1C5RA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5rA02
1LKAA 4IGDA 3M7QA 3ZZ7A 4OS6A 2FS8A 1A5IA 1XUJA 2BDIA 1L4DA 1XVMA 3A8DA 1QCPA 3KQEA 1XVOA 3P95A 1S6FA 2FS9A 3S7HB 1C4U2 1GJ6A 4GCHF 3Q3KA 2PKAA 1AU8A 3E3TA 2W7SA 2FO9A 1VITH 3ZVAA 1UTMA 3ZYDA 4ASHA 1C5XB 3AW1A 4FU7A 3V3MA 1L1JA 1P2NA 1MZDA 3BG4B 1WTGH 2C90B 1SGFG 1GI4A 4OS7A 4MPUA 3FAOA 2BM2A 2WUBA 2H2ZA 4NSYA 3QK1A 1K21H 1ZHMA 2BY6X 3HATH 1GI0A 1H9IE 3RC5A 1LO6A 5E0HA 1CU1A 1CGJE 1ETTH 1NFWA 4YESB 5FXLA 3KN2A 1O3OA 1E35B 3RXDA 3NCLA 3SQHE 3LGIA 4NFEA 1VZQH 3DFJA 5HXFA 2GDEH 4BANB 1EXFA 4RKJB 1F2SE 4UD9H 3RXOA 3LU9B 1BB0B 1W8BH 1C4V2 4K1SA 2GV6A 3SJIA 4IC6A 2W3IA 1UTQA 3MU4A 2F9VA 4GSOA 1O5DH 3ZVDA 2C8WB 1JRTA 9LPRA 2G51A 3GCNA 4AN7A 1VITG 6GCHG 2TRMA 2AGGX 3IWMA 3I29A 1XXFA 2B9LA 3UREA 4XBBA 3PMAB 1K1OA 1UHBA 2FESH 1K1PA 1L1NA 1QL7A 2FTLE 3SV6A 1YPHC 4DIHH 2P8OB 4Y76A 2R2MB 2QAAA 1TQ7B 1AY6H 1CQQA 1OS8A 5ABWA 1FUJA 1GHBG 2AMDA 5GDSH 1S84A 2AMQA 1Y3VA 1TE0A 1IQJA 2RDLA 2ZU4A 4B74A 1GI8B 1CT0E 2GMTB 4X6PA 1HAPH 5EU8A 4O3TA 1AIXH 3F68H 5CHAB 1MTWA 1FQ3A 5C1YA 5A0CA 2Z6BD 3GYLB 2OC8A 2UWPA 3RDZA 1BJUA 3SNEA 3DD2H 1P06A 1V2WT 7LPRA 2EI6A 2ZHWH 3EAJA 1RIWC 1ANDA 2ZGXH 2BD8A 1GVLA 3P8GA 2F9BH 4CH2B 1W10U 3K2UA 1O2ZA 2ZQ2A 3MU8A 2V6NA 2BLVA 4X1QU 1T4VH 2Z9IA 3GISB 5SGAE 3RLWH 1BTPA 1HRTH 1J8AA 4K3JA 3PV4A 1Z1IA 1AVWA 1AKSA 1O2WA 2BDYA 1A4WH 1O37A 4JYUH 1TRYA 1O2XA 5LPRA 4ISHH 1ELGA 4B71A 1GL1A 1GCTB 5GCHG 1ZRKA 1CBWC 6CHAB 3MH7A 2O8LA 1UK4A 1C2EA 1A1RA 2WV5A 2TBSA 1GBMA 4JZFH 2JETC 3AAUA 4BAQB 3MTYA 4AG2A 4YO9A 4Y79A 2R0LA 1AZZA 1SI5H 3ODFA 1M9UA 1SLWB 5C3NA 3BTWE 2HLCA 2ZQ1A 1TNHA 4MPXA 1N6XA 1EZQA 3AASA 1LMWB 1UK2A 2F9PA 3VPKA 2AGIX 2XYAA 7ESTE 3TIUA 4ZMAH 3U69H 3GCHC 4Y10E 2H9HA 5LH8A 4SGBE 4AFUA 5F8TA 4YTAA 3GY2A 2AERH 1VCPA 4ESTE 4XSKU 2OUAA 3BTDE 2Z3CA 1IOEA 1A0HB 1NRPH 1DPOA 3T28A 1HDTH 1B0FA 4K5ZA 1DDJA 2STBE 1FN8A 1HAZB 1KY9A 4QT8C 2ZO3H 4DOQA 2ANKH 3U8OH 3DFLA 1O31A 2QIQA 1O0DH 1E38B 2GP9B 1RS0A 3MNCA 5A09A 3VB3A 4BTUB 1ELDE 4I31A 4THNH 3GCTF 1AB9B 1DWEH 4MNVA 4H42U 1ARBA 3MO3A 3KL6A 4X8SH 3RMNH 3P8FA 1NRQH 2J34A 5G4BA 1THRH 5EQSA 1IQGA 1MKXH 1ORFA 2R3YA 2TGTA 1NM6A 5DP8A 2ANYA 4ABDA 1EJAA 3SUGA 1KDQB 1A0LA 1GJ4H 3M3SA 1HAVA 2ODQA 3RXRA 1H9LB 3S9BA 1TGSZ 1P2JA 1Y3YA 5HM2A 1MMJN 2ZG0H 1GHAG 3PLKA 3MMGA 1S82A 3KQBA 3U1IB 1IAUA 3MH5A 2A5IA 1X7AC 1HFDA 3GCOA 3MO9A 1ZGVA 3NXPA 3Q3XA 3A7YA 3MI4A 4Q80A 2P94A 2UUJB 1IHTH 1DWDH 2Y82A 3RXUA 4M7GA 1AI8H 4Q7XA 2VVVA 5DG6A 3PO1B 5EPNA 5L2YH 3NUMA 1RXPA 1EPTA 3UUZA 1ID5H 5TCAA 2ODPA 2P16A 1ANCA 2HPQH 5FBIA 3RXTA 2ZDVH 1MU6B 2ZFQH 3M7UA 1DSTA 1KYNA 3S69A 1OWJA 1C1RA 3SV8A 1O3MA 1UVPA 3SU5A 1TALA 1TRNA 1T8NA 4U01A 1SL3A 1BTHH 2ZHEH 1TNIA 1BUIA 1UTLM 2QC2A 1YLCA 1LHCH 1YPJH 2IJOB 4BOHA 4A1XA 3O8CA 4OGXA 3SU1A 3EA7A 4YT7H 2ZFTA 4NGAH 1IQFA 5FPSA 1HJ9A 1DS2E 2FYQA 1P2KA 1FXYA 7GCHF 3DUXH 2K1QA 1LVMA 4ZXXH 1YPHE 1TONA 2A2QH 1O3EA 1GHXH 1C2IA 1J9CH 4DVAU 1J15A 1HB0B 2A7CA 1QL8A 2XC0A 3UFAA 1K1MA 4YLQH 1O3LA 3OU0A 1E0FD 1Z7KA 5DJ7A 2ANWA 2BY9X 1GJ5H 3E6PH 4FU9A 4OGYA 1GG6C 2FX6A 1HGTH 4ZXYH 1TIOA 4MQAA 1VGCC 2I6SA 4OS4A 2GCHG 1SQTA 5GPIB 4LK4A 1MAXA 3F9HA 2W3KA 1T8OA 1HAXB 3RU4T 4ISLA 2QCYA 3B9FH 1DM4B 1SR5C 2ZDNA 4YOJA 1C5LH 1MZAA 1C1UH 1ZPZA 4DGJA 1S0QA 1O2IA 2EI8A 2BY8X 4AGKA 3EDXB 1TBQH 3STJA 1D3PB 1HAYB 4JZEH 2BD4A 2PKAB 1THSH 3RM0H 1O3HA 3TNTA 5F8XA 4ZUHA 4Y7AA 1P05A 3STIA 1HPGA 4H6TA 3TU7H 4ABJA 4O97A 1AFQB 2Z9JA 4X1NU 2XWBI 2ZTXA 1BIOA 4AB9A 3QN7A 4K60A 1E36B 3KF2A 1FJSA 2R0KA 1FIZA 3TPIZ 5EQQA 5ESTE 4BNRA 2QF3A 1GPZA 2RCEA 1ZOMA 4B73A 3KCGH 1SGYE 4X1PU 3RXQA 1YBWA 2QA9E 1O3BA 4YM9A 2GV7A 4ABAA 2UUFB 1Z1JA 4RN6A 3IITA 1O2VA 3QTOH 5T6FA 1UVOA 3ATIA 1A7SA 5FBEA 1C9TA 1GMDG 2PUQH 2HVXA 3GDVA 4BXSA 1V2KT 2LPRA 3KNXA 3ZZ8A 2FYRA 2YNBA 2BD7A 1THPB 2F83A 1Q2WA 2FWWA 2VH0A 4Q2KA 2JH0D 2FLBH 3RC4A 1Z6JH 3A8AA 1P02A 2OP9A 1DLEA 2AH4X 4KTCA 4VGCC 2ZTZA 2G8TA 2YNAA 2BLQA 4J1YA 3RXGA 1ZSLA 2WPHS 1TRMA 1OX1A 4MVNA 1O2QA 1GI1A 1OOKB 1BTXA 2H1UA 3TVJB 4WJG2 1K1LA 6ESTA 1JRSA 4KKDA 3EQ0H 2OC0A 2SGPE 1WQSA 1UHBB 3TNSA 4I32A 1SLVB 1BTUA 5EG4A 3BV9B 3SQEE 8GCHG 1O3GA 1GBTA 1LQEA 1E37B 1C5SA 1RGQA 2J9NA 1TMUH 1BDAA 1YF4A 4AZ2B 4LOYH 3SN8A 1V2UT 1YGCH 3M61U 4BTIB 4JCNA 3SU0A 1XX9A 4R0IA 3L33A 1BMNH 2EC9H 2B0FA 3IG6B 4CR9A 1K2I1 4HFPB 4AFZA 4MTBA 1C2LA 2PTCE 2A5AA 3URCA 1WU1A 2ZC9H 1VCQA 2D8WA 2FOEA 1PPCE 3QX5H 1Z8IB 1T8MA 3AAVA 2C93B 2D26C 3UWJH 5DGJA 1OWEA 2BY7X 2BDBA 2VIPA 2PGQB 1EP6A 2GGVB 2VIWA 1DVAH 1GBFA 2Y7ZA 1S5SA 3NZIA 1GJDB 1GJBB 2BQWB 3LC3A 4TYDA 1EJNA 1ESTA 2A4OA 1MAYA 3RMOH 2QGRA 2PGBB 2FI4E 4U2WA 3BTTE 2BQ6B 2OCVB 3UPEA 3QZRA 1AKSB 1TA2A 1CE5A 1TX7A 1A2CH 1O32A 2TGPZ 1JIRA 1GBEA 3RXMA 1PQAA 4FUDA 3Q76A 1W0ZU 2BZAA 2XBVA 3ZV9A 1PYTD 2HRVA 4WF8A 1FPCH 3JZ1B 1Z71A 2J95A 1DOJA 2OC7A 1DT2A 2JH5D 5AHGH 1GBDA 1L1GA 1HXFH 5DP5A 3A7VA 2J92A 3QDZB 1O2OA 3SZNA 3LGVA 3ZVGA 2VIQA 4GAWA 1O5EH 2B8OH 2VWNA 3VEQB 1CA0C 3ZZ5A 1DWCH 3H7TA 3VGCC 1CHGA 4BAMB 1MTNB 4TPYA 1ELTA 1C2GA 3S9CA 1J14A 1O3JA 2B7DH 1GJ9B 5EXLA 5J4QA 4AYVB 5E8EH 5DP4A 1K1NA 2QXIA 4FUGA 5I25A 2KAIA 1P01A 2EA3A 1E34B 4X6NA 1AD8H 1TPSA 1VJ9U 3R3GB 4NIYA 1NC6A 1EP5A 1C2JA 4Y7BA 1SSXA 2AGEX 2R3UA 3LDXH 2FOGA 2HPPH 2V0BA 1AN1E 1VITF 6GCHF 5FCRA 1GGDC 4Z0KA 4IC5A 4HZHA 2VIOA 3HK6B 4D7FA 2GX4A 1H4WA 1G2LA 2ZFSA 2BXTH 2CGAA 2UWLA 1P2MA 5AFZH 2FLRH 2G52A 4INKA 1QB9A 4UEHH 4U30A 1DITH 1TLDA 1QIXB 2PV9B 4TPIZ 1GHWH 1K28D 3QZQA 4YZUA 3UQVA 3P92A 1AGJA 3URDA 3DHKH 1GMCG 3B8JA 3NKKA 1W14U 3PMJA 3F9GA 3PLPA 2BHGA 2SNWA 5B6OA 4LXBH 3A8BA 4WY3A 3BTQE 5JBCS 3TH4H 3F1SB 3GYMA 4ABIA 4FUFA 1EUFA 4ZKSU 2XXLA 4ISOA 1KXEA 2Y81A 2PWXA 4IS5A 5DP3A 1G9IE 2VINA 1Y5AT 1V2OT 2BY5X 1B5GH 2AMPA 1PPFE 2Y5GA 2ZDAH 1KLIH 2ZKSA 1O3DA 4X8VH 1NROH 3SV9A 2BQ7B 5C2ZA 5DP6A 5JBAS 1QBOA 2FX4A 3M5OA 1EPTB 3U9AH 5C67A 4JYTA 1AZ8A 1YYY1 2TGDA 4JZIA 4GCHG 1NFXA 1EOLA 3TH2H 1XUKA 2WPMS 1LHDH 3A8CA 4AYYB 4INHA 3SU3A 1BCUH 4HTCH 2ALPA 5GCHF 3E0NB 1BTYA 1Y3XA 4I8GA 1QB1A 2A0QB 1NU7B 1FY8E 3TK6A 4WH6A 2A4RA 4Q7ZA 1C1TA 1MCTA 4FVBA 2ZU5A 3V0XA 2PHBA 3HGPA 2OXSA 1F5KU 1C5VA 1HV7A 1S0RA 2H5CA 3UWIA 1O39A 4AOQA 1AVXA 1EB1H 2BMGB 1EZUC 3V13A 1AQ7A 2QN5T 1EZSC 2A45B 4RKOB 3RXIA 3PLBA 5DPAA 2FEQH 1GI2A 1W7GH 1QY6A 4OS1A 1XMNB 5L6NH 1MBQA 1GHZA 1EAWA 1C5ZB 1PQ5A 3RXPA 2AIQA 1O30A 1ZPCA 2ZNKH 4MDSA 4CRBA 4ZHMU 3TJNA 1GI9B 1W13U 1CGIE 1UTJA 1YPKH 3WY8A 1KXAA 1B7XB 3RP2A 5BPEA 3BIVH 1SGQE 2TGAA 1C2MA 4K1TA 2BD3A 2VH6A 5L2ZH 1V2TT 3SGBE 1EB2A 2OQUA 9ESTA 2D2DA 4CHAC 2P3UB 1QTFA 1O3CA 4IN2A 4WVPE 1FY3A 1BMLA 1P9SA 2H9TH 1Y8TA 1TPOA 1O2PA 2QXJA 1ZJKA 3M36A 1GJ7B 2QF0A 3UOUA 3BTHE 2FOHA 4AG1A 3DA9B 2C8XB 1XKBC 1JWTA 1K22H 1G32B 1QHRB 1GBCA 4O03A 4D76A 4FUIA 3ZZCA 1HUTH 4KP0A 1RD3B 2UUYA 3QWCH 4BTTB 5EPYA 1BTZA 1HCGA 1C5NH 2ZU3A 2SGEE 3A87A 1O5FH 3PM3A 5CE1A 5EGMA 1OWIA 2GD4B 1YCPM 1GMHG 3NPSA 5I46H 2BVXH 1DICA 4I7YH 2BX4A 2C8YB 3HKJB 2BDHA 1C1VH 4A5TS 4JK5A 1ZPBA 2Q6DA 1DANH 2VGCB 1CSOE 3ZVEA 1C5OH 1TB6H 2O8TA 3F6UH 5JB8S 5DK1A 1W7XH 3BTGE 2ZZUH 1AO5A 5GIBA 1LQDB 1YM0A 3F9EA 2R2WU 1PQ8A 1PPHE 4X1SU 1AFEH 4FVDA 8KME2 2FOCA 1MBMA 3A7TA 1HBTH 1RIWB 1C1QA 1G30B 5C1UA 1N6YA 1BT7A 4NIWA 1F5RA 4CRDA 1A3EH 3M5LA 2G5NA 4ZHLU 1CT4E 4FUHA 2ZU1A 3M35A 1J16A 2O8UA 1P3CA 2SGQE 4O9VA 3BF6H 3FZZA 4K2YA 1HYLA 2G4UA 4CREA 2ZEBA 2ZI2H 1OPHB 1TNLA 4AFSA 3EGKH 1UMAH 1O2MA 1PYTC 5FX5A 3MFJA 2O8WA 3FZDA 4X8TH 1INCA 1MKWH 4FUJA 1C9PA 3SUFA 3H5CB 1AWHB 1KIGH 5JYIA 1K9OE 1O5AB 3P6ZB 2F91A 1RFNA 2WINI 1A0JA 1P2QA 2JETB 2YOLA 2GT7A 4WH8A 4Y0YE 3H7OA 3ATLA 2XCNA 1GBLA 1GI6A 4JK6A 1C5TA 2Z9KA 1QA7A 3TH3H 2XNIA 5DKMA 1OYTH 4NFFA 4RSPA 3G01A 5AF9H 1F0RA 1O33A 1WAYB 3LPRA 2Y5HA 1SHYA 1PPGE 2ZCLP 1C5MD 4R8TB 2GCHF 2A4QA 1WQVH 1MH0A 3GCHB 1D3QB 1Y5BT 7KMEH 1S85A 2CHAC 2HNTF 2Z3EA 2FM2A 2ZWLH 1TWXB 3GCTG 3Q3YA 4U32A 3TLOA 3AW0A 4DCDA 5A8ZA 2IOTA 3MYWA 1JXPA 1F0TA 1O2UA 3T5FH 3LIWA 5ETXA 1BOQA 2PKSC 3SJKA 1LHFH 3BEFB 2NWNA 3RXFA 3RXKA 2A7JA 2G55A 1CHOF 3A80A 1DFPA 1Z8RA 4K8BA 3ESTA 4TY6A 4B2AA 3RXAA 4MNWA 1O2GH 4ABFA 4CRGA 3ZZ4A 1WYKA 1QGFA 4LZ1H 5A8YA 1YPLH 1O2JA 1O2SA 3A88A 2A5KA 1NESE 3UOPA 4XBDA 1SB1H 3VB5A 5E2OA 2BX3A 1P12E 5IYTA 3N7OA 5K0HA 4AB8A 2EI7A 4MG3A 1BA8B 1SQAA 1D6WA 2Z9LA 4XBCA 4Y0ZE 3T27A 3TK5A 4WMDA 3Q00A 3LC5A 1WV7H 4MLFB 2GZ7A 4XE4A 1IQHA 3RLYH 1XKAC 3GDSA 1ABIH 2C4FH 3SJ8A 2OBOA 4IBLH 4Y8ZA 4AFQA 1O3AA 3I77A 1V2PT 2ILNA 2PR3A 1MCVA 1Y59T 4CR5A 4UFFH 4DURA 1TAWA 3BTFE 3FP6E 3GY5A 1NZQH 1U6QA 1ESAA 1SGRE 4GPGA 2CMYA 2OC1A 3AVZA 1P0SH 4NWLA 4ZKOU 4OS2A 2KAIB 3TGJE 2AEIH 1DE7H 1A5HA 3SOSA 1A5GH 1GHVH 2GZ8A 1OWDA 4DIIH 1FPHH 2GVFA 4WMFA 1SMFE 2XC5A 1QR3E 2O9QA 4TWYA 4GLYA 3PTBA 3MWIU 1IQNA 2HALA 2GCTC 3I78A 4CBNA 1T7CA 4I8HA 4MNYA 1BBRE 1MTVA 3D49H 1HJAB 4F4OC 3GDUA 5FAHA 3TK9A 1NRNH 3SJOA 3M3VA 2PLXA 3BEIB 1HNEE 1BRAA 1W11U 3A81A 3A82A 1O2TA 3TJOA 1SFQB 4H4FA 4IMZA 7GCHG 1Z6EA 2VB0A 2AFQB 2VU8E 3P8NA 1BBRK 3BN9A 1OWHA 1CVWH 4AGJA 3V7TA 2RG3A 1JOUB 1ETRH 1N8OC 1V2QT 5GXPA 1C1OA 3M3TA 3M7TA 2NU4E 1MU8B 4IMQA 4K1EA 1KTSB 1DX5M 1SGIB 1ZMNA 3QO6A 4ABHA 1OYQA 3PB1E 2ZPRA 1LHEH 3JZ2B 5F8ZA 2BD2A 4X2XA 4FUEA 5E0GA 3U8RH 3RXHA 3O8BA 4NA7A 2ZPQA 2ESTE 1AUTC 3S7KB 5JBTA 2W7UA 4JZ1A 4ZHAA 1C5WB 2ZF0H 1J17T 1GG6B 2AIPA 3A86A 2WPIS 3ZYEA 2BOKA 1T31A 3KGPA 1VGCB 2JKHA 3QGJA 4UE7H 2AS9A 1GDUA 2DE8A 2WYGA 1LPZB 1KDQA 1EOJA 2ZCHP 1C5QA 1DXPA 1OP8A 1P11E 2H5DA 2CF8H 2WPJS 3PTNA 3SU6A 1ZRBA 1EAXA 3D23A 4FU8A 1ANEA 1UVTH 3T26A 5LPFA 2VWLA 1TBRH 4DJZB 1GBJA 1OXGA 1Y3WA 2HGTH 3C1KA 1ELVA 4K69A 1RRKA 1G3EA 2I6QA 1T8LA 5JPMH 1YC0A 5FCKA 4X2YA 1JMOH 2HNTE 1NTPA 2P93A 1ZSKA 1ARCA 1QFKH 5PTPA 4J2YB 1KXDA 3SO3A 1FY4A 3SU2A 1BQYA 3FANA 1O5BB 4CRAA 3L3TA 3QTVH 1TOMH 1ETSH 1P3EA 2FTMA 1FDPA 2GZ9A 5CMXH 3HKIB 2CJIA 1GBHA 3BG4C 2ZGBH 4Y6DA 1BHXF 1V2VT 2Y80A 1Y5UT 2XBWA 4ISIH 1AWFH 1TQ0B 1UTKA 4XOJA 4UFEH 4FUCA 3SNDA 3K6YA 1HAIH 3S9AA 5F03A 1F92A 4H6SB 2B5TB 3LONA 4ISNA 1WUNH 1OKXA 3A7WA 4GHQA 1NN6A 5JBBS 1CO7E 5F6MA 1ACBE 1ZSJA 2ANMH 3KIDU 4ZAEA 4INLA 1O3IA 3K6ZA 3LJJA 4X1RU 3UNQA 2RA3A 1H9HE 2G4TA 1L4ZA 4VGCB 2J94A 3Q77A 1BZXE 1S83A 1O2RA 2XTTB 1NPMA 1GVKB 3A7XA 3VB4A 1MTSA 1GBAA 1PFXC 1EX3A 3R0FA 4X2WA 2G81E 1FONA 2ZPSA 4CRCA 5T3HA 4O3UA 2CV3A 2FDAA 3ZVFA 2FODA 4D9RA 3E0PB 1TYNA 1W2KH 1ELCA 1SFIA 2A1DB 3ZZBA 3PROA 2WPKS 3SV2H 1Z8GA 1D3TB 1L0ZA 3BEUA 1DUAA 3GOVB 1H8DH 1C1MA 3LKWA 1W0YH 1H8IH 1ABJH 4KTUA 2OLGA 3U1JB 2P8OC 2HOBA 1QA0A 2ZFFH 2A4GA 5HYOA 1ELEE 1LPGB 2SGDE 5FX6A 1OSSA 3UIRA 1QJ6B 1LDTT 1D6RA 3OX7U 1DSUA 2GMTC 1LPKB 1ZYOA 1SC8U 1PPEE 4E05H 2HWLB 1HAHH 1GDNA 5AFYH 5FHTA 3UQOA 5CHAC 1SLUB 3EE0B 3U98H 1P2IA 1KXFA 3SBKA 1LTOA 4NIXA 1Q31A 1C1PA 1GHBF 3GY6A 4WXVA 2TIOA 1CA8B 4SGAE 2BDGA 2P95A 1O36A 3SI4H 2F9NA 1NT1A 1HAVB 2WPLS 1OWKA 1SPJA 2OBQA 4KGAA 3BIUH 3P17H 1SVPA 5A8XA 1T32A 2STAE 4B2BA 2Q1JA 2GT8A 3CS0A 3EA9A 2O8MA 1G3BA 1OP0A 1W12U 1TNGA 2FI5E 3KHVA 4BAHB 2OQ5A 1MQ5A 3T2NA 4ZKRU 1FY5A 1LCYA 2Y7XA 1NU9A 2VVCA 4UDWH 3RXCA 1ZJDA 1MUEB 1NRSH 1TOCB 2BOHB 1GCTC 1O5GH 3LJOA 5HGGA 1WBGB 2BD5A 1AMHA 1UCYE 1ZZZA 6CHAC 3GY4A 3LOXA 1A61H 4ZH8A 1GJ8B 4DT7B 1SHHB 4JMYA 1GL0E 2P3FH 3O8RA 4B1TA 1CA0B 3VGCB 1WOFA 1ZHPA 1DXWA 1UCYK 1ZTKA 1FMGA 1QB6A 5EQRA 1A3BH 2VNTA 3LGYA 5FPTA 1HIAA 3RXJA 2CXVA 4Y8YA 8ESTE 1BMAA 2ULLA 1UVUH 1EAUA 3RXSA 5C5NA 4E06H 1V3XA 5HM9A 3K9XB 3OSYA 1FV9A 3ZVBA 2XWAA 4DW2U 2CN0H 4E7RG 3E16B 5DP7A 4AORA 2VGCC 4ZKNU 1P03A 2OTVA 1GGDB 1V2LT 2D1JA 4NA8A 2XW9A 3MH4A 1GMHF 3PYHA 4NCYA 4OS5A 1BMMH 1NFUA 1AB9C 2BDCA 1NFYA 1EATA 1YCPK 2H9EH 5TJXA 3UR6A 3E90B 1SOZA 4WWYA 1LKBA 1O5CB 4Y11E 1TX6A 2LNCA 1GDQA 3A83A 1Q3XA 3K65B 1TNJA 2ZDMA 3MU0A 2FOBA 1D9IA 1P09A 1DY9A 1QBNA 3MO6A 3O8DA 2VIVA 4BXWA 1CT2E 3A7ZA 3ZZ6A 1ZGIA 3M37A 3VXEH 5IDKA 3ZZ3A 3TGKE 1RJXB 1GBKA 4B2CA 1KTTB 3SORA 5ESBA 1PPBH 1FLEE 3SGAE 2QXHA 1TGCA 5C1XA 1L2EA 1QNJA 3UY9A 1Y3UA 3V12A 4IW4E 5A0BA 1EQ9A 4A1TA 3A84A 1O2LA 1S6HA 1MTUA 3SUDA 5LGOA 1N1LA 3ODDA 4IN1A 3PO1C 3EA8A 2M5TA 4UFGH 1SGNE 1GHAF 2V35A 1O35A 4Z6AH 1A46H 3MNXA 1V2JT 5EW2H 4I8LA 3MH6A 2BVRH 1P04A 1Z8JB 4NZQA 2EEKA 1F5LA 4XDEA 1G2MA 3M5MA 2XBXA 4X8UH 1RTLA 2C8ZB 3GY7A 4WXIA 2FIRH 1ANBA 1EAIA 1YP9A 1C2HA 2VVUA 1C5PA 1SGFA 1AHTH 1GI3A 2NU1E 3LGUA 1RTFB 3SGQE 1H1BA 3RM2H 1XUIA 4X2VA 1EJMA 2Y5FA 1GI5A 2VJ1A 5EODA 1HLTH 2ZGCA 1QQ4A 1BBRH 4NA9H 2V3OH 1WTHD 3HGNA 3CENA 1BITA 1QRXA 5T6DA 1MD8A 2FXRA 4GVUA 2Q6GA 3KQDA 1HXEH 1SOTA 2ZU2A 3B23B 1LHGH 2FPZA 4A6LA 1UTOA 3OY6U 4NG9H 2BLOA 1KLJH 2ZHDA 3GICB 1IHSH 4NWKA 1SG8B 2VIDA 2R9PA 3RUOA 1V2MT 2HNTC 1ZHRA 2IN2A 1NY22 3RXBA 3SJ9A 1HAOH 1TGBA 2C3SA 4Y71A 1C1NA 5C20A 4HI3A 2J4IA 2PTNA 1TBZH 3A85A 4CHAB 1O2KA 4FXGH 4TY7A 1ZMJA 4CH8B 3P8OA 1CBWB 2ZDLA 3CP7A 3BTKE 1C5RA 1GWAA 1P9UA 3KEEA 1V6DA 1TFXA 2XBYA 2ZHQH 1QJ7B 5E0JA 3RXLA 3C27B 1W3CA 2FP7B 2FMJA 1VJAU 1BTWA 3NWUA 1O3NA 1ESBA 4CRFA 1B0EA 1ZTLA 1BRCE 2BDAA 1S81A 1XUFA 2RA0A 1CGHA 2OINA 4JYVH 5J4SA 5T6GA 3ELAH 1O3PB 3BG8A 4YT6H 3PMBB 1DLKB 1PQ7A 1MQ6A 2NU3E 1ZMLA 1P8VC 3EYDA 5HMAA 4MNXA 2FI3E 1NRRH 2ODYB 2QYIA 1SGEE 2PW8H 2ZP0H 1AFQC 3RMMH 3FP8E 2H6MA 4D7GA 3TITA 1HJAC 2A31A 1D4PB 3SW2B 1V2RT 3NK8A 1LVBA 1UVSH 1DY8A 5E2PA 3RU4E 1SBWA 3SNCA 4HGCA 4D8NA 2WV4A 3D62A 3P70B 3ATWA 2OD3B 1KXCA 1QBVH 3RC6A 1DWBH 3FP7E 5K7RA 3BTME 3RXEA 3MNBA 1C2FA 3MHWU 3SV7A 4I8KA 3TJVA 2P3TB 1KXBA 2ZIQH 1SQOA 3MU1A 5LPEA 3LGTA 3LGWA 1F7ZA 1YLDA 1WSSH 1O2YA 3LT3A 1P10A 3SI3H 3LH1A 1TPPA 1V2ST 2WUCA 1V2NT 2BXUH 4KTSA 1AE8H 3MNSA 1C5UA 1GMDF 2PUXB 1ZTJA 3VB6A 1FN6A 3RU4D 3ZZ9A 4BAOB 2NU2E 3GY3A 4ZROA 2G00A 4GUXA 3QLPH 2ZCKP 2A7HA 2UUKB 4AX9H 5JB9S 1TABE 1QQUA 1P2OA 1JIMA 4YLUA 3ATMA 3T62A 2BVSH 1FIWA 2GDDA 2F9UA 3CS7A 3QUMP 1EZXC 3SHAH 1XM1A 5TCCA 2ZA5A 1SGCA 3A89A 5AVDA 4MPWA 3ZZDA 1OP2A 1AUJA 3D65E 1BRBE 2Y6TA 3UR9A 1RTKA 1GJCB 5DO4H 2CF9H 1K1IA 4YOIA 3SNBA 2V3HH 4FUBA 4NSVA 2AYWA 4K8YA 2XC4A 4I33A 1FY1A 1DUEA 2VWOA 1XUGA 1C1WH 1C2DA 4ABBA 3VFEA 1T4UH 1WCZA 8GCHF 1P57B 2ZGJA 5H4IB 4A92A 4LZ4B 1K1JA 3QGNB 2CHAB 1YPEH 1CHOG 4CBOA 2A32A 2FOFA 4ABGA 1ZR0A 2DE9A 2TPIZ 1F0SA 3VXFH 1GVZA 4UFDH 1TX8A 2BD9A 2JH6D 1FAKH 3S0NA 4X6OA 5A0AE 2PKSB 2W26A 2ZHFH 1O3KA 4D9QA 6LPRA 5JDUB 1O2HA 2IPHA 1GI7B 1GHYH 2PSXA 4NIVA 5EXNA 3ITIA 3PWCA 5EOKA 4B75A 4PROA 2F3CE 1GCDA 2ZFRH 1VCWA 2QXGA 1VR1H 4GHTA 2Z9GA 1GBIA 1NO9H 3SNAA 3BTEE 2Q6FA 3ATKA 1ELFA 1MKXK 2UWOA 1O38A 3MU5A 4I8JA 3ZZAA 1ELAA 4DY7B 2Z3DA 5DP9A 3SU4A 1TNKA 4NZLA 3E91A 1IQMA 1C2KA 5BRRE 1SGPE 5EW1H 1G37A 3PWBA 1G3CA 2FOAA 3OY5U 3ZV8A 4A7IB 3F9FA 3RXVA 2BLWA 1MKWK 3L6PA 2BTCE 1IQKA 1AVGH 5FPYA 2SFAA 2QY0B 3SHCH 1HAGE 3T25A 2GTBA 1MTNC 1TGNA 3W95A 1GJAB 2SGAA 3UTUH 1IQLA 1HIAB 5GWZA 1KSNA 1UCYH 2NU0E 1ZLRA 2WYJA 3ENSB 1QL9A 1AE5A 4X6MA 1YKTA 1SGDE 3TGIE 3HK3B 1LVOA 3GY8A 3BSQA 2Z7FE 2SNVA 1TMBH 2J38A 2GCTB 3LH3A 4ABEA 1IQEA 2ZGHA 1SGTA 4XFQA 3FVFB 2ZTYA 4BAKB 2PSYA 1XXDA 4B76A 3VB7A 1TGTA 1MD7A 2ZFPH 1LVYA 4Q7YA 5EXMA 2BZ6H 4A1VA 1XUHA 1TA6A 2ASUB 2PFEA 1FZZA 2ALVA 2F9OA 1FI8A 1IQIA 3OTJE 4KELA 1ELBA 3E8LA 4WMEA 1G36A 3UNRA 1EKBB 1UTNA 1KLTA 1FNIA 2XCFA 1QRZA 2ZDKA 1YCPH 4DG4A 1PJPA 5C5OA 1O3FA 2SGFE 5GJ4B 1N8OB 1O34A 3HPTB 1FAXA 1YPGH 2FOMB 2A2XH 4Y8XA 2W5EA 2VWMA 1TMTH 3RMLH 1TPAE 2QV1A 4F49A 1QURH 3W94A 1C4Y2 1EASA 1QRWA 3U8TH 1PPZA 2XRCA 1YPMH 3MOCA 1C1SA 1SLXB 2DUCA 3OYPA 1HJ8A 2THFB 2BYAX 4UONA 3FFGA 1GMCF 4X0WU 1UO6A 4YOGA 3T29A 3ZVCA 1JBUH 3TJUA 1F0UA 2G5VA 2ZECA 4TWWA 1G3DA 3DT0H 1GBBA 1BRUP 1UK3A 2BB4A 3E1XB 2J2UA 3KQCA 4MPVA 4JZDH 5L30H 3PMHB 1BHXB 1D3DB 1BJVA 3M5NA 1QJ1B 1EPTC 1NS3A 1UTPA 3UNSA 1O2NA 2P59A 4E7NA 1C5YB 8LPRA 2Z94A 2FZZA 1UJ1A 3SUEA 2GKVE 5A2MH
chains in the Genus database with same CATH superfamily
1LKAA 4IGDA 3M7QA 3ZZ7A 4OS6A 2FS8A 1A5IA 1XUJA 2BDIA 1L4DA 1XVMA 3A8DA 1QCPA 3KQEA 4F48B 1XVOA 4XD7D 3P95A 1S6FA 2FS9A 3S7HB 1C4U2 1GJ6A 4GCHF 3Q3KA 2PKAA 1AU8A 3E3TA 2W7SA 2FO9A 1VITH 3ZVAA 1UTMA 3ZYDA 4ASHA 1C5XB 3AW1A 4FU7A 3V3MA 1L1JA 1P2NA 1MZDA 3BG4B 1WTGH 2C90B 1SGFG 1GI4A 4OS7A 4MPUA 3WW7A 3FAOA 2BM2A 2WUBA 2H2ZA 4NSYA 3QK1A 1K21H 1ZHMA 2BY6X 3HATH 1GI0A 1H9IE 3RC5A 1LO6A 5KEDA 5E0HA 1CU1A 1CGJE 1ETTH 1NFWA 4YESB 5FXLA 2LP6A 3KN2A 1SQRA 1O3OA 1E35B 3RXDA 3NCLA 3SQHE 3LGIA 2XOKD 4NFEA 1VZQH 2KCYA 3DFJA 2GDEH 4BANB 5HXFA 1EXFA 4RKJB 1F2SE 4UD9H 3RXOA 3LU9B 1BB0B 1W8BH 1C4V2 4K1SA 2GV6A 2OK5A 3SJIA 4IC6A 2W3IA 1UTQA 3MU4A 2F9VA 4GSOA 1O5DH 3ZVDA 2C8WB 1JRTA 9LPRA 2G51A 3GCNA 4AN7A 2EQNA 1VITG 6GCHG 2TRMA 2AGGX 2JJ2D 3IWMA 3I29A 1XXFA 2B9LA 3UREA 4XBBA 3PMAB 1K1OA 1UHBA 2FESH 1K1PA 1L1NA 1QL7A 2FTLE 3SV6A 1YPHC 4DIHH 2YMSC 3F2FA 2P8OB 4Y76A 2R2MB 2QAAA 1TQ7B 1AY6H 1CQQA 1OS8A 5ABWA 1FUJA 1GHBG 2AMDA 5GDSH 1S84A 2AMQA 1Y3VA 1TE0A 1IQJA 3WWFA 2RDLA 2ZU4A 4B74A 1GI8B 1CT0E 2GMTB 4X6PA 1HAPH 5EU8A 4O3TA 1AIXH 3F68H 5CHAB 1MTWA 1FQ3A 5C1YA 5A0CA 2Z6BD 1UW7A 3GYLB 2OC8A 2UWPA 3RDZA 1BJUA 3SNEA 3DD2H 1P06A 1V2WT 7LPRA 2EI6A 2ZHWH 3EAJA 1RIWC 1ANDA 2ZGXH 2BD8A 1GVLA 3P8GA 2F9BH 4CH2B 1W10U 3K2UA 1O2ZA 4B6EA 2ZQ2A 3MU8A 2V6NA 2BLVA 4X1QU 1T4VH 2Z9IA 3GISB 5SGAE 3RLWH 1BTPA 1HRTH 1J8AA 4K3JA 3PV4A 1Z1IA 1AVWA 1AKSA 1O2WA 2BDYA 1A4WH 1O37A 4JYUH 1TRYA 1O2XA 5LPRA 4ISHH 1ELGA 3OAAD 4B71A 1GL1A 1GCTB 5GCHG 2L6OA 1ZRKA 1CBWC 6CHAB 3MH7A 2O8LA 1UK4A 1C2EA 1A1RA 2WV5A 2TBSA 1GBMA 4JZFH 2JETC 3AAUA 3UB0A 4BAQB 3MTYA 4RT0A 4AG2A 4YO9A 4Y79A 2R0LA 1AZZA 1SI5H 3ODFA 1M9UA 1SLWB 2KR7A 5C3NA 3BTWE 2HLCA 2ZQ1A 1TNHA 4MPXA 1N6XA 1EZQA 3AASA 1LMWB 1UK2A 2F9PA 3VPKA 2AGIX 2XYAA 7ESTE 3TIUA 4ZMAH 3U69H 3GCHC 4Y10E 2H9HA 5LH8A 4SGBE 4AFUA 5F8TA 4YTAA 3GY2A 2AERH 1VCPA 4ESTE 4XSKU 2OUAA 3BTDE 2Z3CA 1IOEA 1A0HB 1NRPH 1DPOA 3T28A 1HDTH 1B0FA 4K5ZA 1DDJA 2STBE 1FN8A 1HAZB 1KY9A 4QT8C 2ZO3H 4DOQA 2ANKH 3U8OH 3DFLA 1O31A 2QIQA 1O0DH 1E38B 2GP9B 1RS0A 3MNCA 5A09A 3VB3A 4BTUB 1ELDE 3PRBA 4I31A 4THNH 3GCTF 4I86A 1AB9B 1DWEH 4MNVA 4H42U 1ARBA 3MO3A 3KL6A 4X8SH 3RMNH 3P8FA 1NRQH 2J34A 5G4BA 1THRH 5EQSA 1IQGA 1MKXH 3FKSD 1NBME 1ORFA 2R3YA 2TGTA 1NM6A 5DP8A 2ANYA 4ABDA 4DT4A 2KFWA 1EJAA 3SUGA 1KDQB 1A0LA 1GJ4H 3M3SA 4ASUD 1HAVA 2ODQA 3RXRA 3DSPA 1H9LB 3S9BA 1TGSZ 1P2JA 1Y3YA 5HM2A 1MMJN 2ZG0H 1GHAG 3PLKA 3MMGA 1S82A 3KQBA 3U1IB 2IJD1 1IAUA 3CNRA 3MH5A 2A5IA 1X7AC 1HFDA 3GCOA 3MO9A 1ZGVA 3NXPA 3Q3XA 2RFKC 3A7YA 3MI4A 4Q80A 2P94A 2UUJB 1IHTH 1DWDH 2Y82A 3RXUA 4M7GA 1AI8H 4Q7XA 5HIYA 2VVVA 5DG6A 3PO1B 5EPNA 5L2YH 3NUMA 1RXPA 1NBMD 1EPTA 3UUZA 1ID5H 5TCAA 2ODPA 2P16A 1ANCA 2HPQH 5FBIA 3RXTA 2ZDVH 1MU6B 2ZFQH 3M7UA 1DSTA 1KYNA 3S69A 1OWJA 1C1RA 3SV8A 1O3MA 1UVPA 3SU5A 1TALA 1TRNA 1T8NA 4U01A 1SL3A 1BTHH 2ZHEH 1TNIA 1BUIA 1UTLM 2QC2A 1YLCA 1LHCH 1YPJH 2IJOB 4BOHA 4A1XA 3O8CA 4OGXA 3SU1A 3EA7A 4YT7H 2ZFTA 4NGAH 1IQFA 5FPSA 1HJ9A 1DS2E 2FYQA 1P2KA 1FXYA 7GCHF 3DUXH 2K1QA 1LVMA 4ZXXH 1YPHE 1TONA 2A2QH 1O3EA 1GHXH 1C2IA 1J9CH 4DVAU 1J15A 1HB0B 2A7CA 1QL8A 2XC0A 3UFAA 1K1MA 4YLQH 1O3LA 3OU0A 1E0FD 1Z7KA 5DJ7A 2ANWA 2BY9X 1GJ5H 3E6PH 4FU9A 4OGYA 2KX4A 1GG6C 2FX6A 2XNDD 1HGTH 4ZXYH 1TIOA 4MQAA 1VGCC 2I6SA 4OS4A 2GCHG 1SQTA 5GPIB 4LK4A 1MAXA 3F9HA 2W3KA 1T8OA 1HAXB 3RU4T 4ISLA 2QCYA 3B9FH 1DM4B 1SR5C 2ZDNA 4YOJA 1C5LH 2YMSD 1E1QD 1MZAA 1C1UH 1ZPZA 4DGJA 1S0QA 1O2IA 2EI8A 2BY8X 4AGKA 3EDXB 1TBQH 3STJA 1D3PB 1HAYB 4JZEH 2BD4A 2PKAB 1THSH 5F53A 3RM0H 1O3HA 3TNTA 5F8XA 4ZUHA 4Y7AA 1P05A 3STIA 1HPGA 4H6TA 3TU7H 4ABJA 4O97A 1AFQB 2Z9JA 4X1NU 2XWBI 2F43B 1BIOA 2ZTXA 4AB9A 3QN7A 4K60A 1E36B 3KF2A 1FJSA 2R0KA 1FIZA 3TPIZ 1E79D 5EQQA 5ESTE 4BNRA 2QF3A 1GPZA 2RCEA 1ZOMA 4B73A 3KCGH 1SGYE 4X1PU 3RXQA 1YBWA 2QA9E 1O3BA 4YM9A 2GV7A 4ABAA 2UUFB 1Z1JA 4RN6A 3IITA 1O2VA 5C94A 3QTOH 5T6FA 1UVOA 3ATIA 1A7SA 5FBEA 1C9TA 1GMDG 2PUQH 2HVXA 3GDVA 4BXSA 1V2KT 2LPRA 3KNXA 3ZZ8A 2FYRA 1FX0B 2YNBA 2BD7A 1THPB 2F83A 1Q2WA 2FWWA 2VH0A 4Q2KA 2JH0D 2FLBH 3RC4A 1Z6JH 3A8AA 1P02A 2OP9A 1DLEA 2AH4X 4KTCA 4VGCC 2ZTZA 2G8TA 2YNAA 2BLQA 2WZQA 4J1YA 3RXGA 1ZSLA 2WPHS 1TRMA 1OX1A 4MVNA 1O2QA 1GI1A 1BMFD 1OOKB 1BTXA 2H1UA 3TVJB 4WJG2 1K1LA 6ESTA 1JRSA 4KKDA 3EQ0H 2OC0A 2SGPE 1WQSA 1UHBB 3TNSA 4I32A 1SLVB 1BTUA 5EG4A 3BV9B 3SQEE 8GCHG 1O3GA 1GBTA 1LQEA 1E37B 1C5SA 1RGQA 2J9NA 1TMUH 1BDAA 1YF4A 4AZ2B 4LOYH 3SN8A 4RI0A 1V2UT 1YGCH 3M61U 4BTIB 4JCNA 3SU0A 1XX9A 4R0IA 3L33A 1BMNH 2EC9H 2B0FA 3IG6B 4CR9A 1K2I1 4HFPB 4AFZA 4MTBA 1C2LA 2PTCE 2A5AA 3URCA 1WU1A 2JJ1D 2ZC9H 1VCQA 2D8WA 2FOEA 1PPCE 3QX5H 1Z8IB 1T8MA 3AAVA 2C93B 2D26C 3H09A 3N7DA 3UWJH 5DGJA 1OWEA 2BY7X 4XRNA 2BDBA 2VIPA 2PGQB 1EP6A 2GGVB 2VIWA 1DVAH 1GBFA 2Y7ZA 1YLNA 1S5SA 3NZIA 1GJDB 1GJBB 2BQWB 3LC3A 4TYDA 1EJNA 1ESTA 2A4OA 1MAYA 3RMOH 2QGRA 2PGBB 2FI4E 4U2WA 3BTTE 3VG8A 2BQ6B 2OCVB 3UPEA 3QZRA 1AKSB 1TA2A 1CE5A 1TX7A 1A2CH 1O32A 2TGPZ 1JIRA 1GBEA 3RXMA 1PQAA 4FUDA 3Q76A 1W0ZU 2BZAA 2XBVA 3ZV9A 1PYTD 2HRVA 4WF8A 4ACBA 1FPCH 3JZ1B 1Z71A 3OFND 2J95A 1DOJA 2OC7A 2KCPA 1DT2A 2JH5D 5AHGH 5C0TA 1GBDA 1L1GA 1HXFH 5DP5A 3A7VA 2J92A 3QDZB 1O2OA 3SZNA 3LGVA 3ZVGA 3F0OA 5EJZA 2VIQA 4GAWA 2K8IA 1O5EH 2B8OH 2VWNA 3VEQB 1CA0C 2KCOA 3ZZ5A 1DWCH 3H7TA 3VGCC 1CHGA 4BAMB 1MTNB 4TPYA 1ELTA 1C2GA 3S9CA 1J14A 1O3JA 2B7DH 1GJ9B 5EXLA 5J4QA 4AYVB 5E8EH 5DP4A 1K1NA 2QXIA 4FUGA 5I25A 2KAIA 1P01A 2EA3A 1E34B 4X6NA 1AD8H 1TPSA 1VJ9U 3R3GB 4NIYA 1NC6A 1EP5A 1C2JA 4Y7BA 1SSXA 2AGEX 2R3UA 3PV5A 3LDXH 2FOGA 2HPPH 2V0BA 1AN1E 1VITF 6GCHF 5FCRA 1GGDC 4Z0KA 4IC5A 4HZHA 2VIOA 3HK6B 4D7FA 2GX4A 1H4WA 1G2LA 2ZFSA 2BXTH 2CGAA 2UWLA 1P2MA 5AFZH 2FLRH 2G52A 4INKA 1QB9A 4UEHH 4U30A 1DITH 1TLDA 1QIXB 2PV9B 4TPIZ 1GHWH 1K28D 3QZQA 4YZUA 3UQVA 3P92A 1AGJA 3URDA 3DHKH 1GMCG 3B8JA 3NKKA 1W14U 3OEED 3PMJA 3F9GA 3PLPA 2BHGA 2SNWA 5B6OA 4LXBH 1MABB 3A8BA 4WY3A 3BTQE 5JBCS 1E1RD 2PP6A 2W6JD 3TH4H 3F1SB 3GYMA 4ABIA 4FUFA 2LELA 1EUFA 4ZKSU 2XXLA 4ISOA 1KXEA 3KYFA 2Y81A 2PWXA 4IS5A 5DP3A 1G9IE 2VINA 1Y5AT 3EE7A 1V2OT 2BY5X 1B5GH 2AMPA 1PPFE 2Y5GA 2ZDAH 1KLIH 2ZKSA 1O3DA 2HLDD 1NROH 4X8VH 3SV9A 2BQ7B 5C2ZA 5DP6A 5JBAS 1QBOA 2FX4A 3M5OA 1EPTB 3U9AH 5C67A 4JYTA 1AZ8A 1YYY1 2TGDA 4JZIA 4GCHG 1NFXA 1EOLA 3TH2H 1XUKA 2WPMS 1LHDH 3A8CA 4AYYB 4INHA 3SU3A 1BCUH 4HTCH 2ALPA 5GCHF 2J98A 3E0NB 1BTYA 1Y3XA 4I8GA 1QB1A 2A0QB 1NU7B 4FOUC 1FY8E 3TK6A 4WH6A 2A4RA 4Q7ZA 1C1TA 2W6ID 1MCTA 4FVBA 2ZU5A 3V0XA 2PHBA 3HGPA 1F5KU 1C5VA 2OXSA 1HV7A 1S0RA 2H5CA 3UWIA 1O39A 2J5UA 4AOQA 1AVXA 1EB1H 2BMGB 1EZUC 3V13A 1AQ7A 2QN5T 1EZSC 2A45B 4RKOB 3RXIA 3PLBA 5DPAA 2FEQH 1GI2A 1W7GH 1QY6A 4OS1A 1XMNB 5L6NH 1MBQA 1GHZA 1EAWA 1C5ZB 1PQ5A 3RXPA 2AIQA 1O30A 1ZPCA 2ZNKH 4MDSA 2QE7D 4CRBA 4ZHMU 3N7EA 3TJNA 1GI9B 1W13U 1CGIE 1UTJA 1YPKH 4AC9A 3WY8A 1KXAA 1B7XB 3RP2A 5BPEA 3BIVH 1SGQE 2TGAA 1K0HA 1C2MA 4K1TA 2BD3A 2VH6A 5L2ZH 1V2TT 3SGBE 1EB2A 2OQUA 9ESTA 2D2DA 4CHAC 2P3UB 1QTFA 1O3CA 4IN2A 4WVPE 1FY3A 1BMLA 1P9SA 2H9TH 1Y8TA 1TPOA 1O2PA 2QXJA 1ZJKA 3M36A 1GJ7B 4TSFD 3MQKC 2QF0A 3UOUA 3BTHE 2FOHA 3F0PA 4AG1A 3DA9B 2C8XB 1XKBC 1JWTA 1K22H 1G32B 1QHRB 1GBCA 3SZEA 4O03A 4D76A 4FUIA 3ZZCA 1HUTH 4KP0A 1RD3B 2UUYA 3QWCH 4Q4LA 4BTTB 5EPYA 1BTZA 1HCGA 1C5NH 2ZU3A 2SGEE 3A87A 1O5FH 3PM3A 5CE1A 5EGMA 1OWIA 2GD4B 1WXRA 1YCPM 1GMHG 3NPSA 5I46H 2BVXH 2YMSB 1DICA 4I7YH 5GNDA 2BX4A 2C8YB 5C0UA 3HKJB 2BDHA 1C1VH 4A5TS 4JK5A 1ZPBA 2Q6DA 1DANH 2VGCB 1CSOE 3ZVEA 1C5OH 1TB6H 2O8TA 3F6UH 5JB8S 3U28C 5DK1A 1W7XH 3BTGE 2ZZUH 1AO5A 5GIBA 4ACAA 1LQDB 1YM0A 3F9EA 2R2WU 1PQ8A 1PPHE 4X1SU 1AFEH 4FVDA 8KME2 2FOCA 1MBMA 3A7TA 1HBTH 1RIWB 1C1QA 5CDFE 1G30B 5C1UA 1N6YA 1BT7A 4NIWA 1F5RA 4CRDA 1A3EH 3M5LA 2G5NA 4ZHLU 1CT4E 4FUHA 2ZU1A 3M35A 1J16A 2O8UA 1P3CA 2SGQE 4O9VA 3BF6H 3FZZA 4K2YA 1HYLA 2G4UA 2EY4C 4CREA 2ZEBA 2ZI2H 1OPHB 1TNLA 4AFSA 3EGKH 1UMAH 1O2MA 4Z1MD 1PYTC 5FX5A 3MFJA 2O8WA 3FZDA 4X8TH 1INCA 1MKWH 4FUJA 5EIYA 1C9PA 3SUFA 3H5CB 1AWHB 1H8ED 1KIGH 5JYIA 1K9OE 1O5AB 3P6ZB 2F91A 1RFNA 2WINI 1A0JA 1P2QA 2JETB 2YOLA 2GT7A 4WH8A 4Y0YE 3H7OA 3ATLA 2XCNA 1GBLA 1GI6A 4JK6A 2M2AA 1C5TA 2Z9KA 1QA7A 3TH3H 2XNIA 5DKMA 1OYTH 4NFFA 4RSPA 3G01A 5AF9H 1F0RA 1O33A 1WAYB 3LPRA 2Y5HA 1SHYA 1PPGE 2ZCLP 1C5MD 4R8TB 4P02A 2GCHF 3DSGA 2A4QA 1WQVH 1MH0A 3GCHB 1D3QB 4B6FA 1Y5BT 7KMEH 1S85A 2CHAC 2HNTF 2Z3EA 4YXWD 2FM2A 2ZWLH 1TWXB 3GCTG 3Q3YA 4U32A 3TLOA 3AW0A 4DCDA 5A8ZA 2IOTA 3MYWA 1JXPA 1F0TA 1O2UA 3T5FH 3LIWA 5ETXA 3PV2A 1BOQA 2PKSC 3SJKA 1LHFH 3BEFB 2NWNA 3RXFA 3RXKA 2A7JA 2G55A 1CHOF 3A80A 1DFPA 1Z8RA 4K8BA 3ESTA 4TY6A 4B2AA 3RXAA 4MNWA 1O2GH 4ABFA 4CRGA 3ZZ4A 1WYKA 1QGFA 4LZ1H 5A8YA 1YPLH 1O2JA 1O2SA 3A88A 2A5KA 1NESE 5T1VA 3UOPA 3PRDA 4XBDA 1SB1H 3VB5A 5E2OA 2BX3A 1P12E 5IYTA 3N7OA 5K0HA 4AB8A 2EI7A 4MG3A 1BA8B 1SQAA 1D6WA 2Z9LA 4XBCA 4Y0ZE 3T27A 3TK5A 4WMDA 3Q00A 3LC5A 1WV7H 4P00A 4MLFB 2GZ7A 4XE4A 1IQHA 3RLYH 1XKAC 3GDSA 1ABIH 2C4FH 3SJ8A 2OBOA 4IBLH 4Y8ZA 4AFQA 1O3AA 3I77A 4Q63A 1V2PT 2ILNA 2PR3A 1MCVA 1Y59T 4CR5A 4UFFH 4DURA 1TAWA 3BTFE 3FP6E 3GY5A 1NZQH 1U6QA 1ESAA 1SGRE 4GPGA 2CMYA 2OC1A 3AVZA 1P0SH 4NWLA 4ZKOU 4OS2A 2KAIB 3TGJE 2AEIH 1DE7H 1A5HA 3SOSA 1A5GH 1GHVH 2GZ8A 1OWDA 4DIIH 1FPHH 2GVFA 4WMFA 1SMFE 2XC5A 1QR3E 2O9QA 4TWYA 4GLYA 3PTBA 3MWIU 1IQNA 2HALA 2GCTC 3I78A 3OTPA 4CBNA 1T7CA 4I8HA 4MNYA 1BBRE 1S6LA 1MTVA 3D49H 1HJAB 4F4OC 3GDUA 5FAHA 3TK9A 1NRNH 3SJOA 3M3VA 2PLXA 3BEIB 1HNEE 1BRAA 1W11U 3A81A 3A82A 1O2TA 3TJOA 1SFQB 3FO8D 4H4FA 5FL7D 1W0JD 4IMZA 7GCHG 1Z6EA 2VB0A 2AFQB 2VU8E 3P8NA 1BBRK 3BN9A 1OWHA 1CVWH 4AGJA 3V7TA 2RG3A 1JOUB 2RDEA 1ETRH 1N8OC 1V2QT 5GXPA 1C1OA 3M3TA 3M7TA 2NU4E 1MU8B 4IMQA 4K1EA 1KTSB 1DX5M 1SGIB 1ZMNA 3QO6A 4ABHA 1OYQA 3PB1E 2ZPRA 1LHEH 3JZ2B 5F8ZA 2BD2A 4X2XA 4FUEA 5E0GA 3U8RH 3RXHA 3O8BA 4NA7A 2ZPQA 2ESTE 1AUTC 3S7KB 5JBTA 2W7UA 4JZ1A 4ZHAA 1C5WB 2ZF0H 1J17T 1GG6B 2AIPA 3A86A 2WPIS 3ZYEA 2BOKA 1T31A 3KGPA 2VBCA 1VGCB 2JKHA 3QGJA 4UE7H 2AS9A 1GDUA 2DE8A 2WYGA 1LPZB 1KDQA 4F55A 1EOJA 2ZCHP 1C5QA 1DXPA 1OP8A 1P11E 2H5DA 2CF8H 2WPJS 3PTNA 3SU6A 1OHHD 2J98B 1ZRBA 1EAXA 3D23A 4FU8A 1ANEA 1UVTH 3T26A 5LPFA 2VWLA 2HVYB 1TBRH 1YY3A 4DJZB 1GBJA 1OXGA 1Y3WA 2HGTH 3C1KA 1ELVA 4K69A 1RRKA 1G3EA 2I6QA 1T8LA 5JPMH 1YC0A 5FCKA 4X2YA 1JMOH 2HNTE 1YWUA 1NTPA 3GS9A 2P93A 1ZSKA 1ARCA 1QFKH 5PTPA 4J2YB 1KXDA 3SO3A 1FY4A 2WV9A 3SU2A 5C17A 2KM0A 1BQYA 3FANA 3NRLA 1O5BB 4CRAA 3L3TA 3QTVH 1TOMH 1ETSH 1P3EA 2FTMA 1FDPA 2GZ9A 5CMXH 3HKIB 2CJIA 1GBHA 3BG4C 2ZGBH 4Y6DA 1BHXF 1V2VT 2Y80A 1Y5UT 2XBWA 4ISIH 1AWFH 1TQ0B 1UTKA 3N99A 4XOJA 4UFEH 4FUCA 3SNDA 3K6YA 1HAIH 3S9AA 5F03A 1F92A 4H6SB 2B5TB 3LONA 4ISNA 1WUNH 1OKXA 3A7WA 4GHQA 1NN6A 5JBBS 1CO7E 5F6MA 1ACBE 1ZSJA 2ANMH 3KIDU 4ZAEA 4INLA 1O3IA 3K6ZA 3LJJA 4X1RU 3UNQA 2RA3A 1H9HE 2G4TA 1L4ZA 4VGCB 2J94A 3Q77A 1BZXE 1S83A 1O2RA 2XTTB 1NPMA 1GVKB 3A7XA 3VB4A 1MTSA 3FN8A 1GBAA 1PFXC 1EX3A 3R0FA 4X2WA 2G81E 1FONA 2ZPSA 4CRCA 5T3HA 4O3UA 2CV3A 2FDAA 3ZVFA 2FODA 4D9RA 3E0PB 1TYNA 1W2KH 1ELCA 1SFIA 2A1DB 3ZZBA 3UAIC 3PROA 2WPKS 3SV2H 1Z8GA 1D3TB 1L0ZA 3BEUA 1DUAA 2JIZD 3GOVB 1H8DH 1C1MA 3LKWA 1W0YH 1H8IH 1ABJH 4KTUA 2OLGA 3U1JB 2P8OC 2HOBA 5CHBA 1QA0A 2L74A 2ZFFH 2A4GA 5HYOA 1ELEE 1LPGB 2SGDE 5FX6A 1OSSA 3UIRA 1QJ6B 1LDTT 1D6RA 3OX7U 1DSUA 2GMTC 5DSFA 1LPKB 1ZYOA 5EJ1A 1SC8U 1PPEE 4E05H 2HWLB 1W0KD 1HAHH 1GDNA 5AFYH 5FHTA 3UQOA 5CHAC 2WHXA 1SLUB 3EE0B 3U98H 1P2IA 1KXFA 3SBKA 1LTOA 4NIXA 1Q31A 1C1PA 1GHBF 3GY6A 4WXVA 2TIOA 1CA8B 4SGAE 2BDGA 2P95A 1O36A 3SI4H 2F9NA 1NT1A 1HAVB 2WPLS 1OWKA 1SPJA 2OBQA 2WPDD 4KGAA 3BIUH 3P17H 1SVPA 5A8XA 1T32A 2STAE 4B2BA 2Q1JA 2GT8A 2QF4A 3CS0A 4TT3D 3EA9A 2O8MA 1G3BA 1OP0A 1W12U 1TNGA 2FI5E 3KHVA 4BAHB 2OQ5A 1MQ5A 3T2NA 4ZKRU 1FY5A 1LCYA 2Y7XA 1NU9A 2VVCA 4UDWH 3RXCA 1ZJDA 1MUEB 1NRSH 1TOCB 2BOHB 1GCTC 1O5GH 3LJOA 5HGGA 1WBGB 2BD5A 1AMHA 1UCYE 1KMHB 1ZZZA 6CHAC 3GY4A 3LOXA 1A61H 4ZH8A 1GJ8B 4DT7B 1SHHB 4JMYA 1GL0E 2P3FH 2AHME 3O8RA 4B1TA 1CA0B 3VGCB 1WOFA 1ZHPA 1DXWA 1UCYK 1ZTKA 1FMGA 1QB6A 5EQRA 4HG6A 1A3BH 2VNTA 3LGYA 5FPTA 1HIAA 3RXJA 2CXVA 4Y8YA 8ESTE 1BMAA 2ULLA 1UVUH 1EAUA 3RXSA 5C5NA 4E06H 1V3XA 5HM9A 3K9XB 3OSYA 2KZ4A 1FV9A 3ZVBA 2XWAA 4DW2U 2CN0H 4E7RG 1EFRD 3E16B 5DP7A 4AORA 2VGCC 4ZKNU 1P03A 2OTVA 1GGDB 1V2LT 2D1JA 4NA8A 2XW9A 3MH4A 1GMHF 3PYHA 4NCYA 4OS5A 1BMMH 1NFUA 2V7QD 1AB9C 2BDCA 1NFYA 1EATA 1YCPK 2H9EH 5TJXA 3UR6A 3E90B 1SOZA 4WWYA 1LKBA 1O5CB 4Y11E 1TX6A 2LNCA 1GDQA 3A83A 1Q3XA 3K65B 1TNJA 2ZDMA 5EJLA 3MU0A 2FOBA 1D9IA 1P09A 1DY9A 1QBNA 3MO6A 3O8DA 2VIVA 4BXWA 1CT2E 3A7ZA 3ZZ6A 1ZGIA 3M37A 3VXEH 5IDKA 3ZZ3A 3TGKE 1RJXB 1GBKA 4B2CA 1KTTB 3SORA 5ESBA 1PPBH 1FLEE 3SGAE 2QXHA 1TGCA 5C1XA 1L2EA 1QNJA 3UY9A 1Y3UA 3V12A 4IW4E 5A0BA 1EQ9A 3OE7D 3W1EA 3A84A 4A1TA 1O2LA 1S6HA 1MTUA 3SUDA 5LGOA 1N1LA 3ODDA 4IN1A 3PO1C 3EA8A 2M5TA 4UFGH 1SGNE 1GHAF 2K0QA 2V35A 1O35A 4RT1A 4Z6AH 1A46H 3MNXA 1V2JT 3ZIAD 5EW2H 4I8LA 3AK5A 3MH6A 2BVRH 1P04A 1Z8JB 4NZQA 2EEKA 1QZ8A 1F5LA 4XDEA 1G2MA 3F2HA 3M5MA 2XBXA 4X8UH 1RTLA 2C8ZB 3GY7A 4WXIA 4M9FA 2FIRH 1ANBA 1EAIA 5B6LA 1YP9A 1C2HA 2VVUA 1C5PA 1SGFA 1AHTH 1GI3A 2NU1E 3LGUA 1RTFB 3SGQE 1H1BA 3RM2H 1XUIA 4X2VA 1EJMA 2Y5FA 1GI5A 2VJ1A 5EODA 1HLTH 2ZGCA 1QQ4A 1BBRH 4NA9H 2V3OH 1WTHD 3HGNA 3CENA 1BITA 1QRXA 5T6DA 1MD8A 2FXRA 4GVUA 2Q6GA 3KQDA 1HXEH 1SOTA 2ZU2A 3F2GA 3B23B 1LHGH 2FPZA 4A6LA 2J97A 1UTOA 3OY6U 4NG9H 2BLOA 1KLJH 2ZHDA 3GICB 1IHSH 4NWKA 3KYGA 1SG8B 2VIDA 2R9PA 3RUOA 1V2MT 2HNTC 1ZHRA 2IN2A 1NY22 3RXBA 3SJ9A 1HAOH 1TGBA 1WDIA 2C3SA 4Y71A 1C1NA 5C20A 4FETA 4HI3A 2J4IA 2PTNA 1TBZH 3A85A 4CHAB 1O2KA 4FXGH 4TY7A 1ZMJA 4CH8B 2CK3D 3P8OA 1CBWB 2ZDLA 3CP7A 3BTKE 1C5RA 3KQ5A 1GWAA 1P9UA 3KEEA 1V6DA 1TFXA 2XBYA 2ZHQH 1QJ7B 5E0JA 3RXLA 3C27B 1W3CA 2FP7B 2FMJA 1VJAU 1BTWA 3NWUA 1O3NA 1ESBA 4CRFA 1B0EA 1ZTLA 1BRCE 2BDAA 1S81A 1XUFA 2RA0A 1CGHA 2OINA 4JYVH 5J4SA 5T6GA 3ELAH 1O3PB 3BG8A 4YT6H 3PMBB 1DLKB 1PQ7A 1MQ6A 2NU3E 1ZMLA 1P8VC 3EYDA 5HMAA 4MNXA 2FI3E 1NRRH 2ODYB 2QYIA 1SGEE 2PW8H 1VKYA 2ZP0H 1AFQC 3RMMH 3FP8E 2H6MA 4D7GA 3TITA 1HJAC 2A31A 1D4PB 3SW2B 1V2RT 3NK8A 1LVBA 1UVSH 1DY8A 5E2PA 3RU4E 1SBWA 3SNCA 4HGCA 4D8NA 2WV4A 3D62A 3P70B 3ATWA 2OD3B 1KXCA 1QBVH 3RC6A 1DWBH 3FP7E 5K7RA 3BTME 3RXEA 3MNBA 1C2FA 3MHWU 3SV7A 4I8KA 3TJVA 2P3TB 1KXBA 2ZIQH 1SQOA 3MU1A 4ZCNA 5LPEA 3LGTA 2F4LA 1F7ZA 3LGWA 1YLDA 1WSSH 2GJGA 1O2YA 3FOAA 3LT3A 1P10A 3SI3H 3LH1A 1TPPA 1V2ST 2WUCA 1V2NT 2BXUH 4KTSA 1AE8H 3DCLA 3MNSA 1C5UA 1GMDF 2PUXB 1ZTJA 3VB6A 1FN6A 3RU4D 3ZZ9A 4BAOB 2NU2E 3GY3A 4ZROA 2G00A 4GUXA 3QLPH 2ZCKP 2A7HA 2UUKB 4AX9H 5JB9S 1TABE 1QQUA 1P2OA 1JIMA 4YLUA 3ATMA 5DN6D 3T62A 2BVSH 1FIWA 2GDDA 2F9UA 3CS7A 3QUMP 1EZXC 3SHAH 1XM1A 5TCCA 2ZA5A 1SGCA 3A89A 1COWD 5AVDA 3DSOA 4MPWA 3ZZDA 1OP2A 1AUJA 3D65E 1BRBE 2Y6TA 3UR9A 1RTKA 1GJCB 5DO4H 2CF9H 1K1IA 4YOIA 3SNBA 2V3HH 4FUBA 4NSVA 2AYWA 4K8YA 2XC4A 4I33A 1FY1A 1DUEA 2VWOA 1XUGA 1C1WH 1C2DA 4ABBA 3VFEA 1T4UH 1WCZA 8GCHF 1P57B 2ZGJA 5H4IB 4A92A 4LZ4B 3F3BA 1K1JA 3QGNB 2CHAB 1YPEH 1CHOG 4CBOA 2A32A 2FOFA 1H8HD 4ABGA 1ZR0A 2WSSD 2DE9A 2TPIZ 1F0SA 5KECA 3VXFH 1GVZA 4UFDH 3WWBA 1TX8A 2BD9A 2JH6D 1FAKH 3S0NA 4X6OA 5A0AE 2PKSB 2W26A 2ZHFH 1O3KA 4D9QA 6LPRA 5JDUB 1O2HA 2IPHA 1GI7B 1GHYH 2PSXA 4NIVA 5EXNA 3ITIA 3PWCA 5EOKA 4B75A 4PROA 2F3CE 1GCDA 2ZFRH 1VCWA 2QXGA 1VR1H 4GHTA 2Z9GA 1GBIA 1NO9H 3SNAA 3BTEE 2Q6FA 3ATKA 1ELFA 1MKXK 2UWOA 1O38A 3MU5A 4I8JA 4OM9A 3ZZAA 1ELAA 4DY7B 2Z3DA 3OEHD 5DP9A 3SU4A 2JDID 5KGOA 3SYJA 1TNKA 4NZLA 3E91A 1IQMA 1C2KA 5BRRE 1SGPE 5EW1H 1G37A 3PWBA 1G3CA 2FOAA 3OY5U 3ZV8A 4A7IB 3F9FA 3RXVA 2BLWA 1MKWK 3L6PA 2BTCE 1IQKA 1AVGH 5FPYA 2SFAA 2QY0B 3SHCH 1HAGE 3T25A 2GTBA 1MTNC 1TGNA 3W95A 1GJAB 2SGAA 3UTUH 1IQLA 1HIAB 5GWZA 1KSNA 1UCYH 2NU0E 1ZLRA 2WYJA 3ENSB 1QL9A 1AE5A 4X6MA 1YKTA 1SGDE 3TGIE 3HK3B 1LVOA 3GY8A 3BSQA 2Z7FE 2SNVA 1TMBH 5IK2D 2J38A 2GCTB 2IPQX 3LH3A 4ABEA 1IQEA 2ZGHA 1SGTA 4XFQA 3FVFB 2ZTYA 4BAKB 2PSYA 1XXDA 4B76A 3VB7A 1TGTA 1MD7A 2ZFPH 1LVYA 4Q7YA 5EXMA 2BZ6H 4A1VA 1XUHA 1TA6A 2ASUB 2PFEA 1FZZA 2ALVA 2F9OA 1FI8A 1IQIA 3OTJE 4KELA 1ELBA 3E8LA 4WMEA 1G36A 3UNRA 1EKBB 1UTNA 1KLTA 1FNIA 2XCFA 1QRZA 2ZDKA 1YCPH 4DG4A 1PJPA 5C5OA 1O3FA 2SGFE 5GJ4B 1N8OB 1O34A 3HPTB 1SKYE 1FAXA 1YPGH 2FOMB 2A2XH 4Y8XA 2W5EA 2VWMA 2QF5A 1TMTH 3RMLH 1TPAE 2QV1A 4F49A 1QURH 3W94A 1C4Y2 1EASA 1QRWA 3U8TH 1PPZA 2XRCA 1YPMH 3MOCA 2KCAA 1C1SA 1SLXB 2DUCA 3OYPA 1HJ8A 2THFB 2BYAX 4UONA 3FFGA 1GMCF 4X0WU 1UO6A 4YOGA 5HIZA 3T29A 3ZVCA 1JBUH 3TJUA 1F0UA 2G5VA 2ZECA 4TWWA 1G3DA 5HKKD 3DT0H 1GBBA 1BRUP 1UK3A 2BB4A 3E1XB 2J2UA 3KQCA 4MPVA 4JZDH 5L30H 3PMHB 1BHXB 1D3DB 1BJVA 3M5NA 1QJ1B 1EPTC 1NS3A 1UTPA 3UNSA 1O2NA 2P59A 2V3MA 4E7NA 1C5YB 8LPRA 2Z94A 2FZZA 1UJ1A 3SUEA 2GKVE 5A2MH
chains in the Genus database with same CATH topology
1LKAA 4IGDA 3M7QA 3ZZ7A 4OS6A 2FS8A 1A5IA 1XUJA 2BDIA 1L4DA 1XVMA 3A8DA 1QCPA 3KQEA 1XVOA 3P95A 1S6FA 2FS9A 3S7HB 1C4U2 1GJ6A 4GCHF 3Q3KA 2PKAA 1AU8A 3E3TA 2W7SA 2FO9A 1VITH 3ZVAA 1UTMA 3ZYDA 4ASHA 1C5XB 3AW1A 4FU7A 3V3MA 1L1JA 1P2NA 1MZDA 3BG4B 1WTGH 2C90B 1SGFG 1GI4A 4OS7A 4MPUA 3FAOA 2BM2A 2WUBA 2H2ZA 4NSYA 3QK1A 1K21H 1ZHMA 2BY6X 3HATH 1GI0A 1H9IE 3RC5A 1LO6A 5E0HA 1CU1A 1CGJE 1ETTH 1NFWA 4YESB 5FXLA 3KN2A 1O3OA 1E35B 3RXDA 3NCLA 3SQHE 3LGIA 4NFEA 1VZQH 3DFJA 5HXFA 2GDEH 4BANB 1EXFA 4RKJB 1F2SE 4UD9H 3RXOA 3LU9B 1BB0B 1W8BH 1C4V2 4K1SA 2GV6A 3SJIA 4IC6A 2W3IA 1UTQA 3MU4A 2F9VA 4GSOA 1O5DH 3ZVDA 2C8WB 1JRTA 9LPRA 2G51A 3GCNA 4AN7A 1VITG 6GCHG 2TRMA 2AGGX 3IWMA 3I29A 1XXFA 2B9LA 3UREA 4XBBA 3PMAB 1K1OA 1UHBA 2FESH 1K1PA 1L1NA 1QL7A 2FTLE 3SV6A 1YPHC 4DIHH 2P8OB 4Y76A 2R2MB 2QAAA 1TQ7B 1AY6H 1CQQA 1OS8A 5ABWA 1FUJA 1GHBG 2AMDA 5GDSH 1S84A 2AMQA 1Y3VA 1TE0A 1IQJA 2RDLA 2ZU4A 4B74A 1GI8B 1CT0E 2GMTB 4X6PA 1HAPH 5EU8A 4O3TA 1AIXH 3F68H 5CHAB 1MTWA 1FQ3A 5C1YA 5A0CA 2Z6BD 3GYLB 2OC8A 2UWPA 3RDZA 1BJUA 3SNEA 3DD2H 1P06A 1V2WT 7LPRA 2EI6A 2ZHWH 3EAJA 1RIWC 1ANDA 2ZGXH 2BD8A 1GVLA 3P8GA 2F9BH 4CH2B 1W10U 3K2UA 1O2ZA 2ZQ2A 3MU8A 2V6NA 2BLVA 4X1QU 1T4VH 2Z9IA 3GISB 5SGAE 3RLWH 1BTPA 1HRTH 1J8AA 4K3JA 3PV4A 1Z1IA 1AVWA 1AKSA 1O2WA 2BDYA 1A4WH 1O37A 4JYUH 1TRYA 1O2XA 5LPRA 4ISHH 1ELGA 4B71A 1GL1A 1GCTB 5GCHG 1ZRKA 1CBWC 6CHAB 3MH7A 2O8LA 1UK4A 1C2EA 1A1RA 2WV5A 2TBSA 1GBMA 4JZFH 2JETC 3AAUA 4BAQB 3MTYA 4AG2A 4YO9A 4Y79A 2R0LA 1AZZA 1SI5H 3ODFA 1M9UA 1SLWB 5C3NA 3BTWE 2HLCA 2ZQ1A 1TNHA 4MPXA 1N6XA 1EZQA 3AASA 1LMWB 1UK2A 2F9PA 3VPKA 2AGIX 2XYAA 7ESTE 3TIUA 4ZMAH 3U69H 3GCHC 4Y10E 2H9HA 5LH8A 4SGBE 4AFUA 5F8TA 4YTAA 3GY2A 2AERH 1VCPA 4ESTE 4XSKU 2OUAA 3BTDE 2Z3CA 1IOEA 1A0HB 1NRPH 1DPOA 3T28A 1HDTH 1B0FA 4K5ZA 1DDJA 2STBE 1FN8A 1HAZB 1KY9A 4QT8C 2ZO3H 4DOQA 2ANKH 3U8OH 3DFLA 1O31A 2QIQA 1O0DH 1E38B 2GP9B 1RS0A 3MNCA 5A09A 3VB3A 4BTUB 1ELDE 4I31A 4THNH 3GCTF 1AB9B 1DWEH 4MNVA 4H42U 1ARBA 3MO3A 3KL6A 4X8SH 3RMNH 3P8FA 1NRQH 2J34A 5G4BA 1THRH 5EQSA 1IQGA 1MKXH 1ORFA 2R3YA 2TGTA 1NM6A 5DP8A 2ANYA 4ABDA 1EJAA 3SUGA 1KDQB 1A0LA 1GJ4H 3M3SA 1HAVA 2ODQA 3RXRA 1H9LB 3S9BA 1TGSZ 1P2JA 1Y3YA 5HM2A 1MMJN 2ZG0H 1GHAG 3PLKA 3MMGA 1S82A 3KQBA 3U1IB 1IAUA 3MH5A 2A5IA 1X7AC 1HFDA 3GCOA 3MO9A 1ZGVA 3NXPA 3Q3XA 3A7YA 3MI4A 4Q80A 2P94A 2UUJB 1IHTH 1DWDH 2Y82A 3RXUA 4M7GA 1AI8H 4Q7XA 2VVVA 5DG6A 3PO1B 5EPNA 5L2YH 3NUMA 1RXPA 1EPTA 3UUZA 1ID5H 5TCAA 2ODPA 2P16A 1ANCA 2HPQH 5FBIA 3RXTA 2ZDVH 1MU6B 2ZFQH 3M7UA 1DSTA 1KYNA 3S69A 1OWJA 1C1RA 3SV8A 1O3MA 1UVPA 3SU5A 1TALA 1TRNA 1T8NA 4U01A 1SL3A 1BTHH 2ZHEH 1TNIA 1BUIA 1UTLM 2QC2A 1YLCA 1LHCH 1YPJH 2IJOB 4BOHA 4A1XA 3O8CA 4OGXA 3SU1A 3EA7A 4YT7H 2ZFTA 4NGAH 1IQFA 5FPSA 1HJ9A 1DS2E 2FYQA 1P2KA 1FXYA 7GCHF 3DUXH 2K1QA 1LVMA 4ZXXH 1YPHE 1TONA 2A2QH 1O3EA 1GHXH 1C2IA 1J9CH 4DVAU 1J15A 1HB0B 2A7CA 1QL8A 2XC0A 3UFAA 1K1MA 4YLQH 1O3LA 3OU0A 1E0FD 1Z7KA 5DJ7A 2ANWA 2BY9X 1GJ5H 3E6PH 4FU9A 4OGYA 1GG6C 2FX6A 1HGTH 4ZXYH 1TIOA 4MQAA 1VGCC 2I6SA 4OS4A 2GCHG 1SQTA 5GPIB 4LK4A 1MAXA 3F9HA 2W3KA 1T8OA 1HAXB 3RU4T 4ISLA 2QCYA 3B9FH 1DM4B 1SR5C 2ZDNA 4YOJA 1C5LH 1MZAA 1C1UH 1ZPZA 4DGJA 1S0QA 1O2IA 2EI8A 2BY8X 4AGKA 3EDXB 1TBQH 3STJA 1D3PB 1HAYB 4JZEH 2BD4A 2PKAB 1THSH 3RM0H 1O3HA 3TNTA 5F8XA 4ZUHA 4Y7AA 1P05A 3STIA 1HPGA 4H6TA 3TU7H 4ABJA 4O97A 1AFQB 2Z9JA 4X1NU 2XWBI 2ZTXA 1BIOA 4AB9A 3QN7A 4K60A 1E36B 3KF2A 1FJSA 2R0KA 1FIZA 3TPIZ 5EQQA 5ESTE 4BNRA 2QF3A 1GPZA 2RCEA 1ZOMA 4B73A 3KCGH 1SGYE 4X1PU 3RXQA 1YBWA 2QA9E 1O3BA 4YM9A 2GV7A 4ABAA 2UUFB 1Z1JA 4RN6A 3IITA 1O2VA 3QTOH 5T6FA 1UVOA 3ATIA 1A7SA 5FBEA 1C9TA 1GMDG 2PUQH 2HVXA 3GDVA 4BXSA 1V2KT 2LPRA 3KNXA 3ZZ8A 2FYRA 2YNBA 2BD7A 1THPB 2F83A 1Q2WA 2FWWA 2VH0A 4Q2KA 2JH0D 2FLBH 3RC4A 1Z6JH 3A8AA 1P02A 2OP9A 1DLEA 2AH4X 4KTCA 4VGCC 2ZTZA 2G8TA 2YNAA 2BLQA 4J1YA 3RXGA 1ZSLA 2WPHS 1TRMA 1OX1A 4MVNA 1O2QA 1GI1A 1OOKB 1BTXA 2H1UA 3TVJB 4WJG2 1K1LA 6ESTA 1JRSA 4KKDA 3EQ0H 2OC0A 2SGPE 1WQSA 1UHBB 3TNSA 4I32A 1SLVB 1BTUA 5EG4A 3BV9B 3SQEE 8GCHG 1O3GA 1GBTA 1LQEA 1E37B 1C5SA 1RGQA 2J9NA 1TMUH 1BDAA 1YF4A 4AZ2B 4LOYH 3SN8A 1V2UT 1YGCH 3M61U 4BTIB 4JCNA 3SU0A 1XX9A 4R0IA 3L33A 1BMNH 2EC9H 2B0FA 3IG6B 4CR9A 1K2I1 4HFPB 4AFZA 4MTBA 1C2LA 2PTCE 2A5AA 3URCA 1WU1A 2ZC9H 1VCQA 2D8WA 2FOEA 1PPCE 3QX5H 1Z8IB 1T8MA 3AAVA 2C93B 2D26C 3UWJH 5DGJA 1OWEA 2BY7X 2BDBA 2VIPA 2PGQB 1EP6A 2GGVB 2VIWA 1DVAH 1GBFA 2Y7ZA 1S5SA 3NZIA 1GJDB 1GJBB 2BQWB 3LC3A 4TYDA 1EJNA 1ESTA 2A4OA 1MAYA 3RMOH 2QGRA 2PGBB 2FI4E 4U2WA 3BTTE 2BQ6B 2OCVB 3UPEA 3QZRA 1AKSB 1TA2A 1CE5A 1TX7A 1A2CH 1O32A 2TGPZ 1JIRA 1GBEA 3RXMA 1PQAA 4FUDA 3Q76A 1W0ZU 2BZAA 2XBVA 3ZV9A 1PYTD 2HRVA 4WF8A 1FPCH 3JZ1B 1Z71A 2J95A 1DOJA 2OC7A 1DT2A 2JH5D 5AHGH 1GBDA 1L1GA 1HXFH 5DP5A 3A7VA 2J92A 3QDZB 1O2OA 3SZNA 3LGVA 3ZVGA 2VIQA 4GAWA 1O5EH 2B8OH 2VWNA 3VEQB 1CA0C 3ZZ5A 1DWCH 3H7TA 3VGCC 1CHGA 4BAMB 1MTNB 4TPYA 1ELTA 1C2GA 3S9CA 1J14A 1O3JA 2B7DH 1GJ9B 5EXLA 5J4QA 4AYVB 5E8EH 5DP4A 1K1NA 2QXIA 4FUGA 5I25A 2KAIA 1P01A 2EA3A 1E34B 4X6NA 1AD8H 1TPSA 1VJ9U 3R3GB 4NIYA 1NC6A 1EP5A 1C2JA 4Y7BA 1SSXA 2AGEX 2R3UA 3LDXH 2FOGA 2HPPH 2V0BA 1AN1E 1VITF 6GCHF 5FCRA 1GGDC 4Z0KA 4IC5A 4HZHA 2VIOA 3HK6B 4D7FA 2GX4A 1H4WA 1G2LA 2ZFSA 2BXTH 2CGAA 2UWLA 1P2MA 5AFZH 2FLRH 2G52A 4INKA 1QB9A 4UEHH 4U30A 1DITH 1TLDA 1QIXB 2PV9B 4TPIZ 1GHWH 1K28D 3QZQA 4YZUA 3UQVA 3P92A 1AGJA 3URDA 3DHKH 1GMCG 3B8JA 3NKKA 1W14U 3PMJA 3F9GA 3PLPA 2BHGA 2SNWA 5B6OA 4LXBH 3A8BA 4WY3A 3BTQE 5JBCS 3TH4H 3F1SB 3GYMA 4ABIA 4FUFA 1EUFA 4ZKSU 2XXLA 4ISOA 1KXEA 2Y81A 2PWXA 4IS5A 5DP3A 1G9IE 2VINA 1Y5AT 1V2OT 2BY5X 1B5GH 2AMPA 1PPFE 2Y5GA 2ZDAH 1KLIH 2ZKSA 1O3DA 4X8VH 1NROH 3SV9A 2BQ7B 5C2ZA 5DP6A 5JBAS 1QBOA 2FX4A 3M5OA 1EPTB 3U9AH 5C67A 4JYTA 1AZ8A 1YYY1 2TGDA 4JZIA 4GCHG 1NFXA 1EOLA 3TH2H 1XUKA 2WPMS 1LHDH 3A8CA 4AYYB 4INHA 3SU3A 1BCUH 4HTCH 2ALPA 5GCHF 3E0NB 1BTYA 1Y3XA 4I8GA 1QB1A 2A0QB 1NU7B 1FY8E 3TK6A 4WH6A 2A4RA 4Q7ZA 1C1TA 1MCTA 4FVBA 2ZU5A 3V0XA 2PHBA 3HGPA 2OXSA 1F5KU 1C5VA 1HV7A 1S0RA 2H5CA 3UWIA 1O39A 4AOQA 1AVXA 1EB1H 2BMGB 1EZUC 3V13A 1AQ7A 2QN5T 1EZSC 2A45B 4RKOB 3RXIA 3PLBA 5DPAA 2FEQH 1GI2A 1W7GH 1QY6A 4OS1A 1XMNB 5L6NH 1MBQA 1GHZA 1EAWA 1C5ZB 1PQ5A 3RXPA 2AIQA 1O30A 1ZPCA 2ZNKH 4MDSA 4CRBA 4ZHMU 3TJNA 1GI9B 1W13U 1CGIE 1UTJA 1YPKH 3WY8A 1KXAA 1B7XB 3RP2A 5BPEA 3BIVH 1SGQE 2TGAA 1C2MA 4K1TA 2BD3A 2VH6A 5L2ZH 1V2TT 3SGBE 1EB2A 2OQUA 9ESTA 2D2DA 4CHAC 2P3UB 1QTFA 1O3CA 4IN2A 4WVPE 1FY3A 1BMLA 1P9SA 2H9TH 1Y8TA 1TPOA 1O2PA 2QXJA 1ZJKA 3M36A 1GJ7B 2QF0A 3UOUA 3BTHE 2FOHA 4AG1A 3DA9B 2C8XB 1XKBC 1JWTA 1K22H 1G32B 1QHRB 1GBCA 4O03A 4D76A 4FUIA 3ZZCA 1HUTH 4KP0A 1RD3B 2UUYA 3QWCH 4BTTB 5EPYA 1BTZA 1HCGA 1C5NH 2ZU3A 2SGEE 3A87A 1O5FH 3PM3A 5CE1A 5EGMA 1OWIA 2GD4B 1YCPM 1GMHG 3NPSA 5I46H 2BVXH 1DICA 4I7YH 2BX4A 2C8YB 3HKJB 2BDHA 1C1VH 4A5TS 4JK5A 1ZPBA 2Q6DA 1DANH 2VGCB 1CSOE 3ZVEA 1C5OH 1TB6H 2O8TA 3F6UH 5JB8S 5DK1A 1W7XH 3BTGE 2ZZUH 1AO5A 5GIBA 1LQDB 1YM0A 3F9EA 2R2WU 1PQ8A 1PPHE 4X1SU 1AFEH 4FVDA 8KME2 2FOCA 1MBMA 3A7TA 1HBTH 1RIWB 1C1QA 1G30B 5C1UA 1N6YA 1BT7A 4NIWA 1F5RA 4CRDA 1A3EH 3M5LA 2G5NA 4ZHLU 1CT4E 4FUHA 2ZU1A 3M35A 1J16A 2O8UA 1P3CA 2SGQE 4O9VA 3BF6H 3FZZA 4K2YA 1HYLA 2G4UA 4CREA 2ZEBA 2ZI2H 1OPHB 1TNLA 4AFSA 3EGKH 1UMAH 1O2MA 1PYTC 5FX5A 3MFJA 2O8WA 3FZDA 4X8TH 1INCA 1MKWH 4FUJA 1C9PA 3SUFA 3H5CB 1AWHB 1KIGH 5JYIA 1K9OE 1O5AB 3P6ZB 2F91A 1RFNA 2WINI 1A0JA 1P2QA 2JETB 2YOLA 2GT7A 4WH8A 4Y0YE 3H7OA 3ATLA 2XCNA 1GBLA 1GI6A 4JK6A 1C5TA 2Z9KA 1QA7A 3TH3H 2XNIA 5DKMA 1OYTH 4NFFA 4RSPA 3G01A 5AF9H 1F0RA 1O33A 1WAYB 3LPRA 2Y5HA 1SHYA 1PPGE 2ZCLP 1C5MD 4R8TB 2GCHF 2A4QA 1WQVH 1MH0A 3GCHB 1D3QB 1Y5BT 7KMEH 1S85A 2CHAC 2HNTF 2Z3EA 2FM2A 2ZWLH 1TWXB 3GCTG 3Q3YA 4U32A 3TLOA 3AW0A 4DCDA 5A8ZA 2IOTA 3MYWA 1JXPA 1F0TA 1O2UA 3T5FH 3LIWA 5ETXA 1BOQA 2PKSC 3SJKA 1LHFH 3BEFB 2NWNA 3RXFA 3RXKA 2A7JA 2G55A 1CHOF 3A80A 1DFPA 1Z8RA 4K8BA 3EST