2ZPQA

Crystal structure of anionic trypsin isoform 1 from chum salmon
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
220
structure length
220
Chain Sequence
b'IVGGYECKAYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPSSCAPAGTMCTVSGWGNTMSSTADKNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anionic trypsin
publication title A structural comparison of three isoforms of anionic trypsin from chum salmon (Oncorhynchus keta).
pubmed doi rcsb
molecule tags Hydrolase
total genus 50
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zpqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zpqA02
2V0BA 3DT0H 4NIVA 2HOBA 2OLGA 4O9VA 1F5KU 1TRYA 3VGCC 1YPMH 4A5TS 1DLKB 1N8OC 2ZFPH 2BOHB 3PMHB 4ISOA 2PKSB 1KY9A 2QIQA 4H6TA 1KLIH 2PR3A 3AAUA 5A8XA 1GBCA 1NRSH 4DG4A 3A7YA 1ZPCA 4OS5A 1VGCC 5JPMH 1SQOA 1T8MA 1TQ0B 3OY5U 2XCFA 5EG4A 1H8IH 4MNYA 1IQLA 3RP2A 3P6ZB 1V2WT 2FS8A 1O3LA 3ZVCA 5AHGH 3PM3A 2BDYA 5JB9S 3KF2A 1HAZB 3E8LA 1IQMA 4YTAA 1E35B 5FPTA 5JBCS 3FANA 1TPOA 3TH3H 1SGFG 5T6GA 3SZNA 1IQFA 1BBRH 5ETXA 1NFWA 3GCNA 2C8WB 1DLEA 1AY6H 1WU1A 3LH3A 8ESTE 4AYVB 5E2PA 3UWIA 2EA3A 2J34A 2OINA 4A92A 1O3GA 1P2KA 3VB5A 1GWAA 2PKSC 1DUAA 1YYY1 1FNIA 5DO4H 1O3OA 1PQ8A 1EB2A 1FUJA 3ZVFA 3RU4T 3D62A 1D3PB 5FCRA 1GHAG 2D26C 4GPGA 1OP8A 1F2SE 2A1DB 1SGPE 1V2NT 2ZDLA 4K1EA 3Q3YA 3UOPA 1EZSC 2HRVA 1ARCA 4OS2A 1C5OH 5C3NA 3O8RA 1C2JA 2JKHA 1SOTA 1K2I1 2A7JA 1UVTH 1QBVH 2Q6DA 1SGDE 1GBJA 1HCGA 2PHBA 4AOQA 4B73A 3BTHE 1IHTH 3D65E 1ESTA 1C2MA 1NM6A 2VGCB 3ATWA 2ZFQH 2BDGA 1ZZZA 2FOFA 4BXSA 1GHXH 2O8WA 4MDSA 2NU3E 3SUGA 9ESTA 4X8VH 2RA0A 2DUCA 3RXCA 3SOSA 1Y3WA 2P59A 1SGFA 3GCHB 4OS1A 2AS9A 1A5GH 1SR5C 2ALPA 3BG4B 3K65B 1GJCB 4HTCH 3ZZBA 5EW1H 4ESTE 3M5LA 2Z94A 4NA9H 1ZJKA 1LHDH 3IITA 1AB9B 1ELEE 3EYDA 1EAIA 4AB9A 2JETC 1VJ9U 5AVDA 1CA0B 2PW8H 3SHCH 2QC2A 3UNQA 2BZAA 2CGAA 1S84A 1P3CA 2F9UA 3K6YA 3S69A 3L33A 1YPHE 3SNAA 2H9TH 3UR9A 1QB6A 3SN8A 1KTSB 3ZZ4A 1YM0A 1MCTA 4K8YA 4FUJA 3A7ZA 2VGCC 1BHXB 2ZNKH 1O2OA 1M9UA 1SGRE 2GMTB 3M5NA 1WTHD 1AUTC 3GYMA 2STAE 1NU9A 1NRQH 5DP7A 3MNCA 2BY5X 1P12E 3BG4C 4INHA 3T25A 1O2XA 2FOAA 1ZGVA 2ZGXH 1GI6A 1K1MA 2V3HH 3MH5A 1OX1A 3A89A 3CS0A 1S5SA 4X8SH 1AB9C 1QL7A 1ANDA 3T27A 3PLBA 1ELFA 1UTNA 3TK5A 3PTNA 2ZPQA 1SHYA 4AB8A 1FAXA 1CA0C 1E34B 3SORA 1Z8RA 5DP4A 3BTWE 3ZV8A 1PPFE 2ZTYA 1DM4B 1LVBA 4FUBA 4MPXA 2A4GA 2HVXA 4AFQA 4B75A 4Q80A 4JZFH 2HPQH 1HUTH 4AG1A 3PWCA 5EQSA 2C93B 3TGKE 1XMNB 1C5XB 4UD9H 4UFEH 2GMTC 2F9NA 2FWWA 3PWBA 1X7AC 2J2UA 1C5SA 3O8BA 2RDLA 2XC0A 1YPJH 3P17H 3T26A 3EDXB 1S6HA 3LIWA 2V3OH 1RTFB 1TOCB 4I7YH 1N6XA 2EC9H 2PSYA 4FUCA 1PPEE 1EPTB 1F0SA 3AAVA 2FX4A 1KXAA 3K2UA 3QWCH 4U2WA 1LCYA 2BLWA 2WPKS 1Z8IB 3FZZA 1HV7A 1O2LA 2GD4B 3W95A 1BBRE 1L4ZA 1ZMJA 2VNTA 2Y82A 3UTUH 1P04A 1QR3E 4FUDA 4RKJB 1UVSH 3SU6A 2VIQA 2VWNA 2ULLA 1AKSA 4GSOA 1ZHPA 2XYAA 2ZFTA 2FI4E 2A4QA 3RXAA 6CHAB 2Y80A 2J95A 1Z1JA 4Z6AH 3MO6A 4A6LA 3AASA 2KAIB 5HXFA 1AHTH 1IQGA 1WSSH 2ZECA 2H1UA 4GUXA 1CGHA 1IHSH 5E8EH 1C5YB 1P2JA 3GOVB 4ZXYH 1EPTC 2WPMS 1C5NH 4ABHA 4NIXA 3SU4A 1PPBH 1CVWH 1W13U 2SNWA 4M7GA 1TX6A 2Z3CA 4CH8B 1DE7H 3MNXA 3QZRA 1DWEH 3LGYA 1ANCA 2FYRA 1GVZA 1LHFH 1YPGH 2ZHWH 1HAPH 3MI4A 4Q7ZA 1BRAA 4YOIA 1BRBE 6CHAC 2VVVA 1SG8B 1BCUH 1MTSA 3VB7A 5A2MH 4ZKOU 3MH6A 1YC0A 1PPCE 1LMWB 1MZDA 2JH5D 6GCHG 1IQKA 2FOMB 5GCHG 2GZ7A 3QTVH 2NU0E 4BOHA 1C5RA 4WF8A 3KIDU 3QTOH 1KXEA 1W2KH 2ZZUH 2SGAA 4XBBA 4ABJA 3F9HA 1RD3B 1A2CH 1DWCH 1G3CA 1GI2A 3GDVA 5DP3A 1NO9H 3GY3A 5PTPA 3S9BA 4JYUH 2FP7B 4MNXA 1TWXB 1UTJA 4NZLA 1PPZA 1F7ZA 4K5ZA 1FY1A 2G52A 4WXIA 2Y5GA 1V2MT 3EQ0H 1G36A 1TLDA 5HM2A 3TGJE 1DS2E 1OYTH 1IOEA 4LZ4B 4ZMAH 3URDA 4NWLA 1JBUH 3NKKA 1ZRKA 2FS9A 1C5WB 4X6OA 1FAKH 2XBYA 2TBSA 2O8UA 1OXGA 2ZDMA 2QA9E 4X2XA 3RC5A 2G51A 3AW1A 1RTKA 2ZTZA 4ZKNU 1MD7A 1HFDA 1NRPH 2BZ6H 2FESH 2VH0A 3V12A 5EXNA 1A5HA 2ZCKP 3A84A 5C5OA 2GKVE 1V2JT 2FOEA 1HAVB 3GDUA 1ARBA 1YLCA 2A2XH 1AI8H 1ZSLA 3T5FH 3O8CA 1Z8JB 1RGQA 7GCHG 1TIOA 2HNTE 1T8NA 1GI5A 2THFB 1AQ7A 2P95A 1MTNB 2HNTF 3H7OA 4CH2B 4B71A 1O3JA 3LJOA 3MH4A 1XVMA 4B74A 3BTQE 5EU8A 2P16A 1SL3A 8KME2 1DOJA 1C1OA 3ATLA 1CT2E 2ZDNA 1QB1A 1D4PB 4ABGA 1O3HA 2A45B 3F9FA 1NTPA 3M61U 1TGSZ 3PLKA 1YPEH 3Q76A 2F9OA 1FIZA 1C4U2 2FM2A 1UK3A 4OGYA 1D3TB 1GDQA 3HKIB 4X1QU 3VB3A 2BD3A 4NSVA 1SOZA 4Y8XA 1MAYA 3SO3A 1KSNA 4ASHA 1QHRB 1ORFA 1Z7KA 1O2IA 4CR9A 1MBMA 1MTNC 1B0EA 4JCNA 1BTWA 2V35A 5ESBA 1HAYB 2ZHQH 3QX5H 2J94A 1GJ8B 3GCOA 5TJXA 2CXVA 4U30A 2M5TA 3K9XB 2FOGA 2G55A 4KELA 2XWAA 1Y59T 3RM0H 2BD7A 3SI3H 3R3GB 1O2TA 4NIWA 3VFEA 5EXMA 2HWLB 1YBWA 3GY4A 2BD5A 3UIRA 4LZ1H 1V2RT 2PGQB 2ZGHA 1Y5BT 5B6OA 1C1NA 3ZZAA 1G3DA 1E0FD 3TVJB 1V2KT 2BDIA 2GZ8A 2ZIQH 2BDCA 2BOKA 3MU4A 2BD4A 3SNDA 1TGTA 1BBRK 3TJUA 1QB9A 1TGCA 4GCHG 3SU1A 4JYTA 3MFJA 4KTCA 1VJAU 6LPRA 3OTJE 3M36A 5GPIB 3OX7U 1GHAF 1CT0E 4JZDH 3W94A 1C2LA 3GY6A 1UVPA 1NFXA 1EZXC 1ELAA 4LK4A 1NS3A 2BMGB 1SI5H 1GBHA 1KXFA 4B2CA 1F0TA 1FV9A 1RFNA 1EZUC 1B7XB 2FTMA 4X1NU 1HDTH 1HJAB 2OBQA 4XBDA 4U01A 1OWIA 1ZMLA 3GY8A 4FVBA 1U6QA 1CHGA 1XX9A 4Y8ZA 3NPSA 1TX7A 4DJZB 4CRDA 4IS5A 3A82A 4CRFA 1H1BA 3MU8A 1TNIA 1EAWA 1ABIH 1OPHB 1O5CB 1UHBA 2V6NA 1QJ6B 3BEFB 4VGCB 1EB1H 1AZZA 4Y6DA 1SGYE 1EASA 1CT4E 1EUFA 1N6YA 1B5GH 2PSXA 2BHGA 2NU1E 1BT7A 1W0YH 4JK6A 1FQ3A 1V2QT 1GBFA 1NESE 4K69A 4X6NA 2PKAB 1C4Y2 1O2VA 4LXBH 5C67A 5F6MA 1GBIA 1L2EA 1OYQA 3TGIE 1XXDA 1Q31A 1MH0A 1MU6B 3RXOA 2P3FH 1A3EH 1O2PA 1O2HA 3HPTB 1UTLM 2BVXH 5A0AE 4DURA 1SGCA 3BEIB 1UK2A 1HJAC 4MLFB 2C3SA 2W7UA 4SGAE 2FIRH 2AGEX 4MG3A 3SU0A 1WQSA 1LKAA 3U8RH 3A7VA 1SLWB 1P9UA 1C1UH 2IN2A 1N1LA 3RXRA 1ELTA 1D3QB 2FX6A 3LGWA 2GCHG 1MTVA 1Y3UA 1O2KA 2A0QB 2Q6GA 2F83A 4VGCC 2A5IA 1SB1H 1ESBA 2FZZA 1SQTA 2CF8H 3FP6E 1GHBG 1BTUA 1A3BH 3RXPA 4I8GA 3RMOH 4NFEA 3A8CA 1FPHH 1SGEE 2ZDVH 2PTCE 2AEIH 1YCPM 2Z3EA 1GBMA 1OWKA 2AIPA 3ELAH 5A8ZA 2BVSH 4TWYA 3LPRA 3ODDA 1EAXA 4B2BA 1C5VA 1O36A 1TYNA 1J9CH 4XBCA 1GJ4H 1YLDA 1O2WA 1SC8U 2BDHA 3RXTA 4X2VA 3SHAH 2BY8X 2EEKA 2YOLA 1DICA 4YO9A 4NWKA 2AMPA 3STIA 5JBTA 3TK6A 1TBQH 5I46H 1NROH 1SMFE 4F4OC 1V2OT 2FEQH 3ATIA 2ZEBA 3E3TA 2PUQH 1DSUA 3MYWA 3T62A 2PLXA 1O39A 1P9SA 3PO1B 1AUJA 2VWOA 2OXSA 4FU8A 1GGDB 4K2YA 1C2EA 3P8NA 5EXLA 1P3EA 2VIOA 5TCAA 3UY9A 1C2HA 3ZVEA 2OTVA 2QXIA 5EW2H 1P06A 2VB0A 4NG9H 1GVLA 1TMUH 1O5BB 3R0FA 4K3JA 2QN5T 4O03A 3V13A 1LDTT 3URCA 2ZU2A 1JRSA 2FTLE 4NSYA 1TE0A 2TIOA 2B5TB 4XFQA 1W7GH 1EATA 1O3NA 1PJPA 3SGQE 3BTGE 3DHKH 1HXEH 2ZGJA 1DFPA 2BQWB 3UUZA 1L1JA 2Q6FA 3A86A 2ILNA 1OP2A 1KXDA 1WYKA 3MOCA 2QXHA 3UFAA 3P8OA 2UWPA 1H4WA 3PO1C 1JMOH 1G37A 1Z8GA 3UPEA 2W3KA 1P2QA 2Y7XA 3S7KB 1GGDC 1MCVA 4UFGH 4UONA 1O5EH 5EPNA 1BTXA 3RM2H 2GT8A 1GCTB 3ENSB 2YNBA 1ZTLA 4Y76A 1GCDA 3SV7A 1MBQA 2FPZA 3UQVA 1G3BA 5A8YA 6GCHF 5GCHF 3EA7A 1L4DA 1Y5UT 5C1UA 1ACBE 2O9QA 3RC6A 1BUIA 2FI5E 5A0CA 1BDAA 1V2VT 1A61H 1MQ6A 5IDKA 1HJ9A 3LJJA 1C1VH 4OS7A 1F5LA 1HAIH 1Q2WA 3ESTA 2O8LA 2CJIA 3FP7E 3GYLB 4I31A 2VIPA 1ANBA 1K1NA 4YZUA 4ZH8A 1THRH 2ZKSA 8LPRA 1C2DA 2ZPSA 3M7TA 1FDPA 4DCDA 1W7XH 1CGIE 4UFDH 1A5IA 1GCTC 4TPIZ 1ZHMA 2BVRH 3E16B 5EQQA 2A2QH 3STJA 3TNTA 5F03A 1XM1A 1XXFA 4Y0ZE 1GBBA 3GCHC 1UVOA 3RDZA 2VIWA 1QIXB 1TA2A 2I6SA 5ESTE 2XRCA 5DGJA 1DY9A 1JIRA 3GCTG 1XUFA 2XC4A 1A1RA 1F0RA 2BD2A 2O8TA 1MQ5A 2OBOA 1GMDG 4WWYA 4X6PA 5GJ4B 1MU8B 2QF0A 1BZXE 1WV7H 1P03A 1JXPA 5BRRE 1LPGB 4CBNA 1GBLA 4X8UH 4IMZA 3LU9B 1W12U 1SFQB 2DE8A 2ZCHP 1LVOA 1EAUA 2RG3A 7GCHF 5JYIA 1ZJDA 4X1SU 1CHOF 4MVNA 1K1IA 1O5DH 2C4FH 3LGUA 4GHTA 3CENA 4ZXXH 4A1XA 2SGQE 3FP8E 4IBLH 3SU2A 1GI7B 1O32A 1ESAA 4F49A 2R0LA 3B9FH 2D1JA 1JWTA 3MMGA 2GCTB 1P2MA 4XOJA 1D9IA 3F6UH 2UUJB 1TBRH 1HLTH 1ZOMA 2BD8A 4FU9A 4D7FA 2HALA 1HXFH 4D9RA 1C1TA 4WMEA 2Z9KA 3QGNB 4AX9H 2A7HA 3RXGA 4YLUA 3ZZ3A 1V2ST 2ANWA 4NZQA 3SNBA 3MNSA 1V2UT 4MQAA 3ZZ7A 1C2FA 3UREA 1LKBA 4TPYA 1AVXA 1HIAA 1BJUA 1W11U 3QK1A 1K1LA 1AMHA 2SGPE 1KDQA 3ZVBA 5FAHA 4Y7BA 4A1VA 1P01A 1NZQH 5DK1A 1EXFA 1DPOA 3SBKA 3VXEH 1QL9A 3PYHA 2NWNA 3EA9A 1ZR0A 1ZTJA 2Y81A 4GVUA 4Q7XA 3TK9A 1O3BA 2J92A 2GCTC 3EE0B 2JH6D 1WCZA 1KIGH 1C9TA 2ZU3A 1VCQA 4LOYH 3PROA 1HNEE 4BAKB 2ANMH 1Z6JH 2Z3DA 4I32A 2BQ6B 4MPUA 3SV2H 1C1QA 1KXBA 1GHWH 5HGGA 4ABFA 1AZ8A 1O3AA 2ODYB 1YKTA 8GCHG 4KKDA 1OS8A 1VITG 2OD3B 4XSKU 3BTME 3KQCA 1A7SA 1O2JA 2BTCE 2PFEA 1IQHA 4ZAEA 1YCPK 1VZQH 2BY6X 4K1SA 4GCHF 4K8BA 3LOXA 3LGIA 1FMGA 3MH7A 3P70B 4XE4A 1QL8A 3TH2H 1ZMNA 1UTKA 5LPRA 3E91A 2OP9A 4CHAB 2EI8A 4R0IA 1A0HB 3P95A 2XBXA 1G2MA 2UUFB 5JBBS 4IGDA 5J4QA 1UO6A 1ELCA 1AE5A 3EA8A 5GDSH 1UJ1A 1C1WH 1D3DB 1GI8B 4ABAA 1GBTA 5DP8A 3WY8A 1S85A 3LONA 5FBEA 4DT7B 4ABIA 1S0QA 3PMJA 2BM2A 1DX5M 1VCWA 4MPWA 5EOKA 2HNTC 1RTLA 1P09A 2AMDA 3A81A 5SGAE 2TPIZ 1TONA 1GHZA 1A4WH 2BXTH 3AW0A 3TH4H 1EOJA 3RU4E 2ZO3H 4AFSA 3GDSA 1WBGB 2XXLA 1XUGA 1H9IE 2VWMA 4CRAA 1PQ5A 3I29A 4I8HA 5CHAB 3PTBA 1UMAH 2A31A 2QXGA 4YT7H 3FVFB 3MO3A 1H9HE 2ZHDA 4CHAC 2QCYA 4AORA 4NFFA 1O3IA 1O37A 2XBVA 1A46H 1V6DA 3KQDA 1G9IE 2P8OB 1XUKA 2Z9LA 3M7UA 2OQ5A 1AO5A 3U98H 1GI3A 1ZTKA 4BAOB 1E37B 4BTIB 4WH6A 2IPHA 3KEEA 2GCHF 1TALA 1O2RA 3DFJA 1QA7A 4X6MA 1QRZA 1LHCH 1ZHRA 2QAAA 1GHBF 1EOLA 1UCYK 2G81E 5CHAC 1DANH 3RXIA 2AMQA 2BD9A 2XNIA 2ZP0H 2FLBH 3T28A 1P0SH 4A7IB 1QJ7B 4HZHA 1Y3YA 1S83A 3F9GA 1MZAA 3AVZA 2ANKH 4DW2U 1CU1A 1Y8TA 3JZ2B 3A85A 4ZROA 1O2GH 2NU4E 2FI3E 2P8OC 3M37A 3RUOA 1O5AB 4WMFA 1EP5A 3SW2B 4YM9A 2ZI2H 4B76A 3EGKH 1QBOA 3RMLH 1MTUA 3ZZCA 1SFIA 4NCYA 3GY5A 2SFAA 1GG6B 1W14U 2ZQ2A 2FYQA 2P3TB 1TPSA 2BX3A 1GMHG 2A4OA 2G00A 3K6ZA 4JZEH 4NA8A 3GY2A 1DY8A 2ANYA 1YCPH 4RSPA 1P02A 1C2GA 2JH0D 1T8LA 5C5NA 3F9EA 2F9PA 4MTBA 4FVDA 1Z1IA 1ETRH 5DP9A 4ABEA 1RJXB 4NA7A 1YPKH 4KGAA 2Z9GA 1JIMA 2VH6A 1FY5A 3SI4H 3A8BA 1MD8A 3ATMA 3F1SB 1QTFA 1UTMA 2GT7A 1PYTC 2WPLS 3PMBB 2UWOA 2R3UA 1HB0B 3OSYA 4KTSA 1DWDH 1SLVB 1AVWA 1P10A 2G5VA 3VXFH 2J9NA 1FY8E 1BMAA 2HPPH 1S6FA 1AKSB 1P05A 4TY6A 3RLWH 5JBAS 1F92A 3BIVH 1H9LB 4H6SB 1D6WA 1NN6A 1GG6C 4D7GA 1YPLH 4X2WA 2B8OH 1GI0A 5C1XA 1GBEA 1VITH 5BPEA 5JB8S 4NIYA 2Y6TA 4CRCA 1DSTA 5FX6A 1G3EA 4AGJA 3TPIZ 3ATKA 2GZ9A 1C5LH 3QN7A 3LT3A 3TJNA 1ELBA 3M7QA 2XTTB 1T32A 2OC1A 1O2NA 2WYGA 3ITIA 3P8FA 1BMLA 4FXGH 3RXLA 1HGTH 2WPHS 3SJOA 1OWEA 3NXPA 3T2NA 2O8MA 4UDWH 1GDNA 5C20A 3BTKE 1XUHA 5L2YH 5A0BA 2VU8E 1HAGE 2WV5A 5JDUB 1RS0A 5GXPA 4FU7A 1ELGA 3SUEA 2OC0A 3TLOA 1Y5AT 3ZVAA 1FJSA 4YT6H 7LPRA 1O3DA 1EP6A 1K22H 1KLJH 4IN2A 1K1OA 1QFKH 3QZQA 3PB1E 1A0LA 3BTEE 1K1PA 2A32A 3LGTA 3RXMA 1K21H 1O3KA 1D6RA 1SGTA 2ZFRH 2ODPA 3A8DA 2EI7A 4X0WU 5DKMA 1ZGIA 5DP6A 5F8TA 5H4IB 1C5ZB 4AG2A 2H5DA 4O3UA 1C5UA 1GBKA 3DA9B 3TU7H 1O2YA 2BLVA 4INLA 4CREA 2VIDA 1UCYH 4BAHB 1F0UA 2WINI 4TWWA 4AGKA 3ZZ6A 1W3CA 5ABWA 3LDXH 4BAMB 3SGAE 1TRNA 4AZ2B 4KTUA 1HAHH 5FPSA 2OCVB 3GCTF 1O2MA 1GMDF 1O2QA 4Y71A 2TGTA 1C1RA 2WV4A 4ISHH 4E05H 1GJ9B 1PYTD 1XUIA 1AGJA 3RXEA 3A7WA 4PROA 4D76A 1EPTA 2R3YA 3MU5A 2PUXB 5DPAA 1TMBH 1J15A 3HATH 2RCEA 2H9EH 3V0XA 1IAUA 5LPEA 1ZPBA 1GHVH 1S82A 1AD8H 1XVOA 2R2WU 3D23A 4QT8C 2FOBA 3KL6A 4J1YA 4CRBA 3GICB 1EQ9A 2BYAX 4MNWA 4DGJA 1BA8B 1YF4A 2AGGX 2HGTH 1HBTH 2Z9JA 2KAIA 4ZUHA 4X2YA 4YESB 3TJOA 5K0HA 2GGVB 1IQEA 3ZZDA 1QGFA 2VVUA 1QCPA 2ODQA 3KGPA 1O33A 1Z6EA 2R9PA 1O31A 2FOHA 5AFYH 3RMNH 4CRGA 5FPYA 1KYNA 2I6QA 3M35A 1OOKB 1TABE 1DUEA 3C1KA 1UTPA 1O3PB 2AGIX 3I77A 3NUMA 5T3HA 4ZHAA 1QBNA 1C1PA 2TGDA 1BTHH 5E0HA 1ETTH 3ZVGA 3I78A 4X1PU 1TPPA 2Y5FA 1TMTH 1GMCG 4ABDA 1O2ZA 3RMMH 1TNHA 3U1IB 1HPGA 1QQ4A 1AFEH 1SPJA 3TIUA 2H2ZA 2QGRA 4Y79A 1GBAA 2ZGCA 2A5KA 3IG6B 1AFQB 2OUAA 1IQIA 1PQAA 3U9AH 2UWLA 1ZLRA 2C90B 1HYLA 4BXWA 4E06H 2QYIA 2GX4A 1YGCH 3QGJA 3OU0A 3OYPA 3U1JB 8GCHF 2QV1A 3MWIU 1VITF 1SLXB 2VJ1A 1YPHC 2AYWA 2JETB 1GPZA 5T6DA 1LVMA 1OWHA 1W0ZU 4DIIH 3S9AA 1FN6A 2A7CA 1RRKA 3E1XB 2AIQA 4K1TA 1GJ6A 3QO6A 2GP9B 3M5OA 1TFXA 5I25A 3S0NA 1IQJA 2Y7ZA 1SQAA 1Q3XA 4ZHLU 1C5MD 2VWLA 2FLRH 3BTTE 1AFQC 1NPMA 2W7SA 2FXRA 2P3UB 3BTFE 1ZRBA 3E90B 3DUXH 2A5AA 1FIWA 4GLYA 2LNCA 2G8TA 1O3EA 2BXUH 2XW9A 1HAVA 4I33A 3Q3KA 1TA6A 5E0GA 3C27B 3RXVA 3ZYEA 5FXLA 3H7TA 1ZSKA 3VB4A 1G32B 3QUMP 2ZU5A 1Z71A 1V2PT 1OSSA 4WH8A 1AU8A 1LPZB 1LPKB 2GV7A 2BLQA 3E0NB 4BAQB 2FMJA 2ZPRA 1UCYE 1AWFH 3F68H 1T31A 1GJ5H 2CHAB 1P2OA 3SQHE 3FAOA 3FZDA 2DE9A 1P57B 3KQBA 1G2LA 5A09A 1UK4A 3BF6H 1UHBB 1CSOE 1GJDB 3SGBE 3CS7A 3Q77A 4O3TA 5L30H 3EAJA 5AFZH 3GISB 4IN1A 4TYDA 1VCPA 2G4TA 3Q3XA 4IC6A 1JOUB 1MAXA 1NFUA 5FBIA 3BTDE 5G4BA 3UOUA 4D9QA 1HAOH 2GV6A 2B9LA 3SUFA 2LPRA 3KN2A 2UUYA 1C4V2 2F9BH 2GDDA 3VPKA 3PV4A 1YP9A 1C5PA 3SUDA 5LPFA 4ZKSU 4FUEA 3QLPH 1WTGH 1L0ZA 2CMYA 2F9VA 3VEQB 1OWJA 2F91A 1MKWK 3RXFA 9LPRA 3ZZ8A 3A8AA 1TAWA 1NY22 5EQRA 3CP7A 3UQOA 3TNSA 1LHEH 3ODFA 1G30B 3P8GA 1C2IA 1E36B 1GVKB 2PV9B 2CHAC 1OWDA 2ZU4A 1W10U 5IYTA 2ZU1A 3RXKA 1LHGH 2Z7FE 2FOCA 3A7XA 3SJIA 3E6PH 5HYOA 3H5CB 4ZKRU 2H6MA 4Y0YE 3U8OH 7ESTE 3E0PB 2OQUA 4ABBA 1O2UA 2VINA 3SQEE 4DOQA 1NT1A 2NU2E 2RA3A 3SJ9A 2ZWLH 3PLPA 2R2MB 4R8TB 1O30A 4KP0A 2HLCA 1ETSH 2ZHEH 5GIBA 1QQUA 1HJ8A 2SGDE 3BEUA 2B7DH 5EGMA 1GJBB 4DY7B 1A0JA 1T4VH 1MMJN 3D49H 1HAXB 1T7CA 1FONA 5J4SA 1NC6A 5LGOA 1KXCA 1HRTH 2XWBI 2ZG0H 1BRCE 5E2OA 1TQ7B 1JRTA 1GBDA 1GMHF 4CR5A 2XC5A 2BX4A 1O3FA 3Q00A 2C8XB 1T4UH 1BHXF 1O38A 4FUGA 1GDUA 1K28D 4I8KA 1QJ1B 1WOFA 3RC4A 5K7RA 1TNLA 2ESTE 3HK6B 2CN0H 1FN8A 2P94A 3QDZB 5FHTA 7KMEH 2VVCA 3UWJH 2H9HA 4RN6A 2C8ZB 3T29A 3M3VA 1ZPZA 3MU1A 3SNCA 1TGNA 1FZZA 1OP0A 4GHQA 4AYYB 1BTPA 2R0KA 1O3CA 1GHYH 1GI9B 2WPJS 4IMQA 1DXWA 3U69H 2OC7A 3SU5A 4MPVA 3SNEA 4I8LA 1RXPA 4Z0KA 3V3MA 1IQNA 2BDBA 1S81A 2H5CA 1DWBH 3LKWA 1SHHB 3RXDA 1PPGE 1FLEE 1QURH 2GVFA 2PKAA 3U8TH 4GAWA 4U32A 3M3SA 4WMDA 4HGCA 1V2TT 1F5RA 1AWHB 1FI8A 2BB4A 1TBZH 1P11E 1MKXK 4FUIA 1BRUP 1DT2A 3JZ1B 4JMYA 1KTTB 1O2SA 1ID5H 2ZQ1A 1CGJE 3IWMA 1K9OE 1ZYOA 2VIVA 1WQVH 2ZFSA 1BMMH 1NRRH 4ISIH 4AFZA 4SGBE 4J2YB 4TY7A 1H8DH 4DIHH 1MKWH 1DXPA 4H42U 5CMXH 1THSH 4E7NA 4BTTB 3LC5A 4WJG2 1WUNH 2TGPZ 2PTNA 1Y3VA 3NK8A 3M5MA 1RIWB 5EPYA 2EI6A 4Q7YA 1BITA 3B23B 3BIUH 4IW4E 2CF9H 3RXHA 1P2IA 2BLOA 1AIXH 4B1TA 3GY7A 1QA0A 3UNSA 3L6PA 3SV8A 3TITA 1ELDE 3LC3A 4WY3A 3RXJA 3S9CA 1O3MA 1C5QA 3MO9A 4AN7A 1MUEB 2BY9X 2IOTA 4B2AA 5CE1A 1TNKA 2FDAA 3PMAB 1XKBC 2D8WA 1PFXC 4Y8YA 1TOMH 2B0FA 1CHOG 1SVPA 4AFUA 2FO9A 3L3TA 3A88A 4Q2KA 4THNH 2TGAA 1TB6H 1FXYA 1ANEA 1BJVA 4RKOB 3RXUA 3NZIA 1XUJA 2ALVA 3BV9B 2BDAA 4HI3A 3DD2H 1PQ7A 5T6FA 1GJ7B 3HKJB 4FUHA 5HMAA 1NFYA 3A87A 1CQQA 2QY0B 1K1JA 1AN1E 1RIWC 2UUKB 2SNVA 4BNRA 4X1RU 2GDEH 5TCCA 4H4FA 1NU7B 5C1YA 3RU4D 2PWXA 3ZZ5A 2ZDAH 4BTUB 4UFFH 3M3TA 1TGBA 4ZHMU 5LH8A 4E7RG 5DG6A 2IJOB 3UR6A 4YOJA 1O5GH 4IC5A 3G01A 2ZF0H 2BQ7B 1ABJH 1OKXA 3KHVA 1PPHE 2OC8A 2ZDKA 1W8BH 5HM9A 2YNAA 5GWZA 2CV3A 1AVGH 2BY7X 2FODA 1EX3A 1E38B 1MTWA 1LVYA 1LO6A 1SGQE 3MHWU 2SGEE 3ZV9A 1ZSJA 5C2ZA 2G4UA 1SGNE 1V3XA 4NGAH 1LTOA 2ZA5A 1EKBB 1TPAE 2J38A 5F8ZA 4D8NA 1L1GA 4INKA 2G5NA 4K60A 1HIAB 4O97A 1T8OA 5L2ZH 1GMCF 1TNGA 1KDQB 1GL1A 1DDJA 3OY6U 1GL0E 2ZHFH 1C1SA 3SJ8A 1LQDB 1TRMA 1VR1H 2Z9IA 4DVAU 3A80A 2ZCLP 1TX8A 3S7HB 4OS4A 1MKXH 3NCLA 1GI1A 4CBOA 3RXSA 3UNRA 1CA8B 2C8YB 5E0JA 3A83A 2W5EA 1DVAH 4JYVH 2AFQB 2SGFE 4ISLA 3ZZ9A 2XCNA 1CE5A 1L1NA 1GI4A 3FFGA 4WVPE 3ZYDA 1CBWB 4A1TA 1WAYB 1THPB 1TNJA 2QF3A 1SBWA 1O5FH 2WYJA 1P2NA 3N7OA 3ZVDA 5F8XA 1FPCH 1SSXA 1FY4A 1UVUH 1EZQA 2AERH 2ASUB 4XDEA 5DP5A 1S0RA 2A4RA 2ZC9H 4JZ1A 1O35A 2W3IA 2AH4X 2WUCA 4FUFA 5FX5A 1INCA 4UEHH 4MNVA 4I8JA 1BQYA 1KLTA 1GJAB 1XKAC 3B8JA 1EJAA 1QNJA 3MTYA 2W26A 1NRNH 3O8DA 1QRWA 2WUBA 2Z6BD 1C1MA 1BTYA 3HGNA 1BMNH 3SV9A 2F3CE 4YOGA 3MNBA 1J16A 1UTOA 4ISNA 1C9PA 4Y7AA 3KCGH 3BN9A 3RLYH 6ESTA 2PGBB 3P92A 5AF9H 3BSQA 3RXQA 1BTZA 2ZGBH 3VB6A 1BB0B 1J14A 3KNXA 1CBWC 3SJKA 1V2LT 3DFLA 4HFPB 2ZFFH 1J17T 2STBE 2Y5HA 4OGXA 1SGIB 4Y11E 3VGCB 1EJMA 1SLUB 4JK5A 1C5TA 3LGVA 1Y3XA 1N8OB 3RXBA 3TJVA 5L6NH 3KQEA 3SV6A 1AE8H 1BOQA 1C2KA 1EJNA 1QY6A 2D2DA 2XBWA 1P8VC 3HK3B 4X8TH 3LH1A 1J8AA 5DJ7A 1QRXA 1VGCB 3V7TA 1ELVA 2GTBA 3SU3A 3NWUA 1DITH 1CO7E 2P93A 2J4IA 1B0FA 4WXVA 4YLQH 2QXJA 3A7TA 2ZTXA 4UE7H 3MU0A 4JZIA 2K1QA 1BIOA 1LQEA 2Q1JA 3HGPA 2WPIS 1FY3A 1UTQA 2TRMA 5FCKA 3BG8A 4Y10E 1O0DH 4BANB 5EODA 4OS6A 1O34A
chains in the Genus database with same CATH superfamily
2V0BA 3DT0H 4NIVA 2HOBA 2OLGA 4O9VA 1W0JD 1F5KU 1TRYA 3VGCC 1YPMH 4A5TS 5C94A 1DLKB 1N8OC 2ZFPH 2BOHB 3PMHB 4ISOA 2PKSB 1KY9A 2QIQA 4H6TA 1KLIH 2PR3A 4M9FA 3AAUA 5A8XA 1GBCA 1NRSH 4DG4A 3A7YA 1ZPCA 4OS5A 1WXRA 1VGCC 5JPMH 1SQOA 1T8MA 1TQ0B 2AHME 2XCFA 3OY5U 5EG4A 1H8IH 4MNYA 1IQLA 5EJ1A 3RP2A 3P6ZB 1V2WT 2FS8A 1O3LA 3ZVCA 5AHGH 3PM3A 2BDYA 5JB9S 3KF2A 1HAZB 3E8LA 1IQMA 4YTAA 1E35B 5FPTA 5JBCS 3FANA 1TPOA 3TH3H 1SGFG 5T6GA 3SZNA 1IQFA 1BBRH 5ETXA 1NFWA 3GCNA 2KX4A 2C8WB 1DLEA 1AY6H 1WU1A 3LH3A 3F2FA 8ESTE 4AYVB 5E2PA 3UWIA 2EA3A 2J34A 2OINA 4A92A 1O3GA 1P2KA 4P00A 3VB5A 1GWAA 2PKSC 1DUAA 1YYY1 1FNIA 5DO4H 1O3OA 1PQ8A 1EB2A 1FUJA 3ZVFA 3RU4T 3D62A 1D3PB 5FCRA 1GHAG 2D26C 4GPGA 1OP8A 1F2SE 2A1DB 1SGPE 1V2NT 2ZDLA 4K1EA 3Q3YA 5F53A 3UOPA 1EZSC 2HRVA 1ARCA 4OS2A 1C5OH 5C3NA 3O8RA 1C2JA 2JKHA 1SOTA 1K2I1 2A7JA 1UVTH 1QBVH 2Q6DA 1SGDE 1GBJA 1HCGA 3N99A 2PHBA 4AOQA 4B73A 3BTHE 1IHTH 2W6JD 3D65E 1ESTA 1C2MA 1NM6A 2VGCB 3ATWA 1SQRA 2ZFQH 2BDGA 1ZZZA 2FOFA 4BXSA 1GHXH 2O8WA 4MDSA 2NU3E 3SUGA 9ESTA 4X8VH 2RA0A 2DUCA 3RXCA 3SOSA 1Y3WA 2P59A 1SGFA 3GCHB 4OS1A 2AS9A 1A5GH 1SR5C 3F3BA 2ALPA 3BG4B 3K65B 1GJCB 4HTCH 3ZZBA 5EW1H 4ESTE 3M5LA 2Z94A 4NA9H 1ZJKA 1LHDH 3IITA 1AB9B 1ELEE 3EYDA 1EAIA 4AB9A 2JETC 1VJ9U 5AVDA 1CA0B 2PW8H 3SHCH 2QC2A 3UNQA 2BZAA 2CGAA 1S84A 1P3CA 2F9UA 3K6YA 3S69A 3L33A 1YLNA 1YPHE 1UW7A 2H9TH 3SNAA 3UR9A 1QB6A 3SN8A 1KTSB 3ZZ4A 1YM0A 1MCTA 4K8YA 4FUJA 3A7ZA 2GJGA 2VGCC 1BHXB 2ZNKH 2JJ1D 1O2OA 1M9UA 1SGRE 2GMTB 3M5NA 1WTHD 1AUTC 3GYMA 3PV5A 1QZ8A 2STAE 1NU9A 5T1VA 1NRQH 5DP7A 3MNCA 2BY5X 1P12E 3BG4C 4INHA 3T25A 1O2XA 2FOAA 1ZGVA 2ZGXH 1GI6A 1K1MA 2V3HH 3MH5A 1OX1A 3A89A 3CS0A 1S5SA 2K0QA 4X8SH 1AB9C 1QL7A 1ANDA 3T27A 3PLBA 1ELFA 1UTNA 3TK5A 3PTNA 2ZPQA 1SHYA 4AB8A 1FAXA 1CA0C 1E34B 3SORA 1Z8RA 5DP4A 3BTWE 3ZV8A 1PPFE 2ZTYA 1DM4B 1LVBA 4FUBA 4MPXA 2QF4A 2V7QD 2A4GA 2HVXA 4AFQA 4B75A 4Q80A 4JZFH 2HPQH 1HUTH 4AG1A 3PWCA 2WZQA 5EQSA 2C93B 3TGKE 1XMNB 1C5XB 4UD9H 4UFEH 2GMTC 2F9NA 2FWWA 3PWBA 1X7AC 2J2UA 1C5SA 3O8BA 2RDLA 2XC0A 1YPJH 3P17H 3T26A 3EDXB 1S6HA 3LIWA 2V3OH 1RTFB 1TOCB 4I7YH 1N6XA 2EC9H 2PSYA 4FUCA 1PPEE 1EPTB 1F0SA 3AAVA 2FX4A 1KXAA 3K2UA 3KYGA 3QWCH 4U2WA 1LCYA 2BLWA 2WPKS 1Z8IB 3FZZA 1HV7A 1O2LA 2GD4B 3W95A 1BBRE 1L4ZA 1ZMJA 2VNTA 2Y82A 3UTUH 1P04A 1QR3E 4FUDA 4RKJB 1UVSH 3SU6A 2VIQA 2JJ2D 2VWNA 2ULLA 1AKSA 4GSOA 1ZHPA 2XYAA 2ZFTA 2FI4E 2A4QA 3RXAA 6CHAB 2Y80A 2J95A 1Z1JA 4Z6AH 3MO6A 4A6LA 3AASA 2KAIB 5HXFA 3N7EA 1AHTH 1IQGA 3OTPA 1WSSH 2ZECA 2H1UA 4GUXA 1CGHA 1IHSH 5E8EH 1C5YB 1E1QD 1P2JA 3GOVB 4ZXYH 1EPTC 2WPMS 1C5NH 4ABHA 4NIXA 3SU4A 1PPBH 1CVWH 1W13U 2SNWA 4M7GA 1TX6A 2Z3CA 4DT4A 4CH8B 1DE7H 3MNXA 3F0OA 1DWEH 3QZRA 3LGYA 1ANCA 2FYRA 1GVZA 1LHFH 1YPGH 2ZHWH 4Z1MD 2KM0A 1HAPH 1H8ED 3MI4A 4Q7ZA 5CDFE 1BRAA 4YOIA 1BRBE 6CHAC 2VVVA 1SG8B 1BCUH 1MTSA 3VB7A 5A2MH 4ZKOU 3MH6A 1YC0A 1PPCE 1LMWB 1MZDA 2JH5D 6GCHG 1IQKA 2FOMB 5GCHG 2GZ7A 3QTVH 2NU0E 4BOHA 1C5RA 4WF8A 3KIDU 3QTOH 1KXEA 1W2KH 2ZZUH 2SGAA 4XBBA 4ABJA 3F9HA 2LELA 1RD3B 1A2CH 1DWCH 1G3CA 1GI2A 3GDVA 5DP3A 1NO9H 3GY3A 5PTPA 3S9BA 2KCPA 4JYUH 2FP7B 4MNXA 1TWXB 1UTJA 4NZLA 1PPZA 2KZ4A 1F7ZA 4K5ZA 1FY1A 2G52A 4WXIA 2Y5GA 1V2MT 3EQ0H 1G36A 1TLDA 5HM2A 3TGJE 1DS2E 1OYTH 1IOEA 4LZ4B 4ZMAH 3URDA 4NWLA 1JBUH 3NKKA 1ZRKA 2FS9A 1C5WB 4X6OA 1FAKH 2XBYA 2TBSA 2O8UA 4Q63A 1OXGA 2ZDMA 2J97A 2QA9E 4X2XA 3RC5A 2G51A 3AW1A 1RTKA 2ZTZA 4ZKNU 1MD7A 1HFDA 1NRPH 2BZ6H 2FESH 2VH0A 3V12A 5EXNA 1A5HA 2ZCKP 3A84A 5C5OA 2GKVE 1V2JT 2FOEA 1HAVB 3GDUA 1ARBA 4P02A 1YLCA 4I86A 2A2XH 1AI8H 1ZSLA 3T5FH 3O8CA 1Z8JB 1RGQA 7GCHG 1TIOA 2HNTE 1T8NA 2JIZD 1GI5A 2THFB 1AQ7A 2P95A 1MTNB 2HNTF 3H7OA 4CH2B 4B71A 1O3JA 3LJOA 3MH4A 1XVMA 4B74A 3BTQE 5EU8A 2P16A 1SL3A 8KME2 1DOJA 1C1OA 3ATLA 1CT2E 2ZDNA 1QB1A 1D4PB 2QF5A 4ABGA 1O3HA 2A45B 3F9FA 1NTPA 3M61U 1TGSZ 3PLKA 1YPEH 3Q76A 2F9OA 1FIZA 1C4U2 2FM2A 1UK3A 4OGYA 1D3TB 1GDQA 3HKIB 4OM9A 4X1QU 4B6EA 5EJLA 3VB3A 2BD3A 4NSVA 1SOZA 1WDIA 4Y8XA 1MAYA 3SO3A 1KSNA 1OHHD 4ASHA 1QHRB 4RT0A 1ORFA 1Z7KA 1EFRD 1O2IA 4CR9A 1MBMA 1MTNC 1B0EA 4JCNA 1BTWA 2V35A 5ESBA 1HAYB 2ZHQH 3QX5H 2J94A 1GJ8B 2KR7A 3GCOA 5TJXA 2CXVA 4U30A 2M5TA 3K9XB 2FOGA 2G55A 4KELA 2XWAA 1Y59T 3RM0H 2BD7A 3SI3H 3R3GB 1O2TA 4NIWA 3VFEA 5DSFA 5EXMA 2HWLB 1YBWA 3GY4A 2BD5A 3UIRA 4LZ1H 1V2RT 2PGQB 2ZGHA 1Y5BT 5B6OA 1C1NA 3ZZAA 1G3DA 1E0FD 3F2HA 3TVJB 1V2KT 2BDIA 2YMSD 2GZ8A 2ZIQH 2BDCA 2BOKA 3MU4A 2BD4A 3SNDA 1TGTA 1BBRK 3TJUA 1QB9A 1TGCA 4GCHG 3SU1A 4JYTA 3MFJA 4KTCA 1VJAU 6LPRA 3OTJE 3M36A 5GPIB 3OX7U 1GHAF 1CT0E 3KQ5A 4JZDH 3W94A 1C2LA 3GY6A 1UVPA 1NFXA 1EZXC 1FX0B 1ELAA 4LK4A 1NS3A 2BMGB 1SI5H 1GBHA 1KXFA 4B2CA 1F0TA 1FV9A 5C17A 1RFNA 1EZUC 1B7XB 2FTMA 4X1NU 1HDTH 1HJAB 2OBQA 4XBDA 4U01A 1OWIA 1ZMLA 3GY8A 4FVBA 1U6QA 1CHGA 1XX9A 4Y8ZA 3NPSA 1TX7A 4DJZB 4CRDA 2LP6A 4TSFD 4IS5A 3A82A 4CRFA 1H1BA 3MU8A 1TNIA 1EAWA 1ABIH 1OPHB 1O5CB 1UHBA 2V6NA 1QJ6B 3BEFB 4VGCB 1EB1H 1AZZA 4Y6DA 1SGYE 1EASA 1CT4E 1MABB 1EUFA 4F48B 1N6YA 1B5GH 2PSXA 2BHGA 2NU1E 1BT7A 1W0YH 4JK6A 1FQ3A 1V2QT 1GBFA 1NESE 4K69A 2J5UA 1C4Y2 2PKAB 1O2VA 4LXBH 4X6NA 5C67A 5F6MA 1GBIA 1L2EA 1OYQA 3TGIE 1XXDA 1Q31A 1MH0A 1MU6B 3RXOA 2P3FH 1A3EH 1O2PA 1O2HA 3HPTB 1UTLM 2BVXH 5A0AE 4DURA 1SGCA 3BEIB 1UK2A 1HJAC 2KFWA 4MLFB 2C3SA 2W7UA 4SGAE 2FIRH 2AGEX 4MG3A 3SU0A 1WQSA 1LKAA 3U8RH 3A7VA 1SLWB 1P9UA 1C1UH 2IN2A 1N1LA 3RXRA 5KECA 1ELTA 4F55A 1D3QB 2FX6A 3PRDA 3LGWA 2GCHG 1MTVA 1Y3UA 1O2KA 2A0QB 2Q6GA 2F83A 4VGCC 2A5IA 1SB1H 1ESBA 2FZZA 1SQTA 2CF8H 3FP6E 1GHBG 1BTUA 1A3BH 1E79D 3RXPA 4I8GA 3RMOH 4NFEA 3A8CA 1FPHH 1SGEE 2ZDVH 2PTCE 2AEIH 1YCPM 2Z3EA 1GBMA 1OWKA 2AIPA 3ELAH 5A8ZA 2BVSH 4TWYA 3LPRA 3ODDA 1EAXA 4B2BA 1C5VA 1O36A 1TYNA 1J9CH 4XBCA 1GJ4H 1YLDA 1O2WA 1SC8U 2BDHA 3RXTA 5C0UA 4X2VA 3SHAH 4TT3D 2BY8X 2EEKA 2YOLA 1DICA 4YO9A 4NWKA 2AMPA 3STIA 5B6LA 5JBTA 3TK6A 1TBQH 5I46H 1NROH 1SMFE 4F4OC 1V2OT 2FEQH 3ATIA 2ZEBA 3E3TA 2PUQH 1DSUA 3MYWA 3OEHD 2PLXA 3FKSD 3T62A 1O39A 1P9SA 3PO1B 1AUJA 2VWOA 2OXSA 4FU8A 1GGDB 4K2YA 1C2EA 3P8NA 5EXLA 1P3EA 2VIOA 5TCAA 3UY9A 1C2HA 3ZVEA 2OTVA 2QXIA 5EW2H 1P06A 2VB0A 4NG9H 1GVLA 1TMUH 1O5BB 3DCLA 3R0FA 4K3JA 2QN5T 4O03A 3V13A 1LDTT 3URCA 2ZU2A 1JRSA 2FTLE 4NSYA 1TE0A 2TIOA 2B5TB 4XFQA 1W7GH 1EATA 1O3NA 1PJPA 3SGQE 3BTGE 2OK5A 2IJD1 3DHKH 1HXEH 2ZGJA 1DFPA 2WSSD 2BQWB 3UUZA 4FOUC 1L1JA 2Q6FA 3A86A 2ILNA 1OP2A 1KXDA 1WYKA 3MOCA 2QXHA 3UFAA 3P8OA 2UWPA 1H4WA 3PO1C 1JMOH 1G37A 1Z8GA 3UPEA 2W3KA 1P2QA 2Y7XA 3S7KB 1GGDC 1MCVA 4UFGH 1H8HD 4UONA 1O5EH 5EPNA 1BTXA 3RM2H 2GT8A 1GCTB 3ENSB 2YNBA 1ZTLA 4Y76A 1GCDA 3SV7A 3H09A 1MBQA 2FPZA 3UQVA 1G3BA 3KYFA 5A8YA 6GCHF 5GCHF 3EA7A 1L4DA 1Y5UT 5C1UA 1ACBE 2O9QA 3RC6A 2KCYA 1BUIA 2FI5E 5A0CA 1BDAA 1V2VT 1A61H 1MQ6A 5IDKA 1HJ9A 3LJJA 1C1VH 5HIYA 4OS7A 1F5LA 1HAIH 3WW7A 1Q2WA 3ESTA 2O8LA 2CJIA 3FP7E 3GYLB 4I31A 2VIPA 1ANBA 1K1NA 4YZUA 4ZH8A 1THRH 2ZKSA 8LPRA 1C2DA 2ZPSA 3M7TA 1FDPA 4DCDA 1W7XH 1CGIE 4UFDH 1A5IA 1GCTC 4TPIZ 1ZHMA 2BVRH 3E16B 5EQQA 2A2QH 3STJA 3TNTA 5F03A 1XM1A 1XXFA 4Y0ZE 1GBBA 3GCHC 1UVOA 3RDZA 2VIWA 1QIXB 1TA2A 2I6SA 4B6FA 5ESTE 2XRCA 5DGJA 1DY9A 1JIRA 3GCTG 1XUFA 2XC4A 1A1RA 1F0RA 2BD2A 2O8TA 1MQ5A 1GMDG 2OBOA 4WWYA 4X6PA 5GJ4B 1MU8B 2QF0A 1BZXE 1WV7H 1P03A 1JXPA 5BRRE 1LPGB 4CBNA 1GBLA 4X8UH 4IMZA 3LU9B 1W12U 1SFQB 2DE8A 2ZCHP 1LVOA 4ASUD 1EAUA 2RG3A 7GCHF 5JYIA 1COWD 1ZJDA 4X1SU 1CHOF 4MVNA 1K1IA 2EQNA 1O5DH 2C4FH 2RDEA 3LGUA 4GHTA 3CENA 4ZXXH 4A1XA 2SGQE 3FP8E 4IBLH 3SU2A 4YXWD 1GI7B 1O32A 1ESAA 4F49A 2R0LA 3B9FH 2D1JA 1JWTA 3MMGA 2GCTB 1P2MA 4XOJA 1D9IA 3F6UH 2UUJB 1TBRH 1HLTH 1ZOMA 2BD8A 4FU9A 4D7FA 2HALA 1HXFH 4D9RA 1C1TA 4WMEA 2Z9KA 3QGNB 4AX9H 2A7HA 3RXGA 4YLUA 3ZZ3A 1V2ST 2ANWA 4NZQA 3SNBA 3MNSA 1V2UT 4MQAA 3ZZ7A 1C2FA 3UREA 1LKBA 4TPYA 1AVXA 1HIAA 1BJUA 1W11U 3QK1A 1K1LA 1AMHA 2SGPE 1KDQA 3ZVBA 5FAHA 4Y7BA 4A1VA 1P01A 1NZQH 5DK1A 1EXFA 1DPOA 3SBKA 3OFND 3VXEH 1QL9A 3PYHA 2NWNA 3EA9A 3F0PA 1ZR0A 1ZTJA 2Y81A 4GVUA 4Q7XA 3TK9A 1O3BA 2J92A 2GCTC 3EE0B 2JH6D 1WCZA 2J98A 3UAIC 1KIGH 1C9TA 2ZU3A 1VCQA 4LOYH 3PROA 1HNEE 4BAKB 2ANMH 1Z6JH 2Z3DA 4I32A 2BQ6B 4MPUA 3SV2H 1C1QA 1KXBA 1GHWH 5HGGA 4ABFA 1AZ8A 1O3AA 2ODYB 1YKTA 8GCHG 2HVYB 4KKDA 1OS8A 1VITG 5EJZA 2OD3B 4XSKU 3BTME 3KQCA 3ZIAD 1A7SA 1O2JA 2BTCE 2PFEA 1IQHA 4ZAEA 1YCPK 2YMSB 1VZQH 2BY6X 4K1SA 4GCHF 4K8BA 3LOXA 3LGIA 1FMGA 3MH7A 3P70B 3W1EA 4XE4A 1QL8A 3TH2H 1ZMNA 1UTKA 5LPRA 3E91A 2OP9A 4CHAB 2EI8A 4R0IA 1A0HB 3P95A 2XBXA 1G2MA 2UUFB 5JBBS 4IGDA 5J4QA 1UO6A 1ELCA 1AE5A 3EA8A 5GDSH 1UJ1A 5C0TA 1C1WH 1D3DB 1GI8B 2F4LA 4ABAA 5IK2D 1GBTA 5DP8A 3WY8A 1S85A 3LONA 5FBEA 4DT7B 4ABIA 1S0QA 3PMJA 2BM2A 1DX5M 1NBME 1VCWA 4MPWA 5EOKA 2HNTC 1RTLA 1P09A 2AMDA 3A81A 5SGAE 2TPIZ 1TONA 1GHZA 1A4WH 2BXTH 3AW0A 2YMSC 3TH4H 1EOJA 3RU4E 2ZO3H 4AFSA 3GDSA 1WBGB 2XXLA 1XUGA 1H9IE 2VWMA 4CRAA 1PQ5A 3I29A 4I8HA 5CHAB 2WHXA 3PTBA 1UMAH 2A31A 2QXGA 4YT7H 2XOKD 3FVFB 3MO3A 5DN6D 1H9HE 2ZHDA 4CHAC 2QCYA 5EIYA 4AORA 4NFFA 1O3IA 4ACAA 1O37A 2XBVA 1A46H 1V6DA 3KQDA 1G9IE 2P8OB 1XUKA 2Z9LA 3M7UA 2OQ5A 1AO5A 3U98H 1GI3A 1ZTKA 4BAOB 1E37B 4BTIB 4WH6A 2IPHA 3KEEA 2GCHF 1TALA 1O2RA 5CHBA 3DFJA 1QA7A 4X6MA 2M2AA 1QRZA 1LHCH 1ZHRA 2QAAA 1GHBF 3FO8D 1EOLA 1UCYK 2G81E 5CHAC 1DANH 3RXIA 2AMQA 3PV2A 2BD9A 2XNIA 2ZP0H 2FLBH 3T28A 1P0SH 4A7IB 1KMHB 1QJ7B 4HZHA 1Y3YA 1S83A 3F9GA 1MZAA 3AVZA 2ANKH 4DW2U 1CU1A 1Y8TA 3JZ2B 3A85A 4ZROA 1O2GH 2NU4E 2FI3E 2P8OC 3M37A 3RUOA 1O5AB 4WMFA 1EP5A 3SW2B 4YM9A 2ZI2H 4B76A 3EGKH 1QBOA 3RMLH 1MTUA 3ZZCA 1SFIA 4NCYA 3GY5A 2SFAA 1GG6B 1W14U 2ZQ2A 2FYQA 2P3TB 1TPSA 2BX3A 1GMHG 2PP6A 2A4OA 2G00A 3K6ZA 4JZEH 4NA8A 3GY2A 1DY8A 2ANYA 1YCPH 4RSPA 1P02A 1C2GA 2JH0D 1T8LA 5C5NA 3F9EA 2F9PA 4MTBA 4FVDA 1Z1IA 1ETRH 5DP9A 4ABEA 1RJXB 4NA7A 1YPKH 4KGAA 2Z9GA 1JIMA 2VH6A 1FY5A 3SI4H 3A8BA 1MD8A 3ATMA 3F1SB 1QTFA 1UTMA 2GT7A 1PYTC 2CK3D 2WPLS 5FL7D 3PMBB 2UWOA 2R3UA 1HB0B 3OSYA 4KTSA 1DWDH 1SLVB 1AVWA 1P10A 2G5VA 3VXFH 2J9NA 1FY8E 1BMAA 2HPPH 1S6FA 1AKSB 1P05A 4TY6A 3RLWH 5JBAS 1F92A 2W6ID 3BIVH 1H9LB 2KCOA 4H6SB 1D6WA 1NN6A 1GG6C 4D7GA 1YPLH 4X2WA 2B8OH 1GI0A 5C1XA 1GBEA 1VITH 5BPEA 5JB8S 4NIYA 2Y6TA 4CRCA 1DSTA 5FX6A 1G3EA 4AGJA 3TPIZ 3ATKA 2GZ9A 1C5LH 3QN7A 3LT3A 3TJNA 1ELBA 3M7QA 2XTTB 1T32A 2OC1A 1O2NA 2WYGA 3ITIA 3P8FA 1BMLA 4FXGH 3RXLA 1HGTH 2WPHS 3SJOA 1OWEA 3NXPA 3T2NA 2O8MA 4UDWH 1GDNA 5C20A 3BTKE 1XUHA 5L2YH 5A0BA 3WWFA 2VU8E 1HAGE 2WV5A 5JDUB 1RS0A 5GXPA 4FU7A 1ELGA 3SUEA 5HKKD 2OC0A 3TLOA 1Y5AT 3ZVAA 1FJSA 4YT6H 7LPRA 1O3DA 1EP6A 1K22H 1KLJH 4IN2A 1K1OA 1QFKH 3QZQA 3PB1E 1A0LA 3BTEE 1K1PA 2A32A 3LGTA 3RXMA 1K21H 1O3KA 1D6RA 1SGTA 2ZFRH 2ODPA 3A8DA 4RI0A 2EI7A 4X0WU 5DKMA 1ZGIA 5DP6A 5F8TA 3OAAD 5H4IB 1C5ZB 4AG2A 2H5DA 4O3UA 1C5UA 1GBKA 3DA9B 3TU7H 1O2YA 2BLVA 4INLA 4CREA 2VIDA 1UCYH 4BAHB 1F0UA 2WINI 4TWWA 4AGKA 3ZZ6A 1W3CA 5ABWA 3LDXH 3MQKC 4BAMB 3SYJA 3SGAE 1TRNA 4AZ2B 2WPDD 4KTUA 1HAHH 5FPSA 2OCVB 3GCTF 1O2MA 1GMDF 1O2QA 4Y71A 2TGTA 1C1RA 2WV4A 4ISHH 4E05H 1GJ9B 1PYTD 1XUIA 1AGJA 3RXEA 3A7WA 4PROA 4D76A 1EPTA 2R3YA 3MU5A 2PUXB 5DPAA 1TMBH 1J15A 3HATH 2RCEA 2H9EH 3V0XA 1IAUA 5LPEA 1ZPBA 1GHVH 1S82A 1AD8H 1XVOA 2R2WU 3D23A 4QT8C 2FOBA 5GNDA 3KL6A 4J1YA 4CRBA 3GICB 1EQ9A 2BYAX 4MNWA 4DGJA 3OEED 1BA8B 1YF4A 2AGGX 2HGTH 1VKYA 1HBTH 2KAIA 2Z9JA 4ZUHA 4X2YA 4YESB 3TJOA 5K0HA 2GGVB 1IQEA 3ZZDA 1QGFA 2K8IA 2VVUA 1QCPA 2ODQA 3KGPA 1O33A 1BMFD 1Z6EA 1O31A 2FOHA 2R9PA 5AFYH 3RMNH 4CRGA 5FPYA 1KYNA 5KEDA 2I6QA 3M35A 1OOKB 1TABE 5KGOA 1DUEA 3C1KA 1UTPA 1O3PB 2AGIX 3I77A 2KCAA 3NUMA 5T3HA 4ZHAA 1QBNA 1C1PA 2TGDA 1BTHH 5E0HA 1ETTH 3ZVGA 3I78A 4X1PU 5HIZA 1TPPA 2Y5FA 1TMTH 1GMCG 4ABDA 1O2ZA 3RMMH 1TNHA 3U1IB 1HPGA 1QQ4A 1AFEH 1SPJA 3TIUA 2H2ZA 2QGRA 4Y79A 1GBAA 2ZGCA 2A5KA 2EY4C 3IG6B 1AFQB 2OUAA 1IQIA 1PQAA 3U9AH 3DSGA 2UWLA 1ZLRA 2C90B 1HYLA 4BXWA 4E06H 2QYIA 2GX4A 1YGCH 3QGJA 2L6OA 3OU0A 3OYPA 3EE7A 3WWBA 3U1JB 8GCHF 2QV1A 3MWIU 1VITF 1SLXB 2VJ1A 1YPHC 2AYWA 2JETB 1GPZA 5T6DA 1LVMA 1OWHA 1W0ZU 4DIIH 3S9AA 1FN6A 2A7CA 1RRKA 3E1XB 2AIQA 4K1TA 1GJ6A 4Q4LA 3QO6A 2GP9B 3M5OA 1TFXA 5I25A 3S0NA 1IQJA 2Y7ZA 1SQAA 1Q3XA 4ZHLU 1C5MD 2VWLA 2FLRH 3BTTE 1AFQC 1NPMA 1W0KD 2W7SA 2FXRA 2P3UB 3BTFE 1ZRBA 3E90B 3DUXH 2A5AA 1FIWA 4GLYA 2LNCA 2G8TA 1O3EA 2VBCA 2BXUH 2XW9A 1HAVA 4I33A 3Q3KA 1TA6A 3F2GA 5E0GA 3C27B 3RXVA 3ZYEA 5FXLA 3H7TA 1ZSKA 3VB4A 1G32B 3QUMP 2ZU5A 1Z71A 1V2PT 3NRLA 1OSSA 4WH8A 3DSOA 1AU8A 1LPZB 1LPKB 2GV7A 2BLQA 3N7DA 3E0NB 4BAQB 2FMJA 2ZPRA 1UCYE 1AWFH 3F68H 1T31A 1GJ5H 2CHAB 1P2OA 3SQHE 3FAOA 3FZDA 2DE9A 1P57B 3KQBA 1G2LA 5A09A 1UK4A 3BF6H 1UHBB 3GS9A 1CSOE 1GJDB 3SGBE 3CS7A 3Q77A 4O3TA 5L30H 3EAJA 5AFZH 3GISB 4IN1A 4TYDA 1VCPA 2G4TA 3Q3XA 4IC6A 1JOUB 1MAXA 1NFUA 5FBIA 3BTDE 5G4BA 3UOUA 4D9QA 1HAOH 2GV6A 2B9LA 3SUFA 2LPRA 3KN2A 2UUYA 1C4V2 2F9BH 2GDDA 3VPKA 3PV4A 1YP9A 1C5PA 3SUDA 5LPFA 4ZKSU 4FUEA 3QLPH 1WTGH 1L0ZA 2CMYA 2F9VA 3VEQB 1OWJA 2F91A 1MKWK 3RXFA 9LPRA 2JDID 3ZZ8A 3A8AA 1TAWA 1NY22 4XD7D 5EQRA 3CP7A 3UQOA 3TNSA 1LHEH 3ODFA 1G30B 3P8GA 1C2IA 1E36B 1GVKB 2PV9B 2CHAC 1OWDA 2ZU4A 1W10U 5IYTA 2ZU1A 3RXKA 1LHGH 2Z7FE 2FOCA 3A7XA 3SJIA 3E6PH 5HYOA 3H5CB 4ZKRU 2H6MA 4Y0YE 3U8OH 7ESTE 3E0PB 2OQUA 4ABBA 1O2UA 2VINA 3SQEE 4DOQA 3UB0A 1NT1A 2NU2E 2RA3A 3SJ9A 2ZWLH 3PLPA 2R2MB 4R8TB 3AK5A 1O30A 4KP0A 2HLCA 1ETSH 2ZHEH 5GIBA 1QQUA 1HJ8A 2SGDE 3BEUA 2B7DH 5EGMA 4FETA 1GJBB 4DY7B 1A0JA 3CNRA 1T4VH 1MMJN 3D49H 1HAXB 1T7CA 1FONA 5J4SA 1NC6A 5LGOA 1KXCA 1HRTH 2XWBI 2ZG0H 1BRCE 5E2OA 1TQ7B 1JRTA 1GBDA 4AC9A 1GMHF 4CR5A 2XC5A 2BX4A 1O3FA 3PRBA 3Q00A 2C8XB 1T4UH 1BHXF 1O38A 4FUGA 1GDUA 1K28D 4I8KA 1QJ1B 1WOFA 3RC4A 5K7RA 1TNLA 2ESTE 3HK6B 2CN0H 1FN8A 2P94A 3QDZB 5FHTA 7KMEH 2VVCA 3UWJH 2H9HA 4RN6A 3DSPA 2C8ZB 2HLDD 3T29A 3M3VA 1ZPZA 3MU1A 3SNCA 1TGNA 1FZZA 1OP0A 4GHQA 4AYYB 2QE7D 1BTPA 2R0KA 1O3CA 1GHYH 1GI9B 2WPJS 4IMQA 1DXWA 2IPQX 3U69H 2OC7A 3SU5A 4MPVA 3SNEA 4I8LA 1RXPA 4Z0KA 3V3MA 1IQNA 2BDBA 1S81A 2H5CA 1DWBH 3LKWA 1SHHB 3RXDA 1PPGE 1FLEE 1QURH 2GVFA 2PKAA 3U8TH 4GAWA 4U32A 3M3SA 4WMDA 4HGCA 1V2TT 1F5RA 1AWHB 1FI8A 2BB4A 1TBZH 1P11E 1MKXK 4FUIA 1BRUP 1DT2A 3JZ1B 4JMYA 1KTTB 1O2SA 1ID5H 2ZQ1A 1CGJE 3IWMA 1K9OE 1ZYOA 2VIVA 1WQVH 2ZFSA 1BMMH 1NRRH 4ZCNA 4ISIH 4AFZA 4SGBE 4J2YB 4TY7A 1H8DH 4DIHH 1MKWH 1DXPA 2RFKC 4H42U 5CMXH 3FN8A 1THSH 4E7NA 4BTTB 3LC5A 4WJG2 1WUNH 2TGPZ 2PTNA 1Y3VA 3NK8A 3M5MA 1RIWB 5EPYA 2EI6A 4Q7YA 1BITA 3B23B 3BIUH 4IW4E 2CF9H 3RXHA 1P2IA 1SKYE 2BLOA 1AIXH 4B1TA 3GY7A 1QA0A 3UNSA 3L6PA 3SV8A 3TITA 1ELDE 3LC3A 4WY3A 3RXJA 3S9CA 1O3MA 1C5QA 2V3MA 3MO9A 4AN7A 1MUEB 2BY9X 2IOTA 4B2AA 5CE1A 1TNKA 2FDAA 3PMAB 1XKBC 2D8WA 1PFXC 4Y8YA 1TOMH 2B0FA 1CHOG 4RT1A 4ACBA 1SVPA 4AFUA 2FO9A 3L3TA 3A88A 4Q2KA 4THNH 2TGAA 1TB6H 1FXYA 1ANEA 1BJVA 4RKOB 3RXUA 3NZIA 1XUJA 2ALVA 3BV9B 2BDAA 4HI3A 3DD2H 1PQ7A 5T6FA 1GJ7B 3HKJB 4FUHA 5HMAA 1NFYA 1NBMD 3A87A 1CQQA 2QY0B 1K1JA 1AN1E 1RIWC 2UUKB 2SNVA 4BNRA 4X1RU 2GDEH 5TCCA 4H4FA 1NU7B 5C1YA 3RU4D 2PWXA 3ZZ5A 2ZDAH 4BTUB 4UFFH 3M3TA 1TGBA 4ZHMU 5LH8A 3SZEA 4E7RG 5DG6A 2WV9A 2IJOB 3UR6A 4YOJA 1O5GH 4IC5A 3G01A 2ZF0H 2BQ7B 1ABJH 1OKXA 1YY3A 1PPHE 2OC8A 3KHVA 3U28C 2ZDKA 1W8BH 5HM9A 2YNAA 5GWZA 2CV3A 1AVGH 2BY7X 2FODA 1EX3A 1E38B 1MTWA 1LVYA 1LO6A 1SGQE 3MHWU 2SGEE 3ZV9A 1ZSJA 5C2ZA 2G4UA 1SGNE 1V3XA 4NGAH 1LTOA 2ZA5A 1EKBB 1TPAE 2J38A 5F8ZA 4D8NA 1L1GA 4INKA 2G5NA 4K60A 1HIAB 4O97A 1T8OA 5L2ZH 1GMCF 1TNGA 1E1RD 4HG6A 1KDQB 1GL1A 1DDJA 3OY6U 1GL0E 2ZHFH 1C1SA 3SJ8A 1LQDB 1TRMA 1VR1H 2Z9IA 4DVAU 3A80A 2XNDD 2ZCLP 1TX8A 3S7HB 4OS4A 1MKXH 3NCLA 1GI1A 4CBOA 3RXSA 3UNRA 1CA8B 2C8YB 5E0JA 2J98B 3A83A 3OE7D 2W5EA 1DVAH 4JYVH 2AFQB 2SGFE 4ISLA 3ZZ9A 2XCNA 1CE5A 1L1NA 1GI4A 3FFGA 4WVPE 3ZYDA 1CBWB 4A1TA 1WAYB 1THPB 1TNJA 2QF3A 1SBWA 1O5FH 2WYJA 1P2NA 3FOAA 3N7OA 3ZVDA 5F8XA 1FPCH 1SSXA 1FY4A 1UVUH 1EZQA 2AERH 2ASUB 4XDEA 5DP5A 1S0RA 2A4RA 2ZC9H 4JZ1A 1O35A 2W3IA 2AH4X 2WUCA 4FUFA 5FX5A 1INCA 4UEHH 4MNVA 4I8JA 1BQYA 4XRNA 1KLTA 2L74A 1GJAB 1XKAC 3B8JA 1EJAA 1QNJA 3MTYA 2W26A 1NRNH 3O8DA 1QRWA 2WUBA 2Z6BD 1C1MA 1BTYA 3HGNA 1BMNH 3SV9A 2F3CE 4YOGA 3MNBA 1J16A 1UTOA 4ISNA 1C9PA 4Y7AA 3KCGH 3BN9A 3RLYH 6ESTA 2PGBB 3P92A 5AF9H 3BSQA 3RXQA 1BTZA 2ZGBH 3VB6A 1BB0B 1J14A 3KNXA 1CBWC 3SJKA 1V2LT 3DFLA 4HFPB 2ZFFH 1J17T 2STBE 2F43B 2Y5HA 4OGXA 1SGIB 4Y11E 3VGCB 1EJMA 1SLUB 4JK5A 1C5TA 3LGVA 1Y3XA 1N8OB 3RXBA 3VG8A 3TJVA 5L6NH 1K0HA 3KQEA 3SV6A 1AE8H 1BOQA 1C2KA 1EJNA 1QY6A 2D2DA 2XBWA 1P8VC 3HK3B 4X8TH 1YWUA 3LH1A 1J8AA 5DJ7A 1QRXA 1VGCB 3V7TA 1ELVA 2GTBA 3SU3A 3NWUA 1DITH 1CO7E 2P93A 2J4IA 1B0FA 4WXVA 4YLQH 2QXJA 3A7TA 2ZTXA 4UE7H 3MU0A 4JZIA 2K1QA 1BIOA 1LQEA 2Q1JA 3HGPA 2WPIS 1FY3A 1UTQA 2TRMA 5FCKA 3BG8A 1S6LA 4Y10E 1O0DH 4BANB 5EODA 4OS6A 1O34A
chains in the Genus database with same CATH topology
2V0BA 3DT0H 4NIVA 2HOBA 2OLGA 4O9VA 1F5KU 1TRYA 3VGCC 1YPMH 4A5TS 1DLKB 1N8OC 2ZFPH 2BOHB 3PMHB 4ISOA 2PKSB 1KY9A 2QIQA 4H6TA 1KLIH 2PR3A 3AAUA 5A8XA 1GBCA 1NRSH 4DG4A 3A7YA 1ZPCA 4OS5A 1VGCC 5JPMH 1SQOA 1T8MA 1TQ0B 3OY5U 2XCFA 5EG4A 1H8IH 4MNYA 1IQLA 3RP2A 3P6ZB 1V2WT 2FS8A 1O3LA 3ZVCA 5AHGH 3PM3A 2BDYA 5JB9S 3KF2A 1HAZB 3E8LA 1IQMA 4YTAA 1E35B 5FPTA 5JBCS 3FANA 1TPOA 3TH3H 1SGFG 5T6GA 3SZNA 1IQFA 1BBRH 5ETXA 1NFWA 3GCNA 2C8WB 1DLEA 1AY6H 1WU1A 3LH3A 8ESTE 4AYVB 5E2PA 3UWIA 2EA3A 2J34A 2OINA 4A92A 1O3GA 1P2KA 3VB5A 1GWAA 2PKSC 1DUAA 1YYY1 1FNIA 5DO4H 1O3OA 1PQ8A 1EB2A 1FUJA 3ZVFA 3RU4T 3D62A 1D3PB 5FCRA 1GHAG 2D26C 4GPGA 1OP8A 1F2SE 2A1DB 1SGPE 1V2NT 2ZDLA 4K1EA 3Q3YA 3UOPA 1EZSC 2HRVA 1ARCA 4OS2A 1C5OH 5C3NA 3O8RA 1C2JA 2JKHA 1SOTA 1K2I1 2A7JA 1UVTH 1QBVH 2Q6DA 1SGDE 1GBJA 1HCGA 2PHBA 4AOQA 4B73A 3BTHE 1IHTH 3D65E 1ESTA 1C2MA 1NM6A 2VGCB 3ATWA 2ZFQH 2BDGA 1ZZZA 2FOFA 4BXSA 1GHXH 2O8WA 4MDSA 2NU3E 3SUGA 9ESTA 4X8VH 2RA0A 2DUCA 3RXCA 3SOSA 1Y3WA 2P59A 1SGFA 3GCHB 4OS1A 2AS9A 1A5GH 1SR5C 2ALPA 3BG4B 3K65B 1GJCB 4HTCH 3ZZBA 5EW1H 4ESTE 3M5LA 2Z94A 4NA9H 1ZJKA 1LHDH 3IITA 1AB9B 1ELEE 3EYDA 1EAIA 4AB9A 2JETC 1VJ9U 5AVDA 1CA0B 2PW8H 3SHCH 2QC2A 3UNQA 2BZAA 2CGAA 1S84A 1P3CA 2F9UA 3K6YA 3S69A 3L33A 1YPHE 3SNAA 2H9TH 3UR9A 1QB6A 3SN8A 1KTSB 3ZZ4A 1YM0A 1MCTA 4K8YA 4FUJA 3A7ZA 2VGCC 1BHXB 2ZNKH 1O2OA 1M9UA 1SGRE 2GMTB 3M5NA 1WTHD 1AUTC 3GYMA 2STAE 1NU9A 1NRQH 5DP7A 3MNCA 2BY5X 1P12E 3BG4C 4INHA 3T25A 1O2XA 2FOAA 1ZGVA 2ZGXH 1GI6A 1K1MA 2V3HH 3MH5A 1OX1A 3A89A 3CS0A 1S5SA 4X8SH 1AB9C 1QL7A 1ANDA 3T27A 3PLBA 1ELFA 1UTNA 3TK5A 3PTNA 2ZPQA 1SHYA 4AB8A 1FAXA 1CA0C 1E34B 3SORA 1Z8RA 5DP4A 3BTWE 3ZV8A 1PPFE 2ZTYA 1DM4B 1LVBA 4FUBA 4MPXA 2A4GA 2HVXA 4AFQA 4B75A 4Q80A 4JZFH 2HPQH 1HUTH 4AG1A 3PWCA 5EQSA 2C93B 3TGKE 1XMNB 1C5XB 4UD9H 4UFEH 2GMTC 2F9NA 2FWWA 3PWBA 1X7AC 2J2UA 1C5SA 3O8BA 2RDLA 2XC0A 1YPJH 3P17H 3T26A 3EDXB 1S6HA 3LIWA 2V3OH 1RTFB 1TOCB 4I7YH 1N6XA 2EC9H 2PSYA 4FUCA 1PPEE 1EPTB 1F0SA 3AAVA 2FX4A 1KXAA 3K2UA 3QWCH 4U2WA 1LCYA 2BLWA 2WPKS 1Z8IB 3FZZA 1HV7A 1O2LA 2GD4B 3W95A 1BBRE 1L4ZA 1ZMJA 2VNTA 2Y82A 3UTUH 1P04A 1QR3E 4FUDA 4RKJB 1UVSH 3SU6A 2VIQA 2VWNA 2ULLA 1AKSA 4GSOA 1ZHPA 2XYAA 2ZFTA 2FI4E 2A4QA 3RXAA 6CHAB 2Y80A 2J95A 1Z1JA 4Z6AH 3MO6A 4A6LA 3AASA 2KAIB 5HXFA 1AHTH 1IQGA 1WSSH 2ZECA 2H1UA 4GUXA 1CGHA 1IHSH 5E8EH 1C5YB 1P2JA 3GOVB 4ZXYH 1EPTC 2WPMS 1C5NH 4ABHA 4NIXA 3SU4A 1PPBH 1CVWH 1W13U 2SNWA 4M7GA 1TX6A 2Z3CA 4CH8B 1DE7H 3MNXA 3QZRA 1DWEH 3LGYA 1ANCA 2FYRA 1GVZA 1LHFH 1YPGH 2ZHWH 1HAPH 3MI4A 4Q7ZA 1BRAA 4YOIA 1BRBE 6CHAC 2VVVA 1SG8B 1BCUH 1MTSA 3VB7A 5A2MH 4ZKOU 3MH6A 1YC0A 1PPCE 1LMWB 1MZDA 2JH5D 6GCHG 1IQKA 2FOMB 5GCHG 2GZ7A 3QTVH 2NU0E 4BOHA 1C5RA 4WF8A 3KIDU 3QTOH 1KXEA 1W2KH 2ZZUH 2SGAA 4XBBA 4ABJA 3F9HA 1RD3B 1A2CH 1DWCH 1G3CA 1GI2A 3GDVA 5DP3A 1NO9H 3GY3A 5PTPA 3S9BA 4JYUH 2FP7B 4MNXA 1TWXB 1UTJA 4NZLA 1PPZA 1F7ZA 4K5ZA 1FY1A 2G52A 4WXIA 2Y5GA 1V2MT 3EQ0H 1G36A 1TLDA 5HM2A 3TGJE 1DS2E 1OYTH 1IOEA 4LZ4B 4ZMAH 3URDA 4NWLA 1JBUH 3NKKA 1ZRKA 2FS9A 1C5WB 4X6OA 1FAKH 2XBYA 2TBSA 2O8UA 1OXGA 2ZDMA 2QA9E 4X2XA 3RC5A 2G51A 3AW1A 1RTKA 2ZTZA 4ZKNU 1MD7A 1HFDA 1NRPH 2BZ6H 2FESH 2VH0A 3V12A 5EXNA 1A5HA 2ZCKP 3A84A 5C5OA 2GKVE 1V2JT 2FOEA 1HAVB 3GDUA 1ARBA 1YLCA 2A2XH 1AI8H 1ZSLA 3T5FH 3O8CA 1Z8JB 1RGQA 7GCHG 1TIOA 2HNTE 1T8NA 1GI5A 2THFB 1AQ7A 2P95A 1MTNB 2HNTF 3H7OA 4CH2B 4B71A 1O3JA 3LJOA 3MH4A 1XVMA 4B74A 3BTQE 5EU8A 2P16A 1SL3A 8KME2 1DOJA 1C1OA 3ATLA 1CT2E 2ZDNA 1QB1A 1D4PB 4ABGA 1O3HA 2A45B 3F9FA 1NTPA 3M61U 1TGSZ 3PLKA 1YPEH 3Q76A 2F9OA 1FIZA 1C4U2 2FM2A 1UK3A 4OGYA 1D3TB 1GDQA 3HKIB 4X1QU 3VB3A 2BD3A 4NSVA 1SOZA 4Y8XA 1MAYA 3SO3A 1KSNA 4ASHA 1QHRB 1ORFA 1Z7KA 1O2IA 4CR9A 1MBMA 1MTNC 1B0EA 4JCNA 1BTWA 2V35A 5ESBA 1HAYB 2ZHQH 3QX5H 2J94A 1GJ8B 3GCOA 5TJXA 2CXVA 4U30A 2M5TA 3K9XB 2FOGA 2G55A 4KELA 2XWAA 1Y59T 3RM0H 2BD7A 3SI3H 3R3GB 1O2TA 4NIWA 3VFEA 5EXMA 2HWLB 1YBWA 3GY4A 2BD5A 3UIRA 4LZ1H 1V2RT 2PGQB 2ZGHA 1Y5BT 5B6OA 1C1NA 3ZZAA 1G3DA 1E0FD 3TVJB 1V2KT 2BDIA 2GZ8A 2ZIQH 2BDCA 2BOKA 3MU4A 2BD4A 3SNDA 1TGTA 1BBRK 3TJUA 1QB9A 1TGCA 4GCHG 3SU1A 4JYTA 3MFJA 4KTCA 1VJAU 6LPRA 3OTJE 3M36A 5GPIB 3OX7U 1GHAF 1CT0E 4JZDH 3W94A 1C2LA 3GY6A 1UVPA 1NFXA 1EZXC 1ELAA 4LK4A 1NS3A 2BMGB 1SI5H 1GBHA 1KXFA 4B2CA 1F0TA 1FV9A 1RFNA 1EZUC 1B7XB 2FTMA 4X1NU 1HDTH 1HJAB 2OBQA 4XBDA 4U01A 1OWIA 1ZMLA 3GY8A 4FVBA 1U6QA 1CHGA 1XX9A 4Y8ZA 3NPSA 1TX7A 4DJZB 4CRDA 4IS5A 3A82A 4CRFA 1H1BA 3MU8A 1TNIA 1EAWA 1ABIH 1OPHB 1O5CB 1UHBA 2V6NA 1QJ6B 3BEFB 4VGCB 1EB1H 1AZZA 4Y6DA 1SGYE 1EASA 1CT4E 1EUFA 1N6YA 1B5GH 2PSXA 2BHGA 2NU1E 1BT7A 1W0YH 4JK6A 1FQ3A 1V2QT 1GBFA 1NESE 4K69A 4X6NA 2PKAB 1C4Y2 1O2VA 4LXBH 5C67A 5F6MA 1GBIA 1L2EA 1OYQA 3TGIE 1XXDA 1Q31A 1MH0A 1MU6B 3RXOA 2P3FH 1A3EH 1O2PA 1O2HA 3HPTB 1UTLM 2BVXH 5A0AE 4DURA 1SGCA 3BEIB 1UK2A 1HJAC 4MLFB 2C3SA 2W7UA 4SGAE 2FIRH 2AGEX 4MG3A 3SU0A 1WQSA 1LKAA 3U8RH 3A7VA 1SLWB 1P9UA 1C1UH 2IN2A 1N1LA 3RXRA 1ELTA 1D3QB 2FX6A 3LGWA 2GCHG 1MTVA 1Y3UA 1O2KA 2A0QB 2Q6GA 2F83A 4VGCC 2A5IA 1SB1H 1ESBA 2FZZA 1SQTA 2CF8H 3FP6E 1GHBG 1BTUA 1A3BH 3RXPA 4I8GA 3RMOH 4NFEA 3A8CA 1FPHH 1SGEE 2ZDVH 2PTCE 2AEIH 1YCPM 2Z3EA 1GBMA 1OWKA 2AIPA 3ELAH 5A8ZA 2BVSH 4TWYA 3LPRA 3ODDA 1EAXA 4B2BA 1C5VA 1O36A 1TYNA 1J9CH 4XBCA 1GJ4H 1YLDA 1O2WA 1SC8U 2BDHA 3RXTA 4X2VA 3SHAH 2BY8X 2EEKA 2YOLA 1DICA 4YO9A 4NWKA 2AMPA 3STIA 5JBTA 3TK6A 1TBQH 5I46H 1NROH 1SMFE 4F4OC 1V2OT 2FEQH 3ATIA 2ZEBA 3E3TA 2PUQH 1DSUA 3MYWA 3T62A 2PLXA 1O39A 1P9SA 3PO1B 1AUJA 2VWOA 2OXSA 4FU8A 1GGDB 4K2YA 1C2EA 3P8NA 5EXLA 1P3EA 2VIOA 5TCAA 3UY9A 1C2HA 3ZVEA 2OTVA 2QXIA 5EW2H 1P06A 2VB0A 4NG9H 1GVLA 1TMUH 1O5BB 3R0FA 4K3JA 2QN5T 4O03A 3V13A 1LDTT 3URCA 2ZU2A 1JRSA 2FTLE 4NSYA 1TE0A 2TIOA 2B5TB 4XFQA 1W7GH 1EATA 1O3NA 1PJPA 3SGQE 3BTGE 3DHKH 1HXEH 2ZGJA 1DFPA 2BQWB 3UUZA 1L1JA 2Q6FA 3A86A 2ILNA 1OP2A 1KXDA 1WYKA 3MOCA 2QXHA 3UFAA 3P8OA 2UWPA 1H4WA 3PO1C 1JMOH 1G37A 1Z8GA 3UPEA 2W3KA 1P2QA 2Y7XA 3S7KB 1GGDC 1MCVA 4UFGH 4UONA 1O5EH 5EPNA 1BTXA 3RM2H 2GT8A 1GCTB 3ENSB 2YNBA 1ZTLA 4Y76A 1GCDA 3SV7A 1MBQA 2FPZA 3UQVA 1G3BA 5A8YA 6GCHF 5GCHF 3EA7A 1L4DA 1Y5UT 5C1UA 1ACBE 2O9QA 3RC6A 1BUIA 2FI5E 5A0CA 1BDAA 1V2VT 1A61H 1MQ6A 5IDKA 1HJ9A 3LJJA 1C1VH 4OS7A 1F5LA 1HAIH 1Q2WA 3ESTA 2O8LA 2CJIA 3FP7E 3GYLB 4I31A 2VIPA 1ANBA 1K1NA 4YZUA 4ZH8A 1THRH 2ZKSA 8LPRA 1C2DA 2ZPSA 3M7TA 1FDPA 4DCDA 1W7XH 1CGIE 4UFDH 1A5IA 1GCTC 4TPIZ 1ZHMA 2BVRH 3E16B 5EQQA 2A2QH 3STJA 3TNTA 5F03A 1XM1A 1XXFA 4Y0ZE 1GBBA 3GCHC 1UVOA 3RDZA 2VIWA 1QIXB 1TA2A 2I6SA 5ESTE 2XRCA 5DGJA 1DY9A 1JIRA 3GCTG 1XUFA 2XC4A 1A1RA 1F0RA 2BD2A 2O8TA 1MQ5A 2OBOA 1GMDG 4WWYA 4X6PA 5GJ4B 1MU8B 2QF0A 1BZXE 1WV7H 1P03A 1JXPA 5BRRE 1LPGB 4CBNA 1GBLA 4X8UH 4IMZA 3LU9B 1W12U 1SFQB 2DE8A 2ZCHP 1LVOA 1EAUA 2RG3A 7GCHF 5JYIA 1ZJDA 4X1SU 1CHOF 4MVNA 1K1IA 1O5DH 2C4FH 3LGUA 4GHTA 3CENA 4ZXXH 4A1XA 2SGQE 3FP8E 4IBLH 3SU2A 1GI7B 1O32A 1ESAA 4F49A 2R0LA 3B9FH 2D1JA 1JWTA 3MMGA 2GCTB 1P2MA 4XOJA 1D9IA 3F6UH 2UUJB 1TBRH 1HLTH 1ZOMA 2BD8A 4FU9A 4D7FA 2HALA 1HXFH 4D9RA 1C1TA 4WMEA 2Z9KA 3QGNB 4AX9H 2A7HA 3RXGA 4YLUA 3ZZ3A 1V2ST 2ANWA 4NZQA 3SNBA 3MNSA 1V2UT 4MQAA 3ZZ7A 1C2FA 3UREA 1LKBA 4TPYA 1AVXA 1HIAA 1BJUA 1W11U 3QK1A 1K1LA 1AMHA 2SGPE 1KDQA 3ZVBA 5FAHA 4Y7BA 4A1VA 1P01A 1NZQH 5DK1A 1EXFA 1DPOA 3SBKA 3VXEH 1QL9A 3PYHA 2NWNA 3EA9A 1ZR0A 1ZTJA 2Y81A 4GVUA 4Q7XA 3TK9A 1O3BA 2J92A 2GCTC 3EE0B 2JH6D 1WCZA 1KIGH 1C9TA 2ZU3A 1VCQA 4LOYH 3PROA 1HNEE 4BAKB 2ANMH 1Z6JH 2Z3DA 4I32A 2BQ6B 4MPUA 3SV2H 1C1QA 1KXBA 1GHWH 5HGGA 4ABFA 1AZ8A 1O3AA 2ODYB 1YKTA 8GCHG 4KKDA 1OS8A 1VITG 2OD3B 4XSKU 3BTME 3KQCA 1A7SA 1O2JA 2BTCE 2PFEA 1IQHA 4ZAEA 1YCPK 1VZQH 2BY6X 4K1SA 4GCHF 4K8BA 3LOXA 3LGIA 1FMGA 3MH7A 3P70B 4XE4A 1QL8A 3TH2H 1ZMNA 1UTKA 5LPRA 3E91A 2OP9A 4CHAB 2EI8A 4R0IA 1A0HB 3P95A 2XBXA 1G2MA 2UUFB 5JBBS 4IGDA 5J4QA 1UO6A 1ELCA 1AE5A 3EA8A 5GDSH 1UJ1A 1C1WH 1D3DB 1GI8B 4ABAA 1GBTA