2HALA

An episulfide cation (thiiranium ring) trapped in the active site of hav 3c proteinase inactivated by peptide-based ketone inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis A Protease 3C
publication title An Episulfide Cation (Thiiranium Ring) Trapped in the Active Site of HAV 3C Proteinase Inactivated by Peptide-based Ketone Inhibitors.
pubmed doi rcsb
source organism Hepatitis a virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 212
sequence length 212
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2halA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2halA02
3HGNA 5EW2H 1ETTH 1EAUA 4FXGH 3SGAE 1MAXA 1MD8A 1A5GH 1GHAF 4Y7BA 3RXRA 4ZKSU 1XUGA 5T6DA 4KTUA 1CT4E 1FQ3A 1C2FA 1CT0E 3T62A 1ANCA 3UQOA 1IQNA 3V7TA 1EQ9A 3P17H 4Q7XA 1HJ9A 3HATH 1PPEE 3AAVA 3SU3A 1GHBG 1C4U2 1UCYH 3DFJA 1MMJN 1UTJA 1P03A 4CRCA 4YOGA 1ZRBA 4O3TA 2Y7ZA 3T27A 1LO6A 1O5DH 1JRTA 1AMHA 2A31A 2P8OC 2JH5D 5H4IB 3SO3A 2AMPA 3JZ2B 2ZCKP 5EW1H 1D6WA 3TK6A 1C1RA 4I8HA 3ZYDA 4ISLA 1EOJA 4B71A 2VNTA 4GVUA 3SV6A 1GJBB 2ALPA 1AI8H 1YPLH 1F0TA 3KEEA 2BY7X 9ESTA 3SV2H 1ESTA 1ETRH 1BRCE 1PPBH 5FPYA 4MG3A 2R9PA 1QBNA 4X1PU 3JZ1B 1XUKA 3SNEA 1HJ8A 1HB0B 1AKSA 5EOKA 4F4OC 2VJ1A 1IQLA 1QBVH 3RXSA 1HRTH 2IOTA 1C5OH 3ZZCA 3KQCA 1SGTA 1O38A 1C2MA 4K2YA 3G01A 1RTKA 2OUAA 1UTOA 2D2DA 1O5BB 3AW1A 3EQ0H 2TGTA 2J4IA 5TCAA 1L0ZA 1RRKA 1O3IA 1SL3A 3ODDA 4K8YA 1DITH 2WUBA 1OWDA 1P01A 2GVFA 1N6XA 1G37A 1AIXH 2OXSA 1SI5H 3MU5A 1QGFA 1TALA 3PTBA 3T25A 1S0RA 1AE5A 3LH1A 3H7TA 3O8DA 3SNBA 2AMQA 3A8DA 4MNVA 3I29A 1O2PA 3SI3H 3ITIA 1ANBA 3PTNA 3F9EA 4I8LA 1OOKB 1SGDE 1O36A 4FU7A 1VITH 1G3BA 3ZVAA 1SVPA 1XVMA 4NSVA 5JDUB 3QN7A 1C2EA 4UONA 2Z9IA 3MH6A 2ZFFH 4GSOA 1W7GH 2B8OH 1FDPA 1GI7B 3S69A 1K1IA 2BY6X 2FS8A 2FYRA 2IN2A 1BMLA 4Y7AA 2Q6GA 3RC5A 1L1JA 2C8XB 3P8FA 4WH8A 3SGBE 4VGCB 2GMTB 2PGQB 4OS4A 3ELAH 1J15A 1EOLA 2XW9A 1AB9B 6GCHG 1L1NA 5BRRE 2F9OA 2BDGA 3FZZA 1P2OA 2Z3EA 1G9IE 1LTOA 1MBQA 1YLCA 1SG8B 2A4RA 2OQUA 1CGJE 1A7SA 4TWYA 1QJ7B 3P70B 5G4BA 1MCTA 4X2WA 3RXLA 4INKA 2J38A 1NRNH 1GDNA 4B2AA 1LPZB 4HTCH 1YPGH 2O9QA 1PJPA 5FPTA 3TH3H 5DGJA 5BPEA 3URDA 2W26A 4MPWA 2ZPSA 2BDIA 1MTVA 2VIWA 1UTQA 1CQQA 1ELGA 1C2IA 4OS5A 3ZVCA 1C2KA 1GMHG 2TRMA 3MH7A 4K1TA 1GPZA 1F5LA 2ZGHA 2FLRH 7KMEH 1VITF 2FI3E 3F9GA 2FMJA 2Z94A 5K0HA 1N8OB 3SUFA 3V13A 4AORA 2NU3E 2ZCHP 3NZIA 1Z1IA 1G3CA 5AFZH 3LJOA 4BTUB 1IQEA 1C1UH 2BVRH 5FAHA 1DVAH 4U30A 4E06H 1TNKA 3IITA 4R8TB 2H9EH 2BDYA 3SNCA 3U8TH 5EQQA 2WYJA 1O2OA 2VIOA 1ID5H 2FPZA 4X6PA 1VZQH 1OWEA 2F9VA 3SBKA 3GCHC 2ZP0H 1CA0B 3A89A 3D23A 1RD3B 3SGQE 2AS9A 1C4Y2 4YO9A 2AYWA 1KXAA 1TBQH 4Y8ZA 1MQ6A 5JBTA 1FN8A 1RIWB 2ZHFH 3RXGA 1P3CA 2TIOA 3PM3A 1TPPA 4XBBA 1O2UA 1HAZB 3RC6A 1A4WH 1FAKH 2G5VA 3VGCC 5GCHG 3M3TA 1G3EA 1LVOA 3O8CA 5E2OA 1T4UH 1THRH 2RA0A 2M5TA 1BBRH 1K2I1 4Y0ZE 8ESTE 2BY8X 1NS3A 1XUFA 1SQOA 1V2JT 2XYAA 1D9IA 2RDLA 2Y81A 5GJ4B 1LHGH 2VH0A 3QUMP 3AAUA 5CE1A 1LHDH 3KGPA 4AGKA 1TX8A 2A2XH 2VWNA 2Y82A 3MNBA 3BSQA 5FHTA 2ANWA 3SU2A 1C1TA 1GBJA 4B75A 5A0AE 1O2NA 2C93B 5T6FA 1Z8JB 3A7TA 1TPAE 2PKSB 1O33A 1P57B 3K6YA 1HNEE 1HPGA 1MH0A 4MPUA 2W3KA 1PPZA 1DY8A 4FUJA 5TCCA 1OYTH 4WY3A 1XXDA 2OINA 4XE4A 1IHTH 5K7RA 2PSXA 2VIDA 3U98H 1P2MA 1H9HE 1C5TA 2CMYA 3CP7A 1DSTA 3BTFE 3OTJE 2Q6DA 3UR6A 3QX5H 4Y8XA 1BTPA 3H5CB 1AVWA 2XCFA 2FZZA 1BTXA 1JOUB 4Q7YA 2PW8H 2VWOA 2ZGXH 2BOKA 2WINI 3S9AA 1ZHRA 1NFXA 1O39A 1DUAA 1BT7A 4XBCA 4GCHG 1D4PB 3UNSA 2A0QB 2GV6A 2BMGB 1TBRH 1JMOH 3GCNA 2VVUA 3URCA 4CBOA 1K28D 1K1MA 1NO9H 3ZVGA 4ZXYH 3GY2A 2F83A 1B7XB 3F9HA 2GCTB 4Q80A 5LH8A 1KTSB 1V2ST 1UVTH 2HRVA 2WPKS 2ZDLA 2YNBA 4K60A 2XBXA 1Z71A 1GMCG 3SU6A 5CMXH 1UK4A 1O3KA 5GWZA 2ZHWH 3VB4A 2G00A 3QO6A 1G2MA 3SQEE 1BDAA 1S83A 4X8TH 2HGTH 3H7OA 2SGQE 2BYAX 3I78A 1DXWA 3T26A 1EJMA 1GHYH 3TJOA 1UVUH 5FX5A 1O32A 4CRBA 2BD4A 3FVFB 1O3OA 1QTFA 4YLUA 1P9UA 1NN6A 1ZGIA 2A5AA 2XCNA 1SQAA 3A7VA 2SGFE 1ZJKA 2FYQA 1QA7A 2THFB 3PV4A 1A0HB 1BTZA 1OWJA 1O2HA 1OS8A 2OP9A 4FUFA 3RU4D 5HYOA 2TGAA 4INLA 2WUCA 3VB7A 4TPIZ 1V2TT 1FLEE 3A86A 1YPHE 4JK5A 5C1YA 1HAVB 1LVBA 1MUEB 1QY6A 1O5EH 4AFSA 3RLWH 1KLIH 1KXEA 5DP4A 1BQYA 1GBCA 3T29A 1TGSZ 1ZGVA 1IQMA 1AY6H 2XNIA 2UUYA 1TNGA 2O8LA 1UTPA 1S5SA 1XVOA 5JYIA 1GL1A 3RU4E 2OBOA 2BLOA 1SQTA 4NWLA 1A61H 1Y5AT 3LKWA 4F49A 5E0HA 3GY5A 1V2MT 3S7HB 2OC0A 1EASA 5TJXA 1C1WH 2QIQA 1B0EA 2O8WA 3D49H 1O3NA 1E34B 4KTCA 4YOJA 1RJXB 1XKAC 2Q1JA 3TK9A 1DS2E 6LPRA 5DP9A 2G55A 4Y8YA 1S6FA 4K8BA 4FVDA 4IMQA 3A88A 3EGKH 3QWCH 1NTPA 3TJNA 1V2OT 1O3JA 2QF0A 3EE0B 1RXPA 3SQHE 1WAYB 3LGVA 3GICB 1LQDB 2BZAA 1AVXA 4AYYB 1KTTB 4AFQA 1S0QA 1SGEE 2LNCA 2ULLA 2OC1A 1QIXB 3A85A 1AO5A 1PQ5A 3MTYA 2A32A 1UVSH 2C8WB 1NRSH 3KL6A 1ELBA 1F5KU 3I77A 1HXFH 3Q76A 4NIYA 3F6UH 1GGDB 3MMGA 1GI4A 1DWBH 3A87A 4FUBA 1BOQA 3HGPA 5AHGH 2BZ6H 1G3DA 4FUGA 4WVPE 2XC4A 1ZTLA 4TWWA 4VGCC 2PSYA 2GMTC 2AH4X 3UUZA 2ZHEH 1T31A 3TIUA 3MU0A 1BTYA 3B9FH 4FVBA 1HGTH 5FCKA 2BY9X 1AB9C 4ISHH 3KF2A 2QXIA 1HJAB 1ANEA 1LCYA 3L3TA 1AUJA 1BJUA 1TNHA 1TB6H 2HALA 4OS2A 1G30B 5DP3A 1NRQH 3UOPA 1QJ1B 1ESAA 5EQRA 1HAOH 1L1GA 1UMAH 2H6MA 1WU1A 1MU8B 4GHTA 1H8IH 1O2ZA 2PUXB 1FIZA 5A0CA 1CT2E 3OY5U 1SGFG 1GI6A 2BX4A 3Q3KA 3STIA 1VCQA 3ZZAA 1OXGA 1O3EA 2GDDA 2OLGA 4X1QU 3M37A 3VB5A 1C5SA 1ZTJA 4CRGA 2BM2A 2FOCA 2ZHDA 3M7UA 1W12U 1FXYA 3TGJE 3GDUA 3AW0A 5A0BA 1UCYE 3U9AH 1OSSA 1S85A 1BMAA 1N8OC 1LHFH 3BTDE 1HAHH 4TYDA 1KY9A 2Z9GA 2ZFQH 5T3HA 5B6OA 3A84A 1GL0E 4OGXA 3F68H 3RXIA 5C5NA 1GBLA 3ATMA 1FPCH 1FAXA 1FMGA 1GJ8B 1Q3XA 3M5OA 1PQ7A 1TLDA 1MKWK 4JYTA 2PKAB 4R0IA 1BMMH 4ZHLU 1BMNH 1TFXA 1KXFA 1K21H 1O3DA 1WOFA 2FLBH 4X2VA 4YT7H 1ELVA 1YPHC 1CA0C 3GYMA 1TX7A 1EUFA 3RXBA 2Y5FA 4ABAA 3UQVA 1F0UA 1RS0A 2GZ9A 1C2JA 1RIWC 2WYGA 2NU4E 1PQAA 1T32A 1PPFE 4D8NA 3MHWU 5DP6A 1OPHB 5HM9A 1DE7H 2J2UA 3RXPA 1A2CH 1KXBA 1PPCE 1V2NT 3SN8A 1GMDG 3ATKA 1HDTH 1W0ZU 3ZZ7A 4ZUHA 1GI2A 3RXKA 4ZKRU 3TH4H 1O2QA 4JYUH 3BTEE 3RXEA 4JCNA 1SPJA 3LGIA 1J17T 1K1NA 2D8WA 4BTTB 1C2HA 1BRBE 1GHZA 1L4ZA 5AF9H 1TGBA 3T5FH 2LPRA 4JZDH 4WF8A 4A92A 1UJ1A 1NM6A 1W2KH 2SNWA 4ZKOU 1FY4A 1HYLA 2CHAB 3QK1A 3TGIE 1GI5A 2PKSC 3MI4A 3PO1B 4HI3A 1ELEE 3EA7A 2QC2A 1TRMA 3E0NB 8LPRA 3U1JB 3Q3XA 3CENA 3DA9B 1GG6B 2ZFSA 1FIWA 2AIQA 2ZECA 5AFYH 2ZGCA 3NXPA 5T6GA 2ASUB 2UUFB 1ACBE 4MQAA 2OQ5A 2FTLE 2A5IA 3S9CA 2QA9E 3SORA 1UK2A 2O8TA 1AU8A 1TRYA 2ZIQH 4UFFH 4OGYA 2BLVA 1AUTC 1C5QA 3A8CA 4Y71A 1AFQB 3ZZ9A 3OSYA 3A8AA 1C5VA 1AD8H 4DJZB 3PWBA 3K9XB 1WBGB 1GCTB 1K22H 1XKBC 3ZZ4A 3R3GB 3BTHE 4MDSA 1TNLA 1C5NH 2FOHA 5EPYA 3M3SA 4ABIA 1T7CA 3KIDU 2J34A 4BOHA 5A8ZA 1P12E 8KME2 2DUCA 4FUHA 3MNXA 2QF3A 3BTKE 3GCTF 3ZZBA 1GJ6A 2J94A 3BG4B 1A46H 3S7KB 1A0LA 5I25A 2GCTC 2B7DH 1JIRA 4SGBE 4TY6A 4AX9H 3RXCA 1CBWB 2HVXA 2F91A 3TLOA 2QCYA 2HNTF 3M3VA 1DICA 8GCHF 3BIUH 3P8NA 3RXDA 1NRRH 5J4SA 5C67A 3BIVH 1MBMA 1ZLRA 1VJAU 2VH6A 2R0LA 1QL9A 3E8LA 2R2WU 1HIAB 1EXFA 2ZO3H 3M7TA 1JBUH 4BAMB 3CS0A 3BF6H 2BD9A 1GBBA 3RM2H 1UK3A 2GV7A 2FOMB 2ZI2H 2I6QA 2TPIZ 4ABHA 1GBKA 1CO7E 2JKHA 5EODA 3SW2B 1TABE 4ABGA 1H9IE 2ZGBH 2WPLS 2EC9H 4D9QA 1JXPA 1JWTA 1ZOMA 2OCVB 3SJIA 1T8LA 2ZTXA 1D3PB 2BDAA 2NU1E 1W14U 2ZEBA 2W7SA 3M5MA 2ZZUH 1IHSH 3E1XB 1BTWA 2SGAA 3UY9A 1UVPA 3ZYEA 1HUTH 2V0BA 1Y5UT 5C5OA 1UTLM 2P3UB 1GBEA 1V2LT 2R3YA 4ISNA 1TYNA 1ELFA 1KLTA 1EB2A 2FX4A 4LZ4B 1BBRE 1OWIA 1AN1E 4DIIH 3KCGH 1Z6EA 1CSOE 3UPEA 2VWMA 1TAWA 4J2YB 3MU1A 2A4QA 3O8BA 4MNXA 1K1OA 1WYKA 4ISIH 4CR5A 1O3GA 4IS5A 4FUIA 1TIOA 3FZDA 5EQSA 1EAIA 2TGPZ 3KHVA 1BHXF 5GXPA 1GHXH 3K2UA 1TQ7B 3DHKH 1PYTD 4WMEA 3UTUH 3LT3A 1NZQH 1SHHB 2BD8A 1GVLA 1P2NA 1QA0A 1C5LH 1DANH 1GJCB 4ZAEA 5HGGA 3VXEH 1QL7A 4WJG2 5HM2A 3PROA 2QYIA 4X0WU 1UHBB 2VU8E 1L4DA 1WTGH 3Q00A 2NU0E 5F8XA 5EPNA 4JYVH 1NU7B 2ZDKA 4AN7A 1HAYB 1K1PA 3OY6U 1KSNA 3RU4T 3BEUA 1GGDC 1C5RA 2GX4A 3RUOA 1TPOA 4Y6DA 1OP8A 1PFXC 2ODQA 3W94A 1YCPH 1TE0A 3ZZDA 4UEHH 4XSKU 1Q31A 1YP9A 1S6HA 1TA2A 2XXLA 3AASA 3U69H 2ALVA 2CV3A 2GD4B 4K3JA 4CREA 1VITG 1SLXB 2QN5T 2B9LA 4O3UA 3ZZ3A 1V2KT 1HJAC 3HKIB 1DDJA 3A7WA 6ESTA 5FCRA 1TNJA 1K1LA 1O2KA 1UCYK 3F9FA 2ZU3A 5GDSH 1SGIB 1ZRKA 2HOBA 3MNSA 4RKOB 3LC3A 1EAWA 2V3HH 4NZLA 5A8XA 2ZNKH 2D1JA 3P8GA 2R3UA 1TX6A 1NT1A 2A1DB 1FY8E 1GDUA 2ZTZA 1FPHH 1BCUH 2FIRH 5DO4H 3P6ZB 2AFQB 5HXFA 1EP6A 1INCA 2DE8A 2F9NA 2G4TA 3QDZB 1VCPA 2FS9A 2ZWLH 5JB9S 4DURA 2AGGX 5E0JA 3ZVBA 1ARBA 1TOCB 2A2QH 1W8BH 1SGCA 1FONA 2FI4E 4DT7B 4RSPA 2Y5HA 4B2CA 4CR9A 1FY3A 3KNXA 3LC5A 1GMCF 4BXSA 2ANYA 4DCDA 4A6LA 1C2DA 1DLKB 4ABEA 4B76A 1KLJH 1MTSA 5FX6A 3PMBB 3GISB 4X8VH 1FN6A 1Y3XA 2W7UA 4HZHA 1C5MD 1HAPH 3C27B 1DWCH 2GCHG 2Z3DA 1P04A 2BVSH 7GCHF 5JBAS 1W13U 3E6PH 1CHGA 3M35A 2FO9A 3LGUA 1BZXE 2QXGA 1A5HA 1P02A 2AGEX 1T8MA 2PTNA 1P06A 2BDCA 5EG4A 1GI0A 1O5CB 1O2TA 4ABBA 3RMMH 1MKXH 1O3LA 4WMFA 4NGAH 2ANMH 2R2MB 4ZMAH 5LPFA 2EA3A 4ESTE 1EX3A 1DY9A 2FM2A 3SUDA 4DGJA 1ZMNA 1K9OE 1GVKB 1GVZA 2WPJS 1G36A 2C8YB 1IQKA 4UFEH 1WV7H 3AVZA 1SGPE 2FP7B 2EI8A 2Y7XA 5LPEA 1SGYE 1YKTA 4GPGA 4I8GA 3PMJA 1YPKH 2GZ8A 4LZ1H 1Y59T 5EXMA 5E2PA 2A4GA 1OP0A 1DXPA 1M9UA 3TK5A 4MNYA 4H6TA 1O34A 1Y8TA 1NPMA 1XUIA 4JZEH 7ESTE 1ZHPA 2G5NA 4AB9A 2HPQH 1O2GH 2Y80A 1C5XB 1UTKA 5I46H 3PLBA 2BLWA 3E91A 1MAYA 5C2ZA 2ZU5A 2Z9LA 3LGTA 3PO1C 1GG6C 1NY22 2O8MA 2BTCE 4A1TA 3VB3A 1PYTC 1LVYA 2IJOB 1ELCA 1X7AC 1J14A 1LQEA 4NZQA 2WPIS 1QURH 1O2YA 2WPMS 4Y76A 1TNIA 1J9CH 1E0FD 1EJNA 1MTNB 4IMZA 3Q3YA 4ABDA 3P92A 2F3CE 2YOLA 2SGEE 1EZUC 1SOTA 2PKAA 3UNRA 1KYNA 1TOMH 2C4FH 1IAUA 1FI8A 4IC5A 3PLPA 1O31A 1C4V2 1BUIA 3ZVDA 2JETB 4E7RG 1C1PA 3IWMA 2STBE 3VFEA 1FUJA 4O97A 2FESH 1C5WB 3TNSA 2ZDVH 1DUEA 4DW2U 1GCTC 4KP0A 3D65E 2ZC9H 1ABIH 2PLXA 1O2RA 1ZPCA 3U1IB 3SU0A 3QGNB 1GJ4H 2FXRA 4ZKNU 1RFNA 3SJKA 2BX3A 1F2SE 2CN0H 2H9HA 1SMFE 4AGJA 1YBWA 1CHOG 3SHAH 2BXTH 5LPRA 1O5GH 3BG4C 3PYHA 3UFAA 1GJ5H 1E37B 5A09A 1H9LB 2ZU4A 3MH5A 2HWLB 1P05A 3BG8A 1CBWC 1NFWA 2OTVA 2Z6BD 3ATIA 2XRCA 2CF8H 1F0SA 4X1NU 1ESBA 2I6SA 1O2LA 1D3QB 1QRXA 2HPPH 4NIXA 4ZROA 5C1UA 1GBAA 4H6SB 4X8UH 3MWIU 1O0DH 4SGAE 1CA8B 1Z8GA 3WY8A 4DG4A 1ZR0A 1P8VC 2C3SA 2SGDE 3RXOA 3K65B 4YESB 4AFZA 2ZG0H 3PMHB 1T8NA 1ABJH 1DM4B 3V3MA 7LPRA 3SI4H 1KDQB 1P0SH 1EZQA 4U32A 4XBDA 2VIPA 1O3PB 3ESTA 1EZSC 3LU9B 9LPRA 3A80A 3SU5A 4K69A 2A7HA 1GHVH 2ZGJA 1BBRK 1C9PA 4KKDA 4D7GA 3MU4A 1VJ9U 2ZPRA 1QFKH 3A8BA 1W3CA 2VIVA 2Y5GA 2EEKA 1ETSH 2QAAA 1O3AA 2O8UA 4BANB 5FXLA 4X1RU 4LOYH 1IQFA 2QXJA 5FBEA 2B5TB 2J95A 1TGCA 1HBTH 5C1XA 2ZFRH 3ENSB 2KAIB 4NA8A 1TGTA 2FOBA 1A3BH 2ANKH 4KTSA 1LPGB 3UIRA 1HLTH 1V3XA 3P8OA 4JK6A 4ZHAA 1O3HA 2AERH 3GY6A 1P2QA 1E35B 3Q77A 1S84A 1GJ9B 1BITA 1AHTH 1C5ZB 1MD7A 2SFAA 3MH4A 4RKJB 3ZV8A 2VVVA 1Y5BT 2RCEA 1DWDH 3BTQE 2FOGA 3SHCH 1GHBF 1NROH 1V2QT 1CGHA 1QBOA 3MO3A 2HNTE 4B74A 1V6DA 2WV4A 1S81A 4H4FA 1Z1JA 2ZQ1A 3T2NA 5F6MA 4D76A 3B23B 3PB1E 1SGFA 1HFDA 1O5FH 1WUNH 3KQEA 5FBIA 4I33A 3OU0A 1QB1A 3HK6B 4AZ2B 2VIQA 1CU1A 4H42U 2FWWA 5CHAB 3ZVFA 2VVCA 3HKJB 1UVOA 2ZPQA 3TJUA 1HIAA 3RM0H 3R0FA 3RXUA 1ZJDA 5HMAA 1IOEA 1TWXB 2Y6TA 2V3OH 3O8RA 3RMNH 4ASHA 1C1MA 4GUXA 1TMBH 1THSH 2PTCE 2YNAA 1DT2A 4Q7ZA 1Y3YA 3D62A 1AQ7A 4DVAU 1H1BA 1W7XH 3SJOA 3LDXH 3UWIA 4B73A 1CVWH 1EPTB 3NKKA 3N7OA 1GI1A 3FFGA 4DY7B 3VB6A 3MU8A 1A0JA 2GDEH 1T4VH 1BTUA 3MO6A 2ZDMA 3EYDA 2EI6A 1SB1H 1V2VT 2AMDA 3SU4A 2QY0B 1O3FA 1NU9A 4YM9A 2XBWA 4CRDA 2GTBA 2IPHA 1O3CA 1Y3UA 3DUXH 1Z8IB 1LPKB 1GCDA 1QRWA 3BTTE 3LPRA 4CHAB 4JMYA 2SNVA 3SV7A 1C5UA 2AGIX 4OS1A 1GHAG 4U2WA 4MPXA 1H8DH 2CXVA 5L2YH 1F5RA 3NPSA 3K6ZA 4I8KA 4AG2A 2P93A 1HCGA 4X6NA 5J4QA 3ATWA 5JBCS 4A1VA 1W10U 4TY7A 4KGAA 1GBFA 4ABJA 1VR1H 2P3TB 2XTTB 1UHBA 1MTUA 3E16B 4QT8C 1VCWA 1ZPZA 5EGMA 2BD3A 4FU8A 1V2PT 1NFYA 3GYLB 4ABFA 2FX6A 4THNH 2W5EA 1PPGE 1SC8U 1O3MA 1TMUH 6GCHF 2W3IA 1AE8H 2R0KA 1SFIA 4X2XA 3A83A 3STJA 1YM0A 1MTWA 3PMAB 1DLEA 1SGRE 1QHRB 4UE7H 1OWKA 5GPIB 2GT8A 1Z6JH 1ZZZA 1LHEH 2Q6FA 2SGPE 4NG9H 1HXEH 1P2KA 3U8RH 3NCLA 1DX5M 1PQ8A 3NK8A 2B0FA 4E7NA 5AVDA 3S0NA 2AEIH 1G2LA 3B8JA 1W0YH 2P95A 1O3BA 2ESTE 1C9TA 5F8TA 3SNAA 3KQBA 1N6YA 1MCVA 3SUGA 4FU9A 1VGCB 1FY5A 1BJVA 1CE5A 2P59A 1GMHF 2QGRA 2RG3A 2UWLA 2C90B 4HGCA 4DOQA 4IGDA 4BAKB 1ELTA 2ODYB 2K1QA 4A5TS 3FAOA 3LONA 2QXHA 3GDVA 5DP8A 3C1KA 1W11U 4IC6A 2PV9B 2Z3CA 5L30H 2HNTC 4CRAA 2F9BH 2ZFPH 2A7JA 4B2BA 3ODFA 2ZDAH 2G81E 1YCPM 3GOVB 3DFLA 3GY4A 1V2RT 3P95A 1O2WA 1SBWA 3MO9A 4ZH8A 6CHAB 2NWNA 3LGWA 2OBQA 5C20A 2UWPA 1EB1H 3VEQB 3TH2H 2F9PA 2G51A 3SNDA 3E3TA 4A1XA 4CBNA 3RXHA 2V6NA 2XWAA 2AIPA 5GIBA 2PWXA 1WQVH 2VGCB 3GCTG 4FUCA 3GY7A 2VWLA 3LJJA 1BB0B 1MTNC 1DOJA 1QL8A 3RXMA 2ZF0H 1G32B 4UFGH 1FZZA 2FOAA 1BIOA 1AWHB 5DP5A 8GCHG 1LKBA 1SLWB 1WQSA 1YC0A 3KN2A 1Q2WA 2FODA 2JETC 3RMOH 5ABWA 1DPOA 2G8TA 1C1OA 1NRPH 1EAXA 1A3EH 2FOEA 1OP2A 1S82A 1LKAA 2BVXH 2UUJB 5GCHF 2H1UA 1BRAA 2FI5E 2ZQ2A 1HAXB 3LH3A 2STAE 1RTLA 2J92A 4ZHMU 3RDZA 3BEIB 5F8ZA 5A2MH 3RXVA 2VINA 1QJ6B 3M5NA 1GBMA 1XMNB 4D7FA 4Z6AH 2ZA5A 1CGIE 1AVGH 1IQJA 3BTME 3FP6E 2ILNA 4NIVA 3FP8E 1JIMA 4BXWA 1AKSB 1N1LA 2FDAA 4UD9H 1AZ8A 1KIGH 3L33A 4K5ZA 3UNQA 1GI9B 2BDHA 3VXFH 1NFUA 1BRUP 3BTGE 3QZRA 2D26C 4K1SA 4CRFA 2PFEA 4JZ1A 1O2JA 2ZHQH 1LHCH 3MNCA 3TGKE 2DE9A 5EXNA 4E05H 1EP5A 3BTWE 5ESBA 1TMTH 4BAOB 2GGVB 2RA3A 1P9SA 1QB6A 2JH6D 1AFEH 1C1SA 2ZU2A 1BTHH 4K1EA 1LDTT 4GHQA 4NIWA 1HAVA 2Z9JA 3BV9B 4NA7A 1C2LA 4YOIA 3A7YA 3A82A 1C1QA 2GCHF 3EA8A 1YPEH 1SFQB 2ZFTA 2V35A 1YLDA 1YGCH 3IG6B 4X1SU 3W95A 1IQHA 1P09A 3RC4A 3ZV9A 1RGQA 4WMDA 4FUEA 3PLKA 3DT0H 4GCHF 1O37A 5C3NA 4NSYA 2P8OB 1SSXA 2P94A 1B5GH 2BD2A 1A1RA 4AG1A 1Z7KA 1NESE 1O2IA 4U01A 2ZU1A 3TITA 4ZXXH 3SV9A 4WH6A 2H2ZA 4A7IB 4Y79A 4WWYA 1D3DB 1GBTA 1TPSA 1A5IA 1ZPBA 3GDSA 3ZVEA 2BD7A 2ZTYA 3SV8A 1TRNA 1TBZH 4UFDH 1J8AA 1AGJA 4IN2A 5ETXA 2WPHS 1C1NA 3NUMA 1MQ5A 5PTPA 4Y0YE 1LVMA 3QTVH 1XUJA 2XBYA 3SJ9A 2BDBA 5JPMH 1AZZA 1QR3E 1UTMA 4BAHB 1O30A 1O2VA 2A45B 5A8YA 5E0GA 2A5KA 2FEQH 2XWBI 3HPTB 5E8EH 3RXTA 3UWJH 1MKWH 1GI8B 5JB8S 1O35A 1KDQA 3TPIZ 5CHAC 2BXUH 4WXVA 4AB8A 3L6PA 2C8ZB 1SGNE 1WSSH 4BAQB 3QZQA 3TJVA 3DD2H 3RXJA 4XOJA 5DK1A 3SJ8A 2OD3B 1FNIA 3MFJA 4D9RA 4AFUA 2BLQA 1DWEH 4OS7A 2CF9H 1E38B 4RN6A 3GCOA 1GWAA 4CH2B 3SUEA 4NCYA 1F0RA 1ZTKA 4NFFA 1EKBB 2UWOA 1U6QA 1TONA 3EA9A 1HAIH 1EPTC 1P3EA 2TBSA 4Z0KA 2TGDA 1ANDA 1YPMH 5DPAA 3RXFA 2KAIA 5DG6A 5F03A 4J1YA 4JZIA 3VPKA 4BTIB 5ESTE 1C5PA 2UUKB 3S9BA 1F7ZA 4M7GA 1V2UT 4INHA 2QV1A 4I8JA 3LGYA 7GCHG 3PWCA 4I32A 1O5AB 1BA8B 2CHAC 3MOCA 1ORFA 4LK4A 3RP2A 4GLYA 4WXIA 3UREA 1Y3VA 4YT6H 3TU7H 3E90B 4CHAC 3ATLA 1GDQA 1MZDA 1SLUB 4AYVB 1KXCA 2G52A 1EZXC 2CGAA 2Z9KA 3FP7E 4LXBH 4NFEA 1CHOF 1GJAB 4X6MA 1GJDB 1XM1A 1EATA 3TNTA 1D6RA 3SU1A 1QRZA 1V2WT 3GY8A 1ZSJA 3QLPH 5FPSA 2A4OA 2P16A 2OC7A 1DFPA 1QB9A 3T28A 4YTAA 1ELAA 4X6OA 2BD5A 2CJIA 4IW4E 1AFQC 3ZZ8A 3UR9A 3ZZ6A 1JRSA 3M61U 1P11E 2GZ7A 3M5LA 1OX1A 5EXLA 1ZHMA 3A7ZA 1C1VH 1ARCA 1YYY1 2EI7A 1SGQE 1WCZA 3A81A 4YZUA 2HLCA 3KQDA 2H5DA 3MYWA 1KXDA 2GT7A 1O2XA 1P10A 4YLQH 3ZZ5A 1T8OA 1E36B 4MTBA 1C2GA 1QQUA 3SZNA 1SLVB 2XC5A 1FV9A 2JH0D 2BQWB 2BOHB 1TQ0B 2ZKSA 1TA6A 1GBDA 2GP9B 5JBBS 3RXQA 3M36A 1Y3WA 1O2MA 1UTNA 2J9NA 2BB4A 1RTFB 2NU2E 3TVJB 3M7QA 3EDXB 4X2YA 1EPTA 5DKMA 1K1JA 1B0FA 1FY1A 1WTHD 1OWHA 1BHXB 4I7YH 2ZDNA 2FTMA 4B1TA 3HK3B 5EU8A 5SGAE 3E0PB 1XXFA 3NWUA 2P3FH 1ZSLA 3GCHB 1QNJA 1VGCC 2H5CA 2ODPA 1YCPK 3RXAA 4KELA 1ELDE 2BQ7B 1OKXA 1MZAA 1XUHA 1GBIA 3V12A 3LIWA 2H9TH 3QTOH 1Z8RA 3EAJA 2WV5A 4NA9H 5IDKA 1GI3A 1H4WA 3VGCB 1YPJH 2A7CA 5DJ7A 4Y11E 5L2ZH 4Q2KA 1HV7A 1SOZA 4PROA 6CHAC 2BY5X 1TGNA 3OYPA 2BHGA 4O03A 2PUQH 2XC0A 3OX7U 2PR3A 2VB0A 2VGCC 1UO6A 1GBHA 1SR5C 1IQGA 4XDEA 2OC8A 2PGBB 4GAWA 3BN9A 4IN1A 1QCPA 1ZSKA 2Z7FE 4JZFH 1ZMJA 2BQ6B 1MU6B 1QQ4A 1XX9A 3U8OH 4MNWA 4UDWH 3FANA 3CS7A 1FJSA 3SOSA 3QGJA 1NC6A 1C5YB 2F9UA 3A7XA 1AWFH 1D3TB 3RLYH 1ZMLA 1PPHE 3GY3A 4FUDA 4Y10E 4NWKA 1GMDF 4I31A 4BNRA 1J16A 4MPVA 2GKVE 1DSUA 4MLFB 2XBVA 1SHYA 3V0XA 1HAGE 4AOQA 5DP7A 1P2IA 3UOUA 4MVNA 4XFQA 4OS6A 3RMLH 4TPYA 2PHBA 2ZCLP 3F1SB 1THPB 1YF4A 4CH8B 5L6NH 1F92A 1L2EA 5LGOA 1ZYOA 1GHWH 1GJ7B 4HFPB 1OYQA 1P2JA 2G4UA 3BEFB 3LOXA 2FOFA 1EJAA 5IYTA 1LMWB 1O2SA 4IBLH 4ISOA 1IQIA 4O9VA 4DIHH 4X8SH 1MKXK
chains in the Genus database with same CATH superfamily
3HGNA 5EW2H 1ETTH 1EAUA 4FXGH 3SGAE 1MAXA 1MD8A 1A5GH 1GHAF 4Y7BA 3RXRA 4ZKSU 1XUGA 5T6DA 4KTUA 1CT4E 1FQ3A 1C2FA 1BMFD 1CT0E 3T62A 1ANCA 3UQOA 1IQNA 3V7TA 1EQ9A 3P17H 4Q7XA 1HJ9A 3HATH 1PPEE 3AAVA 3SU3A 1GHBG 1C4U2 1UCYH 3DFJA 1MMJN 1UTJA 1P03A 4CRCA 4YOGA 1ZRBA 4O3TA 2Y7ZA 3T27A 1LO6A 1O5DH 1JRTA 1AMHA 2A31A 2P8OC 3PRDA 2JH5D 5H4IB 3SO3A 2AMPA 3JZ2B 2ZCKP 5EW1H 1D6WA 3TK6A 1C1RA 4I8HA 3ZYDA 2JIZD 3FO8D 4ISLA 1EOJA 1KMHB 4B71A 2VNTA 2JJ1D 4GVUA 3SV6A 1GJBB 2ALPA 1AI8H 1YPLH 2KCPA 1F0TA 3KEEA 2BY7X 9ESTA 1H8HD 3SV2H 1ESTA 1ETRH 1BRCE 1PPBH 5FPYA 4MG3A 2R9PA 1QBNA 4X1PU 1WXRA 3JZ1B 1XUKA 3SNEA 1HJ8A 1HB0B 1AKSA 5EOKA 4F4OC 2VJ1A 1IQLA 1QBVH 3RXSA 1HRTH 2IOTA 1C5OH 3ZZCA 3KQCA 1SGTA 1O38A 1C2MA 4K2YA 3G01A 1RTKA 2OUAA 1UTOA 2D2DA 1O5BB 3AW1A 3F2FA 3EQ0H 2TGTA 2J4IA 5TCAA 1L0ZA 1RRKA 1O3IA 1SL3A 3ODDA 4K8YA 1DITH 2WUBA 3PV2A 1OWDA 1P01A 3F0PA 2JDID 2GVFA 1N6XA 1G37A 2KCYA 1AIXH 2OXSA 2EY4C 1SI5H 3MU5A 1QGFA 1TALA 3PTBA 3T25A 1S0RA 1AE5A 3LH1A 3H7TA 3O8DA 3SNBA 2AMQA 3A8DA 4MNVA 2F43B 4ZCNA 3I29A 1O2PA 3SI3H 3ITIA 1ANBA 3PTNA 3F9EA 4I8LA 1OOKB 1SGDE 4RI0A 1O36A 4FU7A 1VITH 1G3BA 3ZVAA 1SVPA 1XVMA 4NSVA 5JDUB 3QN7A 1C2EA 4UONA 2Z9IA 3MH6A 2ZFFH 4GSOA 1W7GH 2B8OH 1FDPA 1GI7B 3S69A 1K1IA 2BY6X 2FS8A 2FYRA 2IN2A 1BMLA 4Y7AA 2Q6GA 3RC5A 1L1JA 2C8XB 3P8FA 4Q4LA 4WH8A 3SGBE 4VGCB 2GMTB 2PGQB 4OS4A 3ELAH 1J15A 1EOLA 2XW9A 2K8IA 1AB9B 6GCHG 1L1NA 5BRRE 2F9OA 2BDGA 3FZZA 1P2OA 4XD7D 2Z3EA 1G9IE 1LTOA 2M2AA 1MBQA 1YLCA 1SG8B 4FOUC 2A4RA 1YLNA 2OQUA 4ACBA 1CGJE 1A7SA 4TWYA 1QJ7B 3P70B 5G4BA 1MCTA 4X2WA 3RXLA 4INKA 2J38A 1NRNH 1GDNA 4B2AA 1LPZB 4HTCH 1YPGH 2O9QA 1PJPA 5FPTA 3TH3H 5B6LA 5DGJA 5BPEA 3URDA 2W26A 4MPWA 2ZPSA 5EIYA 3VG8A 2BDIA 1MTVA 4B6FA 2VIWA 1UTQA 1CQQA 1ELGA 1C2IA 4OS5A 3ZVCA 1C2KA 1GMHG 2TRMA 3MH7A 4K1TA 1GPZA 3N99A 1F5LA 4Z1MD 2ZGHA 2FLRH 7KMEH 1VITF 2FI3E 1WDIA 3F9GA 2FMJA 2Z94A 5K0HA 1N8OB 3SUFA 3V13A 4AORA 2NU3E 2ZCHP 3OE7D 3NZIA 1Z1IA 1G3CA 5AFZH 3LJOA 4BTUB 1IQEA 1C1UH 2BVRH 5FAHA 1DVAH 2HVYB 5T1VA 4U30A 4E06H 1TNKA 3IITA 2W6ID 4R8TB 2WZQA 2H9EH 2BDYA 3SNCA 3U8TH 5EQQA 2WYJA 1O2OA 2VIOA 1ID5H 2FPZA 4X6PA 1VZQH 1OWEA 2F9VA 3SBKA 3GCHC 2ZP0H 1CA0B 3A89A 3D23A 1RD3B 3SGQE 2AS9A 1C4Y2 4YO9A 2AYWA 1KXAA 1TBQH 4Y8ZA 1MQ6A 5JBTA 1FN8A 1RIWB 2ZHFH 3RXGA 1P3CA 2TIOA 3PM3A 1TPPA 4XBBA 1O2UA 1HAZB 3RC6A 1A4WH 1FAKH 2G5VA 3VGCC 5GCHG 3M3TA 1G3EA 1LVOA 3O8CA 3GS9A 5E2OA 1T4UH 1THRH 2RA0A 2M5TA 1BBRH 1K2I1 4Y0ZE 8ESTE 2BY8X 1NS3A 1XUFA 1SQOA 1V2JT 2XYAA 1D9IA 2RDLA 2Y81A 5GJ4B 1LHGH 2VH0A 3QUMP 3AAUA 5CE1A 1LHDH 3KGPA 4AGKA 4TSFD 1TX8A 2A2XH 2VWNA 3KYGA 2Y82A 3MNBA 3BSQA 5FHTA 2ANWA 3SU2A 1C1TA 1GBJA 4B75A 5A0AE 1O2NA 2C93B 5T6FA 1Z8JB 3A7TA 1TPAE 2PKSB 1O33A 1P57B 3K6YA 1HNEE 1HPGA 1MH0A 4MPUA 2W3KA 1PPZA 1DY8A 4FUJA 5TCCA 1OYTH 4WY3A 1XXDA 2OINA 3F2HA 4XE4A 1IHTH 2YMSB 5K7RA 2PSXA 2VIDA 3U98H 1P2MA 1H9HE 1C5TA 2CMYA 3CP7A 3PV5A 1DSTA 3BTFE 3OTJE 2Q6DA 3UR6A 3QX5H 4Y8XA 1BTPA 3H5CB 1AVWA 2XCFA 2FZZA 1BTXA 1JOUB 4Q7YA 2PW8H 2VWOA 2ZGXH 3MQKC 2BOKA 2WINI 3S9AA 1ZHRA 1NFXA 1O39A 1DUAA 1BT7A 4XBCA 4GCHG 1D4PB 3UNSA 2A0QB 2GV6A 2BMGB 1TBRH 1JMOH 3GCNA 2VVUA 3URCA 4CBOA 3OEED 1K28D 1K1MA 1NO9H 3ZVGA 4ZXYH 3GY2A 2F83A 1B7XB 3F9HA 2GCTB 4Q80A 5LH8A 1KTSB 1V2ST 1UVTH 2HRVA 2WPKS 2ZDLA 2YNBA 4K60A 2XBXA 1Z71A 4F48B 1GMCG 3SU6A 5CMXH 1UK4A 1O3KA 5GWZA 2ZHWH 3VB4A 2G00A 3QO6A 1G2MA 3SQEE 1BDAA 1S83A 4X8TH 2HGTH 3H7OA 2KR7A 4M9FA 2SGQE 2BYAX 3I78A 1DXWA 3T26A 1EJMA 1GHYH 3TJOA 1UVUH 5FX5A 1O32A 4CRBA 2BD4A 3FVFB 1O3OA 1QTFA 4YLUA 1P9UA 1NN6A 1ZGIA 2A5AA 2XCNA 1SQAA 3A7VA 2SGFE 1ZJKA 2FYQA 1QA7A 2THFB 3PV4A 1A0HB 1BTZA 1OWJA 1O2HA 1OS8A 3SZEA 2OP9A 4FUFA 3RU4D 5HYOA 2TGAA 4INLA 2WUCA 3VB7A 4TPIZ 1V2TT 1FLEE 3A86A 1YPHE 4JK5A 5C1YA 1HAVB 1LVBA 1MUEB 1QY6A 1O5EH 4AFSA 3RLWH 1KLIH 1KXEA 5DP4A 3OTPA 1BQYA 1GBCA 3T29A 1TGSZ 1ZGVA 1IQMA 1AY6H 2XNIA 2UUYA 1TNGA 2O8LA 1UTPA 1S5SA 1XVOA 5JYIA 1GL1A 3RU4E 3NRLA 2OBOA 2BLOA 1SQTA 4NWLA 1A61H 1Y5AT 3LKWA 4F49A 5E0HA 3GY5A 1V2MT 3S7HB 2OC0A 1EASA 5TJXA 1C1WH 2QIQA 1B0EA 2O8WA 3D49H 1O3NA 1E34B 4KTCA 4YOJA 1RJXB 3PRBA 1XKAC 2Q1JA 3TK9A 1DS2E 6LPRA 5DP9A 2G55A 4Y8YA 1S6FA 4K8BA 4FVDA 4IMQA 3A88A 3EGKH 3QWCH 1NTPA 3TJNA 1V2OT 1O3JA 2QF0A 3EE0B 1RXPA 3SQHE 1WAYB 3LGVA 3GICB 1LQDB 2BZAA 1AVXA 2YMSD 4AYYB 1KTTB 4AFQA 1S0QA 1SGEE 2LNCA 3WW7A 2ULLA 2OC1A 1QIXB 4FETA 3A85A 1AO5A 1PQ5A 3MTYA 2A32A 2KCAA 1UVSH 2C8WB 1NRSH 3KL6A 3U28C 1ELBA 1F5KU 3I77A 1HXFH 3Q76A 4NIYA 3F6UH 1GGDB 3MMGA 1GI4A 1DWBH 3A87A 4FUBA 1BOQA 3HGPA 5AHGH 2BZ6H 3FN8A 1G3DA 4FUGA 4RT1A 4WVPE 2XC4A 1ZTLA 4TWWA 4VGCC 2PSYA 2GMTC 2AH4X 3UUZA 2ZHEH 1T31A 3TIUA 3MU0A 1BTYA 3B9FH 4FVBA 1HGTH 5FCKA 2BY9X 1AB9C 4ISHH 3KF2A 2QXIA 1HJAB 1ANEA 1LCYA 3L3TA 1AUJA 1BJUA 1TNHA 1TB6H 2HALA 4OS2A 1G30B 5DP3A 1NRQH 3UOPA 1QJ1B 1ESAA 5EQRA 1HAOH 1L1GA 1UMAH 2H6MA 1WU1A 1MU8B 4GHTA 1H8IH 1W0JD 1O2ZA 2PUXB 1FIZA 5A0CA 1CT2E 3OY5U 1SGFG 1GI6A 2BX4A 3Q3KA 3STIA 1VCQA 3ZZAA 1OXGA 1O3EA 2GDDA 3DSPA 2OLGA 3CNRA 4X1QU 3M37A 3VB5A 1C5SA 1ZTJA 4CRGA 2BM2A 2FOCA 2ZHDA 3M7UA 1W12U 1FXYA 3TGJE 3GDUA 3EE7A 3AW0A 5A0BA 1UCYE 3U9AH 1OSSA 3AK5A 1S85A 1BMAA 1N8OC 1LHFH 3BTDE 1HAHH 4TYDA 1KY9A 2Z9GA 2ZFQH 5T3HA 1VKYA 5B6OA 3A84A 1GL0E 4OGXA 3F68H 3RXIA 5C5NA 1GBLA 3ATMA 1FPCH 1FAXA 1FMGA 1GJ8B 1Q3XA 3M5OA 1PQ7A 1TLDA 1MKWK 4JYTA 2PKAB 4R0IA 1BMMH 4ZHLU 1BMNH 1TFXA 1KXFA 2J97A 1K21H 1O3DA 1WOFA 2FLBH 4X2VA 4YT7H 1ELVA 1YPHC 1CA0C 3GYMA 1TX7A 1EUFA 3RXBA 2Y5FA 4ABAA 3UQVA 1F0UA 1RS0A 2GZ9A 1C2JA 1RIWC 2J5UA 2WYGA 2NU4E 1PQAA 1T32A 1PPFE 4D8NA 3MHWU 5DP6A 1H8ED 1OPHB 5HM9A 1DE7H 2J2UA 3RXPA 1A2CH 1KXBA 1PPCE 1V2NT 3SN8A 1GMDG 3ATKA 2RFKC 1HDTH 1W0ZU 3ZZ7A 4ZUHA 1GI2A 3RXKA 4ZKRU 3TH4H 1O2QA 4JYUH 3BTEE 3RXEA 4JCNA 1SPJA 3LGIA 1J17T 2RDEA 1K1NA 2D8WA 4BTTB 1C2HA 1BRBE 1GHZA 1L4ZA 5AF9H 1TGBA 3T5FH 2LPRA 4JZDH 4WF8A 4A92A 1UJ1A 1NM6A 1W2KH 2SNWA 4ZKOU 1FY4A 1HYLA 2CHAB 3QK1A 3TGIE 1GI5A 2PKSC 3MI4A 3PO1B 4HI3A 1ELEE 3EA7A 2QC2A 1TRMA 3E0NB 8LPRA 3U1JB 3Q3XA 3CENA 3DA9B 1GG6B 2ZFSA 1FIWA 4ACAA 2AIQA 2ZECA 5AFYH 2ZGCA 3NXPA 5T6GA 2ASUB 2UUFB 1ACBE 2YMSC 4MQAA 2OQ5A 2FTLE 2A5IA 3S9CA 2QA9E 3SORA 1UK2A 2O8TA 1AU8A 5KECA 1TRYA 2ZIQH 4UFFH 4OGYA 2BLVA 1AUTC 1C5QA 3A8CA 4Y71A 1AFQB 3ZZ9A 3OSYA 3A8AA 1C5VA 1AD8H 4DJZB 3PWBA 3K9XB 2V7QD 1WBGB 1GCTB 1K22H 1XKBC 3ZZ4A 3R3GB 3BTHE 4MDSA 1TNLA 1C5NH 2FOHA 5EPYA 3M3SA 4ABIA 1T7CA 3KIDU 2J34A 4BOHA 5A8ZA 1P12E 8KME2 2DUCA 4FUHA 3MNXA 2QF3A 4B6EA 3BTKE 3GCTF 3ZZBA 1GJ6A 2J94A 3BG4B 1A46H 3S7KB 1A0LA 5I25A 2GCTC 2B7DH 1JIRA 4SGBE 4TY6A 4AX9H 3RXCA 1CBWB 2HVXA 2F91A 3TLOA 2QCYA 2HNTF 3M3VA 1DICA 8GCHF 3BIUH 2WHXA 3P8NA 3RXDA 1FX0B 1NRRH 1EFRD 5J4SA 5C67A 3BIVH 1MBMA 1YWUA 1ZLRA 1VJAU 2VH6A 2R0LA 1QL9A 3E8LA 2R2WU 1HIAB 1EXFA 4YXWD 2ZO3H 3M7TA 1JBUH 4BAMB 3CS0A 3BF6H 2BD9A 1GBBA 3RM2H 1UK3A 2GV7A 2FOMB 4P00A 2ZI2H 2I6QA 2TPIZ 4ABHA 1GBKA 1CO7E 2JKHA 5EODA 3SW2B 1TABE 4ABGA 1H9IE 2ZGBH 2WPLS 2EC9H 4D9QA 1JXPA 1JWTA 1ZOMA 2OCVB 4ASUD 3SJIA 1T8LA 2ZTXA 1D3PB 2BDAA 2NU1E 1W14U 2ZEBA 2W7SA 5C0TA 3M5MA 2ZZUH 1IHSH 3E1XB 1BTWA 2SGAA 3UY9A 1UVPA 3ZYEA 1HUTH 2V0BA 1Y5UT 5C5OA 1UTLM 2P3UB 1GBEA 1V2LT 2R3YA 4ISNA 2LP6A 1TYNA 1ELFA 1KLTA 1EB2A 2FX4A 4LZ4B 1BBRE 1OWIA 1AN1E 4DIIH 3KCGH 1K0HA 1Z6EA 1CSOE 3UPEA 2VWMA 1TAWA 4J2YB 3MU1A 2A4QA 3O8BA 4MNXA 1K1OA 1WYKA 4ISIH 4CR5A 1O3GA 4IS5A 4FUIA 1TIOA 3FZDA 5EQSA 5F53A 1EAIA 2TGPZ 3KHVA 1BHXF 5GXPA 1GHXH 3K2UA 2CK3D 1TQ7B 3DHKH 1PYTD 4WMEA 3UTUH 3LT3A 1NZQH 1SHHB 2BD8A 1GVLA 1P2NA 2WV9A 1QA0A 1C5LH 1DANH 1GJCB 4DT4A 4ZAEA 5HGGA 3VXEH 1QL7A 4WJG2 5HM2A 3PROA 2QYIA 4X0WU 1UHBB 2VU8E 1L4DA 1WTGH 3Q00A 2NU0E 5F8XA 5EPNA 4JYVH 1NU7B 2ZDKA 4AN7A 2L74A 1HAYB 1K1PA 3OY6U 1KSNA 3RU4T 3BEUA 1GGDC 1C5RA 2GX4A 3RUOA 1TPOA 4Y6DA 1OP8A 1PFXC 2ODQA 3W94A 1YCPH 1TE0A 3ZZDA 4UEHH 3UB0A 4XSKU 1Q31A 1YP9A 1S6HA 1TA2A 2XXLA 3AASA 3U69H 2ALVA 2CV3A 2GD4B 5DSFA 4K3JA 4CREA 1OHHD 2OK5A 1VITG 1SLXB 2QN5T 2B9LA 4O3UA 3ZZ3A 1V2KT 1HJAC 3HKIB 1DDJA 3F3BA 2EQNA 3A7WA 6ESTA 5FCRA 1TNJA 1K1LA 1O2KA 1UCYK 3F9FA 2ZU3A 5GDSH 1SGIB 1ZRKA 2HOBA 3MNSA 4RKOB 3LC3A 1EAWA 2V3HH 4NZLA 5A8XA 4TT3D 2ZNKH 2D1JA 3P8GA 2R3UA 1TX6A 1NT1A 2A1DB 1FY8E 1GDUA 2ZTZA 1FPHH 1BCUH 2FIRH 5DO4H 3P6ZB 2AFQB 5HXFA 1EP6A 1INCA 2DE8A 2F9NA 2G4TA 3QDZB 1VCPA 2FS9A 2ZWLH 5JB9S 3N7DA 4DURA 2QF4A 2AGGX 5E0JA 3ZVBA 1ARBA 1TOCB 2A2QH 1W8BH 1SGCA 1FONA 2FI4E 4DT7B 4RSPA 2Y5HA 4B2CA 4CR9A 1FY3A 3KNXA 3LC5A 3OAAD 1GMCF 4BXSA 2ANYA 4DCDA 4A6LA 1C2DA 1DLKB 4ABEA 4B76A 1KLJH 1MTSA 5FX6A 3PMBB 3GISB 4X8VH 1FN6A 1Y3XA 2W7UA 4HZHA 1C5MD 3W1EA 3C27B 1HAPH 1DWCH 2GCHG 2Z3DA 1P04A 2BVSH 7GCHF 5JBAS 1W13U 3E6PH 1CHGA 3M35A 2FO9A 3LGUA 1BZXE 2QXGA 1A5HA 1P02A 2AGEX 1T8MA 2PTNA 1P06A 2BDCA 5EG4A 1GI0A 1O5CB 1O2TA 4ABBA 3RMMH 2KCOA 1MKXH 1O3LA 4WMFA 4NGAH 2ANMH 2R2MB 4ZMAH 5LPFA 2EA3A 4AC9A 4ESTE 1EX3A 1DY9A 2FM2A 2IJD1 3SUDA 1ZMNA 4DGJA 1K9OE 1GVKB 1GVZA 2WPJS 5GNDA 1G36A 2C8YB 1IQKA 4UFEH 1WV7H 3AVZA 1SGPE 1UW7A 2FP7B 2EI8A 2Y7XA 5LPEA 1SGYE 1YKTA 4GPGA 4I8GA 3PMJA 1YPKH 2GZ8A 4LZ1H 1Y59T 5EXMA 5E2PA 2A4GA 1OP0A 1DXPA 1M9UA 3TK5A 4MNYA 4H6TA 1O34A 1Y8TA 1NPMA 1XUIA 4JZEH 7ESTE 1ZHPA 2G5NA 4AB9A 2HPQH 5CDFE 1O2GH 3DSGA 2Y80A 1C5XB 1UTKA 5I46H 3PLBA 2BLWA 3E91A 1MAYA 5C2ZA 2ZU5A 2Z9LA 3LGTA 3PO1C 3FOAA 1GG6C 1NY22 2O8MA 2BTCE 4A1TA 3VB3A 1PYTC 1LVYA 2IJOB 1ELCA 1X7AC 1J14A 1LQEA 2WPDD 2WPIS 1QURH 4NZQA 1O2YA 2WPMS 4Y76A 1TNIA 1J9CH 1E0FD 1EJNA 1MTNB 4IMZA 3Q3YA 4ABDA 3P92A 2F3CE 2YOLA 2SGEE 1EZUC 1SOTA 2PKAA 3UNRA 1KYNA 1TOMH 2C4FH 1IAUA 1FI8A 4IC5A 3PLPA 1O31A 1C4V2 1BUIA 3ZVDA 2JETB 4E7RG 1C1PA 3IWMA 2STBE 3VFEA 1FUJA 4O97A 2FESH 1C5WB 3TNSA 2ZDVH 1DUEA 1YY3A 4DW2U 1GCTC 4KP0A 1SKYE 3D65E 2ZC9H 1ABIH 2PLXA 1O2RA 1ZPCA 3U1IB 3SU0A 5KEDA 3QGNB 1GJ4H 2IPQX 2FXRA 4ZKNU 1RFNA 3SJKA 2BX3A 1F2SE 2CN0H 2H9HA 1SMFE 4AGJA 1YBWA 1CHOG 3SHAH 2BXTH 5LPRA 1O5GH 3BG4C 3PYHA 3UFAA 1GJ5H 1E37B 5A09A 1H9LB 2ZU4A 3MH5A 2HWLB 1P05A 3BG8A 1CBWC 1NFWA 2F4LA 2OTVA 2Z6BD 2XRCA 3ATIA 2CF8H 1F0SA 4X1NU 1ESBA 2I6SA 1O2LA 1D3QB 1QRXA 2HPPH 4NIXA 4ZROA 5C1UA 1GBAA 4H6SB 2J98B 4X8UH 3MWIU 1O0DH 4SGAE 1CA8B 1Z8GA 3WY8A 4DG4A 1ZR0A 1P8VC 2C3SA 2SGDE 3RXOA 3K65B 4YESB 4AFZA 2ZG0H 3PMHB 1T8NA 1ABJH 1DM4B 3V3MA 7LPRA 3SI4H 1KDQB 1P0SH 5EJ1A 1EZQA 4U32A 4XBDA 2VIPA 1O3PB 3ESTA 1EZSC 3LU9B 9LPRA 3A80A 4RT0A 3SU5A 4K69A 2A7HA 1GHVH 2ZGJA 1BBRK 1C9PA 4KKDA 4D7GA 3MU4A 1VJ9U 2ZPRA 1QFKH 3A8BA 1W3CA 2VIVA 2Y5GA 2EEKA 1ETSH 2JJ2D 1NBMD 2QAAA 1O3AA 2O8UA 4BANB 5FXLA 5HIZA 4X1RU 4LOYH 1IQFA 2QXJA 5FBEA 2B5TB 2J95A 1TGCA 1HBTH 5C1XA 2ZFRH 3ENSB 2KAIB 4NA8A 1TGTA 2FOBA 1A3BH 2ANKH 4KTSA 1LPGB 3UIRA 1HLTH 1V3XA 3P8OA 1NBME 4JK6A 4ZHAA 1O3HA 2AERH 3GY6A 1P2QA 1E35B 3Q77A 1S84A 1GJ9B 1BITA 5C17A 1AHTH 1C5ZB 1MD7A 2SFAA 3MH4A 4RKJB 3ZV8A 2VVVA 1Y5BT 2RCEA 1DWDH 2V3MA 3BTQE 2FOGA 3SHCH 1GHBF 1NROH 1V2QT 4HG6A 1CGHA 1QBOA 3MO3A 2HNTE 4B74A 1V6DA 2WV4A 1S81A 4H4FA 1Z1JA 2ZQ1A 3T2NA 5F6MA 4D76A 3B23B 3PB1E 1SGFA 1HFDA 1O5FH 1WUNH 3KQEA 4Q63A 5FBIA 3ZIAD 4I33A 3OU0A 1QB1A 3HK6B 4AZ2B 2VIQA 1CU1A 1E79D 4H42U 2FWWA 5CHAB 3ZVFA 2VVCA 3HKJB 1UVOA 2ZPQA 4OM9A 2W6JD 1HIAA 3RM0H 3TJUA 3R0FA 3RXUA 1ZJDA 5HMAA 1IOEA 1TWXB 2Y6TA 2V3OH 3O8RA 3RMNH 4ASHA 1C1MA 4GUXA 1TMBH 1THSH 2PTCE 2YNAA 1DT2A 4Q7ZA 2GJGA 1Y3YA 3D62A 1AQ7A 4DVAU 1H1BA 1W7XH 3F2GA 3SJOA 3LDXH 3UWIA 4B73A 1CVWH 1EPTB 3NKKA 3N7OA 1GI1A 3FFGA 4DY7B 3VB6A 3MU8A 1A0JA 2GDEH 1T4VH 1BTUA 3MO6A 2ZDMA 3EYDA 2EI6A 1SB1H 1V2VT 2AMDA 3SU4A 2QY0B 1O3FA 1NU9A 4YM9A 2XBWA 4CRDA 2GTBA 2IPHA 1O3CA 1Y3UA 3DUXH 1Z8IB 1LPKB 1GCDA 1QRWA 3BTTE 3LPRA 4CHAB 2K0QA 5CHBA 4JMYA 2SNVA 3SV7A 1C5UA 2AGIX 4OS1A 1GHAG 4U2WA 4MPXA 1H8DH 2CXVA 5L2YH 1F5RA 3NPSA 3K6ZA 4I8KA 4AG2A 2P93A 1HCGA 4X6NA 2AHME 5J4QA 3WWFA 3ATWA 5JBCS 4A1VA 1W10U 4TY7A 4KGAA 1GBFA 4ABJA 1VR1H 2P3TB 2XTTB 2PP6A 1UHBA 1MTUA 3E16B 4QT8C 1VCWA 1ZPZA 5EGMA 2BD3A 4FU8A 1V2PT 1NFYA 3GYLB 4ABFA 2FX6A 1E1RD 4THNH 2W5EA 1PPGE 1SC8U 1O3MA 1TMUH 6GCHF 2W3IA 1AE8H 2R0KA 2HLDD 5HIYA 1SFIA 4X2XA 3A83A 3STJA 1YM0A 1MTWA 3PMAB 1DLEA 1SGRE 1QHRB 4UE7H 1OWKA 5GPIB 2GT8A 1Z6JH 1ZZZA 1LHEH 2Q6FA 2SGPE 4NG9H 1HXEH 1P2KA 3U8RH 3NCLA 1DX5M 1PQ8A 3NK8A 2B0FA 4E7NA 5AVDA 2KX4A 3S0NA 2AEIH 1G2LA 3B8JA 2WSSD 1W0YH 2P95A 1O3BA 2ESTE 1C9TA 5F8TA 3SNAA 3KQBA 4XRNA 1N6YA 1MCVA 3SUGA 4FU9A 1VGCB 1FY5A 1BJVA 1CE5A 1GMHF 2P59A 2QGRA 2RG3A 2UWLA 2C90B 4HGCA 4DOQA 4IGDA 4BAKB 1ELTA 1S6LA 2ODYB 2K1QA 4A5TS 3FAOA 3LONA 2QXHA 3GDVA 5DP8A 3C1KA 1W11U 4IC6A 5HKKD 2PV9B 2Z3CA 5L30H 2LELA 3SYJA 2HNTC 4CRAA 2F9BH 2ZFPH 2A7JA 4B2BA 3ODFA 2ZDAH 2G81E 1YCPM 3GOVB 3DFLA 3GY4A 1V2RT 3P95A 1O2WA 1SBWA 3MO9A 4ZH8A 6CHAB 2NWNA 3LGWA 2OBQA 5C20A 2UWPA 1EB1H 3WWBA 3VEQB 3TH2H 2F9PA 2G51A 3SNDA 3E3TA 4A1XA 4CBNA 3RXHA 2V6NA 2XWAA 2AIPA 5FL7D 2PWXA 1WQVH 2VGCB 5GIBA 3GCTG 4FUCA 3GY7A 2VWLA 2QE7D 3LJJA 1BB0B 1MTNC 1DOJA 1QL8A 3RXMA 2ZF0H 1G32B 4UFGH 1FZZA 2FOAA 1BIOA 1AWHB 5DP5A 8GCHG 1LKBA 1SLWB 1WQSA 1YC0A 3KN2A 1Q2WA 2FODA 2JETC 3RMOH 5ABWA 1DPOA 2G8TA 1C1OA 1NRPH 1EAXA 1A3EH 2FOEA 1OP2A 1S82A 1LKAA 2BVXH 2UUJB 5GCHF 2H1UA 1BRAA 2FI5E 2ZQ2A 1HAXB 3LH3A 2STAE 1RTLA 2J92A 4ZHMU 3RDZA 3BEIB 5F8ZA 5A2MH 3KQ5A 3RXVA 2VINA 1QJ6B 3M5NA 1GBMA 1XMNB 4D7FA 4Z6AH 2ZA5A 1CGIE 1AVGH 1IQJA 2KZ4A 2VBCA 3BTME 3FP6E 2ILNA 4NIVA 3FP8E 1JIMA 4BXWA 1AKSB 3OFND 1N1LA 3N7EA 2FDAA 4UD9H 1AZ8A 1KIGH 3L33A 4K5ZA 3UNQA 1GI9B 2BDHA 3VXFH 1NFUA 1BRUP 3BTGE 3QZRA 2D26C 4K1SA 4CRFA 2PFEA 4JZ1A 1O2JA 2ZHQH 1LHCH 3MNCA 3TGKE 2DE9A 5EXNA 4E05H 1EP5A 3BTWE 5ESBA 1TMTH 4BAOB 2GGVB 2RA3A 1P9SA 1QB6A 2JH6D 1AFEH 1C1SA 2ZU2A 1BTHH 4K1EA 1LDTT 4GHQA 4NIWA 1HAVA 4P02A 2Z9JA 3BV9B 4NA7A 1C2LA 4YOIA 3A7YA 3A82A 1C1QA 2GCHF 3EA8A 1YPEH 1SFQB 2ZFTA 2V35A 1YLDA 5C94A 1YGCH 3IG6B 4X1SU 3W95A 1IQHA 1P09A 3RC4A 3ZV9A 1RGQA 3F0OA 4FUEA 3PLKA 3DT0H 4WMDA 4GCHF 1O37A 5C3NA 4NSYA 2P8OB 1SSXA 2P94A 1B5GH 2BD2A 1A1RA 4AG1A 1Z7KA 1NESE 1O2IA 4U01A 2ZU1A 3TITA 4ZXXH 3SV9A 4WH6A 2H2ZA 4A7IB 4Y79A 4WWYA 1D3DB 1GBTA 1TPSA 1A5IA 1ZPBA 3GDSA 3ZVEA 2BD7A 2ZTYA 3SV8A 1TRNA 1TBZH 4UFDH 1J8AA 1AGJA 4IN2A 5ETXA 2WPHS 1C1NA 3NUMA 1MQ5A 5PTPA 4Y0YE 1SQRA 1LVMA 3QTVH 1XUJA 2XBYA 3SJ9A 2BDBA 5JPMH 1AZZA 1QR3E 1UTMA 4BAHB 2J98A 1O30A 1O2VA 5KGOA 2A45B 5A8YA 5E0GA 2A5KA 2FEQH 2XWBI 3HPTB 5E8EH 3RXTA 3UWJH 1MKWH 1GI8B 5JB8S 1O35A 1KDQA 3TPIZ 5CHAC 2BXUH 4WXVA 4AB8A 3L6PA 2C8ZB 3H09A 1SGNE 1WSSH 4BAQB 3QZQA 3TJVA 3DD2H 3RXJA 4XOJA 5DK1A 3SJ8A 2OD3B 1FNIA 3MFJA 4D9RA 4AFUA 2BLQA 1DWEH 4OS7A 2CF9H 1E38B 4RN6A 3GCOA 1GWAA 4CH2B 3SUEA 4NCYA 1F0RA 1ZTKA 4NFFA 1EKBB 2UWOA 1U6QA 2QF5A 1TONA 3EA9A 1HAIH 1EPTC 1P3EA 2TBSA 4Z0KA 2TGDA 1ANDA 1YPMH 5DPAA 3RXFA 2KAIA 5DG6A 5F03A 4J1YA 4JZIA 3VPKA 4BTIB 2L6OA 5ESTE 1C5PA 2UUKB 3S9BA 1F7ZA 4M7GA 1V2UT 4INHA 2QV1A 4I8JA 3LGYA 7GCHG 3PWCA 4I32A 1O5AB 1BA8B 2CHAC 3MOCA 1ORFA 4LK4A 3RP2A 4GLYA 4WXIA 3UREA 1Y3VA 4YT6H 3TU7H 3E90B 4CHAC 3ATLA 1GDQA 1MZDA 1SLUB 4AYVB 1KXCA 2G52A 1EZXC 2CGAA 2Z9KA 3FP7E 4LXBH 4NFEA 1CHOF 1GJAB 4X6MA 1GJDB 1XM1A 1EATA 2XOKD 1QZ8A 3TNTA 1D6RA 3SU1A 1QRZA 1V2WT 3GY8A 1ZSJA 3QLPH 5FPSA 2A4OA 2P16A 1COWD 2OC7A 1DFPA 1W0KD 1QB9A 3T28A 4YTAA 1ELAA 4X6OA 2BD5A 2CJIA 4IW4E 1AFQC 3ZZ8A 3UR9A 3ZZ6A 5C0UA 1JRSA 3M61U 1P11E 2GZ7A 3M5LA 1OX1A 5EXLA 1ZHMA 3A7ZA 1C1VH 4F55A 1ARCA 5EJZA 1YYY1 2EI7A 3FKSD 1SGQE 1WCZA 3A81A 4YZUA 2HLCA 3KQDA 2H5DA 3MYWA 1KXDA 2GT7A 1O2XA 1P10A 4YLQH 3ZZ5A 1T8OA 1E36B 4MTBA 1C2GA 1QQUA 1MABB 3SZNA 1SLVB 2XC5A 1FV9A 2JH0D 2BQWB 2BOHB 1TQ0B 2ZKSA 1TA6A 1GBDA 2GP9B 5JBBS 3RXQA 3M36A 1Y3WA 1O2MA 1UTNA 2J9NA 2BB4A 1RTFB 2NU2E 3TVJB 3M7QA 3EDXB 4X2YA 1EPTA 5DKMA 1K1JA 1B0FA 1FY1A 1WTHD 1OWHA 1BHXB 4I7YH 2ZDNA 2FTMA 4B1TA 3HK3B 5EU8A 5SGAE 3E0PB 1XXFA 3NWUA 2P3FH 1ZSLA 3GCHB 1QNJA 1VGCC 2H5CA 2ODPA 1YCPK 3RXAA 4KELA 2KM0A 1ELDE 2BQ7B 1OKXA 1MZAA 1XUHA 1GBIA 3V12A 3UAIC 3LIWA 2H9TH 3QTOH 1Z8RA 3EAJA 2WV5A 5EJLA 4NA9H 5IDKA 1GI3A 1H4WA 3VGCB 1YPJH 2A7CA 3DSOA 5DJ7A 4Y11E 5L2ZH 2XNDD 4Q2KA 1HV7A 1SOZA 4PROA 6CHAC 2BY5X 1TGNA 3OYPA 2BHGA 4O03A 2PUQH 2XC0A 3OX7U 2PR3A 2VB0A 2VGCC 1UO6A 1GBHA 1SR5C 1IQGA 4XDEA 2OC8A 2PGBB 4GAWA 3BN9A 4IN1A 1QCPA 1ZSKA 2Z7FE 4JZFH 1ZMJA 2BQ6B 4I86A 1MU6B 2KFWA 1QQ4A 1XX9A 3U8OH 4MNWA 1E1QD 3FANA 3CS7A 4UDWH 1FJSA 3SOSA 3KYFA 3QGJA 1NC6A 1C5YB 3DCLA 2F9UA 3A7XA 1AWFH 5IK2D 1D3TB 3RLYH 1ZMLA 1PPHE 3GY3A 5DN6D 4FUDA 4Y10E 4NWKA 1GMDF 4I31A 4BNRA 1J16A 4MPVA 2GKVE 1DSUA 4MLFB 2XBVA 1SHYA 3V0XA 1HAGE 4AOQA 5DP7A 1P2IA 3UOUA 4MVNA 4XFQA 4OS6A 3RMLH 4TPYA 2PHBA 2ZCLP 3F1SB 1THPB 3OEHD 1YF4A 4CH8B 5L6NH 1F92A 1L2EA 5LGOA 1ZYOA 1GHWH 1GJ7B 4HFPB 1OYQA 1P2JA 2G4UA 3BEFB 3LOXA 2FOFA 1EJAA 5IYTA 1LMWB 1O2SA 4IBLH 4ISOA 1IQIA 4O9VA 4DIHH 4X8SH 1MKXK
chains in the Genus database with same CATH topology
3HGNA 5EW2H 1ETTH 1EAUA 4FXGH 3SGAE 1MAXA 1MD8A 1A5GH 1GHAF 4Y7BA 3RXRA 4ZKSU 1XUGA 5T6DA 4KTUA 1CT4E 1FQ3A 1C2FA 1CT0E 3T62A 1ANCA 3UQOA 1IQNA 3V7TA 1EQ9A 3P17H 4Q7XA 1HJ9A 3HATH 1PPEE 3AAVA 3SU3A 1GHBG 1C4U2 1UCYH 3DFJA 1MMJN 1UTJA 1P03A 4CRCA 4YOGA 1ZRBA 4O3TA 2Y7ZA 3T27A 1LO6A 1O5DH 1JRTA 1AMHA 2A31A 2P8OC 2JH5D 5H4IB 3SO3A 2AMPA 3JZ2B 2ZCKP 5EW1H 1D6WA 3TK6A 1C1RA 4I8HA 3ZYDA 4ISLA 1EOJA 4B71A 2VNTA 4GVUA 3SV6A 1GJBB 2ALPA 1AI8H 1YPLH 1F0TA 3KEEA 2BY7X 9ESTA 3SV2H 1ESTA 1ETRH 1BRCE 1PPBH 5FPYA 4MG3A 2R9PA 1QBNA 4X1PU 3JZ1B 1XUKA 3SNEA 1HJ8A 1HB0B 1AKSA 5EOKA 4F4OC 2VJ1A 1IQLA 1QBVH 3RXSA 1HRTH 2IOTA 1C5OH 3ZZCA 3KQCA 1SGTA 1O38A 1C2MA 4K2YA 3G01A 1RTKA 2OUAA 1UTOA 2D2DA 1O5BB 3AW1A 3EQ0H 2TGTA 2J4IA 5TCAA 1L0ZA 1RRKA 1O3IA 1SL3A 3ODDA 4K8YA 1DITH 2WUBA 1OWDA 1P01A 2GVFA 1N6XA 1G37A 1AIXH 2OXSA 1SI5H 3MU5A 1QGFA 1TALA 3PTBA 3T25A 1S0RA 1AE5A 3LH1A 3H7TA 3O8DA 3SNBA 2AMQA 3A8DA 4MNVA 3I29A 1O2PA 3SI3H 3ITIA 1ANBA 3PTNA 3F9EA 4I8LA 1OOKB 1SGDE 1O36A 4FU7A 1VITH 1G3BA 3ZVAA 1SVPA 1XVMA 4NSVA 5JDUB 3QN7A 1C2EA 4UONA 2Z9IA 3MH6A 2ZFFH 4GSOA 1W7GH 2B8OH 1FDPA 1GI7B 3S69A 1K1IA 2BY6X 2FS8A 2FYRA 2IN2A 1BMLA 4Y7AA 2Q6GA 3RC5A 1L1JA 2C8XB 3P8FA 4WH8A 3SGBE 4VGCB 2GMTB 2PGQB 4OS4A 3ELAH 1J15A 1EOLA 2XW9A 1AB9B 6GCHG 1L1NA 5BRRE 2F9OA 2BDGA 3FZZA 1P2OA 2Z3EA 1G9IE 1LTOA 1MBQA 1YLCA 1SG8B 2A4RA 2OQUA 1CGJE 1A7SA 4TWYA 1QJ7B 3P70B 5G4BA 1MCTA 4X2WA 3RXLA 4INKA 2J38A 1NRNH 1GDNA 4B2AA 1LPZB 4HTCH 1YPGH 2O9QA 1PJPA 5FPTA 3TH3H 5DGJA 5BPEA 3URDA 2W26A 4MPWA 2ZPSA 2BDIA 1MTVA 2VIWA 1UTQA 1CQQA 1ELGA 1C2IA 4OS5A 3ZVCA 1C2KA 1GMHG 2TRMA 3MH7A 4K1TA 1GPZA 1F5LA 2ZGHA 2FLRH 7KMEH 1VITF 2FI3E 3F9GA 2FMJA 2Z94A 5K0HA 1N8OB 3SUFA 3V13A 4AORA 2NU3E 2ZCHP 3NZIA 1Z1IA 1G3CA 5AFZH 3LJOA 4BTUB 1IQEA 1C1UH 2BVRH 5FAHA 1DVAH 4U30A 4E06H 1TNKA 3IITA 4R8TB 2H9EH 2BDYA 3SNCA 3U8TH 5EQQA 2WYJA 1O2OA 2VIOA 1ID5H 2FPZA 4X6PA 1VZQH 1OWEA 2F9VA 3SBKA 3GCHC 2ZP0H 1CA0B 3A89A 3D23A 1RD3B 3SGQE 2AS9A 1C4Y2 4YO9A 2AYWA 1KXAA 1TBQH 4Y8ZA 1MQ6A 5JBTA 1FN8A 1RIWB 2ZHFH 3RXGA 1P3CA 2TIOA 3PM3A 1TPPA 4XBBA 1O2UA 1HAZB 3RC6A 1A4WH 1FAKH 2G5VA 3VGCC 5GCHG 3M3TA 1G3EA 1LVOA 3O8CA 5E2OA 1T4UH 1THRH 2RA0A 2M5TA 1BBRH 1K2I1 4Y0ZE 8ESTE 2BY8X 1NS3A 1XUFA 1SQOA 1V2JT 2XYAA 1D9IA 2RDLA 2Y81A 5GJ4B 1LHGH 2VH0A 3QUMP 3AAUA 5CE1A 1LHDH 3KGPA 4AGKA 1TX8A 2A2XH 2VWNA 2Y82A 3MNBA 3BSQA 5FHTA 2ANWA 3SU2A 1C1TA 1GBJA 4B75A 5A0AE 1O2NA 2C93B 5T6FA 1Z8JB 3A7TA 1TPAE 2PKSB 1O33A 1P57B 3K6YA 1HNEE 1HPGA 1MH0A 4MPUA 2W3KA 1PPZA 1DY8A 4FUJA 5TCCA 1OYTH 4WY3A 1XXDA 2OINA 4XE4A 1IHTH 5K7RA 2PSXA 2VIDA 3U98H 1P2MA 1H9HE 1C5TA 2CMYA 3CP7A 1DSTA 3BTFE 3OTJE 2Q6DA 3UR6A 3QX5H 4Y8XA 1BTPA 3H5CB 1AVWA 2XCFA 2FZZA 1BTXA 1JOUB 4Q7YA 2PW8H 2VWOA 2ZGXH 2BOKA 2WINI 3S9AA 1ZHRA 1NFXA 1O39A 1DUAA 1BT7A 4XBCA 4GCHG 1D4PB 3UNSA 2A0QB 2GV6A 2BMGB 1TBRH 1JMOH 3GCNA 2VVUA 3URCA 4CBOA 1K28D 1K1MA 1NO9H 3ZVGA 4ZXYH 3GY2A 2F83A 1B7XB 3F9HA 2GCTB 4Q80A 5LH8A 1KTSB 1V2ST 1UVTH 2HRVA 2WPKS 2ZDLA 2YNBA 4K60A 2XBXA 1Z71A 1GMCG 3SU6A 5CMXH 1UK4A 1O3KA 5GWZA 2ZHWH 3VB4A 2G00A 3QO6A 1G2MA 3SQEE 1BDAA 1S83A 4X8TH 2HGTH 3H7OA 2SGQE 2BYAX 3I78A 1DXWA 3T26A 1EJMA 1GHYH 3TJOA 1UVUH 5FX5A 1O32A 4CRBA 2BD4A 3FVFB 1O3OA 1QTFA 4YLUA 1P9UA 1NN6A 1ZGIA 2A5AA 2XCNA 1SQAA 3A7VA 2SGFE 1ZJKA 2FYQA 1QA7A 2THFB 3PV4A 1A0HB 1BTZA 1OWJA 1O2HA 1OS8A 2OP9A 4FUFA 3RU4D 5HYOA 2TGAA 4INLA 2WUCA 3VB7A 4TPIZ 1V2TT 1FLEE 3A86A 1YPHE 4JK5A 5C1YA 1HAVB 1LVBA 1MUEB 1QY6A 1O5EH 4AFSA 3RLWH 1KLIH 1KXEA 5DP4A 1BQYA 1GBCA 3T29A 1TGSZ 1ZGVA 1IQMA 1AY6H 2XNIA 2UUYA 1TNGA 2O8LA 1UTPA 1S5SA 1XVOA 5JYIA 1GL1A 3RU4E 2OBOA 2BLOA 1SQTA 4NWLA 1A61H 1Y5AT 3LKWA 4F49A 5E0HA 3GY5A 1V2MT 3S7HB 2OC0A 1EASA 5TJXA 1C1WH 2QIQA 1B0EA 2O8WA 3D49H 1O3NA 1E34B 4KTCA 4YOJA 1RJXB 1XKAC 2Q1JA 3TK9A 1DS2E 6LPRA 5DP9A 2G55A 4Y8YA 1S6FA 4K8BA 4FVDA 4IMQA 3A88A 3EGKH 3QWCH 1NTPA 3TJNA 1V2OT 1O3JA 2QF0A 3EE0B 1RXPA 3SQHE 1WAYB 3LGVA 3GICB 1LQDB 2BZAA 1AVXA 4AYYB 1KTTB 4AFQA 1S0QA 1SGEE 2LNCA 2ULLA 2OC1A 1QIXB 3A85A 1AO5A 1PQ5A 3MTYA 2A32A 1UVSH 2C8WB 1NRSH 3KL6A 1ELBA 1F5KU 3I77A 1HXFH 3Q76A 4NIYA 3F6UH 1GGDB 3MMGA 1GI4A 1DWBH 3A87A 4FUBA 1BOQA 3HGPA 5AHGH 2BZ6H 1G3DA 4FUGA 4WVPE 2XC4A 1ZTLA 4TWWA 4VGCC 2PSYA 2GMTC 2AH4X 3UUZA 2ZHEH 1T31A 3TIUA 3MU0A 1BTYA 3B9FH 4FVBA 1HGTH 5FCKA 2BY9X 1AB9C 4ISHH 3KF2A 2QXIA 1HJAB 1ANEA 1LCYA 3L3TA 1AUJA 1BJUA 1TNHA 1TB6H 2HALA 4OS2A 1G30B 5DP3A 1NRQH 3UOPA 1QJ1B 1ESAA 5EQRA 1HAOH 1L1GA 1UMAH 2H6MA 1WU1A 1MU8B 4GHTA 1H8IH 1O2ZA 2PUXB 1FIZA 5A0CA 1CT2E 3OY5U 1SGFG 1GI6A 2BX4A 3Q3KA 3STIA 1VCQA 3ZZAA 1OXGA 1O3EA 2GDDA 2OLGA 4X1QU 3M37A 3VB5A 1C5SA 1ZTJA 4CRGA 2BM2A 2FOCA 2ZHDA 3M7UA 1W12U 1FXYA 3TGJE 3GDUA 3AW0A 5A0BA 1UCYE 3U9AH 1OSSA 1S85A 1BMAA 1N8OC 1LHFH 3BTDE 1HAHH 4TYDA 1KY9A 2Z9GA 2ZFQH 5T3HA 5B6OA 3A84A 1GL0E 4OGXA 3F68H 3RXIA 5C5NA 1GBLA 3ATMA 1FPCH 1FAXA 1FMGA 1GJ8B 1Q3XA 3M5OA 1PQ7A 1TLDA 1MKWK 4JYTA 2PKAB 4R0IA 1BMMH 4ZHLU 1BMNH 1TFXA 1KXFA 1K21H 1O3DA 1WOFA 2FLBH 4X2VA 4YT7H 1ELVA 1YPHC 1CA0C 3GYMA 1TX7A 1EUFA 3RXBA 2Y5FA 4ABAA 3UQVA 1F0UA 1RS0A 2GZ9A 1C2JA 1RIWC 2WYGA 2NU4E 1PQAA 1T32A 1PPFE 4D8NA 3MHWU 5DP6A 1OPHB 5HM9A 1DE7H 2J2UA 3RXPA 1A2CH 1KXBA 1PPCE 1V2NT 3SN8A 1GMDG 3ATKA 1HDTH 1W0ZU 3ZZ7A 4ZUHA 1GI2A 3RXKA 4ZKRU 3TH4H 1O2QA 4JYUH 3BTEE 3RXEA 4JCNA 1SPJA 3LGIA 1J17T 1K1NA 2D8WA 4BTTB 1C2HA 1BRBE 1GHZA 1L4ZA 5AF9H 1TGBA 3T5FH 2LPRA 4JZDH 4WF8A 4A92A 1UJ1A 1NM6A 1W2KH 2SNWA 4ZKOU 1FY4A 1HYLA 2CHAB 3QK1A 3TGIE 1GI5A 2PKSC 3MI4A 3PO1B 4HI3A 1ELEE 3EA7A 2QC2A 1TRMA 3E0NB 8LPRA 3U1JB 3Q3XA 3CENA 3DA9B 1GG6B 2ZFSA 1FIWA 2AIQA 2ZECA 5AFYH 2ZGCA 3NXPA 5T6GA 2ASUB 2UUFB 1ACBE 4MQAA 2OQ5A 2FTLE 2A5IA 3S9CA 2QA9E 3SORA 1UK2A 2O8TA 1AU8A 1TRYA 2ZIQH 4UFFH 4OGYA 2BLVA 1AUTC 1C5QA 3A8CA 4Y71A 1AFQB 3ZZ9A 3OSYA 3A8AA 1C5VA 1AD8H 4DJZB 3PWBA 3K9XB 1WBGB 1GCTB 1K22H 1XKBC 3ZZ4A 3R3GB 3BTHE 4MDSA 1TNLA 1C5NH 2FOHA 5EPYA 3M3SA 4ABIA 1T7CA 3KIDU 2J34A 4BOHA 5A8ZA 1P12E 8KME2 2DUCA 4FUHA 3MNXA 2QF3A 3BTKE 3GCTF 3ZZBA 1GJ6A 2J94A 3BG4B 1A46H 3S7KB 1A0LA 5I25A 2GCTC 2B7DH 1JIRA 4SGBE 4TY6A 4AX9H 3RXCA 1CBWB 2HVXA 2F91A 3TLOA 2QCYA 2HNTF 3M3VA 1DICA 8GCHF 3BIUH 3P8NA 3RXDA 1NRRH 5J4SA 5C67A 3BIVH 1MBMA 1ZLRA 1VJAU 2VH6A 2R0LA 1QL9A 3E8LA 2R2WU 1HIAB 1EXFA 2ZO3H 3M7TA 1JBUH 4BAMB 3CS0A 3BF6H 2BD9A 1GBBA 3RM2H 1UK3A 2GV7A 2FOMB 2ZI2H 2I6QA 2TPIZ 4ABHA 1GBKA 1CO7E 2JKHA 5EODA 3SW2B 1TABE 4ABGA 1H9IE 2ZGBH 2WPLS 2EC9H 4D9QA 1JXPA 1JWTA 1ZOMA 2OCVB 3SJIA 1T8LA 2ZTXA 1D3PB 2BDAA 2NU1E 1W14U 2ZEBA 2W7SA 3M5MA 2ZZUH 1IHSH 3E1XB 1BTWA 2SGAA 3UY9A 1UVPA 3ZYEA 1HUTH 2V0BA 1Y5UT 5C5OA 1UTLM 2P3UB 1GBEA 1V2LT 2R3YA 4ISNA 1TYNA 1ELFA 1KLTA 1EB2A 2FX4A 4LZ4B 1BBRE 1OWIA 1AN1E 4DIIH 3KCGH 1Z6EA 1CSOE 3UPEA 2VWMA 1TAWA 4J2YB 3MU1A 2A4QA 3O8BA 4MNXA 1K1OA 1WYKA 4ISIH 4CR5A 1O3GA 4IS5A 4FUIA 1TIOA 3FZDA 5EQSA 1EAIA 2TGPZ 3KHVA 1BHXF 5GXPA 1GHXH 3K2UA 1TQ7B 3DHKH 1PYTD 4WMEA 3UTUH 3LT3A 1NZQH 1SHHB 2BD8A 1GVLA 1P2NA 1QA0A 1C5LH 1DANH 1GJCB 4ZAEA 5HGGA 3VXEH 1QL7A 4WJG2 5HM2A 3PROA 2QYIA 4X0WU 1UHBB 2VU8E 1L4DA 1WTGH 3Q00A 2NU0E 5F8XA 5EPNA 4JYVH 1NU7B 2ZDKA 4AN7A 1HAYB 1K1PA 3OY6U 1KSNA 3RU4T 3BEUA 1GGDC 1C5RA 2GX4A 3RUOA 1TPOA 4Y6DA 1OP8A 1PFXC 2ODQA 3W94A 1YCPH 1TE0A 3ZZDA 4UEHH 4XSKU 1Q31A 1YP9A 1S6HA 1TA2A 2XXLA 3AASA 3U69H 2ALVA 2CV3A 2GD4B 4K3JA 4CREA 1VITG 1SLXB 2QN5T 2B9LA 4O3UA 3ZZ3A 1V2KT 1HJAC 3HKIB 1DDJA 3A7WA 6ESTA 5FCRA 1TNJA 1K1LA 1O2KA 1UCYK 3F9FA 2ZU3A 5GDSH 1SGIB 1ZRKA 2HOBA 3MNSA 4RKOB 3LC3A 1EAWA 2V3HH 4NZLA 5A8XA 2ZNKH 2D1JA 3P8GA 2R3UA 1TX6A 1NT1A 2A1DB 1FY8E 1GDUA 2ZTZA 1FPHH 1BCUH 2FIRH 5DO4H 3P6ZB 2AFQB 5HXFA 1EP6A 1INCA 2DE8A 2F9NA 2G4TA 3QDZB 1VCPA 2FS9A 2ZWLH 5JB9S 4DURA 2AGGX 5E0JA 3ZVBA 1ARBA 1TOCB 2A2QH 1W8BH 1SGCA 1FONA 2FI4E 4DT7B 4RSPA 2Y5HA 4B2CA 4CR9A 1FY3A 3KNXA 3LC5A 1GMCF 4BXSA 2ANYA 4DCDA 4A6LA 1C2DA 1DLKB 4ABEA 4B76A 1KLJH 1MTSA 5FX6A 3PMBB 3GISB 4