3A84A

Crystal structure of trypsin complexed with(e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid (soaking 5 seconds)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a84A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a84A02
1Y5UT 1YCPM 1NRQH 1AUJA 4WXIA 1ZPCA 1DWBH 4MTBA 1HUTH 2GX4A 1O2SA 2FOFA 1TWXB 1YYY1 1A46H 4BANB 1ELCA 2O8UA 2ZHEH 3A83A 5JDUB 1EZQA 1JXPA 4X8SH 3GCHC 3RXUA 1ZSLA 1C9TA 1TBRH 3LDXH 1VITH 4RN6A 4CBNA 4D7GA 1PPGE 1V2QT 4I8HA 1GMCF 4TPYA 5GXPA 1GGDC 4A6LA 2ZKSA 4JZFH 2O8LA 5C20A 1O3EA 4KTUA 1JIMA 3V12A 4H42U 1AZZA 2QXGA 5E2OA 1GHBG 3V7TA 4B71A 2GMTC 3QGJA 5CHAC 2FYRA 4CHAB 4Y76A 1CA0B 4FU9A 1SC8U 1GI3A 4ZKNU 5GCHF 4AG1A 2GVFA 4HZHA 5T6GA 1F0RA 2CV3A 3BG8A 3MU4A 4Q2KA 3RXDA 3FVFB 2THFB 5E0JA 3FAOA 1VGCC 4DY7B 3O8DA 2A4QA 4E06H 2VIDA 2SNWA 1PYTC 1ZSKA 1ZPBA 1EPTC 1EZXC 1AD8H 2Q6FA 1SQOA 1C1SA 2G52A 1AQ7A 7KMEH 3PO1C 6GCHG 1SVPA 3SNAA 4A92A 1V2UT 2BYAX 1TQ0B 3BEFB 4XDEA 3UR6A 3ITIA 1E34B 2HGTH 3ZVDA 2ZGHA 1OWHA 1LVBA 2ZFRH 1YPLH 3IG6B 4AFSA 2OQUA 1NM6A 3TGIE 1V2RT 1A7SA 3QWCH 1FLEE 3KF2A 2PV9B 4BTIB 2ODYB 1GCTC 2VJ1A 3A7VA 5E0HA 5DP9A 3M5NA 4Y10E 1C5LH 3LGWA 1P8VC 2VWLA 2OQ5A 4Y0ZE 3ZVAA 2GD4B 3SQHE 2VINA 1HNEE 1Y59T 3PLBA 1O2JA 4AZ2B 1P2IA 1OX1A 1L0ZA 2P3TB 3FANA 3SUFA 3ZVGA 5FBIA 1ESBA 4K69A 3GY4A 3ZVBA 1U6QA 2Z3DA 2ZPRA 3SO3A 1C5QA 3S9BA 3MTYA 1SLVB 4AGJA 4AN7A 1DXPA 1Q2WA 1DPOA 2Z6BD 1O36A 4I33A 1V2WT 1NROH 1PJPA 4AGKA 4CRGA 5E8EH 1MKXK 2BLQA 1T8LA 8LPRA 4FUHA 1MH0A 1MMJN 1BMNH 1GHYH 4B74A 3LONA 1BA8B 1GBFA 1QR3E 2V0BA 1FY8E 1O39A 2BB4A 2ZIQH 4LZ1H 3TNTA 5C5OA 3M5MA 1QL8A 1DLKB 3UQVA 3TK6A 2WV4A 3PWCA 4RKOB 1TRMA 1C5SA 3O8RA 1GDQA 4AX9H 3QX5H 2GCTC 2G55A 3L3TA 5PTPA 1B0FA 4MPUA 3M5LA 1P2QA 1W13U 1AIXH 1YM0A 4K60A 4DG4A 1Q31A 2FI4E 5A0BA 4ZHLU 2OC7A 4H6SB 4ISLA 4UFEH 1A0LA 1C1UH 1K1IA 4GCHF 3RC5A 1BBRH 1THPB 3A8CA 2SGAA 8KME2 3EA9A 2Y6TA 1VITF 1O2MA 1HGTH 1L2EA 1F0TA 1DICA 3P8FA 4ISHH 1Z8JB 3A85A 3LGUA 2C8XB 2V3OH 2ZECA 1JRTA 2QAAA 4J2YB 3RXPA 1UVSH 1FZZA 1O2XA 1NZQH 2PSXA 1O2QA 1CGIE 4MPVA 2PKSC 1QHRB 1AN1E 4Y8YA 5EXMA 1AY6H 4NSYA 4FUJA 1GHAF 4JZIA 4WH8A 3VEQB 1EP6A 5LPEA 3GY8A 1QJ7B 4O9VA 1O2PA 4ABIA 3A7TA 5DP8A 1BTWA 1IQLA 1AHTH 3BG4C 5HM2A 3GCTF 2ZFQH 3RC4A 1ARCA 1DUAA 1BMAA 4FU8A 3RXRA 2CHAB 3ATWA 4K2YA 3PTNA 3LIWA 5TCCA 5LPFA 4UFFH 2OCVB 1P01A 1GBDA 3ZV8A 4K8BA 1Z71A 5C67A 4ZUHA 5J4QA 1HXFH 3BIVH 2TRMA 2R0KA 3E0NB 3EE0B 1A61H 1V2JT 3ZVCA 3ZZ3A 3ZV9A 4IMQA 3SU0A 5FPSA 2BTCE 3UWIA 1IQNA 1BUIA 1O3KA 2XC5A 1VR1H 1GMDG 1W0YH 4JYVH 1G36A 1YGCH 4X1NU 4FUIA 1O2ZA 1O5BB 1BHXB 1SGCA 3VGCC 2ODQA 1O37A 4GUXA 1BTYA 2B0FA 2BMGB 3OY6U 2XTTB 1P04A 3LGTA 2PUQH 1OOKB 2JKHA 1TNHA 2HALA 2D26C 2P95A 4ABHA 2YNBA 4B73A 4YLQH 3SV8A 1B5GH 2C90B 2XYAA 1ETSH 3UWJH 3S7HB 2FOEA 6LPRA 1UCYK 1TPOA 3Q3YA 1ZHPA 1GJBB 4ABJA 2A1DB 3UREA 2EEKA 3MNBA 2BDBA 2ULLA 1RIWC 4O3TA 1WU1A 1W7XH 2JH0D 1SFIA 1QCPA 1EKBB 3V13A 4Q7YA 1GBMA 1KXEA 1HAHH 3MMGA 2GCHF 1Z8RA 3E16B 3RXKA 3U1JB 3VXFH 1OWDA 1ZTLA 4NWKA 2ZDLA 2PHBA 3MO3A 1K1LA 2WV5A 3M7TA 2VVCA 1SGRE 1PPBH 2W3KA 1W10U 2KAIB 2BY5X 1A1RA 2R2WU 1HFDA 1BJVA 3RXTA 1CU1A 2XWBI 1XM1A 1QB6A 3G01A 3SI4H 4WWYA 4UE7H 1BRCE 1DSTA 1O3HA 3O8BA 1O30A 2J9NA 1SGYE 1V2TT 2SGFE 3U8TH 5AVDA 1GL1A 2ZFPH 1CBWB 1DDJA 1XUIA 1M9UA 1O5EH 2C93B 2A5AA 1DY8A 3BTEE 5EXLA 4DT7B 1DFPA 1PPCE 2BD5A 3A7YA 1O38A 1YPHE 4ZXXH 1MBQA 3TK5A 1NFWA 1QQUA 1P0SH 1W7GH 3B8JA 2BOHB 1D4PB 4ZHAA 2V6NA 1UK4A 3LGVA 4DCDA 3BTHE 3ZZ7A 1J16A 1HAGE 5G4BA 4TY6A 1DT2A 3A8AA 2DE9A 3RC6A 2C8WB 2ZDNA 2ZDAH 1K1OA 3RDZA 5JBCS 3TH3H 1GBLA 5DP6A 1AE8H 1GWAA 2WPKS 1CQQA 5IDKA 1GMHG 3SV2H 3SI3H 1TGNA 2HLCA 2PTCE 4K3JA 2HVXA 2Q6GA 2F9UA 2JH6D 2FM2A 1P3CA 4ESTE 3PLKA 1NFUA 4RKJB 4CH8B 1T31A 1S6FA 2Y5FA 4CRFA 2XW9A 1GG6C 2ZU3A 1CGJE 2NU3E 3KHVA 1UK2A 1ANDA 3P70B 1TONA 1NFXA 3BTQE 3U98H 2ZU2A 2Y5GA 1FAXA 4INKA 1NRSH 3GCOA 2OINA 1QL9A 4D76A 4ABGA 1HDTH 2VIPA 1LHEH 1QBVH 3MU8A 2PWXA 4OS2A 2RDLA 2JETB 1FI8A 3GOVB 3BTME 4NIXA 1SPJA 2IJOB 2Z3EA 4DJZB 1W12U 3NXPA 3OX7U 4HI3A 2BY6X 3D49H 1BQYA 1GI6A 3LU9B 1O3IA 1ZR0A 1UVOA 3F9EA 4OGYA 1DUEA 3OY5U 3TGJE 3FP6E 3UFAA 3AW1A 1MTSA 4UONA 1C2MA 3ZZ6A 4Y11E 3V3MA 4NG9H 2C8YB 1HLTH 2ZDVH 3FP7E 5HGGA 2ALPA 4INLA 4B2CA 4DGJA 1S83A 1GI2A 1K22H 1EOLA 4X2VA 2UUJB 4NZLA 3HKJB 4WXVA 1MUEB 3NPSA 4BAHB 3RXBA 3RXMA 1C1NA 2H6MA 3BTFE 1ELGA 2F9VA 4X1RU 3BN9A 4OS7A 4MNYA 3LH1A 1WYKA 4PROA 1Q3XA 1ELEE 2EI8A 4X2XA 1AFQB 1UO6A 3BEIB 4LZ4B 4NA9H 1F92A 3ATIA 3GYLB 4WJG2 4BAQB 3SUEA 2VIOA 2AMDA 2KAIA 1GBHA 2QIQA 1T4UH 4Z0KA 4JMYA 1WUNH 1EB1H 3ZZ9A 3W95A 1AI8H 1FONA 1SOTA 1D3PB 3RXIA 3RU4T 1MBMA 1H4WA 1HJ9A 5A8ZA 1IQJA 1JMOH 3T29A 3LOXA 1P11E 2FS9A 3T26A 1GI5A 3LC5A 4ABEA 1C1RA 1H9IE 1NU9A 1IAUA 1YF4A 2TGDA 1IQGA 1ZMNA 3RXGA 5L6NH 1ZGIA 1YCPK 1LHDH 1SQTA 3MH6A 1LVMA 2GTBA 3S69A 1SB1H 1MQ6A 2ZZUH 3OSYA 2H1UA 3SQEE 3P6ZB 1GHBF 1NRPH 1AVWA 1HAPH 1AU8A 1MKXH 2V35A 3NCLA 1NTPA 2IOTA 4ASHA 1C5OH 2BLVA 2QN5T 5HYOA 4WMEA 1O2LA 3FZZA 1QTFA 2ZF0H 1FQ3A 2P8OC 5EOKA 1J8AA 1P2JA 1PFXC 2G51A 2FS8A 3BV9B 1C4V2 4NZQA 1C5UA 2VGCC 3BTWE 2Y82A 1D3DB 2BX3A 7LPRA 1LTOA 4Y7BA 3M7UA 2WPHS 3KCGH 3BTDE 1IQIA 4FUBA 1BMMH 2LNCA 5HM9A 1FXYA 2STAE 5K0HA 2H9TH 2AIPA 1ZPZA 2FOAA 4INHA 3SHCH 1XVMA 5FXLA 1K1PA 1GJDB 3E91A 1XUGA 4BXSA 2G81E 1ZTJA 1UTOA 2ZCLP 3T27A 1F7ZA 1KLIH 2ODPA 2HNTF 3HK6B 4UD9H 1O3LA 2ZQ1A 3QO6A 1BBRE 1PQ7A 3EDXB 1KXAA 4UDWH 2AIQA 1HAOH 4U2WA 2PR3A 1IHTH 3NKKA 4ZHMU 1NY22 1TRYA 1TFXA 1O3NA 3QN7A 3UY9A 4GPGA 1W11U 1GI4A 1WTHD 4FVBA 2W7SA 1SHYA 1SLUB 2ZTYA 3BIUH 3SNBA 4CRDA 2SFAA 2RG3A 3F9GA 2UUFB 1QB9A 2ZU5A 1DS2E 1DVAH 2G4UA 2HPQH 5A0AE 1CGHA 4NFEA 4MPWA 4BTTB 1TQ7B 1O3CA 1O5AB 2PTNA 4AYVB 4A1XA 1Y3WA 2EI7A 3SJ8A 5C1XA 2ZI2H 2QA9E 3K9XB 3Q77A 4U01A 4FXGH 2A5IA 3QZQA 1QIXB 2VWOA 1GPZA 5JPMH 4XBBA 1GI0A 1QBOA 1DLEA 2BDCA 3TH2H 2OP9A 2PLXA 3T25A 1N8OB 2UWPA 1O3JA 2VIQA 1X7AC 4AORA 1XXDA 4ISNA 1C5ZB 4AB9A 1OSSA 1XMNB 4A1TA 3SBKA 4ABDA 2J4IA 4X6OA 1TYNA 4FUCA 4BAOB 1GBBA 1S85A 1DITH 4R8TB 1TB6H 3MU1A 2P16A 1GI8B 1LHFH 1SSXA 2FWWA 1BZXE 2F9BH 5JB9S 2STBE 1LDTT 4OS4A 1GI7B 4AG2A 1C5PA 2K1QA 2ZCHP 3I78A 4BTUB 1O2UA 3ZYEA 4VGCC 2FTLE 2GZ9A 3ATLA 5SGAE 2H2ZA 1XUHA 4I8JA 4ABBA 4X8TH 1GI1A 4WY3A 3EAJA 1PQ5A 1ZHRA 3CENA 3RXOA 1NO9H 2ZA5A 4YTAA 1UCYH 3T28A 1Y3VA 2FI5E 3OTJE 3U8OH 1DWDH 2XNIA 2QXHA 1GGDB 2BVRH 1CO7E 3PTBA 4F49A 3CS7A 2AMPA 1SGEE 1RS0A 1TALA 1ZRKA 1FNIA 2Z9GA 4TY7A 1AMHA 5EQRA 2FOBA 1CT0E 3KEEA 4DURA 1V2NT 1BTZA 1LCYA 2TGTA 5CHAB 2GDDA 1SGDE 5LGOA 2BVSH 1GDUA 1EJAA 4Y6DA 1KXDA 4NIYA 2FOMB 3DFJA 2OBOA 3C1KA 4ZMAH 3SV9A 5ESBA 3A89A 1Z7KA 2WUBA 4MNWA 1OP0A 1TRNA 3T62A 1QRZA 3STIA 3EYDA 1NN6A 1VGCB 4E7NA 2V3HH 1G2MA 4OS5A 1LO6A 3KQBA 1C2IA 1NESE 1GHXH 1F0SA 3FFGA 1PQAA 3SU6A 4IS5A 4YM9A 1EPTB 1DSUA 1D6WA 2AGGX 1GBKA 3TJNA 3PM3A 1P12E 2ZFFH 1MTUA 2VIWA 1EUFA 3RP2A 3HGNA 1GJ9B 1SR5C 1YC0A 1N1LA 2ANMH 5F6MA 4IW4E 2XWAA 4Y79A 2ZFTA 3RMOH 4DIIH 4XSKU 1BCUH 4A1VA 1GMDF 1TGCA 3FP8E 1K28D 2D8WA 1AE5A 4XBDA 2YOLA 4XOJA 1KTTB 3H5CB 1A3EH 4ZXYH 1BHXF 4WH6A 3A80A 2P93A 1FJSA 1GBCA 1JIRA 3P92A 1HCGA 6ESTA 3LGYA 3KQDA 4CR9A 3R3GB 5LH8A 1YPHC 1GCTB 2D2DA 3H7OA 3VB7A 5C5NA 1LVYA 3GDVA 1H8DH 1Z1IA 4MNVA 3ZZ4A 2BVXH 1GBEA 1O2RA 1RTFB 2HNTE 3M61U 1MTNC 4FU7A 2PSYA 2F9NA 3SJIA 2ZPSA 2A4OA 3LJJA 1C2KA 2ZO3H 3ZZCA 3GCNA 3M5OA 1GVKB 5GJ4B 3TITA 4Y71A 2VH6A 4BAKB 1L1NA 3BTKE 1GJAB 1ELTA 2VU8E 4LOYH 2Z9JA 3URDA 1L1JA 1YLCA 4KELA 1LKAA 4X8UH 1SI5H 2AEIH 5HXFA 4GLYA 1YPMH 4CR5A 1ACBE 3SU5A 4SGAE 1MTVA 3PB1E 2BQWB 4NCYA 3MNCA 2A31A 1QURH 3LC3A 1QRXA 3KQEA 3ZYDA 1ELFA 2FOGA 2AGIX 4X8VH 4BAMB 1XUKA 1EQ9A 2GCTB 3RUOA 1A0HB 2CMYA 4DVAU 1O2HA 3PROA 2J34A 1NU7B 1GJCB 1DE7H 1OYQA 2W26A 3F6UH 3ZZ8A 3WY8A 3SN8A 1ZLRA 2XBVA 1O3GA 1LQEA 2BDAA 2XCNA 1SBWA 4K1EA 1HYLA 1C2HA 5JBBS 2VVVA 4X6PA 1QBNA 1V2MT 4Y7AA 2QF0A 3ZZBA 4K5ZA 3MOCA 1C1TA 1GMHF 1LHCH 5DGJA 1C5MD 5TCAA 2BOKA 1V2ST 1DM4B 4MG3A 2AMQA 3SV6A 2PKSB 3GYMA 3RXEA 5EW2H 2EI6A 4NA8A 5FBEA 4DOQA 3PMHB 3NUMA 1P2KA 2A4RA 1KLJH 1EJMA 3PMBB 3FZDA 1EPTA 1FUJA 1KIGH 3RMLH 1GHZA 1VITG 1THSH 1B0EA 5F8ZA 1DWEH 4MDSA 2XC4A 3QTVH 3ATKA 3BG4B 2FYQA 1V2OT 2SGDE 2ZHQH 3AAUA 3TU7H 5C2ZA 4GHTA 3B23B 1KSNA 1O3BA 2FOHA 2O8TA 2Y5HA 3K6YA 3JZ1B 3MHWU 3LGIA 2SGQE 2QXJA 1O3AA 1GVZA 2FXRA 1WQSA 1ORFA 8GCHG 1GHAG 1C5VA 1F5RA 4MLFB 2SGEE 2ZU4A 4KGAA 3E0PB 1WAYB 2HRVA 1T8OA 1C2GA 3SUDA 1QJ6B 2J94A 3QLPH 1XKBC 1PPEE 1S0RA 3GDUA 2C3SA 5EG4A 3MO9A 1FV9A 2AGEX 2ZFSA 2FTMA 1ANCA 2BDYA 3VGCB 2HWLB 3KN2A 1SGTA 3MH5A 1ARBA 1SG8B 2BZ6H 2CXVA 1GJ7B 1Y5AT 1BTXA 1ZMLA 1AUTC 1UVTH 3UOUA 1THRH 4JK5A 1IQEA 1ZMJA 5AF9H 3NZIA 2WYJA 3F1SB 4MQAA 4ISIH 1ZRBA 4JYTA 1WTGH 3F9FA 4FUFA 3RXCA 3MNSA 1HIAB 1UMAH 2GDEH 3Q00A 5ESTE 7GCHF 3UR9A 3BSQA 3A84A 4B76A 5DP7A 4IN2A 4BOHA 1ZYOA 5JYIA 4NWLA 1OYTH 2P3UB 2F9PA 1VZQH 4NGAH 1RIWB 5EQSA 5FPYA 1O33A 3RXFA 2BY7X 4D8NA 1EJNA 5DO4H 1HAVB 3DHKH 1MU6B 1V2KT 1P3EA 1BDAA 1YBWA 4YO9A 2QCYA 1AB9C 1C9PA 5EPYA 3UIRA 2ZHDA 1ZOMA 2Y80A 1BBRK 4WVPE 1O2GH 1ID5H 5FAHA 1HAZB 1RTKA 1OKXA 1S81A 2OC8A 1E38B 3B9FH 1W8BH 2B7DH 5E0GA 2I6QA 4I32A 3CP7A 1ABJH 1L4ZA 1A0JA 2DUCA 2Z9KA 1UTNA 1O5DH 3QK1A 3C27B 4JCNA 1TNJA 2FDAA 1G3DA 3D65E 2WPLS 3MH4A 5JB8S 2VB0A 2AERH 1GHVH 4U30A 4ABFA 1MU8B 5FCRA 3RM2H 3VB6A 2SNVA 1P06A 1RXPA 1DOJA 3SUGA 5FX5A 1CHGA 1XVOA 2ZGCA 5JBAS 3TLOA 2Z9LA 2R3UA 1ELAA 1TIOA 2QY0B 3TH4H 1W2KH 1BIOA 4MPXA 1FIZA 5T6FA 1PPFE 1MD7A 1WOFA 3NK8A 1KDQA 2GZ7A 1WQVH 3SGBE 3SNDA 5JBTA 1OWJA 3MU5A 5F8TA 1BTUA 3MU0A 2I6SA 3DD2H 1TNKA 1P2MA 3ELAH 2J2UA 5FHTA 3GDSA 1HJAC 3HGPA 2FX4A 2G00A 2HPPH 5FX6A 3MWIU 3EGKH 1RGQA 4DIHH 4TYDA 4YOJA 2BLWA 4H6TA 1GBJA 3PWBA 2FESH 1TBZH 1LHGH 1YPKH 4FVDA 3ZZDA 5E2PA 1UCYE 3SZNA 3PV4A 1J17T 1O2NA 3AAVA 1ESAA 2BD7A 1V2PT 4A7IB 1V2LT 1C1MA 2VWMA 1FY4A 3E1XB 4X1PU 4H4FA 1UTKA 2RA0A 1AKSB 2FO9A 4B1TA 3SU3A 2GKVE 1HJ8A 3ATMA 1UVUH 2GV6A 3LT3A 5ABWA 2PFEA 4D7FA 4Q7XA 4KKDA 1MCVA 3F9HA 1UVPA 1CT2E 2BXTH 3BTGE 2Y7XA 1Z8GA 5IYTA 2AYWA 1O3PB 3SNCA 2D1JA 1GJ6A 4I8KA 1HIAA 1OP8A 4GSOA 4JZDH 4K1SA 2GT8A 3M3VA 1TA2A 2W7UA 1DWCH 3DUXH 2QV1A 1P05A 1YPJH 1C2FA 1SQAA 1K1MA 3STJA 2GGVB 1Y3YA 4CHAC 4YZUA 3RXAA 1HAVA 1G30B 2ANKH 2HOBA 3RLYH 1CA0C 6GCHF 3RXVA 4YT6H 1CT4E 1G3EA 1N6YA 2ASUB 4ZROA 2BD9A 3U69H 1TX8A 2ZHWH 1LMWB 2EA3A 2PKAB 2TPIZ 1TGSZ 2UWOA 3Q76A 3QDZB 5EU8A 1A5HA 1GI9B 2XBXA 1RD3B 1GVLA 3P95A 3RU4D 1O5GH 5A09A 4NFFA 1KLTA 2WINI 2Y81A 1NPMA 3SOSA 1OS8A 5CMXH 1ZHMA 1BTPA 5EPNA 3QZRA 2A45B 3A82A 4E7RG 3RXSA 2IN2A 1NC6A 2BD2A 1YKTA 1TABE 4E05H 3SW2B 4GHQA 2UWLA 2UUYA 2HNTC 1ZJKA 6CHAB 2RA3A 5L2YH 1EZUC 5F03A 3UUZA 4MNXA 1P9SA 1QA7A 4YOGA 4OGXA 4B75A 1ANEA 2Z7FE 4JYUH 3PLPA 1EB2A 4IC5A 3TPIZ 2B8OH 4LXBH 3TJUA 5HMAA 2P8OB 1ETRH 1LKBA 2A7JA 2ALVA 1H9HE 1MKWK 2BDIA 1UJ1A 5I25A 3P8GA 2G5VA 2ZGXH 2VGCB 1GBTA 3QTOH 1DX5M 3HK3B 1SGNE 2UUKB 3ODDA 1O2WA 1KXBA 3GY3A 5A2MH 4X6NA 4AYYB 2A2QH 1MAYA 5CE1A 1WV7H 2NU4E 1YLDA 1GBAA 1FMGA 2ZP0H 1XKAC 2W5EA 2OD3B 1CHOG 3K2UA 4HTCH 1AFEH 3AVZA 3V0XA 3U1IB 5DK1A 1NRRH 2NU1E 3RMMH 3R0FA 2BY9X 3E3TA 1AGJA 2ZCKP 1UTMA 3S9AA 1K1JA 1IHSH 1SHHB 2R2MB 1AKSA 1A2CH 1QL7A 1AWHB 2O9QA 1SMFE 2FMJA 2AFQB 4TWWA 2ZG0H 1F5LA 5T3HA 3O8CA 1RFNA 1TA6A 3P8OA 1D3TB 5B6OA 1ESTA 1L1GA 2RCEA 2QC2A 2FZZA 1W14U 2H9HA 3GCHB 3QGNB 2VVUA 1LPKB 2CJIA 2FPZA 2G8TA 1VJAU 1GJ4H 1O5FH 1QNJA 3NWUA 1L4DA 1S5SA 2BD4A 4D9RA 4SGBE 3VB3A 1HAXB 1TPPA 2B9LA 1S84A 2PUXB 1XUJA 1GL0E 4U32A 1LVOA 5FCKA 2GMTB 1P9UA 2ZNKH 2TBSA 3AW0A 3HPTB 2AS9A 3ZVFA 4D9QA 1MZAA 4ZKRU 1C5RA 1SGFG 3ZVEA 1A4WH 4AFUA 2LPRA 4NIVA 4UFDH 1GMCG 3MH7A 1A5GH 2PKAA 1P10A 1IQMA 1C4Y2 1GJ8B 1C5WB 1QY6A 4R0IA 1BMLA 1OXGA 2F9OA 1BRAA 2BDGA 1YPGH 1EX3A 1RRKA 1Y8TA 1LPZB 4HGCA 2B5TB 2F3CE 5AFYH 1QRWA 2GP9B 1OWEA 4RSPA 1EASA 2Z94A 4WMFA 3AASA 1QQ4A 1O34A 2H5CA 2ZEBA 2G5NA 3A7XA 2BZAA 3PO1B 3SGAE 1EAWA 3M3SA 1O31A 1C2JA 1SGPE 2OTVA 2BLOA 5GCHG 1C1OA 3RXQA 1G3BA 1VCWA 1FDPA 1SGQE 2CHAC 3MO6A 5DJ7A 2FLRH 3SJKA 1E36B 2OBQA 3BTTE 4J1YA 4UFGH 2C4FH 3P8NA 3U9AH 4VGCB 1KXCA 3KIDU 3SU1A 2O8MA 2XBYA 3KGPA 5DKMA 4THNH 5GIBA 1ZGVA 3LH3A 1FPHH 5GDSH 1P03A 2C8ZB 2ILNA 1HV7A 3VB5A 3GY2A 1TX6A 5TJXA 2F91A 4B2BA 2GT7A 1EATA 1PPZA 4WF8A 1AO5A 1EAUA 3TJVA 1UTLM 1KTSB 2ANWA 3EA8A 1CE5A 2BXUH 1Y5BT 1TPAE 1Z8IB 1MTWA 1AVXA 4Q7ZA 4Y8XA 3I29A 4FUEA 4QT8C 1LQDB 5A8XA 1CSOE 4X0WU 1C5NH 1AZ8A 1UTQA 3QUMP 4X6MA 1A5IA 1DANH 1DY9A 3GY7A 4FUGA 4X1SU 1H9LB 1KXFA 3SHAH 2NU2E 4O03A 1C1WH 1EAXA 2QXIA 2ZPQA 1IQHA 5BRRE 3TJOA 5LPRA 4KTCA 3RMNH 1UTPA 3S7KB 1EAIA 2OC1A 2J92A 3L33A 1SL3A 1SGIB 1WBGB 5C3NA 1E37B 3VPKA 1RJXB 2M5TA 2BD8A 2BD3A 4BXWA 1TBQH 2FODA 1FY3A 3MI4A 4M7GA 1K1NA 2PGQB 2ZQ2A 3S0NA 4X2YA 5K7RA 2WPJS 8GCHF 2TIOA 1V6DA 1O2TA 3UTUH 1C1QA 1EXFA 3A86A 2FI3E 4X1QU 3SJ9A 3M37A 4AFZA 1BRBE 2XCFA 3SNEA 1B7XB 1F0UA 1N6XA 3LKWA 1C2LA 1Z1JA 1G37A 1PQ8A 1ELBA 4XFQA 2P59A 4BNRA 1ZJDA 1TOMH 1HRTH 2ZGJA 4CRCA 1QJ1B 4MVNA 4DW2U 1G2LA 1AVGH 1T7CA 2ZHFH 1P57B 4XBCA 3DT0H 1FPCH 4I31A 1C4U2 1Z6JH 2ESTE 1FAKH 1UHBB 2NWNA 3H7TA 3SJOA 3SV7A 1HBTH 2OXSA 3MFJA 4I7YH 1CBWC 1PPHE 1SGFA 2WPIS 3Q3XA 3SU2A 2WYGA 1MTNB 2CN0H 4NSVA 5I46H 1BT7A 1MAXA 3D62A 2A32A 1W0ZU 3M3TA 5ETXA 1IQKA 1C5TA 2TGPZ 1O32A 2R3YA 3A88A 3KNXA 4OS1A 5BPEA 3HATH 5T6DA 1BRUP 1Z6EA 1V3XA 4IN1A 4NA7A 3T2NA 1DXWA 4GCHG 1KDQB 4JZ1A 3RXHA 1S0QA 2A7CA 2EC9H 2BQ7B 3RXJA 1T8NA 1YCPH 1JOUB 1KY9A 3LPRA 2VIVA 3RM0H 2PW8H 1HAIH 1TMUH 3RXLA 1K21H 4CBOA 1P02A 4FUDA 3LJOA 3SGQE 2XC0A 3ESTA 2QGRA 2QYIA 2A5KA 5DG6A 3GY6A 1OWIA 2ZWLH 3ENSB 4GVUA 3K65B 1S82A 2YNAA 3KL6A 5EQQA 1OPHB 1P2NA 1BOQA 2ANYA 3BEUA 5EGMA 2CF9H 1ELVA 2NU0E 5AFZH 3GCTG 1NRNH 3OYPA 3TGKE 1IQFA 1C5YB 1C5XB 1NT1A 3K6ZA 2WPMS 2GV7A 3TIUA 4Z6AH 1HB0B 5L2ZH 4OS6A 1EZSC 2H9EH 4LK4A 1YP9A 1O2KA 3M36A 1TE0A 1TX7A 2A7HA 2JETC 1Y3XA 2Q1JA 1PYTD 4TPIZ 3TK9A 1W3CA 1O2YA 2DE8A 2BDHA 3M7QA 3PMAB 4A5TS 3A8DA 2VWNA 3M35A 3UNQA 1IOEA 5C1YA 1SLXB 1HAYB 4ZKSU 5J4SA 1G9IE 1C2EA 1TNGA 1WCZA 3A7ZA 2QF3A 3GISB 4IBLH 2BQ6B 2BM2A 2GZ8A 3L6PA 3P17H 4XE4A 1G32B 2R0LA 2FOCA 4X2WA 5DP3A 1TMBH 1UTJA 5A0CA 1E0FD 4AOQA 2Q6DA 1FY5A 1JBUH 3VXEH 2A4GA 4IMZA 1J15A 3UPEA 5EW1H 4Y8ZA 3U8RH 1AFQC 1GCDA 2BHGA 1D3QB 2XRCA 1JWTA 3E90B 1O35A 5DPAA 1C1VH 1SLWB 1QGFA 1EP5A 1HXEH 3SORA 2IPHA 2J95A 1O3OA 1J14A 1O2VA 1MCTA 3UOPA 1MKWH 4HFPB 1UK3A 2Z9IA 1TMTH 1SOZA 1BJUA 2A2XH 3SU4A 4AB8A 2GCHG 4F4OC 1UHBA 4ZH8A 3HKIB 2FP7B 4CREA 2CF8H 1HPGA 4K8YA 3GY5A 1QFKH 4UEHH 5FPTA 1P2OA 3A81A 1O2IA 1T8MA 1GDNA 3W94A 4ZKOU 3MNXA 1TPSA 5DP5A 2VNTA 3ODFA 1TGTA 2OUAA 1BTHH 1WSSH 4I8GA 5A8YA 3BF6H 1TGBA 2ZU1A 1ZTKA 1QA0A 3D23A 1FN8A 2JH5D 1INCA 3UNRA 1TNIA 1H1BA 3UQOA 2BY8X 1MQ5A 2ZDMA 3DFLA 4IC6A 1F5KU 2F83A 1Y3UA 3S9CA 3RU4E 2Z3CA 1BB0B 2OC0A 3T5FH 2FIRH 3RLWH 9LPRA 3Q3KA 1KYNA 3IITA 1D9IA 1BITA 2FX6A 3OU0A 3JZ2B 2ZTXA 1MD8A 1SFQB 1TNLA 3PYHA 1CA8B 2SGPE 3A8BA 4YLUA 1GG6B 1AB9B 4O3UA 4Q80A 1GBIA 7GCHG 4YESB 4I8LA 2P94A 3VB4A 1XXFA 4O97A 5AHGH 1FN6A 3CS0A 2O8WA 3ZZAA 4YT7H 2VH0A 3VFEA 1O5CB 4ABAA 4GAWA 3GICB 4K1TA 1O3MA 4KP0A 1G3CA 4ZAEA 2XXLA 3E8LA 3EA7A 1VCQA 1O3FA 5GPIB 2ZDKA 3TVJB 3I77A 1RTLA 1C1PA 1H8IH 4CRBA 2A0QB 1C2DA 2BX4A 1FIWA 3KQCA 1ZSJA 4TWYA 1O3DA 5H4IB 3MYWA 3N7OA 3F68H 5EODA 1ABIH 1FY1A 3EQ0H 3TNSA 1TOCB 4CRAA 3DA9B 6CHAC 3UNSA 5EXNA 2ZTZA 1J9CH 4ISOA 2OLGA 1GHWH 2G4TA 1LPGB 3PMJA 2Y7ZA 5L30H 1NFYA 1ELDE 1OP2A 3E6PH 4B2AA 3A7WA 2PGBB 9ESTA 1CHOF 1JRSA 1YPEH 1ETTH 4Y0YE 1A3BH 8ESTE 1D6RA 1EOJA 1NS3A 1VJ9U 4YOIA 1T4VH 4IGDA 2FLBH 4KTSA 1N8OC 4CH2B 2P3FH 1P09A 2FEQH 5GWZA 1O2OA 1CVWH 1HJAB 2H5DA 2ZC9H 5DP4A 3URCA 1QB1A 5F8XA 1O0DH 1ANBA 2R9PA 1AWFH 2WUCA 3A87A 4WMDA 3ZZ5A 1K2I1 1ZZZA 2XBWA 1TAWA 1K9OE 2TGAA 1OWKA 1XUFA 2AH4X 4JK6A 3IWMA 4AFQA 1V2VT 5C1UA 1S6HA 1T32A 7ESTE 2CGAA 4NIWA 1MZDA 1VCPA 2J38A 1TLDA 1XX9A 2ZGBH 1F2SE 1GJ5H 2W3IA 1E35B 4JZEH
chains in the Genus database with same CATH superfamily
1Y5UT 1YCPM 1NRQH 3OAAD 1AUJA 4WXIA 1ZPCA 1DWBH 4MTBA 1HUTH 2GX4A 1O2SA 2FOFA 1TWXB 1YYY1 1A46H 4BANB 1ELCA 2O8UA 2ZHEH 3A83A 5JDUB 1EZQA 1JXPA 4X8SH 3GCHC 3RXUA 2AHME 1ZSLA 1C9TA 1TBRH 3LDXH 1VITH 4RN6A 4CBNA 4D7GA 1PPGE 1V2QT 4I8HA 1GMCF 3ZIAD 2K8IA 2QE7D 4TPYA 5GXPA 1GGDC 4A6LA 2ZKSA 4JZFH 2O8LA 5C20A 1O3EA 4KTUA 2JIZD 1JIMA 3V12A 4H42U 1AZZA 2QXGA 5E2OA 4YXWD 1GHBG 3V7TA 4B71A 2GMTC 3QGJA 5CHAC 2FYRA 4CHAB 4Y76A 4B6EA 1CA0B 4FU9A 1SC8U 1GI3A 4ZKNU 5GCHF 1K0HA 4AG1A 2GVFA 4HZHA 5T6GA 1F0RA 2CV3A 3BG8A 1SQRA 3MU4A 4Q2KA 3RXDA 2W6ID 3FVFB 2THFB 5E0JA 3FAOA 1VGCC 4DY7B 3O8DA 2A4QA 4E06H 2VIDA 2SNWA 1PYTC 1ZSKA 1ZPBA 1EPTC 1EZXC 1AD8H 2Q6FA 2RFKC 1SQOA 1C1SA 2G52A 1AQ7A 7KMEH 3PO1C 6GCHG 1SVPA 2LP6A 3SNAA 4A92A 1V2UT 2BYAX 1TQ0B 3BEFB 4XDEA 3UR6A 3ITIA 1E34B 2HGTH 3ZVDA 2ZGHA 1OWHA 1LVBA 5C0UA 5T1VA 2ZFRH 1YPLH 3IG6B 4AFSA 2OQUA 1NM6A 3TGIE 1V2RT 1A7SA 3QWCH 1FLEE 3KF2A 2PV9B 4BTIB 2ODYB 1GCTC 2VJ1A 3A7VA 5E0HA 5DP9A 3M5NA 4Y10E 1C5LH 3FO8D 3LGWA 1P8VC 2VWLA 2OQ5A 4Y0ZE 3ZVAA 2GD4B 3SQHE 2VINA 1HNEE 1Y59T 1QZ8A 3F2GA 3PLBA 1O2JA 4AZ2B 1P2IA 1OX1A 1L0ZA 2P3TB 3FANA 3SUFA 3ZVGA 5FBIA 1ESBA 4K69A 2KX4A 3GY4A 3ZVBA 1U6QA 2Z3DA 2ZPRA 3SO3A 1C5QA 3S9BA 3MTYA 1SLVB 4AGJA 4AN7A 1DXPA 1Q2WA 1DPOA 2Z6BD 1O36A 4I33A 1V2WT 1NROH 1PJPA 4AGKA 4I86A 4CRGA 2YMSC 5E8EH 1MKXK 2BLQA 1T8LA 8LPRA 4FUHA 1MH0A 1MMJN 1BMNH 1GHYH 4B74A 3LONA 1BA8B 1GBFA 2PP6A 1QR3E 2V0BA 1FY8E 1O39A 2BB4A 2ZIQH 4LZ1H 3TNTA 5C5OA 3M5MA 1QL8A 1DLKB 3UQVA 3PRBA 3TK6A 2WV4A 3PWCA 4RKOB 1TRMA 1C5SA 3O8RA 1GDQA 1MABB 3QX5H 4AX9H 2GCTC 3DCLA 2G55A 3L3TA 5PTPA 4TT3D 1B0FA 4MPUA 3M5LA 1P2QA 1W13U 1AIXH 1YM0A 4K60A 4DG4A 1Q31A 2FI4E 5A0BA 4ZHLU 2OC7A 4H6SB 4ISLA 4UFEH 1A0LA 1C1UH 1K1IA 4GCHF 5KGOA 3RC5A 1BBRH 1THPB 3A8CA 2SGAA 8KME2 3EA9A 2Y6TA 1VITF 1O2MA 1HGTH 1L2EA 1F0TA 1DICA 3P8FA 4ISHH 1Z8JB 3A85A 3LGUA 2C8XB 2V3OH 2ZECA 1JRTA 2QAAA 2F4LA 4J2YB 3RXPA 1UVSH 1FZZA 1O2XA 1UW7A 1NZQH 2PSXA 1O2QA 1CGIE 4MPVA 2PKSC 1QHRB 1AN1E 4Y8YA 5EXMA 1AY6H 4NSYA 4FUJA 1GHAF 4JZIA 4WH8A 3VEQB 1EP6A 5LPEA 3GY8A 1QJ7B 4O9VA 1O2PA 4ABIA 3A7TA 5DP8A 1BTWA 1IQLA 1AHTH 3BG4C 5HM2A 3GCTF 2ZFQH 3RC4A 1ARCA 1DUAA 1BMAA 4FU8A 3RXRA 2CHAB 3ATWA 4K2YA 3PTNA 3LIWA 5TCCA 5LPFA 4UFFH 2OCVB 4ACAA 1P01A 1GBDA 3ZV8A 3NRLA 4K8BA 1Z71A 5C67A 4ZUHA 5J4QA 1HXFH 4RT1A 3BIVH 2TRMA 2R0KA 3E0NB 3EE0B 1A61H 1V2JT 3ZVCA 3ZZ3A 3ZV9A 4IMQA 3SU0A 5FPSA 2BTCE 3UWIA 1IQNA 1BUIA 1O3KA 2XC5A 1VR1H 1GMDG 1W0YH 4JYVH 1G36A 1YGCH 4X1NU 4FUIA 1O2ZA 1O5BB 1BHXB 1SGCA 3VGCC 2ODQA 4B6FA 1O37A 4GUXA 1BTYA 2B0FA 2BMGB 3OY6U 2XTTB 1P04A 3LGTA 2PUQH 1OOKB 2JKHA 1TNHA 3WWBA 2HALA 2D26C 2P95A 4ABHA 2YNBA 4B73A 4YLQH 3SV8A 1B5GH 3H09A 2C90B 2XYAA 1ETSH 3UWJH 3S7HB 5GNDA 2FOEA 6LPRA 1UCYK 1TPOA 3Q3YA 1ZHPA 1GJBB 4ABJA 2A1DB 3UREA 2KR7A 2EEKA 3MNBA 2BDBA 2ULLA 1RIWC 4O3TA 1WU1A 1W7XH 2JH0D 1SFIA 1QCPA 1EKBB 3V13A 4Q7YA 1GBMA 1KXEA 1HAHH 3MMGA 2GCHF 5EIYA 1Z8RA 3E16B 3RXKA 3U1JB 3VXFH 1OWDA 1ZTLA 4NWKA 2ZDLA 2PHBA 3MO3A 1K1LA 2WV5A 3M7TA 2VVCA 1SGRE 1PPBH 2W3KA 1W10U 2KAIB 2BY5X 1A1RA 2R2WU 4AC9A 1HFDA 1BJVA 3RXTA 1CU1A 2XWBI 1XM1A 1QB6A 3G01A 4OM9A 3SI4H 4WWYA 4UE7H 1BRCE 1DSTA 1O3HA 3O8BA 1EFRD 1O30A 2J9NA 1SGYE 1V2TT 2SGFE 3U8TH 5AVDA 1GL1A 2ZFPH 1CBWB 1DDJA 1XUIA 1M9UA 1O5EH 2C93B 2A5AA 1DY8A 3BTEE 1YWUA 5EXLA 4DT7B 1DFPA 1PPCE 2BD5A 2L6OA 3A7YA 1O38A 1YPHE 4ZXXH 1MBQA 3TK5A 3FN8A 1NFWA 1QQUA 1P0SH 1W7GH 3B8JA 2BOHB 1D4PB 4ZHAA 2V6NA 1UK4A 3LGVA 4DCDA 3BTHE 3ZZ7A 1J16A 1HAGE 2JJ1D 5G4BA 4TY6A 1DT2A 3A8AA 2DE9A 3RC6A 2C8WB 2ZDNA 2ZDAH 1K1OA 3RDZA 5JBCS 3TH3H 1GBLA 5DP6A 1AE8H 1GWAA 3OFND 2WPKS 1CQQA 3VG8A 5IDKA 1GMHG 3SV2H 3SI3H 1TGNA 2HLCA 2PTCE 4K3JA 2HVXA 2Q6GA 2F9UA 2JH6D 2FM2A 1P3CA 4ESTE 3PLKA 1NFUA 4RKJB 4CH8B 1T31A 1S6FA 2Y5FA 4CRFA 2XW9A 1GG6C 2ZU3A 1CGJE 2NU3E 3KHVA 1UK2A 1ANDA 3EE7A 3P70B 1TONA 1NFXA 3BTQE 3U98H 2ZU2A 2Y5GA 1FAXA 4INKA 1NRSH 3GCOA 2IJD1 2OINA 1QL9A 4D76A 4ABGA 1WXRA 1HDTH 2VIPA 1LHEH 1QBVH 3MU8A 2PWXA 4OS2A 2RDLA 2JETB 1FI8A 3GOVB 3BTME 4NIXA 3F2HA 1NBME 1SPJA 2IJOB 2Z3EA 4DJZB 1W12U 3NXPA 3OX7U 4HI3A 2BY6X 3D49H 1BQYA 1GI6A 3LU9B 1O3IA 1ZR0A 1UVOA 3F9EA 4OGYA 1DUEA 3OY5U 3TGJE 3FP6E 3UFAA 3AW1A 1MTSA 4UONA 1C2MA 3ZZ6A 4Y11E 3V3MA 4NG9H 2C8YB 1HLTH 2ZDVH 3FP7E 5HGGA 2ALPA 4INLA 4B2CA 4DGJA 1S83A 1GI2A 1K22H 1EOLA 4X2VA 2UUJB 4NZLA 3HKJB 4WXVA 1MUEB 3NPSA 4BAHB 3RXBA 3RXMA 1C1NA 2H6MA 3BTFE 1ELGA 2F9VA 2VBCA 2WPDD 4X1RU 3BN9A 4OS7A 4MNYA 3LH1A 1WYKA 5B6LA 4PROA 1Q3XA 1ELEE 2EI8A 4X2XA 1AFQB 1UO6A 3BEIB 4LZ4B 4NA9H 1F92A 3ATIA 3GYLB 2W6JD 4WJG2 4BAQB 3SUEA 2VIOA 2AMDA 2KAIA 1GBHA 2QIQA 1T4UH 4Z0KA 4JMYA 1WUNH 1EB1H 3ZZ9A 3W95A 1AI8H 1FONA 5FL7D 1SOTA 1D3PB 3RXIA 3RU4T 1MBMA 1H4WA 1HJ9A 5A8ZA 1IQJA 1JMOH 3T29A 3LOXA 1P11E 2FS9A 3T26A 1GI5A 3LC5A 4ABEA 1C1RA 1H9IE 1NU9A 1IAUA 1YF4A 2TGDA 1IQGA 1ZMNA 3RXGA 5L6NH 1ZGIA 1YCPK 1LHDH 1SQTA 3MH6A 1LVMA 2GTBA 3S69A 1SB1H 1MQ6A 2ZZUH 3OSYA 2H1UA 3SQEE 3P6ZB 1GHBF 1NRPH 1AVWA 1HAPH 1AU8A 1MKXH 2V35A 3NCLA 1NTPA 3GS9A 2IOTA 4ASHA 1C5OH 2BLVA 2QN5T 5HYOA 4WMEA 1O2LA 3FZZA 1QTFA 2ZF0H 1FQ3A 2P8OC 5EOKA 1J8AA 1P2JA 1PFXC 2G51A 5EJZA 2FS8A 3BV9B 1C4V2 4NZQA 1C5UA 2VGCC 3BTWE 2Y82A 1D3DB 2BX3A 7LPRA 1LTOA 4Y7BA 3M7UA 2WPHS 3KCGH 3BTDE 1IQIA 4FUBA 1BMMH 2LNCA 5HM9A 1FXYA 2STAE 5K0HA 2H9TH 2AIPA 1ZPZA 2FOAA 2KCAA 4INHA 3SHCH 1XVMA 4RT0A 5FXLA 1K1PA 1GJDB 3E91A 1XUGA 4BXSA 2G81E 1ZTJA 1UTOA 2ZCLP 3T27A 1F7ZA 1KLIH 2ODPA 2GJGA 2HNTF 3HK6B 4UD9H 2KCYA 1O3LA 1E1RD 2ZQ1A 3QO6A 1BBRE 1PQ7A 3EDXB 1KXAA 4UDWH 2AIQA 1HAOH 4U2WA 2JJ2D 2PR3A 1IHTH 3NKKA 4ZHMU 1NY22 1TRYA 1TFXA 1O3NA 3QN7A 3UY9A 4GPGA 1W11U 1GI4A 1WTHD 4FVBA 2W7SA 1SHYA 1SLUB 2ZTYA 5EJ1A 3BIUH 3SNBA 4CRDA 2SFAA 2RG3A 3F9GA 2UUFB 1QB9A 2ZU5A 1DS2E 1DVAH 2G4UA 2HPQH 5A0AE 1CGHA 4NFEA 4MPWA 4BTTB 1TQ7B 1O3CA 1O5AB 2PTNA 4AYVB 4A1XA 1Y3WA 2EI7A 3SJ8A 5C1XA 2ZI2H 2QA9E 3K9XB 3Q77A 4U01A 4FXGH 2A5IA 2WV9A 5F53A 3QZQA 1QIXB 4M9FA 2VWOA 1GPZA 5HIYA 5JPMH 4XBBA 4XRNA 1GI0A 1QBOA 1DLEA 2BDCA 3TH2H 2OP9A 2PLXA 3T25A 1N8OB 2UWPA 1O3JA 2VIQA 1X7AC 4AORA 1XXDA 4ISNA 1C5ZB 4AB9A 3N7EA 1OSSA 1XMNB 4A1TA 3SBKA 5C17A 4ABDA 2J4IA 2KZ4A 4X6OA 1TYNA 4FUCA 4BAOB 1GBBA 1S85A 1DITH 4R8TB 1TB6H 3MU1A 2P16A 1GI8B 1LHFH 1SSXA 2FWWA 1BZXE 2F9BH 5JB9S 2STBE 1LDTT 4OS4A 1GI7B 4AG2A 1C5PA 2K1QA 2ZCHP 3I78A 4BTUB 1O2UA 3ZYEA 4VGCC 4DT4A 2FTLE 2GZ9A 3ATLA 5SGAE 2H2ZA 1XUHA 4I8JA 4ABBA 2J5UA 4X8TH 1GI1A 4WY3A 3EAJA 1PQ5A 1E79D 1ZHRA 3CENA 3RXOA 1NO9H 2ZA5A 2KM0A 4YTAA 1UCYH 3T28A 1Y3VA 2FI5E 3OTJE 3U8OH 1DWDH 2XNIA 2QXHA 1GGDB 2BVRH 1CO7E 3PTBA 4F49A 3CS7A 2AMPA 1SGEE 1RS0A 1TALA 1ZRKA 1FNIA 2Z9GA 4TY7A 1AMHA 5EQRA 2FOBA 1CT0E 3KEEA 4DURA 1V2NT 1BTZA 1LCYA 2TGTA 5CHAB 2GDDA 1SGDE 4RI0A 5LGOA 2BVSH 1GDUA 1EJAA 4Y6DA 1KXDA 4NIYA 2FOMB 3DFJA 2OBOA 3C1KA 3FKSD 4ZMAH 3SV9A 5ESBA 3A89A 1Z7KA 2WUBA 4MNWA 1OP0A 1W0JD 1TRNA 3T62A 1QRZA 3STIA 3EYDA 1NN6A 1VGCB 4E7NA 2V3HH 1G2MA 4OS5A 3U28C 1LO6A 3KQBA 1C2IA 1NESE 1GHXH 1F0SA 3FFGA 1PQAA 3SU6A 4IS5A 4YM9A 1EPTB 1DSUA 1D6WA 2AGGX 1GBKA 3TJNA 3PM3A 1P12E 2ZFFH 1MTUA 2VIWA 1EUFA 3RP2A 3HGNA 1GJ9B 1SR5C 1YC0A 1N1LA 2ANMH 5F6MA 4IW4E 2XWAA 4Y79A 2ZFTA 3RMOH 4DIIH 4XSKU 1BCUH 4A1VA 1GMDF 1TGCA 3FP8E 1K28D 2D8WA 1AE5A 4XBDA 2YOLA 2M2AA 4XOJA 1KTTB 3H5CB 1A3EH 4ZXYH 1BHXF 4WH6A 3A80A 2P93A 4ASUD 1FJSA 1GBCA 1JIRA 3P92A 1HCGA 6ESTA 3LGYA 3KQDA 4CR9A 3R3GB 5LH8A 1YPHC 1GCTB 2D2DA 3H7OA 3VB7A 5C5NA 1LVYA 3GDVA 1H8DH 1Z1IA 4MNVA 3ZZ4A 2BVXH 4XD7D 1GBEA 1O2RA 1RTFB 2HNTE 3M61U 2WHXA 1MTNC 4FU7A 2PSYA 2F9NA 3SJIA 2ZPSA 2A4OA 3LJJA 1C2KA 2ZO3H 3ZZCA 3GCNA 3M5OA 1GVKB 5GJ4B 3TITA 4Y71A 2VH6A 4BAKB 1L1NA 3BTKE 1GJAB 1ELTA 2VU8E 4LOYH 2Z9JA 3URDA 1L1JA 2YMSB 1YLCA 4KELA 1LKAA 1S6LA 4X8UH 1SI5H 2AEIH 5HXFA 4GLYA 1YPMH 4CR5A 1ACBE 3SU5A 4SGAE 3AK5A 1MTVA 3PB1E 2BQWB 4NCYA 3MNCA 2A31A 1QURH 3LC3A 1QRXA 3KQEA 3UB0A 3ZYDA 1H8HD 1ELFA 2FOGA 2AGIX 4X8VH 4BAMB 1XUKA 1EQ9A 2GCTB 3RUOA 1A0HB 2CMYA 4DVAU 1O2HA 3DSPA 3PROA 2J34A 1NU7B 1GJCB 1DE7H 1OYQA 2IPQX 2W26A 3F6UH 3ZZ8A 2RDEA 3WY8A 3SN8A 1ZLRA 2XBVA 1O3GA 1LQEA 2BDAA 2XCNA 3F3BA 1SBWA 4K1EA 1HYLA 1C2HA 5JBBS 2VVVA 4X6PA 1QBNA 1V2MT 4Y7AA 2QF0A 3ZZBA 4K5ZA 3MOCA 1C1TA 1GMHF 3F2FA 1LHCH 4P00A 5DGJA 1C5MD 5TCAA 2BOKA 1V2ST 1DM4B 4MG3A 2AMQA 3SV6A 2PKSB 3GYMA 3RXEA 5EW2H 2EI6A 4NA8A 5FBEA 4DOQA 3PMHB 3NUMA 1P2KA 2A4RA 1KLJH 1EJMA 3PMBB 3FZDA 1EPTA 1FUJA 2QF4A 1KIGH 3RMLH 4Q63A 1GHZA 1VITG 1THSH 1B0EA 5F8ZA 1DWEH 4MDSA 2XC4A 3QTVH 3ATKA 3BG4B 2FYQA 1V2OT 2SGDE 2ZHQH 3AAUA 3TU7H 5C2ZA 4GHTA 3B23B 1KSNA 1O3BA 2FOHA 2O8TA 2Y5HA 3DSOA 3K6YA 3KYFA 3JZ1B 1YLNA 3MHWU 3LGIA 2SGQE 2QXJA 1O3AA 1GVZA 2FXRA 1WQSA 1ORFA 8GCHG 1GHAG 1C5VA 1F5RA 4MLFB 2SGEE 2ZU4A 4KGAA 3E0PB 1WAYB 2HRVA 1T8OA 1C2GA 3SUDA 1QJ6B 2J94A 3QLPH 1XKBC 1PPEE 1S0RA 3GDUA 2C3SA 5EG4A 3MO9A 1FV9A 2AGEX 2ZFSA 2FTMA 1ANCA 2BDYA 3VGCB 2HWLB 3KN2A 1SGTA 3MH5A 1ARBA 1SG8B 2BZ6H 2CXVA 1GJ7B 5KECA 1Y5AT 2J98B 1BTXA 1ZMLA 1AUTC 1UVTH 3UOUA 1THRH 4JK5A 1IQEA 1ZMJA 5AF9H 3NZIA 2WYJA 3F1SB 4MQAA 5HKKD 4ISIH 1ZRBA 4JYTA 1WTGH 3F9FA 4FUFA 3RXCA 3MNSA 1HIAB 1UMAH 2GDEH 3Q00A 5ESTE 7GCHF 3UR9A 3BSQA 3A84A 4B76A 5DP7A 4IN2A 4BOHA 1ZYOA 5JYIA 4NWLA 1OYTH 1BMFD 2P3UB 2F9PA 1VZQH 4NGAH 1RIWB 5EQSA 5FPYA 3MQKC 1O33A 3RXFA 2BY7X 4D8NA 1EJNA 5DO4H 1HAVB 3DHKH 1MU6B 1V2KT 1P3EA 1BDAA 1YBWA 4YO9A 2QCYA 1AB9C 1C9PA 5EPYA 3UIRA 2ZHDA 1ZOMA 2Y80A 3FOAA 1BBRK 4WVPE 1O2GH 1ID5H 5FAHA 1HAZB 1RTKA 1OKXA 1S81A 2OC8A 1E38B 3B9FH 1W8BH 2B7DH 5E0GA 2I6QA 4I32A 3CP7A 1E1QD 1ABJH 1L4ZA 1W0KD 1A0JA 2DUCA 2Z9KA 1UTNA 1O5DH 3QK1A 3C27B 4JCNA 1TNJA 2FDAA 1G3DA 3D65E 3OEHD 2WPLS 3UAIC 3MH4A 5JB8S 2VB0A 2AERH 1WDIA 1GHVH 4U30A 4ABFA 1MU8B 5FCRA 3RM2H 3N7DA 3VB6A 1H8ED 2SNVA 1P06A 1RXPA 1DOJA 3SUGA 5FX5A 1CHGA 1XVOA 2ZGCA 5JBAS 3TLOA 2Z9LA 2R3UA 1ELAA 1TIOA 2QY0B 3TH4H 1W2KH 1BIOA 4MPXA 1FIZA 5T6FA 1PPFE 1MD7A 1WOFA 3NK8A 1KDQA 2GZ7A 1WQVH 3SGBE 3SNDA 5JBTA 1OWJA 3MU5A 5F8TA 1BTUA 3MU0A 2I6SA 3DD2H 1TNKA 1P2MA 3ELAH 2J2UA 5FHTA 3GDSA 1HJAC 3HGPA 2FX4A 2G00A 2HPPH 5FX6A 3SYJA 3MWIU 3EGKH 1RGQA 4DIHH 4TYDA 4YOJA 2BLWA 4H6TA 2WSSD 1GBJA 3PWBA 2FESH 1TBZH 1LHGH 1YPKH 4FVDA 3ZZDA 5E2PA 1UCYE 3SZNA 3PV4A 1J17T 1O2NA 3AAVA 3N99A 1ESAA 2BD7A 1V2PT 4A7IB 1V2LT 1C1MA 2VWMA 1FY4A 3E1XB 4X1PU 3PV2A 4H4FA 1UTKA 2RA0A 1AKSB 2FO9A 4B1TA 3SU3A 2GKVE 1HJ8A 3ATMA 1UVUH 2GV6A 3LT3A 5ABWA 2PFEA 4D7FA 4Q7XA 4KKDA 1MCVA 3F9HA 1UVPA 1CT2E 2BXTH 3BTGE 2Y7XA 2KCOA 2J98A 1Z8GA 2JDID 5IYTA 2AYWA 1O3PB 2J97A 3SNCA 2D1JA 1GJ6A 4I8KA 1HIAA 1OP8A 4GSOA 4JZDH 4K1SA 2GT8A 3M3VA 1TA2A 2W7UA 1DWCH 3DUXH 2QV1A 1P05A 2XOKD 1YPJH 1C2FA 1SQAA 1K1MA 3STJA 2GGVB 1Y3YA 4CHAC 4YZUA 3RXAA 1HAVA 1G30B 2ANKH 2HOBA 3RLYH 1CA0C 6GCHF 3RXVA 4YT6H 1CT4E 1G3EA 1N6YA 2ASUB 4ZROA 2BD9A 3U69H 1TX8A 2ZHWH 1LMWB 2EA3A 2PKAB 2TPIZ 1TGSZ 2UWOA 3Q76A 3QDZB 5EU8A 3W1EA 1A5HA 1GI9B 2XBXA 1RD3B 1GVLA 3P95A 3RU4D 1O5GH 5A09A 4NFFA 1KLTA 2WINI 2Y81A 1NPMA 2V7QD 3SOSA 1OS8A 5CMXH 1ZHMA 1BTPA 5EPNA 3QZRA 2A45B 3A82A 4E7RG 3RXSA 2IN2A 1NC6A 2BD2A 1YKTA 1TABE 4E05H 3SW2B 4GHQA 4F55A 2UWLA 2UUYA 2HNTC 1ZJKA 6CHAB 2RA3A 5L2YH 1EZUC 5F03A 3UUZA 4MNXA 1P9SA 1QA7A 4YOGA 4OGXA 4B75A 1ANEA 2Z7FE 4JYUH 3PLPA 1EB2A 4IC5A 3TPIZ 2B8OH 4LXBH 3TJUA 5HMAA 2P8OB 1ETRH 1LKBA 2A7JA 2ALVA 1H9HE 1MKWK 2BDIA 1UJ1A 5I25A 3P8GA 2G5VA 2ZGXH 2VGCB 1GBTA 5C94A 3QTOH 1DX5M 3HK3B 1SGNE 2UUKB 3ODDA 1O2WA 1KXBA 3GY3A 5C0TA 5A2MH 4X6NA 4AYYB 4FOUC 2A2QH 1MAYA 5CE1A 1WV7H 2NU4E 1YLDA 1GBAA 1FMGA 2ZP0H 1XKAC 2W5EA 2OD3B 1CHOG 3K2UA 4HTCH 1AFEH 3AVZA 3V0XA 3U1IB 5DK1A 1NRRH 2NU1E 3RMMH 3R0FA 2BY9X 3E3TA 1AGJA 2ZCKP 1UTMA 3S9AA 1K1JA 1IHSH 1SHHB 2R2MB 1AKSA 1YY3A 3WW7A 1A2CH 1QL7A 1AWHB 2O9QA 1SMFE 2FMJA 2AFQB 4TWWA 2ZG0H 1F5LA 5T3HA 3O8CA 1RFNA 1TA6A 3P8OA 1D3TB 5B6OA 4Z1MD 1ESTA 1L1GA 2RCEA 3KYGA 2QC2A 2FZZA 1W14U 2H9HA 3GCHB 3QGNB 2VVUA 1LPKB 2KCPA 2CJIA 2FPZA 2G8TA 1VJAU 1GJ4H 1O5FH 1QNJA 3NWUA 5EJLA 1L4DA 1S5SA 2BD4A 4D9RA 4SGBE 3VB3A 1HAXB 1TPPA 2B9LA 1S84A 2PUXB 1XUJA 1GL0E 4U32A 1LVOA 5FCKA 2GMTB 1P9UA 2ZNKH 2TBSA 1FX0B 3PV5A 3AW0A 3HPTB 2AS9A 3ZVFA 4D9QA 1MZAA 4ZKRU 4Q4LA 1C5RA 1SGFG 3ZVEA 1A4WH 4AFUA 2LPRA 4NIVA 3DSGA 4UFDH 1GMCG 3MH7A 1A5GH 2PKAA 1P10A 1IQMA 1C4Y2 1GJ8B 1C5WB 1QY6A 4R0IA 1BMLA 1OXGA 2F9OA 1BRAA 2BDGA 1YPGH 3PRDA 1EX3A 1RRKA 1Y8TA 1LPZB 4HGCA 2B5TB 2F3CE 5AFYH 1QRWA 2GP9B 1OWEA 4RSPA 1EASA 2Z94A 4WMFA 3AASA 1QQ4A 1O34A 2H5CA 2ZEBA 2G5NA 3A7XA 2BZAA 3PO1B 3SGAE 1EAWA 3M3SA 1O31A 1C2JA 1SGPE 2OTVA 2BLOA 5GCHG 1C1OA 3RXQA 1G3BA 1VCWA 1FDPA 1SGQE 2CHAC 3MO6A 5DJ7A 2FLRH 3SJKA 1E36B 2OBQA 3BTTE 4J1YA 4UFGH 2C4FH 3P8NA 3U9AH 2EQNA 4VGCB 1KXCA 3KIDU 3SU1A 2O8MA 2XBYA 3KGPA 5DKMA 4THNH 5GIBA 1ZGVA 3LH3A 1FPHH 5GDSH 1P03A 2C8ZB 2ILNA 1HV7A 3VB5A 5HIZA 3GY2A 1TX6A 5TJXA 2F91A 4B2BA 2GT7A 1EATA 1PPZA 4WF8A 5DN6D 1AO5A 1EAUA 3TJVA 1UTLM 1KTSB 2ANWA 3EA8A 1CE5A 2BXUH 1Y5BT 1TPAE 1Z8IB 1MTWA 1AVXA 4Q7ZA 4Y8XA 3I29A 4FUEA 4QT8C 1LQDB 5A8XA 1CSOE 4X0WU 1C5NH 1AZ8A 1UTQA 3QUMP 4X6MA 2L74A 1A5IA 1DANH 1DY9A 1COWD 2V3MA 3GY7A 4FUGA 4X1SU 1H9LB 1KXFA 3SHAH 2NU2E 4O03A 1C1WH 1EAXA 2QXIA 2ZPQA 1IQHA 5BRRE 3TJOA 1KMHB 5LPRA 4KTCA 3RMNH 1UTPA 3S7KB 1EAIA 2OC1A 2J92A 3L33A 1SL3A 1SGIB 1WBGB 5C3NA 1E37B 3VPKA 1RJXB 2M5TA 2BD8A 2BD3A 4BXWA 2EY4C 1TBQH 2FODA 1FY3A 3MI4A 4M7GA 1K1NA 2PGQB 2ZQ2A 3S0NA 4X2YA 5K7RA 2WPJS 8GCHF 2TIOA 1V6DA 1O2TA 3UTUH 1C1QA 1EXFA 3A86A 2FI3E 4X1QU 3SJ9A 3M37A 4AFZA 1BRBE 2XCFA 3SNEA 1B7XB 1F0UA 1N6XA 3LKWA 1C2LA 1Z1JA 1G37A 3SZEA 1PQ8A 1ELBA 4XFQA 2P59A 4BNRA 1ZJDA 1TOMH 1HRTH 3F0PA 2ZGJA 4CRCA 1QJ1B 4MVNA 4DW2U 1G2LA 1AVGH 3OEED 1T7CA 2ZHFH 1P57B 4XBCA 3DT0H 1FPCH 4I31A 1C4U2 1Z6JH 2ESTE 1FAKH 1UHBB 2NWNA 3H7TA 3SJOA 3SV7A 4ZCNA 1HBTH 2OXSA 3MFJA 4I7YH 1CBWC 1PPHE 1SGFA 2WPIS 3Q3XA 3SU2A 2WYGA 1MTNB 2CN0H 2LELA 4NSVA 5I46H 1BT7A 1MAXA 3D62A 2A32A 1W0ZU 3M3TA 5ETXA 1IQKA 1C5TA 2TGPZ 2QF5A 1O32A 2R3YA 3A88A 3KNXA 4OS1A 5BPEA 3HATH 5T6DA 1BRUP 1Z6EA 2CK3D 1V3XA 4IN1A 4NA7A 3T2NA 1DXWA 4GCHG 1KDQB 4JZ1A 3RXHA 1S0QA 2A7CA 2EC9H 2BQ7B 3RXJA 1T8NA 1YCPH 1JOUB 1KY9A 3LPRA 2VIVA 3RM0H 2PW8H 1HAIH 1TMUH 3RXLA 1K21H 4CBOA 1P02A 4FUDA 3LJOA 4FETA 3SGQE 2XC0A 3ESTA 2QGRA 2QYIA 2A5KA 5DG6A 4ACBA 3GY6A 1OWIA 2ZWLH 3ENSB 4GVUA 3K65B 1S82A 2YNAA 3KL6A 5EQQA 1OPHB 1P2NA 2K0QA 1BOQA 2ANYA 3BEUA 5EGMA 2CF9H 1ELVA 2NU0E 5AFZH 3GCTG 1NRNH 3OYPA 3TGKE 1IQFA 1C5YB 1C5XB 1NT1A 3K6ZA 5DSFA 2WPMS 2GV7A 3TIUA 4Z6AH 1HB0B 5L2ZH 4OS6A 1EZSC 2H9EH 4LK4A 1YP9A 1O2KA 4TSFD 3M36A 1TE0A 1TX7A 2A7HA 2JETC 1Y3XA 2Q1JA 1PYTD 4TPIZ 3TK9A 1W3CA 1O2YA 2DE8A 2BDHA 3M7QA 3PMAB 4A5TS 3A8DA 2VWNA 3M35A 3UNQA 3KQ5A 1IOEA 5C1YA 1SLXB 1HAYB 4ZKSU 5J4SA 4P02A 1G9IE 1C2EA 1TNGA 1WCZA 3A7ZA 2QF3A 3GISB 4IBLH 5IK2D 2BQ6B 2BM2A 3CNRA 2GZ8A 3L6PA 3P17H 4XE4A 1G32B 2R0LA 2FOCA 4X2WA 3OE7D 5DP3A 1TMBH 1UTJA 5A0CA 1E0FD 4AOQA 2Q6DA 1VKYA 1FY5A 1JBUH 3VXEH 2A4GA 4IMZA 1J15A 3UPEA 5EW1H 4Y8ZA 3U8RH 1AFQC 1GCDA 2BHGA 1D3QB 2XRCA 1JWTA 3E90B 1O35A 5DPAA 1C1VH 1SLWB 1QGFA 1EP5A 1HXEH 3SORA 2IPHA 2J95A 1O3OA 1J14A 1O2VA 1MCTA 3UOPA 4F48B 1MKWH 4HFPB 1UK3A 2Z9IA 1TMTH 1SOZA 1BJUA 2A2XH 3SU4A 4AB8A 2GCHG 4F4OC 1UHBA 2F43B 2YMSD 4ZH8A 3HKIB 2FP7B 5CDFE 4CREA 2CF8H 1HPGA 4HG6A 4K8YA 3GY5A 1QFKH 4UEHH 5FPTA 1P2OA 3A81A 1O2IA 1T8MA 1GDNA 3W94A 4ZKOU 3MNXA 1TPSA 5DP5A 2VNTA 3ODFA 1TGTA 2OUAA 1BTHH 1WSSH 4I8GA 5A8YA 3BF6H 1TGBA 2ZU1A 1ZTKA 1QA0A 3D23A 2OK5A 1FN8A 2JH5D 1INCA 3UNRA 1TNIA 1H1BA 3UQOA 2BY8X 1MQ5A 2ZDMA 3DFLA 5CHBA 4IC6A 1F5KU 2F83A 1Y3UA 3S9CA 3RU4E 2Z3CA 1BB0B 2OC0A 3T5FH 2FIRH 3RLWH 9LPRA 2XNDD 3Q3KA 1KYNA 3IITA 1D9IA 1BITA 2FX6A 3OU0A 3JZ2B 2ZTXA 1MD8A 1SFQB 1TNLA 3PYHA 1CA8B 2SGPE 3A8BA 4YLUA 1GG6B 1AB9B 3WWFA 4O3UA 4Q80A 1GBIA 7GCHG 4YESB 4I8LA 2P94A 3VB4A 1XXFA 4O97A 5AHGH 1FN6A 3CS0A 2O8WA 3ZZAA 4YT7H 2VH0A 3VFEA 1O5CB 4ABAA 4GAWA 3GICB 4K1TA 1O3MA 4KP0A 1G3CA 4ZAEA 2XXLA 3E8LA 3EA7A 1VCQA 1O3FA 5KEDA 5GPIB 2ZDKA 3TVJB 3I77A 1RTLA 1C1PA 1H8IH 4CRBA 2A0QB 1C2DA 2BX4A 1FIWA 3KQCA 1OHHD 1ZSJA 1O3DA 4TWYA 5H4IB 3F0OA 3MYWA 3N7OA 3F68H 5EODA 1ABIH 1FY1A 3EQ0H 3TNSA 1TOCB 4CRAA 3DA9B 6CHAC 3UNSA 5EXNA 2ZTZA 1J9CH 4ISOA 2OLGA 1GHWH 2G4TA 1LPGB 3PMJA 1SKYE 2Y7ZA 5L30H 1NFYA 1ELDE 1OP2A 3E6PH 4B2AA 3A7WA 2PGBB 9ESTA 1CHOF 1JRSA 1YPEH 1ETTH 4Y0YE 1A3BH 8ESTE 1D6RA 1EOJA 1NS3A 1VJ9U 4YOIA 2HVYB 1NBMD 1T4VH 4IGDA 2FLBH 4KTSA 1N8OC 4CH2B 2P3FH 1P09A 2FEQH 2WZQA 5GWZA 1O2OA 1CVWH 1HJAB 2H5DA 2ZC9H 5DP4A 3URCA 1QB1A 5F8XA 1O0DH 1ANBA 2R9PA 1AWFH 2WUCA 3A87A 4WMDA 3ZZ5A 1K2I1 1ZZZA 2XBWA 1TAWA 2KFWA 1K9OE 2TGAA 1OWKA 1XUFA 2AH4X 4JK6A 3IWMA 4AFQA 1V2VT 3OTPA 5C1UA 1S6HA 1T32A 7ESTE 2CGAA 4NIWA 1MZDA 1VCPA 2J38A 1TLDA 1XX9A 2HLDD 2ZGBH 1F2SE 1GJ5H 2W3IA 1E35B 4JZEH
chains in the Genus database with same CATH topology
1Y5UT 1YCPM 1NRQH 1AUJA 4WXIA 1ZPCA 1DWBH 4MTBA 1HUTH 2GX4A 1O2SA 2FOFA 1TWXB 1YYY1 1A46H 4BANB 1ELCA 2O8UA 2ZHEH 3A83A 5JDUB 1EZQA 1JXPA 4X8SH 3GCHC 3RXUA 1ZSLA 1C9TA 1TBRH 3LDXH 1VITH 4RN6A 4CBNA 4D7GA 1PPGE 1V2QT 4I8HA 1GMCF 4TPYA 5GXPA 1GGDC 4A6LA 2ZKSA 4JZFH 2O8LA 5C20A 1O3EA 4KTUA 1JIMA 3V12A 4H42U 1AZZA 2QXGA 5E2OA 1GHBG 3V7TA 4B71A 2GMTC 3QGJA 5CHAC 2FYRA 4CHAB 4Y76A 1CA0B 4FU9A 1SC8U 1GI3A 4ZKNU 5GCHF 4AG1A 2GVFA 4HZHA 5T6GA 1F0RA 2CV3A 3BG8A 3MU4A 4Q2KA 3RXDA 3FVFB 2THFB 5E0JA 3FAOA 1VGCC 4DY7B 3O8DA 2A4QA 4E06H 2VIDA 2SNWA 1PYTC 1ZSKA 1ZPBA 1EPTC 1EZXC 1AD8H 2Q6FA 1SQOA 1C1SA 2G52A 1AQ7A 7KMEH 3PO1C 6GCHG 1SVPA 3SNAA 4A92A 1V2UT 2BYAX 1TQ0B 3BEFB 4XDEA 3UR6A 3ITIA 1E34B 2HGTH 3ZVDA 2ZGHA 1OWHA 1LVBA 2ZFRH 1YPLH 3IG6B 4AFSA 2OQUA 1NM6A 3TGIE 1V2RT 1A7SA 3QWCH 1FLEE 3KF2A 2PV9B 4BTIB 2ODYB 1GCTC 2VJ1A 3A7VA 5E0HA 5DP9A 3M5NA 4Y10E 1C5LH 3LGWA 1P8VC 2VWLA 2OQ5A 4Y0ZE 3ZVAA 2GD4B 3SQHE 2VINA 1HNEE 1Y59T 3PLBA 1O2JA 4AZ2B 1P2IA 1OX1A 1L0ZA 2P3TB 3FANA 3SUFA 3ZVGA 5FBIA 1ESBA 4K69A 3GY4A 3ZVBA 1U6QA 2Z3DA 2ZPRA 3SO3A 1C5QA 3S9BA 3MTYA 1SLVB 4AGJA 4AN7A 1DXPA 1Q2WA 1DPOA 2Z6BD 1O36A 4I33A 1V2WT 1NROH 1PJPA 4AGKA 4CRGA 5E8EH 1MKXK 2BLQA 1T8LA 8LPRA 4FUHA 1MH0A 1MMJN 1BMNH 1GHYH 4B74A 3LONA 1BA8B 1GBFA 1QR3E 2V0BA 1FY8E 1O39A 2BB4A 2ZIQH 4LZ1H 3TNTA 5C5OA 3M5MA 1QL8A 1DLKB 3UQVA 3TK6A 2WV4A 3PWCA 4RKOB 1TRMA 1C5SA 3O8RA 1GDQA 4AX9H 3QX5H 2GCTC 2G55A 3L3TA 5PTPA 1B0FA 4MPUA 3M5LA 1P2QA 1W13U 1AIXH 1YM0A 4K60A 4DG4A 1Q31A 2FI4E 5A0BA 4ZHLU 2OC7A 4H6SB 4ISLA 4UFEH 1A0LA 1C1UH 1K1IA 4GCHF 3RC5A 1BBRH 1THPB 3A8CA 2SGAA 8KME2 3EA9A 2Y6TA 1VITF 1O2MA 1HGTH 1L2EA 1F0TA 1DICA 3P8FA 4ISHH 1Z8JB 3A85A 3LGUA 2C8XB 2V3OH 2ZECA 1JRTA 2QAAA 4J2YB 3RXPA 1UVSH 1FZZA 1O2XA 1NZQH 2PSXA 1O2QA 1CGIE 4MPVA 2PKSC 1QHRB 1AN1E 4Y8YA 5EXMA 1AY6H 4NSYA 4FUJA 1GHAF 4JZIA 4WH8A 3VEQB 1EP6A 5LPEA 3GY8A 1QJ7B 4O9VA 1O2PA 4ABIA 3A7TA 5DP8A 1BTWA 1IQLA 1AHTH 3BG4C 5HM2A 3GCTF 2ZFQH 3RC4A 1ARCA 1DUAA 1BMAA 4FU8A 3RXRA 2CHAB 3ATWA 4K2YA 3PTNA 3LIWA 5TCCA 5LPFA 4UFFH 2OCVB 1P01A 1GBDA 3ZV8A 4K8BA 1Z71A 5C67A 4ZUHA 5J4QA 1HXFH 3BIVH 2TRMA 2R0KA 3E0NB 3EE0B 1A61H 1V2JT 3ZVCA 3ZZ3A 3ZV9A 4IMQA 3SU0A 5FPSA 2BTCE 3UWIA 1IQNA 1BUIA 1O3KA 2XC5A 1VR1H 1GMDG 1W0YH 4JYVH 1G36A 1YGCH 4X1NU 4FUIA 1O2ZA 1O5BB 1BHXB 1SGCA 3VGCC 2ODQA 1O37A 4GUXA 1BTYA 2B0FA 2BMGB 3OY6U 2XTTB 1P04A 3LGTA 2PUQH 1OOKB 2JKHA 1TNHA 2HALA 2D26C 2P95A 4ABHA 2YNBA 4B73A 4YLQH 3SV8A 1B5GH 2C90B 2XYAA 1ETSH 3UWJH 3S7HB 2FOEA 6LPRA 1UCYK 1TPOA 3Q3YA 1ZHPA 1GJBB 4ABJA 2A1DB 3UREA 2EEKA 3MNBA 2BDBA 2ULLA 1RIWC 4O3TA 1WU1A 1W7XH 2JH0D 1SFIA 1QCPA 1EKBB 3V13A 4Q7YA 1GBMA 1KXEA 1HAHH 3MMGA 2GCHF 1Z8RA 3E16B 3RXKA 3U1JB 3VXFH 1OWDA 1ZTLA 4NWKA 2ZDLA 2PHBA 3MO3A 1K1LA 2WV5A 3M7TA 2VVCA 1SGRE 1PPBH 2W3KA 1W10U 2KAIB 2BY5X 1A1RA 2R2WU 1HFDA 1BJVA 3RXTA 1CU1A 2XWBI 1XM1A 1QB6A 3G01A 3SI4H 4WWYA 4UE7H 1BRCE 1DSTA 1O3HA 3O8BA 1O30A 2J9NA 1SGYE 1V2TT 2SGFE 3U8TH 5AVDA 1GL1A 2ZFPH 1CBWB 1DDJA 1XUIA 1M9UA 1O5EH 2C93B 2A5AA 1DY8A 3BTEE 5EXLA 4DT7B 1DFPA 1PPCE 2BD5A 3A7YA 1O38A 1YPHE 4ZXXH 1MBQA 3TK5A 1NFWA 1QQUA 1P0SH 1W7GH 3B8JA 2BOHB 1D4PB 4ZHAA 2V6NA 1UK4A 3LGVA 4DCDA 3BTHE 3ZZ7A 1J16A 1HAGE 5G4BA 4TY6A 1DT2A 3A8AA 2DE9A 3RC6A 2C8WB 2ZDNA 2ZDAH 1K1OA 3RDZA 5JBCS 3TH3H 1GBLA 5DP6A 1AE8H 1GWAA 2WPKS 1CQQA 5IDKA 1GMHG 3SV2H 3SI3H 1TGNA 2HLCA 2PTCE 4K3JA 2HVXA 2Q6GA 2F9UA 2JH6D 2FM2A 1P3CA 4ESTE 3PLKA 1NFUA 4RKJB 4CH8B 1T31A 1S6FA 2Y5FA 4CRFA 2XW9A 1GG6C 2ZU3A 1CGJE 2NU3E 3KHVA 1UK2A 1ANDA 3P70B 1TONA 1NFXA 3BTQE 3U98H 2ZU2A 2Y5GA 1FAXA 4INKA 1NRSH 3GCOA 2OINA 1QL9A 4D76A 4ABGA 1HDTH 2VIPA 1LHEH 1QBVH 3MU8A 2PWXA 4OS2A 2RDLA 2JETB 1FI8A 3GOVB 3BTME 4NIXA 1SPJA 2IJOB 2Z3EA 4DJZB 1W12U 3NXPA 3OX7U 4HI3A 2BY6X 3D49H 1BQYA 1GI6A 3LU9B 1O3IA 1ZR0A 1UVOA 3F9EA 4OGYA 1DUEA 3OY5U 3TGJE 3FP6E 3UFAA 3AW1A 1MTSA 4UONA 1C2MA 3ZZ6A 4Y11E 3V3MA 4NG9H 2C8YB 1HLTH 2ZDVH 3FP7E 5HGGA 2ALPA 4INLA 4B2CA 4DGJA 1S83A 1GI2A 1K22H 1EOLA 4X2VA 2UUJB 4NZLA 3HKJB 4WXVA 1MUEB 3NPSA 4BAHB 3RXBA 3RXMA 1C1NA 2H6MA 3BTFE 1ELGA 2F9VA 4X1RU 3BN9A 4OS7A 4MNYA 3LH1A 1WYKA 4PROA 1Q3XA 1ELEE 2EI8A 4X2XA 1AFQB 1UO6A 3BEIB 4LZ4B 4NA9H 1F92A 3ATIA 3GYLB 4WJG2 4BAQB 3SUEA 2VIOA 2AMDA 2KAIA 1GBHA 2QIQA 1T4UH 4Z0KA 4JMYA 1WUNH 1EB1H 3ZZ9A 3W95A 1AI8H 1FONA 1SOTA 1D3PB 3RXIA 3RU4T 1MBMA 1H4WA 1HJ9A 5A8ZA 1IQJA 1JMOH 3T29A 3LOXA 1P11E 2FS9A 3T26A 1GI5A 3LC5A 4ABEA 1C1RA 1H9IE 1NU9A 1IAUA 1YF4A 2TGDA 1IQGA 1ZMNA 3RXGA 5L6NH 1ZGIA 1YCPK 1LHDH 1SQTA 3MH6A 1LVMA 2GTBA 3S69A 1SB1H 1MQ6A 2ZZUH 3OSYA 2H1UA 3SQEE 3P6ZB 1GHBF 1NRPH 1AVWA 1HAPH 1AU8A 1MKXH 2V35A 3NCLA 1NTPA 2IOTA 4ASHA 1C5OH 2BLVA 2QN5T 5HYOA 4WMEA 1O2LA 3FZZA 1QTFA 2ZF0H 1FQ3A 2P8OC 5EOKA 1J8AA 1P2JA 1PFXC 2G51A 2FS8A 3BV9B 1C4V2 4NZQA 1C5UA 2VGCC 3BTWE 2Y82A 1D3DB 2BX3A 7LPRA 1LTOA 4Y7BA 3M7UA 2WPHS 3KCGH 3BTDE 1IQIA 4FUBA 1BMMH 2LNCA 5HM9A 1FXYA 2STAE 5K0HA 2H9TH 2AIPA 1ZPZA 2FOAA 4INHA 3SHCH 1XVMA 5FXLA 1K1PA 1GJDB 3E91A 1XUGA 4BXSA 2G81E 1ZTJA 1UTOA 2ZCLP 3T27A 1F7ZA 1KLIH 2ODPA 2HNTF 3HK6B 4UD9H 1O3LA 2ZQ1A 3QO6A 1BBRE 1PQ7A 3EDXB 1KXAA 4UDWH 2AIQA 1HAOH 4U2WA 2PR3A 1IHTH 3NKKA 4ZHMU 1NY22 1TRYA 1TFXA 1O3NA 3QN7A 3UY9A 4GPGA 1W11U 1GI4A 1WTHD 4FVBA 2W7SA 1SHYA 1SLUB 2ZTYA 3BIUH 3SNBA 4CRDA 2SFAA 2RG3A 3F9GA 2UUFB 1QB9A 2ZU5A 1DS2E 1DVAH 2G4UA 2HPQH 5A0AE 1CGHA 4NFEA 4MPWA 4BTTB 1TQ7B 1O3CA 1O5AB 2PTNA 4AYVB 4A1XA 1Y3WA 2EI7A 3SJ8A 5C1XA 2ZI2H 2QA9E 3K9XB 3Q77A 4U01A 4FXGH 2A5IA 3QZQA 1QIXB 2VWOA 1GPZA 5JPMH 4XBBA 1GI0A 1QBOA 1DLEA 2BDCA 3TH2H 2OP9A 2PLXA 3T25A 1N8OB 2UWPA 1O3JA 2VIQA 1X7AC 4AORA 1XXDA 4ISNA 1C5ZB 4AB9A 1OSSA 1XMNB 4A1TA 3SBKA 4ABDA 2J4IA 4X6OA 1TYNA 4FUCA 4BAOB 1GBBA 1S85A 1DITH 4R8TB 1TB6H 3MU1A 2P16A 1GI8B 1LHFH 1SSXA 2FWWA 1BZXE 2F9BH 5JB9S 2STBE 1LDTT 4OS4A 1GI7B 4AG2A 1C5PA 2K1QA 2ZCHP 3I78A 4BTUB 1O2UA 3ZYEA 4VGCC 2FTLE 2GZ9A 3ATLA 5SGAE 2H2ZA 1XUHA 4I8JA 4ABBA 4X8TH 1GI1A 4WY3A 3EAJA 1PQ5A 1ZHRA 3CENA 3RXOA 1NO9H 2ZA5A 4YTAA 1UCYH 3T28A 1Y3VA 2FI5E 3OTJE 3U8OH 1DWDH 2XNIA 2QXHA 1GGDB 2BVRH 1CO7E 3PTBA 4F49A 3CS7A 2AMPA 1SGEE 1RS0A 1TALA 1ZRKA 1FNIA 2Z9GA 4TY7A 1AMHA 5EQRA 2FOBA 1CT0E 3KEEA 4DURA 1V2NT 1BTZA 1LCYA 2TGTA 5CHAB 2GDDA 1SGDE 5LGOA 2BVSH 1GDUA 1EJAA 4Y6DA 1KXDA 4NIYA 2FOMB 3DFJA 2OBOA 3C1KA 4ZMAH 3SV9A 5ESBA 3A89A 1Z7KA 2WUBA 4MNWA 1OP0A 1TRNA 3T62A 1QRZA 3STIA 3EYDA 1NN6A 1VGCB 4E7NA 2V3HH 1G2MA 4OS5A 1LO6A 3KQBA 1C2IA 1NESE 1GHXH 1F0SA 3FFGA 1PQAA 3SU6A 4IS5A 4YM9A 1EPTB 1DSUA 1D6WA 2AGGX 1GBKA 3TJNA 3PM3A 1P12E 2ZFFH 1MTUA 2VIWA 1EUFA 3RP2A 3HGNA 1GJ9B 1SR5C 1YC0A 1N1LA 2ANMH 5F6MA 4IW4E 2XWAA 4Y79A 2ZFTA 3RMOH 4DIIH 4XSKU 1BCUH 4A1VA 1GMDF 1TGCA 3FP8E 1K28D 2D8WA 1AE5A 4XBDA 2YOLA 4XOJA 1KTTB 3H5CB 1A3EH 4ZXYH 1BHXF 4WH6A 3A80A 2P93A 1FJSA 1GBCA 1JIRA 3P92A 1HCGA 6ESTA 3LGYA 3KQDA 4CR9A 3R3GB 5LH8A 1YPHC 1GCTB 2D2DA 3H7OA 3VB7A 5C5NA 1LVYA 3GDVA 1H8DH 1Z1IA 4MNVA 3ZZ4A 2BVXH 1GBEA 1O2RA 1RTFB 2HNTE 3M61U 1MTNC 4FU7A 2PSYA 2F9NA 3SJIA 2ZPSA 2A4OA 3LJJA 1C2KA 2ZO3H 3ZZCA 3GCNA 3M5OA 1GVKB 5GJ4B 3TITA 4Y71A 2VH6A 4BAKB 1L1NA 3BTKE 1GJAB 1ELTA 2VU8E 4LOYH 2Z9JA 3URDA 1L1JA 1YLCA 4KELA 1LKAA 4X8UH 1SI5H 2AEIH 5HXFA 4GLYA 1YPMH 4CR5A 1ACBE 3SU5A 4SGAE 1MTVA 3PB1E 2BQWB 4NCYA 3MNCA 2A31A 1QURH 3LC3A 1QRXA 3KQEA 3ZYDA 1ELFA 2FOGA 2AGIX 4X8VH 4BAMB 1XUKA 1EQ9A 2GCTB 3RUOA 1A0HB 2CMYA 4DVAU 1O2HA 3PROA 2J34A 1NU7B 1GJCB 1DE7H 1OYQA 2W26A 3F6UH 3ZZ8A 3WY8A 3SN8A 1ZLRA 2XBVA 1O3GA 1LQEA 2BDAA 2XCNA 1SBWA 4K1EA 1HYLA 1C2HA 5JBBS 2VVVA 4X6PA 1QBNA 1V2MT 4Y7AA 2QF0A 3ZZBA 4K5ZA 3MOCA 1C1TA 1GMHF 1LHCH 5DGJA 1C5MD 5TCAA 2BOKA 1V2ST 1DM4B 4MG3A 2AMQA 3SV6A 2PKSB 3GYMA 3RXEA 5EW2H 2EI6A 4NA8A 5FBEA 4DOQA 3PMHB 3NUMA 1P2KA 2A4RA 1KLJH 1EJMA 3PMBB 3FZDA 1EPTA 1FUJA 1KIGH 3RMLH 1GHZA 1VITG 1THSH 1B0EA 5F8ZA 1DWEH 4MDSA 2XC4A 3QTVH 3ATKA 3BG4B 2FYQA 1V2OT 2SGDE 2ZHQH 3AAUA 3TU7H 5C2ZA 4GHTA 3B23B 1KSNA 1O3BA 2FOHA 2O8TA 2Y5HA 3K6YA 3JZ1B