1C5RA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5rA02
1K1OA 3F6UH 5C1XA 1GHAG 4YT6H 4OS4A 3F68H 1WYKA 4FVBA 2V0BA 4ABIA 4GUXA 4FU7A 1GBBA 4J2YB 1MD8A 2HNTE 2Y7ZA 2NU1E 1MAXA 1ZGIA 1QQ4A 5JBCS 4FUBA 1QBNA 2F3CE 1Y5AT 2VIOA 2GV7A 4WWYA 4JCNA 4UEHH 1XUFA 3RXVA 2J9NA 2O8UA 3SU1A 2ZHEH 2UWPA 4MLFB 1N6XA 4B2AA 2PR3A 3BIUH 1P2JA 5E2PA 5C67A 4WXIA 3A8DA 1FAXA 1AMHA 1YGCH 4BANB 3SQEE 4OS6A 1NT1A 1QHRB 4GHQA 1GMHF 4X1RU 1JXPA 3MU0A 3RXJA 1UTMA 2WINI 3QTOH 1K1MA 1D3PB 4IC5A 4CRAA 2XRCA 3NWUA 5C20A 1AI8H 1K1IA 4BAOB 2ZTXA 2PKAA 1QNJA 1EAUA 2G81E 1WAYB 1VJ9U 2I6SA 4I8JA 5HM2A 1GBLA 3TGJE 1O2TA 3HGNA 3P17H 1AVXA 3RM0H 3VB3A 2OC1A 3F9HA 3UWJH 1V2UT 1C4V2 1Y3XA 3HK6B 1Z1JA 1SBWA 3A7XA 2VVCA 3L3TA 4O3UA 2ANWA 3NPSA 2UWOA 5C5OA 1GHBG 2WPJS 3A8AA 1AVGH 4BNRA 4OS7A 2JKHA 5FPSA 1TX7A 3PMHB 2QF0A 2AMPA 1VGCC 3GOVB 3TJNA 1FDPA 1THPB 2OUAA 1HRTH 2SGDE 3Q76A 4K60A 1Y3VA 1LO6A 3ZVAA 1NTPA 4GCHF 2XBYA 4X1NU 1GHYH 3ELAH 3F9FA 3U69H 1EOLA 5DKMA 3MH7A 1GJ4H 2ILNA 3QK1A 1UK4A 1TFXA 1O3JA 2XXLA 1BOQA 1INCA 3A81A 2PV9B 2RDLA 1V2NT 1Y3YA 2M5TA 1O3FA 1MTUA 1DWBH 4YOJA 2PSXA 3BTQE 3HK3B 1GGDC 1NU9A 1E36B 1L1NA 4I8HA 1ORFA 1OXGA 4SGAE 1IQFA 3A84A 2BD3A 1BQYA 2PKSB 1IAUA 2Z3CA 3S0NA 1O2GH 4JZFH 1OWIA 1CQQA 3PYHA 4CRCA 3RXBA 3U1JB 1AD8H 1EQ9A 1SB1H 1AB9B 2FX4A 4CRGA 3GCTF 1SR5C 1C5YB 2AFQB 5DP3A 2OBOA 3UTUH 3LGIA 1RIWB 1HYLA 1O3NA 2PKSC 3HKJB 1AQ7A 3W95A 1XVMA 1GBAA 1AZZA 3GYMA 2ZCKP 1UHBA 2YNBA 4BXWA 4X2VA 3U98H 2ZFTA 1G3CA 3RLYH 1RIWC 2XCNA 3ZYEA 2V6NA 2R3UA 1ZMJA 3KNXA 3M5MA 2Z3DA 4K69A 1LTOA 1PPZA 2O9QA 4E05H 2P95A 1DANH 4A1TA 1O30A 1HAVA 5ESBA 5GWZA 1UTOA 4HI3A 2LNCA 1O2SA 3RXUA 1O5DH 4B71A 2HPQH 3E3TA 3UOUA 3R0FA 1JOUB 1BCUH 3FFGA 1B7XB 3MTYA 4NWLA 4ISLA 4CHAB 1FY5A 1UCYH 4AFZA 5CHAC 1MZAA 3SI4H 1EKBB 2GX4A 1ELAA 1EX3A 3FVFB 2HPPH 3HPTB 2FODA 2VWNA 2ZTYA 1TQ0B 3E6PH 1U6QA 1P11E 3BV9B 1ANBA 2FIRH 1K22H 4Q7XA 1ZPZA 2CV3A 2PKAB 3UFAA 3LH1A 4GHTA 2ZFPH 2ANMH 4TPYA 1YPHC 1ELDE 4ISIH 5DK1A 1AHTH 3M7QA 1PPHE 4JZIA 1EB1H 1O2ZA 1DS2E 1LVYA 2FYQA 4Q7YA 2R0KA 1P2KA 4NGAH 3D62A 9LPRA 1UCYE 3PMJA 2EEKA 1B0FA 4ISNA 1AE8H 1O2OA 1RTFB 2ZF0H 5GXPA 2PW8H 3M5NA 1C5UA 2WPLS 1P0SH 4I8LA 3SNDA 2C93B 3RXCA 3P6ZB 3SNBA 7GCHG 1Z1IA 1S81A 1D4PB 3URDA 4VGCB 2THFB 4YLQH 4AB9A 4X6NA 1DWCH 1ZHPA 1BRUP 1ELGA 3RC6A 2YNAA 2TGAA 5FCKA 3U1IB 1K21H 3LT3A 3SNCA 2DE8A 1SGIB 3PLBA 1G36A 1C5PA 1O3LA 3D49H 3VB7A 2FTMA 1SGFG 5HM9A 1MZDA 6CHAC 5EXNA 2FOBA 3MNBA 3A85A 3P95A 1AUJA 5HYOA 4LZ4B 3VGCB 2UUKB 2GZ7A 2RA0A 3NK8A 2ZU3A 1NRSH 3GY8A 4WXVA 1O3MA 3DA9B 4Y0ZE 1BMAA 2J34A 1RXPA 4DIHH 1MU8B 2VIQA 2W5EA 2ZFSA 1PPCE 1VITG 3BG8A 4U32A 1SPJA 1PYTC 3E8LA 1FJSA 1ZOMA 4HFPB 4KKDA 4AX9H 5FBIA 1GHAF 1D3DB 3M7UA 1RFNA 3QLPH 2JH6D 3VXFH 1O33A 1WUNH 2BY9X 2JETC 1MKWK 3UR6A 3E0PB 2BLOA 3E1XB 1GBCA 1NFYA 1TPPA 1W3CA 4ABAA 1ANEA 1MKXH 1UHBB 1ANDA 5EQSA 5EU8A 1Z8IB 4MNWA 1RRKA 3ATWA 2WPHS 1AO5A 4INHA 1V6DA 5ABWA 2Q1JA 1ZLRA 4ZKRU 4O9VA 2PGQB 2OP9A 1LHDH 2JH5D 4XSKU 3T29A 1HAVB 4DGJA 2CHAB 1CGHA 1C9PA 1C5NH 1DITH 3BIVH 4ESTE 2BTCE 1SGDE 2ZPSA 1DXWA 2EA3A 1F0TA 1SHHB 3Q3KA 3QZQA 1Q3XA 3SUGA 5C3NA 4X1QU 4TWYA 1O3OA 3T25A 5FAHA 1DX5M 4AG1A 2KAIA 2F9BH 3FAOA 3E16B 3SW2B 3UQVA 1AUTC 2CHAC 1C5WB 1SHYA 1C1VH 1PPGE 4DURA 2P93A 3GISB 4TYDA 1YCPK 3A89A 5GDSH 1SFQB 4NIWA 3KGPA 1HGTH 3TITA 2ODQA 4FUFA 3M3VA 1OP2A 4MPXA 3I29A 1SGEE 2BOHB 1GI9B 2CXVA 1LPGB 3B8JA 4NSYA 2F91A 4BTUB 2J2UA 4O97A 4JZEH 3EA9A 1BTZA 4UFGH 1P09A 1BIOA 2A0QB 5E0GA 1O5AB 1J16A 1GHBF 1H1BA 3ODDA 5L30H 4FUIA 4D9RA 1TMUH 1X7AC 4J1YA 2ZGXH 2ZEBA 2PWXA 1O5FH 1THRH 2PTNA 1TNHA 2FI5E 2ZWLH 5JB8S 3RXSA 4KTUA 2Y5GA 2IPHA 3R3GB 1FXYA 3QGNB 4ABBA 4H6SB 1IQHA 2WUBA 3EYDA 1XX9A 2SNWA 2TRMA 1NZQH 1C5ZB 1S0QA 1T8NA 1FY4A 4ZUHA 4B75A 1HFDA 1GJDB 2BX3A 1GVKB 1C2MA 1ZTLA 1P04A 3ZV9A 1E34B 5F6MA 4ZKOU 3SNEA 3QX5H 2ZQ2A 4Y8XA 2W3IA 1O38A 2Y81A 1EPTC 1GDQA 2P8OB 1HUTH 2BXTH 3SV7A 2XYAA 3BN9A 2BY7X 1NFUA 1ZPCA 4Q7ZA 5DPAA 2BD7A 3VPKA 2PUXB 1G30B 1P02A 1D9IA 2GT7A 1FN8A 1H9HE 2CJIA 2LPRA 3RDZA 5JDUB 3NKKA 5C1YA 1W2KH 1C2EA 3BTDE 1O2RA 1L1GA 3TK6A 4A92A 5AFYH 3RXEA 4ZKNU 5L2ZH 1C1PA 1WCZA 2R9PA 3ZVEA 1GWAA 1FONA 2PTCE 3LGTA 4ZHMU 4K1SA 4A6LA 1SG8B 3RLWH 2VWOA 1GJ7B 1CT2E 3ZVDA 4X1PU 5C1UA 2HWLB 3S7KB 2WV4A 1QBOA 2AGGX 1GDUA 3RMNH 1O32A 1YF4A 1GI5A 1O5BB 3TH4H 1TRNA 1A5GH 3STIA 1WTHD 1C2HA 3M5OA 1KXAA 1UVSH 2STAE 1FY8E 4K1TA 2Q6GA 3STJA 1UTPA 1QY6A 1DDJA 1GMDG 2A32A 1EATA 3MU1A 4NSVA 4D9QA 3BG4B 1SGYE 1V2VT 1SLWB 2W7SA 3MNCA 4MG3A 2OC0A 2XBWA 3WY8A 3TH2H 4Z6AH 1GI8B 1ELEE 2UWLA 2ZHFH 3S9BA 1O31A 4IW4E 1SGQE 2G4UA 4FXGH 4BAHB 3VB6A 1PQ8A 2G8TA 1K28D 1V2PT 2VIDA 4IMZA 4OS1A 2XWBI 1ZRKA 3F9EA 2KAIB 3G01A 1L2EA 2BXUH 2AH4X 1EXFA 2WV5A 1FAKH 2BVXH 1H8DH 1GI3A 1ZTJA 5EPNA 1BUIA 1NESE 1H8IH 1XM1A 2ZGJA 2IJOB 4AFUA 2GZ9A 1HAZB 2H6MA 2BD8A 1F92A 2VH6A 3TK9A 3V7TA 4RKOB 4D8NA 2ODYB 3ENSB 1NRNH 3K65B 4Q80A 1O2HA 4TWWA 3ATMA 4I31A 2VNTA 1QB6A 2ZGCA 4CH8B 1TRYA 1FIWA 2B8OH 3UY9A 1EJNA 3N7OA 4JMYA 1AWFH 5AFZH 2PUQH 3KCGH 3MU8A 1KXDA 2BDYA 2SNVA 2Y6TA 2XC5A 7GCHF 3UNQA 2UUYA 1NRPH 1Z7KA 5FPYA 2WPIS 4ASHA 4DJZB 1HLTH 2SGQE 5EXMA 4LK4A 4AYYB 1GI2A 1KYNA 2FDAA 3GY3A 1Y5BT 1JMOH 4HGCA 1F2SE 1HAOH 1UVOA 4DIIH 2BLQA 1IQKA 3BTWE 1BJUA 4FUJA 3SUEA 1KIGH 3GCHB 2A1DB 1GL1A 2BD5A 1DUEA 1F0SA 1FV9A 1L4ZA 3A80A 5TJXA 1EOJA 1O2KA 3SHAH 1HJ9A 1GBDA 4ZHAA 1EAWA 4Y8YA 1FN6A 1NRRH 1DY9A 1NPMA 1MTWA 1YPHE 3ZZDA 3LC3A 4XOJA 3I78A 1TABE 1P57B 4IC6A 1KY9A 1S0RA 4I7YH 2VVUA 1ABIH 1ANCA 1WV7H 2ZU4A 4CRFA 1TA2A 1VITF 3PO1B 3B9FH 3S7HB 1DLEA 4KELA 1QB9A 1XMNB 3T62A 5T6FA 4WMDA 3DFLA 6GCHG 5CMXH 1NRQH 4CREA 3ZZAA 1MMJN 2VGCB 1O2QA 3VB5A 4MNVA 3ATLA 2JH0D 1OWKA 2GTBA 4GPGA 1FY1A 1GI6A 3AW1A 5K7RA 3LKWA 1EAIA 1FPHH 2XTTB 1FIZA 5FX6A 1DFPA 1V2KT 2FTLE 3RXLA 1PQ7A 1OPHB 2V3HH 3F9GA 4IN1A 1HBTH 1HCGA 1TIOA 1D3QB 3M5LA 4X6PA 5E8EH 3KN2A 5LH8A 1O2XA 2GZ8A 3QO6A 1P2IA 3A88A 5F8TA 3EE0B 3OU0A 1TGSZ 3EA7A 3M3SA 1WSSH 1NROH 2W26A 1CBWB 2ZTZA 3KHVA 2GCTB 5JB9S 4WJG2 2R3YA 1VCPA 2F9VA 2ZC9H 3PWCA 1C4U2 5DJ7A 4BTTB 3RXQA 1KLJH 2QYIA 1P2MA 1QR3E 1ZPBA 1OWHA 1C1UH 1AE5A 1A1RA 1C1SA 1CBWC 1V2QT 3LONA 1GVZA 1G32B 2GCTC 1YPLH 3TLOA 4Y76A 1Z8GA 2AIPA 4INKA 2VVVA 3SJIA 1BRCE 3AASA 2ZCHP 1IQIA 2FOAA 2P94A 3LGWA 3ZZ5A 3VB4A 1GHXH 1BMNH 5BRRE 3SI3H 4X0WU 4NA8A 3SGAE 2Y82A 1O5GH 5DG6A 4Y7BA 1YPMH 1QFKH 3MNXA 2ZG0H 1O35A 1C9TA 2ZHDA 1C2KA 1YLCA 4LXBH 2ODPA 3PLPA 3BTTE 1O3AA 5DP5A 1G37A 3KQDA 3DD2H 1SGRE 3RXPA 1XUGA 1DWEH 1LHFH 1O2YA 1QRXA 4FU8A 3C27B 2TIOA 1O2LA 5B6OA 1AB9C 1W10U 2A31A 4IN2A 4XE4A 4UFDH 3Q77A 5GJ4B 1IQEA 3TIUA 1A46H 4AGJA 2HLCA 1BRBE 1BTYA 3RU4T 3C1KA 3FP8E 1L4DA 5LGOA 4M7GA 1GMCG 5GCHG 1P3CA 1SGNE 5AHGH 3BTFE 1KDQB 4PROA 1GCDA 1OWDA 1GCTB 3GY7A 4X8VH 1VCQA 1SGFA 1OWJA 4Y7AA 2I6QA 2YOLA 1QA0A 1Y8TA 2ZGBH 2AMQA 2ZKSA 1N8OB 1BA8B 2NU2E 4XFQA 2EI7A 1GCTC 1CGJE 3AW0A 3V0XA 4GVUA 3O8RA 3ATKA 5CE1A 1E37B 2OCVB 3QTVH 1O2JA 1DY8A 1SGPE 4WH6A 4WMEA 3SQHE 2WPKS 1XXDA 1G3EA 1LHCH 2F9UA 1GJ6A 1GDNA 1T8MA 4TPIZ 4CHAC 1PYTD 1ESTA 2XNIA 3MO9A 2XCFA 1TBRH 5FX5A 2BDBA 1MTSA 4K8BA 1T7CA 3LC5A 3BTGE 3P8FA 5AF9H 4BAMB 1F0RA 1UK3A 2TBSA 2PSYA 1MTVA 1GPZA 1WQSA 3RXIA 1MKWH 4RN6A 1K1NA 5JBBS 2A45B 2ZDNA 2Z9JA 4MNXA 1XUKA 1YM0A 1O3PB 1LVBA 4CR5A 4UONA 2GP9B 1TLDA 1W14U 3A87A 1C2LA 5TCAA 1NU7B 2BYAX 1GJAB 4AFQA 4HTCH 3RXDA 2GCHG 1HDTH 1PJPA 2TGDA 2BHGA 2FESH 2OINA 4X2WA 3NXPA 4X1SU 4DOQA 4MTBA 1RTLA 2BQ7B 3KF2A 1J9CH 2C90B 1E35B 2ZQ1A 2C8YB 4LOYH 4D76A 1ELVA 3MWIU 2DUCA 3LGUA 4Q2KA 1ZSKA 1GBIA 2Z9KA 3RXOA 3ESTA 1P05A 1C1QA 1MH0A 1D3TB 4VGCC 3SHCH 4IGDA 1QRZA 1ZMLA 2EI6A 4X8UH 1ZJDA 1YCPM 4FVDA 2V35A 3LDXH 4U01A 4K1EA 2WPMS 2FMJA 7ESTE 1RD3B 3PMBB 1W8BH 2NWNA 1RJXB 3A8CA 3A7TA 2VB0A 1JWTA 3LGVA 3LH3A 3QWCH 1UVTH 8LPRA 1KXFA 3O8DA 3E90B 3RU4E 3GCOA 3CS7A 2FWWA 3M36A 2BVRH 1DT2A 1KTTB 2VU8E 4YT7H 4YOIA 3SV2H 3JZ1B 2BY6X 5DP4A 1MTNB 5DP8A 2OQ5A 4H6TA 2RG3A 1ELBA 2P3UB 1JRSA 2J4IA 4YZUA 1A7SA 3VGCC 7LPRA 2Z94A 2F83A 2A4OA 1ELFA 1C2DA 5E0JA 4U2WA 3KIDU 1KLTA 3ZZ9A 1MD7A 1TX6A 2Q6DA 2TGPZ 1QTFA 3QN7A 3MU4A 3FZZA 1HAIH 6ESTA 3TPIZ 4KGAA 1TGBA 1AKSA 1BTWA 4XDEA 5L2YH 1VR1H 3HATH 2FOHA 3RMOH 1AFQB 1V2TT 2Y5FA 4O3TA 3HGPA 2P16A 4A7IB 1C5MD 2H5CA 4B2BA 1FQ3A 4DG4A 4H42U 4CBOA 1QIXB 1GBFA 3ZZ6A 3B23B 2ZO3H 2B7DH 1AFEH 2QXIA 2QC2A 3F1SB 2FI3E 1SFIA 8GCHG 2XC0A 1Y59T 4AFSA 1G3BA 3SJ9A 1YPKH 6GCHF 2OBQA 1LVOA 1JBUH 1EZXC 2BOKA 3LOXA 1SOZA 1HNEE 4JK6A 4MDSA 3K6YA 1S6FA 4ZXXH 1TOCB 5T6DA 2NU0E 1GI4A 4NA9H 3A7ZA 2ZHQH 2GMTB 2QIQA 1UTNA 1BRAA 1D6RA 3LU9B 1O3IA 1PQ5A 1BTXA 4FUDA 5HXFA 5FXLA 1BBRK 3PTBA 2ZU5A 1P3EA 1B5GH 3RU4D 2FOMB 3ZVCA 1GBHA 1UTKA 4NIYA 1IQLA 3P8NA 4U30A 5TCCA 1FUJA 3GYLB 3TGKE 1C2FA 4UE7H 2RCEA 2GVFA 1F0UA 2K1QA 3ZVGA 1ESBA 3CS0A 1NFXA 1AN1E 4JYVH 1QURH 1DE7H 1RTKA 2HOBA 2FXRA 2OC8A 2PLXA 1ZZZA 2P3TB 4ZHLU 1K1JA 3SGBE 5PTPA 5BPEA 1H9LB 1TNGA 2VIWA 1Z8RA 3SU2A 4THNH 1K2I1 3SUFA 1TBZH 4O03A 1OOKB 2ZDKA 1UK2A 3A86A 3ZVFA 3M35A 4Y11E 3BEFB 3ITIA 2SGEE 4Y6DA 3T26A 1GHZA 1OP0A 2WYGA 4B2CA 1P10A 3MO3A 1OP8A 3TNSA 1FZZA 4NFFA 4ABHA 1GG6B 3UNSA 3GCTG 3SJOA 1THSH 1LPKB 3U9AH 2Z9GA 1L0ZA 2CF8H 3ZZ7A 4YO9A 1CGIE 4I33A 1CT0E 3OX7U 5DP6A 1CHOG 1Z6JH 1LKBA 2ZPRA 2Q6FA 3BTME 2G55A 4YOGA 1SQTA 4AZ2B 1UJ1A 1HAPH 3BTHE 1GBJA 1UMAH 3ODFA 5A0BA 3SV8A 1O36A 2HNTF 3URCA 1Q2WA 1BB0B 1WOFA 1HJ8A 2P8OC 3ZZ4A 2FZZA 3OY5U 3PROA 5F8ZA 3FP6E 3DHKH 2AERH 5EODA 1O37A 1P01A 2ALVA 3SNAA 4UFFH 1SL3A 1TWXB 2D26C 1XXFA 5JBTA 1HJAB 1OS8A 1SVPA 4K2YA 5EGMA 3GY2A 4RSPA 1YLDA 1QRWA 4X8SH 3RXHA 1AWHB 3ZYDA 4Y8ZA 3OSYA 1EJAA 1Z6EA 1GMCF 2A5AA 2Z6BD 1O2IA 1VZQH 4NA7A 4ZH8A 2AGEX 1AKSB 2VWMA 1UTQA 2ZZUH 3HKIB 3TJVA 3UQOA 1BMLA 2BDIA 1CA8B 1SLXB 1EZQA 4A5TS 2H9TH 2FLRH 1IHTH 1DXPA 3V3MA 4AB8A 2Z3EA 1GVLA 1TMBH 1TGNA 1GBKA 4I8KA 1GBTA 4R0IA 1O5CB 2GGVB 1FLEE 1GJ9B 3K9XB 2D1JA 4RKJB 3IITA 1SC8U 1QJ1B 1BITA 5A8XA 1JIRA 2FOFA 3ZZ8A 1E38B 5EXLA 5HGGA 3ZZCA 1QGFA 1A2CH 3MO6A 2FOEA 3BG4C 2BQWB 3GCNA 1XUHA 1SMFE 3UWIA 3SORA 4NFEA 1SOTA 1G2LA 3P8OA 1YYY1 1AZ8A 1OWEA 1QCPA 1V2LT 2BY5X 4ABDA 1O2WA 2QAAA 2HRVA 5E2OA 2ZA5A 4OGXA 3SGQE 5DP7A 2W3KA 1VJAU 3PB1E 1IQMA 1YPEH 5LPEA 3H7TA 4FUGA 1CA0B 1S6HA 2BVSH 1IOEA 1MQ6A 2D8WA 1TYNA 2BDCA 1KSNA 3MNSA 2BB4A 1F5LA 3EGKH 3DFJA 3SO3A 1WTGH 3TU7H 3IWMA 2ZPQA 1QJ6B 1MUEB 2AMDA 3P8GA 1HAHH 2AEIH 2FS9A 1N6YA 1ARCA 3OYPA 1CA0C 2GDDA 2XBVA 1NS3A 4XBBA 2AGIX 4XBDA 3VFEA 3QZRA 4D7FA 2QGRA 3LJOA 1NY22 2BZ6H 3EDXB 1DUAA 2RA3A 1F5KU 1KTSB 4JK5A 1SQAA 1TMTH 3MMGA 1TE0A 1WQVH 1PPBH 3MH6A 1ACBE 1KDQA 1ESAA 4F4OC 1BTPA 1C5XB 2O8TA 3GY6A 1RGQA 4GLYA 4KP0A 1TAWA 3LPRA 2A7JA 2H9EH 4IMQA 1GBMA 1CVWH 3OTJE 1TNKA 2C3SA 1ETSH 4NCYA 4Y79A 3GCHC 3BTKE 4OS5A 1MQ5A 1TB6H 5F8XA 2FOCA 1K9OE 8KME2 2H5DA 3PTNA 3AAUA 3T28A 3LIWA 3SU5A 4B1TA 5FBEA 2WUCA 2AYWA 1XKAC 4IBLH 2ANKH 3S9CA 1P2NA 1BTUA 2UUFB 1J8AA 4OS2A 3TVJB 3MU5A 4MPUA 2W7UA 1AGJA 1ZGVA 2ZDVH 5J4SA 1PPEE 4SGBE 5IDKA 4NWKA 3UR9A 1EASA 4ZXYH 1YPJH 2QY0B 2TGTA 2ZFQH 2ZP0H 3SN8A 3PO1C 1HIAB 3SU3A 4MQAA 4ZROA 1Y3UA 2AS9A 1UTLM 2QXJA 1Y3WA 2FOGA 5G4BA 1P9SA 3CENA 1A3EH 2HVXA 2B5TB 3RMLH 4K8YA 3RUOA 1W13U 2VGCC 2C8XB 3ZV8A 4YLUA 1KLIH 1EZUC 3BF6H 3VXEH 1HV7A 3UOPA 4E06H 3BTEE 3CP7A 5DO4H 3SOSA 3RXKA 4FUEA 2FS8A 1MBMA 3FP7E 1LDTT 2A4QA 3NCLA 3SBKA 5ESTE 8GCHF 1O3KA 3P92A 4OGYA 1BMMH 4TY6A 3TK5A 1VGCB 1O3DA 4MPVA 2XWAA 2ZHWH 3MFJA 2F9NA 1F5RA 3PM3A 1W0ZU 1TPSA 5I25A 1C2JA 1NM6A 1V3XA 2VH0A 4CBNA 5JYIA 4AN7A 1O0DH 2P59A 3T5FH 2ASUB 1P06A 3M3TA 2UUJB 2QV1A 1ARBA 2ZU1A 2A5KA 5E0HA 5LPRA 4BAKB 1IQNA 1EUFA 4A1XA 2Z9LA 1V2MT 1GGDB 3Q3YA 1GI0A 1O2UA 1V2OT 3SZNA 5A0CA 9ESTA 2C4FH 2OLGA 1NC6A 1ABJH 2BDGA 1HAGE 1J14A 3UNRA 3M37A 1Y5UT 1DICA 1A4WH 2FM2A 4ABEA 1GHWH 3D65E 1G3DA 1ID5H 1VITH 2J94A 1LKAA 2PGBB 5SGAE 1LVMA 1C2IA 2QCYA 1TALA 2BLWA 1YBWA 1V2WT 3M7TA 3LGYA 2Z7FE 1GJ8B 3SJ8A 1EZSC 2H1UA 2ZU2A 2Z9IA 3GY5A 2G51A 7KMEH 2BY8X 1CSOE 3DUXH 1GBEA 4ABGA 5A8ZA 4INLA 2VIVA 2FLBH 3QDZB 3SU0A 1VCWA 1CHOF 1T8LA 5FPTA 3RMMH 1W7GH 4X8TH 2A7CA 1O5EH 1KXCA 1MCVA 6LPRA 2ZCLP 2WYJA 1DVAH 2ZDMA 3Q00A 1CT4E 1WU1A 1W11U 4AG2A 2OTVA 2OQUA 1SLVB 2EC9H 1C2GA 2O8WA 5H4IB 2ESTE 3MHWU 3T27A 5CHAB 5IYTA 4DW2U 1S84A 3MYWA 1BT7A 1EB2A 3BEIB 1TNJA 2Y5HA 2BD2A 3ZZ3A 4LZ1H 3TJOA 1S83A 4DY7B 1N8OC 1ZRBA 3JZ2B 3RXRA 5EQRA 1GI1A 2BMGB 4I8GA 2QF3A 2H2ZA 4AGKA 3UIRA 2G52A 1HB0B 1A5HA 4X6MA 2EI8A 5T3HA 3RP2A 3U8TH 2HNTC 3Q3XA 1LHGH 2SGPE 4FUCA 4Y10E 5GIBA 1T4UH 2SGFE 1EP5A 3RC5A 4X2XA 2FX6A 2B0FA 2GKVE 2J92A 3KQCA 4Z0KA 1O2MA 1P2OA 1O2VA 1TX8A 3TJUA 1A3BH 2BD9A 3T2NA 5K0HA 1H4WA 1SLUB 3A7VA 1GMDF 3QUMP 3IG6B 2HGTH 2VWLA 1QQUA 1BHXF 1D6WA 2ANYA 4ZAEA 2SFAA 4WF8A 1HAXB 3SV9A 1UTJA 2CF9H 3NUMA 3GICB 4K5ZA 2ZECA 3RXFA 4BTIB 1H9IE 1GHVH 5HMAA 3BSQA 2XC4A 3KQBA 1IQJA 4IS5A 4UFEH 4K3JA 2BZAA 3L33A 1DSTA 1CHGA 1RS0A 1UVUH 3DT0H 2P3FH 4B76A 4JZDH 1ZR0A 3D23A 2NU4E 1AY6H 3GDUA 1EPTA 4BOHA 1T4VH 4TY7A 1TBQH 4AORA 1YCPH 4NZQA 5LPFA 2NU3E 5C2ZA 3KL6A 1P03A 1ETRH 1IHSH 6CHAB 3PV4A 1BBRH 2VJ1A 3MI4A 1CU1A 1NN6A 2GV6A 1A0HB 4H4FA 1Q31A 3NZIA 2ZDLA 2IN2A 5L6NH 1EJMA 1SSXA 1ZMNA 1L1JA 2GD4B 3I77A 5JBAS 5EW2H 3PLKA 1UCYK 3QGJA 5J4QA 1S82A 4FUHA 4CRDA 5T6GA 1C5OH 1GJ5H 1WBGB 1YC0A 4QT8C 1PPFE 1ZSLA 2GT8A 1O2NA 3SUDA 1W7XH 4JZ1A 2BD4A 1P8VC 2JETB 1MTNC 1AVWA 1KXEA 5AVDA 3RM2H 1GMHG 1LHEH 3ATIA 3L6PA 3SJKA 5A09A 1OSSA 3FZDA 5ETXA 3GDVA 1TPOA 4YM9A 4NZLA 1QB1A 1BZXE 1TQ7B 4DT7B 2D2DA 1GI7B 4B74A 1BBRE 3A82A 2QN5T 4CR9A 1ZHRA 1V2ST 4ABJA 5EW1H 1XUJA 2XBXA 1P9UA 2CMYA 4AOQA 1QL7A 2A5IA 2FEQH 1T32A 3KQEA 4X2YA 2FO9A 3MH5A 1O3CA 4YTAA 2BDHA 1AFQC 2R2WU 1MAYA 1UO6A 1LCYA 3UUZA 5JPMH 3AVZA 2PHBA 3V12A 2HALA 3OY6U 3RXMA 1G2MA 1OYQA 1LQDB 1C5VA 1Z71A 2BLVA 3RXTA 4KTSA 1NO9H 1A61H 1QL8A 1QJ7B 1O2PA 3S9AA 1QBVH 2Y7XA 1DOJA 2FP7B 1YP9A 3O8BA 5EOKA 2A4GA 3SV6A 2FYRA 4E7RG 1YPGH 5FCRA 3TH3H 1SGCA 3TNTA 4Y0YE 2TPIZ 3A83A 3ZVBA 4GCHG 4DCDA 2A7HA 1DWDH 1EP6A 2GMTC 2CGAA 1FMGA 4ISOA 4E7NA 1C5LH 2G5VA 1DSUA 3P70B 1LQEA 2CN0H 5C5NA 4R8TB 2QXGA 5A2MH 1JIMA 4JYTA 3A8BA 4JYUH 4AYVB 1DPOA 1C1WH 3EQ0H 3KEEA 1TONA 2G5NA 1F7ZA 2F9OA 3RXAA 1C1TA 4NIVA 5A8YA 1O39A 1AIXH 2DE9A 1YKTA 1AU8A 2STBE 3TGIE 1DM4B 3U8RH 1C5RA 3EA8A 4MVNA 1MKXK 1GJBB 3RXGA 1CE5A 4BXSA 3S69A 2ZGHA 1ZHMA 4ABFA 5DP9A 1EPTB 4UD9H 4NG9H 1FI8A 3RC4A 1TGCA 1GG6C 2V3OH 1A0LA 1M9UA 4MNYA 1N1LA 4F49A 1P12E 2J38A 1OX1A 1V2JT 1MCTA 4MPWA 8ESTE 2SGAA 1ZSJA 1FNIA 1O3HA 2O8LA 1ZYOA 4ISHH 3PMAB 4FU9A 4CRBA 2ULLA 5GPIB 1C1MA 3V13A 2ZDAH 2BDAA 2J95A 1HIAA 3E0NB 4X6OA 3A7WA 3FANA 1C4Y2 3LJJA 4XBCA 1B0EA 3BEUA 1TNIA 5EPYA 1C1RA 5EG4A 1K1PA 1SI5H 4NIXA 5GCHF 5A0AE 1Z8JB 3UREA 1HJAC 1KXBA 3GY4A 2ALPA 4GAWA 3O8CA 1J15A 2GDEH 2OC7A 2QA9E 1V2RT 1C1NA 1ETTH 1ZJKA 2VINA 1PFXC 5F03A 4WY3A 1EAXA 2OD3B 4Y71A 2QXHA 3EAJA 1O34A 1FY3A 3U8OH 2VIPA 2PFEA 3H7OA 2IOTA 4UDWH 2A2QH 1ELTA 1G9IE 2O8MA 2BM2A 3MH4A 1JRTA 4B73A 4BAQB 1ELCA 1C5TA 4DVAU 3MOCA 2ZFFH 2AIQA 4CH2B 2C8ZB 3W94A 1PQAA 1TOMH 2R0LA 1HXEH 1W0YH 1GJCB 1HAYB 3ZZBA 4ZKSU 1S5SA 1MU6B 3AAVA 1A5IA 1BTHH 1OYTH 2A4RA 2G00A 1T31A 4D7GA 1O3EA 4HZHA 1K1LA 1SGTA 4KTCA 4ZMAH 5DGJA 2OXSA 2C8WB 1DLKB 1TRMA 1IQGA 5EQQA 3M61U 1C5QA 1CO7E 1TGTA 1A0JA 1T8OA 3E91A 4YESB 1HPGA 1E0FD 3K6ZA 1W12U 2G4TA 1LPZB 1GL0E 1TNLA 2BX4A 4WH8A 3VEQB 4GSOA 1TA6A 4A1VA 4WVPE 2ZNKH 3A7YA 5FHTA 2BQ6B 1BJVA 1P2QA 2ZIQH 1S85A 3GDSA 1UVPA 1QA7A 2FPZA 2H9HA 2GCHF 1FPCH 3SU4A 1LMWB 2XW9A 1BDAA 5I46H 1NFWA 2FI4E 1BHXB 1C5SA 1QL9A 2A2XH 1MBQA 2ZI2H 1HXFH 1XUIA 2F9PA 2B9LA 1XKBC 1ZTKA 3K2UA 1XVOA 1SQOA 3UPEA 1C1OA 2Y80A 2R2MB 1O3BA 3H5CB 1J17T 1OKXA 1TPAE 4I32A 3SU6A 4WMFA 3PWBA 2ZFRH 1O3GA
chains in the Genus database with same CATH superfamily
1K1OA 1H8HD 2YMSC 3F6UH 1GHAG 4YT6H 4OS4A 5C1XA 3F68H 5EIYA 1WYKA 4FVBA 2V0BA 4ABIA 4GUXA 4FU7A 1GBBA 4J2YB 1MD8A 2HNTE 5C94A 2Y7ZA 2NU1E 1MAXA 1ZGIA 1QQ4A 5JBCS 4FUBA 1QBNA 2F3CE 1Y5AT 2VIOA 2GV7A 4WWYA 4JCNA 4UEHH 1XUFA 3RXVA 2J9NA 2O8UA 3SU1A 2ZHEH 2UWPA 4MLFB 1N6XA 4B2AA 2PR3A 3BIUH 1P2JA 5E2PA 5C67A 1YLNA 4WXIA 4FETA 3A8DA 1FAXA 1AMHA 1YGCH 4BANB 3SQEE 4OS6A 1NT1A 1QHRB 4GHQA 1GMHF 4X1RU 3F3BA 1JXPA 3MU0A 3RXJA 1UTMA 2WINI 3QTOH 5HIYA 1K1MA 1D3PB 4IC5A 4CRAA 2XRCA 3NWUA 5C20A 1AI8H 1K1IA 4BAOB 2ZTXA 2PKAA 1QNJA 1EAUA 2G81E 1WAYB 1VJ9U 2I6SA 4I8JA 5HM2A 1GBLA 3TGJE 1O2TA 3HGNA 3P17H 1AVXA 3RM0H 3VB3A 2OC1A 3F9HA 3UWJH 1V2UT 1C4V2 3N7DA 1Y3XA 3HK6B 4XRNA 1Z1JA 1SBWA 3A7XA 2W6JD 2VVCA 3L3TA 4O3UA 2ANWA 3NPSA 2UWOA 5C5OA 1GHBG 2WPJS 3A8AA 1AVGH 4BNRA 4OS7A 2JKHA 5FPSA 1TX7A 3PMHB 3KYGA 2V3MA 2QF0A 2AMPA 2J97A 1VGCC 3GOVB 3TJNA 1FDPA 1THPB 2OUAA 1HRTH 2SGDE 3Q76A 4K60A 1Y3VA 1LO6A 3ZVAA 1NTPA 4GCHF 2XBYA 4X1NU 1GHYH 3ELAH 3F9FA 3U69H 1EOLA 5DKMA 3MH7A 1GJ4H 2ILNA 3QK1A 1UK4A 1TFXA 1O3JA 2XXLA 1BOQA 1INCA 3A81A 2PV9B 2RDLA 1V2NT 1Y3YA 2M5TA 1O3FA 1MTUA 1DWBH 4YOJA 2PSXA 3BTQE 3HK3B 1GGDC 1NU9A 1E36B 1L1NA 4I8HA 1ORFA 1OXGA 4SGAE 2KR7A 1IQFA 1NBME 3A84A 2BD3A 2QF4A 1BQYA 2PKSB 1IAUA 2EQNA 2Z3CA 1O2GH 3S0NA 4JZFH 1OWIA 1E1RD 1CQQA 3PYHA 4CRCA 3RXBA 3U1JB 1AD8H 1EQ9A 1SB1H 1AB9B 2FX4A 4CRGA 3GCTF 1SR5C 1C5YB 2AFQB 5DP3A 2OBOA 3UTUH 3LGIA 1RIWB 1HYLA 1O3NA 2PKSC 3HKJB 1AQ7A 3W95A 1XVMA 4DT4A 1GBAA 3FO8D 1AZZA 5EJLA 3GYMA 2ZCKP 1UHBA 2YNBA 4BXWA 4X2VA 3U98H 2ZFTA 1G3CA 3RLYH 1RIWC 2XCNA 3ZYEA 2V6NA 2R3UA 1ZMJA 3KNXA 3M5MA 2Z3DA 4K69A 1LTOA 1PPZA 2O9QA 4E05H 2P95A 1DANH 4A1TA 1O30A 1HAVA 5ESBA 5GWZA 1UTOA 4HI3A 2LNCA 1O2SA 3RXUA 1O5DH 5KECA 4B71A 2HPQH 3E3TA 3UOUA 3R0FA 1JOUB 1BCUH 3FFGA 1B7XB 3MTYA 4NWLA 4ISLA 4CHAB 2LELA 1FY5A 1UCYH 4AFZA 5CHAC 1MZAA 4RT1A 3SI4H 1EKBB 2GX4A 1ELAA 1EX3A 3FVFB 2HPPH 3HPTB 2FODA 2VWNA 2ZTYA 1TQ0B 3E6PH 1U6QA 1P11E 3BV9B 1ANBA 2FIRH 1K22H 4Q7XA 1ZPZA 2CV3A 2PKAB 3UFAA 3LH1A 4GHTA 2ZFPH 2ANMH 4TPYA 1YPHC 1ELDE 4ISIH 5DK1A 1NBMD 1AHTH 3M7QA 1PPHE 4JZIA 1EB1H 1O2ZA 1DS2E 1LVYA 2FYQA 4Q7YA 3UB0A 2R0KA 1P2KA 3DSPA 4NGAH 3D62A 9LPRA 1UCYE 3PMJA 2EEKA 1B0FA 4ISNA 1AE8H 1O2OA 1RTFB 2ZF0H 5GXPA 2PW8H 3M5NA 1C5UA 2WPLS 1P0SH 4I8LA 3SNDA 2C93B 3RXCA 3P6ZB 3SNBA 7GCHG 1Z1IA 1S81A 1D4PB 3URDA 4VGCB 2THFB 4YLQH 4AB9A 4X6NA 2WPDD 1DWCH 1ZHPA 1BRUP 1ELGA 3RC6A 2YNAA 2TGAA 5FCKA 3U1IB 1K21H 3LT3A 3SNCA 2DE8A 1SGIB 3PLBA 1G36A 1C5PA 1O3LA 3D49H 3VB7A 2FTMA 1SGFG 3ZIAD 5HM9A 1MZDA 1EFRD 6CHAC 5EXNA 4TT3D 2FOBA 3MNBA 3A85A 3P95A 1AUJA 5HYOA 4LZ4B 3VGCB 2UUKB 2GZ7A 2RA0A 3NK8A 2ZU3A 1NRSH 3GY8A 4WXVA 1O3MA 3DA9B 4Y0ZE 1BMAA 2J34A 1RXPA 4DIHH 1MU8B 2VIQA 2W5EA 2ZFSA 3GS9A 1PPCE 1VITG 3BG8A 4U32A 1SPJA 1PYTC 3E8LA 1FJSA 1ZOMA 4HFPB 4KKDA 4AX9H 5FBIA 1GHAF 1D3DB 3M7UA 1RFNA 3QLPH 2JH6D 3VXFH 1O33A 1WUNH 2BY9X 2JETC 1MKWK 3UR6A 3E0PB 2BLOA 3E1XB 1GBCA 1NFYA 1TPPA 1W3CA 4ABAA 1ANEA 1MKXH 1UHBB 4P02A 1ANDA 5EQSA 5EU8A 1WDIA 1Z8IB 4MNWA 1RRKA 3ATWA 2WPHS 1AO5A 4INHA 1V6DA 5ABWA 2Q1JA 1ZLRA 4ZKRU 4O9VA 2PGQB 2OP9A 1LHDH 2JH5D 4XSKU 3T29A 2F43B 1HAVB 4DGJA 2CHAB 1CGHA 1C9PA 1C5NH 4OM9A 1DITH 3BIVH 4ESTE 2BTCE 1SGDE 2ZPSA 1DXWA 2EA3A 1F0TA 1SHHB 3Q3KA 3QZQA 1Q3XA 3SUGA 1E79D 5C3NA 4X1QU 4TWYA 1O3OA 3T25A 5FAHA 1DX5M 4AG1A 4B6FA 2KAIA 2F9BH 3FAOA 3E16B 3SW2B 3UQVA 1AUTC 2CHAC 1C5WB 1SHYA 1C1VH 1PPGE 4DURA 2P93A 3GISB 4TYDA 1YCPK 3PRBA 3A89A 5GDSH 1SFQB 4NIWA 3KGPA 1HGTH 3OFND 3TITA 2ODQA 4FUFA 3M3VA 1OP2A 4MPXA 3I29A 1SGEE 2BOHB 1GI9B 2GJGA 2CXVA 1LPGB 3B8JA 4NSYA 2F91A 4BTUB 2J2UA 4O97A 4JZEH 3EA9A 1BTZA 4UFGH 1P09A 1BIOA 2A0QB 5E0GA 1O5AB 3DSOA 1J16A 1GHBF 1H1BA 3ODDA 5L30H 4FUIA 4D9RA 1TMUH 1X7AC 4J1YA 2ZGXH 2ZEBA 3W1EA 2PWXA 1O5FH 1THRH 2PTNA 1TNHA 2FI5E 2ZWLH 5JB8S 2EY4C 3RXSA 2K0QA 4KTUA 2Y5GA 2IPHA 3R3GB 1FXYA 3QGNB 4ABBA 1YWUA 4H6SB 1IQHA 2WUBA 2J98A 1XX9A 3EYDA 2SNWA 2TRMA 1NZQH 1C5ZB 1S0QA 1T8NA 3F2FA 1FY4A 4ZUHA 4B75A 1HFDA 1GJDB 2BX3A 1GVKB 1C2MA 1ZTLA 5GNDA 1P04A 3ZV9A 1E34B 5F6MA 4ZKOU 3SNEA 3QX5H 2ZQ2A 4Y8XA 2W3IA 1O38A 2Y81A 3EE7A 1EPTC 1GDQA 2P8OB 1HUTH 4F48B 2BXTH 3SV7A 2XYAA 3BN9A 2BY7X 1NFUA 1ZPCA 4Q7ZA 5DPAA 2BD7A 2KCYA 2PUXB 1G30B 3VPKA 1P02A 1D9IA 2GT7A 1FN8A 1H9HE 2CJIA 2LPRA 3RDZA 5JDUB 5EJ1A 3NKKA 5C1YA 1W2KH 1C2EA 3BTDE 1O2RA 1L1GA 3TK6A 4A92A 5AFYH 3U28C 3RXEA 4ZCNA 4ZKNU 5L2ZH 1C1PA 1WCZA 2R9PA 3ZVEA 1GWAA 1FONA 2PTCE 3LGTA 4ZHMU 4K1SA 4F55A 2KX4A 3AK5A 4A6LA 1SG8B 3RLWH 2VWOA 1GJ7B 1CT2E 3ZVDA 2YMSD 4X1PU 5C1UA 3FOAA 2HWLB 3S7KB 2WV4A 1QBOA 2AGGX 1GDUA 3RMNH 1O32A 1YF4A 1GI5A 1O5BB 3TH4H 1TRNA 1A5GH 3CNRA 3STIA 2JDID 1WTHD 1C2HA 1BMFD 3M5OA 1KXAA 1UVSH 2STAE 1FY8E 4K1TA 2Q6GA 3STJA 1UTPA 1QY6A 1DDJA 1GMDG 2A32A 1EATA 3MU1A 4NSVA 4RT0A 5CHBA 3BG4B 4D9QA 1SGYE 1V2VT 1SLWB 2W7SA 3MNCA 4MG3A 2OC0A 2XBWA 3WY8A 3TH2H 4Z6AH 1GI8B 1ELEE 2UWLA 2ZHFH 5B6LA 3S9BA 1O31A 4IW4E 1SGQE 2G4UA 4FXGH 4BAHB 3VB6A 1PQ8A 2G8TA 1K28D 1V2PT 2VIDA 4IMZA 4OS1A 2XWBI 1ZRKA 3F9EA 2KAIB 3G01A 1L2EA 2BXUH 2AH4X 1EXFA 2WV5A 1FAKH 2BVXH 1H8DH 1GI3A 1ZTJA 5EPNA 1BUIA 1NESE 1H8IH 1XM1A 2ZGJA 2IJOB 4AFUA 2GZ9A 1HAZB 2H6MA 2BD8A 4YXWD 1F92A 2VH6A 1FX0B 3TK9A 3V7TA 4RKOB 4D8NA 2ODYB 3ENSB 1NRNH 3K65B 4Q80A 1O2HA 4TWWA 3ATMA 4I31A 2VNTA 1QB6A 2ZGCA 4CH8B 1TRYA 1FIWA 2B8OH 3UY9A 4P00A 1EJNA 3N7OA 4JMYA 1AWFH 5AFZH 2PUQH 3KCGH 3MU8A 1KXDA 2BDYA 2SNVA 2Y6TA 2LP6A 2XC5A 7GCHF 2PP6A 3UNQA 2UUYA 1NRPH 1Z7KA 5FPYA 2WPIS 4ASHA 4DJZB 1HLTH 2SGQE 5EXMA 4LK4A 4AYYB 1GI2A 1KYNA 2FDAA 3GY3A 2J98B 1Y5BT 1JMOH 4HGCA 1F2SE 1HAOH 1UVOA 4DIIH 2BLQA 1IQKA 3BTWE 1BJUA 4FUJA 3SUEA 1KIGH 3GCHB 2A1DB 1GL1A 2BD5A 1DUEA 1F0SA 1FV9A 1L4ZA 3A80A 5TJXA 1EOJA 1O2KA 3SHAH 1HJ9A 4Z1MD 1GBDA 4ZHAA 1EAWA 4Y8YA 1FN6A 1NRRH 1DY9A 1NPMA 1MTWA 1YPHE 2L74A 3LC3A 4XOJA 3ZZDA 3I78A 1TABE 1P57B 4IC6A 1KY9A 1S0RA 4I7YH 2VVUA 3WW7A 1ABIH 1ANCA 1WV7H 2ZU4A 4CRFA 1TA2A 1VITF 3PO1B 3B9FH 3S7HB 1DLEA 4KELA 1QB9A 1XMNB 3T62A 5T6FA 4WMDA 3DFLA 6GCHG 5CMXH 1NRQH 4CREA 3ZZAA 1MMJN 2VGCB 1O2QA 3VB5A 4MNVA 3ATLA 2JH0D 1OWKA 2GTBA 4GPGA 1FY1A 2VBCA 1GI6A 3AW1A 5K7RA 3LKWA 1EAIA 1FPHH 2XTTB 1FIZA 2WSSD 5FX6A 1DFPA 1V2KT 2FTLE 3RXLA 1PQ7A 4B6EA 1OPHB 2V3HH 3F9GA 4IN1A 1HBTH 1HCGA 1TIOA 1D3QB 3M5LA 4X6PA 5E8EH 3KN2A 5LH8A 1O2XA 2GZ8A 3QO6A 1P2IA 3A88A 5F8TA 3EE0B 3OU0A 1TGSZ 3EA7A 3M3SA 1WSSH 2KZ4A 1NROH 2W26A 1CBWB 2ZTZA 5C0UA 3KHVA 2GCTB 5JB9S 4WJG2 5C17A 2R3YA 1VCPA 2F9VA 2ZC9H 3PWCA 1C4U2 5DJ7A 4BTTB 3RXQA 1KLJH 2QYIA 1P2MA 1QR3E 1ZPBA 1OWHA 1C1UH 1AE5A 1A1RA 1C1SA 1CBWC 1V2QT 1YY3A 3LONA 1GVZA 1G32B 2GCTC 1YPLH 3TLOA 4Y76A 1Z8GA 2AIPA 4INKA 2VVVA 3SJIA 1BRCE 3AASA 2ZCHP 1IQIA 2FOAA 2P94A 3LGWA 3ZZ5A 3VB4A 1GHXH 3OAAD 1BMNH 5BRRE 3SI3H 4X0WU 4NA8A 3SGAE 2Y82A 1O5GH 5DG6A 4Y7BA 1YPMH 1QFKH 3MNXA 2ZG0H 1O35A 1C9TA 2ZHDA 1C2KA 1YLCA 4LXBH 2ODPA 1W0JD 3PLPA 2F4LA 1O3AA 3BTTE 1G37A 5DP5A 3KQDA 3DD2H 1SGRE 3RXPA 1XUGA 1DWEH 1LHFH 1O2YA 1QRXA 4FU8A 3DCLA 3C27B 2TIOA 1O2LA 5B6OA 1AB9C 1W10U 2A31A 4IN2A 4XE4A 4UFDH 3Q77A 5GJ4B 1IQEA 3TIUA 1A46H 4AGJA 2HLCA 1BRBE 1BTYA 3RU4T 3C1KA 3FP8E 1L4DA 5LGOA 4M7GA 1GMCG 5GCHG 1P3CA 1SGNE 5AHGH 1K0HA 3BTFE 1KDQB 4PROA 1GCDA 1OWDA 1GCTB 3GY7A 4X8VH 5DN6D 1VCQA 1SGFA 1OWJA 4Y7AA 2I6QA 2YOLA 1QA0A 1Y8TA 2ZGBH 2AMQA 2ZKSA 1N8OB 1BA8B 2NU2E 4XFQA 2EI7A 1GCTC 1CGJE 3AW0A 3V0XA 4GVUA 3O8RA 3ATKA 5CE1A 1E37B 2OCVB 3QTVH 1O2JA 1DY8A 1SGPE 4WH6A 4WMEA 3SQHE 2WPKS 1XXDA 1G3EA 1LHCH 2F9UA 1GJ6A 1GDNA 1T8MA 4TPIZ 4CHAC 1PYTD 1ESTA 2XNIA 3MO9A 2XCFA 1TBRH 5FX5A 2BDBA 1MTSA 4K8BA 1T7CA 3N99A 3LC5A 3BTGE 3P8FA 5AF9H 4BAMB 1F0RA 1UK3A 2TBSA 2PSYA 1MTVA 1GPZA 1WQSA 3RXIA 1MKWH 4RN6A 1K1NA 5JBBS 2A45B 2ZDNA 2Z9JA 4MNXA 1XUKA 1YM0A 1O3PB 1LVBA 4CR5A 4UONA 2GP9B 1TLDA 1W14U 3A87A 1C2LA 5TCAA 1NU7B 2BYAX 1GJAB 4AFQA 4HTCH 3RXDA 2GCHG 1HDTH 2RFKC 1PJPA 2TGDA 2BHGA 2FESH 2OINA 5C0TA 4X2WA 3NXPA 4X1SU 4DOQA 4MTBA 1RTLA 2BQ7B 3KF2A 1J9CH 2C90B 1E35B 2ZQ1A 2C8YB 4LOYH 4D76A 1ELVA 3MWIU 2DUCA 3LGUA 4Q2KA 1ZSKA 1GBIA 2Z9KA 3RXOA 3ESTA 1P05A 1C1QA 1MH0A 1D3TB 4VGCC 3SHCH 4IGDA 1QRZA 1ZMLA 2EI6A 4X8UH 5HIZA 1ZJDA 1YCPM 5DSFA 4FVDA 2V35A 3LDXH 4U01A 4K1EA 2WPMS 1MABB 2FMJA 7ESTE 1RD3B 2HVYB 3PMBB 1W8BH 2NWNA 1RJXB 3A8CA 3A7TA 2VB0A 1JWTA 3LGVA 3LH3A 3QWCH 1UVTH 8LPRA 1KXFA 3O8DA 3E90B 3RU4E 3GCOA 3CS7A 2FWWA 3M36A 2BVRH 1DT2A 1KTTB 2VU8E 4YT7H 4YOIA 3SV2H 3JZ1B 2BY6X 5DP4A 1MTNB 5DP8A 2OQ5A 4H6TA 2RG3A 1ELBA 2P3UB 1JRSA 2J4IA 4YZUA 1A7SA 3FKSD 3VGCC 7LPRA 2Z94A 2F83A 2A4OA 1ELFA 1C2DA 5E0JA 4U2WA 3KIDU 1KLTA 3ZZ9A 1MD7A 1TX6A 2Q6DA 2TGPZ 1QTFA 3QN7A 3MU4A 3FZZA 2JIZD 1HAIH 6ESTA 3TPIZ 4KGAA 1TGBA 1AKSA 1BTWA 3OE7D 4XDEA 5L2YH 1VR1H 3HATH 2FOHA 3RMOH 1AFQB 1V2TT 2Y5FA 4O3TA 2J5UA 2WV9A 3HGPA 2P16A 4A7IB 1C5MD 2H5CA 4B2BA 1FQ3A 4DG4A 4H42U 4CBOA 2WZQA 1QIXB 1GBFA 3ZZ6A 1S6LA 2QF5A 2HLDD 3B23B 2ZO3H 3N7EA 2B7DH 1AFEH 2QXIA 2QC2A 3F1SB 2FI3E 2KM0A 1SFIA 8GCHG 2XC0A 3OEHD 1Y59T 4AFSA 1G3BA 3SJ9A 1YPKH 6GCHF 5T1VA 2OBQA 1LVOA 1JBUH 1EZXC 2BOKA 3LOXA 1SOZA 1HNEE 4JK6A 4MDSA 3K6YA 1S6FA 4ZXXH 1TOCB 5T6DA 2NU0E 1GI4A 4NA9H 3A7ZA 2ZHQH 2GMTB 2QIQA 1UTNA 1BRAA 1D6RA 1SKYE 4Q4LA 3LU9B 1O3IA 1PQ5A 1BTXA 4FUDA 5HXFA 5FXLA 1BBRK 2KCPA 3PTBA 2ZU5A 1P3EA 1B5GH 3RU4D 4AC9A 2FOMB 3ZVCA 1GBHA 1UTKA 4NIYA 5HKKD 1IQLA 3P8NA 4U30A 5TCCA 1FUJA 3GYLB 3TGKE 1C2FA 4UE7H 2RCEA 2GVFA 1F0UA 2K1QA 3ZVGA 1ESBA 3CS0A 1NFXA 1AN1E 4JYVH 4Q63A 1QURH 1DE7H 1RTKA 2HOBA 2FXRA 2OC8A 2PLXA 1ZZZA 2P3TB 4ZHLU 1K1JA 3SGBE 5PTPA 5BPEA 1H9LB 1TNGA 3KYFA 2VIWA 1Z8RA 3SU2A 4THNH 1K2I1 3SUFA 1TBZH 4O03A 1OOKB 2ZDKA 1UK2A 3A86A 3ZVFA 3M35A 4Y11E 3BEFB 3ITIA 2SGEE 4Y6DA 3T26A 1GHZA 1OP0A 2WYGA 4B2CA 1P10A 3MO3A 1OP8A 4M9FA 3TNSA 1FZZA 4NFFA 4ABHA 1GG6B 3UNSA 3GCTG 3SJOA 1THSH 1LPKB 3U9AH 2Z9GA 1L0ZA 2CF8H 3ZZ7A 4YO9A 1CGIE 4I33A 1CT0E 3OX7U 5DP6A 1CHOG 1Z6JH 1LKBA 2ZPRA 2Q6FA 3BTME 2G55A 4YOGA 1SQTA 4AZ2B 1UJ1A 1HAPH 3BTHE 1GBJA 1UMAH 3ODFA 5A0BA 3SV8A 1O36A 2HNTF 3URCA 1Q2WA 1BB0B 1WOFA 1HJ8A 2P8OC 3ZZ4A 2FZZA 3KQ5A 3OY5U 3PROA 5F8ZA 3FP6E 3DHKH 2AERH 5EODA 1O37A 1P01A 2ALVA 3SNAA 4UFFH 1SL3A 1TWXB 2D26C 1XXFA 5JBTA 1HJAB 1OS8A 1SVPA 4K2YA 5EGMA 3GY2A 4RSPA 1YLDA 1QRWA 4X8SH 3RXHA 1AWHB 3ZYDA 4Y8ZA 3OSYA 1EJAA 1Z6EA 1UW7A 1GMCF 2A5AA 2Z6BD 1O2IA 1VZQH 4NA7A 4ZH8A 2AGEX 1AKSB 2VWMA 1UTQA 2ZZUH 3HKIB 3TJVA 3UQOA 1BMLA 2BDIA 1CA8B 1SLXB 1EZQA 4A5TS 2H9TH 2FLRH 1IHTH 1DXPA 3V3MA 4AB8A 2Z3EA 1GVLA 1TMBH 1TGNA 1GBKA 4I8KA 1GBTA 4R0IA 3F2GA 1O5CB 2GGVB 1FLEE 1GJ9B 3K9XB 2D1JA 4RKJB 3IITA 1SC8U 1QJ1B 1BITA 5A8XA 1JIRA 2FOFA 3ZZ8A 1E38B 5EXLA 5HGGA 3ZZCA 1QGFA 1A2CH 3MO6A 2FOEA 3BG4C 2BQWB 3GCNA 1XUHA 1SMFE 3UWIA 3SORA 4NFEA 3MQKC 1SOTA 1G2LA 3P8OA 1YYY1 1AZ8A 1OWEA 1QCPA 1V2LT 2BY5X 4ABDA 1O2WA 2QAAA 2HRVA 3F0OA 5E2OA 3UAIC 2ZA5A 4OGXA 3SGQE 5DP7A 2W3KA 1VJAU 3PB1E 1IQMA 3PV5A 1YPEH 5LPEA 3H7TA 4FUGA 1CA0B 1S6HA 2BVSH 1IOEA 1MQ6A 2D8WA 1TYNA 2BDCA 1KSNA 3MNSA 2BB4A 3OTPA 1F5LA 3EGKH 3DFJA 3SO3A 1WTGH 3TU7H 3IWMA 2ZPQA 1QJ6B 1MUEB 1VKYA 2AMDA 3P8GA 1HAHH 2AEIH 2FS9A 1N6YA 1ARCA 5IK2D 3OYPA 1CA0C 2GDDA 2XBVA 1NS3A 4XBBA 2AGIX 4XBDA 3VFEA 3QZRA 4D7FA 2QGRA 3LJOA 1NY22 2BZ6H 1E1QD 3EDXB 1DUAA 2RA3A 1F5KU 1KTSB 3PV2A 4JK5A 1SQAA 2YMSB 1TMTH 3MMGA 1TE0A 1WQVH 1PPBH 3MH6A 1ACBE 1KDQA 2W6ID 1ESAA 4F4OC 1BTPA 1C5XB 2O8TA 3GY6A 1RGQA 4GLYA 4KP0A 1TAWA 3LPRA 2A7JA 2H9EH 4IMQA 1GBMA 1CVWH 3OTJE 1TNKA 2C3SA 1ETSH 4NCYA 4Y79A 3GCHC 3BTKE 4OS5A 1MQ5A 1TB6H 5F8XA 2FOCA 1K9OE 1H8ED 8KME2 2H5DA 3PTNA 3AAUA 3T28A 3LIWA 3SU5A 4B1TA 5FBEA 2WUCA 2AYWA 1XKAC 4IBLH 2ANKH 3S9CA 1P2NA 1BTUA 2UUFB 1J8AA 4OS2A 3TVJB 3MU5A 4MPUA 2W7UA 4I86A 1AGJA 1ZGVA 2ZDVH 5J4SA 1PPEE 4SGBE 5IDKA 4NWKA 3UR9A 1EASA 4ZXYH 1YPJH 2QY0B 2TGTA 2ZFQH 2ZP0H 3SN8A 3PO1C 2M2AA 1HIAB 3SU3A 4MQAA 4ZROA 1Y3UA 2AS9A 3NRLA 1UTLM 2QXJA 1Y3WA 2FOGA 5G4BA 1P9SA 3CENA 1A3EH 2HVXA 2B5TB 3RMLH 3SYJA 4K8YA 3RUOA 1W13U 2VGCC 2C8XB 3ZV8A 4YLUA 1KLIH 1EZUC 3BF6H 2AHME 3VXEH 1HV7A 3UOPA 4E06H 3BTEE 3CP7A 5DO4H 3SOSA 3RXKA 2XOKD 4FUEA 2FS8A 1MBMA 3FP7E 1LDTT 2A4QA 3NCLA 4TSFD 4RI0A 3SBKA 5ESTE 8GCHF 1O3KA 3P92A 4OGYA 1BMMH 4TY6A 3TK5A 1VGCB 1O3DA 4MPVA 2XWAA 2ZHWH 2IPQX 3MFJA 2F9NA 1F5RA 3PM3A 1W0ZU 1TPSA 5I25A 1C2JA 1NM6A 1V3XA 2VH0A 4CBNA 5JYIA 4AN7A 1O0DH 2P59A 3T5FH 2ASUB 1P06A 3M3TA 2UUJB 2QV1A 1ARBA 2ZU1A 2A5KA 5E0HA 5LPRA 4BAKB 1IQNA 1EUFA 4A1XA 2Z9LA 1V2MT 1GGDB 3Q3YA 1GI0A 1O2UA 1V2OT 3SZNA 5A0CA 9ESTA 2C4FH 2OLGA 1NC6A 1ABJH 2BDGA 1HAGE 1J14A 3UNRA 3M37A 1Y5UT 1DICA 1A4WH 2FM2A 4ABEA 1GHWH 2XNDD 3D65E 1G3DA 1ID5H 1VITH 2J94A 1LKAA 2PGBB 5SGAE 1LVMA 1C2IA 2QCYA 1TALA 2BLWA 1YBWA 1V2WT 3M7TA 3LGYA 2Z7FE 1GJ8B 3SJ8A 1EZSC 2H1UA 2ZU2A 2Z9IA 3GY5A 5KGOA 2G51A 7KMEH 2BY8X 1CSOE 3DUXH 1GBEA 4ABGA 5A8ZA 4INLA 2VIVA 2FLBH 3QDZB 3SU0A 1VCWA 1CHOF 2KCOA 1T8LA 5FPTA 3RMMH 1W7GH 4X8TH 2A7CA 1O5EH 1KXCA 1MCVA 6LPRA 2ZCLP 2WYJA 1DVAH 2ZDMA 3Q00A 1CT4E 1WU1A 1W11U 3PRDA 4AG2A 3SZEA 2OTVA 2OQUA 1SLVB 2EC9H 1C2GA 2O8WA 5H4IB 2ESTE 3MHWU 3T27A 5CHAB 5IYTA 4DW2U 1S84A 1KMHB 3MYWA 3F2HA 1BT7A 1QZ8A 1EB2A 3BEIB 1TNJA 2Y5HA 2BD2A 3ZZ3A 4LZ1H 3TJOA 1S83A 4DY7B 1N8OC 1ZRBA 3JZ2B 3RXRA 5EQRA 1GI1A 2BMGB 4I8GA 2QF3A 2H2ZA 4AGKA 3UIRA 2G52A 1HB0B 1A5HA 4X6MA 2EI8A 5KEDA 5T3HA 3RP2A 3U8TH 2HNTC 5EJZA 3Q3XA 1LHGH 2SGPE 4FUCA 4Y10E 5GIBA 1T4UH 2SGFE 1EP5A 3RC5A 4X2XA 2FX6A 2B0FA 2GKVE 2J92A 3KQCA 4Z0KA 1O2MA 1P2OA 1O2VA 1TX8A 3F0PA 3TJUA 1A3BH 2BD9A 3T2NA 5K0HA 1H4WA 2CK3D 1SLUB 3A7VA 1GMDF 3QUMP 3IG6B 2HGTH 2VWLA 1QQUA 1BHXF 1D6WA 2ANYA 4ZAEA 2SFAA 4WF8A 1HAXB 3SV9A 1UTJA 2CF9H 3NUMA 3GICB 4K5ZA 2ZECA 3RXFA 4BTIB 1H9IE 1GHVH 5HMAA 3BSQA 2XC4A 3KQBA 1IQJA 5F53A 4IS5A 4UFEH 4K3JA 2BZAA 3L33A 1DSTA 1CHGA 1RS0A 1UVUH 3DT0H 2P3FH 4B76A 4JZDH 1ZR0A 3D23A 2NU4E 1AY6H 3GDUA 1EPTA 4BOHA 1T4VH 4TY7A 1TBQH 4AORA 1YCPH 4NZQA 4XD7D 5LPFA 2NU3E 5C2ZA 3KL6A 1P03A 1ETRH 1IHSH 6CHAB 3PV4A 1BBRH 2VJ1A 1W0KD 3MI4A 1CU1A 1NN6A 2GV6A 1A0HB 4H4FA 1Q31A 3NZIA 2ZDLA 2IN2A 5L6NH 1EJMA 1SSXA 1ZMNA 1L1JA 2GD4B 3I77A 5JBAS 5EW2H 3PLKA 1UCYK 3QGJA 5J4QA 1S82A 4FUHA 3DSGA 4CRDA 5T6GA 1C5OH 1GJ5H 1WBGB 1YC0A 2RDEA 4QT8C 1PPFE 1ZSLA 2GT8A 1O2NA 3SUDA 1W7XH 4JZ1A 2BD4A 1P8VC 2JETB 1MTNC 1AVWA 1KXEA 5AVDA 3RM2H 3OEED 1GMHG 1LHEH 3ATIA 3L6PA 3SJKA 5A09A 1OSSA 3FZDA 5ETXA 3GDVA 1TPOA 4YM9A 3H09A 4NZLA 1QB1A 1BZXE 1TQ7B 4DT7B 2D2DA 1GI7B 4B74A 1BBRE 3A82A 2QN5T 4CR9A 1ZHRA 1V2ST 4ABJA 5EW1H 1XUJA 2XBXA 1P9UA 2CMYA 1WXRA 4AOQA 1QL7A 2A5IA 2FEQH 1T32A 3KQEA 4X2YA 2FO9A 3MH5A 1O3CA 4YTAA 2BDHA 1AFQC 3FN8A 2R2WU 1MAYA 1UO6A 1LCYA 3UUZA 5JPMH 3AVZA 2PHBA 3V12A 2HALA 3OY6U 3RXMA 1G2MA 1OYQA 1LQDB 1C5VA 1Z71A 2BLVA 3RXTA 4KTSA 1NO9H 1A61H 1QL8A 1QJ7B 1O2PA 3S9AA 2IJD1 2JJ2D 1QBVH 2OK5A 2Y7XA 1DOJA 2FP7B 1YP9A 3O8BA 5EOKA 2A4GA 3SV6A 2FYRA 4E7RG 1YPGH 5FCRA 3TH3H 1SGCA 3TNTA 4Y0YE 2TPIZ 3A83A 3ZVBA 4GCHG 4DCDA 2A7HA 1DWDH 1EP6A 2GMTC 2CGAA 1FMGA 4ISOA 4E7NA 1C5LH 2G5VA 1DSUA 3P70B 1LQEA 2CN0H 5C5NA 4R8TB 2QXGA 5A2MH 1JIMA 4JYTA 3A8BA 4JYUH 4AYVB 1DPOA 1C1WH 3EQ0H 2KFWA 2V7QD 3KEEA 1TONA 2G5NA 4ACAA 3WWBA 1F7ZA 2F9OA 3RXAA 1C1TA 4NIVA 5A8YA 1O39A 1AIXH 2DE9A 1YKTA 1AU8A 2STBE 3TGIE 1DM4B 3U8RH 1C5RA 3EA8A 4MVNA 1MKXK 1GJBB 3RXGA 1CE5A 4BXSA 3S69A 2ZGHA 1ZHMA 4ABFA 5DP9A 1EPTB 4UD9H 4NG9H 1FI8A 3RC4A 1TGCA 1GG6C 2V3OH 1A0LA 1M9UA 4MNYA 2KCAA 1N1LA 4F49A 1P12E 2J38A 1OX1A 5FL7D 1V2JT 1MCTA 4MPWA 8ESTE 2SGAA 1ZSJA 1OHHD 1FNIA 1O3HA 1ZYOA 2O8LA 4ISHH 3PMAB 4FU9A 4CRBA 2ULLA 5GPIB 1C1MA 3V13A 2ZDAH 2BDAA 2J95A 1HIAA 3E0NB 4X6OA 3A7WA 3FANA 1C4Y2 3LJJA 4XBCA 1B0EA 3BEUA 1TNIA 5EPYA 1C1RA 5EG4A 1K1PA 1SI5H 4NIXA 5GCHF 5A0AE 1Z8JB 3UREA 1HJAC 1KXBA 3GY4A 2ALPA 4GAWA 3O8CA 1J15A 2GDEH 2OC7A 2QA9E 1COWD 1V2RT 1C1NA 1ETTH 1ZJKA 2VINA 1PFXC 5F03A 4WY3A 1EAXA 2OD3B 4Y71A 2QXHA 3EAJA 1O34A 2WHXA 1FY3A 3U8OH 2VIPA 2PFEA 3H7OA 2IOTA 4FOUC 4UDWH 2A2QH 1ELTA 1G9IE 2BM2A 2O8MA 2QE7D 3MH4A 1JRTA 4B73A 4BAQB 1ELCA 1C5TA 4DVAU 3MOCA 2ZFFH 2AIQA 4CH2B 2C8ZB 3W94A 1PQAA 1TOMH 2R0LA 1HXEH 1W0YH 1GJCB 1HAYB 3ZZBA 4ZKSU 1S5SA 1MU6B 3AAVA 1A5IA 1SQRA 1BTHH 1OYTH 2A4RA 2G00A 1T31A 4D7GA 1O3EA 4HZHA 1K1LA 1SGTA 4KTCA 4ZMAH 5DGJA 2OXSA 2C8WB 1DLKB 1TRMA 1IQGA 5EQQA 3M61U 1C5QA 1CO7E 1TGTA 1A0JA 1T8OA 3E91A 4YESB 1HPGA 1E0FD 2L6OA 4HG6A 3K6ZA 1W12U 2G4TA 1LPZB 1GL0E 1TNLA 2BX4A 4WH8A 3VEQB 4GSOA 1TA6A 4A1VA 4WVPE 2ZNKH 3A7YA 5FHTA 2BQ6B 1BJVA 1P2QA 2ZIQH 1S85A 3GDSA 1UVPA 1QA7A 2FPZA 4ASUD 2H9HA 2GCHF 1FPCH 3SU4A 4ACBA 1LMWB 2XW9A 1BDAA 5I46H 1NFWA 2FI4E 1BHXB 1C5SA 1QL9A 2A2XH 1MBQA 2ZI2H 1HXFH 1XUIA 2F9PA 2B9LA 2JJ1D 1XKBC 1ZTKA 3K2UA 1XVOA 1SQOA 3UPEA 3VG8A 1C1OA 2Y80A 2R2MB 1O3BA 3H5CB 1J17T 1OKXA 1TPAE 4I32A 3SU6A 2K8IA 3WWFA 5CDFE 4WMFA 3PWBA 2ZFRH 1O3GA
chains in the Genus database with same CATH topology
1K1OA 3F6UH 5C1XA 1GHAG 4YT6H 4OS4A 3F68H 1WYKA 4FVBA 2V0BA 4ABIA 4GUXA 4FU7A 1GBBA 4J2YB 1MD8A 2HNTE 2Y7ZA 2NU1E 1MAXA 1ZGIA 1QQ4A 5JBCS 4FUBA 1QBNA 2F3CE 1Y5AT 2VIOA 2GV7A 4WWYA 4JCNA 4UEHH 1XUFA 3RXVA 2J9NA 2O8UA 3SU1A 2ZHEH 2UWPA 4MLFB 1N6XA 4B2AA 2PR3A 3BIUH 1P2JA 5E2PA 5C67A 4WXIA 3A8DA 1FAXA 1AMHA 1YGCH 4BANB 3SQEE 4OS6A 1NT1A 1QHRB 4GHQA 1GMHF 4X1RU 1JXPA 3MU0A 3RXJA 1UTMA 2WINI 3QTOH 1K1MA 1D3PB 4IC5A 4CRAA 2XRCA 3NWUA 5C20A 1AI8H 1K1IA 4BAOB 2ZTXA 2PKAA 1QNJA 1EAUA 2G81E 1WAYB 1VJ9U 2I6SA 4I8JA 5HM2A 1GBLA 3TGJE 1O2TA 3HGNA 3P17H 1AVXA 3RM0H 3VB3A 2OC1A 3F9HA 3UWJH 1V2UT 1C4V2 1Y3XA 3HK6B 1Z1JA 1SBWA 3A7XA 2VVCA 3L3TA 4O3UA 2ANWA 3NPSA 2UWOA 5C5OA 1GHBG 2WPJS 3A8AA 1AVGH 4BNRA 4OS7A 2JKHA 5FPSA 1TX7A 3PMHB 2QF0A 2AMPA 1VGCC 3GOVB 3TJNA 1FDPA 1THPB 2OUAA 1HRTH 2SGDE 3Q76A 4K60A 1Y3VA 1LO6A 3ZVAA 1NTPA 4GCHF 2XBYA 4X1NU 1GHYH 3ELAH 3F9FA 3U69H 1EOLA 5DKMA 3MH7A 1GJ4H 2ILNA 3QK1A 1UK4A 1TFXA 1O3JA 2XXLA 1BOQA 1INCA 3A81A 2PV9B 2RDLA 1V2NT 1Y3YA 2M5TA 1O3FA 1MTUA 1DWBH 4YOJA 2PSXA 3BTQE 3HK3B 1GGDC 1NU9A 1E36B 1L1NA 4I8HA 1ORFA 1OXGA 4SGAE 1IQFA 3A84A 2BD3A 1BQYA 2PKSB 1IAUA 2Z3CA 3S0NA 1O2GH 4JZFH 1OWIA 1CQQA 3PYHA 4CRCA 3RXBA 3U1JB 1AD8H 1EQ9A 1SB1H 1AB9B 2FX4A 4CRGA 3GCTF 1SR5C 1C5YB 2AFQB 5DP3A 2OBOA 3UTUH 3LGIA 1RIWB 1HYLA 1O3NA 2PKSC 3HKJB 1AQ7A 3W95A 1XVMA 1GBAA 1AZZA 3GYMA 2ZCKP 1UHBA 2YNBA 4BXWA 4X2VA 3U98H 2ZFTA 1G3CA 3RLYH 1RIWC 2XCNA 3ZYEA 2V6NA 2R3UA 1ZMJA 3KNXA 3M5MA 2Z3DA 4K69A 1LTOA 1PPZA 2O9QA 4E05H 2P95A 1DANH 4A1TA 1O30A 1HAVA 5ESBA 5GWZA 1UTOA 4HI3A 2LNCA 1O2SA 3RXUA 1O5DH 4B71A 2HPQH 3E3TA 3UOUA 3R0FA 1JOUB 1BCUH 3FFGA 1B7XB 3MTYA 4NWLA 4ISLA 4CHAB 1FY5A 1UCYH 4AFZA 5CHAC 1MZAA 3SI4H 1EKBB 2GX4A 1ELAA 1EX3A 3FVFB 2HPPH 3HPTB 2FODA 2VWNA 2ZTYA 1TQ0B 3E6PH 1U6QA 1P11E 3BV9B 1ANBA 2FIRH 1K22H 4Q7XA 1ZPZA 2CV3A 2PKAB 3UFAA 3LH1A 4GHTA 2ZFPH 2ANMH 4TPYA 1YPHC 1ELDE 4ISIH 5DK1A 1AHTH 3M7QA 1PPHE 4JZIA 1EB1H 1O2ZA 1DS2E 1LVYA 2FYQA 4Q7YA 2R0KA 1P2KA 4NGAH 3D62A 9LPRA 1UCYE 3PMJA 2EEKA 1B0FA 4ISNA 1AE8H 1O2OA 1RTFB 2ZF0H 5GXPA 2PW8H 3M5NA 1C5UA 2WPLS 1P0SH 4I8LA 3SNDA 2C93B 3RXCA 3P6ZB 3SNBA 7GCHG 1Z1IA 1S81A 1D4PB 3URDA 4VGCB 2THFB 4YLQH 4AB9A 4X6NA 1DWCH 1ZHPA 1BRUP 1ELGA 3RC6A 2YNAA 2TGAA 5FCKA 3U1IB 1K21H 3LT3A 3SNCA 2DE8A 1SGIB 3PLBA 1G36A 1C5PA 1O3LA 3D49H 3VB7A 2FTMA 1SGFG 5HM9A 1MZDA 6CHAC 5EXNA 2FOBA 3MNBA 3A85A 3P95A 1AUJA 5HYOA 4LZ4B 3VGCB 2UUKB 2GZ7A 2RA0A 3NK8A 2ZU3A 1NRSH 3GY8A 4WXVA 1O3MA 3DA9B 4Y0ZE 1BMAA 2J34A 1RXPA 4DIHH 1MU8B 2VIQA 2W5EA 2ZFSA 1PPCE 1VITG 3BG8A 4U32A 1SPJA 1PYTC 3E8LA 1FJSA 1ZOMA 4HFPB 4KKDA 4AX9H 5FBIA 1GHAF 1D3DB 3M7UA 1RFNA 3QLPH 2JH6D 3VXFH 1O33A 1WUNH 2BY9X 2JETC 1MKWK 3UR6A 3E0PB 2BLOA 3E1XB 1GBCA 1NFYA 1TPPA 1W3CA 4ABAA 1ANEA 1MKXH 1UHBB 1ANDA 5EQSA 5EU8A 1Z8IB 4MNWA 1RRKA 3ATWA 2WPHS 1AO5A 4INHA 1V6DA 5ABWA 2Q1JA 1ZLRA 4ZKRU 4O9VA 2PGQB 2OP9A 1LHDH 2JH5D 4XSKU 3T29A 1HAVB 4DGJA 2CHAB 1CGHA 1C9PA 1C5NH 1DITH 3BIVH 4ESTE 2BTCE 1SGDE 2ZPSA 1DXWA 2EA3A 1F0TA 1SHHB 3Q3KA 3QZQA 1Q3XA 3SUGA 5C3NA 4X1QU 4TWYA 1O3OA 3T25A 5FAHA 1DX5M 4AG1A 2KAIA 2F9BH 3FAOA 3E16B 3SW2B 3UQVA 1AUTC 2CHAC 1C5WB 1SHYA 1C1VH 1PPGE 4DURA 2P93A 3GISB 4TYDA 1YCPK 3A89A 5GDSH 1SFQB 4NIWA 3KGPA 1HGTH 3TITA 2ODQA 4FUFA 3M3VA 1OP2A 4MPXA 3I29A 1SGEE 2BOHB 1GI9B 2CXVA 1LPGB 3B8JA 4NSYA 2F91A 4BTUB 2J2UA 4O97A 4JZEH 3EA9A 1BTZA 4UFGH 1P09A 1BIOA 2A0QB 5E0GA 1O5AB 1J16A 1GHBF 1H1BA 3ODDA 5L30H 4FUIA 4D9RA 1TMUH 1X7AC 4J1YA 2ZGXH 2ZEBA 2PWXA 1O5FH 1THRH 2PTNA 1TNHA 2FI5E 2ZWLH 5JB8S 3RXSA 4KTUA 2Y5GA 2IPHA 3R3GB 1FXYA 3QGNB 4ABBA 4H6SB 1IQHA 2WUBA 3EYDA 1XX9A 2SNWA 2TRMA 1NZQH 1C5ZB 1S0QA 1T8NA 1FY4A 4ZUHA 4B75A 1HFDA 1GJDB 2BX3A 1GVKB 1C2MA 1ZTLA 1P04A 3ZV9A 1E34B 5F6MA 4ZKOU 3SNEA 3QX5H 2ZQ2A 4Y8XA 2W3IA 1O38A 2Y81A 1EPTC 1GDQA 2P8OB 1HUTH 2BXTH 3SV7A 2XYAA 3BN9A 2BY7X 1NFUA 1ZPCA 4Q7ZA 5DPAA 2BD7A 3VPKA 2PUXB 1G30B 1P02A 1D9IA 2GT7A 1FN8A 1H9HE 2CJIA 2LPRA 3RDZA 5JDUB 3NKKA 5C1YA 1W2KH 1C2EA 3BTDE 1O2RA 1L1GA 3TK6A 4A92A 5AFYH 3RXEA 4ZKNU 5L2ZH 1C1PA 1WCZA 2R9PA 3ZVEA 1GWAA 1FONA 2PTCE 3LGTA 4ZHMU 4K1SA 4A6LA 1SG8B 3RLWH 2VWOA 1GJ7B 1CT2E 3ZVDA 4X1PU 5C1UA 2HWLB 3S7KB 2WV4A 1QBOA 2AGGX 1GDUA 3RMNH 1O32A 1YF4A 1GI5A 1O5BB 3TH4H 1TRNA 1A5GH 3STIA 1WTHD 1C2HA 3M5OA 1KXAA 1UVSH 2STAE 1FY8E 4K1TA 2Q6GA 3STJA 1UTPA 1QY6A 1DDJA 1GMDG 2A32A 1EATA 3MU1A 4NSVA 4D9QA 3BG4B 1SGYE 1V2VT 1SLWB 2W7SA 3MNCA 4MG3A 2OC0A 2XBWA 3WY8A 3TH2H 4Z6AH 1GI8B 1ELEE 2UWLA 2ZHFH 3S9BA 1O31A 4IW4E 1SGQE 2G4UA 4FXGH 4BAHB 3VB6A 1PQ8A 2G8TA 1K28D 1V2PT 2VIDA 4IMZA 4OS1A 2XWBI 1ZRKA 3F9EA 2KAIB 3G01A 1L2EA 2BXUH 2AH4X 1EXFA 2WV5A 1FAKH 2BVXH 1H8DH 1GI3A 1ZTJA 5EPNA 1BUIA 1NESE 1H8IH 1XM1A 2ZGJA 2IJOB 4AFUA 2GZ9A 1HAZB 2H6MA 2BD8A 1F92A 2VH6A 3TK9A 3V7TA 4RKOB 4D8NA 2ODYB 3ENSB 1NRNH 3K65B 4Q80A 1O2HA 4TWWA 3ATMA 4I31A 2VNTA 1QB6A 2ZGCA 4CH8B 1TRYA 1FIWA 2B8OH 3UY9A 1EJNA 3N7OA 4JMYA 1AWFH 5AFZH 2PUQH 3KCGH 3MU8A 1KXDA 2BDYA 2SNVA 2Y6TA 2XC5A 7GCHF 3UNQA 2UUYA 1NRPH 1Z7KA 5FPYA 2WPIS 4ASHA 4DJZB 1HLTH 2SGQE 5EXMA 4LK4A 4AYYB 1GI2A 1KYNA 2FDAA 3GY3A 1Y5BT 1JMOH 4HGCA 1F2SE 1HAOH 1UVOA 4DIIH 2BLQA 1IQKA 3BTWE 1BJUA 4FUJA 3SUEA 1KIGH 3GCHB 2A1DB 1GL1A 2BD5A 1DUEA 1F0SA 1FV9A 1L4ZA 3A80A 5TJXA 1EOJA 1O2KA 3SHAH 1HJ9A 1GBDA 4ZHAA 1EAWA 4Y8YA 1FN6A 1NRRH 1DY9A 1NPMA 1MTWA 1YPHE 3ZZDA 3LC3A 4XOJA 3I78A 1TABE 1P57B 4IC6A 1KY9A 1S0RA 4I7YH 2VVUA 1ABIH 1ANCA 1WV7H 2ZU4A 4CRFA 1TA2A 1VITF 3PO1B 3B9FH 3S7HB 1DLEA 4KELA 1QB9A 1XMNB 3T62A 5T6FA 4WMDA 3DFLA 6GCHG 5CMXH 1NRQH 4CREA 3ZZAA 1MMJN 2VGCB 1O2QA 3VB5A 4MNVA 3ATLA 2JH0D 1OWKA 2GTBA 4GPGA 1FY1A 1GI6A 3AW1A 5K7RA 3LKWA 1EAIA 1FPHH 2XTTB 1FIZA 5FX6A 1DFPA 1V2KT 2FTLE 3RXLA 1PQ7A 1OPHB 2V3HH 3F9GA 4IN1A 1HBTH 1HCGA 1TIOA 1D3QB 3M5LA 4X6PA 5E8EH 3KN2A 5LH8A 1O2XA 2GZ8A 3QO6A 1P2IA 3A88A 5F8TA 3EE0B 3OU0A 1TGSZ 3EA7A 3M3SA 1WSSH 1NROH 2W26A 1CBWB 2ZTZA 3KHVA 2GCTB 5JB9S 4WJG2 2R3YA 1VCPA 2F9VA 2ZC9H 3PWCA 1C4U2 5DJ7A 4BTTB 3RXQA 1KLJH 2QYIA 1P2MA 1QR3E 1ZPBA 1OWHA 1C1UH 1AE5A 1A1RA 1C1SA 1CBWC 1V2QT 3LONA 1GVZA 1G32B 2GCTC 1YPLH 3TLOA 4Y76A 1Z8GA 2AIPA 4INKA 2VVVA 3SJIA 1BRCE 3AASA 2ZCHP 1IQIA 2FOAA 2P94A 3LGWA 3ZZ5A 3VB4A 1GHXH 1BMNH 5BRRE 3SI3H 4X0WU 4NA8A 3SGAE 2Y82A 1O5GH 5DG6A 4Y7BA 1YPMH 1QFKH 3MNXA 2ZG0H 1O35A 1C9TA 2ZHDA 1C2KA 1YLCA 4LXBH 2ODPA 3PLPA 3BTTE 1O3AA 5DP5A 1G37A 3KQDA 3DD2H 1SGRE 3RXPA 1XUGA 1DWEH 1LHFH 1O2YA 1QRXA 4FU8A 3C27B 2TIOA 1O2LA 5B6OA 1AB9C 1W10U 2A31A 4IN2A 4XE4A 4UFDH 3Q77A 5GJ4B 1IQEA 3TIUA 1A46H 4AGJA 2HLCA 1BRBE 1BTYA 3RU4T 3C1KA 3FP8E 1L4DA 5LGOA 4M7GA 1GMCG 5GCHG 1P3CA 1SGNE 5AHGH 3BTFE 1KDQB 4PROA 1GCDA 1OWDA 1GCTB 3GY7A 4X8VH 1VCQA 1SGFA 1OWJA 4Y7AA 2I6QA 2YOLA 1QA0A 1Y8TA 2ZGBH 2AMQA 2ZKSA 1N8OB 1BA8B 2NU2E 4XFQA 2EI7A 1GCTC 1CGJE 3AW0A 3V0XA 4GVUA 3O8RA 3ATKA 5CE1A 1E37B 2OCVB 3QTVH 1O2JA 1DY8A 1SGPE 4WH6A 4WMEA 3SQHE 2WPKS 1XXDA 1G3EA 1LHCH 2F9UA 1GJ6A 1GDNA 1T8MA 4TPIZ 4CHAC 1PYTD 1ESTA 2XNIA 3MO9A 2XCFA 1TBRH 5FX5A 2BDBA 1MTSA 4K8BA 1T7CA 3LC5A 3BTGE 3P8FA 5AF9H 4BAMB 1F0RA 1UK3A 2TBSA 2PSYA 1MTVA 1GPZA 1WQSA 3RXIA 1MKWH 4RN6A 1K1NA 5JBBS 2A45B 2ZDNA 2Z9JA 4MNXA 1XUKA 1YM0A 1O3PB 1LVBA 4CR5A 4UONA 2GP9B 1TLDA 1W14U 3A87A 1C2LA 5TCAA 1NU7B 2BYAX 1GJAB 4AFQA 4HTCH 3RXDA 2GCHG 1HDTH 1PJPA 2TGDA 2BHGA 2FESH 2OINA 4X2WA 3NXPA 4X1SU 4DOQA 4MTBA 1RTLA 2BQ7B 3KF2A 1J9CH 2C90B 1E35B 2ZQ1A 2C8YB 4LOYH 4D76A 1ELVA 3MWIU 2DUCA 3LGUA 4Q2KA 1ZSKA 1GBIA 2Z9KA 3RXOA 3ESTA 1P05A 1C1QA 1MH0A 1D3TB 4VGCC 3SHCH 4IGDA 1QRZA 1ZMLA 2EI6A 4X8UH 1ZJDA 1YCPM 4FVDA 2V35A 3LDXH 4U01A 4K1EA 2WPMS 2FMJA 7ESTE 1RD3B 3PMBB 1W8BH 2NWNA 1RJXB 3A8CA 3A7TA 2VB0A 1JWTA 3LGVA 3LH3A 3QWCH 1UVTH 8LPRA 1KXFA 3O8DA 3E90B 3RU4E 3GCOA 3CS7A 2FWWA 3M36A 2BVRH 1DT2A 1KTTB 2VU8E 4YT7H 4YOIA 3SV2H 3JZ1B 2BY6X 5DP4A 1MTNB 5DP8A 2OQ5A 4H6TA 2RG3A 1ELBA 2P3UB 1JRSA 2J4IA 4YZUA 1A7SA 3VGCC 7LPRA 2Z94A 2F83A 2A4OA 1ELFA 1C2DA 5E0JA 4U2WA