2BHGA

3c protease from type a10(61) foot-and-mouth disease virus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
199
structure length
194
Chain Sequence
DLQKMVMGNTKPVELNLDGKTVAICCATGVFGTAYLVPRHLFAEKYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLHRGNKVRDITKHFRDTARMKKGTPVVGVVNNADVGRLIFSGEALTYKDIVVTMPGLFAYKAATRAGYAGGAVLAKDGADTFIVGTHSAGGNGVGYCSCVSRSMLQKMKAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FOOT-AND-MOUTH DISEASE VIRUS 3C PROTEASE
publication title Crystal Structure of Foot-and-Mouth Disease Virus 3C Protease: New Insights Into Catalytic Mechanism and Cleavage Specificity
pubmed doi rcsb
source organism Foot-and-mouth disease virus
total genus 34
structure length 194
sequence length 199
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bhgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bhgA01
1VR1H 4JMYA 1TQ7B 4OS2A 3LT3A 4F4OC 1GHBG 1QURH 2B8OH 3TH4H 4D9QA 4ABEA 1BHXF 4DIHH 1CHGA 1CBWB 1CHOF 3T29A 4DG4A 1P04A 4HGCA 2A7JA 2ALPA 1EP5A 1O2KA 3P8NA 5JDUB 1LPZB 2G4UA 2FESH 3FANA 2BLVA 2PV9B 2W3IA 3A7VA 3TH3H 4MNXA 1UJ1A 3KQBA 2EEKA 5F8TA 4Y10E 4ZKRU 1ZRBA 3VB5A 1A7SA 1D3QB 1ELDE 1DXPA 2DUCA 1IQHA 4HFPB 1FN8A 2H9TH 1VJAU 1KXEA 1ZHRA 1OWEA 1C1VH 1SL3A 3RXPA 1WQVH 2UWPA 4MNYA 5FCKA 2AEIH 1MZAA 1ELAA 1V3XA 4H42U 1ZPCA 3UWJH 1B0EA 1EB1H 1TPSA 3E6PH 2XC4A 3STIA 2YNAA 4RKOB 2VIQA 1DWDH 1ZYOA 5ESTE 5TCCA 4INHA 3ZVEA 3M5MA 1S82A 3BF6H 2G8TA 8ESTE 1Z1IA 1W7GH 1WBGB 1CT4E 5TJXA 3P8GA 1GCDA 1GGDC 3A8AA 1ZHPA 2ZU1A 1GBCA 4GPGA 2BDAA 4K1EA 3ZZCA 1OX1A 1O5BB 1MD7A 8GCHF 4X2XA 2FZZA 4B1TA 1EZSC 5L30H 1LHCH 1QY6A 2BB4A 4KTUA 2ZTYA 2G55A 2GV6A 1C4U2 1UHBA 1ZR0A 4YLQH 1GJCB 2C93B 2GKVE 3VXEH 3SNDA 4FU8A 5CE1A 2OXSA 1OS8A 5EODA 2ZA5A 3H5CB 2ZF0H 2QXHA 3M3VA 1QB6A 5C67A 2QF0A 1GBAA 1ANBA 1EOJA 1O2PA 4YOJA 1C5PA 2STBE 2O9QA 3M35A 1DUAA 2WYJA 6ESTA 4Z6AH 1S6HA 1IQKA 1P12E 4RN6A 2A4RA 2NU2E 3ODDA 1YPLH 4BAHB 1KXBA 2VIWA 4CRAA 1MQ6A 5I46H 2C90B 1T8MA 4MTBA 3RMNH 1ZSJA 4YOGA 3LONA 2GCTB 1W0YH 2F9PA 3IWMA 3NPSA 1O2XA 4Q80A 1PPZA 3A8BA 3K6YA 4THNH 4U01A 5DP7A 2ZU2A 1UTOA 4BXSA 2AGIX 1ELEE 5C5NA 2ODPA 3SV9A 1Z8JB 3PROA 1GI7B 3P17H 1P05A 4GLYA 3TPIZ 1O0DH 4ABGA 1GVKB 4GSOA 2RCEA 1QRWA 1K1JA 1ELCA 2ZKSA 4LZ4B 1TQ0B 1GMCG 4KP0A 4IC6A 4WY3A 2Z9GA 2VIDA 1FY1A 1O5GH 4K2YA 1GDNA 4X1QU 1ZMJA 4YZUA 5DP5A 4FUEA 1LKAA 1J9CH 4A92A 2P16A 4NA8A 1G2MA 2Z7FE 2PLXA 3UOPA 1O2OA 2TPIZ 3A80A 4I31A 1XUIA 9ESTA 3DFJA 2ZWLH 4YOIA 2Y80A 1MKXK 1A3BH 3OSYA 1QB1A 1Z7KA 3MO3A 1SBWA 2SFAA 3NKKA 1BMNH 3RXAA 3TNTA 4Y0YE 3PLKA 2GTBA 3AW1A 4Y76A 2BY8X 3QUMP 1Z6JH 1CHOG 9LPRA 4AX9H 3PO1C 3SI4H 1Q3XA 1YCPK 3I78A 2Y5FA 2BD2A 4JZFH 1H1BA 1GJ4H 1NRPH 1T8LA 1Y5UT 2QN5T 3SO3A 2BX3A 3EYDA 5A09A 1KLIH 2KAIB 3RXHA 3ZVAA 1CT2E 1C5TA 2CMYA 3LDXH 3M7UA 2PGQB 4CH2B 2R0LA 3HK3B 1EASA 1RJXB 1RXPA 1MTVA 1BTYA 1OKXA 1ZMLA 1LO6A 1HIAA 2SGQE 1L0ZA 1AUJA 1L4ZA 1BB0B 1XVMA 3TLOA 4ZXXH 2VVUA 5E8EH 3IG6B 5DG6A 1MAXA 2Y7ZA 4NFEA 1O3GA 3HGPA 3Q3KA 4XFQA 4ZKNU 3RMLH 1TNJA 4NIXA 3HATH 3PB1E 4Y79A 2BY5X 2VINA 3TK9A 3ATKA 3SUGA 3A83A 5HM9A 5GIBA 1V2VT 4CRDA 1PQ8A 1C9TA 2Y6TA 4B75A 3BTTE 5EXMA 2F9UA 4ISIH 2VH0A 3URDA 2ZGJA 2FDAA 2OCVB 2FODA 4MPUA 2QXGA 1SLUB 3PWBA 3SI3H 1S0QA 3NZIA 1O3CA 8GCHG 4TWWA 4YT6H 1P10A 3NWUA 1W0ZU 1DT2A 3G01A 2ZFFH 3UNSA 3A8DA 3LH3A 3FFGA 3RXSA 2XBYA 3MO9A 2GT7A 1Z8IB 4OS1A 3AW0A 3M36A 1W3CA 3GDVA 3QZQA 4ABFA 2Z3EA 2P8OC 1MD8A 4Y7AA 1UO6A 3BG8A 1KXDA 2BVSH 2GP9B 5PTPA 1S81A 4I7YH 2WV5A 1ANCA 1FDPA 4NFFA 1O3LA 1G3DA 1NM6A 4O03A 1XKAC 2V6NA 1BQYA 3RXMA 3NCLA 3SHCH 4DIIH 1HJ8A 1O3MA 2ZU3A 1HYLA 1BMMH 2F91A 2FYQA 4HTCH 1BBRK 1GI0A 3LPRA 3QDZB 1HXEH 1ESAA 2VIOA 2FMJA 2IPHA 2VIVA 4X1RU 3SNBA 1N8OB 1O33A 2OC8A 1NU7B 3VXFH 5EPYA 1P0SH 4WJG2 1BTHH 4INKA 3TJOA 5T3HA 1TA6A 2BD7A 1DSUA 1KYNA 3UWIA 1EAIA 2XXLA 2QIQA 1MKXH 2QCYA 1GG6B 2ZI2H 4BTTB 3P6ZB 2ZGHA 3GY7A 4B2CA 4ISLA 5FPSA 1LHDH 1K1OA 2M5TA 4ZH8A 5EU8A 3LU9B 1Q2WA 1SHYA 1Y3XA 3SJOA 1GJAB 2WINI 1TPAE 2HVXA 1K1NA 2XBWA 1HUTH 4I8GA 3BTGE 4NGAH 2SGFE 3GOVB 3RXVA 3NUMA 4JCNA 3KEEA 2O8UA 1P2NA 4MPVA 3RU4T 1A46H 1SMFE 2A31A 2IN2A 3RXTA 4X2WA 4XOJA 3U1IB 4X1SU 2ZU4A 1UVUH 2RDLA 4B74A 1FMGA 4WVPE 1H9IE 1EPTB 1DY9A 2UUJB 1P9SA 3LGVA 1NRRH 3A85A 1KTTB 2XYAA 4MNWA 1O2UA 1SGCA 1AVXA 2ZDMA 4CHAC 2XTTB 2GVFA 1C2DA 4ISNA 1EOLA 1DLKB 3L3TA 2A7CA 2FWWA 4AN7A 3LKWA 2XBVA 1ZHMA 3GYLB 1KXCA 1QL7A 1S6FA 3GCTF 3BEIB 3QGJA 1DY8A 1V2JT 1UVOA 1ACBE 5DP9A 4A6LA 2ANYA 2ZFQH 2QXIA 1GHYH 1HDTH 4IMQA 4NSYA 5EOKA 4U30A 3VB3A 1THPB 1UTNA 2ZCHP 4X8VH 1YPHE 1K2I1 4ABDA 3GY2A 1KLJH 2PTNA 3T27A 5C3NA 4LXBH 2XCNA 2WPMS 2TGDA 1HJAC 3UR9A 1P8VC 2BQ7B 1K22H 3EAJA 2QYIA 3TH2H 3SU5A 1KIGH 2J94A 2GT8A 1ANEA 1FONA 1CE5A 5K7RA 2BQ6B 2NWNA 3UR6A 4NA7A 1QTFA 1QJ7B 1P2JA 3A7WA 1UTLM 1KY9A 1NZQH 1P2KA 3SV8A 4JZEH 1DLEA 5J4SA 1F2SE 2UWLA 2BYAX 2XC5A 2UUKB 4ZKSU 2PKAB 3U8OH 1AWHB 2GD4B 2WYGA 2HOBA 1HLTH 1EZXC 1ELFA 2JETC 4XE4A 1J16A 2SGEE 4Y11E 1O2IA 4CH8B 1GJDB 1C2LA 1HAOH 3MNBA 2FOAA 2ZHWH 3PTNA 3UREA 1D4PB 5DJ7A 1G3CA 1PPGE 2ZPSA 1SR5C 4ABBA 3LGTA 1AFEH 5GWZA 2XNIA 5L2ZH 1NRSH 2XBXA 1HAVA 1O5CB 1ELGA 4K60A 1O36A 1O2ZA 2AMDA 1LKBA 2Z9JA 5EGMA 1UTKA 1TONA 5CHAC 1AB9C 1RTKA 5C1UA 3F1SB 3HK6B 2FM2A 1O2SA 3A89A 1GJ5H 3ZZ9A 1RGQA 3RMOH 8KME2 1NT1A 2HNTF 1PPCE 2FS9A 4NZLA 2HALA 4Y8YA 1VGCC 3ZVBA 1C2HA 1AY6H 3TK5A 1O5EH 1TIOA 2EI7A 6GCHF 2AYWA 2FTLE 1LMWB 2FTMA 3E91A 2BHGA 1FN6A 2H1UA 1EXFA 1HAZB 1AQ7A 1D6WA 1O38A 2ZHFH 3SU0A 3W95A 1TBZH 4AORA 2O8TA 1BZXE 4FUIA 4DGJA 4MPXA 1F5KU 3TK6A 1BUIA 1UVTH 1RTLA 1OWDA 5T6GA 3S7KB 2ANWA 4ZHLU 3HPTB 1QQUA 1C2EA 1CGJE 2NU0E 4SGBE 1DS2E 2XC0A 1TYNA 3MTYA 1P06A 1SQTA 1GI6A 4FUGA 1AVGH 4AYYB 3H7OA 2ZPQA 3A8CA 1AZ8A 3QTOH 1OWJA 1C5UA 1YPMH 4KELA 3SORA 1O2NA 1ELVA 4NA9H 1SGFG 3TIUA 1UCYK 1O32A 3RLWH 2BMGB 1B0FA 3SU2A 4IBLH 3F9EA 3HKJB 2PSXA 4BAQB 4ZROA 1GBDA 5GDSH 3RMMH 1H8DH 1YPGH 3LGIA 1IAUA 2PGBB 3CP7A 3ELAH 3V3MA 4B71A 4X6NA 3UTUH 2ZZUH 3RUOA 4I8LA 2QA9E 1ORFA 3M5OA 5DKMA 3ZYDA 2H9HA 1HB0B 4VGCC 1VITH 4AFQA 1MMJN 1QRZA 2FYRA 1SLXB 1PPEE 4AFSA 4B73A 3MO6A 4TWYA 2AGEX 3U98H 2A45B 3OTJE 2F3CE 4A1XA 4AG1A 4FU7A 1V2PT 1A5HA 1BOQA 2Q6DA 1PYTD 2YOLA 2ZGBH 2WPLS 4U32A 5F8ZA 5I25A 1GL1A 1FV9A 2Z9IA 3UY9A 4DURA 4HZHA 1GMDG 1PYTC 2OTVA 5T6FA 4ZMAH 2D1JA 1GI3A 1AKSB 3ZZ5A 2UWOA 1NESE 5DGJA 3Q3YA 3GDSA 1TNIA 2VB0A 1UTJA 1IQNA 2AH4X 1RTFB 1TBRH 1KTSB 3BSQA 1XUFA 3PM3A 1LVBA 3SW2B 4FU9A 5EQQA 4JK6A 1SGRE 1C2KA 1AE5A 1YF4A 3MHWU 1C1PA 1GI2A 1AD8H 1K28D 1BT7A 1AFQC 1G9IE 4AB9A 3QX5H 1SFQB 4D7FA 1L4DA 1XXDA 2P93A 3P92A 2DE8A 4FUJA 5A0BA 5LPRA 1TA2A 3F9GA 1A1RA 2VIPA 2VVVA 3RDZA 1MQ5A 4XBCA 4JK5A 3ZV8A 4JYUH 1TOCB 1A0JA 4K3JA 2GZ9A 3GCHC 2VNTA 4E05H 4AFZA 4XDEA 2OQUA 3QLPH 1CBWC 1DX5M 1TMBH 5B6OA 5EXLA 1OXGA 1RIWB 3D62A 3SU4A 3R0FA 2Z9LA 4UD9H 2BD9A 1THRH 1NFWA 2F83A 1E36B 2BLQA 2TRMA 1Y3WA 2VWNA 2BY9X 2XW9A 1L1NA 3GY6A 1KDQB 3LC3A 2BDBA 1UVSH 5AHGH 1AUTC 1JOUB 4NIYA 1BRAA 1BBRE 3U8RH 3LJJA 2STAE 3E0PB 1JXPA 2JKHA 1CVWH 4X6PA 2WUBA 4X6MA 2R9PA 3OY6U 4ABAA 3FZZA 5EPNA 1UK2A 1Z1JA 2R2MB 1NROH 2KAIA 1F0UA 2JH0D 4TY6A 1AIXH 5FXLA 1EX3A 3I77A 2QGRA 4AGKA 1GHZA 1LDTT 1C1MA 3GY3A 1GCTB 1C5MD 1DSTA 1W7XH 3BG4B 5FHTA 1Y5BT 1Y5AT 3SQEE 3CENA 5A2MH 4O9VA 1O2HA 4A5TS 3EGKH 5JPMH 3UNQA 2ESTE 2SGDE 1FIZA 3S7HB 4INLA 2PKSB 1IQJA 2THFB 1O5AB 1SLVB 2P3UB 1BTZA 1QNJA 3CS7A 3VPKA 4LZ1H 3RXRA 1SGPE 2A5IA 2FI3E 1LCYA 3V13A 1A0LA 3Q77A 5EG4A 3OY5U 1T4UH 1BMAA 2D2DA 5FPYA 2J34A 1LTOA 4CRBA 1XXFA 1VCQA 4NG9H 5A0AE 1OPHB 2P95A 3RP2A 3PMAB 1UHBB 2VGCB 4BAOB 1F5RA 1GJ6A 1XUJA 1IHSH 1V2QT 2A0QB 1O3AA 4AZ2B 1AO5A 1P01A 5LGOA 3F9HA 4JZIA 1DOJA 3EDXB 3MI4A 5T6DA 3RXCA 1OWHA 1QA7A 4ISHH 1IQGA 3DFLA 2HGTH 3M7TA 1TNLA 1DFPA 1DVAH 3M61U 1CA0B 4LK4A 5HM2A 4FVDA 2GCTC 2VWOA 4YESB 3Q3XA 1SI5H 3SV2H 4ZKOU 3MNXA 1MTNC 1H4WA 2XRCA 3UQVA 1K1IA 4B76A 6LPRA 1ZRKA 1C5NH 4E7NA 4BANB 2H5DA 4AB8A 1OWKA 1DWEH 1HAYB 2BXTH 2TGPZ 5DP4A 4H6TA 3RU4D 2FX4A 1UTMA 4MNVA 4PROA 5DK1A 4IMZA 1ESBA 2Q6FA 4DY7B 1CO7E 2ZFSA 1FXYA 1EAWA 1HV7A 1D3TB 2A5KA 1GVLA 1T31A 2ZG0H 2GDEH 3MH7A 4D9RA 1AE8H 3UNRA 3ODFA 1O3KA 1GVZA 5HXFA 5C5OA 1QBNA 2LPRA 1FPCH 3EA9A 1Y3VA 2FS8A 3QO6A 1TRYA 3VGCB 1RRKA 1EZQA 4UDWH 5HGGA 2BY6X 1S5SA 1LHEH 4FUBA 3K9XB 2OLGA 1GJ9B 1WUNH 4Y8ZA 2AFQB 5DP6A 1BTPA 1XM1A 3GICB 1ZJDA 1C4Y2 3S69A 1W8BH 4NZQA 1J8AA 2H9EH 5F03A 1WU1A 1AVWA 1NFYA 1TBQH 1V2TT 1FNIA 4TPIZ 1SPJA 1QJ6B 3M5LA 1E37B 4WF8A 2F9NA 3KL6A 6CHAB 1XUGA 1P3EA 5F8XA 4K8BA 1FY8E 1YPJH 1AMHA 1O34A 4JYVH 3UFAA 1QIXB 2J9NA 1S85A 3SNCA 1G3BA 1IQEA 4KTCA 4X1PU 1V2MT 1V2LT 3R3GB 4A1TA 2C4FH 1V2UT 4J2YB 3ITIA 4HI3A 1GDUA 5BRRE 1HBTH 2JH6D 4WXVA 1OSSA 2GZ8A 2ZFTA 3A81A 2A1DB 3KF2A 1ID5H 1D6RA 2AIQA 2BDIA 3CS0A 3OU0A 3E16B 4A7IB 4XBBA 3RC5A 2NU4E 1C2IA 2PHBA 2EI8A 4Y8XA 3SU3A 1QJ1B 1BITA 1LHGH 1C1OA 2ODQA 5C1YA 4MLFB 3RU4E 1TNKA 3QN7A 1O2GH 4JZDH 1LPKB 1O3HA 1QL9A 3SGBE 4OGYA 2ANKH 5FCRA 1OP0A 4YO9A 5FAHA 2BD3A 1DICA 1TB6H 1EATA 1UCYE 2FIRH 2XWAA 1GI9B 1O3BA 1NPMA 4ESTE 3TITA 3KCGH 4H4FA 2ZFRH 4MPWA 1MTUA 2FLRH 3BTKE 1S83A 1C1WH 1O3PB 3ATIA 1O5DH 1TPOA 3MNSA 3ATMA 4IGDA 3SUDA 4OGXA 1DWCH 1ZJKA 4KKDA 1LVOA 1YCPH 2FOHA 3ZV9A 1OP8A 4LOYH 2H2ZA 4WXIA 1C5RA 1SGNE 2OINA 1CQQA 1O3EA 2ZCKP 3WY8A 2PKAA 4GVUA 1D9IA 3PLBA 2BM2A 4R0IA 4D7GA 4Y71A 1SGFA 1Z8RA 2ZHDA 3O8CA 3FZDA 2C8YB 3LC5A 3ZVCA 2CN0H 1JBUH 3KNXA 1ZSKA 1HPGA 3MH5A 2ZFPH 5JYIA 1UVPA 1A61H 1MTSA 4M7GA 1DXWA 2TGAA 4Q7YA 1A5GH 3O8RA 3S9AA 4RKJB 1MBMA 1P2IA 3ZZ8A 1G2LA 4BXWA 3RXBA 3A7TA 2XWBI 4WMDA 1Y59T 2GMTB 1C1TA 5JBBS 2ZP0H 4AGJA 2HLCA 4Y0ZE 2QAAA 3MWIU 3QTVH 1BRBE 2AMPA 2PFEA 4GUXA 3TGIE 1N8OC 1LVMA 1AB9B 4YT7H 1GHVH 2WPHS 4XSKU 4NWKA 1TGSZ 1BRUP 4K1SA 2BDCA 1LQDB 1O3IA 2FOCA 2WPIS 5L6NH 3SHAH 1KSNA 1A5IA 1T8NA 2V3OH 1GG6C 1BCUH 1CGIE 5H4IB 4QT8C 1ZTJA 2H6MA 1XUHA 1O35A 1EJNA 4O97A 1VGCB 1WQSA 1PQ7A 1OYTH 3M37A 4Q7XA 4NWLA 3B9FH 1K1MA 1MU8B 2B5TB 4DVAU 1ARCA 1C4V2 2BZ6H 3ESTA 2FI4E 5AFYH 4CBNA 2IOTA 1GJBB 1H9LB 3DHKH 1RD3B 3SJIA 3RXIA 1O2QA 2HWLB 1F0RA 3F6UH 3M5NA 2BDYA 3MFJA 3RC4A 2ODYB 1CSOE 2BZAA 7GCHF 1DE7H 1WCZA 2HRVA 3RM0H 5GXPA 3Q00A 2A4OA 1CGHA 1SLWB 1F5LA 5E0HA 1O3DA 1A3EH 1TALA 1AHTH 3LIWA 1C5XB 4UFEH 5EW1H 1C2JA 4GHQA 4X8UH 1CT0E 2XCFA 1AI8H 1K9OE 3RM2H 3GCOA 3ZZ3A 2Q6GA 2BLWA 1C1UH 2FPZA 1TRMA 1F92A 1M9UA 1Z8GA 2W7SA 1AZZA 3ZVDA 4E7RG 4OS4A 1A2CH 3MU4A 1BBRH 4D8NA 3BEFB 1EUFA 1ESTA 3SNAA 3ZZDA 3SUEA 3V7TA 3LOXA 1F7ZA 1GI5A 4X8SH 3SNEA 1J15A 1QR3E 4X1NU 2EA3A 3RLYH 1TMTH 5E2OA 2YNBA 1XMNB 4WMEA 2ZDKA 1AU8A 1P9UA 1T4VH 3PLPA 1C1SA 3F9FA 5DP8A 3P95A 1TGTA 3ATLA 1GHWH 1TGBA 1VITF 4WWYA 1OWIA 2D26C 3MNCA 7LPRA 1ZTLA 1ELTA 1AKSA 1G36A 3SUFA 1WV7H 1TGNA 3GY8A 3NXPA 4FUCA 1P03A 1FPHH 3SQHE 3V12A 4JZ1A 4ZXYH 2B0FA 1NFXA 1W11U 1W14U 2FX6A 5JBAS 3BTWE 5F6MA 5DO4H 1HAHH 1ZOMA 1YYY1 4IS5A 1TNHA 2RG3A 1D3DB 8LPRA 2J95A 2Q1JA 4BTIB 2ZU5A 3ZZ6A 4ABJA 5GPIB 1TX8A 2UUFB 1HNEE 2A2QH 3S0NA 2G5VA 1YLDA 2BDHA 1BA8B 2OC1A 1GGDB 3KIDU 1INCA 1C5WB 2ZO3H 4IN1A 1HAVB 5GCHF 1PQAA 1C1NA 2ZDAH 4KGAA 1GBFA 2RA3A 5AVDA 1JRTA 1MTWA 3BTDE 3MOCA 2J2UA 1FZZA 2O8WA 1TX7A 1Z6EA 1NFUA 1GBHA 3E0NB 1W13U 2CF9H 2ZPRA 4GCHF 1EJMA 3SN8A 1X7AC 3B8JA 2QF3A 2ZCLP 1F0TA 2CHAC 2BTCE 3GCTG 1K1PA 1ZSLA 3K2UA 2BVXH 1EB2A 1KDQA 3U69H 4BOHA 1DM4B 4K8YA 1PPHE 1V6DA 4UFFH 2FOFA 3FAOA 4SGAE 1TPPA 1SSXA 2P3TB 3LGWA 3SGAE 2J4IA 2PWXA 3AAVA 4X6OA 3F68H 1GI1A 2SNVA 1E34B 1A4WH 1E0FD 1YCPM 2AGGX 1GL0E 1MKWK 1C5QA 3H7TA 5CMXH 3E3TA 1QB9A 2W7UA 3QK1A 2BQWB 7KMEH 1YC0A 5JBCS 1GBEA 2AMQA 5LPFA 5K0HA 5A8YA 1P57B 1VCPA 3ZVGA 1QQ4A 4D76A 3A82A 1SOZA 2K1QA 1MCTA 3OYPA 5E0JA 2ZDLA 1SQAA 5EQSA 1GJ7B 2V0BA 3FP6E 1IQLA 4AYVB 2VWMA 4R8TB 1N1LA 2R0KA 5FBEA 3U9AH 4AFUA 2ZC9H 1G37A 1IHTH 1CU1A 2H5CA 4WMFA 2Z94A 5IDKA 7GCHG 2ZQ2A 3SU1A 4WH6A 1AGJA 1H8IH 1O31A 2OP9A 2P59A 3SJ8A 1QBVH 3HKIB 3GCNA 1G30B 3BN9A 1ELBA 1LQEA 2JH5D 1NTPA 3SZNA 3HGNA 1K21H 1O2RA 2HNTC 1V2NT 3EQ0H 2Y82A 1BJUA 1SGYE 1SGQE 4NIWA 2OBQA 3P8OA 1L1JA 4B2BA 1ZGIA 4YTAA 1BHXB 4U2WA 1HCGA 1SB1H 2AERH 2Y81A 1V2WT 4MVNA 4B2AA 1C5VA 2G81E 3P70B 1P02A 1Y3YA 2F9OA 1IQIA 1S0RA 2IJOB 4DW2U 2O8MA 4K5ZA 3PO1B 4FUFA 2B7DH 6GCHG 1JRSA 1ANDA 2PTCE 2ZEBA 4ASHA 1GWAA 1C5ZB 2BD4A 2FXRA 2TBSA 1MUEB 1V2RT 3U1JB 1V2ST 1D3PB 3RXEA 1QA0A 5A8ZA 1TAWA 4YLUA 1GBIA 1VITG 4IN2A 1MTNB 1TRNA 2BOKA 1UCYH 2I6SA 1SHHB 3RXFA 1GJ8B 1FAKH 3DT0H 2VH6A 4RSPA 2Y5GA 1QGFA 1FAXA 1QL8A 5SGAE 1FY4A 1P3CA 4F49A 3TJNA 1SOTA 1XUKA 2P3FH 1UTPA 2OQ5A 3PMJA 4UE7H 4FXGH 3LJOA 2WUCA 3SJKA 1RS0A 1TWXB 2CF8H 3LGYA 4A1VA 1E35B 1W12U 4CRGA 1JWTA 1BTUA 5EQRA 1C5YB 3VFEA 3TGKE 4DOQA 1WSSH 3PYHA 1KXFA 3ZYEA 3EE0B 1SQOA 2Y5HA 1C1RA 3ZZ4A 1RIWC 3AVZA 3PMBB 3PTBA 3VB6A 2OC0A 2A2XH 4Q7ZA 5LH8A 4ZAEA 3C27B 4MQAA 1L2EA 2B9LA 1ABJH 3PV4A 1EAUA 1MZDA 1PJPA 1YP9A 3KQDA 2GDDA 1B5GH 1IQFA 2BD8A 2NU1E 3AASA 3E1XB 2V3HH 1DANH 4OS6A 5GCHG 3A88A 2HNTE 1OP2A 3RXDA 3DD2H 1B7XB 2ZGCA 2C8ZB 5JB9S 4CREA 2BXUH 1YM0A 3M3TA 1NC6A 1ZGVA 1LPGB 1QCPA 1QFKH 2I6QA 1W10U 1NRQH 1LHFH 2J92A 2C8WB 2PW8H 3SBKA 4GCHG 4NCYA 7ESTE 1MKWH 3MMGA 2ZDVH 1PPBH 4X2VA 1QRXA 4I8KA 1IOEA 1SGEE 1GI8B 4WH8A 1O39A 1O2TA 1AN1E 2FOBA 1ZMNA 2F9BH 1GCTC 2FOEA 1HXFH 4DT7B 1O2WA 2W3KA 1QBOA 1IQMA 3BG4C 2P8OB 4O3TA 4GAWA 1T32A 1EJAA 1BJVA 1C2MA 1P11E 4UFDH 5E2PA 1BRCE 1EKBB 2BY7X 2Y7XA 1ZPZA 3U8TH 2ZGXH 1E38B 1Z71A 2FOMB 1TLDA 2PKSC 1UK3A 3T25A 1TOMH 1UK4A 3GISB 1N6XA 2W5EA 1XVOA 4I32A 1GBMA 2TGTA 2A4GA 4TYDA 5TCAA 5FPTA 2C8XB 2VJ1A 4TY7A 5HYOA 2VGCC 2BOHB 2G4TA 4H6SB 2PUXB 4MDSA 2ALVA 3GDUA 2OUAA 3IITA 1GBJA 1MBQA 2G5NA 1GI4A 4X2YA 1T7CA 3BTFE 1F0SA 2F9VA 1V2KT 2J38A 1SGIB 1FUJA 1CA0C 1BTWA 1ETSH 3O8BA 4Y7BA 3E90B 3T26A 3VB4A 1TNGA 2GV7A 3ZZAA 5FBIA 1GHXH 1TX6A 1GMHF 5AFZH 1OYQA 2ZDNA 1HGTH 2Z6BD 1GDQA 1G3EA 3I29A 1YBWA 3MU0A 1EPTA 5E0GA 4UONA 2GCHF 2PR3A 3KQEA 3SV6A 3N7OA 5HMAA 5C20A 1ETRH 4OS7A 3RXLA 3SU6A 2SGPE 2QC2A 2WV4A 1SVPA 1PQ5A 5A0CA 1EAXA 5A8XA 3PWCA 5GJ4B 1WYKA 1SFIA 1QHRB 1GPZA 1HIAB 3T5FH 4CBOA 4CHAB 2OBOA 2ZNKH 1GBBA 3S9CA 1HAXB 3MYWA 4CRFA 2HPQH 3BTQE 1MCVA 3LGUA 3BIVH 1S84A 1O2MA 1O3FA 4TPYA 3BIUH 1BMLA 3VGCC 2Z9KA 3MU1A 1KLTA 1HFDA 1NY22 3D23A 1YPHC 2BDGA 2HPPH 2PSYA 2VVCA 1CA8B 2G52A 5ESBA 3JZ1B 3SJ9A 3C1KA 3SV7A 3JZ2B 2NU3E 3TNSA 1GHAF 2WPKS 1A0HB 1ETTH 2TIOA 2ZHQH 1YPKH 3GYMA 4ZHMU 3AAUA 1K1LA 3FVFB 3BTHE 4ZHAA 1JMOH 1HJAB 1SGTA 1Q31A 5C1XA 1HJ9A 1C2FA 1PFXC 3T28A 3RC6A 3ZZ7A 4O3UA 4ABIA 1TABE 1O2LA 1VCWA 6CHAC 5DP3A 5FX5A 1UTQA 2ASUB 4FUDA 1EQ9A 3UPEA 5AF9H 2R3YA 5J4QA 3ATWA 1O5FH 3P8FA 1BTXA 4J1YA 5DPAA 2ZTZA 1YKTA 1NS3A 3UUZA 1JIMA 2Z3CA 1JIRA 1FY5A 2JETB 1MAYA 3MU5A 1EZUC 3KGPA 4UEHH 3ZVFA 1O30A 1GHBF 2G00A 2ULLA 4FVBA 5C2ZA 1G32B 1O37A 3ZZBA 3T62A 2CXVA 2WPJS 3DUXH 2V35A 3QGNB 2O8LA 2FI5E 2LNCA 1L1GA 1C5OH 1FIWA 2FP7B 1FQ3A 2A4QA 3EA8A 3GY4A 4MG3A 4BAKB 3TJUA 4I8JA 1O2VA 1C2GA 3LH1A 1DITH 1BIOA 3FP8E 3PMHB 5CHAB 1J17T 1O3NA 3DA9B 5BPEA 5L2YH 1GBLA 2OC7A 3D65E 4ISOA 2AS9A 2D8WA 1FLEE 3L6PA 4X8TH 4ABHA 3OX7U 2ANMH 1YGCH 4DJZB 2R3UA 1GBKA 1GMDF 2SGAA 1C5LH 2A5AA 3E8LA 5G4BA 3VEQB 4BAMB 4K69A 1XX9A 3A87A 3M3SA 3EA7A 3FP7E 1KXAA 1HAPH 1YLCA 4AG2A 4ZUHA 1THSH 1J14A 3GY5A 1GBTA 3TJVA 3M7QA 3UIRA 2DE9A 5FX6A 3QWCH 1AWFH 2W26A 1MH0A 1Y8TA 1NU9A 1RFNA 4BNRA 1BDAA 3W94A 2A32A 1W2KH 3A7YA 1NRNH 3RXOA 3SOSA 3O8DA 5JBTA 3UQOA 1U6QA 3A86A 4NIVA 4Y6DA 2OD3B 4XBDA 3MH6A 3BTME 3SGQE 2QV1A 2UUYA 1EPTC 3RXKA 4YM9A 3BEUA 3UOUA 2FLBH 1TGCA 4I8HA 2CGAA 2A7HA 4X0WU 2ZHEH 4BTUB 1XKBC 3K6ZA 4E06H 1C5SA 3STJA 1WTHD 1V2OT 3RXJA 3L33A 1TE0A 3VB7A 1ZZZA 4I33A 3A7ZA 4DCDA 4FUHA 2VU8E 1Y3UA 1WTGH 3MH4A 1WAYB 3TGJE 2GMTC 2QY0B 3TVJB 4K1TA 1GMHG 5LPEA 1FI8A 1NN6A 1NO9H 2ZECA 3TU7H 1N6YA 2R2WU 2ZQ1A 4GHTA 5JB8S 1DUEA 1EP6A 2EI6A 3RXUA 1MU6B 4NSVA 2GCHG 1TMUH 4CR9A 3A84A 1ARBA 3KN2A 1TFXA 2BX4A 1DDJA 2ILNA 2PUQH 5ABWA 3A7XA 3T2NA 1DWBH 1C1QA 3BV9B 1T8OA 1H9HE 4VGCB 3BTEE 1LVYA 1VZQH 3V0XA 1UMAH 4JYTA 2SNWA 4Z0KA 4IW4E 3RXQA 5EXNA 1O2JA 1FJSA 1P09A 1HRTH 1P2QA 3MU8A 4CRCA 2Z3DA 3D49H 3NK8A 2CHAB 4KTSA 1HAGE 1O3JA 2RA0A 3KHVA 2QXJA 1O3OA 3B23B 5EW2H 1P2MA 2BVRH 2AIPA 3S9BA 1HAIH 1GHAG 1O2YA 2VWLA 4AOQA 2EC9H 2FOGA 1SC8U 1C9PA 1GMCF 1PPFE 1P2OA 4Q2KA 1ZLRA 2P94A 5IYTA 2FEQH 2CJIA 1WOFA 3RXGA 2GX4A 1DPOA 3K65B 3URCA 1ZTKA 3ENSB 1AFQB 1VJ9U 2ZTXA 2ZIQH 1ZPBA 1OOKB 2G51A 1SGDE 2GGVB 3Q76A 4OS5A 2FO9A 2BLOA 2CV3A 3QZRA 1YPEH 2BD5A 3KQCA 4UFGH 2C3SA 1ABIH 4CR5A 1FY3A 1SG8B 5ETXA 2GZ7A 4IC5A 3GCHB
chains in the Genus database with same CATH superfamily
1VR1H 4JMYA 1TQ7B 4OS2A 3LT3A 4F4OC 1GHBG 1QURH 2B8OH 3TH4H 4D9QA 4ABEA 1BHXF 4DIHH 1CHGA 2HLDD 1CBWB 1CHOF 3T29A 4DG4A 1P04A 4HGCA 2A7JA 2ALPA 1EP5A 1O2KA 3P8NA 5JDUB 1LPZB 2PP6A 2G4UA 2FESH 3FANA 2BLVA 2PV9B 2W3IA 3A7VA 3TH3H 4ZCNA 2V3MA 4MNXA 1UJ1A 3KQBA 2EEKA 5F8TA 4Y10E 4ZKRU 1ZRBA 3VB5A 1A7SA 1D3QB 1ELDE 1DXPA 2DUCA 4F55A 1IQHA 4HFPB 1FN8A 2H9TH 1VJAU 1KXEA 1ZHRA 1OWEA 1C1VH 1SL3A 3RXPA 2LP6A 1WQVH 2UWPA 4MNYA 5FCKA 2AEIH 1MZAA 1ELAA 1V3XA 4H42U 1MABB 1ZPCA 3UWJH 1B0EA 1EB1H 1TPSA 3E6PH 2XC4A 3STIA 2YNAA 4RKOB 2VIQA 1DWDH 1ZYOA 5ESTE 5TCCA 4INHA 3ZVEA 3M5MA 1S82A 3BF6H 4RT1A 5HIZA 2G8TA 8ESTE 1Z1IA 1W7GH 1WBGB 1CT4E 5TJXA 3P8GA 1GCDA 1GGDC 2KCYA 3A8AA 1ZHPA 3OEHD 2ZU1A 1GBCA 4GPGA 2BDAA 4K1EA 3ZZCA 1OX1A 1O5BB 1MD7A 8GCHF 4X2XA 2XNDD 2FZZA 4B1TA 1EZSC 5L30H 1LHCH 1QY6A 2BB4A 4KTUA 2ZTYA 2G55A 2GV6A 1C4U2 1UHBA 1ZR0A 4YLQH 1GJCB 2C93B 2GKVE 3VXEH 3SNDA 4FU8A 5CE1A 2OXSA 1OS8A 2HVYB 5EODA 1EFRD 2ZA5A 3H5CB 2ZF0H 2QXHA 3M3VA 1QB6A 5C67A 2QF0A 1ANBA 1GBAA 1EOJA 1O2PA 4YOJA 1C5PA 2STBE 2O9QA 3M35A 1DUAA 2WYJA 6ESTA 4Z6AH 1S6HA 1IQKA 1P12E 4RN6A 2A4RA 2NU2E 3ODDA 1YPLH 4BAHB 1KXBA 2VIWA 4CRAA 1MQ6A 3KYGA 2C90B 1T8MA 4MTBA 5I46H 3RMNH 1ZSJA 4YOGA 3LONA 2GCTB 1W0YH 2V7QD 2F9PA 3IWMA 3NPSA 1O2XA 4Q80A 1PPZA 3A8BA 3K6YA 4THNH 4U01A 5DP7A 2ZU2A 1UTOA 4BXSA 2AGIX 1ELEE 5C5NA 2ODPA 3SV9A 3PRBA 1Z8JB 3PROA 1GI7B 3P17H 1P05A 4GLYA 3TPIZ 1O0DH 4ABGA 2J5UA 5C0TA 1GVKB 4GSOA 2RCEA 1QRWA 1K1JA 1ELCA 2ZKSA 4LZ4B 1TQ0B 1GMCG 4KP0A 4IC6A 4WY3A 2Z9GA 2VIDA 1FY1A 1O5GH 2L74A 4K2YA 1GDNA 4X1QU 1ZMJA 4YZUA 5DP5A 4FUEA 1LKAA 3ZIAD 1J9CH 4A92A 2P16A 3FOAA 4NA8A 1G2MA 2Z7FE 2PLXA 3UOPA 1O2OA 2TPIZ 3A80A 4I31A 1XUIA 9ESTA 3DFJA 2ZWLH 4YOIA 2Y80A 1MKXK 1A3BH 3OSYA 1QB1A 1Z7KA 3MO3A 1SBWA 2SFAA 3NKKA 1BMNH 3RXAA 3TNTA 4Y0YE 3PLKA 2GTBA 3AW1A 4Y76A 2BY8X 3QUMP 1Z6JH 1CHOG 9LPRA 4AX9H 3PO1C 3SI4H 1Q3XA 1YCPK 3I78A 2Y5FA 3N7DA 2BD2A 4JZFH 1H1BA 1GJ4H 1NRPH 1T8LA 1Y5UT 2QN5T 3SO3A 2BX3A 3EYDA 5A09A 1KLIH 2KAIB 3RXHA 3ZVAA 1CT2E 1C5TA 2CMYA 3LDXH 1K0HA 3M7UA 2PGQB 4CH2B 2R0LA 3HK3B 1EASA 1RJXB 1RXPA 1MTVA 1BTYA 1OKXA 1ZMLA 4Q63A 1LO6A 1HIAA 2SGQE 1L0ZA 1AUJA 1L4ZA 1BB0B 1XVMA 3TLOA 4ZXXH 2VVUA 5E8EH 3IG6B 2QF4A 5DG6A 1MAXA 2Y7ZA 4NFEA 1O3GA 3HGPA 3Q3KA 2KM0A 3GS9A 4XFQA 4ZKNU 3RMLH 1TNJA 4NIXA 3HATH 3PB1E 4Y79A 2BY5X 2VINA 2OK5A 3TK9A 3ATKA 3SUGA 3A83A 5HM9A 5GIBA 1V2VT 4CRDA 1PQ8A 1C9TA 2Y6TA 4B75A 3BTTE 5EXMA 2F9UA 4ISIH 2VH0A 3URDA 2ZGJA 2FDAA 2OCVB 2FODA 4MPUA 2QXGA 1SLUB 3PWBA 3SI3H 1S0QA 3NZIA 1O3CA 8GCHG 4TWWA 4YT6H 1P10A 2IJD1 2WPDD 2YMSD 3NWUA 1W0ZU 1DT2A 3G01A 1OHHD 2ZFFH 4B6EA 3UNSA 3A8DA 2YMSC 3FFGA 3LH3A 2XBYA 3MO9A 2GT7A 3RXSA 1Z8IB 4OS1A 3AW0A 3M36A 1W3CA 3GDVA 3QZQA 4ABFA 2Z3EA 2P8OC 1MD8A 4Y7AA 1UO6A 3BG8A 1KXDA 2BVSH 2GP9B 5PTPA 1S81A 4I7YH 2WV5A 5CDFE 1ANCA 1FDPA 4NFFA 1O3LA 1G3DA 1E79D 1NM6A 4O03A 1COWD 1XKAC 2V6NA 1BQYA 3RXMA 2XOKD 3NCLA 3SHCH 4DIIH 1HJ8A 1O3MA 2ZU3A 1HYLA 1BMMH 2F91A 2FYQA 4HTCH 3WW7A 1BBRK 1GI0A 3LPRA 3QDZB 1HXEH 1ESAA 2VIOA 2FMJA 2IPHA 2VIVA 4X1RU 3SNBA 1N8OB 1O33A 2OC8A 1NU7B 3VXFH 3WWFA 5EPYA 1P0SH 4WJG2 1BTHH 4INKA 3TJOA 5T3HA 2F43B 1TA6A 2BD7A 1DSUA 1KYNA 4FOUC 3UWIA 1EAIA 2XXLA 2QIQA 1MKXH 2QCYA 1GG6B 2ZI2H 4BTTB 3P6ZB 2ZGHA 3GY7A 4B2CA 4ISLA 5FPSA 1LHDH 1K1OA 2M5TA 4ZH8A 5EU8A 3LU9B 1Q2WA 1SHYA 1Y3XA 3SJOA 1GJAB 2WINI 1TPAE 2HVXA 1K1NA 2XBWA 1HUTH 4I8GA 3BTGE 4NGAH 2SGFE 3GOVB 3RXVA 3NUMA 3F0PA 4JCNA 3KEEA 2O8UA 1P2NA 4MPVA 3RU4T 1A46H 1SMFE 2A31A 2IN2A 3RXTA 4X2WA 4XOJA 3U1IB 4X1SU 2ZU4A 1UVUH 2RDLA 4B74A 1FMGA 4WVPE 1H9IE 1EPTB 1DY9A 2UUJB 1P9SA 3LGVA 1NRRH 1YY3A 3A85A 1KTTB 2XYAA 4MNWA 1O2UA 1SGCA 1AVXA 2ZDMA 4CHAC 2XTTB 2GVFA 4M9FA 1C2DA 4ISNA 1EOLA 1DLKB 3L3TA 2A7CA 2FWWA 4AN7A 3LKWA 2XBVA 1ZHMA 3GYLB 1KXCA 1QL7A 1S6FA 3F2FA 3GCTF 3BEIB 3QGJA 1DY8A 1V2JT 1UVOA 1ACBE 5DP9A 4A6LA 2ANYA 2ZFQH 2QXIA 1GHYH 1HDTH 3FN8A 4IMQA 4NSYA 5EOKA 4U30A 3VB3A 1THPB 1UTNA 2ZCHP 4X8VH 1YPHE 1K2I1 4ABDA 3GY2A 1KLJH 2PTNA 3T27A 5C3NA 4LXBH 2XCNA 2WPMS 2TGDA 1HJAC 3UR9A 1P8VC 2BQ7B 1K22H 3EAJA 2QYIA 3TH2H 3SU5A 1KIGH 2J94A 2GT8A 1ANEA 1FONA 1CE5A 5K7RA 2BQ6B 2KCAA 2NWNA 3UR6A 4NA7A 1QTFA 1QJ7B 2AHME 1P2JA 3A7WA 1UTLM 1KY9A 1NZQH 1P2KA 3SV8A 4JZEH 1DLEA 5J4SA 2JJ2D 1F2SE 2UWLA 2BYAX 2XC5A 2UUKB 4ZKSU 2PKAB 3U8OH 1AWHB 2GD4B 2WYGA 2HOBA 1HLTH 1EZXC 1ELFA 2JETC 4XE4A 1J16A 2SGEE 4Y11E 1O2IA 4CH8B 1GJDB 1C2LA 1HAOH 3MNBA 2FOAA 2ZHWH 3PTNA 3UREA 3WWBA 1D4PB 5DJ7A 1G3CA 1PPGE 2ZPSA 1SR5C 4ABBA 3LGTA 1AFEH 5GWZA 2XNIA 5L2ZH 1NRSH 2XBXA 1HAVA 1O5CB 5HKKD 1ELGA 4K60A 1O36A 1O2ZA 2AMDA 1W0KD 1LKBA 2Z9JA 5EGMA 1UTKA 1TONA 5CHAC 1AB9C 1RTKA 5C1UA 3F1SB 3HK6B 2FM2A 3OFND 1O2SA 3A89A 1GJ5H 3ZZ9A 1RGQA 3RMOH 8KME2 1NT1A 2HNTF 1PPCE 2FS9A 5GNDA 4NZLA 2HALA 4Y8YA 3FKSD 1VGCC 3ZVBA 1NBMD 2M2AA 1C2HA 1AY6H 3TK5A 1O5EH 1TIOA 2EI7A 6GCHF 2AYWA 2FTLE 1LMWB 2FTMA 5C17A 3E91A 2BHGA 1FN6A 2EQNA 2H1UA 1EXFA 1HAZB 1AQ7A 1D6WA 1O38A 2ZHFH 3SU0A 3W95A 1TBZH 4AORA 2O8TA 2K0QA 3EE7A 1BZXE 4FUIA 4DGJA 4MPXA 1F5KU 3TK6A 1BUIA 1UVTH 1RTLA 1OWDA 5T6GA 3S7KB 2ANWA 4ZHLU 3HPTB 1QQUA 1C2EA 1CGJE 2NU0E 4SGBE 1DS2E 2XC0A 1TYNA 3MTYA 1P06A 1SQTA 1GI6A 4FUGA 1AVGH 4AYYB 3H7OA 1H8HD 2ZPQA 3A8CA 1AZ8A 3QTOH 2KZ4A 1OWJA 1C5UA 1YPMH 4KELA 3SORA 1O2NA 1ELVA 4NA9H 1SGFG 3TIUA 1UCYK 1O32A 3RLWH 2BMGB 3F2HA 1B0FA 3SU2A 4IBLH 3F9EA 3HKJB 2PSXA 4BAQB 4ZROA 4YXWD 1GBDA 5GDSH 3RMMH 1H8DH 2J97A 1YPGH 3LGIA 1IAUA 2PGBB 3CP7A 3ELAH 2KCPA 3V3MA 4B71A 4X6NA 3UTUH 2ZZUH 3RUOA 4I8LA 2QA9E 1ORFA 3M5OA 5DKMA 3ZYDA 2H9HA 1HB0B 4VGCC 1VITH 4AFQA 2JJ1D 1MMJN 1QRZA 2FYRA 1SLXB 1PPEE 4AFSA 4B73A 3MO6A 4TWYA 2AGEX 3U98H 2A45B 3OTJE 2F3CE 4A1XA 4AG1A 4FU7A 1V2PT 1A5HA 1BOQA 2Q6DA 1PYTD 2YOLA 2ZGBH 2KCOA 2WPLS 4U32A 5F8ZA 5I25A 1GL1A 1FV9A 2Z9IA 3UY9A 4DURA 4HZHA 1GMDG 1PYTC 2OTVA 5T6FA 4ZMAH 2D1JA 1GI3A 1NBME 1AKSB 3ZZ5A 2UWOA 1NESE 5DGJA 3Q3YA 3GDSA 1TNIA 2VB0A 1UTJA 1IQNA 2AH4X 1RTFB 1TBRH 1KTSB 3BSQA 2WHXA 1XUFA 3PM3A 1LVBA 3SW2B 4FU9A 5EQQA 4JK6A 1SGRE 1C2KA 1AE5A 1YF4A 3MHWU 1C1PA 1GI2A 1AD8H 1K28D 1BT7A 1AFQC 1G9IE 4AB9A 5F53A 3QX5H 1SFQB 2J98A 3KQ5A 4D7FA 1L4DA 1XXDA 2P93A 3P92A 2DE8A 4FUJA 5A0BA 3OTPA 5LPRA 1TA2A 3F9GA 1A1RA 4F48B 2VIPA 4RI0A 2VVVA 3RDZA 1MQ5A 4XBCA 4JK5A 3ZV8A 4JYUH 1TOCB 1A0JA 4K3JA 5EIYA 2GZ9A 3GCHC 2VNTA 4E05H 4AFZA 4XDEA 5EJ1A 2OQUA 3N99A 3QLPH 1CBWC 1DX5M 1TMBH 5B6OA 5EXLA 1OXGA 1RIWB 3D62A 3SU4A 3R0FA 2Z9LA 4UD9H 2BD9A 1THRH 1NFWA 2F83A 1E36B 2BLQA 2TRMA 1Y3WA 2VWNA 2BY9X 2XW9A 1L1NA 3GY6A 1KDQB 3LC3A 2BDBA 1UVSH 5AHGH 1AUTC 1JOUB 4NIYA 1BRAA 3N7EA 1BBRE 2QF5A 3U8RH 3LJJA 2STAE 3E0PB 1JXPA 2JKHA 1CVWH 4X6PA 2WUBA 4X6MA 2R9PA 3NRLA 3OY6U 4ABAA 3FZZA 5EPNA 1UK2A 1Z1JA 2R2MB 1NROH 2KAIA 1YWUA 5CHBA 1F0UA 2JH0D 4TY6A 1AIXH 5FXLA 1EX3A 3I77A 2QGRA 4AGKA 1GHZA 1LDTT 1C1MA 3GY3A 1GCTB 1C5MD 1DSTA 1W7XH 3BG4B 5FHTA 1Y5BT 1Y5AT 3SQEE 3CENA 5A2MH 4O9VA 1O2HA 4A5TS 3EGKH 5JPMH 3UNQA 2ESTE 2SGDE 1FIZA 3S7HB 4INLA 2PKSB 1IQJA 2THFB 1O5AB 1SLVB 2P3UB 1BTZA 1QNJA 3CS7A 3VPKA 4LZ1H 3RXRA 1SGPE 2A5IA 2FI3E 1LCYA 3V13A 1A0LA 3Q77A 5EG4A 3OY5U 3OE7D 1T4UH 1BMAA 2D2DA 5FPYA 2J34A 1LTOA 4CRBA 1XXFA 1VCQA 3VG8A 4NG9H 5A0AE 1FX0B 1OPHB 2P95A 3RP2A 3PMAB 3OAAD 1UHBB 2VGCB 4BAOB 1F5RA 1GJ6A 1XUJA 1IHSH 1V2QT 2A0QB 1O3AA 4AZ2B 1AO5A 1P01A 5LGOA 3F9HA 4JZIA 1DOJA 3EDXB 3MI4A 5T6DA 3RXCA 1OWHA 1QA7A 4ISHH 1IQGA 3DFLA 2HGTH 3M7TA 1TNLA 1DFPA 1DVAH 3M61U 1CA0B 4LK4A 5HM2A 4FVDA 2GCTC 2VWOA 4YESB 3Q3XA 1SI5H 3SV2H 4ZKOU 3MNXA 1MTNC 1H4WA 2XRCA 4Q4LA 3UQVA 1K1IA 4B76A 6LPRA 1ZRKA 1C5NH 4E7NA 4BANB 2H5DA 4AB8A 1OWKA 1DWEH 1HAYB 2BXTH 2TGPZ 5DP4A 4H6TA 3RU4D 2FX4A 1UTMA 4MNVA 4PROA 5DK1A 4IMZA 1ESBA 2Q6FA 4DY7B 1CO7E 2ZFSA 1FXYA 1EAWA 1HV7A 1D3TB 2A5KA 1GVLA 1T31A 2ZG0H 2GDEH 3MH7A 4D9RA 1AE8H 3UNRA 3ODFA 1O3KA 1GVZA 5HXFA 5C5OA 1QBNA 2LPRA 1FPCH 3EA9A 1Y3VA 2FS8A 3QO6A 1TRYA 3VGCB 1RRKA 1EZQA 4UDWH 5HGGA 2BY6X 1S5SA 3DSOA 1LHEH 2JIZD 4FUBA 3K9XB 2OLGA 1GJ9B 1WUNH 4Y8ZA 2AFQB 5DP6A 1BTPA 1XM1A 3GICB 1ZJDA 3SZEA 1C4Y2 3S69A 1W8BH 4NZQA 1J8AA 4B6FA 2H9EH 5F03A 1WU1A 1AVWA 1NFYA 1TBQH 1V2TT 1FNIA 4TPIZ 1SPJA 1QJ6B 3M5LA 1E37B 4WF8A 2F9NA 3H09A 3KL6A 6CHAB 4I86A 1XUGA 1WXRA 1P3EA 5F8XA 4K8BA 1FY8E 1YPJH 1AMHA 1O34A 4JYVH 3UFAA 1QIXB 2J9NA 1S85A 3SNCA 1G3BA 1IQEA 4KTCA 3UAIC 4X1PU 1V2MT 1V2LT 3R3GB 4A1TA 2C4FH 1V2UT 1S6LA 3ITIA 4J2YB 4HI3A 1GDUA 5BRRE 2GJGA 1HBTH 2JH6D 4WXVA 1OSSA 2GZ8A 2ZFTA 3A81A 2A1DB 3KF2A 1ID5H 1D6RA 2AIQA 2BDIA 3CS0A 3OU0A 3E16B 4A7IB 4XBBA 4OM9A 3RC5A 2NU4E 2F4LA 2KR7A 1C2IA 2PHBA 2EI8A 4Y8XA 3SU3A 1QJ1B 1BITA 1LHGH 1C1OA 2ODQA 5C1YA 4MLFB 3RU4E 1TNKA 3QN7A 1O2GH 4JZDH 1LPKB 1O3HA 1QL9A 3SGBE 4OGYA 2ANKH 5FCRA 1OP0A 4YO9A 5FAHA 2BD3A 1DICA 1TB6H 1EATA 1UCYE 2FIRH 2XWAA 1GI9B 1O3BA 1NPMA 4ESTE 2RDEA 2KFWA 3TITA 3KCGH 4H4FA 2ZFRH 4MPWA 1MTUA 2FLRH 3BTKE 1S83A 1C1WH 1O3PB 3ATIA 2L6OA 1O5DH 1TPOA 3MNSA 3ATMA 4IGDA 3SUDA 4OGXA 1DWCH 1ZJKA 4KKDA 1LVOA 1YCPH 2FOHA 3ZV9A 1OP8A 4LOYH 2H2ZA 1E1RD 4WXIA 1C5RA 1SGNE 2OINA 2W6ID 1CQQA 1O3EA 2ZCKP 3WY8A 2PKAA 4GVUA 1D9IA 3PLBA 2BM2A 4R0IA 4D7GA 4Y71A 1SGFA 1Z8RA 2ZHDA 3O8CA 3FZDA 2C8YB 3LC5A 3ZVCA 2CN0H 1JBUH 3KNXA 1ZSKA 1HPGA 3MH5A 2ZFPH 3FO8D 5JYIA 1UVPA 1A61H 1MTSA 4M7GA 1DXWA 2TGAA 3CNRA 4Q7YA 1A5GH 3O8RA 3S9AA 4RKJB 1MBMA 1P2IA 3ZZ8A 1G2LA 4BXWA 3RXBA 3A7TA 2XWBI 3F3BA 4WMDA 1Y59T 2GMTB 1C1TA 5JBBS 2ZP0H 4AGJA 2HLCA 4Y0ZE 2QAAA 3MWIU 3QTVH 1BRBE 2AMPA 2PFEA 4GUXA 3TGIE 1N8OC 1LVMA 1AB9B 4YT7H 1GHVH 2WPHS 4XSKU 4NWKA 1TGSZ 1BRUP 4K1SA 2BDCA 1LQDB 1O3IA 2FOCA 2WPIS 5L6NH 3SHAH 1KSNA 1A5IA 1T8NA 2V3OH 1GG6C 1BCUH 1CGIE 5H4IB 4QT8C 1ZTJA 2H6MA 1XUHA 1O35A 1EJNA 4O97A 1VGCB 1WQSA 1PQ7A 1OYTH 3M37A 4Q7XA 4NWLA 1KMHB 3B9FH 1K1MA 1MU8B 2B5TB 4DVAU 1ARCA 1C4V2 2BZ6H 3ESTA 2FI4E 5AFYH 4CBNA 2IOTA 1GJBB 1H9LB 3DHKH 1RD3B 3SJIA 3RXIA 4TSFD 1O2QA 2HWLB 1F0RA 3F6UH 3M5NA 2BDYA 3MFJA 3RC4A 2ODYB 1CSOE 2BZAA 7GCHF 1DE7H 1WCZA 2HRVA 3RM0H 5GXPA 3Q00A 2A4OA 1CGHA 1SLWB 1F5LA 5E0HA 1O3DA 1A3EH 1TALA 3PRDA 1AHTH 3LIWA 1C5XB 4UFEH 5EW1H 1C2JA 4GHQA 4X8UH 5IK2D 1CT0E 2XCFA 1AI8H 1K9OE 3RM2H 3GCOA 3ZZ3A 2Q6GA 2BLWA 1C1UH 2FPZA 1TRMA 1F92A 1M9UA 1Z8GA 2W7SA 3AK5A 1AZZA 3ZVDA 4E7RG 4OS4A 5DN6D 1A2CH 3MU4A 1BBRH 4D8NA 3BEFB 1EUFA 1ESTA 3SNAA 3ZZDA 3SUEA 3V7TA 3LOXA 2CK3D 2WZQA 1F7ZA 3SYJA 1GI5A 4X8SH 3SNEA 1J15A 1QR3E 4X1NU 2EA3A 3RLYH 1TMTH 5E2OA 2YNBA 1XMNB 4WMEA 2ZDKA 1AU8A 1P9UA 1T4VH 3PLPA 1C1SA 3F9FA 5DP8A 3P95A 1TGTA 3ATLA 1GHWH 1TGBA 1VITF 4WWYA 1OWIA 2D26C 3MNCA 7LPRA 1ZTLA 1ELTA 1AKSA 5HIYA 1G36A 3SUFA 1WV7H 1TGNA 3GY8A 3NXPA 4XRNA 1E1QD 4FUCA 1P03A 1FPHH 4HG6A 3SQHE 3V12A 4JZ1A 4ZXYH 3F2GA 2B0FA 1NFXA 1W11U 1W14U 2FX6A 5JBAS 3BTWE 5F6MA 5DO4H 1HAHH 1ZOMA 1YYY1 3DCLA 4IS5A 1TNHA 2RG3A 1D3DB 8LPRA 2J95A 2Q1JA 4BTIB 2ZU5A 3ZZ6A 4ABJA 5GPIB 1TX8A 2UUFB 1HNEE 2A2QH 3S0NA 2G5VA 1YLDA 2BDHA 1BA8B 2OC1A 1GGDB 3KIDU 1INCA 1C5WB 2ZO3H 4IN1A 1HAVB 5GCHF 1PQAA 1C1NA 2ZDAH 4KGAA 1GBFA 1H8ED 2RFKC 2RA3A 5AVDA 1JRTA 1MTWA 3BTDE 3MOCA 2J2UA 1FZZA 2O8WA 1TX7A 1Z6EA 1NFUA 2K8IA 1GBHA 3E0NB 1W13U 2CF9H 2ZPRA 4GCHF 1EJMA 3SN8A 1X7AC 3B8JA 2QF3A 2ZCLP 1F0TA 1YLNA 2CHAC 2BTCE 3GCTG 1K1PA 1ZSLA 3K2UA 2BVXH 1EB2A 1KDQA 3U69H 4BOHA 1DM4B 4K8YA 1PPHE 1V6DA 4UFFH 2FOFA 3FAOA 4SGAE 1TPPA 1SSXA 2P3TB 3LGWA 3SGAE 2J4IA 2PWXA 3AAVA 4X6OA 3F68H 1GI1A 2SNVA 1E34B 1A4WH 1E0FD 1YCPM 2AGGX 1GL0E 1MKWK 1C5QA 3H7TA 5CMXH 3E3TA 1QB9A 2W7UA 3QK1A 2BQWB 7KMEH 1YC0A 5JBCS 1GBEA 2AMQA 5LPFA 5K0HA 5A8YA 1P57B 1VCPA 3ZVGA 1QQ4A 5C94A 4D76A 3A82A 1SOZA 2K1QA 1MCTA 3OYPA 5E0JA 2ZDLA 1SQAA 5EQSA 1GJ7B 2V0BA 3FP6E 1IQLA 4AYVB 5B6LA 2VWMA 4R8TB 1N1LA 2R0KA 5FBEA 3U9AH 4AFUA 2ZC9H 1G37A 1IHTH 1CU1A 2H5CA 4WMFA 2Z94A 5KEDA 5IDKA 7GCHG 2ZQ2A 3SU1A 4WH6A 1AGJA 1H8IH 1O31A 2OP9A 2P59A 3SJ8A 1QBVH 3HKIB 3GCNA 1G30B 3BN9A 1ELBA 1LQEA 2JH5D 1NTPA 3SZNA 3HGNA 1K21H 1O2RA 2HNTC 1V2NT 3EQ0H 2Y82A 1BJUA 1SGYE 1SGQE 4NIWA 2OBQA 3P8OA 1L1JA 4B2BA 1ZGIA 4YTAA 1BHXB 4U2WA 1HCGA 1SB1H 2AERH 2Y81A 1V2WT 4MVNA 4B2AA 1C5VA 2G81E 3P70B 1P02A 1Y3YA 2F9OA 3OEED 1IQIA 1S0RA 2IJOB 4DW2U 2O8MA 4K5ZA 3PO1B 4FUFA 2B7DH 6GCHG 1JRSA 1BMFD 1ANDA 2PTCE 2ZEBA 4ASHA 1GWAA 1C5ZB 2BD4A 2FXRA 2TBSA 1MUEB 1V2RT 4RT0A 1V2ST 3U1JB 1D3PB 3RXEA 1QA0A 5A8ZA 1TAWA 4YLUA 1GBIA 1VITG 4IN2A 1MTNB 1TRNA 2BOKA 1UCYH 2I6SA 1SHHB 3RXFA 1GJ8B 1FAKH 3DT0H 2VH6A 4RSPA 2Y5GA 1QGFA 1FAXA 3MQKC 1QL8A 5SGAE 1FY4A 2J98B 1P3CA 4F49A 3TJNA 1SOTA 1XUKA 2P3FH 1UTPA 2OQ5A 3PMJA 4UE7H 4FXGH 4TT3D 3LJOA 2WUCA 3SJKA 1SKYE 1RS0A 1TWXB 2CF8H 3LGYA 4A1VA 1E35B 1W12U 4CRGA 1JWTA 1BTUA 5EQRA 1C5YB 3VFEA 3TGKE 4DOQA 1WSSH 3PYHA 1KXFA 3ZYEA 3EE0B 1SQOA 2Y5HA 1C1RA 3ZZ4A 1RIWC 3AVZA 3PMBB 3PTBA 3VB6A 2OC0A 2A2XH 4Q7ZA 5LH8A 5DSFA 4ZAEA 3C27B 4MQAA 1L2EA 2B9LA 1ABJH 3PV4A 1EAUA 1MZDA 1PJPA 1YP9A 3KQDA 2GDDA 1B5GH 1IQFA 2BD8A 2NU1E 3AASA 3E1XB 2V3HH 1DANH 4OS6A 5GCHG 3A88A 2HNTE 1OP2A 3RXDA 3DD2H 1B7XB 2ZGCA 2C8ZB 5JB9S 4CREA 4P02A 2BXUH 1YM0A 3M3TA 1NC6A 1ZGVA 1LPGB 1QCPA 3DSGA 1QFKH 2I6QA 1W10U 1NRQH 1LHFH 2J92A 2C8WB 2PW8H 3SBKA 4GCHG 4NCYA 7ESTE 1MKWH 4ACAA 3MMGA 2ZDVH 1PPBH 2YMSB 4X2VA 1QRXA 4I8KA 1IOEA 1SGEE 1GI8B 4WH8A 1O39A 4P00A 1O2TA 1W0JD 1AN1E 2FOBA 1ZMNA 2F9BH 1GCTC 2FOEA 1HXFH 4DT7B 1O2WA 2W3KA 1QBOA 1IQMA 3BG4C 2P8OB 5FL7D 4O3TA 4GAWA 1T32A 1EJAA 1BJVA 1C2MA 1P11E 4UFDH 5E2PA 2WSSD 1BRCE 1EKBB 2BY7X 2Y7XA 1ZPZA 3U8TH 2ZGXH 1E38B 1Z71A 2FOMB 1TLDA 2PKSC 1UK3A 3T25A 1TOMH 2VBCA 1UK4A 3GISB 2JDID 1N6XA 2W5EA 1XVOA 4I32A 1GBMA 2TGTA 2A4GA 4TYDA 5TCAA 5FPTA 2C8XB 2VJ1A 4TY7A 5HYOA 2VGCC 1UW7A 2BOHB 2G4TA 4H6SB 2PUXB 4MDSA 5KGOA 2ALVA 3GDUA 2OUAA 3IITA 3PV5A 3PV2A 1GBJA 1MBQA 2G5NA 1GI4A 4X2YA 1T7CA 3BTFE 1F0SA 2F9VA 1V2KT 2J38A 1SGIB 4DT4A 1FUJA 1CA0C 1BTWA 1ETSH 3O8BA 4Y7BA 3E90B 3T26A 3VB4A 1TNGA 2GV7A 3ZZAA 5FBIA 1GHXH 1TX6A 1GMHF 5AFZH 1OYQA 2ZDNA 1HGTH 2Z6BD 1GDQA 1G3EA 3I29A 1YBWA 3MU0A 1EPTA 5E0GA 4UONA 2GCHF 2PR3A 3KQEA 3SV6A 3N7OA 5HMAA 5C20A 1ETRH 4OS7A 3RXLA 3SU6A 2SGPE 2QC2A 2WV4A 1SVPA 1VKYA 1PQ5A 5A0CA 1EAXA 5A8XA 3PWCA 5GJ4B 1WYKA 1SFIA 1QHRB 1GPZA 1HIAB 3T5FH 4CBOA 4CHAB 2OBOA 2ZNKH 1GBBA 3S9CA 1HAXB 1SQRA 3MYWA 4CRFA 2HPQH 3BTQE 1MCVA 3LGUA 3BIVH 1S84A 1O2MA 1O3FA 4TPYA 3BIUH 1BMLA 3VGCC 2Z9KA 3MU1A 1KLTA 1HFDA 1NY22 3D23A 1YPHC 2BDGA 2HPPH 2PSYA 2VVCA 1CA8B 2G52A 5ESBA 3JZ1B 3SJ9A 3C1KA 3SV7A 3JZ2B 2NU3E 3TNSA 1GHAF 2WPKS 3U28C 1A0HB 1ETTH 2TIOA 2ZHQH 3UB0A 1YPKH 3GYMA 4ZHMU 2LELA 3AAUA 1K1LA 3FVFB 3BTHE 4ZHAA 1JMOH 1HJAB 1SGTA 1Q31A 5C1XA 1HJ9A 1C2FA 1PFXC 3T28A 3RC6A 3ZZ7A 4Z1MD 4O3UA 4ABIA 1TABE 1O2LA 1VCWA 2WV9A 6CHAC 5DP3A 5FX5A 1UTQA 2ASUB 4FUDA 1EQ9A 3UPEA 5AF9H 2R3YA 5J4QA 3ATWA 1O5FH 3P8FA 1BTXA 4J1YA 5DPAA 2ZTZA 1YKTA 1NS3A 3UUZA 2EY4C 1JIMA 2Z3CA 1JIRA 1FY5A 2JETB 1MAYA 3MU5A 1EZUC 3KGPA 4UEHH 3ZVFA 1O30A 1GHBF 2G00A 2ULLA 4FVBA 5C2ZA 1G32B 1O37A 3ZZBA 3F0OA 3T62A 2CXVA 2WPJS 3DUXH 2V35A 3QGNB 2O8LA 2FI5E 2LNCA 1L1GA 1C5OH 1FIWA 2FP7B 1FQ3A 2A4QA 3EA8A 3GY4A 4MG3A 4BAKB 3TJUA 4I8JA 1O2VA 1C2GA 3LH1A 1DITH 1BIOA 3FP8E 3PMHB 5CHAB 1WDIA 1J17T 1O3NA 3DA9B 5BPEA 5L2YH 1GBLA 2OC7A 3D65E 4ISOA 2AS9A 2D8WA 1FLEE 3L6PA 4X8TH 4ABHA 3OX7U 2ANMH 1YGCH 2KX4A 2IPQX 2R3UA 1GBKA 4DJZB 1GMDF 2SGAA 1C5LH 2A5AA 3E8LA 5G4BA 3VEQB 4BAMB 4K69A 1XX9A 3A87A 3M3SA 3EA7A 3FP7E 1KXAA 1HAPH 1YLCA 4AG2A 4ZUHA 1THSH 1J14A 3GY5A 1GBTA 3TJVA 3M7QA 3UIRA 2DE9A 5FX6A 3QWCH 3W1EA 1AWFH 2W26A 1MH0A 1Y8TA 1NU9A 1RFNA 4ASUD 4BNRA 1BDAA 3W94A 4ACBA 2A32A 1W2KH 3A7YA 1NRNH 3RXOA 3SOSA 3O8DA 4AC9A 3UQOA 1U6QA 3A86A 4NIVA 5JBTA 4Y6DA 2OD3B 4XBDA 3MH6A 3BTME 3SGQE 2QV1A 2UUYA 1EPTC 3RXKA 4YM9A 3BEUA 3UOUA 2FLBH 1TGCA 4I8HA 2CGAA 2A7HA 4X0WU 2ZHEH 4BTUB 2QE7D 1XKBC 3K6ZA 4E06H 1C5SA 3STJA 1WTHD 1V2OT 3RXJA 3L33A 4FETA 1TE0A 3VB7A 1ZZZA 4I33A 3A7ZA 4DCDA 4FUHA 2VU8E 1Y3UA 1WTGH 3MH4A 1WAYB 3TGJE 2GMTC 2QY0B 3TVJB 4K1TA 1GMHG 5LPEA 1FI8A 1NN6A 1NO9H 2ZECA 3TU7H 1N6YA 2R2WU 2ZQ1A 3KYFA 4GHTA 5JB8S 1DUEA 1EP6A 2EI6A 3RXUA 1MU6B 4NSVA 2GCHG 1TMUH 5EJLA 3A84A 1ARBA 4CR9A 3KN2A 1TFXA 2BX4A 1DDJA 2ILNA 2PUQH 5ABWA 3A7XA 3T2NA 1DWBH 1C1QA 3BV9B 1T8OA 5T1VA 3DSPA 1H9HE 4VGCB 3BTEE 1LVYA 1VZQH 3V0XA 1UMAH 4JYTA 2SNWA 4Z0KA 4IW4E 3RXQA 5C0UA 5EJZA 1QZ8A 5EXNA 1O2JA 1FJSA 1P09A 1HRTH 1P2QA 3MU8A 4CRCA 2Z3DA 3D49H 3NK8A 2CHAB 4KTSA 1HAGE 1O3JA 2RA0A 3KHVA 2QXJA 1O3OA 3B23B 5EW2H 1P2MA 2BVRH 2AIPA 3S9BA 1HAIH 1GHAG 1O2YA 2VWLA 4AOQA 2EC9H 2FOGA 4XD7D 1SC8U 1C9PA 1GMCF 1PPFE 2W6JD 1P2OA 4Q2KA 1ZLRA 2P94A 5IYTA 2FEQH 2CJIA 1WOFA 3RXGA 5KECA 2GX4A 1DPOA 3K65B 3URCA 1ZTKA 3ENSB 1AFQB 1VJ9U 2ZTXA 2ZIQH 1ZPBA 1OOKB 2G51A 1SGDE 2GGVB 3Q76A 4OS5A 2FO9A 2BLOA 2CV3A 3QZRA 1YPEH 2BD5A 3KQCA 4UFGH 2C3SA 1ABIH 4CR5A 1FY3A 1SG8B 5ETXA 2GZ7A 4IC5A 3GCHB
chains in the Genus database with same CATH topology
1VR1H 4JMYA 1TQ7B 4OS2A 3LT3A 4F4OC 1GHBG 1QURH 2B8OH 3TH4H 4D9QA 4ABEA 1BHXF 4DIHH 1CHGA 1CBWB 1CHOF 3T29A 4DG4A 1P04A 4HGCA 2A7JA 2ALPA 1EP5A 1O2KA 3P8NA 5JDUB 1LPZB 2G4UA 2FESH 3FANA 2BLVA 2PV9B 2W3IA 3A7VA 3TH3H 4MNXA 1UJ1A 3KQBA 2EEKA 5F8TA 4Y10E 4ZKRU 1ZRBA 3VB5A 1A7SA 1D3QB 1ELDE 1DXPA 2DUCA 1IQHA 4HFPB 1FN8A 2H9TH 1VJAU 1KXEA 1ZHRA 1OWEA 1C1VH 1SL3A 3RXPA 1WQVH 2UWPA 4MNYA 5FCKA 2AEIH 1MZAA 1ELAA 1V3XA 4H42U 1ZPCA 3UWJH 1B0EA 1EB1H 1TPSA 3E6PH 2XC4A 3STIA 2YNAA 4RKOB 2VIQA 1DWDH 1ZYOA 5ESTE 5TCCA 4INHA 3ZVEA 3M5MA 1S82A 3BF6H 2G8TA 8ESTE 1Z1IA 1W7GH 1WBGB 1CT4E 5TJXA 3P8GA 1GCDA 1GGDC 3A8AA 1ZHPA 2ZU1A 1GBCA 4GPGA 2BDAA 4K1EA 3ZZCA 1OX1A 1O5BB 1MD7A 8GCHF 4X2XA 2FZZA 4B1TA 1EZSC 5L30H 1LHCH 1QY6A 2BB4A 4KTUA 2ZTYA 2G55A 2GV6A 1C4U2 1UHBA 1ZR0A 4YLQH 1GJCB 2C93B 2GKVE 3VXEH 3SNDA 4FU8A 5CE1A 2OXSA 1OS8A 5EODA 2ZA5A 3H5CB 2ZF0H 2QXHA 3M3VA 1QB6A 5C67A 2QF0A 1GBAA 1ANBA 1EOJA 1O2PA 4YOJA 1C5PA 2STBE 2O9QA 3M35A 1DUAA 2WYJA 6ESTA 4Z6AH 1S6HA 1IQKA 1P12E 4RN6A 2A4RA 2NU2E 3ODDA 1YPLH 4BAHB 1KXBA 2VIWA 4CRAA 1MQ6A 5I46H 2C90B 1T8MA 4MTBA 3RMNH 1ZSJA 4YOGA 3LONA 2GCTB 1W0YH 2F9PA 3IWMA 3NPSA 1O2XA 4Q80A 1PPZA 3A8BA 3K6YA 4THNH 4U01A 5DP7A 2ZU2A 1UTOA 4BXSA 2AGIX 1ELEE 5C5NA 2ODPA 3SV9A 1Z8JB 3PROA 1GI7B 3P17H 1P05A 4GLYA 3TPIZ 1O0DH 4ABGA 1GVKB 4GSOA 2RCEA 1QRWA 1K1JA 1ELCA 2ZKSA 4LZ4B 1TQ0B 1GMCG 4KP0A 4IC6A 4WY3A 2Z9GA 2VIDA 1FY1A 1O5GH 4K2YA 1GDNA 4X1QU 1ZMJA 4YZUA 5DP5A 4FUEA 1LKAA 1J9CH 4A92A 2P16A 4NA8A 1G2MA 2Z7FE 2PLXA 3UOPA 1O2OA 2TPIZ 3A80A 4I31A 1XUIA 9ESTA 3DFJA 2ZWLH 4YOIA 2Y80A 1MKXK 1A3BH 3OSYA 1QB1A 1Z7KA 3MO3A 1SBWA 2SFAA 3NKKA 1BMNH 3RXAA 3TNTA 4Y0YE 3PLKA 2GTBA 3AW1A 4Y76A 2BY8X 3QUMP 1Z6JH 1CHOG 9LPRA 4AX9H 3PO1C 3SI4H 1Q3XA 1YCPK 3I78A 2Y5FA 2BD2A 4JZFH 1H1BA 1GJ4H 1NRPH 1T8LA 1Y5UT 2QN5T 3SO3A 2BX3A 3EYDA 5A09A 1KLIH 2KAIB 3RXHA 3ZVAA 1CT2E 1C5TA 2CMYA 3LDXH 3M7UA 2PGQB 4CH2B 2R0LA 3HK3B 1EASA 1RJXB 1RXPA 1MTVA 1BTYA 1OKXA 1ZMLA 1LO6A 1HIAA 2SGQE 1L0ZA 1AUJA 1L4ZA 1BB0B 1XVMA 3TLOA 4ZXXH 2VVUA 5E8EH 3IG6B 5DG6A 1MAXA 2Y7ZA 4NFEA 1O3GA 3HGPA 3Q3KA 4XFQA 4ZKNU 3RMLH 1TNJA 4NIXA 3HATH 3PB1E 4Y79A 2BY5X 2VINA 3TK9A 3ATKA 3SUGA 3A83A 5HM9A 5GIBA 1V2VT 4CRDA 1PQ8A 1C9TA 2Y6TA 4B75A 3BTTE 5EXMA 2F9UA 4ISIH 2VH0A 3URDA 2ZGJA 2FDAA 2OCVB 2FODA 4MPUA 2QXGA 1SLUB 3PWBA 3SI3H 1S0QA 3NZIA 1O3CA 8GCHG 4TWWA 4YT6H 1P10A 3NWUA 1W0ZU 1DT2A 3G01A 2ZFFH 3UNSA 3A8DA 3LH3A 3FFGA 3RXSA 2XBYA 3MO9A 2GT7A 1Z8IB 4OS1A 3AW0A 3M36A 1W3CA 3GDVA 3QZQA 4ABFA 2Z3EA 2P8OC 1MD8A 4Y7AA 1UO6A 3BG8A 1KXDA 2BVSH 2GP9B 5PTPA 1S81A 4I7YH 2WV5A 1ANCA 1FDPA 4NFFA 1O3LA 1G3DA 1NM6A 4O03A 1XKAC 2V6NA 1BQYA 3RXMA 3NCLA 3SHCH 4DIIH 1HJ8A 1O3MA 2ZU3A 1HYLA 1BMMH 2F91A 2FYQA 4HTCH 1BBRK 1GI0A 3LPRA 3QDZB 1HXEH 1ESAA 2VIOA 2FMJA 2IPHA 2VIVA 4X1RU 3SNBA 1N8OB 1O33A 2OC8A 1NU7B 3VXFH 5EPYA 1P0SH 4WJG2 1BTHH 4INKA 3TJOA 5T3HA 1TA6A 2BD7A 1DSUA 1KYNA 3UWIA 1EAIA 2XXLA 2QIQA 1MKXH 2QCYA 1GG6B 2ZI2H 4BTTB 3P6ZB 2ZGHA 3GY7A 4B2CA 4ISLA 5FPSA 1LHDH 1K1OA 2M5TA 4ZH8A 5EU8A 3LU9B 1Q2WA 1SHYA 1Y3XA 3SJOA 1GJAB 2WINI 1TPAE 2HVXA 1K1NA 2XBWA 1HUTH 4I8GA 3BTGE 4NGAH 2SGFE 3GOVB 3RXVA 3NUMA 4JCNA 3KEEA 2O8UA 1P2NA 4MPVA 3RU4T 1A46H 1SMFE 2A31A 2IN2A 3RXTA 4X2WA 4XOJA 3U1IB 4X1SU 2ZU4A 1UVUH 2RDLA 4B74A 1FMGA 4WVPE 1H9IE 1EPTB 1DY9A 2UUJB 1P9SA 3LGVA 1NRRH 3A85A 1KTTB 2XYAA 4MNWA 1O2UA 1SGCA 1AVXA 2ZDMA 4CHAC 2XTTB 2GVFA 1C2DA 4ISNA 1EOLA 1DLKB 3L3TA 2A7CA 2FWWA 4AN7A 3LKWA 2XBVA 1ZHMA 3GYLB 1KXCA 1QL7A 1S6FA 3GCTF 3BEIB 3QGJA 1DY8A 1V2JT 1UVOA 1ACBE 5DP9A 4A6LA 2ANYA 2ZFQH 2QXIA 1GHYH 1HDTH 4IMQA 4NSYA 5EOKA 4U30A 3VB3A 1THPB 1UTNA 2ZCHP 4X8VH 1YPHE 1K2I1 4ABDA 3GY2A 1KLJH 2PTNA 3T27A 5C3NA 4LXBH 2XCNA 2WPMS 2TGDA 1HJAC 3UR9A 1P8VC 2BQ7B 1K22H 3EAJA 2QYIA 3TH2H 3SU5A 1KIGH 2J94A 2GT8A 1ANEA 1FONA 1CE5A 5K7RA 2BQ6B 2NWNA 3UR6A 4NA7A 1QTFA 1QJ7B 1P2JA 3A7WA 1UTLM 1KY9A 1NZQH 1P2KA 3SV8A 4JZEH 1DLEA 5J4SA 1F2SE 2UWLA 2BYAX 2XC5A 2UUKB 4ZKSU 2PKAB 3U8OH 1AWHB 2GD4B 2WYGA 2HOBA 1HLTH 1EZXC 1ELFA 2JETC 4XE4A 1J16A 2SGEE 4Y11E 1O2IA 4CH8B 1GJDB 1C2LA 1HAOH 3MNBA 2FOAA 2ZHWH 3PTNA 3UREA 1D4PB 5DJ7A 1G3CA 1PPGE 2ZPSA 1SR5C 4ABBA 3LGTA 1AFEH 5GWZA 2XNIA 5L2ZH 1NRSH 2XBXA 1HAVA 1O5CB 1ELGA 4K60A 1O36A 1O2ZA 2AMDA 1LKBA 2Z9JA 5EGMA 1UTKA 1TONA 5CHAC 1AB9C 1RTKA 5C1UA 3F1SB 3HK6B 2FM2A 1O2SA 3A89A 1GJ5H 3ZZ9A 1RGQA 3RMOH 8KME2 1NT1A 2HNTF 1PPCE 2FS9A 4NZLA 2HALA 4Y8YA 1VGCC 3ZVBA 1C2HA 1AY6H 3TK5A 1O5EH 1TIOA 2EI7A 6GCHF 2AYWA 2FTLE 1LMWB 2FTMA 3E91A 2BHGA 1FN6A 2H1UA 1EXFA 1HAZB 1AQ7A 1D6WA 1O38A 2ZHFH 3SU0A 3W95A 1TBZH 4AORA 2O8TA 1BZXE 4FUIA 4DGJA 4MPXA 1F5KU 3TK6A 1BUIA 1UVTH 1RTLA 1OWDA 5T6GA 3S7KB 2ANWA 4ZHLU 3HPTB 1QQUA 1C2EA 1CGJE 2NU0E 4SGBE 1DS2E 2XC0A 1TYNA 3MTYA 1P06A 1SQTA 1GI6A 4FUGA 1AVGH 4AYYB 3H7OA 2ZPQA 3A8CA 1AZ8A 3QTOH 1OWJA 1C5UA 1YPMH 4KELA 3SORA 1O2NA 1ELVA 4NA9H 1SGFG 3TIUA 1UCYK 1O32A 3RLWH 2BMGB 1B0FA 3SU2A 4IBLH 3F9EA 3HKJB 2PSXA 4BAQB 4ZROA 1GBDA 5GDSH 3RMMH 1H8DH 1YPGH 3LGIA 1IAUA 2PGBB 3CP7A 3ELAH 3V3MA 4B71A 4X6NA 3UTUH 2ZZUH 3RUOA 4I8LA 2QA9E 1ORFA 3M5OA 5DKMA 3ZYDA 2H9HA 1HB0B 4VGCC 1VITH 4AFQA 1MMJN 1QRZA 2FYRA 1SLXB 1PPEE 4AFSA 4B73A 3MO6A 4TWYA 2AGEX 3U98H 2A45B 3OTJE 2F3CE 4A1XA 4AG1A 4FU7A 1V2PT 1A5HA 1BOQA 2Q6DA 1PYTD 2YOLA 2ZGBH 2WPLS 4U32A 5F8ZA 5I25A 1GL1A 1FV9A 2Z9IA 3UY9A 4DURA 4HZHA 1GMDG 1PYTC 2OTVA 5T6FA 4ZMAH 2D1JA 1GI3A 1AKSB 3ZZ5A 2UWOA 1NESE 5DGJA 3Q3YA 3GDSA 1TNIA 2VB0A 1UTJA 1IQNA 2AH4X 1RTFB 1TBRH 1KTSB 3BSQA 1XUFA 3PM3A 1LVBA 3SW2B 4FU9A 5EQQA 4JK6A 1SGRE 1C2KA 1AE5A 1YF4A 3MHWU 1C1PA 1GI2A 1AD8H 1K28D 1BT7A 1AFQC 1G9IE 4AB9A 3QX5H 1SFQB 4D7FA 1L4DA 1XXDA 2P93A 3P92A 2DE8A 4FUJA 5A0BA 5LPRA 1TA2A 3F9GA 1A1RA 2VIPA 2VVVA 3RDZA 1MQ5A 4XBCA 4JK5A 3ZV8A 4JYUH 1TOCB 1A0JA 4K3JA 2GZ9A 3GCHC 2VNTA 4E05H 4AFZA 4XDEA 2OQUA 3QLPH 1CBWC 1DX5M 1TMBH 5B6OA 5EXLA 1OXGA 1RIWB 3D62A 3SU4A 3R0FA 2Z9LA 4UD9H 2BD9A 1THRH 1NFWA 2F83A 1E36B 2BLQA 2TRMA 1Y3WA 2VWNA 2BY9X 2XW9A 1L1NA 3GY6A 1KDQB 3LC3A 2BDBA 1UVSH 5AHGH 1AUTC 1JOUB 4NIYA 1BRAA 1BBRE 3U8RH 3LJJA 2STAE 3E0PB 1JXPA 2JKHA 1CVWH 4X6PA 2WUBA 4X6MA 2R9PA 3OY6U 4ABAA 3FZZA 5EPNA 1UK2A 1Z1JA 2R2MB 1NROH 2KAIA 1F0UA 2JH0D 4TY6A 1AIXH 5FXLA 1EX3A 3I77A 2QGRA 4AGKA 1GHZA 1LDTT 1C1MA 3GY3A 1GCTB 1C5MD 1DSTA 1W7XH 3BG4B 5FHTA 1Y5BT 1Y5AT 3SQEE 3CENA 5A2MH 4O9VA 1O2HA 4A5TS 3EGKH 5JPMH 3UNQA 2ESTE 2SGDE 1FIZA 3S7HB 4INLA 2PKSB 1IQJA 2THFB 1O5AB 1SLVB 2P3UB 1BTZA 1QNJA 3CS7A 3VPKA 4LZ1H 3RXRA 1SGPE 2A5IA 2FI3E 1LCYA 3V13A 1A0LA 3Q77A 5EG4A 3OY5U 1T4UH 1BMAA 2D2DA 5FPYA 2J34A 1LTOA 4CRBA 1XXFA 1VCQA 4NG9H 5A0AE 1OPHB 2P95A 3RP2A 3PMAB 1UHBB 2VGCB 4BAOB 1F5RA 1GJ6A 1XUJA 1IHSH 1V2QT 2A0QB 1O3AA 4AZ2B 1AO5A 1P01A 5LGOA 3F9HA 4JZIA 1DOJA 3EDXB 3MI4A 5T6DA 3RXCA 1OWHA 1QA7A 4ISHH 1IQGA 3DFLA 2HGTH 3M7TA 1TNLA 1DFPA 1DVAH 3M61U 1CA0B 4LK4A 5HM2A 4FVDA 2GCTC 2VWOA 4YESB 3Q3XA 1SI5H 3SV2H 4ZKOU 3MNXA 1MTNC 1H4WA 2XRCA 3UQVA 1K1IA 4B76A 6LPRA 1ZRKA 1C5NH 4E7NA 4BANB 2H5DA 4AB8A 1OWKA 1DWEH 1HAYB 2BXTH 2TGPZ 5DP4A 4H6TA 3RU4D 2FX4A 1UTMA 4MNVA 4PROA 5DK1A 4IMZA 1ESBA 2Q6FA 4DY7B 1CO7E 2ZFSA 1FXYA 1EAWA 1HV7A 1D3TB 2A5KA 1GVLA 1T31A 2ZG0H 2GDEH 3MH7A 4D9RA 1AE8H 3UNRA 3ODFA 1O3KA 1GVZA 5HXFA 5C5OA 1QBNA 2LPRA 1FPCH 3EA9A 1Y3VA 2FS8A 3QO6A 1TRYA 3VGCB 1RRKA 1EZQA 4UDWH 5HGGA 2BY6X 1S5SA 1LHEH 4FUBA 3K9XB 2OLGA 1GJ9B 1WUNH 4Y8ZA 2AFQB 5DP6A 1BTPA 1XM1A 3GICB 1ZJDA 1C4Y2 3S69A 1W8BH 4NZQA 1J8AA 2H9EH 5F03A 1WU1A 1AVWA 1NFYA 1TBQH 1V2TT 1FNIA 4TPIZ 1SPJA 1QJ6B 3M5LA 1E37B 4WF8A 2F9NA 3KL6A 6CHAB 1XUGA 1P3EA 5F8XA 4K8BA 1FY8E 1YPJH 1AMHA 1O34A 4JYVH 3UFAA 1QIXB 2J9NA 1S85A 3SNCA 1G3BA 1IQEA 4KTCA 4X1PU 1V2MT 1V2LT 3R3GB 4A1TA 2C4FH 1V2UT 4J2YB 3ITIA 4HI3A 1GDUA 5BRRE 1HBTH 2JH6D 4WXVA 1OSSA 2GZ8A 2ZFTA 3A81A 2A1DB 3KF2A 1ID5H 1D6RA 2AIQA 2BDIA 3CS0A 3OU0A 3E16B 4A7IB 4XBBA 3RC5A 2NU4E 1C2IA 2PHBA 2EI8A 4Y8XA 3SU3A