2ZPQA

Crystal structure of anionic trypsin isoform 1 from chum salmon
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
220
structure length
220
Chain Sequence
IVGGYECKAYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPSSCAPAGTMCTVSGWGNTMSSTADKNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anionic trypsin
publication title A structural comparison of three isoforms of anionic trypsin from chum salmon (Oncorhynchus keta).
pubmed doi rcsb
molecule tags Hydrolase
total genus 50
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zpqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zpqA02
1KYNA 1FIZA 1KSNA 2ZDVH 1F5KU 1ZOMA 3WY8A 4CHAB 4ASHA 2JKHA 2J34A 1GGDB 2H1UA 1OWHA 1F0TA 1RGQA 3ATKA 1LHDH 4DT7B 1TNLA 2ZU3A 3BSQA 2BQ6B 2Q6FA 1SGRE 4BAHB 3VGCC 1ZMJA 2ESTE 4ZHLU 1O3NA 3AAVA 1W13U 5FX6A 1S83A 3EYDA 2BTCE 2Y82A 1SLXB 1FAXA 1GJ4H 4PROA 3SOSA 4AX9H 2FTMA 1KTSB 1ZPBA 3AVZA 3QGNB 2ZFSA 5G4BA 3GCOA 3GDUA 2GDEH 4DY7B 1MAYA 4SGAE 3P95A 2ZPQA 1C5YB 4GCHG 1SGYE 1IOEA 3SU6A 3KGPA 2VIQA 1HAVA 5F8XA 2WPIS 1QB6A 1LPGB 1HGTH 3A83A 4A92A 4K3JA 1JIRA 1C9PA 1SGDE 1ZPZA 2BDYA 3ATMA 1J9CH 1C1OA 3DUXH 1PPEE 1F5LA 4Y8ZA 1AY6H 5GDSH 1EUFA 4WJG2 1GCDA 1T4VH 1O2UA 3MO3A 5DP8A 2A7CA 2VIVA 1T8NA 2STAE 3OY6U 3PMAB 4XDEA 2BX4A 2FTLE 1C2LA 5ABWA 3A7TA 4F4OC 1C5VA 2BDAA 1TE0A 3UNSA 1C2FA 4INKA 2HOBA 2WPJS 4JK6A 4HI3A 4AB9A 2ZFQH 5GWZA 1H4WA 3KQDA 2J4IA 3P8FA 3GY4A 1CA8B 5FAHA 2SNWA 4WF8A 6CHAB 4RKOB 1KLIH 2C3SA 2W3IA 3TVJB 2SGEE 2ZFPH 1BDAA 1TMUH 1GDUA 1G3DA 2ILNA 4NGAH 1TNJA 1DPOA 1GDNA 4D76A 1UTOA 3MH6A 4NCYA 1K1PA 2FX6A 2GZ8A 1D6RA 1F7ZA 1JOUB 1KXEA 4FU8A 1ZPCA 1DWCH 4I8GA 2GTBA 1HB0B 2H2ZA 5EW1H 4B1TA 1UTLM 1AWFH 4FUIA 1SOTA 4KP0A 3T25A 3ZVCA 2ZHQH 1YCPK 4TPYA 5C20A 1UVSH 4I7YH 2A7HA 1NS3A 2BDGA 1O3JA 1YC0A 3A7WA 2YNAA 5L2YH 1TNHA 1UVPA 3STIA 1ETRH 3CENA 3PMBB 3BTHE 3SV6A 3RLWH 2I6SA 2XBYA 2JETC 5EXNA 4BTTB 2ZKSA 1A4WH 4ZXXH 5LGOA 1NFWA 2IPHA 1PQ5A 2Z3EA 1W12U 4KGAA 2W7SA 4F49A 1JIMA 1TFXA 4VGCC 3RXKA 3SNAA 1P9UA 5FPYA 3RXHA 1SHHB 2F9NA 2V6NA 1DE7H 1GJ5H 2GMTB 1HDTH 1QJ7B 4J2YB 2O8WA 3OX7U 3ZV9A 1LVMA 5TJXA 2B8OH 5C1YA 3MHWU 1A0HB 3TK9A 1JXPA 2XCFA 2ZF0H 2ODYB 4CRDA 4FUBA 2AIQA 1O3IA 2GCHF 4ZKNU 3RXSA 2FODA 3VB6A 4NZQA 4FUGA 1Z8GA 1TYNA 3A89A 1LO6A 4YLUA 3LC5A 2AMQA 4FUCA 1O3FA 1MTNB 2R3UA 3A81A 3MWIU 4BTUB 3NPSA 3D49H 1IQEA 3VB3A 2BD9A 3BTFE 4X1RU 7ESTE 4TY7A 3A88A 1GJDB 2HPPH 1SB1H 1DWEH 3NXPA 1H9LB 3I78A 2ZGXH 3SJ9A 4Q7YA 1O2QA 3GDVA 5A09A 1P3EA 1OPHB 2ZG0H 2OINA 4X8VH 2QIQA 5DP4A 3RMOH 2FEQH 4K60A 5E0HA 1Y3XA 1P03A 1T4UH 2ZPSA 1C1WH 1ZR0A 4WMEA 1DICA 1KXFA 1ZRKA 3VPKA 1P57B 1S84A 4NSYA 1C5UA 3BF6H 5A8YA 3NZIA 4MPVA 3BTDE 2BD4A 5DP3A 1XMNB 4J1YA 1HXFH 1PPBH 1LQEA 1YPEH 3M5NA 2Y7ZA 1F5RA 4CR5A 1G3BA 5LPRA 3URDA 1P04A 3GCTG 1O36A 1GJ9B 2ZZUH 5FBEA 4Y76A 1OOKB 1SC8U 4SGBE 1MQ6A 2TBSA 4FXGH 5EQSA 1W7XH 1Z6EA 4A7IB 1VJ9U 3OU0A 3M35A 3GCNA 4DJZB 1O38A 2BXUH 3IG6B 2PHBA 1TALA 1S82A 2VJ1A 4MNYA 1HIAA 5FCRA 3SJOA 4UD9H 2FOGA 3T29A 2QY0B 2OXSA 2F9BH 2FYRA 4X8UH 8GCHF 1HAYB 1BCUH 1FY1A 5L2ZH 1K1JA 3HKJB 2ZO3H 3BEUA 1GI9B 3MI4A 1ZMLA 1FIWA 2A4QA 2OC0A 4U01A 1MBQA 1C5PA 2AH4X 1VGCC 1H9HE 2Y7XA 1RD3B 2FIRH 1IQKA 1SG8B 1EXFA 1C1UH 1TNKA 3A7VA 4OS2A 5J4SA 1DDJA 6GCHF 1DY9A 2XC5A 4KTCA 3BG4B 2BD7A 1QR3E 1F0RA 1SQAA 3DHKH 4GHTA 1C5TA 5IYTA 2FDAA 2ZCKP 5FXLA 3VFEA 2AGEX 1G36A 3HGPA 3M37A 3DFJA 5FPSA 1FN8A 1WBGB 5EXLA 1Q2WA 2QYIA 1C2MA 1UTQA 2Q6GA 3FAOA 1BB0B 2F83A 1DSTA 3LGWA 1GBBA 4IN2A 5I25A 1ABJH 2ZGJA 1VCQA 1K9OE 3ENSB 2GCTC 4XFQA 3SQHE 1G9IE 2H5DA 4YT6H 1W2KH 3RU4E 3F68H 1MKWH 2ZA5A 1XUHA 3K65B 4NFEA 2BDBA 1BBRK 2ZCLP 3SV2H 5B6OA 1YM0A 2VNTA 2AIPA 3RXCA 7KMEH 1FDPA 4BAOB 2PSYA 1KXBA 2P3TB 4OS7A 1UHBB 4TPIZ 3SU2A 2FS8A 1O3GA 5EQRA 3A84A 3N7OA 1MCTA 2QC2A 1KDQB 1DX5M 1O3HA 2OCVB 4MPXA 2A7JA 1CT4E 1TOMH 1G2LA 4GUXA 1BJVA 2GDDA 1VITG 1BUIA 1LHFH 2C90B 1GBTA 5JBTA 1NFXA 2P8OC 3ZYEA 1QRWA 7LPRA 3S9CA 1O2GH 3BTGE 2OD3B 1Y3UA 1VCWA 1P06A 1K1IA 1NRSH 2Q6DA 2H9TH 4I8JA 3P8OA 2W3KA 1BJUA 1O2MA 3LPRA 1QBVH 2PV9B 2FESH 1P10A 1ZRBA 3E0PB 4B74A 1ZJKA 4ABJA 4BXWA 1FMGA 2IOTA 1E38B 1SPJA 3F6UH 1Y3WA 1IQLA 4BAMB 3L3TA 2XWBI 4IC5A 4U32A 1UK3A 4OS6A 4MG3A 3V7TA 2W26A 3OY5U 1V3XA 3EA9A 3R0FA 2QCYA 3QO6A 1GJ6A 4BTIB 2TPIZ 2R2WU 1AI8H 4X8SH 4O97A 3ZZAA 2V0BA 1UVTH 3FZZA 5C3NA 1WU1A 1AMHA 1AU8A 2OUAA 1F2SE 1NRQH 2NU2E 3A8CA 1Z71A 1GCTC 1P09A 1G3EA 2BD8A 1IQIA 2A4GA 1ELBA 1EAUA 1ESTA 3RP2A 3O8CA 4LZ1H 3A8BA 2O8MA 4FUJA 5FHTA 3U98H 4K5ZA 4LOYH 1AE8H 1YF4A 1SSXA 2OLGA 3E16B 5DKMA 2B0FA 1UK2A 3E8LA 4I31A 3MH4A 4INLA 1O35A 3PO1C 1FXYA 2C8ZB 1O2ZA 2PWXA 2B9LA 4AB8A 1AVGH 1PQ7A 1OWIA 1RTLA 3DD2H 3NWUA 2FYQA 3CS7A 3U8RH 4IBLH 1T31A 3UOPA 3BTQE 3TU7H 3KIDU 2PGQB 1DLEA 3MYWA 4K2YA 5LH8A 4Y0ZE 2G5VA 3AW1A 1H8DH 2CF8H 1W7GH 1P8VC 3RDZA 3ATLA 1NM6A 1Y5BT 2GZ9A 1V2MT 2CV3A 2BDIA 2O8TA 3S69A 1UCYE 2THFB 1SQOA 4WH6A 2CXVA 5HM9A 4OS5A 1L4ZA 5HXFA 3RU4T 2ZHWH 1HBTH 4UONA 1GHVH 2PW8H 2TGPZ 4CRCA 2FI4E 3F9HA 2FOHA 4NA8A 4GLYA 1PQAA 1BTZA 7GCHG 1KY9A 3PROA 1GBDA 3QTVH 3M3TA 1ZJDA 2UWOA 5EPYA 3RC4A 4CRGA 1P2KA 4CREA 3HKIB 1THSH 5CHAC 1FJSA 2P3FH 1B0FA 3TK6A 3QX5H 2ZNKH 2FI3E 3U1JB 4XBCA 1CBWC 2FOMB 3FANA 3M3VA 1O5GH 1DUAA 3QZRA 2ZEBA 1GG6C 1BOQA 3I77A 2AFQB 1ZLRA 1FLEE 4TY6A 3LH1A 1F92A 1ZZZA 3ATIA 3TLOA 4B71A 1GPZA 4ZUHA 1W0YH 4YOJA 4MQAA 1P12E 2G00A 1SGNE 3OSYA 4H6TA 1K1OA 2JH6D 1BTPA 1BTWA 2HNTF 2JH0D 1PPHE 3SQEE 1XXFA 1GJ8B 3QWCH 2I6QA 5DJ7A 1VCPA 3ZVBA 1BMAA 2CN0H 5TCCA 4AORA 1JRSA 4WXVA 1JRTA 1O2XA 3MO6A 1GBHA 1V2QT 4MTBA 4B73A 2QXHA 4AZ2B 1QA7A 3S9BA 1W10U 3TJOA 2ZGHA 4BOHA 4WXIA 2XYAA 3A85A 1V2KT 3RM0H 2ANKH 5DPAA 4XSKU 5BRRE 2Z9GA 4X0WU 3LGUA 2OP9A 1N6YA 1ORFA 2WPKS 4NWLA 4M7GA 1BMNH 2ZIQH 3L33A 1H1BA 3SU1A 1AFQB 3ODDA 4UFDH 3UIRA 4FVBA 1CT2E 1ELDE 2UWLA 3U9AH 4B76A 3RXOA 5C5NA 4OGXA 2EA3A 2SNVA 2XW9A 5JPMH 1HCGA 4A1XA 2BVRH 1GJ7B 1AVXA 2ZFRH 1HAXB 1XUIA 1FY4A 1IQMA 3FFGA 1DY8A 1Z6JH 4NSVA 5E2PA 1DWBH 4Q7ZA 1C1NA 3ZVDA 3ZZ3A 3SU5A 1ZSJA 2Y80A 4B2CA 1AKSA 3BV9B 4CH8B 1ZHPA 4K1SA 1MCVA 3SUGA 4JYUH 1AVWA 1BT7A 2SGFE 4Y7AA 4ZROA 1OP2A 1WQVH 3ELAH 4WMFA 4ABIA 1GVKB 2C4FH 1FV9A 3TPIZ 1O3BA 2KAIA 4DOQA 1BTHH 2ZFFH 3FP8E 5F03A 1BHXB 3A86A 4NZLA 2EEKA 4H6SB 1DANH 1GJCB 2D8WA 4THNH 4FUEA 4X6OA 4NIYA 4JYVH 3IITA 5GJ4B 3GDSA 4I8KA 3P6ZB 5JBAS 1CHOG 4JCNA 1GMHG 2PKSC 2BQWB 1UK4A 1BHXF 1DWDH 4KKDA 3VEQB 1NY22 1C5SA 5EG4A 2HNTE 2H5CA 3GICB 3ZV8A 1TRYA 2WPLS 2ZECA 4Y10E 1D9IA 3T26A 4WY3A 5HGGA 3E3TA 1Q3XA 2QXIA 5ESTE 4D7GA 2OBQA 3Q77A 3V12A 1FN6A 1Z1JA 1QTFA 4Q7XA 2FLRH 1C5ZB 2BOKA 3M5MA 3E1XB 4FU9A 1O32A 2G5NA 4RN6A 1GGDC 2ZP0H 3V13A 4GCHF 1AE5A 2VVVA 1DLKB 3SJKA 1A0JA 2BB4A 5ETXA 1GHZA 3TJNA 4Y6DA 1OKXA 1Y59T 5DGJA 2C8XB 4MNVA 1O5BB 3HGNA 4IN1A 1S0RA 4MNXA 2BY7X 4JMYA 2A4OA 2HLCA 5HYOA 1INCA 2GT8A 2FXRA 5J4QA 4A5TS 1N8OB 3MTYA 1O0DH 1QQUA 3Q3YA 1D6WA 2ZTZA 2P16A 1ANDA 1EX3A 4YTAA 2AEIH 2PR3A 4LXBH 1GMCG 3PWBA 3QK1A 3O8RA 4Y11E 1UTJA 1GHAG 3LC3A 1NRNH 1JBUH 1MH0A 1RXPA 3PV4A 3A7ZA 4X2VA 1GJBB 2WUCA 1PJPA 2UUFB 1HJAB 4ZKSU 2XC4A 1P02A 5DK1A 1DSUA 1SOZA 1IQHA 1SGQE 1U6QA 2Z9LA 4MNWA 1IQJA 4YLQH 1ELEE 4GSOA 3A8AA 3JZ2B 2TGAA 1Z7KA 4X2WA 1O34A 1TQ0B 3TNSA 4B2AA 1EOLA 1UTNA 3KQBA 4OS1A 3T28A 1XVOA 2BY5X 3Q3XA 4ABFA 1HFDA 4NWKA 5HM2A 2DE9A 3DT0H 1GBCA 1OSSA 4XBBA 2FX4A 5EPNA 1SL3A 3W95A 1A5IA 1GHXH 3RXTA 1KLJH 1CVWH 1KIGH 3M7QA 3SHCH 1Y3VA 4LZ4B 2V3OH 1HUTH 1FQ3A 1J14A 2Z6BD 1ELCA 3VB4A 1C5QA 6CHAC 5JBCS 5K7RA 1MD8A 3SUEA 5C67A 4NIXA 3PB1E 4TWYA 3ITIA 1E35B 2AYWA 1V2WT 2EC9H 2ANWA 2F9PA 4KTSA 3T2NA 1YLDA 5F8ZA 5GIBA 4JZIA 1MBMA 3SW2B 3VB7A 1EJMA 1O2RA 2BDHA 3K2UA 4E7RG 5EQQA 2FS9A 3SZNA 1C2DA 4JYTA 1CSOE 1RJXB 1QL7A 5ESBA 1O37A 4Y8YA 1HNEE 3C27B 1C2JA 2H6MA 1TRNA 1KXCA 9ESTA 1NO9H 2ZHDA 1BRAA 3F9FA 1HAOH 2TRMA 1XKBC 4UFGH 1FPHH 2Y6TA 1P2NA 1UHBA 4RSPA 1AN1E 1WTHD 4UFFH 1KDQA 1ELTA 2BXTH 1BZXE 3GOVB 3ZVAA 1MTSA 3EDXB 2J92A 4ZHAA 3ZVGA 4NA9H 1QURH 1O2HA 2C8YB 1P2MA 3U1IB 4R8TB 2A5AA 4MPUA 1YPJH 1VGCB 2XBXA 1ELVA 2BLOA 1THRH 2O8UA 2RDLA 3Q00A 3RLYH 1O33A 1TAWA 3MNSA 1AGJA 2GKVE 1MTWA 3PYHA 4E05H 2Y81A 4O9VA 4YM9A 2TGDA 5LPFA 1UCYH 1HJ8A 1XKAC 2A1DB 5C1XA 1TX8A 2HPQH 4ABBA 2R0LA 3M7TA 3LGVA 3ESTA 4ABGA 4DCDA 1AD8H 3UFAA 1E0FD 3SGAE 1QY6A 1C1SA 1TA6A 1Z1IA 2B5TB 1G30B 2VIPA 4KELA 3UWIA 1P3CA 1JWTA 1P9SA 2PUXB 1GBAA 3GCTF 3KEEA 2BD3A 1O2LA 3PLKA 1OXGA 1SLUB 2GV6A 4DVAU 1P2OA 3SV9A 1A2CH 1MZAA 1RIWC 2AMDA 1ZSLA 3T5FH 2D26C 3ZZ9A 1EPTA 2ZDAH 3O8DA 3RXBA 1UCYK 3MNBA 5DP5A 1TIOA 1XUFA 1DVAH 4AFZA 2GV7A 1TB6H 1SGEE 2BY9X 1L2EA 1ANBA 2VGCB 3NKKA 1C5XB 2NU0E 1L1JA 1LPKB 1TNIA 1WUNH 2J38A 2QAAA 5SGAE 1BRBE 1MTUA 1S85A 2PSXA 2D2DA 3B9FH 5E8EH 5A0BA 4UE7H 3P8NA 4HTCH 2J95A 1HV7A 1MTVA 4GPGA 1HLTH 2W5EA 1GL0E 2XNIA 2ZGBH 3SJIA 3ZVEA 3BTKE 4NFFA 1EZXC 3A8DA 2BVSH 4ABEA 1J16A 1NC6A 1A1RA 1RRKA 1EAXA 2P8OB 1CGJE 2OBOA 1GI4A 3F9GA 1WV7H 3UQVA 2HWLB 1D3DB 1AZZA 2Z9IA 3MFJA 1SGFA 1NU9A 2AS9A 3SI4H 2ZU2A 4WVPE 4Q2KA 1LMWB 4ZH8A 5DP6A 1GBKA 3QDZB 1AB9B 1M9UA 1O3OA 3SNEA 1W8BH 3TIUA 2VVUA 1NN6A 1MZDA 1Z8IB 1ELFA 1LVOA 4ZXYH 2ZDMA 1O3EA 2WPMS 2FI5E 3MH7A 3RXLA 1OP8A 3ZYDA 1V2PT 5C5OA 3SUFA 3NUMA 1V2JT 2O9QA 4ZAEA 1Z8JB 1O39A 4CR9A 3QGJA 2F9UA 1GMDG 1IQNA 3LOXA 3SI3H 1DITH 4YT7H 5E0GA 1NU7B 1GL1A 1C2EA 1YCPM 1QJ1B 4UFEH 3BG4C 3BN9A 1QBNA 1TGCA 2XTTB 4Y71A 4AYVB 1MKWK 3SO3A 1B0EA 4BANB 3GCHC 2BLVA 3D62A 1ZYOA 3ZZCA 4X8TH 1UVOA 5GCHG 1AHTH 3ZZ8A 3TH4H 1CU1A 3NK8A 3GY2A 2SGAA 1EJAA 3TNTA 2NWNA 4I33A 1OWKA 5H4IB 1AUJA 3PM3A 3LGIA 1VITF 4NIWA 2ZDNA 3AASA 3D65E 2QGRA 2AERH 2QF3A 1OYQA 1VJAU 1O2PA 1NZQH 2CHAB 2G4UA 4WWYA 5A2MH 1MMJN 1MU6B 4AFQA 1EASA 3A7XA 3RXEA 1TLDA 4K1TA 3T62A 3UY9A 3ZZ6A 4JZ1A 3TH2H 1UJ1A 3E0NB 1SGPE 2ZU4A 1AO5A 1QL8A 8KME2 1BTYA 1FZZA 3MO9A 4CH2B 4CBOA 3IWMA 1TBZH 4FUFA 3G01A 3MU4A 1V2TT 1W0ZU 1O5DH 4K8BA 1MQ5A 3PTBA 4HGCA 4B75A 1K28D 1SLVB 1HJ9A 2A5IA 3LGTA 1ARCA 2Z94A 2CJIA 1ARBA 1O2WA 4XBDA 2CGAA 2ODPA 3BIUH 3CP7A 2ZFTA 2FOAA 4I8LA 1NPMA 5CHAB 1YPHC 3V3MA 1OWDA 4AN7A 4Z6AH 1H9IE 4XE4A 2G52A 5EOKA 1HRTH 1TWXB 1NT1A 1FI8A 2BD2A 4ESTE 1QBOA 1S81A 2FWWA 2HRVA 4X6NA 4GVUA 3M61U 1K1NA 1S5SA 2NU1E 1CA0B 3VXFH 1GI3A 1P0SH 1V2NT 3BEIB 1DFPA 1WCZA 5GXPA 3HATH 2VU8E 1GWAA 3E91A 3QN7A 1SQTA 1VZQH 5EXMA 1TX7A 1EPTC 4DIHH 4MLFB 3GY7A 8ESTE 1N6XA 1EZQA 1TPPA 4KTUA 1P11E 1YLCA 1DOJA 1EAWA 3B8JA 3ZZ4A 1X7AC 2AMPA 2FO9A 4NA7A 1EB2A 2ASUB 3JZ1B 3LDXH 1THPB 2K1QA 1TGBA 3M5OA 2BY6X 3M3SA 3SU3A 1GHWH 3K6YA 2AGGX 3VXEH 1FAKH 1O2SA 3SV7A 1PPFE 3ZZ7A 7GCHF 5A0CA 4IMQA 1LVYA 1CT0E 3SJ8A 3KNXA 1EKBB 3TJVA 2Z9KA 3H7OA 1CQQA 1TBRH 3HK3B 1C4U2 2ZCHP 2H9HA 2C93B 2ZWLH 1HPGA 1HXEH 1C2GA 1XVMA 1O3CA 2FOCA 4ISOA 1BBRE 2G55A 1JMOH 3SU0A 3KQCA 1G2MA 1V2ST 2AGIX 1C1RA 3BG8A 2Y5GA 2XBVA 1L4DA 5EGMA 4U2WA 1T32A 2DE8A 1C2IA 2GX4A 1OWEA 1W14U 1O5EH 1L0ZA 3ZZBA 2FP7B 2XXLA 2YOLA 3VGCB 4UDWH 1NFYA 1KLTA 1C4Y2 4WH8A 3UTUH 1ZGVA 4Q80A 3E6PH 3MU0A 1GHBG 1Y8TA 2BZ6H 1YPKH 3P8GA 1YKTA 1EJNA 1GI6A 1ZHRA 2VH0A 2CMYA 3GY3A 5IDKA 3U8OH 2B7DH 1O2OA 3SV8A 1P2QA 1IQFA 1UTKA 4JK5A 1SR5C 4ZKRU 1FY5A 2HNTC 2BDCA 4BNRA 1NFUA 2PKSB 5T6GA 1C9TA 1TMTH 2A32A 5DG6A 1ELGA 1QA0A 4DIIH 1GHYH 5T3HA 2P59A 2ZGCA 1GDQA 5C1UA 1GVZA 1V2UT 2C8WB 2O8LA 1O3MA 3PMJA 4UEHH 3TH3H 1T8LA 3BTTE 2NU3E 1P2JA 1QCPA 1LKAA 1K22H 1SFQB 2XBWA 1E36B 1GI1A 2WYJA 1ZTLA 1BRCE 1LHEH 1SBWA 1ZHMA 4JZEH 1LHCH 2A2QH 1LHGH 2ZU1A 4AGJA 2FMJA 2HVXA 4Y0YE 3OYPA 3FP7E 1TPSA 3A87A 1PYTD 5JB9S 1ZTKA 3E90B 2ALVA 2VVCA 2WYGA 1GI0A 2EI7A 2XC0A 2QV1A 2FM2A 1TGTA 2VH6A 3RXUA 1AFQC 2GGVB 1QB9A 3VB5A 5C2ZA 4ISLA 2TGTA 3M36A 2WUBA 1L1GA 3ATWA 1C1MA 3S9AA 5L30H 3EA8A 2FLBH 2A4RA 2ULLA 4LK4A 3TK5A 2QXJA 4Y79A 1YPMH 1W11U 3PLBA 4BAQB 2ZPRA 2BMGB 5DP7A 4AFUA 1ANCA 1C5RA 3RMNH 4CHAC 2WINI 4ABDA 1Q31A 1WSSH 3SNDA 4D9QA 1C5LH 4AG2A 1Y3YA 1CGHA 1BRUP 2OC7A 1C5WB 4H4FA 1TQ7B 4YESB 1CHOF 4YZUA 1GMHF 1HYLA 1PFXC 3V0XA 6LPRA 1GBIA 1PPZA 3TJUA 2QF0A 2F9OA 2VINA 1J17T 4OS4A 3P92A 1V2LT 1IHTH 1OWJA 1B7XB 2JETB 2PKAB 3UPEA 4AG1A 1MAXA 2V35A 2ANYA 4CRAA 1O3DA 3SUDA 2BHGA 3RXPA 1FY3A 3RC5A 1XXDA 4VGCB 3H5CB 1YCPH 3QLPH 1C1PA 1QJ6B 5BPEA 1TNGA 3CS0A 1SI5H 1UMAH 4AOQA 1LPZB 1GBLA 3MNXA 2J94A 4YOGA 4ZMAH 1P01A 4OGYA 2V3HH 2FOEA 5AVDA 1ELAA 2ZHFH 1W3CA 1HAPH 1C5MD 3A82A 2G51A 1NROH 1TABE 4NG9H 1BA8B 3LH3A 1F0SA 5EODA 5CE1A 3KL6A 1F0UA 1SVPA 3RU4D 1CE5A 1GBMA 1HAZB 2ZU5A 1EZUC 1YP9A 3DA9B 4O3TA 3RXVA 5DP9A 4HZHA 2FZZA 1DUEA 1EQ9A 1GMCF 2ODQA 1K1MA 2A45B 1GVLA 3RXRA 1ETSH 2IN2A 2BYAX 1A7SA 1GHAF 1BITA 2UWPA 2VWLA 5E0JA 1ZGIA 4D7FA 4IGDA 4YO9A 1EOJA 3GY8A 4RKJB 1A61H 2OC1A 2ZDLA 4ZHMU 2GCHG 1A3EH 3TGJE 1DT2A 2YNBA 4JZFH 4X1NU 2Z7FE 4ZKOU 3UREA 4MVNA 3SORA 4K69A 1DS2E 2BLWA 1P05A 2F9VA 1PYTC 1SHYA 2VIOA 1AKSB 3EGKH 2VIDA 1N8OC 3MMGA 1QRXA 1BMLA 1BIOA 4BAKB 1IAUA 1EZSC 1MUEB 3RXFA 3ZZ5A 5FCKA 2A5KA 4ABHA 2WPHS 2KAIB 4O3UA 4X6MA 1HJAC 2CF9H 3F1SB 3TGIE 1HAIH 5T6DA 3LT3A 3O8BA 2BOHB 1UTPA 2H9EH 2FOFA 1TMBH 1WAYB 1NESE 1D3PB 1E34B 1LKBA 9LPRA 2VB0A 5T6FA 1D4PB 2ZQ2A 1ZMNA 2BY8X 1YGCH 1LQDB 1QGFA 1HAVB 5AHGH 1O3PB 5F6MA 1TGNA 4WMDA 2GP9B 1E37B 2PTCE 1O2VA 4Y7BA 1SGIB 1ESBA 4I32A 3KQEA 1C4V2 3M7UA 2ZI2H 2G8TA 3L6PA 3KCGH 2GMTC 2SFAA 3KF2A 3A7YA 5A0AE 3UUZA 1RIWB 3C1KA 3LGYA 1HAGE 3URCA 1SGCA 1GI5A 1K1LA 1AZ8A 3UQOA 2QN5T 3TITA 2UUJB 8GCHG 2RA3A 4IC6A 3GY5A 1MTNC 3RMLH 1ESAA 1SFIA 3RUOA 2Z3CA 5GPIB 3GY6A 3S0NA 1K2I1 1O30A 4B2BA 1TBQH 4X6PA 2GCTB 4K8YA 3LIWA 1D3TB 1VITH 1QFKH 2BZAA 3LKWA 6GCHG 2RA0A 3QUMP 1MKXH 4X1PU 5AFYH 4D8NA 1QL9A 1Z8RA 1C2HA 1C5NH 3RXDA 4DURA 2R0KA 3M5LA 2PUQH 4D9RA 1TPAE 1SMFE 2GT7A 3SNCA 2D1JA 3LU9B 1A46H 3AAUA 2IJOB 5AF9H 2F3CE 1T7CA 4NIVA 1YPGH 1C1QA 1IHSH 1IQGA 1BMMH 2P3UB 4A6LA 5K0HA 1BBRH 1WTGH 1QQ4A 3K6ZA 2Z9JA 1GBEA 3ZVFA 2XRCA 5EW2H 1AWHB 2ZHEH 2P94A 1BTXA 2ZDKA 3UR6A 2M5TA 1MKXK 1DXWA 3GCHB 6ESTA 1AIXH 2UUKB 1YYY1 3EQ0H 5HMAA 3U69H 1GI8B 2A0QB 4IW4E 1EAIA 1NRRH 5DO4H 3BIVH 2ALPA 5A8XA 2PTNA 3MU8A 1A5GH 2VIWA 3I29A 1NTPA 3A80A 2A2XH 3GISB 1YPLH 8LPRA 4FUDA 2GVFA 4CRFA 3FVFB 1O3KA 3P70B 1Y5UT 1GCTB 3SBKA 1G37A 2VGCC 3UWJH 1D3QB 1J15A 5TCAA 2QXGA 1LDTT 4ISNA 1ABIH 4R0IA 1TRMA 1NRPH 1WOFA 1PQ8A 1N1LA 2NU4E 3D23A 2SGPE 2R2MB 3BTEE 1O2KA 1ANEA 2OC8A 3RC6A 2ZC9H 1Y5AT 2ZQ1A 3PO1B 3NCLA 1FY8E 1VR1H 3PMHB 2OQUA 3MU1A 1TA2A 1UVUH 1GMDF 2BD5A 3SGBE 3BEFB 1FUJA 2RG3A 1BQYA 5JBBS 4X2XA 3HK6B 4BXSA 3UOUA 3R3GB 1OX1A 3PWCA 3UNRA 1O3LA 4INHA 3H7TA 1O2YA 1AB9C 1O2IA 3HPTB 1AQ7A 4DG4A 1RTFB 4CBNA 2VWOA 3LJJA 4Y8XA 1HIAB 1J8AA 5GCHF 2RCEA 2HGTH 1SGTA 1GBJA 3ODFA 3B23B 1O5CB 4GHQA 1K21H 1EATA 2DUCA 3U8TH 3DFLA 2OQ5A 2BM2A 2W7UA 1CHGA 4X2YA 4I8HA 1GI7B 4ISIH 4IMZA 2BVXH 4X1QU 1L1NA 2G4TA 1SLWB 2F91A 1ZSKA 2P95A 3RXIA 1LCYA 2GZ7A 3OTJE 1EP6A 2A31A 1DM4B 1PPCE 3QTOH 2FPZA 2VWNA 2BX3A 2LNCA 1EPTB 1V2VT 5A8ZA 5JB8S 4GAWA 3SU4A 1BTUA 3UNQA 1PPGE 2BQ7B 1XUJA 3BTWE 4H42U 3MH5A 1O2NA 1XUGA 1GI2A 1CBWB 1H8IH 1ETTH 5JYIA 1TPOA 1TONA 5LPEA 1GG6B 1V2RT 3FP6E 1SGFG 3SGQE 3KN2A 2CHAC 3LJOA 2PGBB 1MU8B 1TGSZ 3T27A 1GBFA 1RS0A 3FZDA 2FOBA 1V2OT 2TIOA 4O03A 5I46H 1AUTC 2BLQA 3GYMA 5E2OA 1FPCH 3S7KB 5AFZH 1HAHH 3W94A 1DXPA 3AW0A 2R9PA 4X1SU 1O5AB 2GD4B 4DGJA 2HALA 4E06H 1XX9A 4JZDH 3PTNA 1P2IA 4MPWA 1TOCB 1GJAB 1RFNA 3PLPA 4FUHA 1ID5H 4ISHH 5FPTA 1YBWA 3RM2H 1A3BH 4QT8C 2VWMA 2SGQE 4A1TA 2QA9E 1V6DA 1QHRB 1QNJA 5JDUB 4DW2U 1LVBA 4E7NA 5F8TA 5L6NH 3SNBA 1O2TA 1O5FH 1A5HA 4K1EA 1XUKA 1ACBE 3P17H 1O3AA 1C1TA 1S6HA 5PTPA 1WQSA 1OYTH 3RXGA 1FONA 1G32B 4FU7A 5FBIA 5CMXH 3S7HB 1C1VH 2STBE 3Q76A 3RXQA 4CRBA 2XCNA 1O2JA 1YPHE 2SGDE 1QIXB 3Q3KA 1KXAA 1EB1H 3RMMH 3SHAH 1RTKA 1T8OA 3ZZDA 4Z0KA 1O31A 2WV5A 3QZQA 1OP0A 2XWAA 1CA0C 1CGIE 4IS5A 4ABAA 2J2UA 3MU5A 1EP5A 1KTTB 2Z3DA 2PKAA 1A0LA 1CO7E 2ZTYA 1QRZA 4TYDA 4AFSA 2Y5FA 4XOJA 1G3CA 1XM1A 1WYKA 2J9NA 3UR9A 2R3YA 2Y5HA 4TWWA 3KHVA 2EI8A 1LTOA 4U30A 3LONA 3SN8A 4FVDA 1S6FA 3STJA 2P93A 2OTVA 1AFEH 1C2KA 3TGKE 2EI6A 4MDSA 4A1VA 3F9EA 2Q1JA 3EA7A 3MNCA 5EU8A 3K9XB 1FNIA 1T8MA 3BTME 3RXAA 1OS8A 2PLXA 1B5GH 2G81E 1KXDA 3MOCA 5FX5A 2ANMH 3RXMA 1S0QA 4AGKA 3GYLB 2PFEA 1GHBF 1TX6A 2WV4A 2ZTXA 4AYYB 1ZTJA 2LPRA 3EE0B 4HFPB 3RXJA 1C5OH 1UTMA 4YOIA 2UUYA 3EAJA 1QB1A 1MD7A 1UO6A 2JH5D
chains in the Genus database with same CATH superfamily
1KYNA 1FIZA 1KSNA 2ZDVH 1F5KU 1ZOMA 3WY8A 4CHAB 2YMSD 2JKHA 4ASHA 2J34A 2L74A 1GGDB 2H1UA 1OWHA 1F0TA 1RGQA 3ATKA 1LHDH 4DT7B 1TNLA 1EFRD 2ZU3A 3BSQA 2BQ6B 2Q6FA 1SGRE 4BAHB 3VGCC 1ZMJA 2ESTE 4ZHLU 1O3NA 3AAVA 1W13U 5FX6A 1S83A 3EYDA 2BTCE 2Y82A 1E79D 1SLXB 1FAXA 1GJ4H 4PROA 3SOSA 4AX9H 2FTMA 1KTSB 1ZPBA 3AVZA 3QGNB 4HG6A 4Q63A 2ZFSA 5G4BA 3GCOA 4F48B 2WSSD 3GDUA 2GDEH 4DY7B 1MAYA 4SGAE 5KECA 3P95A 2ZPQA 1C5YB 4GCHG 1SGYE 1IOEA 3SU6A 3KGPA 2VIQA 4M9FA 1HAVA 5F8XA 2WPIS 1E1QD 1QB6A 1LPGB 4AC9A 1HGTH 3A83A 4A92A 4K3JA 1JIRA 1C9PA 1SGDE 1W0JD 1ZPZA 2BDYA 3ATMA 1J9CH 1C1OA 3DUXH 1PPEE 3U28C 1F5LA 4Y8ZA 1AY6H 5GDSH 1EUFA 4WJG2 1GCDA 1T4VH 2EY4C 1O2UA 3MO3A 5DP8A 2A7CA 2VIVA 1T8NA 2STAE 3OY6U 3PMAB 4XDEA 1NBME 2BX4A 2FTLE 1C2LA 5ABWA 1YLNA 3A7TA 3OE7D 5C0UA 4F4OC 1C5VA 2BDAA 1TE0A 3UNSA 1C2FA 4INKA 2HOBA 2WPJS 4JK6A 4HI3A 4AB9A 2ZFQH 5GWZA 1H4WA 3KQDA 2J4IA 3P8FA 3GY4A 1CA8B 4XRNA 5FAHA 2SNWA 4WF8A 6CHAB 4RKOB 1KLIH 2C3SA 2W3IA 3TVJB 2SGEE 2ZFPH 1BDAA 1TMUH 1GDUA 1G3DA 2ILNA 4NGAH 1TNJA 1DPOA 1GDNA 4D76A 1UTOA 3MH6A 4NCYA 1K1PA 2FX6A 2GZ8A 1D6RA 1F7ZA 1JOUB 1KXEA 4FU8A 1ZPCA 2F43B 1DWCH 4I8GA 2GTBA 1HB0B 2H2ZA 5EW1H 4B1TA 1UTLM 1AWFH 4FUIA 1SOTA 1H8ED 4KP0A 3T25A 3ZVCA 2ZHQH 1YCPK 4TPYA 5C20A 1UVSH 4I7YH 2A7HA 1NS3A 2BDGA 1O3JA 1YC0A 3A7WA 5EJZA 2YNAA 5L2YH 1TNHA 1UVPA 3STIA 1ETRH 3CENA 3PMBB 3BTHE 3SV6A 3RLWH 2I6SA 2XBYA 2JETC 5EXNA 4BTTB 2ZKSA 1A4WH 4ZXXH 5LGOA 1NFWA 2IPHA 1PQ5A 2Z3EA 1KMHB 1W12U 4KGAA 2W7SA 4F49A 1JIMA 1TFXA 4VGCC 3RXKA 3SNAA 4YXWD 1P9UA 5FPYA 3RXHA 1SHHB 2F9NA 2V6NA 1DE7H 1GJ5H 2GMTB 1HDTH 1QJ7B 4J2YB 2O8WA 3OX7U 3ZV9A 1LVMA 5TJXA 2B8OH 5C1YA 3MHWU 1A0HB 3TK9A 1JXPA 3F3BA 2XCFA 2ZF0H 2ODYB 4CRDA 4FUBA 2AIQA 1O3IA 2GCHF 4ZKNU 3RXSA 2FODA 3VB6A 4NZQA 4FUGA 1Z8GA 1TYNA 3A89A 1LO6A 4YLUA 3LC5A 2AMQA 4FUCA 1O3FA 1MTNB 2R3UA 3A81A 3MWIU 4BTUB 2KCYA 3NPSA 3D49H 1IQEA 3VB3A 2BD9A 3BTFE 4X1RU 7ESTE 4TY7A 3A88A 1GJDB 2HPPH 1SB1H 1DWEH 3NXPA 1H9LB 3I78A 2ZGXH 3SJ9A 4Q7YA 1O2QA 3SZEA 3GDVA 5A09A 1P3EA 1OPHB 2ZG0H 2OINA 4X8VH 2QIQA 5DP4A 2V3MA 3RMOH 2FEQH 4K60A 5E0HA 1Y3XA 1P03A 1T4UH 2ZPSA 1C1WH 1ZR0A 4WMEA 1DICA 1KXFA 1ZRKA 3VPKA 1P57B 1S84A 4NSYA 1C5UA 3BF6H 5A8YA 3NZIA 4MPVA 3BTDE 3N7DA 4ASUD 2BD4A 1WDIA 5DP3A 1XMNB 4J1YA 1HXFH 1PPBH 3H09A 1LQEA 1YPEH 5IK2D 3M5NA 2Y7ZA 1F5RA 4CR5A 1G3BA 5LPRA 3URDA 1P04A 3GCTG 1O36A 1GJ9B 2ZZUH 5FBEA 4Y76A 3SYJA 1OOKB 1SC8U 4SGBE 1MQ6A 2TBSA 4FXGH 5EQSA 1W7XH 1Z6EA 4A7IB 1VJ9U 3OU0A 3M35A 3GCNA 4DJZB 1O38A 2BXUH 3IG6B 2PHBA 1TALA 1S82A 2VJ1A 4MNYA 1HIAA 5FCRA 3SJOA 4UD9H 2FOGA 3T29A 2QY0B 2OXSA 2F9BH 2FYRA 4X8UH 8GCHF 1HAYB 1BCUH 1FY1A 5L2ZH 1K1JA 3HKJB 2ZO3H 3BEUA 1GI9B 3MI4A 1ZMLA 1FIWA 2A4QA 2OC0A 4U01A 1MBQA 1C5PA 2AH4X 1VGCC 1H9HE 2Y7XA 1RD3B 2FIRH 3OFND 1IQKA 1SG8B 1EXFA 1C1UH 1TNKA 4RI0A 3A7VA 4OS2A 5J4SA 1DDJA 4RT0A 6GCHF 1DY9A 2XC5A 4KTCA 3BG4B 2BD7A 1QR3E 1F0RA 1SQAA 3DHKH 4GHTA 1C5TA 5IYTA 1MABB 2FDAA 2ZCKP 5FXLA 3VFEA 2AGEX 3CNRA 1G36A 3HGPA 3M37A 3DFJA 5FPSA 1FN8A 1WBGB 5EXLA 1Q2WA 2QYIA 1C2MA 1UTQA 2Q6GA 3FAOA 1BB0B 2F83A 1DSTA 3LGWA 1GBBA 4IN2A 5I25A 1ABJH 2ZGJA 1VCQA 1K9OE 3ENSB 2GCTC 4XFQA 3SQHE 4TSFD 1G9IE 2H5DA 4YT6H 1W2KH 3RU4E 3F68H 1MKWH 2ZA5A 1XUHA 3K65B 4NFEA 2BDBA 1BBRK 2ZCLP 3SV2H 5B6OA 1YM0A 2VNTA 2AIPA 3RXCA 7KMEH 2WV9A 1FDPA 4BAOB 2PSYA 1KXBA 2P3TB 4OS7A 1UHBB 4TPIZ 3SU2A 2FS8A 1O3GA 5EQRA 3A84A 3N7OA 1MCTA 2QC2A 1KDQB 1DX5M 1O3HA 2OCVB 4MPXA 2A7JA 1CT4E 2RFKC 1TOMH 1G2LA 4GUXA 1BJVA 2GDDA 1VITG 1BUIA 1LHFH 2C90B 1GBTA 5GNDA 5JBTA 1NFXA 2P8OC 3ZYEA 1QRWA 7LPRA 3S9CA 1O2GH 3BTGE 2OD3B 1Y3UA 2VBCA 2OK5A 1VCWA 1P06A 1K1IA 1NRSH 2Q6DA 2H9TH 4I8JA 3P8OA 2W3KA 1BJUA 1O2MA 3LPRA 1QBVH 2PV9B 2FESH 1P10A 1ZRBA 3E0PB 3FN8A 4B74A 1ZJKA 4ABJA 1OHHD 4BXWA 1FMGA 2IOTA 1E38B 1SPJA 3F6UH 1Y3WA 1IQLA 4BAMB 3L3TA 2XWBI 4IC5A 4U32A 1UK3A 4OS6A 4MG3A 3V7TA 2W26A 3OY5U 1V3XA 3EA9A 3R0FA 2QCYA 3QO6A 1GJ6A 4BTIB 2TPIZ 2R2WU 1AI8H 4X8SH 4O97A 3ZZAA 2V0BA 1UVTH 3FZZA 5C3NA 1WU1A 1AMHA 1AU8A 1F2SE 1NRQH 2NU2E 2OUAA 3A8CA 1Z71A 1GCTC 1P09A 1G3EA 2BD8A 1IQIA 2A4GA 1ELBA 1EAUA 1ESTA 3RP2A 3O8CA 4LZ1H 3A8BA 2O8MA 4FUJA 5FHTA 3U98H 4K5ZA 4LOYH 1AE8H 1YF4A 1SSXA 2KM0A 2OLGA 3E16B 5DKMA 2B0FA 1UK2A 3E8LA 3WW7A 4I31A 3MH4A 4INLA 1O35A 3PO1C 1FXYA 2C8ZB 1O2ZA 2PWXA 2B9LA 4AB8A 1AVGH 1PQ7A 2J97A 1OWIA 1RTLA 3DD2H 3NWUA 2FYQA 3CS7A 3U8RH 4Z1MD 4IBLH 1T31A 3UOPA 4ZCNA 3BTQE 3TU7H 3KIDU 2PGQB 1DLEA 3MYWA 4K2YA 5LH8A 4Y0ZE 2G5VA 3AW1A 1H8DH 2CF8H 1W7GH 1P8VC 3RDZA 3ATLA 1NM6A 1Y5BT 2GZ9A 1V2MT 2CV3A 2BDIA 2O8TA 3S69A 1UCYE 2THFB 1SQOA 4WH6A 2CXVA 5HM9A 4OS5A 1L4ZA 5HXFA 3RU4T 2ZHWH 1HBTH 4UONA 1GHVH 2PW8H 2TGPZ 4CRCA 2FI4E 3F9HA 2FOHA 4NA8A 4GLYA 1PQAA 1BTZA 7GCHG 1KY9A 3PROA 1GBDA 3QTVH 3M3TA 1ZJDA 2UWOA 5EPYA 3RC4A 4CRGA 1P2KA 4CREA 3HKIB 1THSH 5CHAC 1FJSA 2P3FH 1B0FA 3TK6A 3QX5H 3KYFA 2ZNKH 2FI3E 3U1JB 4XBCA 1CBWC 2FOMB 3FANA 3M3VA 1O5GH 1DUAA 3QZRA 2ZEBA 1GG6C 1BOQA 3I77A 2AFQB 1ZLRA 1FLEE 4TY6A 3LH1A 1F92A 1SQRA 1ZZZA 3ATIA 3TLOA 4B71A 1GPZA 4ZUHA 1W0YH 4YOJA 4MQAA 1P12E 4RT1A 2G00A 1SGNE 3OSYA 4H6TA 1K1OA 2JH6D 1BTPA 1BTWA 2HNTF 2JH0D 4I86A 1PPHE 3SQEE 1XXFA 1GJ8B 3QWCH 2I6QA 5DJ7A 1VCPA 3ZVBA 1BMAA 2CN0H 5TCCA 4AORA 1JRSA 3KYGA 1JRTA 1O2XA 4WXVA 3MO6A 2WHXA 1GBHA 1V2QT 4MTBA 4B73A 2J98A 2QXHA 4AZ2B 1QA7A 3S9BA 1W10U 3TJOA 2ZGHA 4BOHA 4WXIA 2XYAA 3A85A 1V2KT 3RM0H 2ANKH 5DPAA 4XSKU 5BRRE 3DSOA 2Z9GA 4X0WU 3LGUA 2OP9A 1N6YA 1ORFA 2WPKS 4NWLA 4M7GA 1BMNH 2ZIQH 3L33A 1H1BA 3SU1A 1AFQB 3ODDA 4UFDH 3UIRA 4FVBA 1CT2E 1ELDE 2UWLA 3U9AH 4B76A 3RXOA 5C5NA 4OGXA 2EA3A 2SNVA 3DCLA 2XW9A 5JPMH 1HCGA 4A1XA 2BVRH 1GJ7B 5HIZA 1AVXA 2ZFRH 1HAXB 1XUIA 1FY4A 1IQMA 3FFGA 1DY8A 1Z6JH 4NSVA 5E2PA 1DWBH 4Q7ZA 1C1NA 3ZVDA 3ZZ3A 3SU5A 1ZSJA 2Y80A 4B2CA 1AKSA 3BV9B 4CH8B 2JJ1D 1WXRA 1ZHPA 1QZ8A 1MCVA 4K1SA 3SUGA 1S6LA 4JYUH 1AVWA 1BT7A 3FOAA 2SGFE 4Y7AA 4ZROA 4ACAA 1OP2A 1WQVH 3ELAH 4WMFA 4ABIA 1GVKB 2C4FH 3F0OA 1FV9A 3TPIZ 1O3BA 2KAIA 4DOQA 1BTHH 2ZFFH 3FP8E 5F03A 1BHXB 3A86A 4NZLA 2EEKA 4H6SB 2IPQX 1DANH 1GJCB 2D8WA 4THNH 4FUEA 3UB0A 4X6OA 4NIYA 4JYVH 2J5UA 2M2AA 3IITA 5GJ4B 3GDSA 4I8KA 3P6ZB 5JBAS 1CHOG 4JCNA 1GMHG 2PKSC 2BQWB 4FETA 1E1RD 1BHXF 1DWDH 1UK4A 2WPDD 1NY22 4KKDA 1C5SA 3VEQB 5EG4A 2HNTE 2H5CA 3GICB 3ZV8A 1TRYA 2WPLS 2ZECA 4Y10E 1D9IA 3T26A 4WY3A 3F2HA 5HGGA 3E3TA 1Q3XA 2QXIA 5ESTE 4D7GA 3F2FA 2OBQA 3Q77A 3V12A 1FN6A 1Z1JA 1QTFA 4Q7XA 2FLRH 1C5ZB 5FL7D 2BOKA 3M5MA 3E1XB 4FU9A 1O32A 2G5NA 4RN6A 1GGDC 2ZP0H 5C94A 3V13A 4GCHF 1AE5A 2VVVA 1DLKB 3SJKA 2YMSB 1A0JA 2BB4A 5ETXA 1GHZA 2KCAA 3TJNA 4Y6DA 1OKXA 1Y59T 5DGJA 2C8XB 4MNVA 1O5BB 3HGNA 4IN1A 2KFWA 1S0RA 4MNXA 2BY7X 4JMYA 2A4OA 2HLCA 5HYOA 1INCA 2GT8A 2FXRA 5J4QA 4A5TS 1N8OB 2EQNA 1O0DH 1QQUA 3MTYA 3Q3YA 1D6WA 2ZTZA 2P16A 1ANDA 4XD7D 1EX3A 4YTAA 2AEIH 2PR3A 4LXBH 1GMCG 3PWBA 3QK1A 2F4LA 3O8RA 4Y11E 1UTJA 1GHAG 3LC3A 1NRNH 1JBUH 1MH0A 1RXPA 3PV4A 3A7ZA 4X2VA 1GJBB 2WUCA 1PJPA 2UUFB 1HJAB 4ZKSU 2XC4A 1P02A 5DK1A 1DSUA 1SOZA 1IQHA 1SGQE 1U6QA 2Z9LA 4MNWA 2HLDD 1IQJA 4YLQH 1ELEE 4GSOA 3A8AA 3JZ2B 3PV2A 2TGAA 1Z7KA 4X2WA 1O34A 1TQ0B 3TNSA 4B2AA 1EOLA 1UTNA 3KQBA 4OS1A 3T28A 1XVOA 2BY5X 3Q3XA 4ABFA 1HFDA 4NWKA 5HM2A 2DE9A 3DT0H 1GBCA 1OSSA 4XBBA 2FX4A 5EPNA 5EIYA 1SL3A 3W95A 1A5IA 1GHXH 3RXTA 1KLJH 1CVWH 1KIGH 3M7QA 3SHCH 1Y3VA 4LZ4B 2V3OH 1HUTH 1FQ3A 1J14A 2Z6BD 1ELCA 3VB4A 1C5QA 6CHAC 5JBCS 5K7RA 1MD8A 3SUEA 5C67A 4NIXA 3PB1E 4TWYA 3ITIA 1E35B 2AYWA 1V2WT 2EC9H 2ANWA 2F9PA 4KTSA 3T2NA 1YLDA 5F8ZA 5GIBA 4JZIA 1MBMA 3SW2B 3VB7A 1EJMA 1O2RA 2BDHA 3K2UA 4E7RG 5EQQA 2FS9A 3SZNA 2L6OA 1C2DA 4JYTA 1CSOE 1RJXB 1QL7A 5ESBA 1O37A 4Y8YA 1HNEE 3C27B 1C2JA 2H6MA 1TRNA 1KXCA 9ESTA 1NO9H 2ZHDA 1BRAA 3F9FA 1HAOH 2TRMA 1XKBC 4UFGH 1FPHH 2Y6TA 1P2NA 1UHBA 4RSPA 1AN1E 1WTHD 4UFFH 1KDQA 4P00A 1ELTA 2BXTH 1BZXE 3GOVB 3ZVAA 1MTSA 3EDXB 2J92A 1COWD 1H8HD 4ZHAA 3ZVGA 4NA9H 1QURH 1O2HA 2C8YB 1P2MA 3U1IB 4R8TB 2A5AA 4MPUA 1YPJH 1VGCB 2XBXA 1ELVA 2BLOA 1THRH 2O8UA 2RDLA 3Q00A 4FOUC 3RLYH 1O33A 1TAWA 3MNSA 1AGJA 2GKVE 1MTWA 3PYHA 4E05H 2Y81A 4O9VA 4YM9A 2TGDA 5LPFA 1UCYH 3MQKC 1HJ8A 1XKAC 2A1DB 5C1XA 1TX8A 2HPQH 4ABBA 2R0LA 3M7TA 3LGVA 2QE7D 3ESTA 4ABGA 4DCDA 1AD8H 3UFAA 1E0FD 2W6ID 3SGAE 1QY6A 1C1SA 1TA6A 1Z1IA 2B5TB 1G30B 2VIPA 4KELA 3UWIA 1P3CA 1JWTA 1P9SA 2PUXB 1GBAA 3GCTF 3KEEA 2BD3A 1O2LA 3PLKA 1OXGA 1SLUB 2GV6A 4DVAU 1P2OA 3SV9A 1A2CH 1MZAA 1RIWC 2AMDA 1ZSLA 3T5FH 2D26C 3ZZ9A 1EPTA 2ZDAH 3O8DA 3RXBA 1UCYK 3MNBA 5DP5A 5C0TA 1TIOA 1XUFA 1DVAH 4AFZA 2GV7A 1TB6H 1SGEE 2BY9X 1L2EA 1ANBA 2VGCB 3NKKA 1C5XB 1L1JA 1LPKB 1TNIA 1WUNH 2J38A 2NU0E 2QAAA 5SGAE 1BRBE 1MTUA 1S85A 2PSXA 2D2DA 3B9FH 2RDEA 5E8EH 4UE7H 5A0BA 3P8NA 4HTCH 2J95A 1HV7A 1MTVA 4GPGA 1HLTH 2W5EA 4B6FA 1GL0E 2XNIA 2ZGBH 3SJIA 3ZVEA 3BTKE 4NFFA 1EZXC 3A8DA 2BVSH 4ABEA 1J16A 1NC6A 1A1RA 1RRKA 1EAXA 2P8OB 1CGJE 2OBOA 1GI4A 3F9GA 1WV7H 3UQVA 2HWLB 1D3DB 1AZZA 2Z9IA 3MFJA 1SGFA 1NU9A 2AS9A 3SI4H 2ZU2A 4WVPE 4Q2KA 1LMWB 4ZH8A 5DP6A 1GBKA 5HIYA 3QDZB 1AB9B 1M9UA 1O3OA 3SNEA 1W8BH 3TIUA 2VVUA 1NN6A 1MZDA 1Z8IB 1ELFA 1LVOA 4ZXYH 2ZDMA 4DT4A 1O3EA 2WPMS 2FI5E 3MH7A 3RXLA 1OP8A 3ZYDA 1V2PT 5C5OA 3SUFA 3NUMA 1V2JT 2O9QA 4ZAEA 1Z8JB 1O39A 4CR9A 3QGJA 2K0QA 2F9UA 1GMDG 1IQNA 3LOXA 3SI3H 1DITH 4YT7H 4TT3D 5E0GA 1NU7B 1GL1A 1C2EA 1YCPM 1QJ1B 4UFEH 3BG4C 3BN9A 2HVYB 1QBNA 5CHBA 1TGCA 2XTTB 4Y71A 4AYVB 1MKWK 3SO3A 1B0EA 4BANB 3GCHC 2BLVA 3D62A 1ZYOA 3ZZCA 4X8TH 1UVOA 5GCHG 1AHTH 3ZZ8A 3TH4H 1CU1A 3NK8A 3GY2A 4OM9A 2SGAA 1EJAA 2WZQA 2NWNA 3TNTA 4I33A 1OWKA 5H4IB 1AUJA 3PM3A 3LGIA 1VITF 4NIWA 2ZDNA 3AASA 3D65E 2QGRA 2AERH 2QF3A 1OYQA 1VJAU 1O2PA 1NZQH 2CHAB 2G4UA 4WWYA 5A2MH 3WWFA 1MMJN 1MU6B 4AFQA 1EASA 3A7XA 3RXEA 1TLDA 4K1TA 3T62A 3UY9A 3ZZ6A 4JZ1A 3TH2H 1UJ1A 3E0NB 1SGPE 2ZU4A 1AO5A 1QL8A 8KME2 1BTYA 1FZZA 3MO9A 4CH2B 4CBOA 3IWMA 1TBZH 4FUFA 3G01A 3MU4A 1V2TT 1W0ZU 3GS9A 1O5DH 4K8BA 1MQ5A 3PTBA 4HGCA 4B75A 5EJ1A 5DN6D 1K28D 1SLVB 3NRLA 1HJ9A 2A5IA 3LGTA 1ARCA 2Z94A 2CJIA 1ARBA 1O2WA 4XBDA 2CGAA 2ODPA 3BIUH 3CP7A 2ZFTA 2FOAA 4I8LA 4B6EA 1NPMA 5CHAB 1YPHC 3V3MA 1OWDA 4AN7A 4Z6AH 1H9IE 4XE4A 2G52A 5EOKA 1HRTH 1TWXB 1NT1A 1FI8A 2BD2A 4ESTE 1QBOA 1S81A 2FWWA 2LP6A 2HRVA 4X6NA 4GVUA 3M61U 1K1NA 1S5SA 2NU1E 1CA0B 3VXFH 1GI3A 1P0SH 1V2NT 3BEIB 1DFPA 1WCZA 1NBMD 5GXPA 3HATH 2VU8E 1GWAA 3E91A 3QN7A 1SQTA 1VZQH 5EXMA 1TX7A 1EPTC 4DIHH 4MLFB 3GY7A 8ESTE 1N6XA 3PRDA 1EZQA 1TPPA 4KTUA 1P11E 2KCOA 1YLCA 1DOJA 1EAWA 3B8JA 3W1EA 3ZZ4A 1X7AC 2AMPA 2FO9A 4NA7A 1EB2A 2ASUB 3JZ1B 3LDXH 1THPB 2K1QA 1TGBA 3M5OA 2BY6X 3M3SA 3SU3A 1GHWH 5T1VA 3K6YA 2AGGX 3VXEH 1FAKH 1O2SA 3SV7A 1PPFE 3ZZ7A 7GCHF 5A0CA 4IMQA 1LVYA 1CT0E 3SJ8A 3KNXA 1EKBB 3TJVA 2Z9KA 3H7OA 1CQQA 5C17A 1TBRH 3HK3B 1C4U2 2ZCHP 2H9HA 2C93B 2ZWLH 1HPGA 1HXEH 3ZIAD 1C2GA 1XVMA 1O3CA 2FOCA 4ISOA 1BBRE 2G55A 1JMOH 4Q4LA 3SU0A 3KQCA 1G2MA 1V2ST 2AGIX 1C1RA 3BG8A 2Y5GA 2XBVA 1L4DA 5EGMA 4U2WA 1T32A 3DSPA 2DE8A 1C2IA 2GX4A 3F0PA 1OWEA 1W14U 1O5EH 1L0ZA 3ZZBA 2V7QD 2FP7B 2XXLA 2YOLA 3VGCB 4UDWH 1NFYA 1KLTA 1C4Y2 2JDID 4WH8A 3UTUH 1ZGVA 4Q80A 3E6PH 3MU0A 1GHBG 1Y8TA 2BZ6H 1YPKH 3P8GA 1YKTA 1EJNA 1GI6A 1ZHRA 2VH0A 2CMYA 3GY3A 5IDKA 3U8OH 2B7DH 1O2OA 3SV8A 1P2QA 1IQFA 1UTKA 4JK5A 1SR5C 4ZKRU 1FY5A 2HNTC 2BDCA 4BNRA 1NFUA 2PKSB 5T6GA 1C9TA 1TMTH 2A32A 5DG6A 1ELGA 1QA0A 4DIIH 1GHYH 5T3HA 2P59A 2ZGCA 1GDQA 5C1UA 1GVZA 1V2UT 2C8WB 2QF5A 3KQ5A 2O8LA 1O3MA 3PMJA 4UEHH 3TH3H 1T8LA 3BTTE 2NU3E 1P2JA 1QCPA 1LKAA 1K22H 1SFQB 2XBWA 1E36B 1GI1A 2WYJA 1ZTLA 1BRCE 5DSFA 1LHEH 1SBWA 1ZHMA 2XOKD 4JZEH 1LHCH 2A2QH 1LHGH 2ZU1A 4AGJA 2FMJA 2HVXA 4Y0YE 3OYPA 3FP7E 3FKSD 1TPSA 3A87A 1PYTD 5JB9S 1ZTKA 3E90B 2ALVA 2VVCA 2WYGA 1GI0A 2EI7A 2XC0A 2QV1A 2JIZD 2FM2A 1TGTA 2VH6A 3RXUA 1AFQC 2GGVB 1QB9A 3VB5A 5C2ZA 4ISLA 2TGTA 3M36A 2WUBA 1L1GA 3ATWA 1C1MA 3S9AA 5L30H 3OEHD 3EA8A 2FLBH 2A4RA 2ULLA 4LK4A 3TK5A 2QXJA 4Y79A 1YPMH 1W11U 3PLBA 4BAQB 2ZPRA 2BMGB 5DP7A 4AFUA 1ANCA 1C5RA 3RMNH 4CHAC 2WINI 4ABDA 1Q31A 1WSSH 3SNDA 4D9QA 1C5LH 4AG2A 1Y3YA 1CGHA 1BRUP 2OC7A 1C5WB 4H4FA 3UAIC 1TQ7B 4YESB 1CHOF 4YZUA 1GMHF 1HYLA 1PFXC 3V0XA 6LPRA 1GBIA 1PPZA 3TJUA 2QF0A 2F9OA 2VINA 1J17T 4OS4A 3P92A 1V2LT 1IHTH 1OWJA 2GJGA 1B7XB 2JETB 2PKAB 3UPEA 4AG1A 1MAXA 2V35A 5HKKD 2ANYA 4CRAA 1O3DA 3SUDA 2BHGA 3RXPA 1FY3A 3RC5A 1XXDA 4VGCB 3H5CB 1YCPH 3QLPH 1C1PA 1QJ6B 5BPEA 1TNGA 3CS0A 1SI5H 1UMAH 4AOQA 1LPZB 1GBLA 3MNXA 2J94A 3OTPA 4YOGA 4ZMAH 1P01A 4OGYA 2V3HH 2FOEA 5AVDA 1ELAA 2ZHFH 1W3CA 1HAPH 1C5MD 3A82A 2KR7A 2G51A 1NROH 2J98B 1TABE 4NG9H 1BA8B 3LH3A 1F0SA 5EODA 5CE1A 3KL6A 4P02A 1F0UA 1SVPA 3RU4D 1CE5A 1GBMA 1HAZB 2ZU5A 1EZUC 1YP9A 3DA9B 4O3TA 3RXVA 5DP9A 4HZHA 2FZZA 1DUEA 1EQ9A 1GMCF 1K1MA 2ODQA 2A45B 1GVLA 3RXRA 1ETSH 2IN2A 2BYAX 1A7SA 1GHAF 1BITA 2UWPA 2VWLA 5E0JA 1W0KD 1ZGIA 2YMSC 4D7FA 4IGDA 4YO9A 1EOJA 3GY8A 4RKJB 1A61H 2OC1A 2ZDLA 4ZHMU 2GCHG 1A3EH 3TGJE 1DT2A 3N7EA 2YNBA 4JZFH 5EJLA 4X1NU 2Z7FE 4ZKOU 3UREA 4MVNA 3SORA 4K69A 1DS2E 2BLWA 3WWBA 1P05A 2F9VA 1PYTC 1SHYA 2VIOA 1AKSB 3EGKH 2VIDA 1N8OC 3F2GA 3MMGA 2KZ4A 1QRXA 1BMLA 1BIOA 4BAKB 1IAUA 1EZSC 1MUEB 3RXFA 3ZZ5A 5FCKA 2A5KA 4ABHA 2WPHS 2KAIB 4O3UA 4X6MA 1HJAC 2CF9H 3F1SB 3TGIE 1HAIH 5T6DA 1BMFD 3LT3A 3O8BA 2BOHB 1UTPA 2H9EH 2FOFA 1TMBH 1WAYB 1NESE 1D3PB 1E34B 1YY3A 5KGOA 1LKBA 9LPRA 2VB0A 5T6FA 1D4PB 2ZQ2A 1ZMNA 2CK3D 2BY8X 1YGCH 1LQDB 1QGFA 1HAVB 5AHGH 1O3PB 2IJD1 5F6MA 1TGNA 4WMDA 2GP9B 1SKYE 1E37B 2PTCE 1O2VA 4Y7BA 1SGIB 1ESBA 4I32A 3KQEA 1C4V2 3M7UA 2ZI2H 2G8TA 3L6PA 3KCGH 2GMTC 2SFAA 3KF2A 3A7YA 5A0AE 3UUZA 1RIWB 3C1KA 3VG8A 3LGYA 1HAGE 3URCA 1FX0B 3N99A 1SGCA 1GI5A 1K1LA 1AZ8A 3UQOA 2QN5T 3TITA 2UUJB 8GCHG 2RA3A 4IC6A 3GY5A 1MTNC 3RMLH 1ESAA 1SFIA 3RUOA 2Z3CA 5GPIB 3GY6A 3S0NA 1K2I1 4F55A 1YWUA 1O30A 4B2BA 1TBQH 4X6PA 2GCTB 4K8YA 3LIWA 1D3TB 1VITH 1QFKH 2BZAA 3LKWA 6GCHG 2RA0A 3QUMP 1MKXH 4X1PU 5AFYH 4D8NA 1QL9A 1Z8RA 3AK5A 1C2HA 1C5NH 3RXDA 4DURA 2R0KA 3M5LA 2PUQH 4D9RA 1TPAE 1SMFE 2GT7A 3SNCA 2D1JA 3LU9B 1A46H 3AAUA 2IJOB 5AF9H 2F3CE 1T7CA 4NIVA 1YPGH 1C1QA 1IHSH 1IQGA 1BMMH 2P3UB 4A6LA 5K0HA 1BBRH 1WTGH 1QQ4A 3K6ZA 2Z9JA 2PP6A 1GBEA 3ZVFA 2XRCA 5EW2H 1AWHB 2ZHEH 2P94A 1BTXA 2ZDKA 3UR6A 2M5TA 1K0HA 1MKXK 1DXWA 3GCHB 6ESTA 1AIXH 2UUKB 1YYY1 3EQ0H 5HMAA 3U69H 1GI8B 2A0QB 4IW4E 1UW7A 1EAIA 1NRRH 5DO4H 3BIVH 2ALPA 5A8XA 2PTNA 3MU8A 1A5GH 2VIWA 3I29A 1NTPA 3A80A 3PV5A 2A2XH 3GISB 1YPLH 8LPRA 4FUDA 2GVFA 4CRFA 3FVFB 1O3KA 1VKYA 3P70B 1Y5UT 1GCTB 3SBKA 1G37A 2K8IA 2VGCC 3UWJH 1D3QB 1J15A 5TCAA 2QXGA 1LDTT 4ISNA 1ABIH 4R0IA 1TRMA 1NRPH 1WOFA 1PQ8A 1N1LA 2NU4E 3D23A 2SGPE 2R2MB 3BTEE 1O2KA 1ANEA 2OC8A 3RC6A 2ZC9H 1Y5AT 2ZQ1A 3PO1B 3NCLA 1FY8E 1VR1H 3PMHB 2OQUA 3MU1A 1TA2A 1UVUH 1GMDF 2BD5A 2JJ2D 5CDFE 3SGBE 3BEFB 1FUJA 2RG3A 1BQYA 5JBBS 4X2XA 3HK6B 4BXSA 3UOUA 3R3GB 1OX1A 3PWCA 3UNRA 1O3LA 4INHA 3H7TA 1O2YA 1AB9C 1O2IA 3HPTB 1AQ7A 4DG4A 1RTFB 4CBNA 5KEDA 2VWOA 3LJJA 4Y8XA 1HIAB 1J8AA 5GCHF 2RCEA 2HGTH 1SGTA 1GBJA 3ODFA 3B23B 1O5CB 3EE7A 4GHQA 1K21H 1EATA 2DUCA 3U8TH 3DFLA 2OQ5A 2BM2A 2QF4A 2XNDD 2W7UA 1CHGA 4X2YA 4I8HA 1GI7B 4ISIH 4IMZA 2BVXH 4X1QU 1L1NA 2G4TA 1SLWB 2F91A 3OEED 1ZSKA 2P95A 3RXIA 1LCYA 3OAAD 2GZ7A 3OTJE 1EP6A 2A31A 1DM4B 1PPCE 3QTOH 2FPZA 2VWNA 2BX3A 2LNCA 3DSGA 1EPTB 2KCPA 1V2VT 5A8ZA 5JB8S 4GAWA 3SU4A 1BTUA 5F53A 3UNQA 1PPGE 2BQ7B 1XUJA 3BTWE 4H42U 3MH5A 1O2NA 1XUGA 3PRBA 1GI2A 1CBWB 1H8IH 1ETTH 5JYIA 1TPOA 1TONA 5LPEA 1GG6B 1V2RT 3FP6E 1SGFG 3SGQE 3KN2A 2CHAC 3LJOA 2PGBB 1MU8B 1TGSZ 3T27A 1GBFA 1RS0A 3FZDA 2FOBA 1V2OT 2TIOA 4O03A 5I46H 1AUTC 2BLQA 3GYMA 5E2OA 1FPCH 3S7KB 5AFZH 1HAHH 3W94A 1DXPA 3AW0A 2R9PA 4X1SU 1O5AB 2GD4B 4DGJA 2HALA 4E06H 1XX9A 4JZDH 3PTNA 1P2IA 4MPWA 2W6JD 1TOCB 1GJAB 1RFNA 3PLPA 4FUHA 1ID5H 4ISHH 5FPTA 1YBWA 3RM2H 1A3BH 4QT8C 2VWMA 2SGQE 4A1TA 2QA9E 1V6DA 1QHRB 1QNJA 5JDUB 4DW2U 1LVBA 4E7NA 2LELA 5F8TA 5L6NH 3SNBA 1O2TA 1O5FH 1A5HA 4K1EA 1XUKA 1ACBE 3P17H 1O3AA 1C1TA 1S6HA 5PTPA 1WQSA 1OYTH 3RXGA 1FONA 1G32B 4FU7A 5FBIA 5CMXH 3S7HB 1C1VH 2STBE 3Q76A 3RXQA 4CRBA 2XCNA 1O2JA 1YPHE 2SGDE 1QIXB 3Q3KA 1KXAA 1EB1H 3RMMH 3SHAH 1RTKA 1T8OA 3ZZDA 4Z0KA 1O31A 2WV5A 3QZQA 1OP0A 2XWAA 1CA0C 1CGIE 4IS5A 4ABAA 2J2UA 3MU5A 1EP5A 1KTTB 2Z3DA 2PKAA 1A0LA 1CO7E 2ZTYA 1QRZA 4TYDA 4AFSA 2Y5FA 4XOJA 1G3CA 2KX4A 1XM1A 1WYKA 2J9NA 3UR9A 2R3YA 2Y5HA 4TWWA 2AHME 3KHVA 2EI8A 1LTOA 4U30A 3LONA 3SN8A 4FVDA 1S6FA 3STJA 2P93A 2OTVA 1AFEH 1C2KA 3TGKE 2EI6A 4MDSA 4A1VA 3F9EA 2Q1JA 3EA7A 3MNCA 5EU8A 3K9XB 1FNIA 1T8MA 3BTME 3RXAA 1OS8A 2PLXA 1B5GH 2G81E 1KXDA 3MOCA 5FX5A 4ACBA 3FO8D 2ANMH 3RXMA 1S0QA 4AGKA 3GYLB 2PFEA 1GHBF 1TX6A 2WV4A 2ZTXA 4AYYB 1ZTJA 2LPRA 5B6LA 3EE0B 4HFPB 3RXJA 1C5OH 1UTMA 4YOIA 2UUYA 3EAJA 1QB1A 1MD7A 1UO6A 2JH5D
chains in the Genus database with same CATH topology
1KYNA 1FIZA 1KSNA 2ZDVH 1F5KU 1ZOMA 3WY8A 4CHAB 4ASHA 2JKHA 2J34A 1GGDB 2H1UA 1OWHA 1F0TA 1RGQA 3ATKA 1LHDH 4DT7B 1TNLA 2ZU3A 3BSQA 2BQ6B 2Q6FA 1SGRE 4BAHB 3VGCC 1ZMJA 2ESTE 4ZHLU 1O3NA 3AAVA 1W13U 5FX6A 1S83A 3EYDA 2BTCE 2Y82A 1SLXB 1FAXA 1GJ4H 4PROA 3SOSA 4AX9H 2FTMA 1KTSB 1ZPBA 3AVZA 3QGNB 2ZFSA 5G4BA 3GCOA 3GDUA 2GDEH 4DY7B 1MAYA 4SGAE 3P95A 2ZPQA 1C5YB 4GCHG 1SGYE 1IOEA 3SU6A 3KGPA 2VIQA 1HAVA 5F8XA 2WPIS 1QB6A 1LPGB 1HGTH 3A83A 4A92A 4K3JA 1JIRA 1C9PA 1SGDE 1ZPZA 2BDYA 3ATMA 1J9CH 1C1OA 3DUXH 1PPEE 1F5LA 4Y8ZA 1AY6H 5GDSH 1EUFA 4WJG2 1GCDA 1T4VH 1O2UA 3MO3A 5DP8A 2A7CA 2VIVA 1T8NA 2STAE 3OY6U 3PMAB 4XDEA 2BX4A 2FTLE 1C2LA 5ABWA 3A7TA 4F4OC 1C5VA 2BDAA 1TE0A 3UNSA 1C2FA 4INKA 2HOBA 2WPJS 4JK6A 4HI3A 4AB9A 2ZFQH 5GWZA 1H4WA 3KQDA 2J4IA 3P8FA 3GY4A 1CA8B 5FAHA 2SNWA 4WF8A 6CHAB 4RKOB 1KLIH 2C3SA 2W3IA 3TVJB 2SGEE 2ZFPH 1BDAA 1TMUH 1GDUA 1G3DA 2ILNA 4NGAH 1TNJA 1DPOA 1GDNA 4D76A 1UTOA 3MH6A 4NCYA 1K1PA 2FX6A 2GZ8A 1D6RA 1F7ZA 1JOUB 1KXEA 4FU8A 1ZPCA 1DWCH 4I8GA 2GTBA 1HB0B 2H2ZA 5EW1H 4B1TA 1UTLM 1AWFH 4FUIA 1SOTA 4KP0A 3T25A 3ZVCA 2ZHQH 1YCPK 4TPYA 5C20A 1UVSH 4I7YH 2A7HA 1NS3A 2BDGA 1O3JA 1YC0A 3A7WA 2YNAA 5L2YH 1TNHA 1UVPA 3STIA 1ETRH 3CENA 3PMBB 3BTHE 3SV6A 3RLWH 2I6SA 2XBYA 2JETC 5EXNA 4BTTB 2ZKSA 1A4WH 4ZXXH 5LGOA 1NFWA 2IPHA 1PQ5A 2Z3EA 1W12U 4KGAA 2W7SA 4F49A 1JIMA 1TFXA 4VGCC 3RXKA 3SNAA 1P9UA 5FPYA 3RXHA 1SHHB 2F9NA 2V6NA 1DE7H 1GJ5H 2GMTB 1HDTH 1QJ7B 4J2YB 2O8WA 3OX7U 3ZV9A 1LVMA 5TJXA 2B8OH 5C1YA 3MHWU 1A0HB 3TK9A 1JXPA 2XCFA 2ZF0H 2ODYB 4CRDA 4FUBA 2AIQA 1O3IA 2GCHF 4ZKNU 3RXSA 2FODA 3VB6A 4NZQA 4FUGA 1Z8GA 1TYNA 3A89A 1LO6A 4YLUA 3LC5A 2AMQA 4FUCA 1O3FA 1MTNB 2R3UA 3A81A 3MWIU 4BTUB 3NPSA 3D49H 1IQEA 3VB3A 2BD9A 3BTFE 4X1RU 7ESTE 4TY7A 3A88A 1GJDB 2HPPH 1SB1H 1DWEH 3NXPA 1H9LB 3I78A 2ZGXH 3SJ9A 4Q7YA 1O2QA 3GDVA 5A09A 1P3EA 1OPHB 2ZG0H 2OINA 4X8VH 2QIQA 5DP4A 3RMOH 2FEQH 4K60A 5E0HA 1Y3XA 1P03A 1T4UH 2ZPSA 1C1WH 1ZR0A 4WMEA 1DICA 1KXFA 1ZRKA 3VPKA 1P57B 1S84A 4NSYA 1C5UA 3BF6H 5A8YA 3NZIA 4MPVA 3BTDE 2BD4A 5DP3A 1XMNB 4J1YA 1HXFH 1PPBH 1LQEA 1YPEH 3M5NA 2Y7ZA 1F5RA 4CR5A 1G3BA 5LPRA 3URDA 1P04A 3GCTG 1O36A 1GJ9B 2ZZUH 5FBEA 4Y76A 1OOKB 1SC8U 4SGBE 1MQ6A 2TBSA 4FXGH 5EQSA 1W7XH 1Z6EA 4A7IB 1VJ9U 3OU0A 3M35A 3GCNA 4DJZB 1O38A 2BXUH 3IG6B 2PHBA 1TALA 1S82A 2VJ1A 4MNYA 1HIAA 5FCRA 3SJOA 4UD9H 2FOGA 3T29A 2QY0B 2OXSA 2F9BH 2FYRA 4X8UH 8GCHF 1HAYB 1BCUH 1FY1A 5L2ZH 1K1JA 3HKJB 2ZO3H 3BEUA 1GI9B 3MI4A 1ZMLA 1FIWA 2A4QA 2OC0A 4U01A 1MBQA 1C5PA 2AH4X 1VGCC 1H9HE 2Y7XA 1RD3B 2FIRH 1IQKA 1SG8B 1EXFA 1C1UH 1TNKA 3A7VA 4OS2A 5J4SA 1DDJA 6GCHF 1DY9A 2XC5A 4KTCA 3BG4B 2BD7A 1QR3E 1F0RA 1SQAA 3DHKH 4GHTA 1C5TA 5IYTA 2FDAA 2ZCKP 5FXLA 3VFEA 2AGEX 1G36A 3HGPA 3M37A 3DFJA 5FPSA 1FN8A 1WBGB 5EXLA 1Q2WA 2QYIA 1C2MA 1UTQA 2Q6GA 3FAOA 1BB0B 2F83A 1DSTA 3LGWA 1GBBA 4IN2A 5I25A 1ABJH 2ZGJA 1VCQA 1K9OE 3ENSB 2GCTC 4XFQA 3SQHE 1G9IE 2H5DA 4YT6H 1W2KH 3RU4E 3F68H 1MKWH 2ZA5A 1XUHA 3K65B 4NFEA 2BDBA 1BBRK 2ZCLP 3SV2H 5B6OA 1YM0A 2VNTA 2AIPA 3RXCA 7KMEH 1FDPA 4BAOB 2PSYA 1KXBA 2P3TB 4OS7A 1UHBB 4TPIZ 3SU2A 2FS8A 1O3GA 5EQRA 3A84A 3N7OA 1MCTA 2QC2A 1KDQB 1DX5M 1O3HA 2OCVB 4MPXA 2A7JA 1CT4E 1TOMH 1G2LA 4GUXA 1BJVA 2GDDA 1VITG 1BUIA 1LHFH 2C90B 1GBTA 5JBTA 1NFXA 2P8OC 3ZYEA 1QRWA 7LPRA 3S9CA 1O2GH 3BTGE 2OD3B 1Y3UA 1VCWA 1P06A 1K1IA 1NRSH 2Q6DA 2H9TH 4I8JA 3P8OA 2W3KA 1BJUA 1O2MA 3LPRA 1QBVH 2PV9B 2FESH 1P10A 1ZRBA 3E0PB 4B74A 1ZJKA 4ABJA 4BXWA 1FMGA 2IOTA 1E38B 1SPJA 3F6UH 1Y3WA 1IQLA 4BAMB 3L3TA 2XWBI 4IC5A 4U32A 1UK3A 4OS6A 4MG3A 3V7TA 2W26A 3OY5U 1V3XA 3EA9A 3R0FA 2QCYA 3QO6A 1GJ6A 4BTIB 2TPIZ 2R2WU 1AI8H 4X8SH 4O97A 3ZZAA 2V0BA 1UVTH 3FZZA 5C3NA 1WU1A 1AMHA 1AU8A 2OUAA 1F2SE 1NRQH 2NU2E 3A8CA 1Z71A 1GCTC 1P09A 1G3EA 2BD8A 1IQIA 2A4GA 1ELBA 1EAUA 1ESTA 3RP2A 3O8CA 4LZ1H 3A8BA 2O8MA 4FUJA 5FHTA 3U98H 4K5ZA 4LOYH 1AE8H 1YF4A 1SSXA 2OLGA 3E16B 5DKMA 2B0FA 1UK2A 3E8LA 4I31A 3MH4A 4INLA 1O35A 3PO1C 1FXYA 2C8ZB 1O2ZA 2PWXA 2B9LA 4AB8A 1AVGH 1PQ7A 1OWIA 1RTLA 3DD2H 3NWUA 2FYQA 3CS7A 3U8RH 4IBLH 1T31A 3UOPA 3BTQE 3TU7H 3KIDU 2PGQB 1DLEA 3MYWA 4K2YA 5LH8A 4Y0ZE 2G5VA 3AW1A 1H8DH 2CF8H 1W7GH 1P8VC 3RDZA 3ATLA 1NM6A 1Y5BT 2GZ9A 1V2MT 2CV3A 2BDIA 2O8TA 3S69A 1UCYE 2THFB 1SQOA 4WH6A 2CXVA 5HM9A 4OS5A 1L4ZA 5HXFA 3RU4T 2ZHWH 1HBTH 4UONA 1GHVH 2PW8H 2TGPZ 4CRCA 2FI4E 3F9HA 2FOHA 4NA8A 4GLYA 1PQAA 1BTZA 7GCHG 1KY9A 3PROA 1GBDA 3QTVH 3M3TA 1ZJDA 2UWOA 5EPYA 3RC4A 4CRGA 1P2KA 4CREA 3HKIB 1THSH 5CHAC 1FJSA 2P3FH 1B0FA 3TK6A 3QX5H 2ZNKH 2FI3E 3U1JB 4XBCA 1CBWC 2FOMB 3FANA 3M3VA 1O5GH 1DUAA 3QZRA 2ZEBA 1GG6C 1BOQA 3I77A 2AFQB 1ZLRA 1FLEE 4TY6A 3LH1A 1F92A 1ZZZA 3ATIA 3TLOA 4B71A 1GPZA 4ZUHA 1W0YH 4YOJA 4MQAA 1P12E 2G00A 1SGNE 3OSYA 4H6TA 1K1OA 2JH6D 1BTPA 1BTWA 2HNTF 2JH0D 1PPHE 3SQEE 1XXFA 1GJ8B 3QWCH 2I6QA 5DJ7A 1VCPA 3ZVBA 1BMAA 2CN0H 5TCCA 4AORA 1JRSA 4WXVA 1JRTA 1O2XA 3MO6A 1GBHA 1V2QT 4MTBA 4B73A 2QXHA 4AZ2B 1QA7A 3S9BA 1W10U 3TJOA 2ZGHA 4BOHA 4WXIA 2XYAA 3A85A 1V2KT 3RM0H 2ANKH 5DPAA 4XSKU 5BRRE 2Z9GA 4X0WU 3LGUA 2OP9A 1N6YA 1ORFA 2WPKS 4NWLA 4M7GA 1BMNH 2ZIQH 3L33A 1H1BA 3SU1A 1AFQB 3ODDA 4UFDH 3UIRA 4FVBA 1CT2E 1ELDE 2UWLA 3U9AH 4B76A 3RXOA 5C5NA 4OGXA 2EA3A 2SNVA 2XW9A 5JPMH 1HCGA 4A1XA 2BVRH 1GJ7B 1AVXA 2ZFRH 1HAXB 1XUIA 1FY4A 1IQMA 3FFGA 1DY8A 1Z6JH 4NSVA 5E2PA 1DWBH 4Q7ZA 1C1NA 3ZVDA 3ZZ3A 3SU5A 1ZSJA 2Y80A 4B2CA 1AKSA 3BV9B 4CH8B 1ZHPA 4K1SA 1MCVA 3SUGA 4JYUH 1AVWA 1BT7A 2SGFE 4Y7AA 4ZROA 1OP2A 1WQVH 3ELAH 4WMFA 4ABIA 1GVKB 2C4FH 1FV9A 3TPIZ 1O3BA 2KAIA 4DOQA 1BTHH 2ZFFH 3FP8E 5F03A 1BHXB 3A86A 4NZLA 2EEKA 4H6SB 1DANH 1GJCB 2D8WA 4THNH 4FUEA 4X6OA 4NIYA 4JYVH 3IITA 5GJ4B 3GDSA 4I8KA 3P6ZB 5JBAS 1CHOG 4JCNA 1GMHG 2PKSC 2BQWB 1UK4A 1BHXF 1DWDH 4KKDA 3VEQB 1NY22 1C5SA 5EG4A 2HNTE 2H5CA 3GICB 3ZV8A 1TRYA 2WPLS 2ZECA 4Y10E 1D9IA 3T26A 4WY3A 5HGGA 3E3TA 1Q3XA 2QXIA 5ESTE 4D7GA 2OBQA 3Q77A 3V12A 1FN6A 1Z1JA 1QTFA 4Q7XA 2FLRH 1C5ZB 2BOKA 3M5MA 3E1XB 4FU9A 1O32A 2G5NA 4RN6A 1GGDC 2ZP0H 3V13A 4GCHF 1AE5A 2VVVA 1DLKB 3SJKA 1A0JA 2BB4A 5ETXA 1GHZA 3TJNA 4Y6DA 1OKXA 1Y59T 5DGJA 2C8XB 4MNVA 1O5BB 3HGNA 4IN1A 1S0RA 4MNXA 2BY7X 4JMYA 2A4OA 2HLCA 5HYOA 1INCA 2GT8A 2FXRA 5J4QA 4A5TS 1N8OB 3MTYA 1O0DH 1QQUA 3Q3YA 1D6WA 2ZTZA 2P16A 1ANDA 1EX3A 4YTAA 2AEIH 2PR3A 4LXBH 1GMCG 3PWBA 3QK1A 3O8RA 4Y11E 1UTJA 1GHAG 3LC3A 1NRNH 1JBUH 1MH0A 1RXPA 3PV4A 3A7ZA 4X2VA 1GJBB 2WUCA 1PJPA 2UUFB 1HJAB 4ZKSU 2XC4A 1P02A 5DK1A 1DSUA 1SOZA 1IQHA 1SGQE 1U6QA 2Z9LA 4MNWA 1IQJA 4YLQH 1ELEE 4GSOA 3A8AA 3JZ2B 2TGAA 1Z7KA 4X2WA 1O34A 1TQ0B 3TNSA 4B2AA 1EOLA 1UTNA 3KQBA 4OS1A 3T28A 1XVOA 2BY5X 3Q3XA 4ABFA 1HFDA 4NWKA 5HM2A 2DE9A 3DT0H 1GBCA 1OSSA 4XBBA 2FX4A 5EPNA 1SL3A 3W95A 1A5IA 1GHXH 3RXTA 1KLJH 1CVWH 1KIGH 3M7QA 3SHCH 1Y3VA 4LZ4B 2V3OH 1HUTH 1FQ3A 1J14A 2Z6BD 1ELCA 3VB4A 1C5QA 6CHAC 5JBCS 5K7RA 1MD8A 3SUEA 5C67A 4NIXA 3PB1E 4TWYA 3ITIA 1E35B 2AYWA 1V2WT 2EC9H 2ANWA 2F9PA 4KTSA 3T2NA 1YLDA 5F8ZA 5GIBA 4JZIA 1MBMA 3SW2B 3VB7A 1EJMA 1O2RA 2BDHA 3K2UA 4E7RG 5EQQA 2FS9A 3SZNA 1C2DA 4JYTA 1CSOE 1RJXB 1QL7A 5ESBA 1O37A 4Y8YA 1HNEE 3C27B 1C2JA 2H6MA 1TRNA 1KXCA 9ESTA 1NO9H 2ZHDA 1BRAA 3F9FA 1HAOH 2TRMA 1XKBC 4UFGH 1FPHH 2Y6TA 1P2NA 1UHBA 4RSPA 1AN1E 1WTHD 4UFFH 1KDQA 1ELTA 2BXTH 1BZXE 3GOVB 3ZVAA 1MTSA 3EDXB 2J92A 4ZHAA 3ZVGA 4NA9H 1QURH 1O2HA 2C8YB 1P2MA 3U1IB 4R8TB 2A5AA 4MPUA 1YPJH 1VGCB 2XBXA 1ELVA 2BLOA 1THRH 2O8UA 2RDLA 3Q00A 3RLYH 1O33A 1TAWA 3MNSA 1AGJA 2GKVE 1MTWA 3PYHA 4E05H 2Y81A 4O9VA 4YM9A 2TGDA 5LPFA 1UCYH 1HJ8A 1XKAC 2A1DB 5C1XA 1TX8A 2HPQH 4ABBA 2R0LA 3M7TA 3LGVA 3ESTA 4ABGA 4DCDA 1AD8H 3UFAA 1E0FD 3SGAE 1QY6A 1C1SA 1TA6A 1Z1IA 2B5TB 1G30B 2VIPA 4KELA 3UWIA 1P3CA 1JWTA 1P9SA 2PUXB 1GBAA 3GCTF 3KEEA 2BD3A 1O2LA 3PLKA 1OXGA 1SLUB 2GV6A 4DVAU 1P2OA 3SV9A 1A2CH 1MZAA 1RIWC 2AMDA 1ZSLA 3T5FH 2D26C 3ZZ9A 1EPTA 2ZDAH 3O8DA 3RXBA 1UCYK 3MNBA 5DP5A 1TIOA 1XUFA 1DVAH 4AFZA 2GV7A 1TB6H 1SGEE 2BY9X 1L2EA 1ANBA 2VGCB 3NKKA