3A84A

Crystal structure of trypsin complexed with(e)-2-(4-carbamimidoylbenzylideneaminooxy)acetic acid (soaking 5 seconds)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a84A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a84A02
3MFJA 4I32A 1GJ8B 2JETB 2BY8X 4RKOB 4ABDA 1F5LA 5C5NA 2FX4A 1AE5A 5C67A 1YCPK 2EI7A 4AG2A 1P3EA 3D23A 4B2AA 1O3NA 4WMDA 3PLKA 1EASA 1TMTH 1SGFG 1UHBB 3U8OH 3SHCH 5E0GA 1RIWB 2F9PA 4MG3A 1MTNB 1TPAE 1WQSA 4SGAE 1PQ8A 1DITH 1K9OE 1IQMA 2I6SA 1EZSC 3UFAA 1Z6JH 4D9QA 1O3OA 1VJAU 4H42U 4A92A 1GMHG 2GGVB 1K2I1 3I78A 3MH4A 3NZIA 2O8MA 1GL1A 5DP9A 1C2KA 1ETSH 2AGGX 2OUAA 1OSSA 1MD8A 1LVMA 7KMEH 2OCVB 3M36A 1DUEA 2OC0A 3SHAH 1N6YA 4GHTA 1TGTA 2OQ5A 2H9HA 1MCTA 3GCHB 2ANKH 3LKWA 2J4IA 3MU1A 4ABEA 3UNRA 1QBNA 4NSVA 3SGBE 2BVRH 1C1MA 3PTBA 2BLWA 3D62A 2BLOA 1C4V2 1MAYA 1OX1A 3GY5A 2BXUH 5F6MA 1P03A 2F9VA 1KTTB 1LHDH 2YOLA 3A7XA 3ZZCA 1S6FA 2YNBA 1LQDB 1WQVH 1TQ0B 1QFKH 4CHAB 3A89A 1SQAA 2BY9X 1IQNA 2FXRA 3ZZ9A 2WYGA 2AMPA 1DFPA 2BQ7B 3KIDU 2SNVA 1UTLM 2NU3E 4FUFA 2G8TA 2A1DB 1QTFA 2ODYB 3LGVA 1FY4A 3A86A 1Y59T 4TY6A 3TGKE 5A0AE 8GCHG 1O2VA 4Y7AA 1XX9A 3BTQE 2ZFFH 2FOHA 3H5CB 2R2MB 1ZMNA 4Y8YA 4YLUA 3NUMA 1O2MA 1OP8A 2GV6A 1HV7A 1OP2A 1ANBA 2XBWA 2C8XB 2XC5A 1HNEE 2ZHQH 2AFQB 3NWUA 4YM9A 3EQ0H 2F9BH 2O9QA 1FN6A 2FEQH 1ESAA 2FOMB 3NXPA 4TWWA 4WF8A 2UWOA 4JYVH 3A7TA 4Y0ZE 1KXEA 4CRCA 4NFFA 2BDAA 2GDDA 3M3TA 5LH8A 3URDA 4WWYA 1IHSH 4CRFA 2PV9B 1GHAF 1NS3A 1L1JA 1F7ZA 1SR5C 4XE4A 1TA2A 1P2OA 2J94A 4ESTE 4I8HA 2ZU3A 1QHRB 1DSUA 1D9IA 5CE1A 1AKSA 3SU0A 3T2NA 1C5ZB 4YT7H 3AAUA 1HAVA 4AFQA 1LTOA 4MNYA 3DT0H 2BY6X 4X2XA 1LCYA 2Z9GA 1ZGIA 4ZXXH 3MU8A 3C27B 5FAHA 1GI7B 1EAIA 1Y5AT 1YGCH 3U9AH 4IS5A 2VH0A 2M5TA 1B0FA 1J17T 3UIRA 3VB3A 1C1PA 2XYAA 1AWFH 1KDQB 2VIVA 9LPRA 1TX8A 4B74A 1GBKA 1OWIA 1GGDC 4ASHA 1W0ZU 2V35A 4NIYA 5HXFA 4GUXA 1NC6A 2FI4E 4ZHMU 1GJ7B 1T8MA 2P93A 1QB6A 4B1TA 3A8BA 1QBOA 1YBWA 3MU0A 4K5ZA 1A1RA 4OS2A 4YLQH 1Z6EA 1AO5A 2WPHS 2AH4X 1EZXC 1XUGA 1TRMA 3MO6A 3T27A 1HUTH 1FY3A 1QJ1B 2D26C 3RXAA 3GY3A 1YPJH 5EXNA 7LPRA 1ZSLA 2THFB 2GT7A 4X1RU 3PMHB 1TPSA 4XBDA 4SGBE 3BTFE 1VITH 1GHVH 5GDSH 5A0BA 2A2XH 1ANEA 1NFUA 1TAWA 4BTTB 1SGTA 1O3LA 3E91A 2P94A 2WPLS 1BJUA 2BD3A 3ATMA 3Q00A 2ODPA 1YPHE 3VB7A 2H2ZA 4R8TB 2G5NA 4O3TA 1F0RA 2ZFPH 2HVXA 4YO9A 1S83A 2CF9H 3M3SA 3ENSB 5C2ZA 2WUBA 3TJOA 1AVXA 5EXMA 3BEFB 2HNTC 3SU4A 1G3CA 1RTLA 1ZSKA 2OBQA 2Y5GA 5AFYH 1VGCC 1UTQA 1W7GH 3GYMA 3SOSA 4KTCA 3RDZA 1O5EH 2ZECA 3UQOA 1TGCA 3VGCB 4Y79A 2FPZA 1YLCA 1THSH 1WUNH 1TNKA 3UREA 2VINA 3U69H 2ZPSA 1Q2WA 4WMEA 3QK1A 2R2WU 2GX4A 1BB0B 3U98H 2CV3A 1THPB 2F91A 4NWKA 1MTWA 1IHTH 1T31A 3UNQA 1TBQH 2WPJS 1BMMH 1W0YH 1GL0E 1O35A 1KLTA 1W8BH 4J1YA 1AVWA 1ELCA 1QNJA 3LDXH 3K65B 1PPGE 2A45B 5DP4A 4D7FA 2AGIX 1LHFH 2XCNA 2FODA 1GI8B 1O2JA 2W26A 6LPRA 3SUGA 3RC6A 4IC6A 3UR9A 1O2WA 3TJNA 5A2MH 3SJ9A 1LPKB 2BDCA 1LKAA 1G2MA 1MZAA 5JBBS 3S7HB 1SBWA 1HFDA 2D2DA 1O30A 1BUIA 2VIOA 4BTUB 1W3CA 3U1JB 1J8AA 5LPRA 1SC8U 2Z3DA 1CT0E 6CHAC 2OP9A 1BTUA 4WXVA 1YPMH 1S0QA 3W95A 2C3SA 2FDAA 1TX7A 2HWLB 4AFZA 3ZV8A 3BTEE 4DGJA 2CGAA 1SHYA 1RTFB 5JPMH 1C5PA 2G00A 1OWJA 4I8JA 2SGPE 4HI3A 3SV2H 2H1UA 3RU4T 1K1MA 1CT2E 1J15A 2FTLE 1ELBA 1WOFA 2GMTB 1NPMA 2VWOA 1BDAA 3ZV9A 3VB6A 2UUFB 2ALVA 4QT8C 1MD7A 1K1NA 3EDXB 1AE8H 3ATKA 2C8ZB 1MAXA 2R3UA 1AHTH 1LVOA 4UFDH 3SUFA 1E35B 1O5AB 1HJ8A 3LU9B 2TGDA 1EOLA 2VWNA 2ZI2H 4B76A 2AERH 3Q3YA 7GCHF 1FXYA 4DJZB 1FI8A 2AIPA 2J38A 3MNBA 1O3JA 5GXPA 1LPZB 1UK3A 4R0IA 3SI3H 1XXDA 2H5CA 1GPZA 1AVGH 3QX5H 1HJAC 1VCQA 3CS0A 1OKXA 2PWXA 1SGIB 1SGCA 1P2QA 1EOJA 2QXGA 3B8JA 2Y7ZA 2PSXA 1AZZA 4JZDH 2BXTH 1CHGA 2CMYA 1XM1A 5FX6A 4JZ1A 1IQHA 1Z71A 4YT6H 3BV9B 4YOIA 3Q3XA 1V3XA 5DP6A 1E0FD 4FU7A 2W3IA 5C3NA 1A5GH 2ZGHA 4I31A 4BAHB 1GHBG 1C1SA 1LDTT 2CXVA 3R0FA 2J95A 1UCYH 1DLKB 2ANWA 2PW8H 2Q6FA 4CBOA 3AW0A 3DD2H 3M7UA 1MMJN 1GBMA 1MCVA 4ABBA 1GJ6A 3BF6H 1TFXA 1O3IA 3ATLA 3BTKE 3VXFH 3RXSA 5L30H 1HAPH 1P11E 1ELVA 3AVZA 2ZDKA 3ZZ6A 1ELDE 1GBBA 3F9EA 3SORA 3MNXA 1U6QA 2Z9IA 4UFGH 1CT4E 3LIWA 2EA3A 1C5SA 4Q2KA 4BOHA 1T8LA 4ZH8A 1D6WA 1XMNB 3OYPA 1OP0A 1H8IH 1NRPH 3LOXA 1GJDB 4ZXYH 1C1UH 1O33A 1G30B 3A8CA 1SMFE 4A1VA 2PUQH 1TPOA 5FXLA 2VWLA 3ZVAA 4NFEA 3SJKA 3D65E 3TNSA 1QB9A 3KQCA 4NWLA 1QIXB 3PMJA 1MKWK 1FPCH 1FNIA 2BYAX 1GDQA 2FI5E 1C9PA 2VH6A 3RP2A 4ZAEA 2B7DH 1DM4B 1Z1IA 1V2LT 9ESTA 2AMQA 2B5TB 3SU3A 1UCYK 1PPBH 2JH5D 3GISB 3RXJA 2DE8A 1BITA 2B8OH 1VITG 1YPEH 1KXBA 1ABJH 4OGYA 2G52A 5E2PA 1QL9A 3GYLB 2Z9KA 3ODDA 5GWZA 1PJPA 3BG4C 1TBRH 2UUKB 4MPVA 1UK2A 5K7RA 8LPRA 2IPHA 1L1GA 1RD3B 1K28D 1EPTC 2HALA 5JB9S 2BDBA 2ZFTA 1ANDA 2ZZUH 1WBGB 3BTTE 3MH5A 1GI1A 1C2DA 1DLEA 1GBTA 1AB9B 1O3AA 1S82A 1BRUP 1T4UH 2RCEA 3Q3KA 5T6DA 1E36B 5EPYA 4XBCA 2Y81A 1NY22 3K6YA 1HLTH 1H4WA 2BLQA 1TONA 2QF0A 2VB0A 4JZIA 1AFEH 1LHGH 1QQUA 1YLDA 2Y7XA 3S0NA 1HAIH 1TQ7B 4MVNA 2QXIA 4LK4A 4AN7A 2CHAC 1GI6A 1W10U 3U8RH 1JWTA 1GI4A 4MQAA 3RXLA 1GI3A 1YCPH 4LZ4B 1GG6C 2XWBI 1ZPZA 2BVXH 2P8OC 4AGJA 2PGBB 4KTSA 2CF8H 2V3HH 3E90B 4D8NA 1AFQC 3QTVH 1DY8A 3LGWA 3HKJB 4CREA 4D76A 1BTYA 1BJVA 3EAJA 1BBRK 2FMJA 1MUEB 4Z0KA 4DVAU 3NKKA 3QZQA 3ZVBA 5T6GA 1HIAA 1TX6A 2VVVA 2PKAA 1DICA 1OWDA 1A61H 2GVFA 2Z3CA 2O8LA 3STIA 5K0HA 2FS9A 1AQ7A 3L33A 3RXRA 3M61U 3EA9A 4U01A 3PLPA 3PYHA 4WH6A 5DP5A 1QR3E 2SFAA 1GI2A 1ZR0A 3CENA 1BZXE 3BIVH 1IQKA 4XOJA 2C8WB 4Q7YA 3IG6B 1MBMA 1W2KH 3DHKH 4WMFA 2FOBA 1V2NT 2D1JA 1IQFA 1PQ7A 1KTSB 4H4FA 5EOKA 4AYYB 5EW1H 1P8VC 4ISIH 3FP8E 5ABWA 3PMBB 2ZFRH 1V2MT 5HYOA 3RXFA 2HGTH 1Y3YA 4WY3A 1ZSJA 2ZHDA 2GT8A 1FONA 3OSYA 4IN2A 1DY9A 4Y8ZA 3SN8A 1C5VA 2EC9H 1UHBA 4GSOA 4K1EA 1TNJA 1YF4A 2FS8A 2P95A 2W5EA 5E8EH 2C8YB 4HTCH 1SGQE 2P59A 1ESTA 4MTBA 3SJIA 1EZQA 3K9XB 1EB2A 2FLBH 1WV7H 1B7XB 2FM2A 1G3DA 4Z6AH 1HDTH 2Z9JA 4Q80A 1CA0C 2G4UA 3E0PB 1V2WT 3SNDA 1TRYA 2F83A 6GCHG 3FP6E 3EA7A 3N7OA 1O3CA 1C1TA 1S85A 3QUMP 2Z3EA 3MU5A 1V2ST 3RM2H 3O8CA 2IN2A 1P9UA 1GI5A 1GMCF 3PLBA 2VVUA 5FBEA 2BD7A 4X1QU 5EODA 3NK8A 3LONA 2A7JA 1OWHA 1DUAA 1VCPA 1V6DA 1H9IE 3GDUA 2FI3E 3KNXA 1JIMA 1GI0A 3BEUA 3PB1E 5J4SA 2OBOA 3RMMH 1O2IA 2EEKA 1JXPA 3BSQA 2F3CE 1S5SA 3MYWA 4AZ2B 1B0EA 1UTPA 1CU1A 1YYY1 3RC4A 1P2IA 1BTZA 1Z8RA 2ZDLA 5HM2A 4A7IB 4NCYA 1HGTH 4NGAH 5TCCA 5LPEA 3S7KB 1O2PA 3TH2H 5TJXA 1CHOF 5FPTA 5TCAA 1DXWA 3SQHE 3A82A 1BT7A 5AHGH 1AUTC 2A4GA 4JYTA 2BY7X 3RM0H 2FESH 1OPHB 4OS5A 4KP0A 1EP6A 3ESTA 4CRAA 3ZYDA 1CVWH 3E8LA 1O37A 2WINI 1NU9A 3HPTB 1OWKA 1O2NA 2A31A 5I46H 2QY0B 1THRH 1GBAA 2R3YA 3UNSA 4RN6A 3TGIE 4DY7B 2B0FA 1B5GH 2NU4E 2BY5X 1W7XH 3SNAA 4ZKOU 3UOUA 4LOYH 3LT3A 5C5OA 1VJ9U 2FOEA 1BRBE 2ZQ2A 1YPGH 3SJ8A 1ETTH 3A81A 1EX3A 1DOJA 3UUZA 1HPGA 1ZZZA 1IAUA 1EATA 5C1UA 3ZZ5A 1A0LA 2ZHFH 1V2JT 5HGGA 2ZTZA 2BD4A 2FYQA 4OS1A 3GY6A 5JYIA 4PROA 2RA0A 1O2YA 5AVDA 3SNBA 3P8OA 2ZCKP 3ATWA 4ZHAA 2J9NA 1TABE 1RRKA 1INCA 1ELEE 1A46H 5EG4A 1SQOA 1GGDB 4K60A 3G01A 5AF9H 2BTCE 2V3OH 1BHXB 2Y6TA 1SVPA 2G4TA 1A2CH 1C2JA 2P3UB 5E0JA 1GDUA 1GBLA 1KDQA 4Q7XA 3S9CA 5C1XA 3F9HA 1RTKA 2GCHF 1V2VT 2BDGA 1BTXA 2ZU4A 1WTGH 2OTVA 3V0XA 2PTNA 4B2BA 1H8DH 2SGQE 1H1BA 1O5CB 1GDNA 1TGSZ 2XBVA 6ESTA 2ZHWH 1HAXB 1VCWA 4AFUA 1BMAA 3KN2A 1XUHA 1ZHMA 2XRCA 1YCPM 4JMYA 5EQQA 1O5BB 5EXLA 1KY9A 1O31A 2HOBA 3RXBA 3LH1A 1C2GA 1K1JA 3PM3A 5EW2H 3HATH 1SSXA 2JKHA 3ZYEA 2VU8E 4KKDA 1HAYB 4AOQA 5L6NH 2H9TH 4MPWA 1F2SE 1WAYB 1QA7A 3W94A 1BMLA 3IITA 2AMDA 1AMHA 1IQLA 1A5HA 2QIQA 1ZTKA 1G2LA 3O8RA 3RXGA 3M5LA 3M37A 1UVSH 5SGAE 4OGXA 1C5RA 1TPPA 3E6PH 3LC3A 1D3PB 1QY6A 4MNWA 1LHCH 1C5NH 1FAXA 2BDHA 2ZGXH 1VITF 1VGCB 2ZGBH 2NWNA 1UVOA 2Y82A 4CR5A 3SJOA 3BTHE 1QL7A 1E38B 2H9EH 1HAGE 2LPRA 3TK9A 5JBAS 1OOKB 4KGAA 1C2LA 3EYDA 1CGJE 1SGYE 2Y5FA 1A5IA 1KLJH 1GMDF 2BQWB 1ZHRA 3KQEA 3L6PA 3AAVA 4YOGA 5A8ZA 2UUJB 2BD2A 3AASA 2WPIS 2PLXA 1HAHH 3T26A 2VIPA 2STAE 1P10A 2FIRH 2KAIB 1FMGA 3P6ZB 3BTGE 4ABIA 2ZDVH 1PYTC 2QC2A 1H9LB 3SU2A 2VJ1A 2ZFSA 1SGNE 4Y71A 1PQAA 3VB5A 1V2OT 3HK3B 4E05H 3GY2A 4E7RG 1DPOA 1FV9A 4K1TA 2ZGCA 3LGIA 1L0ZA 1KIGH 1RGQA 1RXPA 6CHAB 4O97A 2W7SA 1G37A 1O2QA 3QO6A 1OYTH 4ZKNU 3ZZDA 1FAKH 2A5KA 5FX5A 2G81E 3GCTF 4X6PA 5FPYA 1O5DH 1CGIE 3MNCA 4BAMB 3SBKA 3RLWH 5L2ZH 3MO3A 2BB4A 1QBVH 2PR3A 2BDIA 3LJJA 5CMXH 1FIZA 1EZUC 1O2TA 2OXSA 3HGPA 3MMGA 1KLIH 2SGDE 1SFIA 2XC0A 1NU7B 3T29A 3PO1C 2IOTA 2FLRH 1GJAB 2XNIA 3BTWE 4DURA 3SV7A 1D3DB 3BTME 1ETRH 1GBFA 2F9UA 5JBCS 2GKVE 3NCLA 3V3MA 1UTOA 4GPGA 2A5IA 2PKSC 3PWBA 1F0UA 1HBTH 1MKXK 1P57B 1HJAB 1G36A 3QWCH 5E0HA 1WCZA 4HFPB 1Z8JB 4ABFA 4HGCA 4UFEH 1IQGA 2A0QB 2WPMS 3FVFB 2PSYA 1ZRKA 2VGCC 3VEQB 1A7SA 3A80A 1H9HE 2I6QA 1C5MD 1EJAA 2CJIA 3RXEA 4AB9A 4AFSA 2ZGJA 2F9OA 1O3PB 1C5YB 3PTNA 4Y7BA 1NRQH 4FUEA 3F1SB 2ANYA 3SU1A 1CBWC 1K1IA 4ZROA 2HPQH 1VR1H 3A84A 1P09A 1FDPA 1O3EA 2ZO3H 4IN1A 1TWXB 1EAUA 3K6ZA 2QF3A 2XWAA 1HXEH 1ZYOA 1GVKB 1MKWH 4X2WA 1C1NA 1AUJA 2P16A 2A4QA 3GICB 2WV5A 4FUHA 3MHWU 1GMHF 3DFLA 1SPJA 2ESTE 2Z7FE 3RLYH 3M5MA 3KEEA 1HXFH 1C4Y2 2YNAA 3V13A 2G51A 1GJ4H 1KSNA 1MTVA 3MNSA 6GCHF 1OWEA 1C4U2 1VZQH 1P2NA 5DJ7A 3F9GA 3M35A 1K22H 1HCGA 1FY8E 1DVAH 2GP9B 2V6NA 2WPKS 4TPYA 3O8DA 4BAOB 1C1VH 5JB8S 3ODFA 1NESE 1YM0A 4ISHH 1NRNH 3TH3H 3KGPA 1O3HA 1XUFA 4I8GA 1O2ZA 5F8ZA 1FY5A 3M5OA 1O3GA 1CA8B 4K8YA 1YP9A 1BQYA 1Z8GA 5FBIA 1PFXC 3RXVA 1ELTA 3ZZ3A 3SU5A 1NN6A 2GTBA 4NIWA 3RXQA 4J2YB 3A7ZA 1DWDH 3B23B 1N8OC 3T25A 3SNCA 3DUXH 4DIIH 3HKIB 3RU4D 1SGFA 5FPSA 4Y0YE 3PMAB 4Y8XA 4I8KA 3D49H 5IYTA 1S81A 1LO6A 4GAWA 2ZWLH 3SO3A 1C1WH 1K1OA 1O3DA 3SV8A 2PHBA 1C1RA 3P95A 1MU6B 1C1QA 5EQSA 8GCHF 3BG4B 3TK6A 1BMNH 3H7OA 5F03A 2HLCA 1J9CH 2FO9A 4I8LA 5CHAC 2AGEX 3TK5A 3TVJB 3KQDA 1O38A 1EPTB 1F92A 4ABJA 1L2EA 2HRVA 1JIRA 2SGAA 4B2CA 1BBRH 3LH3A 1Y8TA 3ZVGA 3RU4E 1BA8B 2PTCE 4O9VA 1SOTA 4ZKRU 3PROA 4THNH 3UPEA 1KXDA 1FZZA 4X1PU 5AFZH 1FQ3A 5DP8A 5ETXA 4Y76A 3A8AA 3BTDE 3CS7A 4M7GA 2A32A 1NM6A 3P70B 3IWMA 2Z6BD 1LHEH 4NA9H 4AGKA 2CHAB 2TGTA 2BD9A 2J34A 5F8TA 1ZJKA 1V2QT 4YTAA 3KHVA 1GG6B 3L3TA 2GDEH 1XXFA 2P8OB 2ULLA 4FU9A 5DPAA 1ZLRA 3ZVFA 3V7TA 1AFQB 1PYTD 2R9PA 3U8TH 2BOKA 1N6XA 5DG6A 2A7HA 1TA6A 1SLUB 1QGFA 2GZ9A 3NPSA 3RXDA 2C4FH 3RXKA 1GCTC 3SGAE 1ORFA 1XVMA 4FUGA 3TJVA 3LPRA 4XSKU 1PPEE 1TGNA 2HNTE 1NFWA 4NIXA 1ZGVA 2GV7A 3I29A 3O8BA 1QURH 4B71A 1PQ5A 3UWJH 1GBHA 1GBCA 1EXFA 3ITIA 4KELA 3SQEE 2OQUA 2UWLA 2QYIA 4K8BA 5BRRE 8KME2 2Z9LA 4OS4A 1ID5H 1P04A 1O0DH 1O3KA 2ZDMA 4JZFH 3PV4A 2VIQA 5H4IB 3KL6A 1TALA 1ELFA 2ZU5A 2QAAA 4X6OA 4WJG2 1MU8B 4AG1A 5A8XA 2FZZA 4F49A 4OS7A 5ESTE 1IQEA 4X1NU 1SFQB 4ZMAH 1FUJA 1ZMLA 3E3TA 5GCHG 3STJA 1SHHB 3TJUA 4NA8A 3UOPA 3RMOH 1GHZA 3Q77A 3UTUH 3A88A 4BANB 1YPHC 3FAOA 3OTJE 3ZZ7A 1GBEA 2CN0H 3SU6A 2HPPH 1AY6H 4MLFB 1QRZA 1HYLA 2BD5A 4Y11E 4U32A 4I33A 1AZ8A 1EKBB 4X8UH 3JZ2B 4X8VH 2BZ6H 5C1YA 3SUDA 1NZQH 4XFQA 3QDZB 1TLDA 4IMZA 2GCTC 2TRMA 1XKAC 1O2GH 4GCHG 1CA0B 2EI8A 4CH2B 3TPIZ 2OD3B 4YZUA 1SLVB 3ATIA 1PPHE 3HGNA 5ESBA 3UY9A 1E37B 5EQRA 2ZEBA 7GCHG 1EUFA 3ZVEA 1O2LA 1QA0A 4BAQB 1XUJA 3SNEA 1JRTA 2ZPQA 1GJ9B 1FN8A 1O2XA 1D4PB 1C9TA 1WU1A 3EA8A 3LGUA 1GJCB 1P06A 2JETC 4JYUH 4UFFH 2VIWA 4JK5A 2BDYA 1C5UA 4NA7A 2GD4B 2VIDA 3FANA 1BCUH 1WTHD 4FVDA 2OC7A 3TITA 2PFEA 4FUBA 3A7YA 2RA3A 1GJ5H 3MWIU 3SW2B 3S9BA 1TE0A 4X1SU 1ZMJA 1HRTH 2BZAA 1AN1E 4NZQA 2IJOB 1XVOA 1L1NA 4MDSA 4X8SH 4X0WU 1NFXA 3E1XB 1RIWC 2NU0E 2VNTA 1MTNC 1RJXB 1Y3WA 2SGFE 3QN7A 3URCA 4I7YH 1TNGA 3QZRA 1D3TB 3T62A 1DWCH 4DCDA 2OC1A 3KCGH 1SOZA 4FUJA 1C2HA 4ISLA 5EU8A 1V2TT 1EB1H 1RFNA 3A7WA 1D6RA 3FP7E 2WV4A 2BM2A 1V2PT 1C5WB 2ZIQH 1MQ6A 2FX6A 1BTPA 2V0BA 1ZRBA 5DP7A 1G3EA 5A09A 3RUOA 1GBJA 3M3VA 4X6NA 3GCHC 1DXPA 2QN5T 4MPXA 1SL3A 2ASUB 1BHXF 4JCNA 2RG3A 3R3GB 4HZHA 1YKTA 3GCNA 3P92A 3RXUA 3OY6U 2R0KA 3ELAH 5FCKA 1FY1A 3VPKA 4INHA 1DDJA 4WVPE 3RXCA 2AEIH 1O34A 3P8NA 4WH8A 3RXTA 4CHAC 2Q1JA 1SGDE 1W12U 1HJ9A 4XDEA 3A87A 1S0RA 4CRDA 2A4RA 5DKMA 1KXAA 1XUIA 4UD9H 5I25A 2BX3A 1S6HA 4UONA 1Q3XA 3LJOA 1DSTA 1GI9B 1C5TA 3ZVDA 1KXCA 1D3QB 1QL8A 4H6SB 3MTYA 2XBXA 2C93B 1L4ZA 4ZUHA 5BPEA 5JBTA 1HB0B 1Z8IB 5PTPA 3F9FA 4FUIA 1LKBA 2STBE 3GDSA 1P0SH 1O3BA 1LQEA 2H6MA 2QV1A 3H7TA 1EAXA 2LNCA 4VGCB 2QGRA 1SI5H 5IDKA 1A4WH 4YESB 2AS9A 2HNTF 5GIBA 3LGTA 1F0TA 1LVBA 1Z1JA 1GHBF 2Z94A 5DGJA 1JMOH 1JBUH 2UWPA 1ABIH 2O8TA 3DA9B 1ELGA 3FFGA 1ZJDA 4BTIB 1G3BA 4K3JA 4ABAA 4JZEH 1AKSB 4VGCC 5EGMA 2XW9A 4K69A 1L4DA 2A4OA 3A83A 1HAVB 5T3HA 3BIUH 1UVTH 1Y5UT 2Q6DA 4IMQA 2H5DA 1NO9H 2JH0D 3GY4A 3SZNA 2BLVA 3M7TA 1OYQA 3EE0B 1UCYE 1AWHB 2FP7B 1UVPA 2OC8A 1Y5BT 3QTOH 2ZC9H 1V2KT 1UK4A 2OINA 4CR9A 1UTKA 3JZ1B 1GVZA 4AORA 1NTPA 1P05A 2P3FH 1ESBA 1E34B 4IW4E 3MO9A 1F0SA 1O39A 2ZG0H 2ZFQH 5GPIB 1ARCA 4DOQA 1BTHH 2AYWA 5J4QA 3RXIA 3S9AA 1F5RA 2D8WA 1DT2A 4A1TA 1GBIA 1DWEH 4A1XA 1TOMH 1LVYA 3FZZA 3FZDA 3LC5A 1GJBB 3A7VA 3HK6B 5LPFA 1MBQA 1O36A 1WYKA 4BXWA 1C5QA 1LPGB 4O3UA 4F4OC 1HAOH 3QLPH 1P12E 3MU4A 1TMUH 5LGOA 3M5NA 2ZHEH 2XCFA 2QXHA 2FOGA 1JRSA 2WUCA 1O2HA 1OXGA 1P9SA 1O2RA 1JOUB 4UEHH 4TWYA 2BOHB 1DE7H 2ZPRA 2ZP0H 2FYRA 1ZTLA 3RXHA 5FHTA 3RXMA 1KXFA 3GCOA 2KAIA 1QJ6B 1BBRE 2AIQA 2BQ6B 1O3FA 4UDWH 4FXGH 2ZU2A 1A3EH 1C5LH 2XXLA 3T5FH 2GZ8A 2SGEE 1DX5M 4FU8A 1MKXH 3CP7A 3E16B 3A85A 4ZKSU 1Z7KA 2PUXB 2ALPA 1GWAA 2QXJA 1TB6H 1TNIA 1GBDA 3ZVCA 1PPCE 3A8DA 3VXEH 2BD8A 1QRXA 1TNHA 3BN9A 1FLEE 1O2KA 2J92A 1GMCG 1MTSA 1ARBA 1SGRE 3ZZBA 1GVLA 5HMAA 4BXSA 3PO1B 2OLGA 3C1KA 3BEIB 3VGCC 1O2UA 1P02A 2BMGB 4ISOA 5JDUB 2A7CA 1DWBH 2RDLA 2G55A 4INKA 2ZCLP 2UUYA 4Y6DA 4CBNA 1K21H 2PKSB 1K1PA 1O5GH 1BRAA 4RKJB 3TLOA 1SQTA 4NZLA 3ZZAA 2NU1E 4ABHA 2ZF0H 4NG9H 1Y3XA 4FUDA 5GCHF 3MI4A 3RC5A 4CRBA 1CHOG 4K1SA 1C1OA 1TIOA 1K1LA 1SLWB 2VGCB 3DFJA 1MH0A 4UE7H 3UQVA 3WY8A 3GDVA 3OU0A 1QRWA 5E2OA 4A5TS 5EPNA 3KQBA 5T6FA 1WSSH 1Q31A 1X7AC 1C2EA 2BVSH 1EAWA 4B73A 3LGYA 1CBWB 1RS0A 1TGBA 5DK1A 3UR6A 1SLXB 1TRNA 3VB4A 4MNVA 1IQIA 1MTUA 4X2YA 1T4VH 1A0JA 1P3CA 1C2IA 1MZDA 4MPUA 1O2SA 5FCRA 3TIUA 1FJSA 1UVUH 3QGJA 4IBLH 4AB8A 4GCHF 2ZTYA 1ACBE 3GY7A 3QGNB 1Y3VA 4RSPA 1V2RT 3GY8A 3U1IB 4CRGA 2GMTC 1GHYH 2A5AA 1EQ9A 4CH8B 4U30A 5GJ4B 1J14A 1ELAA 1GCDA 1M9UA 1GHAG 4OS6A 3TNTA 4GHQA 1OS8A 1P2KA 5L2YH 1NRSH 1ZHPA 2ZQ1A 2XBYA 4INLA 4YOJA 4D9RA 3RMLH 3P8GA 3RXPA 1T8OA 3SGQE 1C5XB 3MOCA 1AD8H 1EP5A 1G32B 2W3KA 1QQ4A 1TYNA 1ZPCA 1FPHH 4NSYA 1N8OB 1DANH 4X8TH 1P2MA 5A0CA 4NIVA 1QJ7B 3RMNH 4DIHH 3VFEA 4E06H 2ANMH 1W13U 4Q7ZA 1UTMA 1A0HB 4GLYA 2ZU1A 1AGJA 2ZA5A 1ANCA 1FIWA 1ZPBA 2GCHG 2DE9A 2NU2E 4ISNA 3B9FH 2SNWA 2FTMA 1N1LA 3SV6A 1IOEA 1J16A 5CHAB 2XC4A 1GHXH 7ESTE 3RXOA 1EJMA 4TY7A 1C5OH 1HAZB 2DUCA 1NROH 3OX7U 3AW1A 1UJ1A 3P8FA 1QCPA 3F68H 2W7UA 1ZTJA 2ODQA 1TNLA 4GVUA 1C2MA 3F6UH 3V12A 1YPLH 1F5KU 1V2UT 3SUEA 1ZOMA 2QCYA 1EPTA 2GZ7A 1BTWA 1T32A 4DT7B 4ZHLU 4LXBH 3Q76A 3MH6A 3T28A 3UWIA 1T8NA 2TGPZ 3TH4H 2Y5HA 2R0LA 5B6OA 1A3BH 2EI6A 1YC0A 3GOVB 2ZTXA 2TBSA 2FOCA 4O03A 2VVCA 2VWMA 1SGEE 1G9IE 4TPIZ 2FWWA 5A8YA 4JK6A 1PPFE 3TGJE 2BHGA 2P3TB 4KTUA 1DS2E 1GCTB 3MH7A 3OY5U 5HM9A 1TOCB 4X2VA 1AI8H 2ILNA 1LMWB 2J2UA 4AYVB 4BAKB 4U2WA 4AX9H 4BNRA 1UTJA 4DG4A 1GMDG 1CQQA 1TBZH 2Y80A 4WXIA 2ZDAH 1BOQA 2C90B 1IQJA 3PWCA 3M7QA 1EJNA 5F8XA 1TMBH 3KF2A 3S69A 4D7GA 4FVBA 3BG8A 4XBBA 1AIXH 1QB1A 1MQ5A 4DW2U 1S84A 1SG8B 1CE5A 2JH6D 5DP3A 1CSOE 4Y10E 2A2QH 2TIOA 3K2UA 3SI4H 4E7NA 2QA9E 2TGAA 2TPIZ 2K1QA 4FUCA 1AB9C 2O8UA 1W11U 4K2YA 1O32A 2O8WA 1GHWH 1SB1H 1PPZA 1UO6A 1C2FA 2Q6GA 1T7CA 2XTTB 2F9NA 3GCTG 1P01A 2B9LA 2BX4A 4IC5A 1YPKH 1SGPE 3I77A 3P17H 1W14U 5C20A 1P2JA 3EGKH 1HIAB 4MNXA 2ZKSA 1UTNA 4B75A 4H6TA 2PKAB 2ZNKH 5DO4H 1NRRH 3SV9A 2FOAA 4X6MA 2ZCHP 1NFYA 2GCTB 4IGDA 4TYDA 1O2OA 4ABGA 1CGHA 1O3MA 1XKBC 1XUKA 2WYJA 1NT1A 2G5VA 2ZDNA 1UMAH 1CO7E 3E0NB 3TU7H 4LZ1H 1O5FH 1KYNA 2PGQB 2FOFA 1BRCE 1BIOA 1AU8A 3ZZ8A 5G4BA 3ZZ4A 4A6LA 8ESTE 1Y3UA
chains in the Genus database with same CATH superfamily
3MFJA 4I32A 1GJ8B 2JETB 2BY8X 4RKOB 4ABDA 1F5LA 5C5NA 2FX4A 1AE5A 3N99A 5C67A 1YCPK 2EI7A 2GJGA 4AG2A 1P3EA 3D23A 4B2AA 1O3NA 4WMDA 3PLKA 1EASA 1TMTH 5T1VA 1SGFG 1UHBB 3U8OH 3SHCH 5E0GA 1RIWB 2F9PA 4MG3A 1MTNB 3OEED 1TPAE 1WQSA 4SGAE 1PQ8A 1DITH 1K9OE 3F2FA 3FKSD 1IQMA 2I6SA 1EZSC 3UFAA 1Z6JH 4D9QA 1O3OA 1VJAU 4H42U 4A92A 1GMHG 2GGVB 1K2I1 3I78A 3MH4A 3NZIA 2O8MA 1GL1A 5DP9A 1C2KA 1ETSH 2AGGX 2OUAA 1OSSA 1MD8A 1LVMA 7KMEH 2OCVB 3M36A 4XRNA 1DUEA 2OC0A 3SHAH 1N6YA 4GHTA 1TGTA 2OQ5A 2H9HA 1MCTA 3GCHB 2ANKH 3LKWA 2J4IA 3MU1A 4ABEA 3UNRA 1QBNA 4NSVA 3SGBE 2BVRH 1C1MA 3PTBA 2BLWA 3D62A 2BLOA 1C4V2 1MAYA 1OX1A 3GY5A 2BXUH 5F6MA 1P03A 2F9VA 1KTTB 1LHDH 2YOLA 3A7XA 3ZZCA 1S6FA 2YNBA 1LQDB 1WQVH 1TQ0B 1QFKH 4CHAB 3A89A 1SQAA 2BY9X 1IQNA 2FXRA 3ZZ9A 2WYGA 2AMPA 1DFPA 2BQ7B 3KIDU 2SNVA 1UTLM 2NU3E 4FUFA 2G8TA 2A1DB 1QTFA 2ODYB 3LGVA 1FY4A 3A86A 1Y59T 4TY6A 3TGKE 5A0AE 8GCHG 1O2VA 4Y7AA 1XX9A 3BTQE 2ZFFH 2FOHA 3H5CB 2R2MB 1ZMNA 4Y8YA 4ZCNA 4YLUA 3NUMA 1O2MA 1OP8A 2GV6A 1HV7A 1OP2A 1ANBA 2XBWA 2C8XB 2XC5A 1HNEE 2ZHQH 5HKKD 2AFQB 3NWUA 4YM9A 3EQ0H 2F9BH 2O9QA 1FN6A 2FEQH 1ESAA 2FOMB 3NXPA 4TWWA 4WF8A 2UWOA 4JYVH 3A7TA 1W0JD 4Y0ZE 1KXEA 4CRCA 4NFFA 2BDAA 2GDDA 3M3TA 5LH8A 3URDA 4WWYA 1IHSH 4CRFA 3NRLA 4Q4LA 2PV9B 1GHAF 1NS3A 1L1JA 1F7ZA 1SR5C 4XE4A 1TA2A 3F2GA 1P2OA 2EY4C 2J94A 4ESTE 4I8HA 2ZU3A 1QHRB 1DSUA 1D9IA 1NBMD 3FO8D 5CE1A 1AKSA 3SU0A 3T2NA 1C5ZB 4YT7H 3AAUA 1HAVA 4AFQA 1LTOA 4MNYA 3DT0H 2BY6X 4X2XA 1LCYA 2Z9GA 1ZGIA 4ZXXH 3MU8A 3C27B 5FAHA 1GI7B 1EAIA 1Y5AT 1YGCH 3DCLA 3U9AH 4IS5A 2VH0A 2M5TA 5EJLA 1B0FA 1J17T 2F43B 3UIRA 3VB3A 1C1PA 2XYAA 1AWFH 1KDQB 3PV5A 2VIVA 9LPRA 1TX8A 4B74A 1GBKA 1OWIA 1GGDC 4ASHA 1W0ZU 1NBME 2V35A 4NIYA 5HXFA 4GUXA 1NC6A 2FI4E 4ZHMU 1GJ7B 2HVYB 1T8MA 2P93A 1QB6A 4B1TA 3A8BA 1QBOA 1YBWA 3MU0A 4K5ZA 1A1RA 4OS2A 4YLQH 1Z6EA 1AO5A 2WPHS 2AH4X 1EZXC 1XUGA 1TRMA 3MO6A 5EJZA 3T27A 1HUTH 1FY3A 1QJ1B 2D26C 3RXAA 3GY3A 1YPJH 5KGOA 5EXNA 7LPRA 1H8HD 1ZSLA 2THFB 2GT7A 4X1RU 3PMHB 1TPSA 4XBDA 4SGBE 3BTFE 1VITH 1GHVH 5GDSH 5A0BA 2A2XH 1ANEA 1NFUA 1TAWA 4BTTB 1SGTA 1O3LA 3E91A 2P94A 2WPLS 1BJUA 4P02A 5C94A 2BD3A 2F4LA 3ATMA 3Q00A 2ODPA 1YPHE 3VB7A 2H2ZA 4R8TB 2G5NA 4O3TA 1F0RA 3OTPA 2ZFPH 2LELA 2HVXA 4YO9A 1S83A 2CF9H 3M3SA 3ENSB 5C2ZA 2WUBA 3TJOA 1AVXA 5EXMA 3BEFB 2HNTC 1BMFD 3SU4A 1G3CA 1RTLA 1ZSKA 2OBQA 2Y5GA 5AFYH 1VGCC 1UTQA 1W7GH 3GYMA 3SOSA 4KTCA 3RDZA 3W1EA 1O5EH 2ZECA 3UQOA 1TGCA 3VGCB 4Y79A 2FPZA 1YLCA 1THSH 1WUNH 1TNKA 3UREA 2VINA 3U69H 2ZPSA 1Q2WA 4WMEA 3QK1A 2R2WU 2GX4A 1BB0B 3U98H 2CV3A 1THPB 2F91A 4NWKA 1MTWA 1IHTH 1T31A 3UNQA 1TBQH 2WPJS 1BMMH 1W0YH 1GL0E 1O35A 1KLTA 1W8BH 4J1YA 1AVWA 1ELCA 1QNJA 3LDXH 3K65B 1PPGE 2A45B 5DP4A 4D7FA 2AGIX 1LHFH 2XCNA 2FODA 1GI8B 1O2JA 3WWFA 2W26A 6LPRA 3SUGA 3RC6A 4IC6A 4FETA 1O2WA 3FOAA 3TJNA 3UR9A 5A2MH 3SJ9A 1LPKB 3N7DA 2BDCA 2HLDD 1LKAA 1G2MA 1MZAA 5JBBS 3S7HB 1SBWA 1HFDA 2D2DA 3AK5A 1O30A 1BUIA 2VIOA 4BTUB 1W3CA 3U1JB 1J8AA 5LPRA 2M2AA 1SC8U 2Z3DA 1CT0E 6CHAC 2OP9A 1BTUA 4WXVA 1YPMH 1S0QA 3W95A 2C3SA 2FDAA 1TX7A 2HWLB 4AFZA 3ZV8A 3BTEE 4DGJA 2CGAA 1VKYA 1SHYA 1RTFB 5JPMH 1C5PA 2G00A 1OWJA 4I8JA 2SGPE 4HI3A 3SV2H 2H1UA 3RU4T 1K1MA 1CT2E 1YY3A 1J15A 2FTLE 1ELBA 1WOFA 2GMTB 1NPMA 2VWOA 1BDAA 3ZV9A 3VB6A 2UUFB 2ALVA 4QT8C 1MD7A 1K1NA 3EDXB 1AE8H 3ATKA 2C8ZB 1MAXA 2R3UA 1AHTH 1LVOA 4UFDH 3SUFA 1E35B 1O5AB 1HJ8A 3LU9B 2TGDA 1EOLA 2VWNA 2ZI2H 4B76A 2AERH 3Q3YA 7GCHF 1FXYA 4DJZB 1FI8A 2AIPA 2J38A 3MNBA 1O3JA 5GXPA 1LPZB 1UK3A 4R0IA 3SI3H 1XXDA 2H5CA 1GPZA 1AVGH 1EFRD 3QX5H 1HJAC 1VCQA 3CS0A 1OKXA 2PWXA 1SGIB 1SGCA 1P2QA 1EOJA 2QXGA 3B8JA 2Y7ZA 2PSXA 1AZZA 4JZDH 2BXTH 1CHGA 2CMYA 1XM1A 5FX6A 4JZ1A 1IQHA 3EE7A 1Z71A 4YT6H 3BV9B 4YOIA 3Q3XA 1V3XA 5DP6A 1E0FD 4FU7A 2W3IA 5C3NA 1A5GH 3WWBA 2ZGHA 4I31A 4BAHB 1GHBG 1C1SA 1LDTT 2CXVA 3R0FA 2J95A 1UCYH 1DLKB 2ANWA 2PW8H 2Q6FA 4CBOA 3AW0A 3DD2H 3M7UA 1MMJN 2WV9A 2J5UA 1GBMA 1MCVA 4ABBA 1GJ6A 3BF6H 1TFXA 1O3IA 3ATLA 3BTKE 3VXFH 3RXSA 5L30H 1HAPH 1P11E 1ELVA 3AVZA 2ZDKA 3ZZ6A 1ELDE 1GBBA 3F9EA 3SORA 3MNXA 1U6QA 2Z9IA 4UFGH 1CT4E 3LIWA 2EA3A 1C5SA 4Q2KA 4BOHA 1T8LA 4ZH8A 1D6WA 1XMNB 3OYPA 1OP0A 4RT0A 1H8IH 1NRPH 3LOXA 1GJDB 4ZXYH 1C1UH 1O33A 1G30B 3A8CA 5DSFA 1SMFE 4A1VA 2PUQH 1TPOA 5FXLA 2VWLA 3ZVAA 4NFEA 3SJKA 3D65E 3TNSA 1QB9A 3KQCA 4NWLA 1QIXB 3PMJA 1MKWK 1FPCH 1FNIA 2BYAX 1GDQA 2FI5E 1C9PA 2VH6A 3RP2A 4ZAEA 2B7DH 5B6LA 1DM4B 1Z1IA 1V2LT 9ESTA 2AMQA 2B5TB 3SU3A 1UCYK 1PPBH 2JH5D 2J98B 3GISB 3RXJA 2DE8A 1BITA 2B8OH 1VITG 1YPEH 1KXBA 1ABJH 4OGYA 2G52A 5E2PA 1QL9A 3GYLB 2Z9KA 3ODDA 5GWZA 1PJPA 3BG4C 1TBRH 2UUKB 4MPVA 1UK2A 5K7RA 8LPRA 2IPHA 2XOKD 1L1GA 3OFND 1RD3B 1K28D 1EPTC 2HALA 3DSGA 5JB9S 2BDBA 2ZFTA 1ANDA 2ZZUH 1WBGB 3BTTE 3MH5A 1GI1A 1C2DA 1DLEA 1GBTA 1AB9B 1O3AA 1S82A 1BRUP 1T4UH 2RCEA 3Q3KA 5T6DA 1E36B 5EPYA 4XBCA 2Y81A 1NY22 3K6YA 1HLTH 4DT4A 1H4WA 2BLQA 1TONA 2QF0A 2VB0A 4JZIA 1AFEH 1LHGH 1QQUA 2J97A 1YLDA 2Y7XA 3S0NA 1HAIH 1TQ7B 4MVNA 2QXIA 4ACAA 4LK4A 2JDID 4AN7A 2CHAC 1GI6A 1W10U 3U8RH 1JWTA 1GI4A 1WDIA 4MQAA 3RXLA 1GI3A 1YCPH 4LZ4B 1GG6C 2XWBI 1ZPZA 2BVXH 2P8OC 4AGJA 2PGBB 4KTSA 2CF8H 2V3HH 3E90B 4D8NA 1AFQC 3QTVH 1DY8A 3LGWA 3HKJB 4CREA 4D76A 1BTYA 1BJVA 3EAJA 1BBRK 2FMJA 1MUEB 4Z0KA 4DVAU 3NKKA 3QZQA 3ZVBA 5T6GA 1HIAA 1TX6A 2VVVA 2PKAA 1DICA 1OWDA 1A61H 2GVFA 2Z3CA 2O8LA 3STIA 5K0HA 2FS9A 1AQ7A 3L33A 2JJ1D 3RXRA 3M61U 3EA9A 4U01A 3PLPA 3PYHA 4WH6A 5DP5A 1QR3E 2SFAA 1GI2A 1ZR0A 3CENA 1BZXE 3BIVH 1IQKA 4XOJA 2C8WB 4Q7YA 3IG6B 1MBMA 1W2KH 3DHKH 4WMFA 2FOBA 1V2NT 2CK3D 2D1JA 1IQFA 1PQ7A 1KTSB 4H4FA 5EOKA 4AYYB 5EW1H 1P8VC 3MQKC 4ISIH 3FP8E 5ABWA 3PMBB 2ZFRH 1V2MT 5HYOA 3RXFA 2HGTH 1Y3YA 4WY3A 1ZSJA 2ZHDA 3SYJA 2RDEA 2YMSB 3KYFA 2GT8A 1FONA 3OSYA 4IN2A 1DY9A 4Y8ZA 3SN8A 1C5VA 2EC9H 1UHBA 4GSOA 4K1EA 1TNJA 1YF4A 2FS8A 2P95A 2W5EA 5E8EH 2C8YB 4HTCH 1SGQE 2P59A 1ESTA 4MTBA 3SJIA 1EZQA 5CHBA 3K9XB 1EB2A 2FLBH 2YMSC 1WV7H 1B7XB 2FM2A 1G3DA 4Z6AH 1HDTH 4YXWD 2Z9JA 4Q80A 1CA0C 2G4UA 3E0PB 1V2WT 3SNDA 1TRYA 2F83A 6GCHG 3FP6E 4RI0A 3EA7A 3N7OA 1O3CA 1C1TA 1S85A 3QUMP 2Z3EA 3MU5A 1V2ST 3RM2H 3O8CA 3CNRA 2IN2A 1P9UA 1GI5A 1GMCF 3PLBA 2VVUA 5FBEA 4P00A 2BD7A 3KQ5A 4X1QU 3NK8A 5EODA 3LONA 2A7JA 1OWHA 1DUAA 1VCPA 1V6DA 1H9IE 3GDUA 2FI3E 3H09A 3KNXA 1JIMA 1GI0A 3BEUA 3PB1E 5J4SA 2OBOA 3RMMH 1O2IA 2EEKA 1JXPA 3BSQA 2F3CE 1S5SA 3MYWA 4AZ2B 1B0EA 1UTPA 1CU1A 1YYY1 3RC4A 1P2IA 1BTZA 1Z8RA 2ZDLA 5HM2A 4A7IB 4NCYA 1HGTH 4NGAH 5TCCA 5LPEA 3S7KB 1O2PA 3TH2H 5TJXA 1CHOF 2KCAA 5FPTA 5TCAA 1DXWA 3SQHE 3A82A 1BT7A 5AHGH 1AUTC 2A4GA 4JYTA 2BY7X 3RM0H 2FESH 1KMHB 1OPHB 4OS5A 4KP0A 1EP6A 3ESTA 4CRAA 3ZYDA 1CVWH 3E8LA 4Z1MD 1O37A 2WINI 1NU9A 3HPTB 1OWKA 1O2NA 2A31A 5I46H 2QY0B 1THRH 1GBAA 2R3YA 3UNSA 4RN6A 3TGIE 4DY7B 2B0FA 1B5GH 2NU4E 2BY5X 1W7XH 3SNAA 4ZKOU 3UOUA 4LOYH 3LT3A 5C5OA 1VJ9U 2FOEA 1BRBE 2ZQ2A 1YPGH 3SJ8A 1ETTH 3A81A 1EX3A 1DOJA 3UUZA 1HPGA 1ZZZA 1IAUA 1EATA 5C1UA 3ZZ5A 1A0LA 2ZHFH 1V2JT 5HGGA 2ZTZA 2BD4A 2FYQA 4OS1A 3GY6A 5JYIA 4PROA 2RA0A 1O2YA 2WPDD 5AVDA 3SNBA 3P8OA 2ZCKP 3ATWA 4ZHAA 2J9NA 1TABE 2KZ4A 1RRKA 3KYGA 1INCA 3UB0A 1ELEE 1A46H 5EG4A 1SQOA 1GGDB 4K60A 5FL7D 3G01A 5AF9H 2BTCE 2V3OH 1BHXB 2Y6TA 1SVPA 2G4TA 1A2CH 1C2JA 2P3UB 5E0JA 1GDUA 1GBLA 1KDQA 4Q7XA 3S9CA 5C1XA 3F9HA 1RTKA 2GCHF 1V2VT 2BDGA 1BTXA 2ZU4A 1WTGH 2OTVA 3V0XA 2V3MA 1K0HA 2PTNA 4B2BA 1H8DH 2SGQE 1H1BA 1O5CB 1GDNA 1TGSZ 2K0QA 2XBVA 6ESTA 2ZHWH 1HAXB 1VCWA 4AFUA 1BMAA 3KN2A 1XUHA 1ZHMA 2XRCA 1YCPM 4JMYA 5EQQA 1O5BB 5EXLA 1KY9A 1O31A 2HOBA 3RXBA 3LH1A 1C2GA 1K1JA 3PM3A 2KCPA 5EW2H 3HATH 1SSXA 2JKHA 5HIZA 2VU8E 3ZYEA 4KKDA 1HAYB 4AOQA 5L6NH 2H9TH 4MPWA 1F2SE 1WAYB 1QA7A 3W94A 1BMLA 3IITA 2AMDA 1AMHA 1IQLA 1A5HA 2QIQA 1ZTKA 1G2LA 3O8RA 3RXGA 3M5LA 3M37A 1UVSH 5SGAE 4OGXA 1C5RA 1TPPA 3E6PH 3LC3A 1D3PB 1QY6A 4MNWA 5F53A 1LHCH 1C5NH 1FAXA 2BDHA 2ZGXH 1VITF 1VGCB 2ZGBH 2NWNA 1UVOA 2Y82A 4CR5A 3SJOA 3BTHE 1QL7A 1E38B 2H9EH 1HAGE 2LPRA 3TK9A 5JBAS 1OOKB 4KGAA 1C2LA 3EYDA 1CGJE 1SGYE 2Y5FA 1A5IA 1KLJH 1GMDF 2BQWB 1ZHRA 3KQEA 3L6PA 3AAVA 4YOGA 5A8ZA 2UUJB 2YMSD 2BD2A 3AASA 2WPIS 2PLXA 1HAHH 3T26A 2VIPA 2STAE 1P10A 2FIRH 2KAIB 2QF4A 1FMGA 3P6ZB 3BTGE 2QF5A 4ABIA 2ZDVH 1PYTC 2QC2A 1H9LB 3SU2A 2VJ1A 2ZFSA 1SGNE 4Y71A 1PQAA 3VB5A 1V2OT 3HK3B 4E05H 3GY2A 2OK5A 4E7RG 5C17A 1DPOA 1FV9A 4K1TA 2ZGCA 3LGIA 1L0ZA 1KIGH 1RGQA 1RXPA 6CHAB 1WXRA 4O97A 2W7SA 1G37A 1O2QA 3QO6A 1OYTH 4ZKNU 3ZZDA 1FAKH 2A5KA 5FX5A 5EIYA 2G81E 3GCTF 4X6PA 5FPYA 1O5DH 2LP6A 1CGIE 3MNCA 4BAMB 3SBKA 3RLWH 5L2ZH 3MO3A 2BB4A 1QBVH 2PR3A 2BDIA 3LJJA 5CMXH 1FIZA 1EZUC 1O2TA 2OXSA 3HGPA 3MMGA 1KLIH 2SGDE 1SFIA 2XC0A 1NU7B 3T29A 3PO1C 2IOTA 2FLRH 1GJAB 2XNIA 3BTWE 4DURA 3SV7A 1D3DB 3BTME 1ETRH 1GBFA 2F9UA 5JBCS 2GKVE 3NCLA 3V3MA 1UTOA 4GPGA 2A5IA 2PKSC 3PWBA 1F0UA 5C0UA 4F48B 1HBTH 1MKXK 1P57B 1HJAB 1G36A 3QWCH 5E0HA 1WCZA 4HFPB 1Z8JB 4ABFA 4HGCA 4UFEH 1IQGA 2A0QB 2WPMS 3FVFB 2PSYA 1ZRKA 2KX4A 2VGCC 3VEQB 1A7SA 3OEHD 3A80A 1H9HE 2I6QA 1C5MD 1EJAA 2CJIA 3RXEA 4AB9A 4AFSA 2ZGJA 2F9OA 1O3PB 1C5YB 3PTNA 4Y7BA 1NRQH 4FUEA 3F1SB 2ANYA 3SU1A 1CBWC 1K1IA 4ZROA 2HPQH 1VR1H 3A84A 1P09A 1FDPA 1O3EA 2ZO3H 4IN1A 1TWXB 1EAUA 3K6ZA 2QF3A 2XWAA 1HXEH 1ZYOA 1GVKB 1MKWH 1S6LA 4X2WA 1C1NA 1AUJA 2P16A 2A4QA 3GICB 2WV5A 4FUHA 3MHWU 3DSPA 1GMHF 3DFLA 1SPJA 2ESTE 2Z7FE 3RLYH 3M5MA 3KEEA 1HXFH 1C4Y2 2YNAA 3V13A 2G51A 1GJ4H 1KSNA 1MTVA 3MNSA 6GCHF 1OWEA 1C4U2 1VZQH 1P2NA 5DJ7A 3F9GA 1SKYE 3M35A 1K22H 1HCGA 1FY8E 1DVAH 2GP9B 2V6NA 2WPKS 4TPYA 3O8DA 4BAOB 1C1VH 5C0TA 3ODFA 5JB8S 1NESE 1YM0A 4ISHH 1NRNH 3TH3H 3KGPA 1O3HA 1XUFA 4I8GA 1O2ZA 5F8ZA 1FY5A 3M5OA 1O3GA 1CA8B 4K8YA 1YP9A 1BQYA 1Z8GA 5FBIA 1PFXC 3RXVA 1ELTA 3ZZ3A 3SU5A 1NN6A 2GTBA 4NIWA 3RXQA 4J2YB 2WZQA 3A7ZA 1DWDH 3B23B 1N8OC 3T25A 3SNCA 3DUXH 4DIIH 3HKIB 3RU4D 1SGFA 5FPSA 4Y0YE 3PMAB 4Y8XA 4I8KA 3D49H 5IYTA 1S81A 1LO6A 4GAWA 2ZWLH 3SO3A 1C1WH 1K1OA 1O3DA 3F0PA 3SV8A 2PHBA 1C1RA 3P95A 1MU6B 1C1QA 5EQSA 8GCHF 3BG4B 3TK6A 1BMNH 3H7OA 5F03A 2HLCA 1J9CH 2FO9A 2J98A 4I8LA 5CHAC 2AGEX 3TK5A 3TVJB 3KQDA 1O38A 1EPTB 1F92A 4ABJA 1L2EA 2HRVA 1JIRA 2XNDD 2SGAA 4B2CA 1BBRH 3LH3A 1Y8TA 3ZVGA 3RU4E 1BA8B 2PTCE 4O9VA 1SOTA 4ZKRU 3PROA 4THNH 3UPEA 1KXDA 1FZZA 4X1PU 5AFZH 1FQ3A 5DP8A 1W0KD 5ETXA 4Y76A 3A8AA 3BTDE 3CS7A 4M7GA 2A32A 1NM6A 3P70B 3IWMA 2Z6BD 1LHEH 4NA9H 4AGKA 2CHAB 2TGTA 2BD9A 2J34A 5F8TA 1ZJKA 1V2QT 4YTAA 3KHVA 1GG6B 3L3TA 2GDEH 1XXFA 2P8OB 4F55A 2ULLA 4FU9A 5DPAA 1ZLRA 3ZVFA 3V7TA 1AFQB 1PYTD 2R9PA 3U8TH 2BOKA 2KFWA 1N6XA 5DG6A 2A7HA 1TA6A 1SLUB 1QGFA 2GZ9A 3NPSA 3RXDA 2C4FH 3RXKA 1GCTC 4TSFD 3SGAE 1ORFA 1XVMA 4FUGA 3TJVA 3LPRA 4XSKU 1PPEE 1TGNA 2HNTE 1NFWA 4NIXA 1ZGVA 2GV7A 3I29A 3O8BA 1QURH 4B71A 1PQ5A 5GNDA 3UWJH 4M9FA 1GBHA 1GBCA 1EXFA 3ITIA 4KELA 3SQEE 2OQUA 2UWLA 2QYIA 4K8BA 5BRRE 8KME2 2Z9LA 4OS4A 1ID5H 1P04A 1O0DH 1O3KA 2ZDMA 4JZFH 3PV4A 2VIQA 5H4IB 3KL6A 1TALA 4FOUC 1ELFA 2ZU5A 2QAAA 4X6OA 4WJG2 4Q63A 1MU8B 4AG1A 5A8XA 2FZZA 4F49A 4OS7A 2WHXA 1IQEA 4X1NU 5ESTE 1SFQB 4ZMAH 1FUJA 1ZMLA 3E3TA 5GCHG 3STJA 1SHHB 3TJUA 4NA8A 3UOPA 3RMOH 1GHZA 3Q77A 3UTUH 3A88A 4BANB 1YPHC 3FAOA 3OTJE 3ZZ7A 1GBEA 2CN0H 3SU6A 2HPPH 1AY6H 4MLFB 1QRZA 1HYLA 2BD5A 4Y11E 4U32A 4I33A 1AZ8A 1EKBB 4X8UH 3SZEA 3JZ2B 4X8VH 2VBCA 2BZ6H 5C1YA 3SUDA 3F3BA 1NZQH 4XFQA 3QDZB 1TLDA 4IMZA 2WSSD 3GS9A 2GCTC 2TRMA 1XKAC 1O2GH 4GCHG 1CA0B 2EI8A 4CH2B 3TPIZ 2OD3B 4YZUA 1SLVB 3ATIA 1PPHE 2AHME 3HGNA 5ESBA 3UY9A 1E37B 5EQRA 2EQNA 2ZEBA 7GCHG 1EUFA 3ZVEA 1O2LA 1QA0A 4BAQB 1FX0B 1XUJA 3SNEA 1JRTA 2ZPQA 1GJ9B 1FN8A 1O2XA 1D4PB 1C9TA 1WU1A 3EA8A 3LGUA 1GJCB 1P06A 2JETC 4JYUH 4UFFH 2VIWA 4JK5A 2BDYA 1C5UA 4NA7A 2GD4B 2VIDA 3FANA 1BCUH 1WTHD 4FVDA 2OC7A 3TITA 2PFEA 4FUBA 3A7YA 2RA3A 1GJ5H 2KR7A 3MWIU 3SW2B 3S9BA 1TE0A 4X1SU 1ZMJA 1HRTH 2BZAA 1AN1E 4NZQA 2IJOB 1XVOA 1L1NA 4MDSA 4X8SH 4X0WU 1NFXA 3E1XB 1RIWC 2NU0E 2VNTA 1MTNC 1RJXB 1Y3WA 2SGFE 3QN7A 3URCA 4I7YH 2JJ2D 5KEDA 1TNGA 3QZRA 1D3TB 1COWD 3T62A 1DWCH 4DCDA 2OC1A 3KCGH 1SOZA 4FUJA 1C2HA 4ISLA 5EU8A 1V2TT 1EB1H 1RFNA 3A7WA 1D6RA 3FP7E 2WV4A 2BM2A 1V2PT 1C5WB 2ZIQH 1MQ6A 2FX6A 1BTPA 2V0BA 3ZIAD 1ZRBA 5DP7A 1G3EA 5A09A 3RUOA 1GBJA 3M3VA 4X6NA 3GCHC 1DXPA 2QN5T 3VG8A 2KCYA 4MPXA 1SL3A 2ASUB 1BHXF 4JCNA 2RG3A 3R3GB 4HZHA 1YKTA 3GCNA 3P92A 3RXUA 3OY6U 2R0KA 2W6JD 3ELAH 5FCKA 1E1RD 1FY1A 3VPKA 4INHA 1DDJA 4WVPE 3RXCA 2AEIH 1O34A 3P8NA 4WH8A 3RXTA 4CHAC 2Q1JA 1SGDE 1W12U 1HJ9A 4XDEA 1UW7A 3A87A 1S0RA 4CRDA 2A4RA 5DKMA 1KXAA 1XUIA 4UD9H 5I25A 2BX3A 1S6HA 4UONA 1Q3XA 3LJOA 1DSTA 1GI9B 1C5TA 3ZVDA 1KXCA 1D3QB 1QL8A 4H6SB 2KCOA 3MTYA 2XBXA 2C93B 1L4ZA 4ZUHA 5BPEA 5JBTA 1HB0B 4OM9A 1Z8IB 5PTPA 3F9FA 4FUIA 1LKBA 2STBE 3GDSA 1P0SH 1O3BA 1LQEA 2H6MA 2QV1A 3H7TA 1EAXA 2LNCA 4VGCB 2QGRA 1SI5H 5IDKA 1A4WH 4YESB 2AS9A 2HNTF 5GIBA 3LGTA 1F0TA 1LVBA 1Z1JA 1GHBF 2Z94A 5DGJA 1JMOH 1JBUH 2UWPA 1ABIH 2O8TA 3DA9B 1ELGA 3FFGA 1ZJDA 4BTIB 1G3BA 4K3JA 4I86A 4ABAA 4JZEH 1AKSB 4VGCC 5EGMA 2XW9A 4K69A 1L4DA 2A4OA 3A83A 1HAVB 5T3HA 3BIUH 1UVTH 1QZ8A 1Y5UT 2Q6DA 4IMQA 2H5DA 1NO9H 2JH0D 3GY4A 3SZNA 2BLVA 3M7TA 1OYQA 3EE0B 1UCYE 1AWHB 2FP7B 1UVPA 2OC8A 1Y5BT 3QTOH 2ZC9H 1V2KT 1UK4A 2OINA 4CR9A 1UTKA 3JZ1B 1GVZA 3OAAD 4AORA 1NTPA 2RFKC 1P05A 2P3FH 1ESBA 1E34B 4IW4E 3MO9A 1F0SA 1O39A 2ZG0H 2ZFQH 5GPIB 1ARCA 4DOQA 1BTHH 2AYWA 2W6ID 5J4QA 3RXIA 3S9AA 1F5RA 3N7EA 2D8WA 1DT2A 4A1TA 1GBIA 1DWEH 4A1XA 1TOMH 1LVYA 3FZZA 3FZDA 3LC5A 1GJBB 3A7VA 3HK6B 5LPFA 1MBQA 1O36A 1WYKA 4BXWA 1C5QA 1LPGB 4O3UA 4F4OC 1HAOH 3QLPH 1P12E 3MU4A 1TMUH 5LGOA 3M5NA 2ZHEH 2XCFA 2QXHA 2FOGA 1JRSA 2WUCA 1O2HA 1OXGA 1P9SA 1O2RA 1JOUB 4UEHH 4TWYA 2BOHB 1DE7H 1OHHD 2ZPRA 2ZP0H 2FYRA 1ZTLA 3RXHA 5FHTA 3RXMA 1KXFA 3GCOA 2KAIA 1QJ6B 1BBRE 2AIQA 2BQ6B 1O3FA 4UDWH 4FXGH 2ZU2A 1A3EH 1C5LH 2XXLA 3T5FH 2GZ8A 2SGEE 1DX5M 4FU8A 1MKXH 3CP7A 3E16B 3A85A 4ZKSU 1Z7KA 2PUXB 2ALPA 1GWAA 2QXJA 5IK2D 1TB6H 1TNIA 1GBDA 3ZVCA 1PPCE 3A8DA 3VXEH 2BD8A 1QRXA 1TNHA 3BN9A 1FLEE 1O2KA 2J92A 1GMCG 1MTSA 1ARBA 1SGRE 3ZZBA 1GVLA 5HMAA 4BXSA 3PO1B 2KM0A 2OLGA 3C1KA 3BEIB 3VGCC 1O2UA 1P02A 2BMGB 4ISOA 5JDUB 2A7CA 1DWBH 2RDLA 2G55A 3PRBA 4INKA 2ZCLP 2UUYA 4Y6DA 4CBNA 1K21H 2PKSB 1K1PA 1O5GH 1BRAA 4RKJB 3TLOA 1SQTA 4NZLA 3ZZAA 2NU1E 4ABHA 2ZF0H 4NG9H 1Y3XA 4FUDA 5GCHF 3MI4A 3RC5A 4CRBA 1CHOG 4K1SA 1C1OA 1TIOA 1K1LA 1SLWB 2VGCB 3DFJA 1MH0A 4UE7H 3UQVA 3WY8A 3GDVA 3OU0A 5HIYA 1E79D 1QRWA 5E2OA 4A5TS 5EPNA 3KQBA 5T6FA 1WSSH 1Q31A 1X7AC 1C2EA 2BVSH 1EAWA 4B73A 3LGYA 1CBWB 1RS0A 1TGBA 5DK1A 3UR6A 1SLXB 1TRNA 3VB4A 4MNVA 1IQIA 1MTUA 4X2YA 1T4VH 1A0JA 1P3CA 1C2IA 1MZDA 4MPUA 1O2SA 5FCRA 3TIUA 1FJSA 1UVUH 3QGJA 4IBLH 4AB8A 4GCHF 2ZTYA 1ACBE 3GY7A 3QGNB 1Y3VA 4RSPA 1V2RT 3GY8A 3U1IB 4CRGA 3UAIC 2GMTC 1GHYH 2A5AA 1EQ9A 4CH8B 4U30A 5GJ4B 1J14A 1ELAA 1GCDA 1M9UA 1GHAG 4OS6A 3TNTA 4GHQA 1MABB 1OS8A 1P2KA 5L2YH 1NRSH 1ZHPA 2ZQ1A 2XBYA 4INLA 3OE7D 4YOJA 4D9RA 2L74A 3RMLH 3P8GA 1E1QD 3RXPA 1T8OA 3SGQE 1C5XB 3MOCA 1AD8H 1EP5A 1G32B 2W3KA 1QQ4A 1TYNA 1ZPCA 5DN6D 1FPHH 4NSYA 1N8OB 1DANH 4X8TH 1P2MA 5A0CA 4NIVA 1QJ7B 3RMNH 4B6FA 4DIHH 3VFEA 4E06H 2ANMH 1W13U 3WW7A 4Q7ZA 1UTMA 1A0HB 4GLYA 2ZU1A 1AGJA 4AC9A 2ZA5A 1ANCA 1FIWA 1ZPBA 2GCHG 2DE9A 2NU2E 3F2HA 4ISNA 4HG6A 3B9FH 2SNWA 2FTMA 1N1LA 3SV6A 3F0OA 1IOEA 1J16A 5CHAB 2XC4A 1GHXH 7ESTE 3RXOA 1EJMA 4TY7A 1C5OH 1HAZB 2DUCA 1YLNA 1NROH 3OX7U 3AW1A 1UJ1A 3P8FA 1QCPA 3F68H 2W7UA 1ZTJA 2ODQA 1TNLA 4RT1A 4GVUA 1C2MA 3F6UH 2V7QD 3V12A 1YPLH 1F5KU 1V2UT 3SUEA 1ZOMA 4B6EA 2QCYA 1EPTA 2GZ7A 1BTWA 1T32A 4DT7B 4ZHLU 5CDFE 4LXBH 3Q76A 3MH6A 4ACBA 3T28A 3UWIA 4ASUD 1T8NA 2TGPZ 3TH4H 2Y5HA 2R0LA 5B6OA 1A3BH 2EI6A 1YC0A 3GOVB 2ZTXA 2TBSA 2FOCA 4O03A 2VVCA 2K8IA 3U28C 2VWMA 1SGEE 2PP6A 1G9IE 4TPIZ 2FWWA 5A8YA 4JK6A 1PPFE 1YWUA 3TGJE 2BHGA 2P3TB 4KTUA 1DS2E 1GCTB 3MH7A 3OY5U 5HM9A 1TOCB 4X2VA 1AI8H 2ILNA 1LMWB 2J2UA 4AYVB 4BAKB 4U2WA 4AX9H 4BNRA 3DSOA 1UTJA 4DG4A 1GMDG 1CQQA 1TBZH 2Y80A 3PV2A 4WXIA 2ZDAH 1BOQA 2C90B 1IQJA 2L6OA 3PWCA 3M7QA 1EJNA 5F8XA 1TMBH 3KF2A 3S69A 4D7GA 4FVBA 3BG8A 4XBBA 1AIXH 1QB1A 1MQ5A 2JIZD 4TT3D 4DW2U 1S84A 1SG8B 1CE5A 2JH6D 5DP3A 2IJD1 1CSOE 4Y10E 2A2QH 2TIOA 3K2UA 3SI4H 4E7NA 2QA9E 2TGAA 2TPIZ 2K1QA 4FUCA 5KECA 1AB9C 2O8UA 3FN8A 1W11U 4K2YA 1O32A 5EJ1A 2O8WA 1GHWH 1SB1H 1PPZA 1UO6A 1C2FA 2Q6GA 1T7CA 2XTTB 2F9NA 3GCTG 1P01A 2B9LA 2BX4A 4IC5A 1YPKH 1SGPE 3I77A 3P17H 1W14U 5C20A 1P2JA 3EGKH 1HIAB 4MNXA 2ZKSA 1UTNA 4B75A 4H6TA 2PKAB 2ZNKH 5DO4H 1NRRH 3PRDA 3SV9A 2FOAA 4X6MA 2ZCHP 1NFYA 2GCTB 4IGDA 4TYDA 1O2OA 4ABGA 4XD7D 1CGHA 1O3MA 1XKBC 1XUKA 2IPQX 2WYJA 1NT1A 2G5VA 2ZDNA 1UMAH 1CO7E 1H8ED 1SQRA 3E0NB 3TU7H 4LZ1H 1O5FH 1KYNA 2PGQB 2FOFA 1BRCE 1BIOA 1AU8A 3ZZ8A 5G4BA 3ZZ4A 2QE7D 4A6LA 8ESTE 1Y3UA
chains in the Genus database with same CATH topology
3MFJA 4I32A 1GJ8B 2JETB 2BY8X 4RKOB 4ABDA 1F5LA 5C5NA 2FX4A 1AE5A 5C67A 1YCPK 2EI7A 4AG2A 1P3EA 3D23A 4B2AA 1O3NA 4WMDA 3PLKA 1EASA 1TMTH 1SGFG 1UHBB 3U8OH 3SHCH 5E0GA 1RIWB 2F9PA 4MG3A 1MTNB 1TPAE 1WQSA 4SGAE 1PQ8A 1DITH 1K9OE 1IQMA 2I6SA 1EZSC 3UFAA 1Z6JH 4D9QA 1O3OA 1VJAU 4H42U 4A92A 1GMHG 2GGVB 1K2I1 3I78A 3MH4A 3NZIA 2O8MA 1GL1A 5DP9A 1C2KA 1ETSH 2AGGX 2OUAA 1OSSA 1MD8A 1LVMA 7KMEH 2OCVB 3M36A 1DUEA 2OC0A 3SHAH 1N6YA 4GHTA 1TGTA 2OQ5A 2H9HA 1MCTA 3GCHB 2ANKH 3LKWA 2J4IA 3MU1A 4ABEA 3UNRA 1QBNA 4NSVA 3SGBE 2BVRH 1C1MA 3PTBA 2BLWA 3D62A 2BLOA 1C4V2 1MAYA 1OX1A 3GY5A 2BXUH 5F6MA 1P03A 2F9VA 1KTTB 1LHDH 2YOLA 3A7XA 3ZZCA 1S6FA 2YNBA 1LQDB 1WQVH 1TQ0B 1QFKH 4CHAB 3A89A 1SQAA 2BY9X 1IQNA 2FXRA 3ZZ9A 2WYGA 2AMPA 1DFPA 2BQ7B 3KIDU 2SNVA 1UTLM 2NU3E 4FUFA 2G8TA 2A1DB 1QTFA 2ODYB 3LGVA 1FY4A 3A86A 1Y59T 4TY6A 3TGKE 5A0AE 8GCHG 1O2VA 4Y7AA 1XX9A 3BTQE 2ZFFH 2FOHA 3H5CB 2R2MB 1ZMNA 4Y8YA 4YLUA 3NUMA 1O2MA 1OP8A 2GV6A 1HV7A 1OP2A 1ANBA 2XBWA 2C8XB 2XC5A 1HNEE 2ZHQH 2AFQB 3NWUA 4YM9A 3EQ0H 2F9BH 2O9QA 1FN6A 2FEQH 1ESAA 2FOMB 3NXPA 4TWWA 4WF8A 2UWOA 4JYVH 3A7TA 4Y0ZE 1KXEA 4CRCA 4NFFA 2BDAA 2GDDA 3M3TA 5LH8A 3URDA 4WWYA 1IHSH 4CRFA 2PV9B 1GHAF 1NS3A 1L1JA 1F7ZA 1SR5C 4XE4A 1TA2A 1P2OA 2J94A 4ESTE 4I8HA 2ZU3A 1QHRB 1DSUA 1D9IA 5CE1A 1AKSA 3SU0A 3T2NA 1C5ZB 4YT7H 3AAUA 1HAVA 4AFQA 1LTOA 4MNYA 3DT0H 2BY6X 4X2XA 1LCYA 2Z9GA 1ZGIA 4ZXXH 3MU8A 3C27B 5FAHA 1GI7B 1EAIA 1Y5AT 1YGCH 3U9AH 4IS5A 2VH0A 2M5TA 1B0FA 1J17T 3UIRA 3VB3A 1C1PA 2XYAA 1AWFH 1KDQB 2VIVA 9LPRA 1TX8A 4B74A 1GBKA 1OWIA 1GGDC 4ASHA 1W0ZU 2V35A 4NIYA 5HXFA 4GUXA 1NC6A 2FI4E 4ZHMU 1GJ7B 1T8MA 2P93A 1QB6A 4B1TA 3A8BA 1QBOA 1YBWA 3MU0A 4K5ZA 1A1RA 4OS2A 4YLQH 1Z6EA 1AO5A 2WPHS 2AH4X 1EZXC 1XUGA 1TRMA 3MO6A 3T27A 1HUTH 1FY3A 1QJ1B 2D26C 3RXAA 3GY3A 1YPJH 5EXNA 7LPRA 1ZSLA 2THFB 2GT7A 4X1RU 3PMHB 1TPSA 4XBDA 4SGBE 3BTFE 1VITH 1GHVH 5GDSH 5A0BA 2A2XH 1ANEA 1NFUA 1TAWA 4BTTB 1SGTA 1O3LA 3E91A 2P94A 2WPLS 1BJUA 2BD3A 3ATMA 3Q00A 2ODPA 1YPHE 3VB7A 2H2ZA 4R8TB 2G5NA 4O3TA 1F0RA 2ZFPH 2HVXA 4YO9A 1S83A 2CF9H 3M3SA 3ENSB 5C2ZA 2WUBA 3TJOA 1AVXA 5EXMA 3BEFB 2HNTC 3SU4A 1G3CA 1RTLA 1ZSKA 2OBQA 2Y5GA 5AFYH 1VGCC 1UTQA 1W7GH 3GYMA 3SOSA 4KTCA 3RDZA 1O5EH 2ZECA 3UQOA 1TGCA 3VGCB 4Y79A 2FPZA 1YLCA 1THSH 1WUNH 1TNKA 3UREA 2VINA 3U69H 2ZPSA 1Q2WA 4WMEA 3QK1A 2R2WU 2GX4A 1BB0B 3U98H 2CV3A 1THPB 2F91A 4NWKA 1MTWA 1IHTH 1T31A 3UNQA 1TBQH 2WPJS 1BMMH 1W0YH 1GL0E 1O35A 1KLTA 1W8BH 4J1YA 1AVWA 1ELCA 1QNJA 3LDXH 3K65B 1PPGE 2A45B 5DP4A 4D7FA 2AGIX 1LHFH 2XCNA 2FODA 1GI8B 1O2JA 2W26A 6LPRA 3SUGA 3RC6A 4IC6A 3UR9A 1O2WA 3TJNA 5A2MH 3SJ9A 1LPKB 2BDCA 1LKAA 1G2MA 1MZAA 5JBBS 3S7HB 1SBWA 1HFDA 2D2DA 1O30A 1BUIA 2VIOA 4BTUB 1W3CA 3U1JB 1J8AA 5LPRA 1SC8U 2Z3DA 1CT0E 6CHAC 2OP9A 1BTUA 4WXVA 1YPMH 1S0QA 3W95A 2C3SA 2FDAA 1TX7A 2HWLB 4AFZA 3ZV8A 3BTEE 4DGJA 2CGAA 1SHYA 1RTFB 5JPMH 1C5PA 2G00A 1OWJA 4I8JA 2SGPE 4HI3A 3SV2H 2H1UA 3RU4T 1K1MA 1CT2E 1J15A 2FTLE 1ELBA 1WOFA 2GMTB 1NPMA 2VWOA 1BDAA 3ZV9A 3VB6A 2UUFB 2ALVA 4QT8C 1MD7A 1K1NA 3EDXB 1AE8H 3ATKA 2C8ZB 1MAXA 2R3UA 1AHTH 1LVOA 4UFDH 3SUFA 1E35B 1O5AB 1HJ8A 3LU9B 2TGDA 1EOLA 2VWNA 2ZI2H 4B76A 2AERH 3Q3YA 7GCHF 1FXYA 4DJZB 1FI8A 2AIPA 2J38A 3MNBA 1O3JA 5GXPA 1LPZB 1UK3A 4R0IA 3SI3H 1XXDA 2H5CA 1GPZA 1AVGH 3QX5H 1HJAC 1VCQA 3CS0A 1OKXA 2PWXA 1SGIB 1SGCA 1P2QA 1EOJA 2QXGA 3B8JA 2Y7ZA 2PSXA 1AZZA 4JZDH 2BXTH 1CHGA 2CMYA 1XM1A 5FX6A 4JZ1A 1IQHA 1Z71A 4YT6H 3BV9B 4YOIA 3Q3XA 1V3XA 5DP6A 1E0FD 4FU7A 2W3IA 5C3NA 1A5GH 2ZGHA 4I31A 4BAHB 1GHBG 1C1SA 1LDTT 2CXVA 3R0FA 2J95A 1UCYH 1DLKB 2ANWA 2PW8H 2Q6FA 4CBOA 3AW0A 3DD2H 3M7UA 1MMJN 1GBMA 1MCVA 4ABBA 1GJ6A 3BF6H 1TFXA 1O3IA 3ATLA 3BTKE 3VXFH 3RXSA 5L30H 1HAPH 1P11E 1ELVA 3AVZA 2ZDKA 3ZZ6A 1ELDE 1GBBA 3F9EA 3SORA 3MNXA 1U6QA 2Z9IA 4UFGH 1CT4E 3LIWA 2EA3A 1C5SA 4Q2KA 4BOHA 1T8LA 4ZH8A 1D6WA 1XMNB 3OYPA 1OP0A 1H8IH 1NRPH 3LOXA 1GJDB 4ZXYH 1C1UH 1O33A 1G30B 3A8CA 1SMFE 4A1VA 2PUQH 1TPOA 5FXLA 2VWLA 3ZVAA 4NFEA 3SJKA 3D65E 3TNSA 1QB9A 3KQCA 4NWLA 1QIXB 3PMJA 1MKWK 1FPCH 1FNIA 2BYAX 1GDQA 2FI5E 1C9PA 2VH6A 3RP2A 4ZAEA 2B7DH 1DM4B 1Z1IA 1V2LT 9ESTA 2AMQA 2B5TB 3SU3A 1UCYK 1PPBH 2JH5D 3GISB 3RXJA 2DE8A 1BITA 2B8OH 1VITG 1YPEH 1KXBA 1ABJH 4OGYA 2G52A 5E2PA 1QL9A 3GYLB 2Z9KA 3ODDA 5GWZA 1PJPA 3BG4C 1TBRH 2UUKB 4MPVA 1UK2A 5K7RA 8LPRA 2IPHA 1L1GA 1RD3B 1K28D 1EPTC 2HALA 5JB9S 2BDBA 2ZFTA 1ANDA 2ZZUH 1WBGB 3BTTE 3MH5A 1GI1A 1C2DA 1DLEA 1GBTA 1AB9B 1O3AA 1S82A 1BRUP 1T4UH 2RCEA 3Q3KA 5T6DA 1E36B 5EPYA 4XBCA 2Y81A 1NY22 3K6YA 1HLTH 1H4WA 2BLQA 1TONA 2QF0A 2VB0A 4JZIA 1AFEH 1LHGH 1QQUA 1YLDA 2Y7XA 3S0NA 1HAIH 1TQ7B 4MVNA 2QXIA 4LK4A 4AN7A 2CHAC 1GI6A 1W10U 3U8RH 1JWTA 1GI4A 4MQAA 3RXLA 1GI3A 1YCPH 4LZ4B 1GG6C 2XWBI 1ZPZA 2BVXH 2P8OC 4AGJA 2PGBB 4KTSA 2CF8H 2V3HH 3E90B 4D8NA 1AFQC 3QTVH 1DY8A 3LGWA 3HKJB 4CREA 4D76A 1BTYA 1BJVA 3EAJA 1BBRK 2FMJA 1MUEB 4Z0KA 4DVAU 3NKKA 3QZQA 3ZVBA 5T6GA 1HIAA 1TX6A 2VVVA 2PKAA 1DICA 1OWDA 1A61H 2GVFA 2Z3CA 2O8LA 3STIA 5K0HA 2FS9A 1AQ7A 3L33A 3RXRA 3M61U 3EA9A 4U01A 3PLPA 3PYHA 4WH6A 5DP5A 1QR3E 2SFAA 1GI2A 1ZR0A 3CENA 1BZXE 3BIVH 1IQKA 4XOJA 2C8WB 4Q7YA 3IG6B 1MBMA 1W2KH 3DHKH 4WMFA 2FOBA 1V2NT 2D1JA 1IQFA 1PQ7A 1KTSB 4H4FA 5EOKA 4AYYB 5EW1H 1P8VC 4ISIH 3FP8E 5ABWA 3PMBB 2ZFRH 1V2MT 5HYOA 3RXFA 2HGTH 1Y3YA 4WY3A 1ZSJA 2ZHDA 2GT8A 1FONA 3OSYA 4IN2A 1DY9A 4Y8ZA 3SN8A 1C5VA 2EC9H 1UHBA 4GSOA 4K1EA 1TNJA 1YF4A 2FS8A 2P95A 2W5EA 5E8EH 2C8YB 4HTCH 1SGQE 2P59A 1ESTA 4MTBA 3SJIA 1EZQA 3K9XB 1EB2A 2FLBH 1WV7H 1B7XB 2FM2A 1G3DA 4Z6AH 1HDTH 2Z9JA 4Q80A 1CA0C 2G4UA 3E0PB 1V2WT 3SNDA 1TRYA 2F83A 6GCHG 3FP6E 3EA7A 3N7OA 1O3CA 1C1TA 1S85A 3QUMP 2Z3EA 3MU5A 1V2ST 3RM2H 3O8CA 2IN2A 1P9UA 1GI5A 1GMCF 3PLBA 2VVUA 5FBEA 2BD7A 4X1QU 5EODA 3NK8A 3LONA 2A7JA 1OWHA 1DUAA 1VCPA 1V6DA 1H9IE 3GDUA 2FI3E 3KNXA 1JIMA 1GI0A 3BEUA 3PB1E 5J4SA 2OBOA 3RMMH 1O2IA 2EEKA 1JXPA 3BSQA 2F3CE 1S5SA 3MYWA 4AZ2B 1B0EA 1UTPA 1CU1A 1YYY1 3RC4A 1P2IA 1BTZA 1Z8RA 2ZDLA 5HM2A 4A7IB 4NCYA 1HGTH 4NGAH 5TCCA 5LPEA 3S7KB 1O2PA 3TH2H 5TJXA 1CHOF 5FPTA 5TCAA 1DXWA 3SQHE 3A82A 1BT7A 5AHGH 1AUTC 2A4GA 4JYTA 2BY7X 3RM0H 2FESH 1OPHB 4OS5A 4KP0A 1EP6A 3ESTA 4CRAA 3ZYDA 1CVWH 3E8LA 1O37A 2WINI 1NU9A 3HPTB 1OWKA 1O2NA 2A31A 5I46H 2QY0B 1THRH 1GBAA 2R3YA 3UNSA 4RN6A 3TGIE 4DY7B 2B0FA 1B5GH 2NU4E 2BY5X 1W7XH 3SNAA 4ZKOU 3UOUA 4LOYH 3LT3A 5C5OA 1VJ9U 2FOEA 1BRBE 2ZQ2A 1YPGH 3SJ8A 1ETTH 3A81A 1EX3A 1DOJA 3UUZA 1HPGA 1ZZZA 1IAUA 1EATA 5C1UA 3ZZ5A 1A0LA 2ZHFH 1V2JT 5HGGA 2ZTZA 2BD4A 2FYQA 4OS1A 3GY6A 5JYIA 4PROA 2RA0A 1O2YA 5AVDA 3SNBA 3P8OA 2ZCKP 3ATWA 4ZHAA 2J9NA 1TABE 1RRKA 1INCA 1ELEE 1A46H 5EG4A 1SQOA 1GGDB 4K60A 3G01A 5AF9H 2BTCE 2V3OH 1BHXB 2Y6TA 1SVPA 2G4TA 1A2CH 1C2JA 2P3UB 5E0JA 1GDUA 1GBLA 1KDQA 4Q7XA 3S9CA 5C1XA 3F9HA 1RTKA 2GCHF 1V2VT 2BDGA 1BTXA 2ZU4A 1WTGH 2OTVA 3V0XA 2PTNA 4B2BA 1H8DH 2SGQE 1H1BA 1O5CB 1GDNA 1TGSZ 2XBVA 6ESTA 2ZHWH 1HAXB 1VCWA 4AFUA 1BMAA 3KN2A 1XUHA 1ZHMA 2XRCA 1YCPM 4JMYA 5EQQA 1O5BB 5EXLA 1KY9A 1O31A 2HOBA 3RXBA 3LH1A 1C2GA 1K1JA 3PM3A 5EW2H 3HATH 1SSXA 2JKHA 3ZYEA 2VU8E 4KKDA 1HAYB 4AOQA 5L6NH 2H9TH 4MPWA 1F2SE 1WAYB 1QA7A 3W94A 1BMLA 3IITA 2AMDA 1AMHA 1IQLA 1A5HA 2QIQA 1ZTKA 1G2LA 3O8RA 3RXGA 3M5LA 3M37A 1UVSH 5SGAE 4OGXA 1C5RA 1TPPA 3E6PH 3LC3A 1D3PB 1QY6A 4MNWA 1LHCH 1C5NH 1FAXA 2BDHA 2ZGXH 1VITF 1VGCB 2ZGBH 2NWNA 1UVOA 2Y82A 4CR5A 3SJOA 3BTHE 1QL7A 1E38B 2H9EH 1HAGE 2LPRA 3TK9A 5JBAS 1OOKB 4KGAA 1C2LA 3EYDA 1CGJE 1SGYE 2Y5FA 1A5IA 1KLJH 1GMDF 2BQWB 1ZHRA 3KQEA 3L6PA 3AAVA 4YOGA 5A8ZA 2UUJB 2BD2A 3AASA 2WPIS 2PLXA 1HAHH 3T26A 2VIPA 2STAE 1P10A 2FIRH 2KAIB 1FMGA 3P6ZB 3BTGE 4ABIA 2ZDVH 1PYTC 2QC2A 1H9LB 3SU2A 2VJ1A 2ZFSA 1SGNE 4Y71A 1PQAA 3VB5A 1V2OT 3HK3B 4E05H 3GY2A 4E7RG 1DPOA 1FV9A 4K1TA 2ZGCA 3LGIA 1L0ZA 1KIGH 1RGQA 1RXPA 6CHAB 4O97A 2W7SA 1G37A 1O2QA 3QO6A 1OYTH 4ZKNU 3ZZDA 1FAKH 2A5KA 5FX5A 2G81E 3GCTF 4X6PA 5FPYA 1O5DH 1CGIE 3MNCA 4BAMB 3SBKA 3RLWH 5L2ZH 3MO3A 2BB4A 1QBVH 2PR3A