2ZPQA

Crystal structure of anionic trypsin isoform 1 from chum salmon
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
220
structure length
220
Chain Sequence
IVGGYECKAYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPSSCAPAGTMCTVSGWGNTMSSTADKNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural comparison of three isoforms of anionic trypsin from chum salmon (Oncorhynchus keta).
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Anionic trypsin
total genus 50
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zpqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zpqA02
1RXPA 1TPSA 1ZSJA 1EAIA 1TOCB 1P9SA 1NTPA 2HALA 1W3CA 3BTHE 2ZP0H 1SOZA 4MDSA 5IDKA 1EJMA 5L6NH 1AI8H 1DY9A 1GBJA 4JK5A 2G4UA 4U30A 1EZSC 1IQKA 1H9LB 4ASHA 1TNKA 3ATMA 2VVUA 3NUMA 5A8XA 4I8HA 1TGCA 4DG4A 1LHFH 1BCUH 1GMCG 5EQSA 3KCGH 1CSOE 2RA3A 3A7TA 5LH8A 1BRAA 2Z6BD 3SHCH 3ZZ3A 2AERH 4FU7A 3S9AA 1O31A 4CR9A 1XUFA 3ZYEA 1XVOA 1OKXA 1K1MA 5AFYH 1SQOA 4MQAA 4DW2U 1HAGE 2HPQH 5A2MH 1Y3YA 3MNXA 4X6PA 2OBOA 3SZNA 1IQJA 9LPRA 9ESTA 1D3DB 1RRKA 3ZZBA 1TNGA 1P06A 2ZTZA 1XUGA 1FAXA 2PHBA 5LPFA 1KXFA 4WY3A 2VNTA 3VB7A 2Y5GA 2GDEH 2Y81A 1O37A 2AYWA 1DWDH 1AB9B 6GCHF 1DICA 4I8LA 4Q7ZA 2HNTE 3RXIA 4JCNA 1C2LA 2XCNA 4MVNA 4Y8XA 1MTUA 1EAXA 6LPRA 2PGQB 5GJ4B 4X8VH 1FY3A 2STAE 2R3YA 1EATA 3SV8A 1PPFE 4BOHA 3QGJA 3RXCA 3KEEA 1AZ8A 1FI8A 2G51A 4YM9A 1ORFA 1VITF 2FMJA 3TGKE 1GMCF 1KXDA 1C2GA 3UTUH 4X6MA 4CRDA 4ZKSU 1ZMJA 4Q7XA 1OSSA 1SGQE 1RJXB 5CHAB 2PKSB 3GCTF 2ZGHA 3E1XB 2OCVB 4U2WA 3V7TA 3NWUA 2TGPZ 2CGAA 2OC1A 3MH5A 2V0BA 5JBAS 1J15A 2ANMH 2A5AA 5BRRE 6CHAB 3A89A 4IS5A 5EOKA 1WV7H 1XM1A 1V2RT 1EKBB 4ABFA 3P8FA 1O3AA 3DD2H 2ZU2A 2CV3A 2Z3DA 4ESTE 1D3QB 1C5XB 4JZFH 1PQ7A 3OYPA 1AE8H 2C90B 1O2MA 1K1OA 2Z9JA 5EG4A 1GHBG 3W94A 1BTZA 1SGRE 2GCTC 1F7ZA 3VPKA 3PMAB 4ZMAH 1OX1A 1NFXA 1TPAE 1KXBA 4RKOB 4IBLH 1V2MT 1JWTA 4DGJA 4YT7H 1DVAH 2IJOB 3KGPA 1BTYA 3E16B 2A2XH 1DLEA 1O5GH 3RXAA 1B7XB 1ELEE 4KTCA 1Z8JB 3ZZ8A 4ABBA 4LZ1H 1G2LA 1JRSA 3EE0B 2VWNA 4FUFA 3ZZ7A 2FESH 2CF9H 1NM6A 4AX9H 1GI1A 1O2TA 2P94A 2WPLS 3QO6A 4WH8A 1A5HA 2CHAB 3LOXA 1FY5A 1SGNE 1SGTA 4TY7A 1J14A 1FIWA 3LGVA 5EGMA 1N8OC 3DHKH 3MO3A 2JETB 2LPRA 3RMNH 2C4FH 2BLQA 3SU6A 1O2PA 1EOJA 3P92A 1L0ZA 1YPLH 2XC5A 1MD8A 1W0YH 1G3CA 1W8BH 5F6MA 3ATIA 1TX6A 1SLUB 1CT4E 2GV6A 1S83A 1BUIA 2NU4E 3UR9A 1H4WA 3LJJA 1NPMA 1WYKA 4D7GA 3LGTA 4KGAA 1B0FA 1GWAA 1UK3A 2G81E 4D76A 1KDQA 2FTMA 1GG6C 1TGSZ 2H5DA 1QQUA 4ISOA 2FLBH 2ZO3H 3AAUA 4F49A 2BZ6H 1GL0E 1L1GA 4AZ2B 6ESTA 4JZDH 1HFDA 1W10U 1ETRH 4NCYA 1O2SA 3SJIA 2PKSC 2OQ5A 2XC4A 1JOUB 2BY6X 3S7KB 3GY4A 1P2JA 5I46H 1ZMLA 1UTQA 1O3LA 2ZDAH 3R3GB 1LO6A 1QJ7B 4Y10E 4ZUHA 1BBRK 2QXHA 3M3TA 2ZQ2A 1OS8A 2ZIQH 3E0NB 1C4U2 3ZZ4A 1DPOA 3EQ0H 1GG6B 4D9RA 3NKKA 2NWNA 3PMJA 1WTGH 1IQNA 1NRQH 1DXWA 3F9FA 1Y3UA 1GJAB 3BIVH 1C5NH 1HUTH 2V6NA 2Z9GA 2F3CE 1PFXC 2ZC9H 2GX4A 4OS6A 2D1JA 8GCHG 1T8LA 3RXVA 1V2LT 3SU1A 4ZAEA 1P2QA 3ATWA 1EP6A 3ZZ9A 2Y7ZA 3E6PH 1RD3B 3M61U 4VGCC 1C5VA 1O3JA 1YCPM 4FUEA 2ZTYA 1OWJA 4RKJB 1A3EH 1F5LA 2Z9IA 4YZUA 3L3TA 2R2WU 5EQRA 2BDCA 3E90B 4FUGA 3BSQA 1HLTH 2STBE 4I8KA 3T25A 5C3NA 3OX7U 2GVFA 1GI7B 3RXTA 1ELCA 1VGCC 3M5LA 1AY6H 1F5RA 3QN7A 4LXBH 4FXGH 5BPEA 1EZUC 1SOTA 1C5LH 2JH6D 3GDSA 2TIOA 2O8LA 4ISLA 1UTKA 4MNXA 3A7YA 1RFNA 3S9BA 2Z7FE 1C9TA 1SVPA 3ZV9A 1HYLA 4K8BA 1QIXB 1UCYH 2LNCA 8GCHF 4BTIB 3SV6A 5LPRA 2ASUB 2J95A 4NGAH 2G52A 1M9UA 1QJ1B 1O2GH 2XBYA 4ZKRU 1HB0B 4A5TS 1UMAH 5E0JA 1FLEE 1FNIA 3PV4A 1Y5BT 3T27A 1C1TA 1YPMH 3MU5A 3PB1E 1HV7A 4XBCA 3LDXH 4X6OA 3SNCA 1ZTJA 3RU4E 4KKDA 4MPXA 1OYQA 2XWAA 2QGRA 1XUHA 1BBRE 4A7IB 1O3PB 4E05H 3UNQA 2UWOA 5PTPA 2EI6A 2OC7A 5HM9A 1MBMA 3M5NA 1C2HA 2ULLA 2FYQA 1JIMA 1KLJH 1GBCA 2OTVA 3QUMP 1P03A 2OXSA 4DURA 4BTUB 4H42U 1PPHE 3E3TA 1UTOA 5ESBA 1SFQB 2XBVA 3T26A 2VIOA 2QXIA 3UOPA 4QT8C 3M7TA 4UEHH 1HDTH 2B8OH 3AW0A 4AFUA 1OOKB 1O3NA 3QX5H 3UPEA 5HXFA 1C2JA 4JK6A 4NA7A 1O5DH 1C1WH 5CMXH 1BTUA 1TX8A 1CBWB 3RXRA 3SQHE 3RXKA 1O2NA 3AAVA 1MCTA 1RGQA 2OP9A 1YPKH 3A7ZA 1DLKB 5IYTA 3HKJB 1QBOA 4K8YA 1KY9A 3A88A 4U32A 1GJ9B 2BLOA 1O3IA 2WV5A 4X2YA 3SJ9A 1O2JA 3MTYA 4Y0YE 1XX9A 1GDQA 1V2OT 4UFEH 2ZZUH 4UDWH 1C5RA 1HAOH 1WQSA 5EQQA 3I77A 3RUOA 1ZGVA 3TH3H 1LTOA 2ZHQH 4J2YB 4OS4A 1GJ4H 3F9EA 1XUIA 5C1XA 2VWLA 1C5WB 4I8GA 4RSPA 1AIXH 4TWYA 1AZZA 3DA9B 1TPPA 1ZSLA 3RU4D 5A0AE 3RXEA 3SJKA 2R9PA 4BXWA 1O2QA 4M7GA 3TGJE 5FBEA 3MOCA 1ZHMA 1BTHH 1O3EA 3BTME 2FI4E 5A0BA 3SGBE 3PO1C 3QGNB 1Z8GA 3R0FA 2VH0A 1DSUA 1T32A 1TFXA 1BA8B 4JZIA 7LPRA 5F8ZA 1KXAA 1O38A 3ZZCA 1CA8B 1Q3XA 1VCQA 1Z7KA 1N6XA 1S0RA 2PSYA 1A3BH 2ZGJA 3A7WA 2UUJB 1YPHC 2ZCHP 4ABJA 1GDNA 1LPZB 1UJ1A 1BHXF 1VGCB 2P3FH 4ABIA 1FIZA 1OPHB 3BTGE 2GCHF 3F6UH 4BAKB 1BZXE 1JXPA 2D26C 3E91A 4MNWA 3VB6A 7GCHF 1P2IA 4O9VA 3VFEA 2RCEA 3M36A 3SU4A 1ARCA 1AVXA 5T6FA 2VGCC 4MPWA 1GGDB 5FPYA 3P8OA 1C5SA 4OS5A 4XDEA 5AFZH 2P8OC 4FVDA 3D65E 3GOVB 1TABE 1GVLA 1VCWA 2XTTB 1ANEA 2AFQB 3N7OA 1F2SE 4JYUH 3O8RA 5ESTE 3MFJA 1GJ8B 2Q6FA 1FPCH 2IN2A 4KELA 5B6OA 3CS0A 1GBEA 1FY1A 2SGFE 1P2MA 1YPJH 4ABEA 1EPTC 2FTLE 1FMGA 1KLIH 4ZKOU 5C67A 3TGIE 1HIAA 5DP6A 1LPGB 1SG8B 4ZHMU 2GCHG 1PPGE 1T8MA 3KHVA 3RMMH 2AMPA 3EA9A 1QL7A 5GXPA 1YM0A 1C5UA 2NU2E 1O2HA 1E0FD 3FP8E 5JBBS 2ZF0H 3UWJH 1P2NA 1O3BA 2BY7X 1HIAB 3LPRA 3M5OA 1CA0C 1Y3WA 2CN0H 1O5AB 1V6DA 2B0FA 2ZCLP 3ITIA 2GT8A 3MWIU 2ANWA 4JZEH 3A86A 2BD5A 1S6FA 2JKHA 1QRZA 2XXLA 4AB8A 1P8VC 3RXPA 1X7AC 5E2OA 5AHGH 2FX4A 1BJUA 3FP7E 1D3TB 3SU0A 4NA8A 3BEIB 3EA7A 1BMAA 2P93A 1EJAA 3KQBA 3SV7A 1UTLM 2J92A 1AD8H 2EEKA 5F03A 2SGDE 3FP6E 4NFFA 1HRTH 2FOFA 4YOGA 1TGTA 1HBTH 1N8OB 2TGAA 5TCCA 2BD7A 6GCHG 1AU8A 1HXEH 1TLDA 4BXSA 2A4OA 2Y82A 4WH6A 1ZLRA 3NXPA 4OS2A 4UONA 2PSXA 4THNH 3T2NA 1IAUA 4BAMB 1A5IA 5HYOA 3PTNA 3W95A 1C1VH 2K1QA 3CENA 1BMMH 2Z3EA 1UTMA 4XE4A 1Q2WA 1SGEE 1H8DH 4H4FA 3EGKH 1U6QA 1CA0B 2ZDMA 2ZHFH 1J16A 3GDUA 1O3KA 2GZ8A 3K6ZA 3SJ8A 2FOMB 3A7VA 1SGDE 1TRYA 3PLKA 3GY6A 3Q00A 3RM0H 1C5OH 1DDJA 3ATKA 3MU1A 3QTVH 2FO9A 1IOEA 4LK4A 2R2MB 3SV9A 5LGOA 3TK5A 3O8CA 1ZPZA 7GCHG 2XYAA 3M5MA 3FFGA 2A2QH 1AE5A 2G00A 1DY8A 2NU0E 1NRRH 2BD8A 4NIWA 4X2WA 3BTWE 3ODFA 4UFDH 4Q2KA 3TJNA 2BOKA 3U8OH 1GVZA 2W7UA 1WU1A 3L6PA 3RXJA 2D8WA 1HCGA 1LPKB 4JYVH 1O2YA 1V2PT 1AMHA 2A5IA 5DP3A 2NU3E 2BDIA 4Z0KA 4GHTA 2VIQA 2GDDA 2M5TA 2SGQE 1MAXA 3HK3B 3QLPH 3LONA 4XFQA 3SU2A 1DUEA 4F4OC 2HNTC 2ZFSA 2FPZA 4J1YA 4D7FA 2TGTA 4AFZA 3A87A 1HJAB 4MG3A 2WPJS 1GJDB 5DGJA 1P0SH 1W7XH 1A2CH 2FOBA 5EW2H 2A7JA 2GMTB 1TONA 3SW2B 3ZZAA 1SMFE 2FYRA 4O97A 1GBAA 3P70B 1L1JA 1HPGA 4AB9A 1NFUA 2BY8X 1HAVB 1QCPA 2V35A 4X1PU 4CBOA 4XBDA 1GBIA 1AGJA 4IMZA 2FEQH 3C1KA 5DP5A 2JETC 2A4QA 4B71A 3HGPA 1D3PB 1HJ8A 3ZVFA 1K9OE 1QFKH 4WMDA 1E34B 3RMOH 1ZTLA 2CHAC 4A1TA 3SN8A 4RN6A 2BD2A 2FWWA 3UQOA 3MMGA 1G9IE 1GVKB 1VR1H 2FI5E 3TNTA 4ABHA 1O2XA 3GY8A 2HGTH 1O3HA 3STIA 5A8YA 2NU1E 4LOYH 4DCDA 1NU7B 1Y3XA 4Y0ZE 4ABDA 4O3TA 3GY7A 1PPEE 3BN9A 5H4IB 3MNSA 1S5SA 3ZYDA 1SLXB 2AGEX 3U69H 4X8TH 1FN8A 1QNJA 4HFPB 5GDSH 3MHWU 4WVPE 5AF9H 3KL6A 5FAHA 5E8EH 1V2NT 2ZU1A 1S85A 2PV9B 2SGAA 1UHBB 2C3SA 2HVXA 2XC0A 3IITA 3VEQB 5A8ZA 2B7DH 1HAPH 1LCYA 1QBNA 1LHCH 2Y6TA 2ZFPH 1BITA 2HNTF 2SGEE 1P10A 1TWXB 6CHAC 1ARBA 1CHGA 2DUCA 1A61H 2R3UA 2QY0B 1C9PA 3P8GA 1QGFA 4Y71A 3WY8A 2A7CA 3M7UA 4K5ZA 1C2EA 1V2ST 2CJIA 2ZFRH 1THSH 2W5EA 4GPGA 2BDGA 3UREA 4TPIZ 1AWHB 3UFAA 2JH5D 2EI8A 3LC3A 2H2ZA 4MPUA 2ZFFH 4B2BA 4X2XA 3MO9A 1KXEA 1SGCA 3I29A 3GCTG 1Y59T 1XUJA 4I7YH 1H9HE 1IQHA 3RC5A 2BOHB 3SUGA 2EI7A 5EPYA 1C1SA 4AG2A 1L4ZA 3LH3A 2VWMA 3SBKA 2I6SA 1IHSH 1AFQC 5F8XA 1AFEH 2AMDA 1GDUA 3SJOA 2ZI2H 1SQAA 3ESTA 1DOJA 1MQ5A 1EPTA 2GGVB 2BHGA 2XCFA 1INCA 4AN7A 1GI3A 1QHRB 2H1UA 1DXPA 1RS0A 1ZRBA 5I25A 4AOQA 1LHEH 3BG8A 1PYTC 1T7CA 1O30A 1FN6A 5GCHF 5EODA 2OINA 3SQEE 3STJA 1ZHPA 2C8ZB 3OY6U 1EAWA 1ACBE 1K1IA 5L2YH 4MTBA 2ZFTA 1SHYA 4K2YA 3EA8A 1XVMA 4GSOA 1TNIA 2BYAX 3UY9A 1QA0A 1IQMA 2ANYA 3RXMA 3SUEA 2P3UB 3B23B 3MI4A 4B76A 3RLWH 2CF8H 1O2OA 1SGIB 2ZPRA 1V3XA 3ZVAA 2G5NA 2ODQA 1HNEE 1BMLA 2IOTA 1P11E 3A85A 2PKAA 2G4TA 1GHAF 1NZQH 1UCYK 4HTCH 1THPB 1W0ZU 1FAKH 2PR3A 1O2RA 3RXUA 4ABGA 2BQ6B 3RDZA 1C1MA 1GJ7B 1TALA 2V3HH 2ZHEH 2UUFB 1N6YA 3TIUA 1BRUP 1P2KA 4KTUA 1EX3A 2F9UA 1O5BB 3MYWA 1QTFA 1P12E 2A1DB 1EPTB 3PLPA 2F9PA 2ZQ1A 1W7GH 1W11U 3FVFB 4GCHG 1AO5A 3DT0H 5EW1H 1SC8U 2ILNA 1AKSA 2VIPA 4WWYA 5DG6A 4Y76A 1ANDA 2W3IA 1B5GH 1CVWH 2O8TA 4B2CA 1C2DA 3H5CB 2O9QA 2ZDVH 3UQVA 1C5QA 3KQCA 4WMEA 1GHYH 1Z6EA 5FXLA 1UVPA 4X1SU 3SU5A 1GGDC 1BQYA 1JIRA 2WUBA 2J94A 2WYJA 3O8DA 2A4GA 3RLYH 2BVSH 2QCYA 5T6DA 3URDA 1BBRH 4I8JA 1MQ6A 3QTOH 4CHAC 3OTJE 4BAQB 2THFB 1JRTA 2PUQH 3RXGA 1QR3E 1O34A 2FDAA 3A82A 2PFEA 2BMGB 5JB8S 1EP5A 1Z8RA 1PPCE 1EXFA 4NZQA 3RXOA 5DO4H 1IQFA 1MTSA 1TQ0B 2OUAA 3DUXH 3SOSA 1A5GH 1P04A 5C2ZA 4E7NA 3RU4T 1H1BA 1ZJKA 2VU8E 1Q31A 2SNVA 1G3EA 3SNAA 4YO9A 1FY4A 3Q3XA 1CT0E 1PQAA 1OWDA 1RTKA 1PPBH 4TPYA 1T31A 1UCYE 2BLWA 4DVAU 1ANCA 5C1UA 4YT6H 2BM2A 1EZXC 3BG4C 3RXFA 5DP4A 1DE7H 1TB6H 1V2TT 1A0JA 1EB1H 1QURH 1UTPA 4B74A 2QC2A 2R0LA 3VGCC 1IQIA 1BJVA 2O8MA 2BB4A 1BIOA 2BTCE 2HPPH 3EDXB 3MNCA 1G37A 1GJ5H 1DFPA 3K65B 1SPJA 1GBHA 3TJUA 2FS9A 2XWBI 3C27B 2A7HA 2C93B 1BDAA 1C5PA 4BAOB 4DT7B 2ZCKP 1CU1A 3RXHA 1B0EA 5CHAC 1AWFH 4NIVA 4JZ1A 1QL8A 1EOLA 3UNSA 1MZAA 3FZZA 1QB6A 1VITG 1YGCH 3QK1A 2FXRA 1KLTA 1MD7A 4WF8A 1DX5M 1EAUA 1IQGA 2FX6A 2QA9E 3RC4A 3TPIZ 3BTKE 1CO7E 3BTTE 5DP7A 1CBWC 1SGPE 1NU9A 1P3CA 3LJOA 1FUJA 5T6GA 5SGAE 1O3MA 3GCNA 4YTAA 1TX7A 3RC6A 1FONA 1Y8TA 5CE1A 1FY8E 2YNAA 1F92A 1WAYB 1C1RA 1P02A 2Y7XA 4Y6DA 3U98H 3M37A 2C8XB 2ZG0H 1F0SA 1NT1A 3BTFE 4GHQA 4DOQA 3BEUA 3TH2H 4FUJA 1A7SA 2GD4B 4I33A 2QAAA 1BB0B 3ZVEA 2Y80A 1DITH 1J9CH 4Y8ZA 1Z71A 3S7HB 2FOGA 3M3SA 1K1JA 3I78A 1FV9A 1GI6A 2HWLB 2ANKH 3GICB 5JYIA 2VINA 2A31A 2VIDA 3MH6A 1CE5A 5C20A 2O8UA 1OP0A 2GTBA 3KQEA 1O5EH 4X8SH 2HLCA 2PWXA 1MBQA 1TMTH 1CHOG 1LKBA 3OY5U 3VGCB 5FBIA 7ESTE 3DFLA 1O2KA 1V2UT 1ELFA 1AQ7A 3AASA 3ATLA 1MTNC 1ZPCA 3ELAH 4A1XA 2IPHA 3TLOA 1GI4A 5JBCS 4FUIA 3NZIA 2WPKS 5DKMA 1QB9A 1V2KT 2DE9A 4CRGA 1TE0A 3H7OA 3T28A 4JMYA 4ZROA 1A46H 4OGXA 1HAXB 5T3HA 4LZ4B 2FM2A 1VZQH 3Q3YA 2ZHWH 1G3BA 1GI2A 1YF4A 1K28D 1GHWH 1O2ZA 3MH7A 3U8RH 2FS8A 1W12U 4CREA 2GKVE 3LIWA 1TA2A 3O8BA 1LQDB 1IHTH 1MTNB 1O36A 1GMHG 1AKSB 3A8AA 1J8AA 2SNWA 8ESTE 1XMNB 1NN6A 4Y7AA 1MTWA 3PLBA 4INLA 1LVMA 3K9XB 3RXDA 1UK2A 2BD9A 1NRNH 3GY3A 1G36A 1CGJE 2ODPA 1QRXA 1T8NA 1T8OA 1C1NA 3F9HA 3S69A 2FLRH 5EXNA 4ZKNU 1WCZA 1BHXB 3GISB 5E2PA 1TBRH 3M3VA 1HAHH 4HZHA 1K1LA 1KSNA 5HGGA 1OWIA 1GBLA 2KAIA 3KN2A 3PWCA 8KME2 2QV1A 1O5FH 3AW1A 4WMFA 4ZXXH 4B73A 4FU9A 4UFGH 2SFAA 3PYHA 1O0DH 5C5OA 2OBQA 3RM2H 3U9AH 1YPGH 1NS3A 3BEFB 3NCLA 1EJNA 4CH8B 1TNJA 2H9HA 2ZKSA 3P8NA 2GV7A 1KDQB 1S0QA 3ODDA 2GT7A 1MH0A 2P3TB 1T4UH 4I31A 1MZDA 2BVRH 3RP2A 1K2I1 1ZPBA 2G5VA 1EZQA 1QRWA 1C4Y2 1TYNA 1ELTA 1GMDG 1ID5H 3QDZB 1FDPA 2BZAA 4H6SB 5HMAA 2QXJA 2Z94A 1XKBC 3UIRA 4NZLA 1P09A 1ZYOA 5DJ7A 1SGFA 3SORA 2ZPQA 3GYLB 3GCHB 1NESE 1GBKA 4NA9H 2UWLA 3A8CA 1LQEA 1NY22 1QQ4A 2DE8A 3SGAE 3LH1A 1PJPA 2KAIB 1YLDA 4B1TA 1MAYA 3A7XA 4K60A 1Y3VA 1XXFA 2BX4A 3MU0A 3P17H 1O33A 1GI5A 1H9IE 1TNHA 5GCHG 4YESB 1F0UA 1LVBA 3BG4B 3NK8A 3GCOA 1D4PB 1K1PA 4GUXA 4X6NA 1QB1A 4AFQA 2H9TH 1ZMNA 2BLVA 3IG6B 1BTXA 2YNBA 2OD3B 3B8JA 2D2DA 2FODA 1MCVA 5L30H 2OLGA 3QWCH 2BQWB 2A5KA 2FOCA 2VH6A 3VXFH 1QY6A 1TQ7B 3V3MA 1SGYE 3CS7A 2V3OH 1Z1JA 1AVGH 1C5ZB 2BDBA 4Y7BA 1LMWB 2C8WB 3PWBA 1RIWB 4O03A 4X1RU 5AVDA 1GI9B 1S6HA 3QZQA 4K3JA 2O8WA 2YOLA 4ZHAA 2ZA5A 3T29A 1V2WT 1C2IA 3MO6A 3UR6A 3E8LA 4BAHB 1Y5UT 1YBWA 4Z6AH 1RIWC 1E35B 3ZVGA 1LKAA 1SHHB 4AGKA 2GCTB 1QL9A 5EU8A 4YOIA 1YCPH 2ODYB 1PPZA 3U1IB 4ZHLU 1FQ3A 4FUCA 1J17T 1O2WA 4CRCA 1ELGA 2AH4X 2AIPA 1DM4B 4R8TB 1JBUH 5GWZA 1O39A 3D62A 3GY5A 1YYY1 3L33A 1KYNA 4KP0A 4GLYA 4O3UA 3UUZA 2ZU3A 4FUBA 3SNDA 2H9EH 1D6RA 3TJOA 4AFSA 4CHAB 4MNVA 4K1EA 5K0HA 1ELDE 8LPRA 1DWBH 1YPEH 3S0NA 3TNSA 3Q3KA 4UFFH 1T4VH 1UVTH 3SGQE 3LT3A 4IGDA 3SU3A 4ABAA 4X1NU 5EXLA 1OP2A 1EUFA 1EQ9A 4MPVA 1ABJH 5C1YA 2ZWLH 1C5TA 2Z9LA 2ZECA 1QJ6B 1YCPK 3KIDU 1BOQA 1OWEA 2ZU4A 3K2UA 4KTSA 4MLFB 4H6TA 2PTNA 1GBMA 2BDYA 3UNRA 4AYYB 4XBBA 1OXGA 1ESBA 1AVWA 5DP8A 4TWWA 1S81A 3ZZ5A 1C1PA 2ZGCA 1HGTH 1NFWA 4WXVA 2XW9A 2Q6DA 4YLQH 1BTPA 2BVXH 1E38B 1ZTKA 1DWCH 2Y5HA 3MU8A 3LGYA 3F9GA 4NWKA 1OP8A 5TJXA 4SGBE 1TRMA 3EYDA 1ZGIA 2EA3A 2A4RA 2FOHA 1DT2A 2Z3CA 3HGNA 1Z1IA 1QBVH 1LVOA 4GVUA 2QN5T 1DUAA 3K6YA 2RG3A 3VB5A 3Q77A 2EC9H 1E37B 1IQEA 1KIGH 2P8OB 4NSYA 2TBSA 1PQ8A 1L4DA 1TMBH 3V0XA 2VIWA 3BV9B 4NG9H 3ZVBA 4B75A 1XXDA 2VGCB 3PROA 3F68H 1C2KA 1Z8IB 2P16A 4Y8YA 2AS9A 3MH4A 4ISHH 1L2EA 1YKTA 2C8YB 3RXBA 1SR5C 2F91A 1F5KU 1CGIE 1SLVB 1C2MA 2WPHS 3LC5A 4K1SA 4DY7B 1V2JT 1S84A 1XKAC 1TPOA 1A1RA 2QF0A 4AYVB 4A1VA 2Q1JA 4GCHF 4NSVA 1GHAG 1C1QA 3ZV8A 1MMJN 1BT7A 1AUTC 1GJ6A 1GI0A 2WV4A 1DANH 1GJCB 1K21H 1KTTB 3B9FH 1MKWK 1PQ5A 4NIXA 1TIOA 4IN1A 3TVJB 1C5MD 1C5YB 4BNRA 3PMBB 3GDVA 1JMOH 1NROH 1O2LA 3A81A 3H7TA 2BQ7B 1SFIA 1EASA 1TRNA 4FU8A 1AFQB 5F8TA 4CRBA 4D9QA 1HJAC 1TMUH 4TY6A 2ZHDA 1HAYB 1ZR0A 4FUDA 1FXYA 2QXGA 3CP7A 1G2MA 3MNBA 1OWHA 3V13A 2P59A 2UUYA 3P95A 4CR5A 4OGYA 3E0PB 2QF3A 1MU6B 1ZOMA 2ZEBA 2WYGA 2BDHA 1A0HB 4SGAE 2AMQA 2BX3A 3A8BA 1G32B 7KMEH 3G01A 5J4QA 4JYTA 2PUXB 3TJVA 3KNXA 1G30B 4IC6A 1UVUH 4X1QU 5JPMH 1V2VT 1Y5AT 2AGIX 3ZZ6A 4K1TA 4Q7YA 1WTHD 2R0KA 1MUEB 1W14U 2BDAA 3P6ZB 1SL3A 1SLWB 5GPIB 4YOJA 1P2OA 2ZU5A 1F0TA 1HAVA 1UTNA 3FZDA 1H8IH 5TCAA 4TYDA 1DWEH 1YPHE 1NO9H 3ZZDA 1XUKA 2BXTH 4UE7H 2ZPSA 4I32A 1O5CB 2SGPE 3GCHC 1EB2A 5L2ZH 2RA0A 2Z9KA 2VJ1A 3D23A 1O3FA 2FOAA 1MTVA 4B2AA 2BY5X 2WINI 1AB9C 3SO3A 3VB4A 5FX6A 1FZZA 2ZDNA 3EAJA 3BF6H 3FANA 2ZGXH 1GHXH 1HAIH 2OC0A 1OWKA 1GBBA 3ZVDA 4XOJA 1D6WA 3QZRA 1K22H 1Z6JH 3OSYA 2VVCA 3A83A 1UO6A 5FCKA 2FZZA 2H5CA 1UK4A 5A0CA 1W13U 3RXSA 1NRSH 2J34A 4NFEA 1PYTD 4OS7A 1SQTA 4IN2A 1SSXA 1GBTA 1TBZH 3LU9B 2XBXA 2G8TA 4ZXYH 2GP9B 1K1NA 3A8DA 4NIYA 4DJZB 1HAZB 1V2QT 2A32A 2J9NA 3HK6B 2BXUH 3SNBA 2QIQA 2W26A 1TBQH 2GMTC 2FOEA 1ZJDA 2XBWA 4FUHA 2Q6GA 4XSKU 3T5FH 1O3GA 5DP9A 1ETSH 1WBGB 1O35A 2F83A 2RDLA 5JDUB 2HOBA 4HGCA 1S82A 2VVVA 1P05A 3TK9A 5JBTA 4E7RG 3DFJA 3M35A 1C2FA 1MKXK 1BMNH 1O3CA 2B5TB 1ELAA 2UWPA 2F9BH 3ENSB 3F1SB 3M7QA 3U1JB 5HM2A 3PO1B 1VITH 3VXEH 2PTCE 2HRVA 1FJSA 1C4V2 1WSSH 1GHVH 4DIHH 1UHBA 1NFYA 1ZSKA 3GY2A 2J4IA 4X0WU 4D8NA 1VJAU 2GZ9A 1DSTA 2OQUA 2PKAB 2FI3E 2VIVA 4FVBA 1ESAA 4AG1A 1GHZA 1GI8B 1BRBE 2JH0D 4ISIH 4DIIH 3A84A 1AN1E 1W2KH 2ZTXA 5FHTA 1ZRKA 1ZZZA 4BANB 1CHOF 3BTEE 1AHTH 1GMDF 1TOMH 3UOUA 2VWOA 2FIRH 4E06H 4BTTB 2XNIA 3VB3A 3JZ2B 1P3EA 5EPNA 3URCA 3GYMA 1ESTA 4VGCB 4ZH8A 1SBWA 1VCPA 1TA6A 2W3KA 2ZDKA 1L1NA 3RMLH 1BTWA 1YC0A 2ALVA 4CRFA 1ELVA 3Q76A 1AUJA 1HJ9A 1WOFA 5ABWA 2ZFQH 1GCTC 2B9LA 1SI5H 2ESTE 2AEIH 5E0HA 2BD4A 3FAOA 4MNYA 3D49H 2ALPA 1ETTH 1TGBA 2P95A 3LGIA 5FCRA 2OC8A 5JB9S 3PTBA 5G4BA 1GHBF 4NWLA 2WUCA 3HATH 3TU7H 1WUNH 1MKXH 4WJG2 4AORA 1TNLA 4OS1A 1GCDA 2FP7B 4R0IA 2H6MA 1UTJA 3A80A 3KQDA 1N1LA 1HXFH 1GMHF 2TGDA 5DPAA 2GZ7A 2AGGX 2QYIA 1CT2E 4CBNA 1G3DA 3IWMA 1DS2E 3TK6A 3SHAH 1ELBA 1NRPH 1GJBB 2F9VA 2VB0A 2XRCA 2PW8H 1P01A 1VJ9U 2A45B 5FX5A 3SUDA 1LDTT 3SI4H 2UUKB 5DK1A 3UWIA 4Y11E 4CRAA 1O2IA 5GIBA 5ETXA 3HKIB 1LHDH 1P57B 1A0LA 1KTSB 1D9IA 1TGNA 1UVOA 1TAWA 4UD9H 1NC6A 4X2VA 1SGFG 4A92A 3T62A 1BRCE 4CH2B 4X8UH 1C1OA 2ZGBH 4WXIA 3LGUA 2PLXA 2A0QB 2BD3A 1O3OA 5E0GA 1E36B 2F9NA 3OU0A 2ZNKH 2PGBB 1LHGH 1IQLA 1RTFB 1WQVH 4Q80A 3U8TH 3SUFA 1GL1A 1FPHH 3ZVCA 3HPTB 3LKWA 1O32A 3NPSA 1LVYA 5J4SA 1THRH 1GBDA 3PMHB 2ZDLA 5C5NA 5LPEA 5FPTA 1KXCA 4ISNA 3MU4A 4U01A 1O2VA 5EXMA 2G55A 3BIUH 1ANBA 3SV2H 4HI3A 1C1UH 1UVSH 4YLUA 3SNEA 1GCTB 1OYTH 1SB1H 1A4WH 2J38A 2TPIZ 1RTLA 2CXVA 1YLCA 3KF2A 3V12A 2BY9X 4IC5A 4PROA 4AGJA 3RXLA 1P9UA 2W7SA 2WPMS 1MKWH 4A6LA 1CGHA 1GPZA 1CQQA 3RXQA 3S9CA 1YP9A 1O3DA 4GAWA 4IMQA 1MU8B 2AIQA 3AVZA 2I6QA 1O2UA 2WPIS 2Y5FA 5A09A 1F0RA 3PM3A 3SI3H 4IW4E 2J2UA 2F9OA 2TRMA 1ABIH 3LGWA 3TITA 5K7RA 4INKA 5FPSA 1ZHRA 4K69A 4INHA 1QA7A 1GBFA 3BTDE 3BTQE 4Y79A 3TH4H 3JZ1B 2CMYA
chains in the Genus database with same CATH superfamily
1RXPA 1TPSA 1ZSJA 1EAIA 1TOCB 1P9SA 1NTPA 2HALA 1W3CA 3BTHE 2ZP0H 1SOZA 4MDSA 5IDKA 1EJMA 5L6NH 1AI8H 1DY9A 1GBJA 4JK5A 2G4UA 4U30A 1EZSC 1IQKA 1H9LB 4ASHA 1TNKA 3ATMA 2VVUA 3NUMA 5A8XA 4I8HA 1TGCA 4DG4A 1LHFH 1BCUH 1GMCG 5EQSA 3KCGH 1CSOE 4B6FA 2RA3A 3A7TA 5LH8A 1BRAA 2Z6BD 3SHCH 3ZZ3A 2AERH 4FU7A 3S9AA 1O31A 4CR9A 1XUFA 3ZYEA 1XVOA 1OKXA 1K1MA 5AFYH 1SQOA 4MQAA 4DW2U 1HAGE 2HPQH 5A2MH 1Y3YA 3MNXA 4X6PA 2OBOA 1EFRD 3SZNA 1IQJA 2KCOA 9LPRA 9ESTA 1D3DB 1RRKA 3ZZBA 1TNGA 1P06A 2ZTZA 1XUGA 1FAXA 2PHBA 4ASUD 5LPFA 1KXFA 4WY3A 2VNTA 3VB7A 2Y5GA 2GDEH 2Y81A 1O37A 2AYWA 1DWDH 1AB9B 6GCHF 1DICA 4I8LA 4Q7ZA 2HNTE 2W6JD 2W6ID 3RXIA 4JCNA 1C2LA 2XCNA 4MVNA 4Y8XA 1MTUA 1EAXA 6LPRA 2PGQB 5GJ4B 4X8VH 1FY3A 2STAE 2R3YA 1EATA 3SV8A 2LP6A 1PPFE 4BOHA 3QGJA 3RXCA 3KEEA 1AZ8A 1FI8A 2G51A 4YM9A 1ORFA 1VITF 2FMJA 3TGKE 1GMCF 1KXDA 1C2GA 3UTUH 1YWUA 4X6MA 4CRDA 4ZKSU 1ZMJA 4Q7XA 1OSSA 1SGQE 1RJXB 5CHAB 2PKSB 3GCTF 2ZGHA 3E1XB 2OCVB 4U2WA 3V7TA 3NWUA 2TGPZ 2CGAA 5CHBA 2OC1A 3MH5A 2V0BA 3FKSD 5JBAS 1J15A 2ANMH 2A5AA 5BRRE 6CHAB 3A89A 4IS5A 5EOKA 1WV7H 1XM1A 1V2RT 1EKBB 4ABFA 3P8FA 1O3AA 3DD2H 2ZU2A 4FETA 2CV3A 2Z3DA 4ESTE 1D3QB 1C5XB 4JZFH 5HIYA 1PQ7A 3OYPA 1AE8H 3ZIAD 2C90B 1O2MA 1K1OA 2Z9JA 5EG4A 1GHBG 3W94A 1BTZA 1SGRE 2GCTC 1F7ZA 3VPKA 3PMAB 4ZMAH 1OX1A 1H8ED 1NFXA 1TPAE 1KXBA 4RKOB 3W1EA 4IBLH 1V2MT 1JWTA 4DGJA 4YT7H 1DVAH 2IJOB 3KGPA 1BTYA 3E16B 2A2XH 1DLEA 1O5GH 3RXAA 1B7XB 1ELEE 4KTCA 1Z8JB 3ZZ8A 4ABBA 4LZ1H 3WWFA 1G2LA 1JRSA 3EE0B 2VWNA 4FUFA 3ZZ7A 2FESH 2CF9H 2V7QD 1NM6A 4AX9H 1GI1A 1O2TA 2P94A 2WPLS 3QO6A 4WH8A 1A5HA 4ACBA 2CHAB 3LOXA 1FY5A 1SGNE 1SGTA 3EE7A 4TY7A 1J14A 1FIWA 3LGVA 5EGMA 1N8OC 3DHKH 3MO3A 2JETB 2LPRA 3RMNH 2C4FH 2BLQA 3SU6A 1O2PA 1EOJA 3P92A 1L0ZA 1YPLH 2XC5A 1MD8A 2YMSB 1W0YH 1G3CA 1W8BH 5F6MA 3ATIA 1TX6A 1SLUB 1CT4E 2GV6A 1S83A 1BUIA 2NU4E 3UR9A 1H4WA 3LJJA 1NPMA 1WYKA 4D7GA 3LGTA 4KGAA 1B0FA 1GWAA 1UK3A 2G81E 4D76A 1KDQA 2FTMA 1GG6C 1TGSZ 2H5DA 1QQUA 4ISOA 2FLBH 2ZO3H 3AAUA 4F49A 2BZ6H 1GL0E 1L1GA 4AZ2B 6ESTA 5FL7D 4JZDH 1HFDA 1W10U 1ETRH 4NCYA 1O2SA 3SJIA 2PKSC 2OQ5A 2XC4A 1JOUB 2BY6X 3S7KB 3GY4A 1P2JA 5I46H 1ZMLA 1UTQA 1O3LA 2ZDAH 3R3GB 1LO6A 1QJ7B 4Y10E 4ZUHA 1BBRK 2QXHA 3M3TA 2ZQ2A 1OS8A 2ZIQH 3E0NB 1C4U2 3ZZ4A 1DPOA 3EQ0H 1GG6B 4D9RA 3NKKA 2NWNA 3PMJA 1WTGH 1COWD 1IQNA 1NRQH 1DXWA 3F9FA 3UAIC 1Y3UA 1GJAB 3BIVH 1C5NH 1HUTH 2V6NA 2Z9GA 2F3CE 1PFXC 2ZC9H 2GX4A 4OS6A 2D1JA 8GCHG 1T8LA 3RXVA 1V2LT 1SQRA 4ZAEA 3SU1A 1P2QA 3ATWA 1EP6A 3ZZ9A 2Y7ZA 3E6PH 1RD3B 3M61U 4VGCC 4RT1A 1C5VA 1O3JA 1YCPM 4FUEA 2ZTYA 1OWJA 4RKJB 1A3EH 1F5LA 2Z9IA 4YZUA 3L3TA 2R2WU 5EQRA 2BDCA 3E90B 4FUGA 3BSQA 1HLTH 2STBE 4I8KA 3T25A 5C3NA 3F0PA 3OX7U 2GVFA 1GI7B 3RXTA 1ELCA 1VGCC 3M5LA 1AY6H 1F5RA 3QN7A 4LXBH 4FXGH 5BPEA 1EZUC 1SOTA 1C5LH 2JH6D 3GDSA 2TIOA 2O8LA 4ISLA 1UTKA 4MNXA 3A7YA 1RFNA 3S9BA 2Z7FE 1C9TA 1SVPA 3ZV9A 1HYLA 4K8BA 1QIXB 1UCYH 2LNCA 8GCHF 4BTIB 3SYJA 5LPRA 3SV6A 2ASUB 2J95A 4NGAH 2G52A 5EJLA 1M9UA 1QJ1B 1O2GH 2XBYA 4ZKRU 1HB0B 4P00A 4A5TS 1UMAH 5E0JA 1FLEE 1FNIA 3PV4A 1Y5BT 3T27A 1C1TA 1YPMH 3MU5A 3PB1E 1HV7A 4XBCA 3LDXH 4X6OA 3SNCA 1ZTJA 3RU4E 4KKDA 4MPXA 3MQKC 1OYQA 2XWAA 2QGRA 3DSPA 1XUHA 1BBRE 4A7IB 1O3PB 4E05H 2JJ2D 3UNQA 2UWOA 5PTPA 2EI6A 2OC7A 5HM9A 1MBMA 3M5NA 1C2HA 2ULLA 2FYQA 1JIMA 1KLJH 1GBCA 2OTVA 3QUMP 1P03A 2OXSA 4DURA 1NBME 1W0KD 4BTUB 4H42U 1PPHE 3E3TA 1UTOA 3DSGA 5ESBA 1SFQB 2XBVA 3T26A 2VIOA 2QXIA 3UOPA 4QT8C 3M7TA 4UEHH 1HDTH 2B8OH 3AW0A 4AFUA 1OOKB 1O3NA 3OE7D 3QX5H 3UPEA 5HXFA 1C2JA 4JK6A 4NA7A 1O5DH 1C1WH 5CMXH 1BTUA 1TX8A 1CBWB 3RXRA 3SQHE 1UW7A 3RXKA 1O2NA 2HLDD 3AAVA 1MCTA 1RGQA 2OP9A 1YPKH 3A7ZA 3F2HA 1DLKB 5IYTA 3HKJB 1QBOA 4K8YA 1KY9A 3A88A 4U32A 1GJ9B 2BLOA 1O3IA 2WV5A 4X2YA 3SJ9A 1O2JA 3MTYA 4Y0YE 1XX9A 1GDQA 1V2OT 4UFEH 2ZZUH 4UDWH 1C5RA 1HAOH 1WQSA 5EQQA 3I77A 3RUOA 1ZGVA 3TH3H 1LTOA 2ZHQH 4J2YB 4OS4A 1GJ4H 3F9EA 1XUIA 5C1XA 2VWLA 1C5WB 1WDIA 4I8GA 4RSPA 1AIXH 4TWYA 1AZZA 3DA9B 1TPPA 1ZSLA 3RU4D 5A0AE 3RXEA 3SJKA 5F53A 2R9PA 4BXWA 1O2QA 4M7GA 3TGJE 5FBEA 3MOCA 1ZHMA 1BTHH 1O3EA 3BTME 2FI4E 5A0BA 3SGBE 3PO1C 3QGNB 1Z8GA 3R0FA 2VH0A 1DSUA 1T32A 1TFXA 1BA8B 4JZIA 7LPRA 5F8ZA 1KXAA 1O38A 3ZZCA 1CA8B 1Q3XA 1VCQA 1Z7KA 1N6XA 1S0RA 2PSYA 1A3BH 2ZGJA 3A7WA 2UUJB 1YPHC 2ZCHP 4ABJA 1GDNA 1LPZB 3CNRA 1UJ1A 1BHXF 1VGCB 2P3FH 4ABIA 1FIZA 1OPHB 3BTGE 2GCHF 3F6UH 4BAKB 1BZXE 1JXPA 2D26C 3H09A 3E91A 4MNWA 3VB6A 7GCHF 1P2IA 4O9VA 3VFEA 2RCEA 3M36A 3SU4A 1ARCA 1AVXA 5T6FA 2VGCC 4MPWA 1GGDB 5FPYA 3P8OA 1C5SA 4OS5A 4XDEA 5AFZH 2P8OC 4FVDA 2RFKC 3D65E 3GOVB 1TABE 1GVLA 1VCWA 2XTTB 1ANEA 2K8IA 2AFQB 3N7OA 1F2SE 4JYUH 3O8RA 5ESTE 3MFJA 1GJ8B 2Q6FA 1FPCH 2IN2A 4KELA 5IK2D 5B6OA 3CS0A 1GBEA 1FY1A 2SGFE 1P2MA 1YPJH 4ABEA 1EPTC 2FTLE 1FMGA 1KLIH 4ZKOU 5C67A 3TGIE 1HIAA 5DP6A 1LPGB 1SG8B 4ZHMU 2GCHG 3N99A 1PPGE 1T8MA 3KHVA 3RMMH 2AMPA 3EA9A 1QL7A 5GXPA 1YM0A 1C5UA 2NU2E 1O2HA 1E0FD 3FP8E 5JBBS 2ZF0H 2WHXA 3UWJH 5KEDA 1P2NA 2F43B 1O3BA 2BY7X 1HIAB 1S6LA 3LPRA 3M5OA 1CA0C 1Y3WA 2CN0H 3VG8A 1O5AB 1V6DA 2B0FA 2ZCLP 3ITIA 2GT8A 3MWIU 2ANWA 4JZEH 3A86A 2BD5A 1S6FA 2JKHA 1QRZA 2XXLA 4AB8A 1P8VC 3RXPA 1X7AC 5E2OA 5AHGH 2FX4A 1BJUA 3FP7E 1D3TB 3SU0A 4NA8A 3BEIB 3EA7A 1BMAA 2P93A 4F55A 1EJAA 3KQBA 3SV7A 1UTLM 2J92A 1AD8H 2EEKA 5F03A 2SGDE 2VBCA 3FP6E 4NFFA 1HRTH 2FOFA 4YOGA 1TGTA 1HBTH 1N8OB 2TGAA 5TCCA 2BD7A 6GCHG 1AU8A 1HXEH 1TLDA 4XRNA 4BXSA 2A4OA 2Y82A 4WH6A 3OFND 1ZLRA 2JDID 3NXPA 4OS2A 4UONA 2PSXA 4THNH 3T2NA 1IAUA 4BAMB 1A5IA 5HYOA 3DCLA 2HVYB 3PTNA 3W95A 4ZCNA 1C1VH 2K1QA 3CENA 1BMMH 2Z3EA 1UTMA 4XE4A 1Q2WA 1SGEE 1H8DH 4H4FA 3EGKH 1U6QA 1CA0B 2ZDMA 2ZHFH 1J16A 3GDUA 1O3KA 2GZ8A 3K6ZA 3SJ8A 2FOMB 3A7VA 1SGDE 1TRYA 3PLKA 3GY6A 2YMSD 3Q00A 3RM0H 1C5OH 1WXRA 1DDJA 3ATKA 3MU1A 3QTVH 2FO9A 1IOEA 4LK4A 2R2MB 3SV9A 5LGOA 3TK5A 3O8CA 1ZPZA 3SZEA 7GCHG 2XYAA 3M5MA 3FFGA 2A2QH 1AE5A 2G00A 1DY8A 2NU0E 1NRRH 2BD8A 4NIWA 2EY4C 3BTWE 4X2WA 3ODFA 4UFDH 3NRLA 4Q2KA 3TJNA 2BOKA 3U8OH 1GVZA 2W7UA 1E79D 1WU1A 3L6PA 3RXJA 2D8WA 1HCGA 1LPKB 4JYVH 1O2YA 1V2PT 1AMHA 3F3BA 4RI0A 2A5IA 5DP3A 2NU3E 2BDIA 4Z0KA 4GHTA 2VIQA 2GDDA 2M5TA 2SGQE 4Q63A 1MAXA 3HK3B 3QLPH 3LONA 4XFQA 3SU2A 1DUEA 4F4OC 2HNTC 2ZFSA 2FPZA 4J1YA 4D7FA 2TGTA 4AFZA 3A87A 1HJAB 4MG3A 2WPJS 1GJDB 5DGJA 5C0UA 1P0SH 1W7XH 1A2CH 2FOBA 2QF5A 5EW2H 2A7JA 2GMTB 1TONA 3SW2B 3ZZAA 1SMFE 2FYRA 4O97A 1GBAA 3P70B 1L1JA 1HPGA 4AB9A 1NFUA 2BY8X 1HAVB 1QCPA 2V35A 4X1PU 4CBOA 4XBDA 1GBIA 1AGJA 4IMZA 2FEQH 3C1KA 5DP5A 2JETC 3OEHD 2J98A 2A4QA 1VKYA 4B71A 3HGPA 1D3PB 1HJ8A 3ZVFA 1K9OE 1QFKH 4WMDA 1E34B 3RMOH 1ZTLA 2CHAC 4A1TA 3SN8A 4RN6A 2BD2A 2FWWA 3UQOA 3MMGA 1G9IE 1GVKB 1VR1H 2EQNA 2KFWA 2FI5E 3TNTA 4ABHA 1O2XA 3GY8A 1KMHB 2HGTH 1O3HA 3STIA 5A8YA 2NU1E 4LOYH 4DCDA 1NU7B 1Y3XA 4Y0ZE 4ABDA 4O3TA 3GY7A 1PPEE 3BN9A 5H4IB 3MNSA 1S5SA 3ZYDA 1SLXB 2AGEX 3U69H 4X8TH 1FN8A 1QNJA 4HFPB 5GDSH 3MHWU 4WVPE 5AF9H 4Q4LA 3KL6A 5FAHA 5E8EH 1V2NT 2ZU1A 1S85A 2PV9B 2SGAA 1UHBB 2C3SA 2HVXA 2XC0A 3IITA 3VEQB 5A8ZA 2B7DH 1HAPH 1LCYA 1QBNA 1LHCH 2Y6TA 2ZFPH 1BITA 2HNTF 2SGEE 1P10A 1TWXB 6CHAC 1ARBA 1CHGA 2DUCA 2J5UA 1A61H 5C17A 2R3UA 2QY0B 1C9PA 4TSFD 3P8GA 1QGFA 4Y71A 3WY8A 2A7CA 3M7UA 4K5ZA 1C2EA 1V2ST 2CJIA 2ZFRH 1THSH 2W5EA 4GPGA 2BDGA 3UREA 4TPIZ 1AWHB 3UFAA 2JH5D 2EI8A 3LC3A 2H2ZA 4MPUA 2ZFFH 4B2BA 4X2XA 3MO9A 1KXEA 1SGCA 3I29A 2QF4A 3GCTG 1Y59T 1XUJA 4I7YH 1H9HE 1IQHA 3RC5A 2BOHB 3SUGA 2EI7A 5EPYA 1C1SA 4AG2A 1L4ZA 3LH3A 2VWMA 3SBKA 2I6SA 1IHSH 1AFQC 5F8XA 1AFEH 2AMDA 1GDUA 3SJOA 2ZI2H 3OTPA 1SQAA 3ESTA 1DOJA 1MQ5A 1EPTA 2GGVB 2BHGA 2XCFA 1INCA 4AN7A 1GI3A 1QHRB 2H1UA 2K0QA 1DXPA 1RS0A 4AC9A 1ZRBA 5I25A 4AOQA 1LHEH 3BG8A 1PYTC 1T7CA 3PV5A 1O30A 1FN6A 5GCHF 4HG6A 5EODA 2OINA 3SQEE 3STJA 1ZHPA 2C8ZB 3OY6U 1EAWA 1ACBE 1K1IA 5L2YH 4MTBA 2ZFTA 1SHYA 4K2YA 3EA8A 1XVMA 4GSOA 4B6EA 1TNIA 2BYAX 3UY9A 1QA0A 1IQMA 2ANYA 3RXMA 5EJ1A 3SUEA 2P3UB 3B23B 3MI4A 4B76A 3RLWH 2CF8H 1O2OA 1SGIB 2ZPRA 1V3XA 3ZVAA 2G5NA 2ODQA 1HNEE 1BMLA 2IOTA 5KECA 1P11E 3A85A 2PKAA 2G4TA 1GHAF 1NZQH 1UCYK 4HTCH 1THPB 1W0ZU 5C94A 1FAKH 2PR3A 1O2RA 3RXUA 4ABGA 2BQ6B 3RDZA 1C1MA 1GJ7B 1TALA 2V3HH 2ZHEH 2UUFB 1N6YA 2L74A 3TIUA 1BRUP 1P2KA 4KTUA 2WV9A 1EX3A 2F9UA 5DSFA 1O5BB 3MYWA 1QTFA 1P12E 2A1DB 1EPTB 3PLPA 2F9PA 2ZQ1A 1W7GH 1W11U 3FVFB 4GCHG 1AO5A 5GNDA 3DT0H 5EW1H 1SC8U 2ILNA 1AKSA 2VIPA 4WWYA 5DG6A 4Y76A 1ANDA 2W3IA 1B5GH 1CVWH 2O8TA 4B2CA 1C2DA 3H5CB 2O9QA 5T1VA 2ZDVH 3UQVA 1C5QA 3KQCA 4WMEA 1GHYH 1Z6EA 5FXLA 5C0TA 5EIYA 1UVPA 4X1SU 3SU5A 1GGDC 1BQYA 1JIRA 2WUBA 2J94A 2OK5A 2WYJA 3F2FA 3O8DA 2A4GA 3RLYH 2BVSH 2QCYA 4YXWD 5T6DA 3URDA 1BBRH 4I8JA 1MQ6A 3QTOH 4CHAC 3OTJE 4BAQB 2THFB 1JRTA 2PUQH 3RXGA 1QR3E 1O34A 2FDAA 2KCPA 3A82A 2PFEA 2BMGB 5JB8S 1EP5A 1Z8RA 1PPCE 2J98B 1FX0B 1EXFA 4FOUC 4NZQA 3RXOA 3F2GA 5DO4H 1IQFA 1MTSA 1TQ0B 2OUAA 3DUXH 3SOSA 1A5GH 1P04A 5C2ZA 4E7NA 3RU4T 1H1BA 1ZJKA 2VU8E 1Q31A 2SNVA 1G3EA 3SNAA 4YO9A 1FY4A 3Q3XA 1CT0E 1PQAA 4XD7D 1OWDA 1RTKA 1PPBH 4TPYA 1T31A 1UCYE 2BLWA 4DVAU 1ANCA 5C1UA 4YT6H 2BM2A 1EZXC 3BG4C 3RXFA 5DP4A 1DE7H 1TB6H 1V2TT 1A0JA 1EB1H 1QURH 1UTPA 4B74A 2QC2A 2R0LA 3VGCC 1IQIA 1BJVA 2O8MA 2BB4A 1BIOA 2BTCE 2HPPH 3EDXB 3MNCA 1G37A 1GJ5H 1DFPA 3K65B 1SPJA 1GBHA 3TJUA 2FS9A 2XWBI 3C27B 2A7HA 2C93B 1BDAA 1C5PA 4BAOB 4DT7B 2ZCKP 1CU1A 3RXHA 1B0EA 5CHAC 1AWFH 4NIVA 5HKKD 1QZ8A 4JZ1A 1QL8A 1EOLA 3UNSA 1MZAA 3FZZA 1QB6A 1VITG 1YGCH 3QK1A 2FXRA 1KLTA 2XOKD 1MD7A 4WF8A 1DX5M 1EAUA 1IQGA 2FX6A 2QA9E 3RC4A 3TPIZ 3BTKE 1CO7E 3BTTE 5DP7A 1CBWC 1SGPE 1NU9A 1P3CA 3LJOA 1FUJA 5T6GA 5SGAE 1O3MA 3GCNA 4YTAA 1TX7A 3RC6A 1FONA 1Y8TA 5CE1A 1FY8E 2YNAA 4F48B 1F92A 1WAYB 1C1RA 1P02A 2KCAA 2Y7XA 4Y6DA 3U98H 3M37A 2C8XB 2ZG0H 1F0SA 1NT1A 3BTFE 4GHQA 4DOQA 3BEUA 3TH2H 4FUJA 1A7SA 2GD4B 4I33A 2QAAA 1BB0B 3ZVEA 2Y80A 1DITH 1J9CH 4Y8ZA 1Z71A 3S7HB 2FOGA 3M3SA 1K1JA 3I78A 1FV9A 1GI6A 2HWLB 2ANKH 3GICB 1K0HA 5JYIA 2VINA 2A31A 2VIDA 3MH6A 1CE5A 5C20A 2O8UA 1OP0A 2GTBA 3KQEA 1O5EH 4X8SH 2HLCA 2PWXA 1MBQA 1TMTH 1CHOG 1LKBA 3OY5U 3VGCB 5FBIA 7ESTE 3DFLA 1O2KA 1V2UT 1ELFA 1AQ7A 3AASA 3ATLA 1MTNC 4TT3D 1ZPCA 3ELAH 4A1XA 2IPHA 3TLOA 1GI4A 5JBCS 4FUIA 3NZIA 2WPKS 5DKMA 1QB9A 1V2KT 2DE9A 4CRGA 1TE0A 1E1RD 3H7OA 3T28A 4JMYA 4ZROA 1A46H 4OGXA 1HAXB 5T3HA 4LZ4B 2FM2A 1VZQH 3Q3YA 2ZHWH 1G3BA 1GI2A 1YY3A 1YF4A 1K28D 1GHWH 1O2ZA 3MH7A 3U8RH 2FS8A 1W12U 4CREA 2GKVE 3LIWA 1TA2A 3O8BA 1LQDB 1IHTH 3PRBA 3PV2A 1MTNB 1O36A 1GMHG 1AKSB 3A8AA 1J8AA 2SNWA 8ESTE 1XMNB 1NN6A 4Y7AA 1MTWA 3PLBA 2KM0A 4INLA 1LVMA 3K9XB 3RXDA 1UK2A 2BD9A 1NRNH 3GY3A 1G36A 4P02A 1CGJE 2ODPA 1QRXA 1T8NA 1T8OA 1C1NA 3F9HA 3S69A 3UB0A 2FLRH 5EXNA 2IPQX 4ZKNU 1WCZA 1BHXB 3GISB 5E2PA 1TBRH 3M3VA 1HAHH 4HZHA 1K1LA 1KSNA 5HGGA 1OWIA 1GBLA 2KAIA 3KN2A 3PWCA 8KME2 2QV1A 1O5FH 5CDFE 3AW1A 4WMFA 4ZXXH 4B73A 4FU9A 4UFGH 2SFAA 3PYHA 1O0DH 5C5OA 2OBQA 3RM2H 3U9AH 1YPGH 1NS3A 3BEFB 3NCLA 1EJNA 4CH8B 1TNJA 2H9HA 2ZKSA 3P8NA 2KZ4A 2GV7A 1KDQB 1S0QA 3ODDA 2GT7A 1MH0A 2P3TB 1T4UH 4I31A 1MZDA 2BVRH 3RP2A 3AK5A 1K2I1 1ZPBA 2G5VA 1EZQA 1QRWA 1C4Y2 1TYNA 1ELTA 1GMDG 1ID5H 2PP6A 3QDZB 1FDPA 3WWBA 4DT4A 2BZAA 4H6SB 5HMAA 2QXJA 2Z94A 1XKBC 3UIRA 2L6OA 4NZLA 1P09A 1ZYOA 5DJ7A 1SGFA 3SORA 2ZPQA 3GYLB 3GCHB 1NESE 1GBKA 4NA9H 2UWLA 3A8CA 1LQEA 1NY22 1QQ4A 2DE8A 3SGAE 3LH1A 1PJPA 2KAIB 1YLDA 4B1TA 1MAYA 3A7XA 4K60A 1Y3VA 1XXFA 2BX4A 3MU0A 3P17H 1O33A 1GI5A 1H9IE 1TNHA 5GCHG 4YESB 1F0UA 1LVBA 3BG4B 2JIZD 3NK8A 3GCOA 1D4PB 1K1PA 4GUXA 4X6NA 1QB1A 4AFQA 2H9TH 1ZMNA 2BLVA 3IG6B 1BTXA 2YNBA 2OD3B 3B8JA 2D2DA 2FODA 1MCVA 5L30H 3N7DA 2OLGA 3QWCH 2BQWB 1SKYE 2A5KA 2FOCA 2VH6A 3VXFH 1QY6A 1TQ7B 4ACAA 3V3MA 1SGYE 3CS7A 2V3OH 2F4LA 1Z1JA 1AVGH 1C5ZB 2BDBA 4Y7BA 1LMWB 2C8WB 3PWBA 1RIWB 4O03A 4X1RU 5AVDA 1GI9B 1S6HA 3QZQA 4K3JA 2O8WA 2YOLA 4ZHAA 2ZA5A 3T29A 1V2WT 1C2IA 3MO6A 3UR6A 3E8LA 4BAHB 1Y5UT 1YBWA 4Z6AH 1RIWC 1E35B 3ZVGA 1LKAA 1SHHB 4AGKA 2GCTB 1QL9A 5EU8A 4YOIA 1YCPH 2ODYB 1PPZA 3U1IB 4ZHLU 1FQ3A 4FUCA 1J17T 1O2WA 4CRCA 1ELGA 2AH4X 2AIPA 1DM4B 4R8TB 1JBUH 5GWZA 1O39A 3D62A 3GY5A 3GS9A 1YYY1 3L33A 1KYNA 4KP0A 4GLYA 4O3UA 3UUZA 2ZU3A 4FUBA 3SNDA 2H9EH 1D6RA 3TJOA 4AFSA 4CHAB 4MNVA 2KR7A 4K1EA 5K0HA 1ELDE 8LPRA 1DWBH 1YPEH 3S0NA 3TNSA 2JJ1D 3Q3KA 4UFFH 1T4VH 1UVTH 3SGQE 3LT3A 4IGDA 3SU3A 4ABAA 4X1NU 5EXLA 1OP2A 1EUFA 1EQ9A 4MPVA 1ABJH 5C1YA 2ZWLH 1C5TA 2Z9LA 2ZECA 1QJ6B 1YCPK 3KIDU 1BOQA 3FO8D 1OWEA 2V3MA 2ZU4A 3K2UA 4KTSA 4MLFB 4H6TA 2PTNA 1GBMA 2BDYA 3UNRA 4AYYB 4XBBA 1OXGA 1ESBA 1AVWA 5DP8A 4TWWA 1S81A 3ZZ5A 1C1PA 2ZGCA 1HGTH 1NFWA 4WXVA 2XW9A 2Q6DA 4YLQH 1BTPA 2BVXH 1E38B 1ZTKA 1DWCH 2Y5HA 1BMFD 3PRDA 3MU8A 3LGYA 3F9GA 4NWKA 1OP8A 5TJXA 2WSSD 4SGBE 1TRMA 3EYDA 1ZGIA 2EA3A 2A4RA 3N7EA 2FOHA 1DT2A 2Z3CA 3HGNA 1Z1IA 1QBVH 1LVOA 4GVUA 2QN5T 1DUAA 2YMSC 3K6YA 2RG3A 3VB5A 3Q77A 2EC9H 1E37B 1IQEA 1KIGH 3U28C 2P8OB 4NSYA 2TBSA 1PQ8A 1L4DA 1TMBH 5B6LA 3V0XA 2VIWA 3BV9B 4NG9H 3ZVBA 4B75A 1XXDA 2VGCB 3PROA 3F68H 1C2KA 1Z8IB 2P16A 4Y8YA 2AS9A 3MH4A 2RDEA 4ISHH 1L2EA 1YKTA 2C8YB 3RXBA 1SR5C 2F91A 4Z1MD 1F5KU 1CGIE 1SLVB 1C2MA 2WPHS 3LC5A 4K1SA 4DY7B 1V2JT 1S84A 1XKAC 2M2AA 1TPOA 1A1RA 2QF0A 4AYVB 4A1VA 2Q1JA 4GCHF 4NSVA 1GHAG 1C1QA 1NBMD 3ZV8A 1MMJN 1BT7A 1AUTC 1GJ6A 1GI0A 2WV4A 1DANH 1GJCB 1K21H 1KTTB 3B9FH 1MKWK 1PQ5A 4NIXA 1TIOA 4IN1A 2KCYA 3TVJB 1C5MD 1C5YB 4BNRA 3PMBB 3GDVA 1JMOH 1NROH 1O2LA 3A81A 3H7TA 2BQ7B 1SFIA 1EASA 1TRNA 4FU8A 1AFQB 5F8TA 4CRBA 4D9QA 1HJAC 1TMUH 4TY6A 2ZHDA 1HAYB 1ZR0A 4FUDA 1FXYA 2QXGA 3CP7A 1G2MA 3MNBA 1OWHA 3V13A 2P59A 2UUYA 3P95A 4CR5A 4OGYA 3E0PB 2QF3A 1MU6B 1ZOMA 2ZEBA 2WYGA 2BDHA 1A0HB 4SGAE 2AMQA 2BX3A 3A8BA 1G32B 7KMEH 3G01A 5J4QA 4JYTA 2PUXB 3TJVA 3KNXA 1G30B 4IC6A 1UVUH 4X1QU 5JPMH 1V2VT 1Y5AT 2AGIX 3ZZ6A 4K1TA 4Q7YA 1WTHD 2R0KA 1MUEB 1W14U 2BDAA 3P6ZB 1SL3A 1SLWB 5GPIB 4YOJA 1P2OA 2ZU5A 1F0TA 1HAVA 1UTNA 3FZDA 1H8IH 5TCAA 4TYDA 1DWEH 1YPHE 1NO9H 3ZZDA 1XUKA 2BXTH 4UE7H 2ZPSA 4I32A 1O5CB 2SGPE 3GCHC 1EB2A 5L2ZH 2RA0A 2Z9KA 2VJ1A 3D23A 1O3FA 1YLNA 2FOAA 1MTVA 4B2AA 2BY5X 2WINI 1AB9C 3SO3A 3VB4A 5FX6A 1FZZA 2ZDNA 3EAJA 3BF6H 3FANA 2ZGXH 3KYFA 1GHXH 1HAIH 2OC0A 1OWKA 1GBBA 3ZVDA 4XOJA 1D6WA 3QZRA 1K22H 1Z6JH 3OSYA 2VVCA 2GJGA 3A83A 1E1QD 1UO6A 5FCKA 2FZZA 2H5CA 1UK4A 5A0CA 1W13U 3RXSA 1NRSH 2J34A 4NFEA 1PYTD 4OS7A 1SQTA 4IN2A 1SSXA 1GBTA 1TBZH 3LU9B 2XBXA 2G8TA 4ZXYH 2GP9B 1K1NA 3A8DA 1H8HD 4NIYA 4DJZB 1HAZB 1V2QT 2A32A 2J9NA 3HK6B 2BXUH 3SNBA 2QIQA 1TBQH 2W26A 2GMTC 2FOEA 1ZJDA 2XBWA 4FUHA 2Q6GA 4XSKU 3T5FH 1O3GA 5DP9A 1ETSH 1WBGB 1O35A 2F83A 2RDLA 5JDUB 1OHHD 2HOBA 4HGCA 1S82A 2VVVA 1P05A 3TK9A 5JBTA 4E7RG 3DFJA 2KX4A 3M35A 1C2FA 1MKXK 1BMNH 1O3CA 2B5TB 1ELAA 2UWPA 2F9BH 3ENSB 3F1SB 3M7QA 3U1JB 5HM2A 3PO1B 1VITH 3VXEH 2PTCE 2HRVA 1FJSA 1C4V2 2XNDD 1WSSH 1GHVH 4DIHH 1UHBA 1NFYA 1ZSKA 3GY2A 2J4IA 3OAAD 4X0WU 4D8NA 1VJAU 2GZ9A 1DSTA 2OQUA 2PKAB 2FI3E 2VIVA 4FVBA 1ESAA 4AG1A 1GHZA 1GI8B 1BRBE 2JH0D 4ISIH 4DIIH 3A84A 1AN1E 1W2KH 4OM9A 2ZTXA 5FHTA 1ZRKA 1ZZZA 4BANB 1CHOF 3BTEE 1AHTH 1GMDF 1TOMH 3UOUA 2VWOA 2FIRH 4E06H 2J97A 4BTTB 2XNIA 3VB3A 3KQ5A 3JZ2B 1P3EA 5EPNA 3URCA 3GYMA 1ESTA 4VGCB 4ZH8A 3DSOA 1SBWA 4I86A 1VCPA 1TA6A 2W3KA 2ZDKA 1L1NA 3RMLH 1BTWA 1YC0A 2ALVA 4CRFA 1ELVA 3Q76A 1AUJA 1HJ9A 3OEED 1WOFA 5ABWA 2ZFQH 1GCTC 2B9LA 1SI5H 2ESTE 2AEIH 5E0HA 2BD4A 3FAOA 4MNYA 3D49H 2ALPA 2CK3D 1ETTH 1TGBA 2P95A 3LGIA 3FOAA 5FCRA 2OC8A 5JB9S 3PTBA 5G4BA 1GHBF 4NWLA 2WUCA 3HATH 3TU7H 1WUNH 1MKXH 4WJG2 4AORA 1TNLA 4OS1A 1GCDA 2FP7B 4R0IA 2H6MA 1UTJA 3A80A 3KQDA 1N1LA 1HXFH 1GMHF 2TGDA 5DPAA 2GZ7A 2AGGX 2QYIA 1CT2E 4CBNA 1G3DA 3IWMA 1DS2E 3TK6A 3SHAH 1ELBA 1NRPH 1GJBB 3WW7A 5EJZA 2F9VA 2VB0A 2XRCA 2PW8H 1P01A 1VJ9U 2A45B 5FX5A 5DN6D 3SUDA 1LDTT 3SI4H 2UUKB 5DK1A 3UWIA 2AHME 4Y11E 4CRAA 2IJD1 1O2IA 5GIBA 5ETXA 1W0JD 3HKIB 1LHDH 2WZQA 1P57B 1A0LA 1KTSB 1D9IA 1TGNA 1UVOA 1TAWA 4UD9H 1NC6A 4X2VA 1SGFG 4A92A 3T62A 1BRCE 4CH2B 4X8UH 1C1OA 2ZGBH 4WXIA 3LGUA 2PLXA 2A0QB 2BD3A 1O3OA 5E0GA 1E36B 2F9NA 3OU0A 2ZNKH 2PGBB 1LHGH 1IQLA 1RTFB 1WQVH 4Q80A 3U8TH 3SUFA 1GL1A 1FPHH 3ZVCA 2QE7D 2WPDD 3HPTB 3LKWA 1O32A 3NPSA 1LVYA 5J4SA 1THRH 1GBDA 3PMHB 2ZDLA 5C5NA 5LPEA 5FPTA 1KXCA 4ISNA 4M9FA 3MU4A 4U01A 1O2VA 5EXMA 2G55A 5KGOA 3BIUH 1ANBA 3SV2H 4HI3A 1C1UH 1UVSH 4YLUA 3SNEA 1GCTB 1OYTH 5HIZA 1SB1H 1A4WH 2J38A 2TPIZ 2LELA 1RTLA 2CXVA 1YLCA 3KF2A 3V12A 2BY9X 4IC5A 4PROA 4AGJA 3RXLA 1P9UA 2W7SA 2WPMS 1MKWH 4A6LA 1CGHA 1GPZA 1MABB 1CQQA 3FN8A 3KYGA 3RXQA 3S9CA 1YP9A 1O3DA 4RT0A 4GAWA 4IMQA 1MU8B 2AIQA 3AVZA 2I6QA 1O2UA 2WPIS 2Y5FA 5A09A 1F0RA 3PM3A 3SI3H 4IW4E 2J2UA 2F9OA 2TRMA 1ABIH 3LGWA 3TITA 5K7RA 4INKA 3F0OA 5FPSA 1ZHRA 4K69A 4INHA 1QA7A 1GBFA 3BTDE 3BTQE 4Y79A 3TH4H 3JZ1B 2CMYA
chains in the Genus database with same CATH topology
1RXPA 1TPSA 1ZSJA 1EAIA 1TOCB 1P9SA 1NTPA 2HALA 1W3CA 3BTHE 2ZP0H 1SOZA 4MDSA 5IDKA 1EJMA 5L6NH 1AI8H 1DY9A 1GBJA 4JK5A 2G4UA 4U30A 1EZSC 1IQKA 1H9LB 4ASHA 1TNKA 3ATMA 2VVUA 3NUMA 5A8XA 4I8HA 1TGCA 4DG4A 1LHFH 1BCUH 1GMCG 5EQSA 3KCGH 1CSOE 2RA3A 3A7TA 5LH8A 1BRAA 2Z6BD 3SHCH 3ZZ3A 2AERH 4FU7A 3S9AA 1O31A 4CR9A 1XUFA 3ZYEA 1XVOA 1OKXA 1K1MA 5AFYH 1SQOA 4MQAA 4DW2U 1HAGE 2HPQH 5A2MH 1Y3YA 3MNXA 4X6PA 2OBOA 3SZNA 1IQJA 9LPRA 9ESTA 1D3DB 1RRKA 3ZZBA 1TNGA 1P06A 2ZTZA 1XUGA 1FAXA 2PHBA 5LPFA 1KXFA 4WY3A 2VNTA 3VB7A 2Y5GA 2GDEH 2Y81A 1O37A 2AYWA 1DWDH 1AB9B 6GCHF 1DICA 4I8LA 4Q7ZA 2HNTE 3RXIA 4JCNA 1C2LA 2XCNA 4MVNA 4Y8XA 1MTUA 1EAXA 6LPRA 2PGQB 5GJ4B 4X8VH 1FY3A 2STAE 2R3YA 1EATA 3SV8A 1PPFE 4BOHA 3QGJA 3RXCA 3KEEA 1AZ8A 1FI8A 2G51A 4YM9A 1ORFA 1VITF 2FMJA 3TGKE 1GMCF 1KXDA 1C2GA 3UTUH 4X6MA 4CRDA 4ZKSU 1ZMJA 4Q7XA 1OSSA 1SGQE 1RJXB 5CHAB 2PKSB 3GCTF 2ZGHA 3E1XB 2OCVB 4U2WA 3V7TA 3NWUA 2TGPZ 2CGAA 2OC1A 3MH5A 2V0BA 5JBAS 1J15A 2ANMH 2A5AA 5BRRE 6CHAB 3A89A 4IS5A 5EOKA 1WV7H 1XM1A 1V2RT 1EKBB 4ABFA 3P8FA 1O3AA 3DD2H 2ZU2A 2CV3A 2Z3DA 4ESTE 1D3QB 1C5XB 4JZFH 1PQ7A 3OYPA 1AE8H 2C90B 1O2MA 1K1OA 2Z9JA 5EG4A 1GHBG 3W94A 1BTZA 1SGRE 2GCTC 1F7ZA 3VPKA 3PMAB 4ZMAH 1OX1A 1NFXA 1TPAE 1KXBA 4RKOB 4IBLH 1V2MT 1JWTA 4DGJA 4YT7H 1DVAH 2IJOB 3KGPA 1BTYA 3E16B 2A2XH 1DLEA 1O5GH 3RXAA 1B7XB 1ELEE 4KTCA 1Z8JB 3ZZ8A 4ABBA 4LZ1H 1G2LA 1JRSA 3EE0B 2VWNA 4FUFA 3ZZ7A 2FESH 2CF9H 1NM6A 4AX9H 1GI1A 1O2TA 2P94A 2WPLS 3QO6A 4WH8A 1A5HA 2CHAB 3LOXA 1FY5A 1SGNE 1SGTA 4TY7A 1J14A 1FIWA 3LGVA 5EGMA 1N8OC 3DHKH 3MO3A 2JETB 2LPRA 3RMNH 2C4FH 2BLQA 3SU6A 1O2PA 1EOJA 3P92A 1L0ZA 1YPLH 2XC5A 1MD8A 1W0YH 1G3CA 1W8BH 5F6MA 3ATIA 1TX6A 1SLUB 1CT4E 2GV6A 1S83A 1BUIA 2NU4E 3UR9A 1H4WA 3LJJA 1NPMA 1WYKA 4D7GA 3LGTA 4KGAA 1B0FA 1GWAA 1UK3A 2G81E 4D76A 1KDQA 2FTMA 1GG6C 1TGSZ 2H5DA 1QQUA 4ISOA 2FLBH 2ZO3H 3AAUA 4F49A 2BZ6H 1GL0E 1L1GA 4AZ2B 6ESTA 4JZDH 1HFDA 1W10U 1ETRH 4NCYA 1O2SA 3SJIA 2PKSC 2OQ5A 2XC4A 1JOUB 2BY6X 3S7KB 3GY4A 1P2JA 5I46H 1ZMLA 1UTQA 1O3LA 2ZDAH 3R3GB 1LO6A 1QJ7B 4Y10E 4ZUHA 1BBRK 2QXHA 3M3TA 2ZQ2A 1OS8A 2ZIQH 3E0NB 1C4U2 3ZZ4A 1DPOA 3EQ0H 1GG6B 4D9RA 3NKKA 2NWNA 3PMJA 1WTGH 1IQNA 1NRQH 1DXWA 3F9FA 1Y3UA 1GJAB 3BIVH 1C5NH 1HUTH 2V6NA 2Z9GA 2F3CE 1PFXC 2ZC9H 2GX4A 4OS6A 2D1JA 8GCHG 1T8LA 3RXVA 1V2LT 3SU1A 4ZAEA 1P2QA 3ATWA 1EP6A 3ZZ9A 2Y7ZA 3E6PH 1RD3B 3M61U 4VGCC 1C5VA 1O3JA 1YCPM 4FUEA 2ZTYA 1OWJA 4RKJB 1A3EH 1F5LA 2Z9IA 4YZUA 3L3TA 2R2WU 5EQRA 2BDCA 3E90B 4FUGA 3BSQA 1HLTH 2STBE 4I8KA 3T25A 5C3NA 3OX7U 2GVFA 1GI7B 3RXTA 1ELCA 1VGCC 3M5LA 1AY6H 1F5RA 3QN7A 4LXBH 4FXGH 5BPEA 1EZUC 1SOTA 1C5LH 2JH6D 3GDSA 2TIOA 2O8LA 4ISLA 1UTKA 4MNXA 3A7YA 1RFNA 3S9BA 2Z7FE 1C9TA 1SVPA 3ZV9A 1HYLA 4K8BA 1QIXB 1UCYH 2LNCA 8GCHF 4BTIB 3SV6A 5LPRA 2ASUB 2J95A 4NGAH 2G52A 1M9UA 1QJ1B 1O2GH 2XBYA 4ZKRU 1HB0B 4A5TS 1UMAH 5E0JA 1FLEE 1FNIA 3PV4A 1Y5BT 3T27A 1C1TA 1YPMH 3MU5A 3PB1E 1HV7A 4XBCA 3LDXH 4X6OA 3SNCA 1ZTJA 3RU4E 4KKDA 4MPXA 1OYQA 2XWAA 2QGRA 1XUHA 1BBRE 4A7IB 1O3PB 4E05H 3UNQA 2UWOA 5PTPA 2EI6A 2OC7A 5HM9A 1MBMA 3M5NA 1C2HA 2ULLA 2FYQA 1JIMA 1KLJH 1GBCA 2OTVA 3QUMP 1P03A 2OXSA 4DURA 4BTUB 4H42U 1PPHE 3E3TA 1UTOA 5ESBA 1SFQB 2XBVA 3T26A 2VIOA 2QXIA 3UOPA 4QT8C 3M7TA 4UEHH 1HDTH 2B8OH 3AW0A 4AFUA 1OOKB 1O3NA 3QX5H 3UPEA 5HXFA 1C2JA 4JK6A 4NA7A 1O5DH 1C1WH 5CMXH 1BTUA 1TX8A 1CBWB 3RXRA 3SQHE 3RXKA 1O2NA 3AAVA 1MCTA 1RGQA 2OP9A 1YPKH 3A7ZA 1DLKB 5IYTA 3HKJB 1QBOA 4K8YA 1KY9A 3A88A 4U32A 1GJ9B 2BLOA 1O3IA 2WV5A 4X2YA 3SJ9A 1O2JA 3MTYA 4Y0YE 1XX9A 1GDQA 1V2OT 4UFEH 2ZZUH 4UDWH 1C5RA 1HAOH 1WQSA 5EQQA 3I77A 3RUOA 1ZGVA 3TH3H 1LTOA 2ZHQH 4J2YB 4OS4A 1GJ4H 3F9EA 1XUIA 5C1XA 2VWLA 1C5WB 4I8GA 4RSPA 1AIXH 4TWYA 1AZZA 3DA9B 1TPPA 1ZSLA 3RU4D 5A0AE 3RXEA 3SJKA 2R9PA 4BXWA 1O2QA 4M7GA 3TGJE 5FBEA 3MOCA 1ZHMA 1BTHH 1O3EA 3BTME 2FI4E 5A0BA 3SGBE 3PO1C 3QGNB 1Z8GA 3R0FA 2VH0A 1DSUA 1T32A 1TFXA 1BA8B 4JZIA 7LPRA 5F8ZA 1KXAA 1O38A 3ZZCA 1CA8B 1Q3XA 1VCQA 1Z7KA 1N6XA 1S0RA 2PSYA 1A3BH 2ZGJA 3A7WA 2UUJB 1YPHC 2ZCHP 4ABJA 1GDNA 1LPZB 1UJ1A 1BHXF 1VGCB 2P3FH 4ABIA 1FIZA 1OPHB 3BTGE 2GCHF 3F6UH 4BAKB 1BZXE 1JXPA 2D26C 3E91A 4MNWA 3VB6A 7GCHF 1P2IA 4O9VA 3VFEA 2RCEA 3M36A 3SU4A 1ARCA 1AVXA 5T6FA 2VGCC 4MPWA 1GGDB 5FPYA 3P8OA 1C5SA 4OS5A 4XDEA 5AFZH 2P8OC 4FVDA 3D65E 3GOVB 1TABE 1GVLA 1VCWA 2XTTB 1ANEA 2AFQB 3N7OA 1F2SE 4JYUH 3O8RA 5ESTE 3MFJA 1GJ8B 2Q6FA 1FPCH 2IN2A 4KELA 5B6OA 3CS0A 1GBEA 1FY1A 2SGFE 1P2MA 1YPJH 4ABEA 1EPTC 2FTLE 1FMGA 1KLIH 4ZKOU 5C67A 3TGIE 1HIAA 5DP6A 1LPGB 1SG8B 4ZHMU 2GCHG 1PPGE 1T8MA 3KHVA 3RMMH 2AMPA 3EA9A 1QL7A 5GXPA 1YM0A 1C5UA 2NU2E 1O2HA 1E0FD 3FP8E 5JBBS 2ZF0H 3UWJH 1P2NA 1O3BA 2BY7X 1HIAB 3LPRA 3M5OA 1CA0C 1Y3WA 2CN0H 1O5AB 1V6DA 2B0FA 2ZCLP 3ITIA 2GT8A 3MWIU 2ANWA 4JZEH 3A86A 2BD5A 1S6FA 2JKHA 1QRZA 2XXLA 4AB8A 1P8VC 3RXPA 1X7AC 5E2OA 5AHGH 2FX4A 1BJUA 3FP7E 1D3TB 3SU0A 4NA8A 3BEIB 3EA7A 1BMAA 2P93A 1EJAA 3KQBA 3SV7A 1UTLM 2J92A 1AD8H 2EEKA 5F03A 2SGDE 3FP6E 4NFFA 1HRTH 2FOFA 4YOGA 1TGTA 1HBTH 1N8OB 2TGAA 5TCCA 2BD7A 6GCHG 1AU8A 1HXEH 1TLDA 4BXSA 2A4OA 2Y82A 4WH6A 1ZLRA 3NXPA 4OS2A 4UONA 2PSXA 4THNH 3T2NA 1IAUA 4BAMB 1A5IA 5HYOA 3PTNA 3W95A 1C1VH 2K1QA 3CENA 1BMMH 2Z3EA 1UTMA 4XE4A 1Q2WA 1SGEE 1H8DH 4H4FA 3EGKH 1U6QA 1CA0B 2ZDMA 2ZHFH 1J16A 3GDUA 1O3KA 2GZ8A 3K6ZA 3SJ8A 2FOMB 3A7VA 1SGDE 1TRYA 3PLKA 3GY6A 3Q00A 3RM0H 1C5OH 1DDJA 3ATKA 3MU1A 3QTVH 2FO9A 1IOEA 4LK4A 2R2MB 3SV9A 5LGOA 3TK5A 3O8CA 1ZPZA 7GCHG 2XYAA 3M5MA 3FFGA 2A2QH 1AE5A 2G00A 1DY8A 2NU0E 1NRRH 2BD8A 4NIWA 4X2WA 3BTWE 3ODFA 4UFDH 4Q2KA 3TJNA 2BOKA 3U8OH 1GVZA 2W7UA 1WU1A 3L6PA 3RXJA 2D8WA 1HCGA 1LPKB 4JYVH 1O2YA 1V2PT 1AMHA 2A5IA 5DP3A 2NU3E 2BDIA 4Z0KA 4GHTA 2VIQA 2GDDA 2M5TA 2SGQE 1MAXA 3HK3B 3QLPH 3LONA 4XFQA 3SU2A 1DUEA 4F4OC 2HNTC 2ZFSA 2FPZA 4J1YA 4D7FA 2TGTA 4AFZA 3A87A 1HJAB 4MG3A 2WPJS 1GJDB 5DGJA 1P0SH 1W7XH 1A2CH 2FOBA 5EW2H 2A7JA 2GMTB 1TONA 3SW2B 3ZZAA 1SMFE 2FYRA 4O97A 1GBAA 3P70B 1L1JA 1HPGA 4AB9A 1NFUA 2BY8X 1HAVB 1QCPA 2V35A 4X1PU 4CBOA 4XBDA 1GBIA 1AGJA 4IMZA 2FEQH 3C1KA 5DP5A 2JETC 2A4QA 4B71A 3HGPA 1D3PB 1HJ8A 3ZVFA 1K9OE 1QFKH 4WMDA 1E34B 3RMOH 1ZTLA 2CHAC 4A1TA 3SN8A 4RN6A 2BD2A 2FWWA 3UQOA 3MMGA 1G9IE 1GVKB 1VR1H 2FI5E 3TNTA 4ABHA 1O2XA 3GY8A 2HGTH 1O3HA 3STIA 5A8YA 2NU1E 4LOYH 4DCDA 1NU7B 1Y3XA 4Y0ZE 4ABDA 4O3TA 3GY7A 1PPEE 3BN9A 5H4IB 3MNSA 1S5SA 3ZYDA 1SLXB 2AGEX 3U69H 4X8TH 1FN8A 1QNJA 4HFPB 5GDSH 3MHWU 4WVPE 5AF9H 3KL6A 5FAHA 5E8EH 1V2NT 2ZU1A 1S85A 2PV9B 2SGAA 1UHBB 2C3SA 2HVXA 2XC0A 3IITA 3VEQB 5A8ZA 2B7DH 1HAPH 1LCYA 1QBNA 1LHCH 2Y6TA 2ZFPH 1BITA 2HNTF 2SGEE 1P10A 1TWXB 6CHAC 1ARBA 1CHGA 2DUCA 1A61H 2R3UA 2QY0B 1C9PA 3P8GA 1QGFA 4Y71A 3WY8A 2A7CA 3M7UA 4K5ZA 1C2EA 1V2ST 2CJIA 2ZFRH 1THSH 2W5EA 4GPGA 2BDGA 3UREA 4TPIZ 1AWHB 3UFAA 2JH5D 2EI8A 3LC3A 2H2ZA 4MPUA 2ZFFH 4B2BA 4X2XA 3MO9A 1KXEA 1SGCA 3I29A 3GCTG 1Y59T 1XUJA 4I7YH 1H9HE 1IQHA 3RC5A 2BOHB 3SUGA 2EI7A 5EPYA 1C1SA 4AG2A 1L4ZA 3LH3A 2VWMA 3SBKA 2I6SA 1IHSH 1AFQC 5F8XA 1AFEH 2AMDA 1GDUA 3SJOA 2ZI2H 1SQAA 3ESTA 1DOJA 1MQ5A 1EPTA 2GGVB 2BHGA 2XCFA 1INCA 4AN7A 1GI3A 1QHRB 2H1UA 1DXPA 1RS0A 1ZRBA 5I25A 4AOQA 1LHEH 3BG8A 1PYTC 1T7CA 1O30A 1FN6A 5GCHF 5EODA 2OINA 3SQEE 3STJA 1ZHPA 2C8ZB 3OY6U 1EAWA 1ACBE 1K1IA 5L2YH 4MTBA 2ZFTA 1SHYA 4K2YA 3EA8A 1XVMA 4GSOA 1TNIA 2BYAX 3UY9A 1QA0A 1IQMA 2ANYA 3RXMA 3SUEA 2P3UB 3B23B 3MI4A 4B76A 3RLWH 2CF8H 1O2OA 1SGIB 2ZPRA 1V3XA 3ZVAA 2G5NA 2ODQA 1HNEE 1BMLA 2IOTA 1P11E 3A85A 2PKAA 2G4TA 1GHAF 1NZQH 1UCYK 4HTCH 1THPB 1W0ZU 1FAKH 2PR3A 1O2RA 3RXUA 4ABGA 2BQ6B 3RDZA 1C1MA 1GJ7B 1TALA 2V3HH 2ZHEH 2UUFB 1N6YA 3TIUA 1BRUP 1P2KA 4KTUA 1EX3A 2F9UA 1O5BB 3MYWA 1QTFA 1P12E 2A1DB 1EPTB 3PLPA 2F9PA 2ZQ1A 1W7GH 1W11U 3FVFB 4GCHG 1AO5A 3DT0H 5EW1H 1SC8U 2ILNA 1AKSA 2VIPA 4WWYA 5DG6A 4Y76A 1ANDA 2W3IA 1B5GH 1CVWH 2O8TA 4B2CA 1C2DA 3H5CB 2O9QA 2ZDVH 3UQVA 1C5QA 3KQCA 4WMEA 1GHYH 1Z6EA 5FXLA 1UVPA 4X1SU 3SU5A 1GGDC 1BQYA 1JIRA 2WUBA