2ZPQA

Crystal structure of anionic trypsin isoform 1 from chum salmon
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
220
structure length
220
Chain Sequence
IVGGYECKAYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPSSCAPAGTMCTVSGWGNTMSSTADKNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Anionic trypsin
publication title A structural comparison of three isoforms of anionic trypsin from chum salmon (Oncorhynchus keta).
pubmed doi rcsb
total genus 50
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zpqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zpqA02
4U30A 4CHAC 4WXVA 1NESE 4H4FA 1FIWA 1O2TA 3BG4C 1FMGA 3RXPA 1K1IA 1Q31A 2GV6A 3ZZCA 4KTSA 1C5YB 1P2IA 3E16B 5EU8A 1A4WH 1W2KH 2QAAA 3B9FH 3MNCA 1P06A 1TNIA 2A7HA 2QN5T 4Y8XA 5DJ7A 3I77A 3SNAA 4NA7A 2ANWA 3LKWA 1BTPA 3F9HA 1O2ZA 2HPPH 4F49A 1C2HA 1GJ5H 1K28D 5T3HA 2WUBA 4X6PA 1RGQA 4AOQA 4FU8A 1C5QA 4Y7BA 5DP5A 2BD3A 1GHZA 2WV4A 2ZHDA 2P3TB 2W7SA 4AFQA 1L1GA 3RXCA 2OD3B 5EODA 3SOSA 3RLYH 4BTUB 4O97A 1O2QA 1O36A 4IMQA 1V2LT 1DX5M 3T26A 1KXEA 1E36B 4UE7H 1C5SA 3UREA 1ZMLA 1SGRE 2PSXA 3QLPH 3KQEA 2J9NA 1V2KT 2VGCB 3GY7A 2ZU4A 1O3MA 1ZR0A 1YCPM 3JZ1B 3ATKA 3SU6A 1KTTB 1ZSKA 2ZQ1A 4GCHF 3MTYA 1Y3XA 2F9OA 2FX4A 1W3CA 4TPYA 4X2VA 5TJXA 3NPSA 1AFQB 2A5AA 3P6ZB 2ODQA 5K0HA 3LJJA 3LGTA 1UTQA 3SJOA 4FUIA 3FP6E 2G55A 3SI3H 2A4RA 2RDLA 4ZMAH 3A86A 1GBTA 2QXHA 2QXGA 4IC5A 3BG8A 3V0XA 1MKXK 4I33A 1QHRB 1BITA 1ZGIA 1UCYE 1ANDA 2ZP0H 1EQ9A 2A5IA 4KELA 8GCHF 1EZQA 1JBUH 4AN7A 1A3EH 2CV3A 2A32A 3F68H 2IJOB 4DOQA 1BTHH 4NG9H 1O2VA 1NROH 1LPGB 1LVOA 3ZYDA 3KNXA 6ESTA 2PUXB 1F5LA 1G3BA 3RP2A 1CT4E 1GJ4H 4ISNA 2OC8A 1TPSA 3E8LA 1EPTB 4A6LA 3M37A 4SGBE 5GIBA 1IQFA 2FI4E 1YC0A 3A85A 1RJXB 3SGQE 3SJ8A 2EI6A 2A7CA 1YKTA 3MWIU 5ESTE 2Z9IA 1F5RA 1O3AA 2Z9LA 3KQBA 3PO1B 1M9UA 1ARCA 2BY8X 2ANYA 1GBJA 4CRGA 2BVRH 1ESBA 3MOCA 4ESTE 1UTJA 2GD4B 1D3PB 2J95A 1AB9C 1TBRH 5SGAE 1C2FA 1P9SA 1IQHA 4ZHMU 2BY5X 1AKSA 3KEEA 2LNCA 4Q7XA 2C8XB 4NFFA 1KYNA 1KLJH 2BDHA 2BD9A 2CHAC 9LPRA 1UO6A 3VXFH 1YPGH 2HVXA 1QJ1B 1S83A 1IQKA 5HMAA 2TGDA 4ABHA 2ZECA 5EW1H 2WINI 1O3NA 5LPRA 4AGKA 4ZHLU 3MNSA 1AU8A 4ISIH 1SOZA 3R3GB 2VWMA 1O0DH 4B71A 1P2OA 1C1NA 1AFEH 5F6MA 1XX9A 1SLXB 2FLRH 3BTGE 3SN8A 3VB4A 1TNHA 3MO3A 1Y3WA 4HZHA 1FUJA 1HBTH 5JYIA 1GJ9B 1K1LA 4CHAB 1CU1A 1CT2E 2HRVA 1CSOE 2F83A 5DP7A 3BTWE 5FXLA 3BG4B 3ZZAA 5EQQA 3DT0H 1PPBH 3L3TA 4WJG2 1Z6EA 3EA8A 2FTMA 1O2KA 4FUGA 1K1NA 2SGFE 4CRDA 1OWEA 1SGFA 2BTCE 2OCVB 3LPRA 4HI3A 4NFEA 2ZU5A 1GGDC 4X8VH 3EDXB 1C5WB 1S82A 2H6MA 2UWLA 2FS8A 3BTQE 2XRCA 1DM4B 4WH8A 5AVDA 1VCQA 1UTOA 3U8TH 2QC2A 4A5TS 1IAUA 1KIGH 4JZDH 3BIVH 4LXBH 1IOEA 4WY3A 1JIRA 1QA0A 1W14U 1RRKA 7GCHF 2R0LA 1ELEE 1KXAA 1FONA 3Q77A 2FLBH 1TMUH 1V2JT 1GHWH 1UK4A 2OQ5A 2PKAB 5J4SA 1P03A 1MTVA 1J17T 3W94A 1J16A 2ASUB 3SNCA 1O2JA 4GCHG 3S0NA 1BHXB 4ABEA 4FUFA 1JIMA 2P16A 2VU8E 3EA7A 3GY2A 1DUAA 3M36A 1C2EA 3EA9A 3LONA 1SQAA 3VPKA 4X1QU 1TA2A 5F03A 1WOFA 2H9HA 1KLTA 2HNTF 1K1OA 1O3DA 4IGDA 3S9BA 3VB5A 2Y82A 2WPLS 3AASA 4MNXA 2A4OA 3A8DA 2WPJS 2ZNKH 2AMPA 3TH4H 3A7WA 1ZPCA 7LPRA 1IHSH 1OXGA 4B75A 1EOLA 2VWLA 1SFQB 1EPTA 8GCHG 1EB2A 1TFXA 4JK5A 5EPNA 1QL7A 3UNQA 2P59A 1DDJA 1O2IA 3ATMA 2H1UA 3PLPA 1HAPH 2FXRA 4ISHH 4A1XA 1SLUB 3AW0A 3ATLA 1QA7A 3BTFE 2RCEA 3BN9A 1GDNA 1UK2A 1MD8A 4DT7B 1N1LA 1SI5H 2ZFSA 2ZF0H 2BQ7B 3VXEH 4SGAE 2FZZA 5C5OA 2GP9B 1G2MA 5E0HA 1SG8B 4R0IA 1O5DH 2AEIH 6CHAC 1ZHRA 4AGJA 1MQ6A 1QJ7B 4MPUA 4O03A 3ZZ7A 4MTBA 1GHAF 3SQHE 2VIOA 2Z9JA 1O5CB 1O2WA 2VH0A 3P92A 2VIPA 2IOTA 3SU3A 1AB9B 1TLDA 3VB3A 4H6SB 3SO3A 1ETRH 2HPQH 2GMTB 1Y5UT 3DD2H 4CRFA 2BD7A 2H5CA 5JDUB 6GCHG 2VIDA 1ZSLA 3PLKA 2O8MA 1V2RT 1ESTA 2A7JA 2AYWA 3NZIA 1IQNA 2G52A 2PGBB 2PLXA 3EQ0H 3H5CB 2CHAB 3ZV8A 1LVMA 1MQ5A 2ZPRA 3ZV9A 4DGJA 3AAVA 1FY5A 1EJNA 3RU4D 2Q6DA 3GY8A 3RXOA 1LHDH 2PGQB 1W0ZU 3UPEA 3ZZBA 3UNSA 1CHOF 3CENA 4ISOA 2ILNA 2D1JA 4OS6A 4NZLA 2A31A 5HYOA 1GL0E 4X6NA 1BBRH 1AZZA 4ISLA 3RXQA 4TPIZ 4ABDA 2ZHWH 1EATA 3PROA 1ELDE 2OINA 1HV7A 3URCA 3SW2B 1XMNB 1SSXA 1EOJA 4Y8ZA 4ABAA 1SMFE 1G3DA 4BXWA 1PPGE 4Y71A 1OSSA 3TH2H 2DE8A 1WAYB 3P95A 2C90B 2BQ6B 1DFPA 2M5TA 2TGTA 2ZI2H 5DGJA 2SNVA 4NWKA 1GI0A 1S6FA 1GHXH 1SLWB 1TPOA 1BHXF 1WCZA 1U6QA 2VVUA 4MDSA 1NS3A 3SU1A 2F9BH 2C93B 2ZKSA 1GMDG 4YT6H 3BTEE 5E0JA 4CH2B 5A09A 2FODA 1EB1H 1KY9A 3RXAA 1TRNA 4X6OA 1INCA 5DG6A 4Y8YA 3ZZ8A 4XBDA 1P3EA 7GCHG 5FPYA 3HGPA 1YCPH 3MHWU 1C1SA 2ZDNA 3UFAA 2TIOA 5JBBS 2J2UA 2A5KA 2AIPA 2F9NA 1NU9A 2Z3CA 3D23A 1ELBA 1HAXB 4X0WU 1S5SA 1LHFH 1QFKH 1V6DA 2FI5E 4XE4A 4YTAA 1THPB 3MH6A 4YOGA 2QV1A 3FZZA 4GVUA 2HOBA 1C5LH 3L6PA 1OP0A 1Z8IB 1DOJA 1TGTA 2AS9A 1SGYE 3SNBA 1JWTA 2XTTB 1YPHC 4TWYA 1VCWA 3LGIA 2SGQE 3HATH 1UK3A 1FLEE 1AO5A 3TNSA 1Y59T 3UR6A 2FWWA 2CN0H 2ESTE 2SGDE 4I8JA 4NCYA 4ZHAA 3M3VA 1VJAU 1YF4A 1THSH 3TVJB 1SGNE 1CHGA 3Q3YA 4BAOB 3PMHB 4ZROA 2VH6A 3A88A 2EI7A 3HKIB 1CGJE 1CVWH 2Q1JA 3JZ2B 3ZZ6A 4GSOA 1O2MA 1QBVH 1FN6A 2ZTZA 1BIOA 1DICA 1O2UA 1EP5A 2AFQB 2UUFB 4E7NA 5AHGH 4O3UA 3BTME 1MCTA 5LGOA 3DFLA 5GPIB 4E06H 6CHAB 2Z3EA 1TMTH 2G51A 3DHKH 3MU4A 1TNGA 2QCYA 2BB4A 2VIWA 1EASA 1RTKA 3I78A 4Q80A 3GICB 2BY6X 1G3CA 1QGFA 1C4Y2 1AN1E 2G00A 3LGYA 1PPCE 1L2EA 1T7CA 5TCAA 2O8WA 1FAKH 1EAUA 2AGGX 3BIUH 2FTLE 3V3MA 3KGPA 1HJAC 1ZTLA 2ZFPH 3T62A 1HB0B 2CGAA 1BQYA 3A80A 5L2ZH 1LQEA 2XBWA 3QO6A 1F7ZA 1LQDB 1TIOA 1C1OA 4AG1A 1O31A 4DCDA 4FXGH 1F92A 2R3YA 4ZUHA 1P2MA 1D3DB 1OP2A 3OTJE 1P3CA 1CA0C 1XXFA 2OP9A 3SU4A 2BHGA 5JB9S 3B8JA 1TE0A 2FPZA 4NSYA 1NFYA 3RU4T 4UDWH 1BRBE 4FUCA 2PW8H 1K1JA 1BRAA 1SGDE 1B0FA 1NTPA 1OWKA 2J38A 4X1NU 1FPCH 3D62A 1BMLA 3RXGA 4FUJA 4IN2A 3S9AA 1NRNH 3SUEA 4U32A 3SV6A 1QB6A 3QTVH 1GHBG 1C5TA 5ESBA 1G9IE 2HLCA 1GMHF 3GDUA 3ODDA 1C5OH 3NKKA 4YZUA 3Q76A 1BTZA 1G36A 1K1MA 1TNKA 2BDGA 1OYQA 1S0RA 2WV5A 1GVZA 4MLFB 4ABBA 1WU1A 2C8ZB 2G5NA 2ZEBA 4LOYH 1L0ZA 1AGJA 1T31A 2G5VA 1F0UA 4YESB 4MNVA 2XYAA 2JKHA 1OP8A 3O8CA 2Z6BD 1SGCA 1SQTA 1N8OC 1YPLH 3H7OA 3ZVBA 1A0LA 2QF3A 4RN6A 1H9LB 2BZ6H 4LZ4B 2GCTC 1ANCA 4K60A 4BXSA 2QXJA 1P2NA 1LHEH 1ZLRA 1TA6A 1CT0E 3TK5A 3M3TA 4X1SU 2Y5FA 2C8YB 5K7RA 1V2UT 1PJPA 4I8GA 1GG6C 1FJSA 5A0BA 1UHBB 2FDAA 3K6ZA 3QK1A 1QURH 1RIWC 1C5VA 2ZU3A 1L4DA 1C5ZB 4XDEA 5EQRA 3RXKA 1Q2WA 2BLQA 1DVAH 1Y8TA 1VGCC 4QT8C 1ZOMA 1SQOA 1ZHPA 2OBQA 1ZSJA 1TABE 1DE7H 4F4OC 1SLVB 1GBIA 5T6FA 2VINA 3PMBB 5BRRE 1AUTC 1TGCA 1D6WA 1XKBC 3DA9B 3UWJH 2PFEA 1KXDA 2CF9H 1QTFA 2ANMH 2XWBI 1GI2A 3UWIA 4IMZA 1O2OA 2GCHF 2O8LA 1MU8B 2OQUA 1D3TB 3SUDA 1UMAH 3T25A 1MZAA 3TIUA 1SR5C 4BAKB 2FESH 5C67A 1NO9H 3NXPA 1NY22 2Y7XA 3A7ZA 4DY7B 1BMMH 1QRZA 1UCYH 1S85A 3P17H 1E38B 2V3OH 1Y5BT 1O2RA 1TPPA 4B2CA 1A5GH 2Y5GA 2P3FH 1UTMA 2Q6GA 1NRPH 4Y7AA 2J34A 1YP9A 2FOFA 2CJIA 1JMOH 2AIQA 3R0FA 3RM0H 1ZPZA 1H9IE 1C5MD 1W7GH 2VVVA 3M5LA 2Z9KA 5CMXH 1T8MA 2R3UA 4CH8B 4MPVA 2BLWA 1MKWK 1HJAB 1LPZB 1AWFH 1GBMA 3D49H 1A2CH 3KL6A 3M35A 1AUJA 5T6DA 4ABFA 2XBYA 1TB6H 1HJ8A 1DXWA 3SZNA 1HYLA 3LGVA 1BMNH 4B2AA 3U8OH 1CA0B 1O2SA 1PPFE 3IG6B 1L1JA 1QB9A 3FP8E 3FP7E 1MTSA 1D6RA 4Q2KA 2FIRH 3P8GA 1EKBB 2EA3A 1P2QA 5JBTA 4JYVH 2GT8A 1MBMA 2PUQH 1TGSZ 2ZFFH 4FVDA 3BTKE 3LJOA 3C1KA 1GMHG 5PTPA 1C2IA 2P94A 2BLVA 5GJ4B 1PYTD 1P2JA 1BTWA 1Z1JA 5EW2H 2ZGXH 2QXIA 4WH6A 1A1RA 5DP9A 1V2WT 2Z7FE 5LPFA 3RXBA 2BQWB 3ZVDA 1BDAA 2GX4A 2FOMB 1AVGH 1XUGA 4UFFH 1XVMA 4BNRA 3Q00A 1SL3A 5IDKA 1T8OA 1AI8H 3T5FH 1A46H 1E37B 1UTNA 1TRYA 1TGBA 3M61U 3U8RH 5FPTA 1GI6A 3OY6U 2O8TA 1UHBA 4JZIA 4WVPE 2GCTB 3ATWA 3SJIA 2PV9B 2J4IA 1VJ9U 3MU0A 2AH4X 3TJNA 2HGTH 1MD7A 1CO7E 4NWLA 1BJVA 1BCUH 1O3OA 5F8XA 3GYMA 1DSUA 1KLIH 3UOPA 1KXBA 4AFSA 3U1IB 1K1PA 4B2BA 4D7GA 1HIAB 1V2VT 1IQJA 1GG6B 3VGCC 1TAWA 3CS7A 3QGNB 1ZMJA 2STAE 3RXFA 2C4FH 1ELTA 1TX7A 2JETC 4B1TA 3P8NA 1BTUA 4UEHH 1FY8E 1ELGA 4WMEA 3OY5U 3GDSA 4X1RU 1GBBA 1VGCB 1LHCH 1AWHB 1GVKB 1OKXA 4YT7H 2FOBA 5FX6A 3S9CA 1XKAC 5ABWA 3SU2A 1TQ7B 1GHVH 3RXSA 1WQVH 4IS5A 5BPEA 1ZTJA 1LCYA 5ETXA 1XUIA 4FUHA 1AZ8A 2GZ7A 3MNBA 1O2LA 1H8DH 1HCGA 2ZDLA 2J92A 1VITF 1GBLA 2F9UA 5F8TA 1VZQH 1OYTH 1ZJDA 2R2WU 1VR1H 3TLOA 1D9IA 1DXPA 3OX7U 3HKJB 4H42U 1ELAA 2H5DA 3OSYA 5I25A 4D9RA 1P57B 4GUXA 2D26C 3HGNA 2ZGCA 3SV7A 2SGAA 4JCNA 3ZVFA 1PQ7A 1ID5H 8ESTE 4CR5A 4Y79A 1A5HA 3SV8A 1GJAB 1XUJA 1P11E 2ZPSA 4XOJA 1A5IA 1NFXA 4XBBA 1S84A 1A7SA 1EP6A 2CF8H 3VB7A 1TNLA 2QYIA 1BT7A 3V13A 2PTCE 3MI4A 1O5FH 1DWBH 4RKOB 2BD5A 1YYY1 2V0BA 1HXEH 1EZSC 3FANA 2SFAA 1J8AA 1CBWC 1O5BB 1O2NA 1TBZH 2PR3A 1QY6A 1GI7B 1V2PT 2A1DB 4XFQA 3N7OA 3GCNA 3A8BA 1C2DA 3RXRA 1QQUA 2AERH 1GBAA 2ZHFH 3T27A 3A8CA 1TMBH 3RXHA 1XXDA 3SHCH 5CE1A 1GJ7B 3LC5A 4UFDH 5AFZH 2RA0A 1BTXA 2B5TB 4M7GA 1O38A 1MAXA 1FY4A 3F9GA 4OGXA 4JK6A 4CRAA 4KTCA 4JYTA 5E8EH 2O8UA 4MNYA 3GY6A 1FDPA 2AGEX 3FAOA 1BJUA 2GVFA 3E0PB 1FAXA 2ZFRH 5LPEA 3A7YA 3GCHC 2ZDVH 3GYLB 1THRH 2FMJA 2ZGHA 1PYTC 1NZQH 3CS0A 2SNWA 5FBEA 1SGPE 2FS9A 2ZC9H 4INKA 5HM2A 3RXVA 1W12U 1HAHH 3K65B 3D65E 1Z8JB 2GT7A 1PFXC 1HIAA 3A87A 1O2HA 1K2I1 1O3LA 4ZKNU 3MH7A 2XBXA 4R8TB 1A3BH 1YLCA 1K9OE 1CA8B 2ZDMA 1Y3YA 1SGFG 2GGVB 5GCHF 1B0EA 2P3UB 1V2NT 1P09A 1F0TA 1H9HE 1NFUA 2DE9A 2Y80A 3HK6B 4K1SA 1ELFA 1LPKB 1NM6A 2C3SA 1EJMA 1GMCF 1YLDA 1UTLM 4Q7ZA 4B74A 1GGDB 4WF8A 3VGCB 1AVXA 1BA8B 1VCPA 3UQVA 2JH6D 2OC7A 4J2YB 4FUBA 1QRWA 4UD9H 3SJKA 1ACBE 2XXLA 3ZVAA 1GI5A 2JETB 2FOGA 1YPHE 2A0QB 3PMJA 3TK9A 5HXFA 4NIVA 2BDIA 1LO6A 1C9TA 3A7VA 5G4BA 4YLUA 7KMEH 1MZDA 1W7XH 1BRUP 2BDCA 1C2MA 3KIDU 1S6HA 4KP0A 4CREA 1ANBA 3V7TA 5JPMH 1PPHE 2ZU2A 1F2SE 1SGTA 1QIXB 3C27B 5EQSA 1ABJH 5GWZA 1C1PA 5A0AE 1TONA 3LDXH 4GHTA 3VEQB 1E35B 3NCLA 5FAHA 4YOIA 1O30A 1F5KU 1LDTT 2ZGJA 4ZAEA 3UQOA 3F6UH 1ZJKA 1O3HA 3PWCA 1SGIB 1HNEE 1BTYA 4DURA 1IQGA 2WYGA 2XC4A 1T8LA 4VGCC 2JH5D 2YOLA 1HAYB 4NIWA 3B23B 4MPWA 1QBOA 3CP7A 3E6PH 1HFDA 1RTLA 1X7AC 1C9PA 4OS1A 1WTHD 2WPIS 1VITH 3PYHA 1LKAA 2W5EA 3ZZ9A 3A84A 1JOUB 3LU9B 1P05A 3RXEA 3BTTE 4CBOA 7ESTE 2I6QA 1MKXH 1H4WA 1K21H 1AQ7A 4Y76A 2QF0A 1P02A 1HXFH 3EE0B 4K8BA 1UTKA 5C5NA 1O2YA 3BSQA 4AZ2B 4CR9A 4I32A 2UUKB 4D8NA 3L33A 1S0QA 2FO9A 3PB1E 1GJ8B 2VNTA 3O8DA 5AFYH 1CBWB 2FEQH 3PLBA 5L6NH 3LOXA 1P8VC 2FI3E 1HUTH 4MVNA 3V12A 1MH0A 1V2OT 5A2MH 1NC6A 1GHAG 3QN7A 2FOHA 4IN1A 1J15A 3SNEA 4H6TA 1SBWA 2ZFQH 2PHBA 3U9AH 1TNJA 4B76A 2NU1E 1HAGE 2OC1A 3M5MA 3RU4E 1UJ1A 2BVXH 4BANB 2XNIA 1TOMH 1XUHA 1NFWA 3K2UA 5DKMA 2ZA5A 1TGNA 2FM2A 1W10U 2G4TA 1UVOA 1DANH 1WV7H 3GCHB 4TYDA 1H8IH 1NN6A 2ZWLH 4CRBA 1Z7KA 4OS2A 4RKJB 2BD8A 4X1PU 1DLEA 3RMNH 2PKSC 1O3JA 1TBQH 2TPIZ 3BEUA 2EC9H 4K1EA 1AE8H 1GI3A 3KHVA 3FZDA 2AGIX 1CHOG 2HNTC 5J4QA 5GXPA 4DIIH 4ZH8A 1G3EA 3UTUH 4Z0KA 4U01A 1O3PB 3E0NB 1XUKA 1OWDA 2F9VA 2VWNA 2CMYA 2BD4A 1AHTH 2SGPE 3OU0A 3WY8A 1G30B 4AX9H 2Z3DA 2FP7B 3TJVA 5F8ZA 2TGPZ 1GMCG 2UWOA 2GV7A 3MYWA 1UVTH 1GJBB 2XW9A 3ZZ3A 1EAXA 5LH8A 1V2ST 2HALA 1A0JA 3GCOA 3RDZA 3H7TA 5EXLA 4BTTB 1DSTA 3LGUA 4K5ZA 4NA9H 4Y11E 3DUXH 2Y81A 3I29A 1MBQA 2XC0A 2YNBA 2TRMA 4JZ1A 3SU0A 2QY0B 3EGKH 1MAYA 2ZHQH 1ESAA 2BX4A 2VIQA 1BBRK 2GZ9A 2BX3A 3T29A 1RTFB 2PTNA 3W95A 1Y3UA 1GL1A 1OS8A 4JYUH 4E7RG 1F0SA 1GJCB 1DUEA 1ELCA 2BY9X 1GVLA 5C2ZA 2UUYA 1GBKA 5AF9H 1WQSA 2BMGB 3ZVEA 1C5PA 1DITH 4AB9A 3SBKA 5EGMA 3GY5A 1QL9A 1ETSH 2QA9E 5A8XA 3EYDA 4JZEH 1PQ8A 4MG3A 5FX5A 1GI4A 3VB6A 2UWPA 2BDAA 1HJ9A 4VGCB 3T28A 1UVPA 3P8FA 1P0SH 1P01A 3AAUA 3UNRA 4X2YA 3S7KB 1O32A 5JBCS 1YCPK 1DS2E 3SV2H 1FPHH 2GDDA 3RM2H 1TRMA 2Z94A 4INHA 3BTDE 1FY1A 2W7UA 3MNXA 4NGAH 2BDBA 2ZCKP 1ZRKA 3MU1A 1EX3A 1HGTH 1PPZA 1O5GH 2WPMS 3RMMH 3SGBE 4TWWA 1MTUA 5HGGA 2BY7X 2UUJB 3TGIE 1GI9B 2D2DA 4AFUA 3SNDA 4ZXXH 1ZTKA 4RSPA 1B5GH 4X2WA 1IHTH 1GHYH 6LPRA 2ZPQA 1LMWB 2XCNA 5A8YA 2OBOA 1WSSH 3E90B 1J9CH 4OS7A 1KDQB 3U69H 1GPZA 1WTGH 4I7YH 3TPIZ 1UTPA 3RLWH 1IQLA 2D8WA 1T8NA 2TBSA 3KCGH 1C1QA 2BVSH 2ALVA 3SU5A 3KN2A 1O5EH 3PTNA 4CRCA 2ZCLP 1ANEA 4LZ1H 1P2KA 3Q3KA 1LVYA 1RXPA 2Y5HA 1DT2A 4DW2U 2VIVA 3VFEA 3GY4A 3RXLA 1FQ3A 2PKSB 1IQIA 5IYTA 3MH4A 1HAVB 3TJUA 5DP6A 3UUZA 4ABIA 3M5NA 2J94A 4D76A 5E0GA 1BMAA 5A0CA 3M7UA 1EAIA 2HWLB 2P95A 3RXMA 4K1TA 3RC5A 2RG3A 3FFGA 4NIYA 1QQ4A 2VVCA 4YLQH 3URDA 4FU7A 2OLGA 3E3TA 3RXJA 1LTOA 3TGKE 3GISB 2ZU1A 2K1QA 1W11U 2A2XH 2ZDKA 2BYAX 1C1MA 1O34A 2GKVE 1A61H 1SVPA 2WUCA 4WXIA 3S7HB 1ARBA 1NRRH 2PSYA 4E05H 1C4V2 1KXCA 3BV9B 4JZFH 1OWIA 1K22H 2GMTC 1D4PB 3RC4A 1QL8A 2ZDAH 6GCHF 3GCTF 4DVAU 3ZYEA 3ZVGA 1XM1A 1QB1A 3QUMP 1Z6JH 1N8OB 3RXDA 4NIXA 1FN8A 2ZO3H 1MMJN 2ANKH 2GZ8A 1WYKA 1TX6A 2ZZUH 2BDYA 5EPYA 1BB0B 2ALPA 1YPEH 9ESTA 5L2YH 1FXYA 4I8KA 3MMGA 1G37A 5DP4A 4ABJA 3A81A 3GOVB 8LPRA 1C5UA 2A2QH 2WPHS 4D7FA 1LVBA 1P12E 1EAWA 4I8LA 3UIRA 3MH5A 1MU6B 3S69A 2P8OC 5JBAS 4A92A 3SJ9A 1PQAA 3UR9A 1RIWB 4DJZB 2ZTXA 5L30H 2ZQ2A 5FBIA 1C5RA 3F9FA 1DPOA 3PTBA 1DWDH 3SUGA 4I31A 1HAIH 1NRSH 1ZPBA 2THFB 1OWHA 3LH1A 2P93A 3MFJA 4TY7A 2AMQA 2BZAA 2YNAA 3QDZB 2BXUH 3A8AA 2BOHB 5EXMA 1GBFA 1CGHA 1Y5AT 1C2LA 3ENSB 1KXFA 1WBGB 1GI1A 5C1XA 4GPGA 1GMDF 4B73A 1O3FA 5DO4H 5CHAC 1SPJA 1C1TA 1RFNA 1Z71A 1NU7B 1HDTH 3QZQA 5FCRA 2GCHG 2BD2A 1RD3B 3GDVA 4KKDA 1E0FD 2QGRA 3QTOH 3A7XA 1KDQA 1P9UA 2FOCA 4ZKRU 1XVOA 1ZHMA 1O3GA 3IITA 4WMFA 2KAIB 2TGAA 2H2ZA 1V2QT 1O5AB 3NWUA 3DFJA 1OPHB 4INLA 2B9LA 2VJ1A 1MTWA 2H9EH 1GBDA 3LT3A 3PWBA 1YBWA 3ESTA 2B8OH 3ZZ4A 5I46H 5GDSH 4PROA 1SOTA 4NSVA 4CBNA 1GDUA 1ZZZA 3BTHE 2NU2E 1JRTA 1HAVA 1QNJA 1CQQA 5C20A 1MUEB 4K2YA 2XBVA 1AMHA 5E2PA 2F91A 4MQAA 2VB0A 1HLTH 1FIZA 1C1WH 1A0HB 3LH3A 3TITA 1H1BA 2LPRA 1C5XB 1ZRBA 1V2TT 2V6NA 2VWOA 1ORFA 2NWNA 1C1RA 2OUAA 4TY6A 2ZTYA 5JB8S 3UY9A 4ASHA 3RMOH 3RC6A 1UCYK 2BLOA 1YGCH 3KQDA 3BEIB 4X8TH 5EXNA 1GBCA 2NU0E 2W3IA 4WWYA 3M7QA 4MNWA 1SC8U 5H4IB 1O2XA 2OTVA 1XUFA 1O2PA 3A82A 4A7IB 4UFEH 1OWJA 1C5NH 1O2GH 1P04A 1SHHB 4BTIB 1ZMNA 1Z8GA 1G32B 3G01A 4O9VA 1EXFA 1LHGH 1D3QB 1OX1A 3TGJE 4X8UH 2ZCHP 4FUEA 1IQMA 4K3JA 2ODYB 1HAOH 2ULLA 4K8YA 3STIA 2V35A 1SGQE 5C1YA 1ZYOA 3RXUA 1GCTC 3TJOA 2R9PA 3SHAH 3GCTG 4IW4E 1TWXB 3RMLH 2F9PA 1YM0A 2Z9GA 1CE5A 3LC3A 1C4U2 4UONA 1BRCE 1EJAA 1FZZA 3U98H 1MCVA 1W0YH 4DIHH 3QGJA 1C2GA 4I8HA 1HRTH 2ODPA 1C2KA 3T2NA 1GCDA 2PWXA 4AYVB 2V3HH 3FVFB 4GAWA 4K69A 3Q3XA 3SUFA 2XWAA 3MU5A 4ZKSU 2FOAA 3SI4H 3MO9A 1JRSA 4XSKU 4FUDA 2F3CE 4ZKOU 2XCFA 1EUFA 1ELVA 1GHBF 3HK3B 4AORA 5DP3A 3P70B 3ITIA 2P8OB 4AYYB 1O3BA 1HPGA 5DPAA 1TYNA 4Y0YE 1BBRE 2DUCA 2AMDA 2QIQA 2RA3A 2IN2A 4KTUA 3GY3A 2I6SA 4HGCA 3RXTA 3BF6H 1DWCH 1GWAA 3E1XB 1HAZB 4FVBA 1O3CA 4Y0ZE 2BXTH 3QWCH 4JMYA 3LGWA 2WPKS 3ATIA 3QZRA 3ZVCA 1SGEE 1T4UH 1V2MT 4LK4A 4YM9A 3NK8A 1MTNC 3UOUA 1YPMH 2KAIA 2PKAA 1DY8A 1NT1A 1Q3XA 2STBE 1QJ6B 1DY9A 5DP8A 2A4GA 1V3XA 2BOKA 1PPEE 1J14A 5CHAB 1GJDB 4THNH 2NU4E 1EZUC 3SGAE 1O33A 1VITG 1AIXH 4BAQB 4X6MA 3PMAB 3SORA 2W26A 1YPJH 3ODFA 4X8SH 4FU9A 5B6OA 2A4QA 1QRXA 1CGIE 1O3EA 4OGYA 1L1NA 5DK1A 1GBEA 5C3NA 1C2JA 3E91A 1O37A 4D9QA 1B7XB 1Z1IA 2BM2A 4MPXA 2EEKA 2IPHA 4X2XA 4HTCH 5A8ZA 3KF2A 1NPMA 2SGEE 2EI8A 1AVWA 1S81A 2FYRA 4Y10E 4OS5A 3MU8A 3RUOA 3M3SA 2OXSA 1YPKH 3F9EA 2H9TH 4IC6A 1G2LA 4U2WA 1TALA 1TOCB 3AVZA 1SFIA 4HFPB 1T4VH 4Y6DA 4BOHA 2GDEH 4GHQA 3HPTB 4ZXYH 1GBHA 2Q6FA 1ABIH 1QCPA 2R2MB 2VGCC 4YO9A 3PM3A 3QX5H 1GJ6A 1N6XA 1MKWH 1NRQH 5E2OA 2FOEA 4NZQA 3U1JB 4OS4A 1AFQC 1UVSH 3TU7H 3P8OA 3M7TA 1EZXC 1ZGVA 2HNTE 1DLKB 1E34B 2B0FA 2GTBA 1JXPA 5FPSA 3SV9A 1W8BH 5FHTA 2OC0A 1PQ5A 2C8WB 4DG4A 3AW1A 3K6YA 1KTSB 4J1YA 1QBNA 4Z6AH 1L4ZA 3ZZ5A 2JH0D 4AG2A 2ZGBH 1QR3E 1TQ0B 1KSNA 2ZHEH 5C1UA 5HM9A 2Y6TA 2ZG0H 1SHYA 3BEFB 1AD8H 1O3KA 2R0KA 1GCTB 1O39A 4XBCA 2G81E 5TCCA 1GI8B 3LIWA 4NA8A 4O3TA 4WMDA 1BOQA 1EPTC 3TK6A 4AB8A 4ABGA 1O35A 3A7TA 1OOKB 1C1VH 1FI8A 1T32A 1GDQA 3K9XB 5FCKA 1TPAE 1RS0A 2NU3E 3ELAH 3PO1C 5GCHG 4BAMB 4YOJA 3O8BA 2B7DH 3PV4A 1FV9A 4GLYA 1DWEH 4BAHB 3ZZDA 3O8RA 2FX6A 1FY3A 1ETTH 3RXIA 1W13U 1WUNH 2W3KA 1F0RA 1BUIA 2FYQA 5EOKA 1AY6H 1FNIA 2CXVA 5T6GA 3MO6A 2ZFTA 3F1SB 2G4UA 3IWMA 1AE5A 1LKBA 1N6YA 3EAJA 2WYJA 8KME2 1P10A 2A45B 2XC5A 4Q7YA 2G8TA 3SQEE 3KQCA 3TH3H 1Y3VA 1BZXE 5EG4A 1TX8A 2O9QA 3NUMA 1IQEA 3M5OA 1SB1H 2Y7ZA 1AKSB 1Z8RA 3A89A 4A1VA 4IBLH 1MTNB 3OYPA 4KGAA 4AFZA 2ZIQH 3STJA 4UFGH 1UVUH 3TNTA 3A83A 1O3IA 1C1UH 4A1TA
chains in the Genus database with same CATH superfamily
4U30A 3KYGA 2J97A 5CDFE 4CHAC 4WXVA 1NESE 4H4FA 1FIWA 1O2TA 3BG4C 1FMGA 3RXPA 1K1IA 1Q31A 2GV6A 3ZZCA 5EJLA 4KTSA 1C5YB 1P2IA 3E16B 5EU8A 1A4WH 1W2KH 2QAAA 3B9FH 3MNCA 3VG8A 1P06A 1TNIA 2A7HA 2QN5T 4Y8XA 5DJ7A 3I77A 1EFRD 3SNAA 4NA7A 2ANWA 3LKWA 1BTPA 3F9HA 1O2ZA 2HPPH 3FKSD 1C2HA 1GJ5H 1K28D 4F49A 5T3HA 2WUBA 2IJD1 1RGQA 4X6PA 4AOQA 4FU8A 1C5QA 4Y7BA 5DP5A 4XRNA 2BD3A 1GHZA 2WV4A 1K0HA 2ZHDA 2P3TB 2W7SA 4AFQA 1L1GA 3RXCA 2OD3B 5EODA 3SOSA 3RLYH 4BTUB 4O97A 1O2QA 1O36A 4IMQA 1V2LT 1DX5M 3T26A 1KXEA 1E36B 4UE7H 4P00A 1C5SA 3UREA 1ZMLA 1SGRE 2PSXA 3QLPH 3KQEA 2J9NA 1V2KT 2VGCB 2YMSB 3GY7A 2ZU4A 1O3MA 1ZR0A 1YCPM 3JZ1B 3ATKA 3SU6A 1KTTB 1ZSKA 2ZQ1A 4GCHF 3MTYA 1Y3XA 2F9OA 2FX4A 1W3CA 4TPYA 4X2VA 5TJXA 3NPSA 3NRLA 1AFQB 2A5AA 3P6ZB 2ODQA 5K0HA 3LJJA 3LGTA 1UTQA 3SJOA 4FUIA 3FP6E 2G55A 3SI3H 2A4RA 2RDLA 4ZMAH 3A86A 1GBTA 2QXHA 2QXGA 4IC5A 3BG8A 3V0XA 1MKXK 4I33A 1QHRB 1BITA 1ZGIA 1UCYE 1ANDA 2ZP0H 1EQ9A 2A5IA 4KELA 8GCHF 2KX4A 3FN8A 1EZQA 1JBUH 4AN7A 1A3EH 2CV3A 2A32A 3F68H 2IJOB 4DOQA 1BTHH 4NG9H 1O2VA 1NROH 1LPGB 1LVOA 3ZYDA 3KNXA 6ESTA 2PUXB 1F5LA 1G3BA 3RP2A 1CT4E 1GJ4H 4ISNA 2OC8A 1TPSA 3E8LA 1EPTB 4A6LA 3M37A 4SGBE 1H8ED 5GIBA 1IQFA 2FI4E 1YC0A 3A85A 1RJXB 3SGQE 3SJ8A 2EI6A 2A7CA 1YKTA 3MWIU 5ESTE 2Z9IA 1F5RA 1O3AA 2Z9LA 3KQBA 3PO1B 1M9UA 1ARCA 2BY8X 2ANYA 1GBJA 4CRGA 2BVRH 1ESBA 3MOCA 4ESTE 1UTJA 2GD4B 1D3PB 2J95A 1AB9C 3WWFA 1TBRH 5SGAE 1C2FA 1P9SA 1IQHA 4ZHMU 2BY5X 2K0QA 1AKSA 3KEEA 2LNCA 4Q7XA 2C8XB 4NFFA 3UB0A 1KYNA 1KLJH 2BDHA 2BD9A 1SKYE 2CHAC 9LPRA 1UO6A 3VXFH 4Q4LA 1YPGH 2HVXA 1QJ1B 1S83A 1IQKA 5HMAA 2TGDA 4ABHA 2ZECA 5EW1H 2WINI 3N99A 1O3NA 5LPRA 4AGKA 4ZHLU 3MNSA 1AU8A 4ISIH 1SOZA 3R3GB 2VWMA 1O0DH 4B71A 1P2OA 1C1NA 1AFEH 5F6MA 1XX9A 1SLXB 2FLRH 3BTGE 3SN8A 2KR7A 3VB4A 1TNHA 3MO3A 1Y3WA 4HZHA 1FUJA 1HBTH 5JYIA 1GJ9B 1K1LA 2J98A 4CHAB 1CU1A 1CT2E 2HRVA 1CSOE 2F83A 5DP7A 3BTWE 5FXLA 3BG4B 3ZZAA 5EQQA 3DT0H 1PPBH 3L3TA 4WJG2 1Z6EA 3EA8A 2FTMA 1O2KA 4FUGA 1K1NA 2JIZD 2SGFE 1OWEA 4CRDA 1SGFA 2BTCE 2OCVB 3LPRA 4HI3A 4NFEA 2ZU5A 1GGDC 4X8VH 3EDXB 1C5WB 1S82A 2H6MA 2UWLA 2FS8A 4B6EA 3BTQE 2XRCA 1DM4B 4WH8A 2EQNA 1VCQA 5DSFA 5AVDA 1UTOA 3U8TH 2QC2A 4A5TS 1IAUA 1KIGH 4JZDH 3BIVH 4LXBH 2QF5A 1IOEA 4WY3A 1JIRA 1QA0A 1W14U 1RRKA 7GCHF 2R0LA 4ASUD 1ELEE 3PRBA 1KXAA 1FONA 5EJZA 3Q77A 2FLBH 1TMUH 1V2JT 1GHWH 1UK4A 2OQ5A 2PKAB 5J4SA 1P03A 1MTVA 2L6OA 3CNRA 1J17T 3W94A 1J16A 2ASUB 3SNCA 1O2JA 4GCHG 3S0NA 1BHXB 4ABEA 4FUFA 1JIMA 2P16A 2VU8E 3EA7A 3GY2A 1DUAA 3M36A 1C2EA 3EA9A 3LONA 1SQAA 3VPKA 4X1QU 1TA2A 5F03A 1WOFA 2H9HA 1KLTA 2HNTF 1K1OA 1O3DA 4IGDA 3S9BA 3VB5A 2Y82A 2WPLS 3AASA 4MNXA 2A4OA 3A8DA 2WPJS 2ZNKH 2AMPA 4RT1A 2KCYA 3TH4H 3A7WA 1ZPCA 7LPRA 1IHSH 1OXGA 4B75A 1EOLA 2VWLA 1SFQB 1EPTA 8GCHG 1EB2A 4TT3D 1TFXA 4JK5A 5EPNA 1QL7A 3UNQA 2P59A 1DDJA 1O2IA 3ATMA 2H1UA 3PLPA 1HAPH 2FXRA 2KFWA 4ISHH 4A1XA 1SLUB 3AW0A 3ATLA 3H09A 1QA7A 3BTFE 2RCEA 3BN9A 1GDNA 1UK2A 1MD8A 4DT7B 1N1LA 1SI5H 2ZFSA 2ZF0H 2BQ7B 3VXEH 4SGAE 2FZZA 5C5OA 2GP9B 1G2MA 5E0HA 1SG8B 4R0IA 1O5DH 2AEIH 6CHAC 1ZHRA 4AGJA 1MQ6A 1QJ7B 4MPUA 4O03A 3ZZ7A 2V3MA 4MTBA 1GHAF 3SQHE 2VIOA 2HLDD 2Z9JA 1O5CB 1O2WA 2VH0A 3P92A 2VIPA 2IOTA 3SU3A 1AB9B 1TLDA 3VB3A 4H6SB 3SO3A 1ETRH 2HPQH 2GMTB 1Y5UT 3DD2H 4CRFA 2BD7A 2H5CA 5JDUB 6GCHG 2VIDA 1ZSLA 3PLKA 2O8MA 1V2RT 1ESTA 1QZ8A 2A7JA 2AYWA 3NZIA 1IQNA 2G52A 2PGBB 2PLXA 3EQ0H 3H5CB 2CHAB 3ZV8A 1LVMA 1MQ5A 2ZPRA 3ZV9A 4DGJA 3AAVA 1FY5A 1EJNA 2JJ1D 2Q6DA 3GY8A 3RU4D 1LHDH 2PGQB 3RXOA 1W0ZU 3UPEA 3ZZBA 3UNSA 1CHOF 3CENA 4ISOA 2ILNA 2D1JA 4OS6A 4NZLA 2A31A 4FOUC 1GL0E 4X6NA 5HYOA 1BBRH 1AZZA 4ISLA 3RXQA 4TPIZ 4ABDA 2ZHWH 1EATA 4RT0A 3PROA 1ELDE 3KQ5A 2OINA 1HV7A 3URCA 3SW2B 1XMNB 1SSXA 1EOJA 4Y8ZA 4ABAA 1SMFE 1G3DA 4BXWA 1PPGE 2CK3D 4Y71A 2KCPA 1OSSA 3TH2H 2M2AA 1W0KD 2DE8A 1WAYB 3P95A 2C90B 2BQ6B 1DFPA 2M5TA 2TGTA 2ZI2H 5DGJA 2SNVA 4NWKA 1GI0A 1S6FA 1GHXH 1SLWB 1TPOA 1BHXF 1WCZA 5KECA 1U6QA 2VVUA 4MDSA 1NS3A 3SU1A 2F9BH 2C93B 2ZKSA 1GMDG 4YT6H 3BTEE 5E0JA 4CH2B 5A09A 2FODA 1EB1H 1KY9A 3RXAA 1TRNA 4X6OA 1INCA 5DG6A 4Y8YA 3ZZ8A 4XBDA 1P3EA 7GCHG 5FPYA 3HGPA 1YCPH 3MHWU 1C1SA 2ZDNA 3UFAA 2TIOA 5JBBS 2J2UA 2A5KA 2AIPA 4AC9A 2F9NA 1NU9A 2Z3CA 3D23A 1ELBA 1HAXB 4X0WU 1S5SA 1LHFH 1QFKH 1V6DA 2FI5E 4XE4A 4YTAA 1THPB 3MH6A 4YOGA 2QV1A 3FZZA 4GVUA 2HOBA 1C5LH 3L6PA 1OP0A 3AK5A 1Z8IB 1DOJA 1TGTA 2AS9A 1SGYE 3SNBA 1JWTA 2XTTB 1YPHC 4TWYA 1VCWA 3LGIA 2SGQE 3HATH 1UK3A 1FLEE 1AO5A 3TNSA 1Y59T 3UR6A 2FWWA 2CN0H 2ESTE 2SGDE 4I8JA 4NCYA 4ZHAA 3M3VA 1VJAU 1YF4A 1THSH 3TVJB 1SGNE 5EIYA 3SYJA 1CHGA 3Q3YA 4BAOB 3PMHB 4ZROA 2VH6A 3A88A 2EI7A 3HKIB 1CGJE 1CVWH 2Q1JA 3JZ2B 3ZZ6A 3WW7A 4GSOA 1O2MA 1QBVH 1FN6A 2ZTZA 1BIOA 1DICA 1O2UA 1EP5A 2AFQB 2UUFB 4E7NA 5AHGH 4O3UA 3BTME 1MCTA 5LGOA 3PV5A 2KM0A 3DFLA 5GPIB 4E06H 6CHAB 2Z3EA 1TMTH 3F2FA 2G51A 3DHKH 3MU4A 1TNGA 2QCYA 2BB4A 2VIWA 1EASA 1RTKA 3I78A 4Q80A 3GICB 2BY6X 1G3CA 1QGFA 5EJ1A 1C4Y2 1AN1E 2G00A 3LGYA 1PPCE 1L2EA 1T7CA 5TCAA 1NBME 2O8WA 1FAKH 1EAUA 2AGGX 3BIUH 2FTLE 3V3MA 3KGPA 1HJAC 1ZTLA 2ZFPH 3T62A 1HB0B 2CGAA 1BQYA 3A80A 5L2ZH 1LQEA 2XBWA 3QO6A 1F7ZA 1LQDB 1TIOA 1C1OA 4AG1A 1O31A 4DCDA 4P02A 4FXGH 1F92A 2R3YA 2WZQA 4ZUHA 1P2MA 1D3DB 1OP2A 3OTJE 1P3CA 1CA0C 1XXFA 2OP9A 3SU4A 2BHGA 5JB9S 3B8JA 1TE0A 2FPZA 4NSYA 1NFYA 2RDEA 3RU4T 4UDWH 1BRBE 4FUCA 2PW8H 1K1JA 1BRAA 1SGDE 1B0FA 1NTPA 1OWKA 2J38A 4X1NU 1FPCH 3D62A 1BMLA 3RXGA 4FUJA 4IN2A 3S9AA 1NRNH 3SUEA 4U32A 3SV6A 1QB6A 3QTVH 1GHBG 1C5TA 5ESBA 1G9IE 2HLCA 1GMHF 3GDUA 3ODDA 1C5OH 3NKKA 4YZUA 3Q76A 3OEED 1BTZA 1G36A 1K1MA 1TNKA 2BDGA 1OYQA 1S0RA 2WV5A 1GVZA 4MLFB 4ABBA 1WU1A 2C8ZB 2G5NA 2ZEBA 4LOYH 1L0ZA 1AGJA 1T31A 2G5VA 1F0UA 4YESB 4MNVA 2XYAA 2JKHA 1OP8A 3O8CA 2Z6BD 1SGCA 1SQRA 1SQTA 1N8OC 1YPLH 3H7OA 3ZVBA 1A0LA 2QF3A 4RN6A 1H9LB 2BZ6H 4LZ4B 2GCTC 1ANCA 4K60A 4BXSA 2QXJA 1P2NA 1LHEH 1ZLRA 1TA6A 2KCOA 1CT0E 3TK5A 3M3TA 4X1SU 2Y5FA 2C8YB 5K7RA 1V2UT 1PJPA 4I8GA 1GG6C 1FJSA 5A0BA 1UHBB 2FDAA 3K6ZA 3QK1A 1QURH 1RIWC 2J98B 1C5VA 5B6LA 2ZU3A 3DSOA 1L4DA 1C5ZB 4XDEA 5EQRA 3RXKA 1Q2WA 2BLQA 1DVAH 1Y8TA 1VGCC 5HKKD 4QT8C 1ZOMA 1SQOA 1ZHPA 2OBQA 1ZSJA 1TABE 1DE7H 4F4OC 1SLVB 1GBIA 5T6FA 2VINA 3PMBB 5BRRE 1AUTC 1TGCA 1XKBC 1D6WA 3DA9B 1BMFD 3UWJH 2PFEA 1KXDA 2CF9H 1QTFA 2ANMH 2XWBI 5HIZA 1GI2A 3UWIA 4IMZA 1O2OA 2GCHF 2O8LA 1MU8B 2OQUA 1D3TB 3SUDA 1UMAH 3T25A 1MZAA 3TIUA 1SR5C 4BAKB 2FESH 5C67A 1NO9H 3NXPA 1NY22 2Y7XA 3A7ZA 4DY7B 2V7QD 1BMMH 1QRZA 1UCYH 1S85A 3P17H 3OTPA 1E38B 2V3OH 2QF4A 1Y5BT 1O2RA 1TPPA 4B2CA 1A5GH 2Y5GA 2P3FH 1UTMA 2Q6GA 5GNDA 1NRPH 4Y7AA 2J34A 1YP9A 2FOFA 2CJIA 1JMOH 2AIQA 3R0FA 3RM0H 1ZPZA 1H9IE 1C5MD 1W7GH 2VVVA 3M5LA 2Z9KA 5CMXH 4OM9A 1T8MA 2R3UA 4CH8B 4MPVA 2BLWA 1MKWK 1HJAB 1LPZB 1AWFH 1GBMA 3D49H 1A2CH 3KL6A 3M35A 1AUJA 5T6DA 4B6FA 4ABFA 2XBYA 1TB6H 1HJ8A 1DXWA 3SZNA 1HYLA 3LGVA 1BMNH 4B2AA 3U8OH 1CA0B 4FETA 4XD7D 1O2SA 1PPFE 3IG6B 1L1JA 1QB9A 3FP8E 4YXWD 3FP7E 1MTSA 1D6RA 4Q2KA 2FIRH 3P8GA 1EKBB 2EA3A 1P2QA 5JBTA 4JYVH 2GT8A 1MBMA 2PUQH 1TGSZ 2ZFFH 4FVDA 3BTKE 3LJOA 3C1KA 1GMHG 5PTPA 1C2IA 2P94A 2BLVA 5GJ4B 1PYTD 2GJGA 1P2JA 1BTWA 1Z1JA 5EW2H 2ZGXH 2QXIA 4WH6A 1A1RA 5DP9A 1V2WT 2Z7FE 5LPFA 3RXBA 2BQWB 3ZVDA 1BDAA 2GX4A 2FOMB 1AVGH 1XUGA 4UFFH 1XVMA 4BNRA 3Q00A 1SL3A 3KYFA 1T8OA 5IDKA 1AI8H 3T5FH 1A46H 1E37B 1UTNA 1TRYA 1TGBA 3M61U 3U8RH 5FPTA 1UW7A 1GI6A 2W6JD 3OY6U 2O8TA 1UHBA 4JZIA 4WVPE 2GCTB 3ATWA 3SJIA 2PV9B 4M9FA 2J4IA 1VJ9U 3MU0A 1MABB 2AH4X 3TJNA 2HGTH 1MD7A 1CO7E 4NWLA 1BJVA 1BCUH 1O3OA 5F8XA 3GYMA 1DSUA 1KLIH 3UOPA 1KXBA 4AFSA 3U1IB 3GS9A 1K1PA 4B2BA 4D7GA 1HIAB 1V2VT 1IQJA 3N7EA 1GG6B 3VGCC 1TAWA 3CS7A 3N7DA 3QGNB 1ZMJA 2STAE 5F53A 3RXFA 2C4FH 1ELTA 1TX7A 2JETC 4B1TA 3P8NA 1BTUA 4UEHH 1FY8E 1ELGA 4WMEA 3OY5U 3GDSA 4X1RU 1GBBA 1VGCB 1LHCH 1AWHB 1GVKB 1OKXA 4YT7H 2FOBA 5FX6A 3S9CA 1XKAC 5ABWA 3SU2A 1TQ7B 3DSPA 1GHVH 3RXSA 1WQVH 4IS5A 5BPEA 1ZTJA 1LCYA 5ETXA 1XUIA 4FUHA 1AZ8A 1VKYA 2GZ7A 3MNBA 1O2LA 4ACAA 1H8DH 1HCGA 2ZDLA 2J92A 1VITF 1GBLA 4Z1MD 2F9UA 5F8TA 1VZQH 1OYTH 1ZJDA 2R2WU 1VR1H 3TLOA 1D9IA 1DXPA 3OX7U 3HKJB 4H42U 1ELAA 2H5DA 3OSYA 5I25A 4D9RA 1P57B 4GUXA 2D26C 4TSFD 3HGNA 3EE7A 2ZGCA 3SV7A 2SGAA 4JCNA 3ZVFA 1PQ7A 1ID5H 8ESTE 4CR5A 4Y79A 1A5HA 3SV8A 1GJAB 1XUJA 1P11E 2ZPSA 4XOJA 1A5IA 1NFXA 4XBBA 1S84A 1A7SA 1EP6A 2CF8H 3VB7A 1TNLA 2QYIA 1BT7A 3V13A 2PTCE 3MI4A 1O5FH 1DWBH 4RKOB 2BD5A 1YYY1 2V0BA 1HXEH 1EZSC 3FANA 2SFAA 1YY3A 1J8AA 2XNDD 1CBWC 1O5BB 1O2NA 1TBZH 2PR3A 1QY6A 1GI7B 1V2PT 2A1DB 4XFQA 3N7OA 3GCNA 3A8BA 1C2DA 3RXRA 1QQUA 2AERH 1GBAA 2ZHFH 3T27A 3A8CA 1TMBH 3RXHA 1XXDA 3SHCH 5CE1A 1GJ7B 3LC5A 4UFDH 5AFZH 2RA0A 1BTXA 4F48B 5T1VA 2B5TB 4M7GA 1O38A 3OE7D 1MAXA 1FY4A 5KGOA 3F9GA 4OGXA 4JK6A 4CRAA 4KTCA 4JYTA 5E8EH 2O8UA 4MNYA 3GY6A 1FDPA 2AGEX 3FAOA 1BJUA 2GVFA 3E0PB 1FAXA 2ZFRH 1OHHD 5LPEA 3A7YA 3GCHC 2ZDVH 3GYLB 1THRH 2FMJA 2ZGHA 1PYTC 1NZQH 3CS0A 2SNWA 5FBEA 1SGPE 4Q63A 2FS9A 2ZC9H 4INKA 5HM2A 3RXVA 1W12U 1HAHH 3K65B 2HVYB 3MQKC 3D65E 1Z8JB 5C0TA 2GT7A 1PFXC 1HIAA 3A87A 1O2HA 1K2I1 1O3LA 4ZKNU 3MH7A 2XBXA 4R8TB 1A3BH 1YLCA 1K9OE 1CA8B 2ZDMA 1Y3YA 1SGFG 2GGVB 5GCHF 1B0EA 2P3UB 1V2NT 1P09A 1F0TA 1H9HE 1NFUA 2DE9A 2Y80A 3HK6B 4K1SA 1ELFA 1LPKB 1NM6A 1COWD 2C3SA 1EJMA 1GMCF 1YLDA 1UTLM 4Q7ZA 4B74A 1GGDB 4WF8A 3VGCB 1AVXA 1BA8B 1VCPA 3UQVA 2JH6D 5HIYA 2OC7A 4J2YB 4ZCNA 3F0PA 4FUBA 1QRWA 4UD9H 3SJKA 1ACBE 2XXLA 3ZVAA 1GI5A 2JETB 2FOGA 1YPHE 2A0QB 3PMJA 3TK9A 5HXFA 4NIVA 2BDIA 1LO6A 1C9TA 3A7VA 5G4BA 4YLUA 7KMEH 1MZDA 1W7XH 1BRUP 2BDCA 1C2MA 3KIDU 1S6HA 2WV9A 4KP0A 4CREA 1ANBA 3F2GA 3V7TA 5JPMH 1PPHE 2ZU2A 3OFND 1F2SE 1SGTA 1QIXB 3C27B 5EQSA 1ABJH 5GWZA 1C1PA 5A0AE 1TONA 3LDXH 4GHTA 3VEQB 1E35B 3NCLA 5FAHA 2XOKD 4YOIA 1O30A 1F5KU 1LDTT 2ZGJA 4ZAEA 3UQOA 3F6UH 2KZ4A 1ZJKA 1O3HA 3PWCA 1SGIB 1HNEE 1BTYA 4DURA 1IQGA 2WPDD 2WYGA 1T8LA 2XC4A 4VGCC 2JH5D 2YOLA 1HAYB 5CHBA 4NIWA 3B23B 4MPWA 1QBOA 3CP7A 3E6PH 1HFDA 1RTLA 1X7AC 1C9PA 4OS1A 3FOAA 1WTHD 2WPIS 1VITH 3PYHA 1LKAA 2W5EA 3ZZ9A 1S6LA 3A84A 1JOUB 3LU9B 1P05A 3RXEA 3BTTE 4CBOA 7ESTE 2I6QA 1MKXH 1H4WA 1K21H 1AQ7A 4Y76A 2QF0A 2RFKC 1P02A 1HXFH 3EE0B 4K8BA 1UTKA 5C5NA 5C0UA 1O2YA 3BSQA 4AZ2B 4CR9A 4I32A 2UUKB 4D8NA 3L33A 1S0QA 2FO9A 3PB1E 1GJ8B 2VNTA 3O8DA 5AFYH 1CBWB 2FEQH 3PLBA 5L6NH 3LOXA 2J5UA 1P8VC 2L74A 2FI3E 1WDIA 4MVNA 1HUTH 3V12A 1FX0B 1MH0A 1V2OT 5A2MH 1NC6A 1GHAG 3QN7A 2FOHA 4IN1A 1J15A 3SNEA 4H6TA 1SBWA 2ZFQH 2PHBA 3U9AH 1TNJA 4B76A 2NU1E 1HAGE 2OC1A 3M5MA 3RU4E 1UJ1A 2BVXH 2W6ID 4BANB 2XNIA 1TOMH 1XUHA 1NFWA 3K2UA 5DKMA 2ZA5A 1TGNA 2FM2A 1W10U 2G4TA 1UVOA 1DANH 1WV7H 3GCHB 4TYDA 1H8IH 3WWBA 1NN6A 2ZWLH 4CRBA 1Z7KA 4OS2A 2AHME 4RKJB 2BD8A 4X1PU 1DLEA 3RMNH 2PKSC 1O3JA 1TBQH 2TPIZ 3BEUA 2EC9H 4K1EA 1AE8H 1GI3A 3KHVA 3FZDA 2AGIX 1CHOG 2HNTC 5J4QA 5GXPA 4DIIH 4ZH8A 5C17A 1G3EA 3UTUH 4Z0KA 4U01A 1O3PB 3E0NB 1XUKA 1OWDA 2F9VA 2VWNA 2CMYA 2BD4A 1AHTH 2SGPE 3FO8D 3OU0A 3WY8A 1G30B 4AX9H 2Z3DA 2FP7B 3TJVA 5F8ZA 2TGPZ 1GMCG 1E1RD 2GV7A 2UWOA 3MYWA 1UVTH 1GJBB 2XW9A 3ZZ3A 1EAXA 5LH8A 1V2ST 2HALA 1A0JA 5IK2D 3GCOA 3RDZA 3H7TA 5EXLA 4BTTB 1DSTA 3LGUA 4K5ZA 4NA9H 4Y11E 3DUXH 2Y81A 3I29A 1MBQA 2XC0A 2YNBA 2TRMA 4JZ1A 3SU0A 2QY0B 3DCLA 3EGKH 1MAYA 2ZHQH 1ESAA 2BX4A 2VIQA 1BBRK 2GZ9A 2BX3A 3T29A 1RTFB 2PTNA 3W95A 1Y3UA 1GL1A 1OS8A 4JYUH 4E7RG 2F4LA 1F0SA 1GJCB 1DUEA 1ELCA 2BY9X 1GVLA 5C2ZA 2UUYA 1GBKA 2JJ2D 5AF9H 1WQSA 2BMGB 3ZVEA 1C5PA 1DITH 4AB9A 3SBKA 5EGMA 2F43B 3GY5A 1QL9A 1ETSH 2QA9E 5A8XA 3EYDA 4JZEH 1PQ8A 4MG3A 5FX5A 3PRDA 1GI4A 3VB6A 2UWPA 2BDAA 1HJ9A 4VGCB 3T28A 1UVPA 3P8FA 1P0SH 1P01A 3AAUA 3UNRA 4X2YA 3S7KB 1O32A 5JBCS 1YCPK 1DS2E 3SV2H 1FPHH 2GDDA 3RM2H 1TRMA 2Z94A 4INHA 3BTDE 1FY1A 2W7UA 3MNXA 4NGAH 2BDBA 2ZCKP 1ZRKA 3MU1A 1EX3A 1HGTH 1PPZA 1O5GH 2WPMS 3RMMH 3SGBE 4TWWA 1MTUA 5HGGA 2BY7X 2UUJB 3TGIE 1GI9B 2D2DA 4AFUA 3SNDA 4ZXXH 1ZTKA 4RSPA 1B5GH 4X2WA 1IHTH 1GHYH 6LPRA 2ZPQA 1LMWB 2XCNA 2LP6A 5A8YA 2OBOA 1WSSH 3E90B 1J9CH 4OS7A 1KDQB 3U69H 1GPZA 1WTGH 4I7YH 3TPIZ 1UTPA 3RLWH 1IQLA 2D8WA 1T8NA 2TBSA 3KCGH 1C1QA 5DN6D 2BVSH 2ALVA 3SU5A 3KN2A 1O5EH 3PTNA 4CRCA 2ZCLP 1ANEA 4LZ1H 1P2KA 3Q3KA 1LVYA 1RXPA 2Y5HA 1DT2A 4DW2U 2VIVA 3VFEA 3GY4A 3RXLA 1FQ3A 2PKSB 1IQIA 5IYTA 3MH4A 1HAVB 3TJUA 5DP6A 3UUZA 4ABIA 3M5NA 2J94A 4D76A 5E0GA 1BMAA 5A0CA 3M7UA 1EAIA 2HWLB 2P95A 3RXMA 4K1TA 3RC5A 2RG3A 3FFGA 4NIYA 2WSSD 1QQ4A 2VVCA 4YLQH 3URDA 4FU7A 2OLGA 3E3TA 3RXJA 1LTOA 3TGKE 3GISB 2ZU1A 3W1EA 2K1QA 1W11U 2A2XH 2ZDKA 2BYAX 1C1MA 1O34A 2GKVE 1A61H 1SVPA 2WUCA 3F2HA 4WXIA 3S7HB 1ARBA 1NRRH 2PSYA 4E05H 3F3BA 1C4V2 1KXCA 3BV9B 4JZFH 1OWIA 1K22H 2GMTC 1D4PB 3RC4A 1QL8A 2ZDAH 6GCHF 3GCTF 4DVAU 3ZYEA 3ZVGA 1XM1A 1QB1A 3QUMP 1Z6JH 1N8OB 3RXDA 4NIXA 1FN8A 2ZO3H 1MMJN 2ANKH 2GZ8A 1WYKA 1TX6A 2ZZUH 3PV2A 2BDYA 5EPYA 1BB0B 2ALPA 1YPEH 9ESTA 5L2YH 1FXYA 4I8KA 3MMGA 1G37A 5DP4A 4ABJA 3A81A 3GOVB 8LPRA 1C5UA 2A2QH 2WPHS 4D7FA 1LVBA 1P12E 1EAWA 4I8LA 3UIRA 3MH5A 1MU6B 3S69A 2P8OC 5JBAS 4A92A 3SJ9A 1PQAA 3UR9A 1RIWB 4DJZB 2ZTXA 5L30H 2ZQ2A 5FBIA 1C5RA 3F9FA 1DPOA 3PTBA 1DWDH 3SUGA 4I31A 1HAIH 1NRSH 1ZPBA 2THFB 1OWHA 3LH1A 2P93A 3MFJA 4TY7A 2AMQA 2BZAA 2YNAA 3QDZB 2BXUH 3ZIAD 3A8AA 2BOHB 5EXMA 1GBFA 1CGHA 1Y5AT 1C2LA 2JDID 3ENSB 1KXFA 1WBGB 1GI1A 5C1XA 4GPGA 1GMDF 4B73A 1O3FA 5DO4H 5CHAC 1SPJA 1C1TA 1RFNA 1Z71A 1NU7B 1HDTH 3QZQA 5FCRA 2GCHG 2BD2A 1RD3B 3GDVA 4KKDA 1E0FD 2QGRA 3QTOH 3A7XA 1KDQA 1P9UA 2FOCA 4ZKRU 1XVOA 1ZHMA 1O3GA 3IITA 4WMFA 2KAIB 2TGAA 2H2ZA 1V2QT 2PP6A 1O5AB 3OAAD 3NWUA 3DFJA 1OPHB 4INLA 2B9LA 2VJ1A 1MTWA 2H9EH 1GBDA 3LT3A 3PWBA 1YBWA 3ESTA 2B8OH 3ZZ4A 5C94A 5I46H 5GDSH 2VBCA 4PROA 1SOTA 4NSVA 4CBNA 1GDUA 1YLNA 1ZZZA 3BTHE 2NU2E 1JRTA 1HAVA 1QNJA 1CQQA 5C20A 1MUEB 4K2YA 2XBVA 1AMHA 5E2PA 2YMSD 2F91A 4MQAA 2VB0A 1HLTH 1FIZA 1C1WH 1A0HB 3LH3A 3TITA 1H1BA 2LPRA 1C5XB 1ZRBA 2K8IA 1V2TT 2V6NA 2VWOA 1ORFA 2NWNA 1C1RA 2OUAA 4TY6A 2ZTYA 5JB8S 3UY9A 4ASHA 3RMOH 3RC6A 1UCYK 2BLOA 1YGCH 3KQDA 3BEIB 4X8TH 5EXNA 1GBCA 2NU0E 2W3IA 4WWYA 3M7QA 4MNWA 1SC8U 5H4IB 1O2XA 2OTVA 1YWUA 1XUFA 1O2PA 3A82A 4A7IB 4UFEH 1OWJA 1C5NH 1O2GH 1P04A 1SHHB 4BTIB 1ZMNA 1Z8GA 1G32B 3G01A 4O9VA 1EXFA 1LHGH 1D3QB 1OX1A 1E1QD 1H8HD 3TGJE 4X8UH 2ZCHP 4FUEA 1IQMA 4K3JA 2ODYB 1HAOH 2ULLA 4K8YA 3STIA 2V35A 1SGQE 5C1YA 3F0OA 1ZYOA 3RXUA 1GCTC 3TJOA 2R9PA 3SHAH 3GCTG 4IW4E 1TWXB 3RMLH 2F9PA 3OEHD 1YM0A 2Z9GA 1CE5A 3LC3A 1C4U2 4UONA 1BRCE 1EJAA 1FZZA 3U98H 1MCVA 1W0YH 4DIHH 3QGJA 1C2GA 4I8HA 1HRTH 2ODPA 1C2KA 3T2NA 1GCDA 2PWXA 4AYVB 2V3HH 3FVFB 4GAWA 4K69A 3Q3XA 3SUFA 1NBMD 2XWAA 3MU5A 4ZKSU 2FOAA 3SI4H 3MO9A 1JRSA 4XSKU 4FUDA 2F3CE 4ZKOU 2EY4C 2XCFA 1EUFA 1ELVA 1GHBF 3HK3B 4AORA 5DP3A 3P70B 4I86A 3ITIA 2P8OB 4AYYB 1O3BA 1HPGA 5DPAA 1TYNA 4Y0YE 1BBRE 2DUCA 2AMDA 2QIQA 2RA3A 2IN2A 4KTUA 4DT4A 3GY3A 2I6SA 2WHXA 4HGCA 3RXTA 3BF6H 1DWCH 2QE7D 1GWAA 3E1XB 1HAZB 4FVBA 1O3CA 4Y0ZE 2BXTH 3QWCH 4JMYA 3LGWA 2WPKS 3ATIA 4HG6A 3QZRA 1W0JD 3ZVCA 1SGEE 1T4UH 1V2MT 4LK4A 4YM9A 3NK8A 1MTNC 3UOUA 1YPMH 2KAIA 2PKAA 1DY8A 1NT1A 1Q3XA 2STBE 1QJ6B 1DY9A 5DP8A 2A4GA 1V3XA 2BOKA 3DSGA 1PPEE 1J14A 5CHAB 5KEDA 1GJDB 4THNH 2NU4E 1EZUC 3SGAE 1O33A 1VITG 1AIXH 4BAQB 1KMHB 4X6MA 3PMAB 3SORA 2OK5A 2W26A 1YPJH 3ODFA 4X8SH 4FU9A 5B6OA 2A4QA 1QRXA 1CGIE 1O3EA 4OGYA 1L1NA 5DK1A 1GBEA 5C3NA 1C2JA 3E91A 1O37A 4D9QA 1B7XB 1Z1IA 2BM2A 4MPXA 2EEKA 2IPHA 4X2XA 4HTCH 5A8ZA 3KF2A 1NPMA 2SGEE 2EI8A 1AVWA 1S81A 2FYRA 4Y10E 4OS5A 3MU8A 3RUOA 3M3SA 2OXSA 1YPKH 3F9EA 2H9TH 4IC6A 1G2LA 4U2WA 1TALA 1TOCB 3AVZA 1SFIA 4HFPB 1T4VH 4Y6DA 4BOHA 2GDEH 4GHQA 3HPTB 4ZXYH 1GBHA 2Q6FA 3SZEA 1ABIH 1QCPA 2R2MB 2VGCC 2YMSC 4YO9A 3PM3A 3QX5H 1GJ6A 1N6XA 1MKWH 1NRQH 5E2OA 4RI0A 2FOEA 2LELA 4NZQA 3U1JB 4OS4A 1AFQC 1UVSH 3TU7H 3P8OA 3M7TA 1EZXC 1ZGVA 1WXRA 2HNTE 1DLKB 1E34B 2B0FA 2GTBA 1JXPA 5FPSA 3SV9A 1W8BH 5FHTA 2OC0A 1PQ5A 2C8WB 4DG4A 3AW1A 3K6YA 1KTSB 3UAIC 4J1YA 1QBNA 4Z6AH 1L4ZA 3ZZ5A 2JH0D 4AG2A 2ZGBH 1QR3E 2IPQX 1TQ0B 2KCAA 1KSNA 2ZHEH 5C1UA 5HM9A 2Y6TA 2ZG0H 4ACBA 1SHYA 3BEFB 1AD8H 1O3KA 2R0KA 1GCTB 1O39A 4XBCA 2G81E 5TCCA 1GI8B 3LIWA 4NA8A 4O3TA 4WMDA 1BOQA 1EPTC 3TK6A 4AB8A 4ABGA 1O35A 3A7TA 1OOKB 1C1VH 1FI8A 1T32A 1GDQA 3K9XB 5FCKA 1TPAE 1RS0A 2NU3E 3ELAH 3PO1C 5GCHG 4BAMB 4YOJA 3O8BA 2B7DH 3PV4A 1FV9A 4GLYA 1DWEH 4BAHB 1E79D 3ZZDA 3O8RA 2FX6A 1FY3A 1ETTH 3RXIA 1W13U 1WUNH 2W3KA 1F0RA 1BUIA 2FYQA 5EOKA 1AY6H 1FNIA 2CXVA 5T6GA 4F55A 3MO6A 2ZFTA 3F1SB 2G4UA 3IWMA 1AE5A 1LKBA 1N6YA 3EAJA 2WYJA 8KME2 1P10A 2A45B 2XC5A 4Q7YA 2G8TA 3SQEE 3KQCA 3TH3H 1Y3VA 1BZXE 5EG4A 1TX8A 2O9QA 3NUMA 1IQEA 3M5OA 1SB1H 2Y7ZA 1AKSB 1Z8RA 3A89A 4A1VA 4IBLH 3U28C 1MTNB 3OYPA 4KGAA 4AFZA 2ZIQH 3STJA 4UFGH 5FL7D 1UVUH 3TNTA 3A83A 1O3IA 1C1UH 4A1TA
chains in the Genus database with same CATH topology
4U30A 4CHAC 4WXVA 1NESE 4H4FA 1FIWA 1O2TA 3BG4C 1FMGA 3RXPA 1K1IA 1Q31A 2GV6A 3ZZCA 4KTSA 1C5YB 1P2IA 3E16B 5EU8A 1A4WH 1W2KH 2QAAA 3B9FH 3MNCA 1P06A 1TNIA 2A7HA 2QN5T 4Y8XA 5DJ7A 3I77A 3SNAA 4NA7A 2ANWA 3LKWA 1BTPA 3F9HA 1O2ZA 2HPPH 4F49A 1C2HA 1GJ5H 1K28D 5T3HA 2WUBA 4X6PA 1RGQA 4AOQA 4FU8A 1C5QA 4Y7BA 5DP5A 2BD3A 1GHZA 2WV4A 2ZHDA 2P3TB 2W7SA 4AFQA 1L1GA 3RXCA 2OD3B 5EODA 3SOSA 3RLYH 4BTUB 4O97A 1O2QA 1O36A 4IMQA 1V2LT 1DX5M 3T26A 1KXEA 1E36B 4UE7H 1C5SA 3UREA 1ZMLA 1SGRE 2PSXA 3QLPH 3KQEA 2J9NA 1V2KT 2VGCB 3GY7A 2ZU4A 1O3MA 1ZR0A 1YCPM 3JZ1B 3ATKA 3SU6A 1KTTB 1ZSKA 2ZQ1A 4GCHF 3MTYA 1Y3XA 2F9OA 2FX4A 1W3CA 4TPYA 4X2VA 5TJXA 3NPSA 1AFQB 2A5AA 3P6ZB 2ODQA 5K0HA 3LJJA 3LGTA 1UTQA 3SJOA 4FUIA 3FP6E 2G55A 3SI3H 2A4RA 2RDLA 4ZMAH 3A86A 1GBTA 2QXHA 2QXGA 4IC5A 3BG8A 3V0XA 1MKXK 4I33A 1QHRB 1BITA 1ZGIA 1UCYE 1ANDA 2ZP0H 1EQ9A 2A5IA 4KELA 8GCHF 1EZQA 1JBUH 4AN7A 1A3EH 2CV3A 2A32A 3F68H 2IJOB 4DOQA 1BTHH 4NG9H 1O2VA 1NROH 1LPGB 1LVOA 3ZYDA 3KNXA 6ESTA 2PUXB 1F5LA 1G3BA 3RP2A 1CT4E 1GJ4H 4ISNA 2OC8A 1TPSA 3E8LA 1EPTB 4A6LA 3M37A 4SGBE 5GIBA 1IQFA 2FI4E 1YC0A 3A85A 1RJXB 3SGQE 3SJ8A 2EI6A 2A7CA 1YKTA 3MWIU 5ESTE 2Z9IA 1F5RA 1O3AA 2Z9LA 3KQBA 3PO1B 1M9UA 1ARCA 2BY8X 2ANYA 1GBJA 4CRGA 2BVRH 1ESBA 3MOCA 4ESTE 1UTJA 2GD4B 1D3PB 2J95A 1AB9C 1TBRH 5SGAE 1C2FA 1P9SA 1IQHA 4ZHMU 2BY5X 1AKSA 3KEEA 2LNCA 4Q7XA 2C8XB 4NFFA 1KYNA 1KLJH 2BDHA 2BD9A 2CHAC 9LPRA 1UO6A 3VXFH 1YPGH 2HVXA 1QJ1B 1S83A 1IQKA 5HMAA 2TGDA 4ABHA 2ZECA 5EW1H 2WINI 1O3NA 5LPRA 4AGKA 4ZHLU 3MNSA 1AU8A 4ISIH 1SOZA 3R3GB 2VWMA 1O0DH 4B71A 1P2OA 1C1NA 1AFEH 5F6MA 1XX9A 1SLXB 2FLRH 3BTGE 3SN8A 3VB4A 1TNHA 3MO3A 1Y3WA 4HZHA 1FUJA 1HBTH 5JYIA 1GJ9B 1K1LA 4CHAB 1CU1A 1CT2E 2HRVA 1CSOE 2F83A 5DP7A 3BTWE 5FXLA 3BG4B 3ZZAA 5EQQA 3DT0H 1PPBH 3L3TA 4WJG2 1Z6EA 3EA8A 2FTMA 1O2KA 4FUGA 1K1NA 2SGFE 4CRDA 1OWEA 1SGFA 2BTCE 2OCVB 3LPRA 4HI3A 4NFEA 2ZU5A 1GGDC 4X8VH 3EDXB 1C5WB 1S82A 2H6MA 2UWLA 2FS8A 3BTQE 2XRCA 1DM4B 4WH8A 5AVDA 1VCQA 1UTOA 3U8TH 2QC2A 4A5TS 1IAUA 1KIGH 4JZDH 3BIVH 4LXBH 1IOEA 4WY3A 1JIRA 1QA0A 1W14U 1RRKA 7GCHF 2R0LA 1ELEE 1KXAA 1FONA 3Q77A 2FLBH 1TMUH 1V2JT 1GHWH 1UK4A 2OQ5A 2PKAB 5J4SA 1P03A 1MTVA 1J17T 3W94A 1J16A 2ASUB 3SNCA 1O2JA 4GCHG 3S0NA 1BHXB 4ABEA 4FUFA 1JIMA 2P16A 2VU8E 3EA7A 3GY2A 1DUAA 3M36A 1C2EA 3EA9A 3LONA 1SQAA 3VPKA 4X1QU 1TA2A 5F03A 1WOFA 2H9HA 1KLTA 2HNTF 1K1OA 1O3DA 4IGDA 3S9BA 3VB5A 2Y82A 2WPLS 3AASA 4MNXA 2A4OA 3A8DA 2WPJS 2ZNKH 2AMPA 3TH4H 3A7WA 1ZPCA 7LPRA 1IHSH 1OXGA 4B75A 1EOLA 2VWLA 1SFQB 1EPTA 8GCHG 1EB2A 1TFXA 4JK5A 5EPNA 1QL7A 3UNQA 2P59A 1DDJA 1O2IA 3ATMA 2H1UA 3PLPA 1HAPH 2FXRA 4ISHH 4A1XA 1SLUB 3AW0A 3ATLA 1QA7A 3BTFE 2RCEA 3BN9A 1GDNA 1UK2A 1MD8A 4DT7B 1N1LA 1SI5H 2ZFSA 2ZF0H 2BQ7B 3VXEH 4SGAE 2FZZA 5C5OA 2GP9B 1G2MA 5E0HA 1SG8B 4R0IA 1O5DH 2AEIH 6CHAC 1ZHRA 4AGJA 1MQ6A 1QJ7B 4MPUA 4O03A 3ZZ7A 4MTBA 1GHAF 3SQHE 2VIOA 2Z9JA 1O5CB 1O2WA 2VH0A 3P92A 2VIPA 2IOTA 3SU3A 1AB9B 1TLDA 3VB3A 4H6SB 3SO3A 1ETRH 2HPQH 2GMTB 1Y5UT 3DD2H 4CRFA 2BD7A 2H5CA 5JDUB 6GCHG 2VIDA 1ZSLA 3PLKA 2O8MA 1V2RT 1ESTA 2A7JA 2AYWA 3NZIA 1IQNA 2G52A 2PGBB 2PLXA 3EQ0H 3H5CB 2CHAB 3ZV8A 1LVMA 1MQ5A 2ZPRA 3ZV9A 4DGJA 3AAVA 1FY5A 1EJNA 3RU4D 2Q6DA 3GY8A 3RXOA 1LHDH 2PGQB 1W0ZU 3UPEA 3ZZBA 3UNSA 1CHOF 3CENA 4ISOA 2ILNA 2D1JA 4OS6A 4NZLA 2A31A 5HYOA 1GL0E 4X6NA 1BBRH 1AZZA 4ISLA 3RXQA 4TPIZ 4ABDA 2ZHWH 1EATA 3PROA 1ELDE 2OINA 1HV7A 3URCA 3SW2B 1XMNB 1SSXA 1EOJA 4Y8ZA 4ABAA 1SMFE 1G3DA 4BXWA 1PPGE 4Y71A 1OSSA 3TH2H 2DE8A 1WAYB 3P95A 2C90B 2BQ6B 1DFPA 2M5TA 2TGTA 2ZI2H 5DGJA 2SNVA 4NWKA 1GI0A 1S6FA 1GHXH 1SLWB 1TPOA 1BHXF 1WCZA 1U6QA 2VVUA 4MDSA 1NS3A 3SU1A 2F9BH 2C93B 2ZKSA 1GMDG 4YT6H 3BTEE 5E0JA 4CH2B 5A09A 2FODA 1EB1H 1KY9A 3RXAA 1TRNA 4X6OA 1INCA 5DG6A 4Y8YA 3ZZ8A 4XBDA 1P3EA 7GCHG 5FPYA 3HGPA 1YCPH 3MHWU 1C1SA 2ZDNA 3UFAA 2TIOA 5JBBS 2J2UA 2A5KA 2AIPA 2F9NA 1NU9A 2Z3CA 3D23A 1ELBA 1HAXB 4X0WU 1S5SA 1LHFH 1QFKH 1V6DA 2FI5E 4XE4A 4YTAA 1THPB 3MH6A 4YOGA 2QV1A 3FZZA 4GVUA 2HOBA 1C5LH 3L6PA 1OP0A 1Z8IB 1DOJA 1TGTA 2AS9A 1SGYE 3SNBA 1JWTA 2XTTB 1YPHC 4TWYA 1VCWA 3LGIA 2SGQE 3HATH 1UK3A 1FLEE 1AO5A 3TNSA 1Y59T 3UR6A 2FWWA 2CN0H 2ESTE 2SGDE 4I8JA 4NCYA 4ZHAA 3M3VA 1VJAU 1YF4A 1THSH 3TVJB 1SGNE 1CHGA 3Q3YA 4BAOB 3PMHB 4ZROA 2VH6A 3A88A 2EI7A 3HKIB 1CGJE 1CVWH 2Q1JA 3JZ2B 3ZZ6A 4GSOA 1O2MA 1QBVH 1FN6A 2ZTZA 1BIOA 1DICA 1O2UA 1EP5A 2AFQB 2UUFB 4E7NA 5AHGH 4O3UA 3BTME 1MCTA 5LGOA 3DFLA 5GPIB 4E06H 6CHAB 2Z3EA 1TMTH 2G51A 3DHKH 3MU4A 1TNGA 2QCYA 2BB4A 2VIWA 1EASA 1RTKA 3I78A 4Q80A 3GICB 2BY6X 1G3CA 1QGFA 1C4Y2 1AN1E 2G00A 3LGYA 1PPCE 1L2EA 1T7CA 5TCAA 2O8WA 1FAKH 1EAUA 2AGGX 3BIUH 2FTLE 3V3MA 3KGPA 1HJAC 1ZTLA 2ZFPH 3T62A 1HB0B 2CGAA 1BQYA 3A80A 5L2ZH 1LQEA 2XBWA 3QO6A 1F7ZA 1LQDB 1TIOA 1C1OA 4AG1A 1O31A 4DCDA 4FXGH 1F92A 2R3YA 4ZUHA 1P2MA 1D3DB 1OP2A 3OTJE 1P3CA 1CA0C 1XXFA 2OP9A 3SU4A 2BHGA 5JB9S 3B8JA 1TE0A 2FPZA 4NSYA 1NFYA 3RU4T 4UDWH 1BRBE 4FUCA 2PW8H 1K1JA 1BRAA 1SGDE 1B0FA 1NTPA 1OWKA 2J38A 4X1NU 1FPCH 3D62A 1BMLA 3RXGA 4FUJA 4IN2A 3S9AA 1NRNH 3SUEA 4U32A 3SV6A 1QB6A 3QTVH 1GHBG 1C5TA 5ESBA 1G9IE 2HLCA 1GMHF 3GDUA 3ODDA 1C5OH 3NKKA 4YZUA 3Q76A 1BTZA 1G36A 1K1MA 1TNKA 2BDGA 1OYQA 1S0RA 2WV5A 1GVZA 4MLFB 4ABBA 1WU1A 2C8ZB 2G5NA 2ZEBA 4LOYH 1L0ZA 1AGJA 1T31A 2G5VA 1F0UA 4YESB 4MNVA 2XYAA 2JKHA 1OP8A 3O8CA 2Z6BD 1SGCA 1SQTA 1N8OC 1YPLH 3H7OA 3ZVBA 1A0LA 2QF3A 4RN6A 1H9LB 2BZ6H 4LZ4B 2GCTC 1ANCA 4K60A 4BXSA 2QXJA 1P2NA 1LHEH 1ZLRA 1TA6A 1CT0E 3TK5A 3M3TA 4X1SU 2Y5FA 2C8YB 5K7RA 1V2UT 1PJPA 4I8GA 1GG6C 1FJSA 5A0BA 1UHBB 2FDAA 3K6ZA 3QK1A 1QURH 1RIWC 1C5VA 2ZU3A 1L4DA 1C5ZB 4XDEA 5EQRA 3RXKA 1Q2WA 2BLQA 1DVAH 1Y8TA 1VGCC 4QT8C 1ZOMA 1SQOA 1ZHPA 2OBQA 1ZSJA 1TABE 1DE7H 4F4OC 1SLVB 1GBIA 5T6FA 2VINA 3PMBB 5BRRE 1AUTC 1TGCA 1D6WA 1XKBC 3DA9B 3UWJH 2PFEA 1KXDA 2CF9H 1QTFA 2ANMH 2XWBI 1GI2A 3UWIA 4IMZA 1O2OA 2GCHF 2O8LA 1MU8B 2OQUA 1D3TB 3SUDA 1UMAH 3T25A 1MZAA 3TIUA 1SR5C 4BAKB 2FESH 5C67A 1NO9H 3NXPA 1NY22 2Y7XA 3A7ZA 4DY7B 1BMMH 1QRZA 1UCYH 1S85A 3P17H 1E38B 2V3OH 1Y5BT 1O2RA 1TPPA 4B2CA 1A5GH 2Y5GA 2P3FH 1UTMA 2Q6GA 1NRPH 4Y7AA 2J34A 1YP9A 2FOFA 2CJIA 1JMOH 2AIQA 3R0FA 3RM0H 1ZPZA 1H9IE 1C5MD 1W7GH 2VVVA 3M5LA 2Z9KA 5CMXH 1T8MA 2R3UA 4CH8B 4MPVA 2BLWA 1MKWK 1HJAB 1LPZB 1AWFH 1GBMA 3D49H 1A2CH 3KL6A 3M35A 1AUJA 5T6DA 4ABFA 2XBYA 1TB6H 1HJ8A 1DXWA 3SZNA 1HYLA 3LGVA 1BMNH 4B2AA 3U8OH 1CA0B 1O2SA 1PPFE 3IG6B 1L1JA 1QB9A 3FP8E 3FP7E 1MTSA 1D6RA 4Q2KA 2FIRH 3P8GA 1EKBB 2EA3A 1P2QA 5JBTA 4JYVH 2GT8A 1MBMA 2PUQH 1TGSZ 2ZFFH 4FVDA 3BTKE 3LJOA 3C1KA 1GMHG 5PTPA 1C2IA 2P94A 2BLVA 5GJ4B 1PYTD 1P2JA 1BTWA 1Z1JA 5EW2H 2ZGXH 2QXIA 4WH6A 1A1RA 5DP9A 1V2WT 2Z7FE 5LPFA 3RXBA 2BQWB 3ZVDA 1BDAA 2GX4A 2FOMB 1AVGH 1XUGA 4UFFH 1XVMA 4BNRA 3Q00A 1SL3A 5IDKA 1T8OA 1AI8H 3T5FH 1A46H 1E37B 1UTNA 1TRYA 1TGBA 3M61U 3U8RH 5FPTA 1GI6A 3OY6U 2O8TA 1UHBA 4JZIA 4WVPE 2GCTB 3ATWA 3SJIA 2PV9B 2J4IA 1VJ9U 3MU0A 2AH4X 3TJNA 2HGTH 1MD7A 1CO7E 4NWLA 1BJVA 1BCUH 1O3OA 5F8XA 3GYMA 1DSUA 1KLIH 3UOPA 1KXBA 4AFSA 3U1IB 1K1PA 4B2BA 4D7GA 1HIAB 1V2VT 1IQJA 1GG6B 3VGCC 1TAWA 3CS7A 3QGNB 1ZMJA 2STAE 3RXFA 2C4FH 1ELTA 1TX7A 2JETC 4B1TA 3P8NA 1BTUA 4UEHH 1FY8E 1ELGA 4WMEA 3OY5U 3GDSA 4X1RU 1GBBA 1VGCB 1LHCH 1AWHB 1GVKB 1OKXA 4YT7H 2FOBA 5FX6A 3S9CA 1XKAC 5ABWA 3SU2A 1TQ7B 1GHVH 3RXSA 1WQVH 4IS5A 5BPEA 1ZTJA 1LCYA 5ETXA 1XUIA 4FUHA 1AZ8A 2GZ7A 3MNBA 1O2LA 1H8DH 1HCGA 2ZDLA 2J92A 1VITF 1GBLA 2F9UA 5F8TA 1VZQH 1OYTH 1ZJDA 2R2WU 1VR1H 3TLOA 1D9IA 1DXPA 3OX7U 3HKJB 4H42U 1ELAA 2H5DA 3OSYA 5I25A 4D9RA 1P57B 4GUXA 2D26C 3HGNA 2ZGCA 3SV7A 2SGAA 4JCNA 3ZVFA 1PQ7A 1ID5H 8ESTE 4CR5A 4Y79A 1A5HA 3SV8A 1GJAB 1XUJA 1P11E 2ZPSA 4XOJA 1A5IA 1NFXA 4XBBA 1S84A 1A7SA 1EP6A 2CF8H 3VB7A 1TNLA 2QYIA 1BT7A 3V13A 2PTCE 3MI4A 1O5FH 1DWBH 4RKOB 2BD5A 1YYY1 2V0BA 1HXEH 1EZSC 3FANA 2SFAA 1J8AA 1CBWC 1O5BB 1O2NA 1TBZH 2PR3A 1QY6A 1GI7B 1V2PT 2A1DB 4XFQA 3N7OA 3GCNA 3A8BA 1C2DA 3RXRA 1QQUA 2AERH