PQAA 3MO6A 1C5UA 1C2IA 3S7HB 1SLWB 4CRCA 1DWEH 1UCYK 1O3BA 1KLIH 4ZKSU 4BNRA 5JBAS 3STIA 4UDWH 1Y5BT 3GCTG 5ABWA 5FHTA 1TA2A 4ZXXH 3RMNH 3GISB 1A5IA 2B5TB 3OX7U 4B2BA 4B2AA 1Y59T 4Y7BA 1GI2A 1NROH 2XBWA 2ANMH 3MO3A 3SV9A 1BT7A 3QZQA 1DS2E 1KXCA 1HAZB 1CSOE 3O8CA 1F5RA 1GBDA 1SGIB 4K60A 3RLWH 2Y80A 4X6OA 1EJAA 1LHGH 2ALPA 3EYDA 5DP7A 1LO6A 3PM3A 3LGYA 1THSH 2KAIA 2P93A 3SBKA 5DP6A 2J95A 2FEQH 4LOYH 1TPOA 2H1UA 6GCHF 3TH4H 2SGEE 1YPLH 1SGRE 1GHAF 1BRCE 3ZZ3A 1TE0A 2ZWLH 3BEIB 1HIAB 2NU0E 1GHBG 2QCYA 3GCHB 5DP4A 1WYKA 2BDHA 1XUKA 2XC5A 4ZROA 2A5IA 1ZPCA 1K1LA 2O9QA 2XCNA 2R0LA 3A82A 5HMAA 3T25A 3B8JA 1XUHA 2ZCLP 1HAXB 4AFUA 2J94A 2VVUA 2A5KA 4OGYA 1EB2A 1AFQB 2J4IA 1OS8A 2W7UA 2ZHFH 2EI8A 2UUFB 3RXHA 1FY1A 3KF2A 1D3TB 1IQHA 2QXGA 2RDLA 1AFQC 2BLWA 2HGTH 2NU3E 2HVXA 5BRRE 1GBKA 2FI5E 3S9BA 2G5VA 1NS3A 2BY7X 1GMCG 2WUCA 3RXBA 1UTLM 2BDBA 1UCYH 4FUHA 3TH2H 1U6QA 3AVZA 5JB8S 3MU5A 4MDSA 1QIXB 1XUIA 1O33A 1HB0B 1QQUA 2ZGHA 1RD3B 5AVDA 3UQVA 5E0GA 1O38A 1UO6A 1G2MA 7LPRA 1P05A 4WXVA 1TMUH 5A8ZA 4KP0A 3V3MA 4ISIH 2FXRA 4NGAH 1MKWK 1P0SH 1CGHA 1E38B 3ATLA 3KQDA 3PTBA 4JK5A 3E1XB 1V3XA 3M7UA 1O5CB 1QBNA 3CP7A 2TRMA 2AEIH 1TBRH 3M5OA 1W7XH 1ZHMA 1XXFA 2ZHQH 2IPHA 1UK4A 2FTMA 1SB1H 2PWXA 2TIOA 2OC1A 2FOMB 1SI5H 5AHGH 1F7ZA 4U30A 6GCHG 2ZGCA 1O31A 1QURH 2O8MA 2G00A 1ARCA 2GCHG 2OINA 1ETSH 5ESTE 2IOTA 1A0LA 2BD4A 2ZDAH 3LKWA 4DT7B 1A3BH 1PYTD 1T7CA 1UTOA 1O3HA 2ZU5A 2RA0A 1G32B 1SVPA 1WAYB 5EXLA 4HGCA 1LCYA 5DO4H 1GMDF 2BD7A 1ANDA 3L6PA 3A7WA 3ZVAA 3AAVA 1BTPA 2FP7B 2OUAA 3P17H 4CR5A 1FMGA 1LVMA 1EP6A 2QIQA 5E0HA 3A81A 3DT0H 3SV7A 4ABBA 1O2TA 2WPIS 2Y5HA 2QF3A 2A7CA 1TB6H 1Z8IB 4AB9A 3KNXA 4DJZB 2FX4A 3RMOH 1IQLA 1TRYA 3FFGA 2NU4E 1C1TA 2UWLA 1SGNE 2GGVB 5FCRA 3UNQA 4BOHA 2H9EH 5E2PA 1AFEH 4X1QU 1ELBA 1ZMJA 1MKWH 2ZU2A 4X1PU 3T29A 2AYWA 4M7GA 4KTUA 4JZIA 1QL9A 1TNJA 1TX7A 1DITH 1OWKA 4YO9A 4QT8C 4I8HA 4WH8A 4FU7A 1JMOH 1TLDA 1K1OA 1LVYA 4WF8A 3JZ1B 5DP3A 2ZIQH 3RXTA 1C5YB 1O39A 1IHTH 2ANKH 2ANWA 1GL0E 2B0FA 4B71A 2BDIA 3NK8A 4FVDA 4K1TA 1RRKA 1C2LA 4JZEH 4NIVA 3BTGE 4X6PA 2PKSB 1SQOA 1ZR0A 4ZXYH 2UWPA 1C4V2 2BVSH 2ODYB 2CN0H 4I33A 3RXJA 1UMAH 3GY6A 4RKOB 2Y7ZA 5EGMA 3RMMH 1MAYA 1O2QA 4D7FA 3SV6A 1W3CA 1MZDA 1FPCH 4XDEA 2PKSC 2QF0A 2GZ8A 2ZU3A 3CENA 3PMJA 5F8ZA 3GY8A 2P94A 1DT2A 1RXPA 3VEQB 2C3SA 2UWOA 1GMDG 1KSNA 1BMAA 5JBBS 4A1VA 1MUEB 1L4DA 1H8DH 2GCTC 2GMTB 4TY7A 1G30B 4K1EA 1YPHC 1J8AA 4DURA 3Q3XA 4O3UA 3D62A 3SJ8A 1G3DA 1P57B 2AERH 3M35A 4FUDA 1OYQA 1TFXA 2GMTC 3BTKE 3ATIA 1BHXB 1EX3A 3V12A 2P8OB 1KLTA 2TPIZ 1O2LA 3F1SB 1O3OA 2ZCKP 2WPKS 3KHVA 1HJAC 2BVXH 2O8WA 1O5EH 1GBCA 1XVMA 2G51A 4MPUA 1WSSH 1SFIA 1ZMNA 4E7RG 4H6SB 1FIWA 1EZQA 2OD3B 1XUFA 1UVPA 4KKDA 2H5DA 2VNTA 1C5TA 4BXSA 3RXPA 3EGKH 5T6DA 3KEEA 4I7YH 1NO9H 2XWAA 1FLEE 4ZMAH 2ZPRA 1D6RA 1OWIA 1YPJH 2FS8A 1XUJA 2VJ1A 3FAOA 4JZ1A 1S83A 1Q3XA 2BDCA 2XBVA 3LDXH 1GMHF 1GHWH 4CR9A 3KQCA 4ABHA 1GBJA 3OSYA 1O2VA 1O3EA 2BDAA 1F0RA 4B76A 4Z0KA 1CHOF 3FVFB 1KXDA 4NIWA 5AFZH 2ZDLA 1HLTH 1BMMH 1WV7H 1LVBA 2Z7FE 2R0KA 4WMDA 1F2SE 1P2OA 1JBUH 1YPHE 3QK1A 4X6NA 3SZNA 1QCPA 3UNRA 1SHHB 1O36A 2ZZUH 1WBGB 1DSTA 4AX9H 3VB3A 1GI5A 1TGSZ 3SU4A 2QV1A 4X0WU 1FNIA 1A5HA 2D8WA 4OS4A 4ISLA 5A0CA 3KQEA 5F03A 4RKJB 5E2OA 3HK3B 1HPGA 4DGJA 5K0HA 2BQ7B 2SFAA 1QJ6B 1TABE 5DKMA 4E05H 3H7OA 2GV6A 2BDYA 6ESTA 3MH4A 3ODDA 5LGOA 3MWIU 1UTMA 1GJ4H 3QLPH 1LVOA 1J17T 1YPEH 1X7AC 1C5VA 5A2MH 2PTCE 1DPOA 4MNYA 1TRNA 4SGAE 2JETC 2OBQA 1TGNA 4DIIH 2FIRH 2C8YB 1FDPA 1P10A 1D4PB 3VB7A 3H5CB 4ZKOU 1PPFE 1C4U2 1HUTH 2UUYA 2Z9KA 3RXVA 1GBFA 3S9AA 1MCVA 7GCHF 2VVCA 4D9RA 1SLVB 2XBYA 1HIAA 1O2JA 4H6TA 1QL8A 1AE8H 4FXGH 2H9TH 1HAGE 1RTKA 1C1NA 1V2KT 1MKXK 2A7JA 4ZAEA 5A09A 3URDA 4Q7XA 4Y6DA 2Z6BD 2TGPZ 3E0NB 1S82A 1G36A 1GGDB 4YTAA 4IW4E 1KYNA 3SUFA 1N8OB 4CRFA 1ANCA 2QY0B 2PR3A 2QXIA 1J16A 5EXMA 1NPMA 1ANEA 1H9IE 1GBTA 1GGDC 1AB9B 3RXEA 2W26A 1PQ5A 2TGDA 2XTTB 3DUXH 4DCDA 4XOJA 1UCYE 1BTYA 1ESTA 3DD2H 1DWBH 3F68H 1TNGA 4SGBE 3GICB 4ABEA 1C5PA 1BITA 2BHGA 3LPRA 1QJ7B 1MTNB 5FBEA 5IYTA 5FX5A 4GCHG 2A4QA 1YGCH 1ZRBA 1SMFE 3M5NA 3ZZ8A 1ZTKA 1CT4E 3EQ0H 1MTNC 3BG8A 1GI7B 4CRAA 1O5AB 3EA7A 2ZQ1A 5TCCA 2FDAA 3PMBB 2HLCA 5EPYA 1TALA 1NRRH 2I6SA 1O2UA 1XUGA 3SUEA 3TH3H 3ZV9A 1GHXH 1PJPA 4ABAA 1Q31A 2G81E 1O5DH 3ATMA 1BTHH 1C1UH 1AWFH 3TJNA 1BOQA 1LQDB 3UWIA 1CT2E 3GCTF 1BB0B 1C2HA 5FPTA 2VH6A 4K2YA 1KXAA 2Y7XA 4GHQA 1THPB 5FAHA 1A5GH 2ZO3H 1UTQA 4K69A 3P92A 1EQ9A 4WVPE 4NWKA 1YP9A 3SU1A 4Y10E 3LGVA 2YNBA 3VPKA 2PSYA 2SGFE 1MKXH 1ELDE 1ID5H 2BLOA 3VFEA 4X2XA 3A7TA 3N7OA 5TCAA 1SGPE 1GI6A 2OC8A 3FANA 4XBCA 2WYJA 1C5SA 1NT1A 5GWZA 1HAYB 2DUCA 3I77A 1TGBA 1DLEA 3BTEE 3VXEH 4D9QA 4GHTA 1UVOA 3SNDA 1GBBA 2YNAA 1Z71A 2EC9H 1GHBF 2RA3A 1KY9A 1TYNA 4CRGA 3CS7A 1FY3A 1LMWB 4NSVA 1GJBB 4HI3A 3A80A 1VJ9U 1SGCA 1ZZZA 4MNXA 5DK1A 2BY9X 3QN7A 3SV2H 3TITA 1GJAB 2OQ5A 1NM6A 2A4GA 5GJ4B 2Z94A 2P59A 1BTXA 2VIOA 4I31A 3RXCA 1LHFH 3K6YA 4YOIA 3UR9A 3VGCB 4A92A 1OWHA 5CHAB 3ZZ7A 4TWYA 1NRPH 1Z1JA 3C27B 4K3JA 1A61H 2J34A 1FJSA 4MNVA 1QR3E 1V2OT 3VGCC 1YM0A 9ESTA 1HGTH 2H2ZA 1NC6A 3RXUA 4TYDA 4FVBA 5JPMH 3GYLB 1HCGA 2TBSA 2Z9IA 2PHBA 3SUDA 1GVKB 4X2VA 2GX4A 4MPWA 3Q3KA 4K5ZA 2BQWB 5HYOA 1CA0B 1FZZA 4HTCH 4ABGA 1L1NA 1W12U 3Q3YA 1T32A 1KDQB 3TK5A 4X6MA 1GJCB 1L1JA 3TNTA 3MNSA 1WU1A 5IDKA 1OP2A 1HFDA 4GLYA 1GVLA 1ARBA 1BMLA 3U1JB 3NWUA 1MCTA 1AVXA 3EE0B 5LPRA 1P02A 3P8FA 1TNIA 1OXGA 1DICA 5TJXA 2C8WB 1JOUB 1ZMLA 2FODA 3MU0A 1AHTH 4IN1A 3RMLH 5EG4A 1W14U 2V3HH 1RGQA 1V2ST 4H42U 5EPNA 1T31A 3ZZ6A 1C9PA 1DOJA 4NA8A 2V3OH 2ZI2H 2CV3A 4LZ1H 4INHA 2GCHF 3VB6A 3LOXA 1C5MD 2FX6A 2A1DB 3GDVA 4UFFH 2HNTC 3RU4E 5A8YA 4X2YA 4D8NA 3ZV8A 1LTOA 1IQFA 4U01A 3GCHC 1O3LA 4WH6A 3QTOH 1C5NH 1O3CA 1O30A 2ZTYA 3O8BA 1Y5UT 2ZTXA 2VGCB 3SI3H 3P6ZB 1S0RA 3UR6A 3LJJA 4NCYA 1NY22 1AN1E 1QB1A 1QRZA 2BY5X 1IQMA 1V2QT 2HRVA 3K6ZA 4Y0ZE 3A8CA 5EU8A 2V0BA 1E34B 2ZF0H 1VITH 3PLKA 3U8TH 4AN7A 4MQAA 3PWCA 2PUXB 3ZYDA 5LPFA 5EW1H 3H7TA 4FU8A 1NZQH 5C1UA 1DXWA 3SJ9A 5JBTA 1MQ5A 2O8UA 3DHKH 4CHAB 1CT0E 2EA3A 1SG8B 2QGRA 5B6OA 1ZSLA 2TGTA 1H9LB 1A0HB 2Z9LA 2ZG0H 5L30H 1L0ZA 4AZ2B 4I8LA 1WTHD 1V2LT 4CHAC 5SGAE 4NIXA 3FP8E 3KL6A 2HNTE 1ABIH 1K9OE 1QL7A 1ZYOA 5E0JA 1H9HE 1NFXA 1WQSA 3FZZA 1ZHRA 2XYAA 4A7IB 3UTUH 3UY9A 4GUXA 3ZZ4A 2A31A 1S6HA 2PTNA 3PWBA 2FO9A 1ORFA 4O9VA 1NRQH 3LH3A 2ZGJA 1Z8RA 4H4FA 2OCVB 2STAE 1BBRK 2PGQB 2NU1E 1LKAA 1K1IA 1LKBA 4UFGH 3SJIA 1T8OA 1EUFA 1FXYA 5FPSA 3UOUA 1JRSA 2VIWA 4UONA 1HAHH 1UK3A 1CA8B 5J4SA 1BA8B 1OP8A 3SO3A 6LPRA 3BTHE 1ZHPA 1RTLA 3URCA 1Y5AT 1SGQE 1YPGH 1T4VH 4YZUA 2BX4A 1VR1H 2HWLB 3RU4T 1A46H 2ZU1A 1BIOA 2R3YA 5G4BA 3QUMP 1SGEE 2EEKA 2Z9JA 1P2MA 1SL3A 3SQEE 1BQYA 1PPGE 1OYTH 5DGJA 2H9HA 3A7VA 3E6PH 2OC7A 2AMPA 1GJ8B 4AORA 2GKVE 3RXSA 1BMNH 2FOEA 2ESTE 4JMYA 3M61U 1MTSA 3K65B 3MYWA 3P8OA 1FY5A 1HJ9A 3ZZCA 4LXBH 4DVAU 1G3EA 1PPHE 1UVUH 3L3TA 4WMFA 3RXOA 3T28A 2DE9A 1LHEH 1AU8A 1SQAA 1AWHB 3AW0A 3QDZB 1BTWA 5PTPA 2SNWA 2WV5A 3SHCH 3TGJE 3KGPA 1K28D 2FS9A 1C2JA 1ZGVA 1BBRH 2FESH 2FOCA 3SUGA 5A8XA 1QBOA 1GL1A 1KXEA 4FUIA 3GY3A 1TX6A 4K8YA 4CH2B 3T26A 1ANBA 1S85A 4B74A 1FONA 3FP7E 3RXQA 1UHBB 3OTJE 2ANYA 3TNSA 3FZDA 1DXPA 3UPEA 1V2WT 2FOFA
chains in the Genus database with same CATH superfamily
1O3MA 1MQ6A 1NU9A 2OLGA 1PPCE 4IBLH 1HDTH 1GHYH 3O8RA 4WMEA 3ZZDA 1JRTA 4DW2U 2WPHS 2OC0A 4XBDA 2FI3E 2Q6DA 3RXRA 2ASUB 2A2QH 4UEHH 4F55A 2ZGXH 2WPLS 3HK6B 2WUBA 4AGJA 4FU9A 9LPRA 1BDAA 2P8OC 4Q63A 1M9UA 1RS0A 3MH5A 4JZFH 3ZZAA 4X8VH 3V13A 1H8IH 3KIDU 4HZHA 3A8DA 4R0IA 3A89A 3I29A 2M5TA 1GJDB 3GDSA 3OEHD 1TMBH 5JDUB 3ESTA 2C90B 4OS5A 2PW8H 4CH8B 5HKKD 2G55A 3EA8A 3VB4A 1WCZA 1KTTB 3RXLA 3DFLA 1ZOMA 3OYPA 4X1NU 1HRTH 1OHHD 5CMXH 5L6NH 4OS1A 1SGFA 5HM2A 4AOQA 1OWDA 3MH7A 4I8GA 3M3SA 3TK6A 1EAWA 4NIYA 2XNDD 1HBTH 4NG9H 2VU8E 4KGAA 2C4FH 1IOEA 1DUEA 1EAUA 1N6XA 4YLUA 4FUBA 1NFUA 1O3AA 1NU7B 2GDDA 4D76A 2P16A 4ZH8A 1F0TA 3SNAA 1C1WH 3A85A 1D3PB 2H6MA 2ODQA 3FP6E 4TWWA 1O2SA 3RXGA 2F9VA 1EXFA 3LC3A 1S5SA 2ZECA 5GIBA 2GV7A 4BTTB 2QAAA 1FN8A 1MTWA 1O0DH 1S6FA 1HYLA 2H5CA 3HPTB 1UK2A 4OS2A 4ACAA 4AGKA 1GG6B 2BLVA 1DY8A 4ABDA 2ZFQH 1EAIA 4INLA 2L74A 1PYTC 4R8TB 4UD9H 1C1QA 2ZTZA 2AGIX 3ODFA 2A0QB 2FOHA 1TAWA 4GCHF 2OXSA 1DE7H 5DG6A 4FUCA 7ESTE 2SGPE 3CS0A 4ABJA 1GG6C 1NTPA 2VWMA 1SQTA 4ASUD 1V2VT 2LP6A 5A0BA 1QA7A 3A7YA 1V2RT 3U28C 2XWBI 3SNEA 4Y71A 1KDQA 3MU4A 1C1MA 4I8JA 3PLBA 1GCTB 2ZDKA 2D26C 2O8LA 2HLDD 4I86A 4IS5A 1IQGA 2QYIA 1ZTJA 2G5NA 4AG2A 4HFPB 4J1YA 1KTSB 1S84A 3PYHA 1MBQA 3LGTA 2V35A 2BOHB 2K8IA 1J15A 1SOTA 1GCTC 4YM9A 1Y3XA 1EKBB 2RCEA 3EE7A 3SI4H 1FY8E 1UTKA 4FUGA 3M37A 1Z7KA 3MMGA 1D3QB 1TGCA 3W95A 3NXPA 1BJVA 1GI0A 1EOJA 4X8UH 3NPSA 5ESBA 5T1VA 1Y3WA 4NZLA 1YC0A 1O2OA 4GSOA 3TPIZ 2C93B 2THFB 1V2JT 1PPBH 4RN6A 1AD8H 5ETXA 3RC4A 2B8OH 1LDTT 5AF9H 1GBHA 1OX1A 3GY7A 1C2GA 1F92A 1GCDA 4BTIB 1IQJA 1VCWA 1N8OC 2J9NA 3UOPA 8GCHG 1K1MA 1SGYE 2ZDVH 2PFEA 4K1SA 2DE8A 3RLYH 1AB9C 1ELTA 1QRXA 4F49A 3RM0H 3BF6H 4IMZA 1RIWB 4B2CA 1TMTH 3MU8A 3TLOA 2W6JD 1MD7A 2ZFPH 3F6UH 4KTCA 2JH0D 1PPEE 3NCLA 2F83A 3U69H 2F9NA 1AZZA 1E0FD 3P8GA 2HNTF 4Q4LA 1MBMA 1YY3A 1O37A 1F5LA 1UTJA 5EODA 4AFZA 1RIWC 2QC2A 1GBLA 4O03A 1TX8A 4FUFA 1HNEE 1W8BH 2C8XB 1H8HD 1BUIA 4Y0YE 1SGFG 2F3CE 2FYQA 5FPYA 4DT4A 3KN2A 1ZSJA 4JYTA 2HALA 3SQHE 1SGDE 2FM2A 1TGTA 2FWWA 4THNH 1BJUA 1CHGA 4JYUH 4A6LA 1FIZA 1MTUA 1P2JA 2AS9A 4NSYA 3SJOA 1K1NA 1LHCH 1PQ7A 2LELA 3PV4A 3MNXA 1Z8JB 1UVSH 4TPIZ 5K7RA 1TA6A 3EAJA 4ZKNU 1GI1A 5C20A 3ZVCA 3E0PB 3QWCH 3ATWA 1UW7A 2GD4B 1O2KA 1FN6A 3UNSA 2JIZD 4AG1A 1MTVA 2BLQA 3ITIA 3UAIC 2ZNKH 4Y79A 1D3DB 3SOSA 2BD2A 2W3KA 4Q7YA 5T3HA 2OQUA 1AVWA 4MNWA 1C5OH 1LPKB 3Q76A 2J2UA 2XC0A 1FV9A 3FKSD 1TBZH 1ETTH 1C5ZB 2R9PA 2YMSD 4OS7A 4MVNA 3NRLA 2Z3CA 3MTYA 1OWJA 1E36B 2BX3A 1EASA 3A88A 5EQRA 4ZUHA 3VG8A 3ZVFA 1SOZA 1OWEA 3R0FA 1S81A 2XC4A 1HAIH 1OP0A 1IAUA 1P11E 3UWJH 4F48B 1G37A 1W11U 4KELA 1OOKB 1Y3UA 1LQEA 2F9UA 3ZYEA 2Z3EA 3D49H 1FUJA 3A8AA 3E3TA 1AGJA 1CGIE 1A7SA 1F5KU 2FMJA 3SGAE 5HM9A 3P70B 1QY6A 2R2WU 1QB6A 3GDUA 1IHSH 3SU5A 4CRBA 1UTNA 4M9FA 4AYYB 5KECA 3A86A 4MTBA 1CBWB 2BYAX 3SHAH 4RI0A 1T8NA 2G4TA 5C5NA 4VGCB 1C2EA 3RDZA 3M36A 4E06H 1WUNH 4RSPA 1XKAC 3WWBA 1SSXA 1C1VH 4UFEH 1CBWC 2J5UA 1MU6B 2A4RA 3RXKA 1JIMA 1YBWA 3MHWU 2V3MA 5CHAC 3DSGA 4VGCC 3D65E 1O5GH 2ZGBH 2BM2A 1L4ZA 2PKAB 3SV8A 2VWLA 1MABB 1BTUA 1V2NT 1EP5A 3TIUA 2BMGB 4E7NA 3A7XA 1C1RA 1N6YA 5EJLA 1TONA 3Q00A 1YCPK 3UIRA 3BTQE 1GVZA 1P12E 5JYIA 3UQOA 1XMNB 5AFYH 1GHVH 1BBRE 1QFKH 3F9HA 3T62A 2VWOA 4AFQA 5L2ZH 2FI4E 2XOKD 3RUOA 1Q2WA 3BTFE 3PV2A 4GPGA 1CA0C 1O35A 1Z8GA 4CBOA 4NA7A 5CHBA 1NRNH 3WY8A 5JBCS 1OKXA 3MU1A 3S7KB 1NRSH 1P9SA 4B73A 1W13U 1NBME 3M7QA 1P06A 1DSUA 3ZZ5A 4YT7H 1JWTA 1LPZB 2R2MB 5DJ7A 1AVGH 3HGPA 2PGBB 3JZ2B 2I6QA 4IMQA 1O2RA 2F43B 1FY4A 1P2NA 1UHBA 4XE4A 1AMHA 3IWMA 2KCPA 4X8SH 1O3FA 1C5WB 2P3FH 3TJVA 3UFAA 1AKSB 3F2FA 2V6NA 1GI8B 1UVTH 3UREA 2BDGA 1CVWH 1Y3YA 2D1JA 3M3TA 3A84A 2QE7D 4INKA 1GJ9B 3ZIAD 1P03A 3L33A 1TRMA 2W3IA 1VCPA 1K22H 3MNCA 4YESB 3ZZ9A 1O2GH 1YCPM 5C1XA 4MPXA 1A3EH 1HAVB 2QA9E 3GY2A 2W5EA 1GPZA 1QNJA 1YLCA 1DVAH 1O2YA 4B1TA 4YXWD 4BAQB 1QGFA 1MH0A 2G4UA 2BXTH 1Z6JH 2L6OA 2F9PA 1VJAU 2ZFFH 2STBE 4NFEA 1SGTA 4ABIA 2G52A 2XNIA 4U32A 2VGCC 3OU0A 1AUTC 1JIRA 1JXPA 3SNBA 1NESE 5DP5A 2AIQA 2PV9B 2Y5FA 4JZDH 2ZA5A 4LZ4B 1EPTB 4MG3A 1RJXB 3UB0A 1N1LA 2JKHA 1W2KH 2BQ6B 1Y3VA 2D2DA 2A7HA 2J38A 4Y11E 2O8TA 5EJZA 2ZFTA 2Y5GA 3LU9B 1EPTC 1V2TT 1YCPH 3BIVH 1SR5C 1G3BA 1SPJA 1UJ1A 2J97A 1KIGH 1F0UA 2A32A 1BHXF 5F8TA 5C5OA 1J9CH 4DOQA 1J14A 1SLUB 4YOGA 1GBAA 2VIVA 2VIDA 4B6EA 2XXLA 1P9UA 3NKKA 5JB9S 2FYRA 2RG3A 3F9FA 2A45B 4DIHH 1HXEH 3LGIA 3BV9B 3PRBA 1O3KA 3RXFA 2VIPA 1AIXH 6CHAB 1O3IA 1FAXA 3RC5A 3O8DA 3F9GA 3PLPA 1ACBE 4YLQH 4FOUC 3F2HA 3AASA 3WW7A 1YPKH 2ZKSA 2SGQE 2ZFSA 6CHAC 1G2LA 2GZ9A 3BTME 1W10U 2ZPSA 5E8EH 1C1OA 5F53A 2WSSD 1DUAA 2PLXA 5F8XA 1HAPH 1O3DA 2ZHEH 4NFFA 1ZJKA 1V2PT 1O3JA 2ZDNA 2KM0A 4AFSA 1WOFA 1P04A 2FTLE 1GHAG 2VIQA 2FPZA 2K1QA 1WTGH 1GWAA 5C3NA 1IQNA 1O3GA 5EXNA 1MAXA 3SU2A 5DP8A 1VZQH 1C9TA 3NUMA 2FOGA 2NWNA 2JH6D 2BY8X 2YOLA 3BTDE 3ENSB 5EQQA 1GBEA 2VWNA 3PB1E 4IC5A 2LNCA 1VCQA 1TNKA 2WINI 1ELEE 2CXVA 1ZPBA 2OBOA 4ISOA 2ZC9H 4WJG2 2BTCE 2BVRH 3HGNA 5CE1A 3AW1A 3M5MA 4ASHA 1O3PB 3G01A 1ABJH 2GTBA 2BOKA 1K1PA 1ZGIA 1VITF 2FZZA 1QHRB 3I78A 3WWFA 3RXDA 1MMJN 4CREA 1ESBA 2GJGA 3M7TA 1GHZA 2ILNA 2XW9A 2QN5T 1SQRA 2AMQA 1C1PA 2F9BH 2QF5A 3BTTE 3QO6A 1AQ7A 2A4OA 1ELFA 1YKTA 2P95A 4KTSA 4Q7ZA 2RDEA 1DANH 3SNCA 2ZP0H 4Y76A 3HATH 1GJ5H 1ZJDA 1AE5A 2AHME 3BTWE 2ZDMA 3R3GB 2M2AA 1A0JA 2BD3A 2PSXA 2PUQH 3LT3A 2BD8A 1IQEA 4TY6A 4BXWA 1EFRD 3U9AH 2BZAA 4Y8YA 1GBIA 1PPZA 3E90B 1CE5A 2PP6A 3RP2A 2R3UA 1SFQB 1MU8B 1O2HA 1C5QA 5FXLA 1YYY1 3SJKA 3E16B 1S0QA 3GYMA 3B23B 4I8KA 1C2MA 1A4WH 3F0PA 2BD9A 1BZXE 1LPGB 2UUKB 4XFQA 5GCHF 1TOCB 1G9IE 3BEUA 1GDUA 5H4IB 1P2QA 1QBVH 2A2XH 1P01A 1YLNA 4ZKRU 2GT7A 4Q2KA 1KLJH 1P3EA 4ESTE 1EOLA 3BIUH 4A1TA 1C2FA 1TPPA 1MZAA 3GY5A 3W94A 4B75A 2QXJA 4LK4A 2SGAA 5I25A 5C2ZA 1T8LA 2Z9GA 4YT6H 2GT8A 3RXAA 3E8LA 1CQQA 4A5TS 3RM2H 3GY4A 2VVVA 1XX9A 2GCTB 2WPJS 2KZ4A 3RXMA 2KAIB 3TVJB 4X2WA 4MLFB 4UE7H 8LPRA 1NFWA 1GJ7B 3IG6B 2B7DH 2AGGX 3DFJA 1H1BA 2EQNA 3STJA 1W0YH 2AGEX 3N7DA 2W6ID 1VGCB 1MD8A 2UUJB 3M5LA 1SBWA 1CU1A 1P3CA 3SGBE 1VITG 1GBMA 1O2WA 2Q6GA 1CO7E 1HJAB 2EI6A 3GCOA 5KGOA 4ISHH 1P2IA 3IITA 1VGCC 3AAUA 3RC6A 4IN2A 5L2YH 4WY3A 3A83A 3PMAB 4CBNA 3AK5A 1P09A 2P3UB 2ZFRH 4K8BA 3TU7H 3MOCA 1EZUC 4ZHAA 1RTFB 1FI8A 1V2MT 3K2UA 5EOKA 1QJ1B 3P95A 1B7XB 4PROA 1TWXB 1ELGA 2KCYA 2XRCA 4O3TA 1V6DA 1XKBC 2J92A 1AY6H 4AYVB 2J98B 1XVOA 1ELCA 1FPHH 3BSQA 3KQ5A 2ZHDA 1IQKA 1B0FA 2BZ6H 2ZU4A 8GCHF 3C1KA 2BB4A 4GAWA 2FOAA 2HPQH 4P00A 4IGDA 4XBBA 4AB8A 4U2WA 2F9OA 2AIPA 1ELAA 5FBIA 3A8BA 2C8ZB 5GCHG 3ZZBA 3S0NA 1AZ8A 1BRUP 1Z6EA 1E37B 1QB9A 4GVUA 3BG4B 1YLDA 1KXFA 3ZVEA 1AO5A 3M3VA 3SW2B 1C4Y2 3GCNA 2PKAA 1C1SA 2NU2E 1HJ8A 1EZXC 1P8VC 4FUEA 3EDXB 1C5RA 1C2KA 3ZVDA 1L2EA 2BD5A 2CJIA 5A0AE 1DM4B 3BG4C 2CF9H 1PFXC 1V2UT 4XD7D 4BAMB 1O34A 1ZSKA 5J4QA 2FOBA 1TPSA 2WV4A 3PMHB 3RU4D 2Y6TA 3F9EA 3ELAH 1G3CA 3T2NA 3MFJA 3A87A 3PROA 4X1SU 3V7TA 2OK5A 3T27A 1O2IA 3DA9B 3OY5U 1Y8TA 3DCLA 4UFDH 1K21H 1K2I1 1COWD 3MNBA 1SLXB 2FLBH 1GI9B 2JETB 2VB0A 3E91A 5LH8A 4A1XA 1KXBA 1A1RA 2KX4A 2Y82A 1AKSA 1O2ZA 1SHYA 1F0SA 3LGUA 4OS6A 3FO8D 3MI4A 3VXFH 5FCKA 2Y81A 1AI8H 2EY4C 2HPPH 1NN6A 4XSKU 2BXUH 1TQ0B 2GDEH 1LHDH 3A7ZA 1QTFA 1HAVA 2OTVA 1BRAA 2SGDE 4BANB 1CGJE 4Y8ZA 1ELVA 1FAKH 4I32A 8ESTE 1GMHG 1W0ZU 2WV9A 1O5BB 2ALVA 2CF8H 2CHAB 1TNHA 1GDNA 1W0JD 1YF4A 4BAHB 2CGAA 2SNVA 4ABFA 2JH5D 3P8NA 3T5FH 2EI7A 1TPAE 2P3TB 2IN2A 2ODPA 4NZQA 1IQIA 2CHAC 1H4WA 8KME2 1CHOG 2Q1JA 3QX5H 3MH6A 2ZPQA 1EPTA 1P2KA 3PRDA 4X1RU 4WXIA 1T4UH 2V7QD 3W1EA 1BRBE 1WQVH 3Q77A 5FX6A 5GPIB 2G8TA 3KCGH 3TJOA 4MPVA 1E35B 1FQ3A 4F4OC 1THRH 1ZTLA 1ETRH 2CMYA 1O2XA 2OP9A 3U1IB 3GOVB 4Y7AA 1AUJA 2ZEBA 1EB1H 1TBQH 2AH4X 2GVFA 1D9IA 1C5LH 3S69A 1O2NA 1ZRKA 2TGAA 5LPEA 4ZCNA 4CRDA 1Z1IA 1XM1A 3LH1A 1HXFH 3QGJA 2WYGA 4WWYA 3V0XA 2BY6X 5C1YA 4ISNA 1SC8U 3UUZA 3RXIA 1DWDH 3PTNA 2XCFA 4O97A 4DG4A 3TGKE 3NZIA 1O5FH 1EJMA 2GZ7A 4Q80A 3S9CA 3LONA 1D6WA 3LIWA 4NA9H 1GI3A 3TGIE 4D7GA 1O2MA 3SU0A 3QGNB 1NFYA 1TIOA 1UTPA 1DX5M 4BTUB 3HKJB 3OY6U 1C5XB 2IJOB 1W7GH 1A2CH 3HKIB 4J2YB 3QTVH 5DP9A 1DDJA 4BAOB 4ACBA 1RFNA 2A5AA 5I46H 1K1JA 3VB5A 3ATKA 4IC6A 1DY9A 3ZVBA 3LC5A 1BTZA 3BEFB 2XBXA 4AC9A 3U8OH 1QA0A 2WPMS 1B5GH 1C2DA 4JYVH 2ZHWH 1HV7A 1OPHB 7GCHG 4X8TH 2F91A 4JK6A 1INCA 3KQBA 4JCNA 3N7EA 7KMEH 1TQ7B 5T6GA 4DY7B 2B9LA 3LGWA 3LJOA 2AMDA 1T8MA 1B0EA 2ZQ2A 3B9FH 1DFPA 1L1GA 2LPRA 5DPAA 1TOMH 5T6FA 1O3NA 5HXFA 2W7SA 1PQ8A 3SU6A 1QRWA 4Y8XA 1SKYE 4TPYA 3SGQE 1DLKB 3DSPA 3U98H 1EJNA 1YPMH 3DSOA 4Z6AH 2HOBA 3PO1B 1QQ4A 3D23A 2QXHA 4YOJA 2AFQB 1O2PA 1OSSA 2Q6FA 4ZHMU 1TNLA 3SU3A 3EA9A 5BPEA 3PO1C 5GDSH 2GP9B 1GI4A 5F6MA 3U8RH 5GXPA 3K9XB 4FUJA 1DWCH 1EATA 1GJ6A 4NWLA 3TJUA 1ESAA 2VINA 3BN9A 3QZRA 2ZCHP 1ZPZA 5EQSA 1EAXA 1XXDA 3SORA 1O32A 2ULLA 5HGGA 5C67A 1GDQA 1EZSC 1HAOH 5EW2H 3TK9A 2FLRH 4ZHLU 3OE7D 2VH0A 1ZLRA 3SN8A 4BAKB 1GMCF 2Z3DA 3MO9A 5HIYA 1BCUH 3ZVGA 4OGXA 1PQAA 3MO6A 1C5UA 1C2IA 3S7HB 1SLWB 4CRCA 1DWEH 5EIYA 1UCYK 1O3BA 1KLIH 4ZKSU 4BNRA 5JBAS 3STIA 4UDWH 1Y5BT 3GCTG 5ABWA 5FHTA 1TA2A 4ZXXH 3RMNH 3GISB 1A5IA 2B5TB 3OX7U 4B2BA 4B2AA 1Y59T 4Y7BA 1GI2A 1NROH 2XBWA 2ANMH 3MO3A 3SV9A 1BT7A 3QZQA 1DS2E 1KXCA 1HAZB 1CSOE 5HIZA 3O8CA 1F5RA 1GBDA 1SGIB 4K60A 3RLWH 2Y80A 4X6OA 1EJAA 1LHGH 2ALPA 3EYDA 5DP7A 1LO6A 3PM3A 3LGYA 1THSH 2KAIA 2P93A 3SBKA 5DP6A 4B6FA 2J95A 2FEQH 4LOYH 5CDFE 1TPOA 2H1UA 6GCHF 3TH4H 2SGEE 1YPLH 1SGRE 2KFWA 1GHAF 1BRCE 3ZZ3A 1TE0A 2ZWLH 3BEIB 1HIAB 2NU0E 1GHBG 2QCYA 3GCHB 5DP4A 1WYKA 2BDHA 1XUKA 2XC5A 4ZROA 2A5IA 1ZPCA 1K1LA 2O9QA 2XCNA 2R0LA 3A82A 5HMAA 3T25A 3B8JA 1XUHA 2ZCLP 1HAXB 4AFUA 2J94A 2VVUA 2A5KA 4OGYA 1EB2A 1AFQB 2J4IA 1OS8A 2W7UA 2ZHFH 2EI8A 2UUFB 3RXHA 1FY1A 3KF2A 1D3TB 1IQHA 2QXGA 2RDLA 1AFQC 2BLWA 2HGTH 2NU3E 2HVXA 5BRRE 1GBKA 2FI5E 3S9BA 2G5VA 1NS3A 2BY7X 1GMCG 2WUCA 3RXBA 4Z1MD 1UTLM 2BDBA 2J98A 1UCYH 4FUHA 3TH2H 1U6QA 2JJ2D 3AVZA 5JB8S 3MU5A 4MDSA 1QIXB 1XUIA 1O33A 1HB0B 1QQUA 2ZGHA 1RD3B 5AVDA 3UQVA 5E0GA 1O38A 1UO6A 1G2MA 3OTPA 7LPRA 1P05A 4WXVA 1TMUH 5A8ZA 4KP0A 3V3MA 4ISIH 2FXRA 4NGAH 1MKWK 1P0SH 1CGHA 1E38B 3ATLA 3KQDA 3PTBA 4JK5A 3E1XB 1V3XA 3M7UA 1O5CB 1QBNA 3CP7A 2YMSB 2TRMA 2AEIH 4TT3D 1TBRH 3M5OA 1W7XH 1ZHMA 1XXFA 2YMSC 2ZHQH 2IPHA 1UK4A 2FTMA 1SB1H 2PWXA 2TIOA 2OC1A 2FOMB 5C94A 1SI5H 2KCAA 3H09A 5AHGH 1F7ZA 4U30A 6GCHG 2ZGCA 1O31A 1QURH 2O8MA 2G00A 1ARCA 2GCHG 2OINA 1ETSH 5ESTE 2IOTA 1A0LA 2BD4A 2ZDAH 3LKWA 4DT7B 1A3BH 1PYTD 1T7CA 1UTOA 1O3HA 2ZU5A 2RA0A 1G32B 1SVPA 1WAYB 5EXLA 4HGCA 1LCYA 5DO4H 1GMDF 2BD7A 1ANDA 3L6PA 3A7WA 2WHXA 3ZVAA 3AAVA 1VKYA 1BTPA 2FP7B 2OUAA 3P17H 4CR5A 1FMGA 1LVMA 2IJD1 1EP6A 2QIQA 5E0HA 3A81A 3DT0H 3SV7A 4ABBA 2JJ1D 1O2TA 2WPIS 2Y5HA 1K0HA 2QF3A 2A7CA 1TB6H 1Z8IB 4AB9A 3KNXA 3F3BA 4DJZB 2FX4A 3RMOH 1IQLA 1TRYA 3FFGA 2NU4E 1C1TA 2UWLA 1SGNE 2GGVB 5FCRA 3UNQA 4BOHA 2H9EH 5E2PA 1AFEH 4X1QU 1ELBA 1ZMJA 1MKWH 2ZU2A 4X1PU 3T29A 2AYWA 4M7GA 5KEDA 4KTUA 4JZIA 1QL9A 1TNJA 1TX7A 1DITH 1OWKA 4YO9A 4QT8C 3OFND 4I8HA 4WH8A 4FU7A 1JMOH 1TLDA 1K1OA 1LVYA 4WF8A 3JZ1B 5DP3A 2ZIQH 3RXTA 1C5YB 1O39A 1WDIA 1IHTH 2ANKH 2ANWA 1GL0E 2B0FA 3FN8A 4B71A 2BDIA 3MQKC 3NK8A 4FVDA 4K1TA 1RRKA 1C2LA 4JZEH 4NIVA 3BTGE 4X6PA 2PKSB 1SQOA 1ZR0A 4ZXYH 2UWPA 1C4V2 2BVSH 2ODYB 2CN0H 2WZQA 4I33A 3RXJA 1UMAH 3GY6A 4RKOB 2Y7ZA 5EGMA 3RMMH 5DN6D 1MAYA 1O2QA 4D7FA 3SV6A 1W3CA 1MZDA 1FPCH 4XDEA 2PKSC 2QF0A 2GZ8A 2ZU3A 3CENA 3PMJA 5F8ZA 3GY8A 2P94A 1DT2A 2CK3D 1RXPA 3VEQB 2C3SA 2UWOA 4FETA 1GMDG 1KSNA 1BMAA 5JBBS 1YWUA 4A1VA 1MUEB 1L4DA 1H8DH 2GCTC 2GMTB 4TY7A 1G30B 4K1EA 1YPHC 5FL7D 1J8AA 4DURA 3Q3XA 4O3UA 3D62A 3SJ8A 1G3DA 1P57B 2AERH 3M35A 4FUDA 1OYQA 1TFXA 2GMTC 3BTKE 3ATIA 1BHXB 1EX3A 3V12A 2P8OB 1KLTA 2TPIZ 1O2LA 3F1SB 1O3OA 2ZCKP 2WPKS 3KHVA 1HJAC 2BVXH 2O8WA 1O5EH 1GBCA 1XVMA 2G51A 4MPUA 1WSSH 1SFIA 1S6LA 1ZMNA 4E7RG 4H6SB 1FIWA 1EZQA 2OD3B 1XUFA 1UVPA 4KKDA 2H5DA 2VNTA 1C5TA 4BXSA 3RXPA 3EGKH 5T6DA 3KEEA 4I7YH 3KYFA 1NO9H 3OEED 2XWAA 1FLEE 4ZMAH 2ZPRA 1D6RA 1OWIA 1YPJH 2FS8A 1XUJA 2KR7A 2VJ1A 3FAOA 4JZ1A 1S83A 2BDCA 1Q3XA 2XBVA 3LDXH 1GMHF 1GHWH 4CR9A 3KQCA 4ABHA 1GBJA 3OSYA 1O2VA 1O3EA 2BDAA 1WXRA 1F0RA 4B76A 4Z0KA 1CHOF 3FVFB 1KXDA 4NIWA 5AFZH 2ZDLA 1HLTH 1BMMH 1WV7H 1LVBA 1NBMD 2Z7FE 2R0KA 4WMDA 1F2SE 1P2OA 1JBUH 1YPHE 3QK1A 4X6NA 3SZNA 1QCPA 3UNRA 1SHHB 1O36A 2ZZUH 1WBGB 1DSTA 4AX9H 3VB3A 1GI5A 1TGSZ 3SU4A 2QV1A 4X0WU 1FNIA 1A5HA 2D8WA 4OS4A 4ISLA 5A0CA 3KQEA 5F03A 4RKJB 5E2OA 3HK3B 1HPGA 4DGJA 5K0HA 2BQ7B 2SFAA 1QJ6B 1TABE 5DKMA 4E05H 3H7OA 2GV6A 5DSFA 2BDYA 6ESTA 3MH4A 3ODDA 5LGOA 3MWIU 2K0QA 1UTMA 1GJ4H 3QLPH 1LVOA 1J17T 1YPEH 1X7AC 1C5VA 5A2MH 2PTCE 1DPOA 4MNYA 1TRNA 4SGAE 2JETC 2OBQA 1TGNA 4DIIH 2FIRH 2C8YB 1FDPA 4HG6A 1P10A 1D4PB 3VB7A 3H5CB 4ZKOU 1PPFE 1C4U2 1HUTH 2UUYA 1W0KD 2Z9KA 3RXVA 2QF4A 1GBFA 3OAAD 3S9AA 1MCVA 7GCHF 2HVYB 2VVCA 5IK2D 4D9RA 1SLVB 2XBYA 1HIAA 1O2JA 4H6TA 1QL8A 1AE8H 4FXGH 2H9TH 1HAGE 1RTKA 1C1NA 1V2KT 1MKXK 2A7JA 4ZAEA 5A09A 3URDA 4Q7XA 4Y6DA 2Z6BD 2TGPZ 3E0NB 1S82A 1G36A 1GGDB 4YTAA 4IW4E 1KYNA 3SUFA 1N8OB 4CRFA 1ANCA 2QY0B 2PR3A 2QXIA 1J16A 5EXMA 1NPMA 1ANEA 1H9IE 1GBTA 1GGDC 1AB9B 3RXEA 2W26A 1PQ5A 2TGDA 2XTTB 3DUXH 4DCDA 4XOJA 1UCYE 1BTYA 1ESTA 4XRNA 3DD2H 1DWBH 3F68H 1TNGA 4SGBE 3GICB 4ABEA 1C5PA 1BITA 2BHGA 3LPRA 1QJ7B 1MTNB 3KYGA 5FBEA 5IYTA 5FX5A 3CNRA 4GCHG 2A4QA 5GNDA 1YGCH 1ZRBA 1SMFE 3M5NA 3FOAA 3ZZ8A 1ZTKA 1CT4E 3EQ0H 1MTNC 3BG8A 1GI7B 4CRAA 1O5AB 3EA7A 4P02A 2ZQ1A 5TCCA 2FDAA 3PMBB 2HLCA 5EPYA 1TALA 1NRRH 2I6SA 1O2UA 1XUGA 3SUEA 3TH3H 3ZV9A 1GHXH 1H8ED 1PJPA 4ABAA 1Q31A 2G81E 1O5DH 3ATMA 1BTHH 4RT0A 1C1UH 1AWFH 3TJNA 1BOQA 1LQDB 3UWIA 1CT2E 3GCTF 1BB0B 1C2HA 5FPTA 2VH6A 4K2YA 4RT1A 1KXAA 2Y7XA 4GHQA 1THPB 5FAHA 1A5GH 2ZO3H 1UTQA 4K69A 3P92A 1EQ9A 4WVPE 4NWKA 1YP9A 3SU1A 4Y10E 3LGVA 2YNBA 3VPKA 1BMFD 2PSYA 2SGFE 1MKXH 1ELDE 1ID5H 2BLOA 3VFEA 4X2XA 3A7TA 3N7OA 5TCAA 1SGPE 1GI6A 2OC8A 3FANA 4XBCA 2WYJA 1C5SA 1NT1A 5GWZA 1HAYB 2DUCA 3I77A 1TGBA 1DLEA 3BTEE 3VXEH 4D9QA 4GHTA 1UVOA 3SNDA 2WPDD 2IPQX 1GBBA 2YNAA 1Z71A 2EC9H 1GHBF 2RA3A 1KY9A 1TYNA 4CRGA 3CS7A 1FY3A 1LMWB 4NSVA 1GJBB 4HI3A 3A80A 1VJ9U 1SGCA 1ZZZA 4MNXA 5DK1A 2BY9X 3QN7A 3SV2H 3TITA 2RFKC 1GJAB 2OQ5A 1NM6A 2A4GA 3F2GA 5GJ4B 2Z94A 2P59A 1BTXA 2VIOA 4I31A 3RXCA 1LHFH 3K6YA 4YOIA 3UR9A 3VGCB 4A92A 1OWHA 5CHAB 3ZZ7A 4TWYA 1NRPH 1Z1JA 3C27B 4K3JA 1A61H 2J34A 1FJSA 4MNVA 1QR3E 1V2OT 3VGCC 1YM0A 9ESTA 1HGTH 1KMHB 2H2ZA 1NC6A 3RXUA 4TYDA 4FVBA 5JPMH 3GYLB 1HCGA 2TBSA 5C0UA 2Z9IA 2PHBA 3SUDA 1GVKB 4X2VA 2GX4A 4MPWA 3Q3KA 4K5ZA 2BQWB 5HYOA 1CA0B 1FZZA 4HTCH 3SYJA 4ABGA 1L1NA 1W12U 3Q3YA 1T32A 1KDQB 3TK5A 4X6MA 1GJCB 1L1JA 3TNTA 3MNSA 1WU1A 5IDKA 1OP2A 1HFDA 4GLYA 1GVLA 1ARBA 1BMLA 3U1JB 3NWUA 1MCTA 1AVXA 3EE0B 5LPRA 1P02A 3P8FA 1TNIA 1OXGA 1DICA 5TJXA 2C8WB 1JOUB 1ZMLA 2FODA 3MU0A 1AHTH 4IN1A 3RMLH 5EG4A 1W14U 2V3HH 1RGQA 1V2ST 4H42U 5EPNA 1T31A 3ZZ6A 1C9PA 1DOJA 4NA8A 2V3OH 2ZI2H 2CV3A 4LZ1H 4INHA 2GCHF 3VB6A 3LOXA 1C5MD 2FX6A 2A1DB 3GDVA 4UFFH 2HNTC 3RU4E 5A8YA 4X2YA 4D8NA 3ZV8A 1E1RD 1IQFA 1LTOA 4U01A 3GCHC 1O3LA 4WH6A 3QTOH 1C5NH 1O3CA 1O30A 2ZTYA 3O8BA 1Y5UT 2ZTXA 2VGCB 3SI3H 3P6ZB 1S0RA 3UR6A 3LJJA 4NCYA 1NY22 1AN1E 1QB1A 1QRZA 2BY5X 1IQMA 1V2QT 2HRVA 3K6ZA 4Y0ZE 2VBCA 3A8CA 5EU8A 2V0BA 1E34B 2ZF0H 1VITH 3PLKA 3U8TH 4AN7A 4MQAA 3PWCA 2PUXB 3ZYDA 5LPFA 5EW1H 3H7TA 4FU8A 1NZQH 5C1UA 1DXWA 3SJ9A 5JBTA 1MQ5A 5C0TA 2O8UA 3DHKH 4CHAB 1CT0E 2EA3A 1SG8B 2QGRA 5B6OA 1ZSLA 2TGTA 2KCOA 1H9LB 1A0HB 2Z9LA 2ZG0H 5L30H 1L0ZA 4AZ2B 4I8LA 1WTHD 1V2LT 4CHAC 5SGAE 4NIXA 3FP8E 1FX0B 3KL6A 2HNTE 1ABIH 1K9OE 1QL7A 1ZYOA 5E0JA 3N99A 1H9HE 1NFXA 1WQSA 3FZZA 1ZHRA 2XYAA 4A7IB 3UTUH 3UY9A 4GUXA 3ZZ4A 3F0OA 2A31A 1S6HA 2PTNA 3PWBA 2FO9A 1ORFA 4O9VA 4TSFD 1NRQH 3LH3A 2ZGJA 1Z8RA 4H4FA 2OCVB 2STAE 1BBRK 2PGQB 2NU1E 1LKAA 1K1IA 1LKBA 4UFGH 3SZEA 3SJIA 1T8OA 1EUFA 1FXYA 5FPSA 3UOUA 5EJ1A 1JRSA 2VIWA 4UONA 1HAHH 1UK3A 1CA8B 5J4SA 1BA8B 1OP8A 3SO3A 6LPRA 3BTHE 1ZHPA 1RTLA 3URCA 1E1QD 1Y5AT 1SGQE 1YPGH 1T4VH 4YZUA 2BX4A 1VR1H 2HWLB 3RU4T 5B6LA 1A46H 2ZU1A 1BIOA 3GS9A 1QZ8A 2R3YA 5G4BA 3QUMP 1SGEE 2EEKA 2Z9JA 1P2MA 1SL3A 5C17A 3SQEE 1BQYA 1PPGE 1OYTH 5DGJA 2H9HA 3A7VA 3E6PH 2OC7A 2AMPA 1GJ8B 4AORA 2GKVE 3RXSA 1BMNH 2JDID 2FOEA 2ESTE 4JMYA 3M61U 2F4LA 1MTSA 3K65B 3MYWA 3P8OA 1FY5A 1HJ9A 3ZZCA 4LXBH 4DVAU 1G3EA 1PPHE 1UVUH 3L3TA 4WMFA 3RXOA 3T28A 2DE9A 1E79D 1LHEH 1AU8A 1SQAA 1AWHB 3AW0A 3QDZB 1BTWA 5PTPA 4OM9A 2SNWA 2WV5A 3SHCH 3TGJE 3KGPA 1K28D 3PV5A 2FS9A 1C2JA 1ZGVA 1BBRH 2FESH 2FOCA 3SUGA 5A8XA 1QBOA 1GL1A 1KXEA 4FUIA 3GY3A 1TX6A 4K8YA 4CH2B 3T26A 1ANBA 1S85A 4B74A 1FONA 3FP7E 3RXQA 1UHBB 3OTJE 2ANYA 3TNSA 3FZDA 1DXPA 3UPEA 1V2WT 2FOFA
chains in the Genus database with same CATH topology
1O3MA 1MQ6A 1NU9A 2OLGA 1PPCE 4IBLH 1HDTH 1GHYH 3O8RA 4WMEA 3ZZDA 1JRTA 4DW2U 2WPHS 2OC0A 4XBDA 2FI3E 2Q6DA 3RXRA 2ASUB 2A2QH 4UEHH 2ZGXH 2WPLS 3HK6B 2WUBA 4AGJA 4FU9A 9LPRA 1BDAA 2P8OC 1M9UA 1RS0A 3MH5A 4JZFH 3ZZAA 4X8VH 3V13A 1H8IH 3KIDU 4HZHA 3A8DA 4R0IA 3A89A 3I29A 2M5TA 1GJDB 3GDSA 1TMBH 5JDUB 3ESTA 2C90B 4OS5A 2PW8H 4CH8B 2G55A 3EA8A 3VB4A 1WCZA 1KTTB 3RXLA 3DFLA 1ZOMA 3OYPA 4X1NU 1HRTH 5CMXH 5L6NH 4OS1A 1SGFA 5HM2A 4AOQA 1OWDA 3MH7A 4I8GA 3M3SA 3TK6A 1EAWA 4NIYA 1HBTH 4NG9H 2VU8E 4KGAA 2C4FH 1IOEA 1DUEA 1EAUA 1N6XA 4YLUA 4FUBA 1NFUA 1O3AA 1NU7B 2GDDA 4D76A 2P16A 4ZH8A 1F0TA 3SNAA 1C1WH 3A85A 1D3PB 2H6MA 2ODQA 3FP6E 4TWWA 1O2SA 3RXGA 2F9VA 1EXFA 3LC3A 1S5SA 2ZECA 5GIBA 2GV7A 4BTTB 2QAAA 1FN8A 1MTWA 1O0DH 1S6FA 1HYLA 2H5CA 3HPTB 1UK2A 4OS2A 4AGKA 1GG6B 2BLVA 1DY8A 4ABDA 2ZFQH 1EAIA 4INLA 1PYTC 4R8TB 4UD9H 1C1QA 2ZTZA 2AGIX 3ODFA 2A0QB 2FOHA 1TAWA 4GCHF 2OXSA 1DE7H 5DG6A 4FUCA 7ESTE 2SGPE 3CS0A 4ABJA 1GG6C 1NTPA 2VWMA 1SQTA 1V2VT 5A0BA 1QA7A 3A7YA 1V2RT 2XWBI 3SNEA 4Y71A 1KDQA 3MU4A 1C1MA 4I8JA 3PLBA 1GCTB 2ZDKA 2D26C 2O8LA 4IS5A 1IQGA 2QYIA 1ZTJA 2G5NA 4AG2A 4HFPB 4J1YA 1KTSB 1S84A 3PYHA 1MBQA 3LGTA 2V35A 2BOHB 1J15A 1SOTA 1GCTC 4YM9A 1Y3XA 1EKBB 2RCEA 3SI4H 1FY8E 1UTKA 4FUGA 3M37A 1Z7KA 3MMGA 1D3QB 1TGCA 3W95A 3NXPA 1BJVA 1GI0A 1EOJA 4X8UH 3NPSA 5ESBA 1Y3WA 4NZLA 1YC0A 1O2OA 4GSOA 3TPIZ 2C93B 2THFB 1V2JT 1PPBH 4RN6A 1AD8H 5ETXA 3RC4A 2B8OH 1LDTT 5AF9H 1GBHA 1OX1A 3GY7A 1C2GA 1F92A 1GCDA 4BTIB 1IQJA 1VCWA 1N8OC 2J9NA 3UOPA 8GCHG 1K1MA 1SGYE 2ZDVH 2PFEA 4K1SA 2DE8A 3RLYH 1AB9C 1ELTA 1QRXA 4F49A 3RM0H 3BF6H 4IMZA 1RIWB 4B2CA 1TMTH 3MU8A 3TLOA 1MD7A 2ZFPH 3F6UH 4KTCA 2JH0D 1PPEE 3NCLA 2F83A 3U69H 2F9NA 1AZZA 1E0FD 3P8GA 2HNTF 1MBMA 1O37A 1F5LA 1UTJA 5EODA 4AFZA 1RIWC 2QC2A 1GBLA 4O03A 1TX8A 4FUFA 1HNEE 1W8BH 2C8XB 1BUIA 4Y0YE 1SGFG 2F3CE 2FYQA 5FPYA 3KN2A 1ZSJA 4JYTA 2HALA 3SQHE 1SGDE 2FM2A 1TGTA 2FWWA 4THNH 1BJUA 1CHGA 4JYUH 4A6LA 1FIZA 1MTUA 1P2JA 2AS9A 4NSYA 3SJOA 1K1NA 1LHCH 1PQ7A 3PV4A 3MNXA 1Z8JB 1UVSH 4TPIZ 5K7RA 1TA6A 3EAJA 4ZKNU 1GI1A 5C20A 3ZVCA 3E0PB 3QWCH 3ATWA 2GD4B 1O2KA 1FN6A 3UNSA 4AG1A 1MTVA 2BLQA 3ITIA 2ZNKH 4Y79A 1D3DB 3SOSA 2BD2A 2W3KA 4Q7YA 5T3HA 2OQUA 1AVWA 4MNWA 1C5OH 1LPKB 3Q76A 2J2UA 2XC0A 1FV9A 1TBZH 1ETTH 1C5ZB 2R9PA 4OS7A 4MVNA 2Z3CA 3MTYA 1OWJA 1E36B 2BX3A 1EASA 3A88A 5EQRA 4ZUHA 3ZVFA 1SOZA 1OWEA 3R0FA 1S81A 2XC4A 1HAIH 1OP0A 1IAUA 1P11E 3UWJH 1G37A 1W11U 4KELA 1OOKB 1Y3UA 1LQEA 2F9UA 3ZYEA 2Z3EA 3D49H 1FUJA 3A8AA 3E3TA 1AGJA 1CGIE 1A7SA 1F5KU 2FMJA 3SGAE 5HM9A 3P70B 1QY6A 2R2WU 1QB6A 3GDUA 1IHSH 3SU5A 4CRBA 1UTNA 4AYYB 3A86A 4MTBA 1CBWB 2BYAX 3SHAH 1T8NA 2G4TA 5C5NA 4VGCB 1C2EA 3RDZA 3M36A 4E06H 1WUNH 4RSPA 1XKAC 1SSXA 1C1VH 4UFEH 1CBWC 3RXKA 1MU6B 2A4RA 1JIMA 1YBWA 3MHWU 5CHAC 4VGCC 3D65E 1O5GH 2ZGBH 2BM2A 1L4ZA 2PKAB 3SV8A 2VWLA 1BTUA 1V2NT 1EP5A 3TIUA 2BMGB 4E7NA 3A7XA 1C1RA 1N6YA 1TONA 3Q00A 1YCPK 3UIRA 3BTQE 1GVZA 1P12E 5JYIA 3UQOA 1XMNB 5AFYH 1GHVH 1BBRE 1QFKH 3F9HA 3T62A 2VWOA 4AFQA 5L2ZH 2FI4E 3RUOA 1Q2WA 3BTFE 4GPGA 1CA0C 1O35A 1Z8GA 4CBOA 4NA7A 1NRNH 3WY8A 5JBCS 1OKXA 3MU1A 3S7KB 1NRSH 1P9SA 4B73A 1W13U 3M7QA 1P06A 1DSUA 3ZZ5A 4YT7H 1JWTA 1LPZB 2R2MB 5DJ7A 1AVGH 3HGPA 2PGBB 3JZ2B 2I6QA 4IMQA 1O2RA 1FY4A 1P2NA 1UHBA 4XE4A 1AMHA 3IWMA 4X8SH 1O3FA 1C5WB 2P3FH 3TJVA 3UFAA 1AKSB 2V6NA 1GI8B 1UVTH 3UREA 2BDGA 1CVWH 1Y3YA 2D1JA 3M3TA 3A84A 4INKA 1GJ9B 1P03A 3L33A 1TRMA 2W3IA 1VCPA 1K22H 3MNCA 4YESB 3ZZ9A 1O2GH 1YCPM 5C1XA 4MPXA 1A3EH 1HAVB 2QA9E 3GY2A 2W5EA 1GPZA 1QNJA 1YLCA 1DVAH 1O2YA 4B1TA 4BAQB 1QGFA 1MH0A 2G4UA 2BXTH 1Z6JH 2ZFFH 2F9PA 1VJAU 4NFEA 2STBE 4ABIA 1SGTA 2G52A 2XNIA 4U32A 2VGCC 3OU0A 1AUTC 1JIRA 1JXPA 3SNBA 1NESE 5DP5A 2AIQA 2PV9B 2Y5FA 4JZDH 2ZA5A 4LZ4B 1EPTB 4MG3A 1RJXB 1N1LA 2JKHA 1W2KH 2BQ6B 1Y3VA 2D2DA 2A7HA 2J38A 4Y11E 2O8TA 2ZFTA 2Y5GA 3LU9B 1EPTC 1V2TT 1YCPH 3BIVH 1SR5C 1G3BA 1SPJA 1UJ1A 1KIGH 1F0UA 2A32A 1BHXF 5F8TA 5C5OA 1J9CH 4DOQA 1J14A 1SLUB 4YOGA 1GBAA 2VIVA 2VIDA 2XXLA 1P9UA 3NKKA 5JB9S 2FYRA 2RG3A 3F9FA 2A45B 4DIHH 1HXEH 3LGIA 3BV9B 1O3KA 3RXFA 2VIPA 1AIXH 6CHAB 1O3IA 1FAXA 3RC5A 3O8DA 3F9GA 3PLPA 1ACBE 4YLQH 3AASA 1YPKH 2ZKSA 2SGQE 2ZFSA 6CHAC 1G2LA 2GZ9A 3BTME 1W10U 2ZPSA 5E8EH 1C1OA 1DUAA 2PLXA 5F8XA 1HAPH 1O3DA 2ZHEH 4NFFA 1ZJKA 1V2PT 1O3JA 2ZDNA 4AFSA 1WOFA 1P04A 2FTLE 1GHAG 2VIQA 2FPZA 2K1QA 1WTGH 1GWAA 5C3NA 1IQNA 1O3GA 5EXNA 1MAXA 3SU2A 5DP8A 1VZQH 1C9TA 3NUMA 2FOGA 2NWNA 2JH6D 2BY8X 2YOLA 3BTDE 3ENSB 5EQQA 1GBEA 2VWNA 3PB1E 4IC5A 2LNCA 1VCQA 1TNKA 2WINI 1ELEE 2CXVA 1ZPBA 2OBOA 4ISOA 2ZC9H 4WJG2 2BTCE 2BVRH 3HGNA 5CE1A 3AW1A 3M5MA 4ASHA 1O3PB 3G01A 1ABJH 2GTBA 2BOKA 1K1PA 1ZGIA 1VITF 2FZZA 1QHRB 3I78A 3RXDA 1MMJN 4CREA 1ESBA 3M7TA 1GHZA 2ILNA 2XW9A 2QN5T 2AMQA 1C1PA 2F9BH 3BTTE 3QO6A 1AQ7A 2A4OA 1ELFA 1YKTA 2P95A 4KTSA 4Q7ZA 1DANH 3SNCA 2ZP0H 4Y76A 3HATH 1GJ5H 1ZJDA 1AE5A 3BTWE 2ZDMA 3R3GB 1A0JA 2BD3A 2PSXA 2PUQH 3LT3A 2BD8A 1IQEA 4TY6A 4BXWA 3U9AH 2BZAA 4Y8YA 1GBIA 1PPZA 3E90B 1CE5A 3RP2A 2R3UA 1SFQB 1MU8B 1O2HA 1C5QA 5FXLA 1YYY1 3SJKA 3E16B 1S0QA 3GYMA 3B23B 4I8KA 1C2MA 1A4WH 2BD9A 1BZXE 1LPGB 2UUKB 4XFQA 5GCHF 1TOCB 1G9IE 3BEUA 1GDUA 5H4IB 1P2QA 1QBVH 2A2XH 1P01A 4ZKRU 2GT7A 4Q2KA 1KLJH 1P3EA 4ESTE 1EOLA 3BIUH 4A1TA 1C2FA 1TPPA 1MZAA 3GY5A 3W94A 4B75A 2QXJA 4LK4A 2SGAA 5I25A 5C2ZA 1T8LA 2Z9GA 4YT6H 2GT8A 3RXAA 3E8LA 1CQQA 4A5TS 3RM2H 3GY4A 2VVVA 1XX9A 2GCTB 2WPJS 3RXMA 2KAIB 3TVJB 4X2WA 4MLFB 4UE7H 8LPRA 1NFWA 1GJ7B 3IG6B 2B7DH 2AGGX 3DFJA 1H1BA 3STJA 1W0YH 2AGEX 1VGCB 1MD8A 2UUJB 3M5LA 1SBWA 1CU1A 1P3CA 3SGBE 1VITG 1GBMA 1O2WA 2Q6GA 1CO7E 1HJAB 2EI6A 3GCOA 4ISHH 1P2IA 3IITA 1VGCC 3AAUA 3RC6A 4IN2A 5L2YH 4WY3A 3A83A 3PMAB 4CBNA 1P09A 2P3UB 2ZFRH 4K8BA 3TU7H 3MOCA 1EZUC 4ZHAA 1RTFB 1FI8A 1V2MT 3K2UA 5EOKA 1QJ1B 3P95A 1B7XB 4PROA 1TWXB 1ELGA 2XRCA 4O3TA 1V6DA 1XKBC 2J92A 1AY6H 4AYVB 1XVOA 1ELCA 1FPHH 3BSQA 2ZHDA 1IQKA 1B0FA 2BZ6H 2ZU4A 8GCHF 3C1KA 2BB4A 4GAWA 2FOAA 2HPQH 4IGDA 4XBBA 4AB8A 4U2WA 2F9OA 2AIPA 1ELAA 5FBIA 3A8BA 2C8ZB 5GCHG 3ZZBA 3S0NA 1AZ8A 1BRUP 1Z6EA 1E37B 1QB9A 4GVUA 3BG4B 1YLDA 1KXFA 3ZVEA 1AO5A 3M3VA 3SW2B 1C4Y2 3GCNA 2PKAA 1C1SA 2NU2E 1HJ8A 1EZXC 1P8VC 4FUEA 3EDXB 1C5RA 1C2KA 3ZVDA 1L2EA 2BD5A 2CJIA 5A0AE 1DM4B 3BG4C 2CF9H 1PFXC 1V2UT 4BAMB 1O34A 1ZSKA 5J4QA 2FOBA 1TPSA 2WV4A 3PMHB 3RU4D 2Y6TA 3F9EA 3ELAH 1G3CA 3T2NA 3MFJA 3A87A 3PROA 4X1SU 3V7TA 3T27A 1O2IA 3DA9B 3OY5U 1Y8TA 4UFDH 1K21H 1K2I1 3MNBA 1SLXB 2FLBH 1GI9B 2JETB 2VB0A 3E91A 5LH8A 4A1XA 1KXBA 1A1RA 2Y82A 1AKSA 1O2ZA 1SHYA 1F0SA 3LGUA 4OS6A 3MI4A 3VXFH 5FCKA 2Y81A 1AI8H 2HPPH 1NN6A 4XSKU 2BXUH 1TQ0B 2GDEH 1LHDH 3A7ZA 1QTFA 1HAVA 2OTVA 1BRAA 2SGDE 4BANB 1CGJE 4Y8ZA 1ELVA 1FAKH 4I32A 8ESTE 1GMHG 1W0ZU 1O5BB 2ALVA 2CF8H 2CHAB 1TNHA 1GDNA 1YF4A 4BAHB 2CGAA 2SNVA 4ABFA 2JH5D 3P8NA 3T5FH 2EI7A 1TPAE 2P3TB 2IN2A 2ODPA 4NZQA 1IQIA 2CHAC 1H4WA 8KME2 1CHOG 2Q1JA 3QX5H 3MH6A 2ZPQA 1EPTA 1P2KA 4X1RU 4WXIA 1T4UH 1BRBE 1WQVH 3Q77A 5FX6A 5GPIB 2G8TA 3KCGH 3TJOA 4MPVA 1E35B 1FQ3A 4F4OC 1THRH 1ZTLA 1ETRH 2CMYA 1O2XA 2OP9A 3U1IB 3GOVB 4Y7AA 1AUJA 2ZEBA 1EB1H 1TBQH 2AH4X 2GVFA 1D9IA 1C5LH 3S69A 1O2NA 1ZRKA 2TGAA 5LPEA 4CRDA 1Z1IA 1XM1A 3LH1A 1HXFH 3QGJA 2WYGA 4WWYA 3V0XA 2BY6X 5C1YA 4ISNA 1SC8U 3UUZA 3RXIA 1DWDH 3PTNA 2XCFA 4O97A 4DG4A 3TGKE 3NZIA 1O5FH 1EJMA 2GZ7A 4Q80A 3S9CA 3LONA 1D6WA 3LIWA 4NA9H 1GI3A 3TGIE 4D7GA 1O2MA 3SU0A 3QGNB 1NFYA 1TIOA 1UTPA 1DX5M 4BTUB 3HKJB 3OY6U 1C5XB 2IJOB 1W7GH 1A2CH 3HKIB 4J2YB 3QTVH 5DP9A 1DDJA 4BAOB 1RFNA 2A5AA 5I46H 1K1JA 3VB5A 3ATKA 4IC6A 1DY9A 3ZVBA 3LC5A 1BTZA 3BEFB 2XBXA 3U8OH 1QA0A 2WPMS 1B5GH 1C2DA 4JYVH 2ZHWH 1HV7A 1OPHB 7GCHG 4X8TH 2F91A 4JK6A 1INCA 3KQBA 4JCNA 7KMEH 1TQ7B 5T6GA 4DY7B 2B9LA 3LGWA 3LJOA 2AMDA 1T8MA 1B0EA 2ZQ2A 3B9FH 1DFPA 1L1GA 2LPRA 5DPAA 1TOMH 5T6FA 1O3NA 5HXFA 2W7SA 1PQ8A 3SU6A 1QRWA 4Y8XA 4TPYA 3SGQE 1DLKB 3U98H 1EJNA 1YPMH 4Z6AH 2HOBA 3PO1B