3V3MA

Severe acute respiratory syndrome coronavirus (sars-cov) 3cl protease in complex with n-[(1r)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)ethyl]-n-(4-tert-butylphenyl)furan-2-carboxamide inhibitor.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Discovery, Synthesis, And Structure-Based Optimization of a Series of N-(tert-Butyl)-2-(N-arylamido)-2-(pyridin-3-yl) Acetamides (ML188) as Potent Noncovalent Small Molecule Inhibitors of the Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV) 3CL Protease.
pubmed doi rcsb
source organism Sars coronavirus
total genus 88
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3v3mA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v3mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v3mA02
2BD2A 3SNDA 2BDYA 2C8YB 4SGBE 3IG6B 3A8AA 2R2WU 1GI8B 2DE9A 2J9NA 1DXWA 2FTLE 4UEHH 1BTUA 2ZPSA 3HATH 3E3TA 3ZV9A 5JBAS 4OS1A 1ZSKA 2BD8A 1RIWB 3RXAA 3NPSA 3MNBA 3T2NA 5DO4H 3GY6A 4YLQH 2CXVA 2FS8A 1Y59T 2PKSB 3L33A 3PO1B 3E6PH 4MNWA 1DE7H 1WCZA 1NTPA 2QA9E 1D3DB 2A4OA 4Q80A 2G51A 3VXFH 4FUCA 4AB8A 1GBAA 1PPGE 1N6XA 2Z7FE 4Z0KA 1ZTJA 1UTKA 4NZQA 2ZU1A 4BTIB 4ISHH 4O3UA 1WBGB 2ZHWH 3NZIA 2OBQA 4MPXA 3MH6A 1DOJA 2JETC 2QGRA 1GI5A 3M5LA 1SBWA 3U9AH 1HXFH 3F1SB 4Y0ZE 1O3AA 2EC9H 3CS7A 1UCYK 2TGAA 2PGQB 1UTMA 3A8BA 3GY2A 4DVAU 2ZU3A 4K2YA 2F9NA 5I25A 1O5DH 4X2VA 5EODA 1HAYB 1C1SA 3ZZCA 4WF8A 1VGCC 3S69A 3SJOA 1IQEA 3BG4C 3LJOA 4YLUA 1GHZA 1GMCG 3A82A 1O35A 3LC3A 1C5PA 1BBRK 1C5OH 1V2JT 1RXPA 3PLKA 3PWBA 1AVGH 1XUJA 2OC8A 2AERH 1KDQB 1FIWA 3H7OA 2D8WA 1FPCH 4UONA 1DUAA 1YC0A 1N1LA 3M7QA 3ZZDA 1MU6B 4ZHMU 1EP6A 2I6QA 2CF9H 1MKWK 1BRAA 1SVPA 7GCHF 5FXLA 2G8TA 1K2I1 1E38B 1NRSH 1VITF 1TGTA 1UK3A 1BRUP 1D6RA 2G00A 3EA7A 2FLRH 1V2UT 1DWBH 1NU7B 4CHAC 3SGQE 3UNRA 4FUGA 2VWLA 1W3CA 3TK5A 2V0BA 4CBOA 1PPBH 1UTNA 1FV9A 4NFFA 2BX3A 4KGAA 5C5OA 1Y3VA 1HJ8A 1O2KA 2A7JA 2QY0B 1O5BB 1XX9A 5DK1A 3RXSA 5JB9S 1ETSH 2SGEE 2XWBI 1O38A 2F3CE 1GG6B 1GBHA 1BTZA 2TPIZ 9ESTA 4AYYB 2Q1JA 1HAPH 8KME2 1YPHC 4JYTA 2FOFA 4KTCA 4OS4A 1HYLA 2V6NA 3SJKA 1UVTH 2XW9A 1KXDA 3NK8A 3BIUH 5EQRA 1SQOA 2G5NA 6CHAB 3TJVA 3LT3A 1DWDH 1TBQH 1E34B 1GBKA 1FY4A 3RXHA 1C1QA 4M7GA 4O3TA 1HIAB 1QA7A 3B9FH 4AOQA 4FUFA 4YT6H 1TX6A 1C1MA 4CRBA 3ZZ7A 3BF6H 1TB6H 2V3OH 5ESBA 3ESTA 1IQLA 1W11U 2VU8E 5G4BA 1HAVB 2G4TA 1F0UA 2QV1A 1O2LA 1IQMA 1UK4A 1C1UH 2WPMS 3GY3A 5I46H 3T5FH 1K9OE 4GUXA 3A8CA 1GCDA 3BEFB 2PR3A 2HALA 4ISLA 4H4FA 3Q77A 1SHHB 1A0LA 1PPCE 2P16A 4FVBA 1GCTB 5DP3A 1KLTA 1D3TB 1SPJA 2F9BH 5TCCA 1TOMH 3GY5A 2UUKB 4HFPB 1NU9A 1ZYOA 4NWLA 1SGFG 1NPMA 1GI3A 2FM2A 3V13A 1MMJN 1HAVA 2WPLS 1O3BA 1IHSH 3STIA 2CV3A 4X6OA 2F83A 2D26C 1TNIA 2ZHQH 2IPHA 4A6LA 1CBWB 4JK5A 1TABE 1GHBF 2O8TA 3U1IB 2GTBA 4I8KA 4SGAE 4NA9H 1JIRA 2C90B 2BY8X 2R3YA 1O2HA 3QUMP 1RRKA 1TYNA 4MPVA 3Q3YA 1YLCA 1YPLH 2VNTA 5E8EH 1IQKA 2G4UA 1AFQB 2A0QB 1GJ8B 3PLPA 1BMLA 1ABJH 1V6DA 6GCHF 1CHOG 1SOZA 3AW1A 3DFJA 2PV9B 4QT8C 4ASHA 1P04A 1D3QB 1MQ6A 4AYVB 5BPEA 4XBBA 1O2ZA 3MO3A 4IN2A 1P02A 1PPFE 4UFDH 1FQ3A 1TBZH 3A86A 1T31A 3BG8A 3BTWE 4Y8XA 4ZKSU 5F03A 3GCHC 1QFKH 4CREA 2QYIA 2XNIA 1XXFA 2OUAA 3RXLA 1N8OB 2P59A 1KSNA 1DWCH 3ATKA 4DG4A 3OTJE 1EJAA 4VGCC 3A7XA 1O3CA 3A7VA 1VJ9U 2XBXA 5JYIA 2TBSA 5CE1A 1P2JA 2QIQA 2AS9A 3G01A 3R3GB 1ZMJA 1T8NA 5FPSA 4ABIA 4ABDA 4BTUB 1UK2A 2UUFB 3NXPA 1C2FA 1QBVH 3MMGA 1UTQA 2CHAC 3SI4H 3SHAH 1EXFA 1PYTC 2ZGBH 3GISB 1J14A 1TRYA 4LZ1H 2CN0H 2XBYA 2P3UB 4U2WA 1LCYA 3EE0B 1YYY1 2J2UA 3PLBA 4WMDA 1XKAC 1CA0B 4FVDA 3RXMA 2F9UA 5HM9A 2FX6A 1O2QA 1GHAF 1SHYA 2BDHA 1TMTH 3C27B 2VH6A 3RXFA 1O2SA 3HK3B 1AI8H 3RLWH 1P12E 2A2QH 1D4PB 3KN2A 2ZP0H 1C2LA 1KYNA 3LOXA 2VINA 1GBJA 1EJNA 3VB7A 4ZKRU 2FX4A 2ZPRA 2G5VA 2O8WA 2R0LA 2SNWA 2J94A 2H6MA 3C1KA 1GHYH 1C5SA 4R8TB 1ZMNA 2ZQ1A 1AZZA 1ACBE 3P92A 5F8XA 4Y6DA 1FLEE 1CHGA 3URDA 4CBNA 4FUIA 2STAE 1LQEA 3SU6A 5EQSA 1JIMA 4BNRA 3GY7A 1OWKA 2FOMB 3M36A 2JH5D 4CRCA 1GMDF 3SOSA 1HAOH 2VWMA 2WPHS 1O30A 4B76A 4THNH 5EW1H 1XM1A 2A4RA 4YOGA 1QURH 1P3CA 3VGCC 1MUEB 3RXQA 5CHAC 5DG6A 3RMNH 2HLCA 5EU8A 1LKBA 4Y10E 1TNLA 2FYQA 2PKAA 1WTHD 1PQ8A 5L6NH 1P09A 5EPNA 2GZ9A 3DHKH 4X2YA 1TA2A 1BTPA 4FU7A 1OYTH 3GCTG 2BD9A 4BAKB 2J92A 2ASUB 1RTFB 2P8OB 3DT0H 3A7ZA 1QJ1B 1MTSA 5E2PA 1Z6JH 1FNIA 1HJ9A 1PYTD 3ODFA 4ZKOU 2DE8A 2FZZA 4LOYH 3ZZ3A 3ENSB 4I8HA 1SLWB 3GY8A 3RC6A 2ZEBA 1QTFA 2ZFTA 1O3JA 4OGXA 2A31A 2OC0A 2HNTF 1C2KA 4A1VA 1C5WB 2PKSC 2QF3A 2LNCA 3PO1C 1SQTA 4NIWA 1HAXB 3URCA 1C2EA 1UO6A 4H42U 1C1NA 2BB4A 4I8JA 1Q3XA 2G52A 1NS3A 4X6NA 4DCDA 1CGIE 3RXBA 4I31A 2Y7XA 1SI5H 1A2CH 1AWFH 1C9PA 3AVZA 1C5YB 1NFYA 3GY4A 4B1TA 2VVCA 3ZZ8A 1EOLA 1ELGA 2NU0E 1BBRH 3P8NA 1RTKA 3S7HB 3SU3A 5SGAE 1L0ZA 1P2NA 1CGHA 1MH0A 1LDTT 5E2OA 1ORFA 2ZCLP 4U32A 1V2MT 1ARCA 4Y8YA 5FAHA 2RDLA 3SV6A 2H2ZA 1N6YA 7GCHG 1A46H 1CSOE 3MNSA 4GHTA 4IC5A 1VITG 3EGKH 4KTUA 1BJUA 2UWOA 2ZU4A 1FONA 2QXGA 1BZXE 3GYLB 2DUCA 3RMLH 4CRAA 3LPRA 3RXUA 3LGUA 1S0QA 5H4IB 1O3LA 4ZUHA 2BLOA 2CGAA 4OS5A 2F9PA 3A87A 1C1PA 3TNTA 3S9BA 1IQHA 1ANDA 5FBEA 4AG2A 1S82A 2BDBA 5GPIB 3V3MA 1RJXB 1EOJA 1KXBA 1MZAA 1YCPH 2H5CA 3KHVA 4MPUA 4UDWH 1QQ4A 1O5FH 3S9AA 3MH7A 3UY9A 3VFEA 1FMGA 1THRH 2Y5FA 1AU8A 2WPIS 4XE4A 1QB6A 4ZXYH 1DANH 4B75A 3MTYA 4D9RA 5L2ZH 2EI7A 1SGNE 2ODQA 5AVDA 3STJA 5DP9A 4ABJA 1Y5UT 1GBBA 2ZKSA 1FY1A 1CU1A 1BOQA 4Q2KA 4RKJB 1FAXA 1HDTH 2B0FA 2ZWLH 1P10A 3SV7A 2NU1E 2VIQA 3D65E 1TX8A 3LIWA 4FXGH 1OP0A 5A0BA 1G30B 1FY5A 1O3GA 1ZSLA 5A8YA 4YESB 4Y76A 1C2DA 1HCGA 1XMNB 3BIVH 4IC6A 1KTSB 1BDAA 3WY8A 1D3PB 3O8RA 1LHCH 3A7TA 5JPMH 1ZPZA 2VGCB 2GP9B 2BQ6B 1CA8B 2WUCA 1ESAA 3PROA 3W95A 2ANKH 1XVOA 2THFB 1P11E 5GXPA 1WOFA 3GICB 1QL7A 1INCA 2EI8A 2FOAA 2GX4A 1OS8A 6CHAC 3SHCH 3KEEA 1PQAA 4FUHA 2WPJS 5K7RA 3BEUA 1YBWA 1TPAE 3OX7U 1S84A 4GSOA 2BY5X 1KXCA 1LVBA 1DS2E 1EPTA 2FOGA 4K1EA 1OYQA 1F7ZA 2ZECA 3BTTE 1HLTH 1FI8A 1OP2A 1ARBA 2BDIA 5ABWA 4MLFB 5EW2H 1PJPA 2BVXH 1C5ZB 1O3PB 1YPMH 3L6PA 1MTNB 1A5IA 4IMZA 1O32A 1SR5C 3V0XA 1ZLRA 3OU0A 2K7XA 1O3MA 1X7AC 2BY7X 4A1XA 3VXEH 2A1DB 1GHBG 1GJDB 1PQ5A 1O5GH 3M3TA 1UTLM 2ANYA 1FJSA 5TCAA 4BAMB 3UREA 1P57B 2XRCA 3ZYDA 1BUIA 2UUJB 1W10U 1AE5A 1GCTC 1AQ7A 1O39A 2JKHA 4TPYA 3O8CA 1P3EA 3SO3A 2HNTC 4CRGA 2PWXA 2AIPA 2A5KA 4NIVA 1AVWA 3GDSA 2ZTXA 1P9SA 2XXLA 1V2OT 2Y80A 1FDPA 3ATLA 6GCHG 1A5HA 3MHWU 3I77A 3SJIA 4GAWA 4B74A 1C4Y2 4ISOA 4NSVA 3GCTF 1CBWC 3LGTA 4MVNA 4X1RU 2ZQ2A 2GVFA 2H9TH 2WYJA 1GDUA 1ELAA 3MU5A 4J1YA 1NRRH 1NRNH 3E0PB 2Z9IA 1ELDE 3P6ZB 3SGBE 2Y5HA 1CT4E 1EB2A 4Y7BA 1V2WT 1DX5M 2BVRH 2LPRA 1A5GH 1CO7E 4YTAA 2OD3B 2ZFSA 5A2MH 1AFQC 2ZU2A 1ELTA 1BMAA 5HXFA 1AIXH 2ZFQH 4JYUH 1XUFA 1T8MA 2SGPE 5C1XA 2EA3A 1QL8A 4YZUA 3T62A 1QA0A 1HBTH 2W5EA 3O8DA 4Y0YE 5GWZA 1S6HA 3TH4H 1XUIA 3EQ0H 5DP6A 1D9IA 1C1OA 2VIWA 1L4ZA 4ZHLU 1QIXB 2BDCA 4TWYA 3E91A 1W0YH 2A5IA 2GV7A 3K6YA 2OLGA 4CRDA 1SOTA 3MH4A 3S7KB 2BLWA 1O2NA 1LVMA 1IAUA 1C1VH 3ZZ9A 1OKXA 1BRBE 1Y5BT 1OPHB 5GJ4B 1ZHPA 1O2GH 1UVPA 3QX5H 2F9OA 2AH4X 1QQUA 1UVUH 1MU8B 1N8OC 2VIDA 3QZQA 5HM2A 1GHAG 5A8ZA 2FOCA 3CP7A 3RXIA 1G37A 1OWDA 5E0HA 1VCQA 2A4QA 1GI9B 1GI2A 2BLQA 3RXVA 1Z6EA 2VB0A 1NRPH 2VWOA 3QK1A 4CR9A 4X1SU 4PROA 2FOEA 5J4SA 1VR1H 1EP5A 1ZPCA 4JZFH 1WTGH 2WUBA 3RXTA 1YCPK 3QGJA 5C67A 1ZGIA 3BN9A 1TQ0B 3UIRA 2FMJA 1QHRB 1Y3XA 2ZCHP 4MNVA 1SGQE 2STBE 1Y3UA 1Y8TA 2VIPA 4JZDH 1C5LH 5F6MA 1LVOA 2W7SA 4TYDA 3SQEE 1CA0C 1V2LT 1E36B 1P9UA 1DSUA 2OC1A 2PHBA 1A1RA 3SNAA 2WV5A 2BHGA 1F0TA 2ANMH 4CH2B 3TJNA 1O31A 4NZLA 5LH8A 1VITH 1E35B 1W7GH 3JZ1B 2BLVA 5GCHF 5FPTA 2SGAA 1HXEH 1TPSA 1GMDG 3FANA 1P2KA 1AZ8A 3FZZA 9LPRA 1SLUB 2ZFFH 4BTTB 1BTYA 4K3JA 4A1TA 2GV6A 4Y11E 1P2OA 4HZHA 4AGJA 3ZYEA 2KAIB 4TY7A 1AMHA 5DP7A 1C2JA 1VJAU 2YOLA 3ATIA 2IN2A 2PFEA 4X8VH 4BXWA 5J4QA 3GOVB 4DOQA 2P3TB 3BTHE 2PSYA 3RDZA 2Q6FA 2GDDA 2HNTE 3D49H 1P05A 1QL9A 1WV7H 1EAIA 2SGQE 1GL1A 2BXUH 1W14U 1TE0A 3JZ2B 3RXRA 3UOUA 2PTCE 1K1NA 2FP7B 4ZKNU 1SB1H 1A3EH 1NN6A 1O37A 3R0FA 2ZGXH 2P95A 1Y5AT 2OBOA 2RA0A 1O2OA 2KAIA 3SU5A 1UVOA 2RG3A 5FX6A 2H9EH 3KNXA 1BQYA 1C2HA 4U30A 2PTNA 2BDGA 3KQCA 1C1TA 1RFNA 3H7TA 1L4DA 2ALVA 5L30H 1QBOA 2AFQB 1L1NA 3RU4D 1YP9A 8LPRA 1Z8RA 2P3FH 2BMGB 3ELAH 1YLDA 4A92A 1GBEA 4HI3A 4YT7H 5DP8A 1GGDB 1W7XH 5GIBA 2C93B 4GLYA 1PPZA 4I33A 1XUKA 1BB0B 4X8UH 5FCRA 2LIZA 1BA8B 3LGWA 1ZJKA 2EI6A 1GMHF 1THPB 3SV8A 3A88A 4K1TA 1ELBA 1KY9A 4K8BA 5C20A 1VCWA 1G3DA 1V2NT 1V2QT 4MNXA 1O2MA 3OSYA 1QJ6B 1YPJH 1L1JA 1SFQB 1NFWA 3UFAA 1DT2A 4HGCA 1TWXB 2QXIA 4NCYA 2BX4A 1CT2E 2PUXB 1E37B 4YOIA 2TIOA 1IOEA 2A7CA 5EXLA 1AN1E 3F9FA 3UWJH 1EZXC 2GZ7A 4HTCH 2BTCE 1FIZA 4LXBH 1TPPA 1LMWB 1BRCE 1TFXA 1M9UA 3EBNA 2R3UA 4Y7AA 3TK9A 2UUYA 2A45B 2ZTZA 4FU8A 3SV9A 3RU4E 1W8BH 1FY3A 1HJAC 1PPHE 1UHBA 1C9TA 1ZRBA 3HK6B 1EJMA 3VB5A 3TVJB 1CE5A 4F4OC 3U1JB 2NU4E 3LGVA 4B2CA 2A2XH 1ZMLA 1EB1H 2WINI 4BAQB 4JZ1A 1JXPA 1SGCA 2GCTB 2GCHF 1OXGA 1AUTC 3P8OA 2BD7A 3SQHE 1DLKB 3M7TA 3ZV8A 4CRFA 1GBMA 4DJZB 3UWIA 3UNSA 1HPGA 3A7YA 1H1BA 1BTHH 7LPRA 2G55A 1YM0A 3ZVEA 3HKIB 1GPZA 3F9GA 1O2TA 4INLA 1SG8B 2ZDVH 1SGPE 5CMXH 1OWEA 1Y3WA 2VWNA 5E0JA 1GJ9B 1TGSZ 1QGFA 3SNCA 3TGJE 2ZG0H 1W13U 7KMEH 1NZQH 2VVVA 4NIXA 1JMOH 1DUEA 2C3SA 1GHVH 2HGTH 3ZZ4A 2VGCC 1ZGVA 2PKAB 3SN8A 4INKA 1RS0A 1J9CH 1MTVA 1O36A 2OCVB 4UFGH 1H9LB 1Y3YA 1G36A 3CS0A 2ZHDA 5PTPA 3IITA 4UE7H 1EZSC 1MBMA 1ABIH 4XDEA 1O5AB 1TBRH 2FI5E 1UJ1A 1V2TT 2BM2A 1WSSH 3PWCA 1TONA 3NCLA 3UR9A 4X8SH 1TMBH 3U8RH 1SGRE 3Q3KA 3ZVFA 3D23A 3PMHB 3ZVDA 5EXMA 2V3HH 4ESTE 5A8XA 1O2UA 3T25A 4ABGA 2OC7A 2ZFRH 4DIHH 1T8LA 4K5ZA 4FU9A 1MTNC 1HRTH 2NU3E 1GBFA 1JOUB 2Z9JA 3E8LA 1HV7A 1O3KA 4ZROA 1DY8A 1E0FD 2AIQA 4MTBA 4CH8B 1AFEH 2HPPH 5EG4A 5LGOA 5FHTA 1GJAB 1FXYA 3T26A 1H8IH 3EA8A 2XTTB 1RIWC 5DKMA 3TGKE 3KGPA 1ZPBA 4FUEA 1DWEH 3TITA 1LO6A 1YF4A 4I8GA 5EPYA 4AFUA 3E90B 2PGBB 1AHTH 2XBVA 1KTTB 1P8VC 5IYTA 2FI4E 2ZNKH 4BAOB 4IMQA 1A61H 1GI6A 1ELFA 2BXTH 4XBCA 4BANB 3P8FA 1S6FA 3NKKA 3AASA 3SUGA 4Y8ZA 2FWWA 2BD5A 3F9EA 1TNGA 2JH0D 3EYDA 1DPOA 1OX1A 4A5TS 5JDUB 3HGNA 2QAAA 4BOHA 3K6ZA 3MU8A 4MQAA 4U01A 3MO6A 5JB8S 1EASA 1W0ZU 1QNJA 2OQ5A 1W12U 3BTKE 2XYAA 3DD2H 3ITIA 1YKTA 3S9CA 1EQ9A 4WVPE 3VB3A 5TJXA 1NRQH 4E05H 6ESTA 4Q7XA 2ILNA 3RM0H 4WY3A 3QTOH 1DFPA 2OP9A 3RXJA 3NUMA 1MCTA 3BTQE 3M5NA 5LPRA 1G3EA 3ZZ5A 2QN5T 2ZA5A 2JH6D 1ZRKA 3P8GA 4DIIH 3MFJA 3RMOH 3KCGH 1V2PT 5K0HA 4IN1A 4KTSA 1NFUA 3PYHA 4B73A 3FP7E 4K60A 1NO9H 3S0NA 5JBBS 1Z71A 1DVAH 5DJ7A 2GKVE 1GL0E 3GCHB 4RSPA 3SNEA 1EAWA 1JWTA 1O3DA 1GVLA 1Z8JB 2XC5A 5LPEA 4VGCB 2PW8H 4X2XA 1FAKH 1TGNA 3MU0A 4XSKU 1GVZA 2FS9A 1PPEE 4J2YB 4WWYA 4X6MA 5HGGA 1MD8A 1NY22 5GCHG 1GBIA 3M37A 1LTOA 1SGYE 5C2ZA 3MO9A 4XOJA 3B23B 4OS7A 1TA6A 5T6DA 1O5EH 3SU1A 2AMDA 5L2YH 2HWLB 1HAZB 3RC4A 1GI4A 3M3VA 1WUNH 3TPIZ 2VH0A 1S0RA 2NWNA 1EPTB 1G9IE 2R2MB 2Z3EA 2YNAA 2G81E 2HPQH 1L1GA 1GG6C 4ZMAH 3SNBA 2HVXA 2VVUA 1F5RA 1TPOA 1KXEA 1O3IA 1TX7A 2XC0A 3BTME 2Y6TA 2RCEA 1ELVA 4FUJA 4BXSA 4DGJA 4AFSA 3TJUA 3M5OA 4AN7A 3SZNA 1HAHH 1BTXA 4INHA 1QY6A 2BQ7B 1A3BH 1BMNH 5IDKA 2AMPA 3U69H 3BTGE 4B2BA 3N7OA 3ODDA 1DSTA 3F6UH 3KQDA 1GHWH 5EXNA 5ETXA 2HRVA 1GHXH 1ZR0A 2ZCKP 3F68H 5BRRE 4MG3A 1AKSB 3MH5A 3U98H 3BTEE 2ZGHA 1FZZA 4DT7B 4ISNA 4ABBA 2ALPA 4YM9A 4X6PA 4NG9H 4TY6A 3V12A 1HB0B 3UQOA 1V2KT 1T7CA 4LK4A 2ESTE 1GI0A 2ZHFH 4UD9H 4ABFA 3VGCB 3QLPH 1C2IA 1XXDA 4K69A 1EKBB 1ZTLA 2FEQH 2ZHEH 1THSH 2VIVA 1B0EA 2ANWA 1P06A 3A80A 2AGEX 4DW2U 2F91A 1GJBB 1O3EA 1A0JA 1AKSA 1OWJA 2GMTB 2BVSH 3A8DA 3LJJA 4JCNA 3HKJB 1DITH 2ODYB 1K1OA 1K21H 3QGNB 1P01A 3K9XB 2J95A 2NU2E 3M7UA 4JZEH 4NGAH 4AX9H 1GMHG 3TLOA 4AG1A 1EX3A 1O2RA 4IBLH 4Q7ZA 3E1XB 3W94A 3KIDU 2CF8H 2BD3A 2ZDLA 3LH1A 1QB1A 1O2JA 2P93A 3B8JA 1WYKA 4D7GA 1EATA 1LQDB 4UFFH 3UR6A 4KP0A 2SGFE 2AYWA 1RGQA 3K65B 1GGDC 3OYPA 3OY6U 2Q6DA 3EAJA 3U8TH 1GBLA 3AAVA 3QZRA 4D76A 2H5DA 1AO5A 5LPFA 4ABEA 3H5CB 1OOKB 2W26A 2FESH 3PM3A 1O33A 1KLIH 4Y79A 2BD4A 1BHXB 1GDQA 1LHEH 6LPRA 5GDSH 2Y81A 3LDXH 4JYVH 5HYOA 1B7XB 2GDEH 2BQWB 2ZGJA 4GCHF 1ZZZA 1HNEE 1YCPM 2GCHG 2BZ6H 1SGIB 2Y82A 3P17H 2GGVB 1UVSH 3VPKA 1K28D 2H1UA 1H8DH 3LC5A 4E7NA 2QC2A 1ANCA 2B7DH 3LONA 1EUFA 2CMYA 4D9QA 1EAUA 3DA9B 2WV4A 2TRMA 5EGMA 1AB9B 1HGTH 3EDXB 2FXRA 3QDZB 8ESTE 2FDAA 1ESTA 1AGJA 3SBKA 3RM2H 1U6QA 1TMUH 3TU7H 3ZZAA 5A0AE 3QO6A 1HAGE 1K22H 2FIRH 2GD4B 8GCHF 1ZSJA 3FAOA 3RXEA 4IS5A 1ELEE 2GCTC 3A85A 4I32A 1B0FA 4R0IA 1TRMA 4ZH8A 2FLBH 1SLXB 3M35A 2FPZA 1KDQA 1MTUA 1UTPA 1K1PA 4OS2A 3UOPA 2QXJA 1MAXA 3ATMA 1MKXH 1MZDA 1V2RT 1C4V2 3RC5A 1TQ7B 1O0DH 1KIGH 2ZFPH 3MNCA 3SU4A 1SLVB 4AB9A 2ZF0H 1SL3A 1CT0E 1GJ6A 2PLXA 2ZU5A 1QJ7B 1UCYE 3SJ8A 1FY8E 4AORA 2Y7ZA 3E16B 3UPEA 3LGYA 3CENA 4Y71A 1GBTA 4XBDA 2PSXA 1AUJA 1SSXA 1WQSA 1PQ7A 1XKBC 2ZPQA 1TGCA 1SFIA 1HFDA 4TPIZ 1BT7A 4K8YA 1G3CA 3ATWA 4WMFA 3M3SA 4E06H 1O2YA 1C5NH 1NT1A 3MWIU 1BBRE 1D6WA 1UTOA 3Q3XA 7ESTE 1EAXA 2ZIQH 4Z6AH 1MCVA 1IQNA 1BCUH 1KLJH 2FOBA 3FP8E 4H6TA 1C5TA 3RXOA 3ZVBA 2IJOB 2ZC9H 4AZ2B 1DM4B 1BTWA 3DUXH 1C5XB 4YOJA 1VCPA 1QBNA 3ZZ6A 1OSSA 1ZTKA 1GI7B 1DLEA 2P8OC 1IQGA 3KQBA 3RXKA 1HIAA 3KQEA 4O03A 1ID5H 4X1QU 3SV2H 4AFZA 1K1IA 1TOCB 1CGJE 1TNKA 2ZDKA 3VB4A 3MNXA 4WJG2 5T3HA 3RU4T 3TJOA 3PV4A 1C5QA 3GCOA 5EQQA 1SGEE 2Z3CA 5ESTE 2C8WB 1K1LA 1LHDH 3FVFB 4KKDA 2H9HA 5JBTA 3SW2B 4D7FA 1BMMH 1C4U2 2I6SA 1T4VH 4GVUA 2OQUA 3A81A 3HGPA 5F8TA 2JETB 3A84A 1O2XA 2CJIA 1P2IA 5AHGH 2YNBA 3PMAB 3UUZA 4FUBA 1KXFA 2Z3DA 5AFYH 4OGYA 1GWAA 4AFQA 1UHBB 3KF2A 4ZAEA 2QCYA 5DP5A 2M5TA 2C8ZB 2RA3A 2QXHA 1T8OA 4WH6A 4NA8A 1F5LA 1C2MA 1LPGB 1GJ5H 2SFAA 3GDUA 4NSYA 3SORA 1VGCB 1SGFA 3UTUH 3P95A 3BG4B 1DICA 1FN8A 1F5KU 5AF9H 1ESBA 2C4FH 4TWWA 2XCFA 3M61U 1BHXF 3MU4A 3VB6A 1F92A 2BOHB 4OS6A 1Z1IA 2O8UA 5HMAA 1DDJA 2W7UA 1H4WA 1K1JA 4E7RG 1G32B 3KL6A 2D2DA 2AEIH 2FODA 1F0RA 4MPWA 3TH2H 1O2PA 3I29A 4X0WU 5T6FA 1OWIA 1ETTH 4WXIA 2PUQH 4CHAB 1QCPA 1SMFE 1O3NA 1GMCF 4O9VA 1Z1JA 3ZZBA 2XWAA 2C8XB 1KXAA 2Z9LA 1WQVH 2P94A 3LKWA 1QRZA 1MTWA 1MAYA 1FN6A 1O5CB 4D8NA 4I7YH 2Z9KA 1LKAA 1YPHE 1P0SH 2BDAA 4MNYA 1GDNA 2Z6BD 5FPYA 1G2LA 1C1WH 1B5GH 3RXCA 2A4GA 1FUJA 1H9HE 1V2ST 1EPTC 2XC4A 1LVYA 1SQAA 3Q00A 1O34A 5AFZH 4JMYA 2GT7A 1FPHH 2F9VA 1F2SE 3LGIA 1Z8GA 2TGTA 2ZI2H 3QN7A 4A7IB 1TNJA 4YO9A 4B2AA 3BTDE 4NIYA 3LH3A 5C5NA 1Z7KA 2B5TB 1L2EA 2VJ1A 1ZHRA 1GJCB 5C1UA 1C2GA 1UMAH 3M5MA 1SC8U 3SUFA 1HUTH 1RD3B 2FOHA 3IWMA 1MKXK 1TNHA 3FP6E 5FX5A 4I8LA 2BY9X 1J15A 1EZQA 1NFXA 2J4IA 1XUHA 1WAYB 1O2WA 5EOKA 1Z8IB 4ABHA 3AW0A 2Y5GA 1O3FA 1HAIH 3TNSA 4CR5A 3PMJA 3GCNA 2W3KA 1XVMA 1K1MA 2QF0A 3V7TA 5FBIA 5B6OA 4RN6A 2ZDNA 2EEKA 4IGDA 1T32A 3QTVH 3FFGA 2OXSA 1NC6A 4IW4E 4JZIA 5E0GA 3BEIB 5T6GA 4XFQA 1QRWA 1TALA 1IQFA 1LPZB 3PTBA 4Q7YA 3SI3H 1QRXA 1JRSA 1MD7A 3AAUA 1A0HB 1O2IA 1TLDA 3GYMA 3VEQB 4NFEA 3RUOA 3TIUA 2FI3E 3BTFE 4ISIH 1ANEA 1G3BA 1UTJA 2GMTC 3Q76A 3PMBB 2BOKA 2TGPZ 1EZUC 2ZDAH 5FCKA 3DFLA 2BYAX 3SJ9A 3UQVA 2ZTYA 4JK6A 2FYRA 4ZHAA 4DURA 1GJ4H 3GDVA 1LHFH 3NWUA 1AY6H 3A89A 4ABAA 3EA9A 1A7SA 4NWKA 3MI4A 3TK6A 3K2UA 1JRTA 2ZO3H 4GPGA 1CVWH 3UNQA 3PTNA 4K1SA 3RMMH 3HPTB 1OP8A 3ZVAA 2VIOA 1IHTH 1UCYH 3O8BA 1ETRH 2Z94A 4F49A 2AGIX 3PB1E 1C5MD 2UWPA 4WXVA 1IQIA 2GT8A 2OTVA 4GCHG 4B71A 4X1PU 2B8OH 1YPEH 2Z9GA 1O2VA 1YPKH 3FZDA 1CQQA 2B9LA 3MU1A 2Q6GA 1V3XA 1LHGH 2AMQA 2A32A 2FO9A 3MYWA 1TRNA 1XUGA 2ZDMA 2K1QA 4BAHB 1OWHA 1P2MA 1S83A 1NM6A 2AGGX 1DY9A 1QB9A 5JBCS 1P2QA 5A0CA 5A09A 3T27A 1MKWH 3SUDA 2A5AA 4RKOB 2SGDE 8GCHG 4UFEH 2FTMA 1S81A 1O3OA 3SGAE 1MBQA 3SU2A 1TIOA 3QWCH 3A7WA 4KELA 3U8OH 1CHOF 2J38A 1RTLA 1C5VA 3P70B 4X2WA 1PFXC 4X8TH 4DY7B 1S5SA 1J16A 1HJAB 1O3HA 5DP4A 1GBDA 1J17T 2IOTA 1AB9C 5C1YA 2BY6X 1WU1A 1W2KH 1H9IE 1J8AA 3MOCA 2WYGA 2CHAB 3A83A 2ZGCA 1T4UH 3SU0A 2ULLA 1Q2WA 4FUDA 3D62A 5DPAA 4GHQA 1DXPA 3F9HA 1JBUH 1VZQH 3ZVGA 1F0SA 1GVKB 2R0KA 3L3TA 1SGTA 1TGBA 2BZAA 4O97A 3TH3H 1ZJDA 1S85A 1AE8H 1YPGH 3RXGA 2V35A 2A7HA 4H6SB 4WMEA 2ODPA 1ZOMA 4NA7A 5DGJA 2ZZUH 3ZVCA 1G2MA 1BITA 1V2VT 2O8MA 1IQJA 1AVXA 1C1RA 3RXDA 2HOBA 3RP2A 2W3IA 1GI1A 4ZXXH 4AGKA 1A4WH 1Q31A 4WH8A 2SNVA 1NESE 1AWHB 3RXPA 3LU9B 1BJVA 2J34A 1C5RA 1ELCA 5F8ZA 3OY5U 2TGDA 2R9PA 3SUEA 1C5UA 2WPKS 2UWLA 1GBCA 2O8LA 1ZHMA 3BV9B 3E0NB 3RLYH 3T29A 1GJ7B 2XCNA 4LZ4B 4MDSA 1AD8H 2OINA 1BIOA 2XBWA 3TGIE 1QR3E 1TAWA 3BSQA 2GZ8A 1LPKB 1MQ5A 2O9QA 3T28A 1NROH 1ANBA 1YGCH 2D1JA 5C3NA 4X1NU 5CHAB 1P03A 1SGDE 3I78A
chains in the Genus database with same CATH superfamily
2BD2A 3SNDA 2BDYA 2C8YB 4SGBE 3IG6B 3A8AA 2R2WU 1WDIA 1GI8B 2DE9A 2J9NA 1DXWA 2FTLE 4UEHH 1BTUA 2ZPSA 3HATH 3E3TA 3ZV9A 5JBAS 4OS1A 1ZSKA 2BD8A 4F55A 1QZ8A 1RIWB 3RXAA 3NPSA 2HVYB 3MNBA 3T2NA 5DO4H 3GY6A 4YLQH 2CXVA 2FS8A 1Y59T 2PKSB 3L33A 3PO1B 3E6PH 4MNWA 1DE7H 1WCZA 1NTPA 2QA9E 1D3DB 2L6OA 2A4OA 4Q80A 2G51A 3VXFH 4FUCA 4AB8A 1GBAA 1PPGE 1N6XA 2Z7FE 4Z0KA 1ZTJA 1UTKA 3KQ5A 4NZQA 2ZU1A 4BTIB 4ISHH 4O3UA 1WBGB 2ZHWH 3NZIA 2OBQA 4MPXA 3MH6A 1DOJA 2JETC 2QGRA 1GI5A 3M5LA 1SBWA 3U9AH 1HXFH 2W6ID 3F1SB 4Y0ZE 1O3AA 2EC9H 3CS7A 1UCYK 2TGAA 2PGQB 1UTMA 3A8BA 3GY2A 4DVAU 2ZU3A 4K2YA 2F9NA 5HIYA 5I25A 1O5DH 4X2VA 5EODA 1HAYB 2J5UA 1C1SA 3ZZCA 4WF8A 1VGCC 3S69A 3SJOA 1IQEA 3BG4C 3LJOA 4YLUA 1GHZA 1GMCG 3A82A 1O35A 3LC3A 1C5PA 3N7EA 1BBRK 4RI0A 1C5OH 1V2JT 1RXPA 3PLKA 3PWBA 1AVGH 1XUJA 2OC8A 2AERH 1KDQB 1FIWA 3H7OA 2D8WA 1FPCH 4UONA 1DUAA 1YC0A 1N1LA 3M7QA 3ZZDA 1MU6B 4ZHMU 1EP6A 2I6QA 2CF9H 1MKWK 1BRAA 1SVPA 7GCHF 5FXLA 2G8TA 2EY4C 1K2I1 1E38B 1NRSH 1VITF 1TGTA 1UK3A 1BRUP 1D6RA 2G00A 3EA7A 2FLRH 1V2UT 1DWBH 1NU7B 4CHAC 3SGQE 3UNRA 4FUGA 2VWLA 1W3CA 3TK5A 2V0BA 4CBOA 1PPBH 1UTNA 1FV9A 4NFFA 2BX3A 4KGAA 5C5OA 1Y3VA 1HJ8A 1O2KA 2A7JA 2QY0B 1O5BB 1XX9A 5DK1A 3RXSA 5JB9S 1ETSH 2SGEE 2XWBI 1O38A 2F3CE 1GG6B 1GBHA 1BTZA 2TPIZ 9ESTA 4AYYB 3EE7A 2Q1JA 1HAPH 8KME2 5EJ1A 1YPHC 4JYTA 2FOFA 4KTCA 4OS4A 1HYLA 2V6NA 2F4LA 1UVTH 2XW9A 3SJKA 1KXDA 3NK8A 3BIUH 5EQRA 1SQOA 2G5NA 6CHAB 3TJVA 3LT3A 1DWDH 1TBQH 1E34B 1GBKA 1FY4A 3RXHA 1C1QA 2YMSB 4M7GA 4O3TA 1HIAB 1QA7A 3B9FH 4AOQA 4FUFA 4YT6H 1TX6A 1C1MA 4ASUD 4CRBA 3ZZ7A 3BF6H 1TB6H 2V3OH 1YWUA 5ESBA 3ESTA 1IQLA 1W11U 2VU8E 5G4BA 1HAVB 2G4TA 1F0UA 2QV1A 1O2LA 1IQMA 4RT1A 5C94A 1UK4A 1C1UH 2WPMS 3GY3A 5I46H 3T5FH 1K9OE 4GUXA 3A8CA 1GCDA 3BEFB 2PR3A 2HALA 3DCLA 4ISLA 4H4FA 3Q77A 1SHHB 1A0LA 1PPCE 2P16A 4FVBA 1GCTB 5DP3A 1KLTA 1W0JD 3N7DA 1D3TB 1SPJA 2F9BH 5TCCA 1TOMH 3GY5A 2UUKB 4HFPB 1NU9A 1ZYOA 4NWLA 1SGFG 1NPMA 1GI3A 2FM2A 3V13A 1MMJN 1HAVA 2WPLS 1O3BA 2KFWA 1IHSH 3STIA 2CV3A 4X6OA 2V3MA 2F83A 2D26C 1TNIA 2ZHQH 2IPHA 4A6LA 1CBWB 4JK5A 1TABE 1GHBF 2O8TA 3U1IB 2GTBA 4I8KA 4SGAE 2CK3D 4NA9H 1JIRA 2C90B 2BY8X 2R3YA 1O2HA 4Q63A 3OEED 3QUMP 1RRKA 1TYNA 4MPVA 3Q3YA 1YLCA 1YPLH 2VNTA 5E8EH 1IQKA 2G4UA 1AFQB 2A0QB 1GJ8B 3WWFA 3PLPA 1BMLA 1ABJH 1V6DA 6GCHF 1CHOG 1SOZA 3AW1A 3DFJA 2PV9B 4QT8C 4ASHA 1P04A 1D3QB 1MQ6A 4AYVB 1SQRA 5BPEA 4P02A 4XBBA 1O2ZA 3MO3A 4IN2A 1P02A 1PPFE 4UFDH 1FQ3A 1TBZH 3A86A 1T31A 2IPQX 3BG8A 3BTWE 4Y8XA 2LP6A 4ZKSU 5F03A 3GCHC 1QFKH 4CREA 2QYIA 2XNIA 4RT0A 1XXFA 2OUAA 3RXLA 1N8OB 2P59A 1KSNA 1DWCH 3ATKA 4DG4A 3OTJE 1EJAA 4VGCC 3A7XA 1O3CA 3A7VA 1VJ9U 2XBXA 5JYIA 2TBSA 5CE1A 1P2JA 2QIQA 2AS9A 3G01A 3R3GB 1ZMJA 1T8NA 5FPSA 4ABIA 4ABDA 4BTUB 1UK2A 2UUFB 3NXPA 1C2FA 1QBVH 3MMGA 1UTQA 2CHAC 3SI4H 3SHAH 1EXFA 1PYTC 2ZGBH 3GISB 1J14A 1TRYA 4LZ1H 2CN0H 2XBYA 2P3UB 4U2WA 1LCYA 3EE0B 1YYY1 2J2UA 3PLBA 4WMDA 1XKAC 1CA0B 4FVDA 3RXMA 2F9UA 5CDFE 5HM9A 2FX6A 1O2QA 1GHAF 1SHYA 2BDHA 1TMTH 3C27B 4I86A 2VH6A 3RXFA 1O2SA 3HK3B 1AI8H 3RLWH 1P12E 2A2QH 1D4PB 3KN2A 2ZP0H 1C2LA 1KYNA 3LOXA 2VINA 1GBJA 1EJNA 3VB7A 4ZKRU 2FX4A 2ZPRA 2G5VA 2O8WA 2R0LA 2SNWA 2J94A 2H6MA 3C1KA 1GHYH 1C5SA 4R8TB 1ZMNA 2ZQ1A 1YLNA 1AZZA 3PV5A 1ACBE 3P92A 5F8XA 4Y6DA 1E79D 1FLEE 1CHGA 3URDA 4ACBA 4CBNA 4FUIA 2STAE 1LQEA 3SU6A 5EQSA 1JIMA 4BNRA 3GY7A 1OWKA 2FOMB 3M36A 2JH5D 4CRCA 1GMDF 3SOSA 1HAOH 2VWMA 2WPHS 1O30A 4B76A 4THNH 5EW1H 1XM1A 2A4RA 4YOGA 1QURH 1P3CA 3VGCC 1MUEB 3RXQA 5CHAC 5DG6A 3RMNH 2HLCA 5EU8A 1LKBA 4Y10E 1TNLA 2FYQA 1YY3A 2PKAA 1WTHD 1PQ8A 5L6NH 1P09A 5EPNA 1W0KD 2GZ9A 3DHKH 4X2YA 1TA2A 1BTPA 4FU7A 2W6JD 1OYTH 3GCTG 2BD9A 4BAKB 2J92A 2ASUB 1RTFB 2P8OB 3DT0H 3A7ZA 1QJ1B 1MTSA 5E2PA 1Z6JH 1FNIA 1HJ9A 1PYTD 3ODFA 4ZKOU 2DE8A 2FZZA 4LOYH 3ZZ3A 3ENSB 4I8HA 1SLWB 3GY8A 3RC6A 2ZEBA 1QTFA 2ZFTA 1O3JA 4OGXA 2A31A 2OC0A 4ZCNA 2HNTF 1C2KA 4A1VA 1C5WB 2PKSC 2QF3A 2LNCA 3PO1C 1SQTA 4NIWA 1HAXB 3URCA 3NRLA 1C2EA 1UO6A 4H42U 1C1NA 2BB4A 4I8JA 1Q3XA 2G52A 1NS3A 4X6NA 4DCDA 1CGIE 3RXBA 4I31A 2Y7XA 1SI5H 2KCOA 1A2CH 1AWFH 1C9PA 3F2GA 3AVZA 1C5YB 1NFYA 3GY4A 4B1TA 2VVCA 3ZZ8A 1EOLA 1ELGA 2NU0E 1BBRH 3P8NA 1RTKA 3S7HB 3SU3A 5SGAE 1L0ZA 1P2NA 1CGHA 1MH0A 4B6FA 1LDTT 5E2OA 1ORFA 2ZCLP 4U32A 1V2MT 1ARCA 4Y8YA 5FAHA 2RDLA 3SV6A 2H2ZA 1N6YA 7GCHG 1A46H 1CSOE 3MNSA 4GHTA 4IC5A 1VITG 4ACAA 3EGKH 4KTUA 1BJUA 2UWOA 2ZU4A 1FONA 4P00A 2QXGA 1BZXE 3GYLB 2DUCA 3RMLH 4CRAA 3LPRA 3RXUA 3LGUA 1S0QA 5H4IB 1O3LA 4ZUHA 2BLOA 2CGAA 4OS5A 2F9PA 3A87A 1C1PA 3TNTA 3S9BA 1IQHA 1ANDA 5FBEA 4AG2A 1S82A 2BDBA 5GPIB 3V3MA 1RJXB 1EOJA 1KXBA 1MZAA 1YCPH 2H5CA 3KHVA 4MPUA 4UDWH 1QQ4A 1O5FH 3S9AA 3MH7A 3UY9A 3VFEA 1FMGA 1THRH 2Y5FA 1AU8A 2WPIS 4XE4A 1QB6A 4ZXYH 1DANH 4B75A 3MTYA 4D9RA 5L2ZH 2EI7A 1SGNE 2ODQA 5AVDA 3STJA 2HLDD 5DP9A 4ABJA 1Y5UT 1GBBA 2ZKSA 1FY1A 1CU1A 1BOQA 4Q2KA 4RKJB 1FAXA 1HDTH 2B0FA 2ZWLH 1P10A 3SV7A 2NU1E 2VIQA 3D65E 1TX8A 3LIWA 4FXGH 1OP0A 5A0BA 1G30B 1FY5A 1O3GA 1ZSLA 3OFND 5A8YA 2KCAA 4YESB 4Y76A 1C2DA 1HCGA 1XMNB 3BIVH 4IC6A 1KTSB 1BDAA 3WY8A 1D3PB 3O8RA 1LHCH 3A7TA 5JPMH 1ZPZA 2VGCB 2GP9B 2BQ6B 1CA8B 2WUCA 1ESAA 3PROA 3W95A 2ANKH 1XVOA 2THFB 1P11E 5GXPA 1WOFA 3GICB 1QL7A 1INCA 5GNDA 2EI8A 2FOAA 2KX4A 2GX4A 1OS8A 6CHAC 3SHCH 3KEEA 1PQAA 5CHBA 4FUHA 2WPJS 5K7RA 3BEUA 1YBWA 1TPAE 3OX7U 1S84A 2YMSC 4GSOA 2BY5X 1KXCA 1LVBA 1DS2E 1EPTA 4F48B 2FOGA 4K1EA 1OYQA 1F7ZA 2ZECA 3BTTE 1HLTH 1FI8A 1OP2A 1ARBA 2BDIA 5ABWA 4MLFB 5EW2H 1PJPA 2BVXH 1C5ZB 1O3PB 1YPMH 3L6PA 1MTNB 1A5IA 4IMZA 1O32A 1SR5C 3V0XA 1ZLRA 3OU0A 2K7XA 1O3MA 1X7AC 2BY7X 4A1XA 3VXEH 2A1DB 1GHBG 1GJDB 1PQ5A 1O5GH 3M3TA 1UTLM 2ANYA 1FJSA 5TCAA 4BAMB 3UREA 1P57B 2XRCA 3ZYDA 1BUIA 2UUJB 1W10U 1AE5A 1GCTC 1AQ7A 1O39A 2JKHA 4TPYA 3O8CA 1P3EA 3SO3A 2HNTC 4CRGA 2PWXA 2AIPA 5C0TA 2A5KA 3OAAD 4NIVA 1AVWA 3GDSA 2ZTXA 3KYGA 1P9SA 2XXLA 1V2OT 2Y80A 1FDPA 3ATLA 6GCHG 1A5HA 3MHWU 3I77A 3SJIA 4GAWA 4B74A 1C4Y2 4ISOA 4NSVA 3UB0A 3GCTF 1CBWC 3LGTA 4MVNA 4X1RU 2ZQ2A 2GVFA 2H9TH 2WYJA 1GDUA 1ELAA 3MU5A 4J1YA 1NRRH 1NRNH 3E0PB 2Z9IA 1ELDE 2K0QA 3P6ZB 3SGBE 2Y5HA 1CT4E 1EB2A 4Y7BA 1V2WT 1DX5M 2BVRH 3MQKC 4TT3D 2LPRA 1A5GH 1CO7E 4YTAA 2OD3B 2ZFSA 2KZ4A 5A2MH 1AFQC 2ZU2A 1ELTA 1BMAA 5HXFA 1AIXH 2ZFQH 2XNDD 4JYUH 1XUFA 1T8MA 2SGPE 1WXRA 5C1XA 2EA3A 1QL8A 4YZUA 3T62A 1QA0A 1HBTH 2YMSD 2W5EA 3O8DA 4Y0YE 5GWZA 1S6HA 3TH4H 1XUIA 3EQ0H 4HG6A 1D9IA 5DP6A 1C1OA 2VIWA 4XD7D 1L4ZA 2WV9A 4ZHLU 1QIXB 2BDCA 4TWYA 3E91A 1W0YH 2A5IA 2GV7A 3K6YA 2OLGA 4CRDA 1SOTA 3MH4A 3S7KB 2BLWA 1O2NA 1LVMA 1IAUA 1C1VH 3ZZ9A 1OKXA 1BRBE 1Y5BT 1OPHB 5GJ4B 1ZHPA 2JJ1D 1O2GH 1UVPA 3QX5H 2F9OA 2AH4X 1QQUA 1UVUH 1MU8B 1N8OC 2VIDA 3QZQA 5HM2A 1GHAG 2GJGA 2L74A 5A8ZA 2FOCA 3CP7A 3RXIA 1G37A 1OWDA 4Q4LA 1VCQA 5E0HA 2A4QA 1GI9B 5KECA 1GI2A 2BLQA 3RXVA 1Z6EA 2VB0A 1NRPH 2VWOA 3QK1A 4CR9A 4X1SU 4PROA 2FOEA 5J4SA 1VR1H 1EP5A 1ZPCA 4JZFH 1WTGH 2WUBA 3FO8D 3RXTA 1YCPK 3QGJA 5C67A 1ZGIA 3BN9A 1TQ0B 3UIRA 2FMJA 1QHRB 1Y3XA 2ZCHP 2JIZD 4MNVA 2PP6A 1SGQE 2STBE 5FL7D 1Y3UA 1Y8TA 2VIPA 4JZDH 1C5LH 5F6MA 1LVOA 2W7SA 4TYDA 3SQEE 1CA0C 1V2LT 1E36B 1P9UA 1DSUA 2OC1A 2PHBA 1A1RA 3SNAA 2WV5A 2BHGA 1MABB 1F0TA 2ANMH 4CH2B 3TJNA 1O31A 4NZLA 5LH8A 1VITH 1E35B 1W7GH 3JZ1B 2BLVA 5GCHF 5FPTA 2SGAA 1HXEH 1TPSA 1GMDG 3FANA 1P2KA 1AZ8A 3FZZA 9LPRA 1SLUB 2ZFFH 4BTTB 1BTYA 4K3JA 4A1TA 2GV6A 4Y11E 1P2OA 4HZHA 4AGJA 3ZYEA 2KAIB 4TY7A 1AMHA 5DP7A 1C2JA 1VJAU 2YOLA 3ATIA 2IN2A 2PFEA 4X8VH 4BXWA 1EFRD 5J4QA 3GOVB 4DOQA 2P3TB 3BTHE 2PSYA 3RDZA 2Q6FA 3N99A 2GDDA 2HNTE 3D49H 1P05A 1QL9A 1WV7H 1EAIA 2SGQE 1GL1A 2BXUH 2WPDD 1W14U 1TE0A 3JZ2B 3RXRA 3UOUA 2PTCE 1K1NA 2FP7B 3VG8A 4ZKNU 1SB1H 1A3EH 1NN6A 1O37A 3R0FA 2ZGXH 2P95A 1Y5AT 2OBOA 2RA0A 1O2OA 2KAIA 3SU5A 1UVOA 2RG3A 5FX6A 2H9EH 3KNXA 1BQYA 1C2HA 4U30A 2PTNA 2BDGA 3KQCA 1C1TA 1RFNA 3H7TA 1L4DA 2ALVA 2KCYA 5L30H 1QBOA 2AFQB 1L1NA 3RU4D 2EQNA 4FETA 1YP9A 8LPRA 1Z8RA 2P3FH 2BMGB 3ELAH 1YLDA 4A92A 1GBEA 4HI3A 4YT7H 5DP8A 1GGDB 1W7XH 5GIBA 2C93B 4GLYA 1PPZA 4I33A 1XUKA 1BB0B 4X8UH 5FCRA 2LIZA 1BA8B 3LGWA 1ZJKA 2EI6A 1GMHF 1THPB 3SV8A 3A88A 4K1TA 1K0HA 1ELBA 1KY9A 4K8BA 5C20A 1VCWA 1G3DA 1V2NT 1V2QT 4MNXA 1O2MA 3OSYA 1QJ6B 1YPJH 1L1JA 1SFQB 1NFWA 3UFAA 1DT2A 4HGCA 1TWXB 2QXIA 4NCYA 2BX4A 1CT2E 2PUXB 1E37B 4YOIA 2TIOA 1IOEA 2A7CA 5EXLA 1AN1E 3F9FA 3UWJH 1EZXC 2GZ7A 2KR7A 4HTCH 2BTCE 1FIZA 4LXBH 1TPPA 1LMWB 1BRCE 1TFXA 1M9UA 3EBNA 2R3UA 4Y7AA 3TK9A 2UUYA 2A45B 2ZTZA 4FU8A 3SV9A 3RU4E 1W8BH 2KM0A 1FY3A 1HJAC 1PPHE 1UHBA 1C9TA 1ZRBA 3HK6B 1EJMA 3VB5A 3TVJB 1CE5A 4F4OC 3U1JB 2NU4E 3LGVA 4B2CA 2A2XH 1ZMLA 1EB1H 2WINI 4BAQB 4JZ1A 1JXPA 1SGCA 2GCTB 2GCHF 4FOUC 1OXGA 1AUTC 3P8OA 2BD7A 3SQHE 1DLKB 3M7TA 3ZV8A 4CRFA 1GBMA 4DJZB 3UWIA 3UNSA 1HPGA 3A7YA 1H1BA 1BTHH 7LPRA 2G55A 2QE7D 1YM0A 3ZVEA 3HKIB 1GPZA 3F9GA 1O2TA 4INLA 1SG8B 2ZDVH 1SGPE 5CMXH 1OWEA 1Y3WA 2VWNA 5E0JA 1GJ9B 1TGSZ 1QGFA 3SNCA 5EIYA 3TGJE 2ZG0H 1W13U 7KMEH 1NZQH 2VVVA 4NIXA 1JMOH 1H8HD 1DUEA 2C3SA 1GHVH 2HGTH 3ZZ4A 4AC9A 5IK2D 2VGCC 1ZGVA 2PKAB 3SYJA 3SN8A 4INKA 1RS0A 1J9CH 1MTVA 1O36A 2OCVB 4UFGH 1H9LB 1Y3YA 1G36A 3CS0A 2ZHDA 5PTPA 3IITA 4UE7H 1EZSC 1MBMA 1ABIH 4XDEA 1O5AB 1TBRH 2FI5E 2OK5A 1UJ1A 1V2TT 2BM2A 1WSSH 3PWCA 1TONA 3NCLA 3UR9A 4X8SH 2F43B 1TMBH 3U8RH 1SGRE 3Q3KA 3ZVFA 3D23A 3PMHB 3ZIAD 1E1QD 3ZVDA 4Z1MD 5EXMA 2V3HH 4ESTE 5A8XA 1O2UA 3T25A 4ABGA 2OC7A 2ZFRH 4DIHH 1T8LA 4K5ZA 4FU9A 1MTNC 1HRTH 2NU3E 1GBFA 1JOUB 2Z9JA 3E8LA 1HV7A 1O3KA 4ZROA 1DY8A 3F3BA 1E0FD 2AIQA 4MTBA 4CH8B 1AFEH 2HPPH 5EG4A 5LGOA 5FHTA 1GJAB 1FXYA 3T26A 1H8IH 5KEDA 3EA8A 2XTTB 1RIWC 5DKMA 3TGKE 3KGPA 1ZPBA 4FUEA 1DWEH 3TITA 1LO6A 1YF4A 4I8GA 5EPYA 4AFUA 3E90B 2PGBB 1AHTH 2XBVA 1KTTB 1P8VC 5IYTA 2FI4E 2ZNKH 4BAOB 4IMQA 5C17A 1A61H 1GI6A 1ELFA 2BXTH 4XBCA 4BANB 3P8FA 1S6FA 3NKKA 3AASA 3SUGA 4Y8ZA 2FWWA 2BD5A 3F0OA 3F9EA 1TNGA 2JH0D 3EYDA 1DPOA 1OX1A 4A5TS 5JDUB 3HGNA 2QAAA 4BOHA 3K6ZA 3MU8A 4MQAA 4OM9A 4U01A 3MO6A 5JB8S 1EASA 1W0ZU 1QNJA 4YXWD 2OQ5A 1W12U 3BTKE 2XYAA 3FN8A 3DD2H 3ITIA 1YKTA 3S9CA 1EQ9A 1BMFD 4WVPE 2WZQA 3VB3A 5TJXA 1NRQH 4E05H 6ESTA 4Q7XA 2ILNA 3RM0H 4WY3A 3QTOH 1DFPA 2OP9A 3RXJA 3NUMA 1MCTA 3BTQE 3M5NA 5LPRA 1G3EA 3ZZ5A 2QN5T 2ZA5A 2JH6D 1ZRKA 3P8GA 4DIIH 3MFJA 3RMOH 3KCGH 1V2PT 5K0HA 4IN1A 4KTSA 1NFUA 3PYHA 3WW7A 4B73A 3FP7E 4K60A 1NO9H 3S0NA 5JBBS 1Z71A 1DVAH 5DJ7A 2GKVE 1GL0E 3GCHB 4RSPA 3SNEA 1EAWA 1JWTA 1O3DA 1GVLA 3DSGA 1Z8JB 2XC5A 5LPEA 4VGCB 2PW8H 4X2XA 1FAKH 1TGNA 2XOKD 3MU0A 4XSKU 1GVZA 2FS9A 3UAIC 1PPEE 4J2YB 4WWYA 4X6MA 5HGGA 1MD8A 2M2AA 1NY22 5GCHG 1GBIA 3M37A 1LTOA 1SGYE 5C2ZA 3MO9A 4XOJA 4M9FA 3B23B 4OS7A 1TA6A 5T6DA 1O5EH 3SU1A 2AMDA 5L2YH 2HWLB 1HAZB 3RC4A 1GI4A 3M3VA 1WUNH 3TPIZ 2VH0A 1S0RA 2NWNA 3F0PA 1EPTB 1G9IE 2R2MB 2Z3EA 2YNAA 2G81E 2HPQH 1L1GA 1GG6C 4ZMAH 3SNBA 2HVXA 2VVUA 1F5RA 1TPOA 1KXEA 1O3IA 1TX7A 2QF4A 2XC0A 3BTME 2Y6TA 2RCEA 1ELVA 4FUJA 4BXSA 4DGJA 3OE7D 3DSPA 4AFSA 3TJUA 3M5OA 4AN7A 3SZNA 1HAHH 1BTXA 2QF5A 4INHA 1QY6A 2BQ7B 1A3BH 1BMNH 5IDKA 2AMPA 3U69H 3F2FA 3BTGE 4B2BA 3N7OA 3ODDA 1DSTA 3F6UH 3KQDA 5HKKD 1GHWH 5EXNA 5ETXA 2HRVA 1GHXH 1ZR0A 2ZCKP 3F68H 3F2HA 5BRRE 4MG3A 1AKSB 3MH5A 3U98H 3BTEE 2ZGHA 1FZZA 4DT7B 4ISNA 4ABBA 5DN6D 2ALPA 4YM9A 4X6PA 4NG9H 4TY6A 3V12A 1HB0B 3UQOA 1V2KT 1T7CA 4LK4A 2ESTE 1GI0A 2ZHFH 4UD9H 4ABFA 3VGCB 3QLPH 1C2IA 1XXDA 4K69A 1EKBB 1ZTLA 2FEQH 2ZHEH 1THSH 2VIVA 1B0EA 2ANWA 1P06A 3A80A 2AGEX 4DW2U 2F91A 1GJBB 1O3EA 1A0JA 1AKSA 1OWJA 2GMTB 2BVSH 3A8DA 3LJJA 4JCNA 3HKJB 1DITH 2ODYB 1K1OA 1K21H 3QGNB 1P01A 3K9XB 3SZEA 2J95A 2NU2E 3M7UA 4JZEH 4NGAH 4AX9H 1GMHG 4XRNA 3TLOA 4AG1A 1EX3A 1O2RA 4IBLH 4Q7ZA 3E1XB 3W94A 3KIDU 2CF8H 2BD3A 2ZDLA 3LH1A 3OTPA 1QB1A 1O2JA 2P93A 3B8JA 1WYKA 4D7GA 1EATA 1LQDB 4UFFH 3UR6A 4KP0A 2SGFE 2AYWA 1RGQA 3K65B 1GGDC 2RDEA 3OYPA 3OY6U 2Q6DA 3EAJA 3U8TH 1GBLA 3AAVA 3QZRA 4D76A 2H5DA 1AO5A 5LPFA 1COWD 2KCPA 4ABEA 1SKYE 3H5CB 1OOKB 2W26A 2FESH 3PM3A 3WWBA 1O33A 1KLIH 4Y79A 2BD4A 1BHXB 1GDQA 1LHEH 6LPRA 5GDSH 2Y81A 3LDXH 3OEHD 4JYVH 3PRDA 5HYOA 1B7XB 2GDEH 2BQWB 2JJ2D 2ZGJA 4GCHF 1ZZZA 1HNEE 1YCPM 2GCHG 2BZ6H 1SGIB 5F53A 2Y82A 3P17H 2GGVB 1UVSH 3VPKA 1K28D 1H8DH 2H1UA 3LC5A 4E7NA 2QC2A 5T1VA 1ANCA 3H09A 2B7DH 2VBCA 3LONA 1EUFA 2CMYA 4D9QA 2JDID 1EAUA 3DA9B 2WV4A 2TRMA 5EGMA 1AB9B 1HGTH 3EDXB 2FXRA 3QDZB 8ESTE 2FDAA 1ESTA 1AGJA 3SBKA 3RM2H 1U6QA 1TMUH 3TU7H 3ZZAA 5A0AE 3QO6A 1HAGE 1K22H 2FIRH 2GD4B 8GCHF 1ZSJA 3FAOA 3CNRA 3RXEA 4IS5A 1ELEE 2GCTC 3A85A 4I32A 1B0FA 2J97A 4R0IA 1TRMA 4ZH8A 2FLBH 1SLXB 3M35A 2FPZA 1KDQA 1MTUA 1VKYA 1UTPA 1K1PA 4OS2A 3UOPA 2QXJA 1MAXA 3ATMA 1MKXH 1MZDA 1V2RT 1C4V2 3RC5A 1TQ7B 1O0DH 1KIGH 2ZFPH 3MNCA 3SU4A 1SLVB 4AB9A 2ZF0H 1SL3A 1CT0E 1GJ6A 2PLXA 2ZU5A 1QJ7B 1UCYE 3SJ8A 1FY8E 4AORA 2Y7ZA 3E16B 3UPEA 3LGYA 3CENA 4Y71A 1GBTA 4XBDA 3U28C 2PSXA 1AUJA 1SSXA 1WQSA 1PQ7A 1XKBC 2ZPQA 5C0UA 1TGCA 1SFIA 1HFDA 4TPIZ 1BT7A 4K8YA 1G3CA 3ATWA 4WMFA 3M3SA 4E06H 1O2YA 1C5NH 1NT1A 3MWIU 1BBRE 1D6WA 1UTOA 3Q3XA 7ESTE 1EAXA 2ZIQH 4Z6AH 1MCVA 3DSOA 1IQNA 1BCUH 1KLJH 2FOBA 3FP8E 4H6TA 1C5TA 3RXOA 3ZVBA 2IJOB 2ZC9H 4AZ2B 1DM4B 1BTWA 3DUXH 1C5XB 4YOJA 1VCPA 1QBNA 3ZZ6A 1OSSA 1ZTKA 1GI7B 1DLEA 2V7QD 2P8OC 1IQGA 3KQBA 3RXKA 1HIAA 3KQEA 4O03A 1ID5H 2WSSD 4X1QU 3SV2H 4AFZA 1K1IA 1TOCB 1CGJE 1TNKA 2ZDKA 3VB4A 3MNXA 4WJG2 5T3HA 3RU4T 3TJOA 3PV4A 1C5QA 3GCOA 5EQQA 1SGEE 2Z3CA 5ESTE 2C8WB 1K1LA 1LHDH 3FVFB 2WHXA 4KKDA 2H9HA 5JBTA 3SW2B 2IJD1 4D7FA 2RFKC 1BMMH 1C4U2 2I6SA 1T4VH 4GVUA 2OQUA 3A81A 3HGPA 5F8TA 2JETB 3A84A 1O2XA 3PV2A 2CJIA 1P2IA 4B6EA 4DT4A 5AHGH 2YNBA 3PMAB 3UUZA 5EJZA 4FUBA 1KXFA 2Z3DA 5AFYH 4OGYA 1GWAA 4AFQA 1UHBB 3KF2A 4ZAEA 2QCYA 5DP5A 2M5TA 2C8ZB 2RA3A 2QXHA 1T8OA 4WH6A 4NA8A 1F5LA 1C2MA 1LPGB 1GJ5H 2SFAA 3GDUA 4NSYA 3SORA 1VGCB 1SGFA 3UTUH 3P95A 3BG4B 1DICA 1FN8A 1F5KU 5AF9H 1ESBA 2C4FH 4TWWA 2XCFA 3M61U 1BHXF 3MU4A 3VB6A 1F92A 2BOHB 4OS6A 1Z1IA 2O8UA 5HMAA 3PRBA 1DDJA 2W7UA 1E1RD 1H4WA 1K1JA 4E7RG 1G32B 2LELA 3KL6A 2D2DA 2AEIH 2FODA 1F0RA 4MPWA 1KMHB 1O2PA 3TH2H 3I29A 4X0WU 5T6FA 1OWIA 1ETTH 4WXIA 2PUQH 4CHAB 1QCPA 1SMFE 1O3NA 1GMCF 4O9VA 1Z1JA 3ZZBA 2XWAA 2C8XB 1KXAA 2Z9LA 1WQVH 2P94A 3LKWA 1QRZA 1MTWA 1MAYA 1FN6A 1O5CB 4D8NA 4I7YH 2Z9KA 1LKAA 1YPHE 1P0SH 2BDAA 4MNYA 2K8IA 1GDNA 2Z6BD 5FPYA 1G2LA 1C1WH 1B5GH 3RXCA 2A4GA 1FUJA 1H9HE 1V2ST 1EPTC 2XC4A 1LVYA 1SQAA 3Q00A 1O34A 5AFZH 4JMYA 2GT7A 1FPHH 2F9VA 1F2SE 3LGIA 1Z8GA 2TGTA 2ZI2H 2AHME 3QN7A 4A7IB 3AK5A 1TNJA 4YO9A 4B2AA 3BTDE 4NIYA 4TSFD 3LH3A 5C5NA 1Z7KA 2B5TB 1L2EA 1OHHD 2VJ1A 1ZHRA 1GJCB 5C1UA 1C2GA 1UMAH 3M5MA 1SC8U 3SUFA 1HUTH 1RD3B 2FOHA 3IWMA 1MKXK 1TNHA 3FP6E 5FX5A 4I8LA 2BY9X 1J15A 1EZQA 1NFXA 2J4IA 1XUHA 1WAYB 1O2WA 5EOKA 1Z8IB 4ABHA 3AW0A 2Y5GA 1O3FA 1HAIH 3TNSA 4CR5A 3PMJA 3GCNA 2W3KA 1XVMA 1K1MA 2QF0A 3V7TA 5FBIA 5B6OA 4RN6A 2ZDNA 2EEKA 3FKSD 1T32A 3QTVH 3FFGA 4IGDA 2OXSA 1NBMD 1NC6A 4IW4E 4JZIA 5E0GA 3W1EA 3BEIB 5T6GA 4XFQA 1QRWA 1TALA 1IQFA 1LPZB 3PTBA 4Q7YA 3SI3H 3FOAA 1QRXA 1JRSA 1MD7A 3AAUA 1A0HB 1O2IA 1TLDA 3GYMA 3VEQB 4NFEA 3RUOA 3TIUA 2FI3E 3BTFE 4ISIH 1ANEA 1G3BA 1UTJA 2GMTC 3Q76A 3PMBB 2BOKA 2TGPZ 1EZUC 2ZDAH 5FCKA 3DFLA 2BYAX 3SJ9A 3UQVA 2ZTYA 4JK6A 2FYRA 4ZHAA 4DURA 1GJ4H 3GDVA 1LHFH 3NWUA 1AY6H 3A89A 4ABAA 3EA9A 1A7SA 4NWKA 3MI4A 3TK6A 3K2UA 1JRTA 2ZO3H 4GPGA 5EJLA 1CVWH 3UNQA 3PTNA 4K1SA 3RMMH 3HPTB 1OP8A 3ZVAA 2VIOA 1IHTH 3KYFA 1UCYH 3O8BA 1ETRH 2Z94A 4F49A 2AGIX 3PB1E 1C5MD 5B6LA 2UWPA 4WXVA 1IQIA 2GT8A 2OTVA 4GCHG 4B71A 4X1PU 2B8OH 2J98B 1YPEH 2Z9GA 1O2VA 5DSFA 1YPKH 3FZDA 1CQQA 2B9LA 3MU1A 2Q6GA 1V3XA 1LHGH 2AMQA 2A32A 2FO9A 3MYWA 1TRNA 1XUGA 1NBME 2ZDMA 2K1QA 4BAHB 1OWHA 1P2MA 1S83A 1NM6A 2AGGX 1DY9A 1QB9A 5JBCS 1P2QA 5A0CA 5A09A 3T27A 1MKWH 3SUDA 2A5AA 4RKOB 2SGDE 8GCHG 4UFEH 2FTMA 1S81A 1O3OA 3SGAE 1MBQA 3SU2A 2J98A 1TIOA 3QWCH 3A7WA 4KELA 3U8OH 1CHOF 2J38A 1RTLA 1C5VA 3P70B 4X2WA 1PFXC 4X8TH 4DY7B 1S5SA 1J16A 1HJAB 1O3HA 5DP4A 1GBDA 1J17T 2IOTA 1AB9C 5C1YA 2BY6X 1WU1A 1W2KH 1H9IE 1J8AA 3MOCA 2WYGA 2CHAB 3A83A 2ZGCA 1T4UH 3SU0A 2ULLA 1Q2WA 4FUDA 3D62A 5DPAA 4GHQA 1DXPA 3F9HA 1JBUH 1VZQH 3ZVGA 1F0SA 1GVKB 2R0KA 3L3TA 1SGTA 1S6LA 1TGBA 2BZAA 4O97A 3TH3H 1ZJDA 1S85A 1AE8H 1YPGH 3RXGA 2V35A 2A7HA 4H6SB 4WMEA 2ODPA 1ZOMA 4NA7A 5DGJA 2ZZUH 3ZVCA 1G2MA 1BITA 1V2VT 2O8MA 1IQJA 1AVXA 1C1RA 3RXDA 2HOBA 3RP2A 2W3IA 1GI1A 4ZXXH 3GS9A 4AGKA 1A4WH 1Q31A 4WH8A 2SNVA 1NESE 1AWHB 3RXPA 3LU9B 1BJVA 2J34A 1C5RA 1ELCA 1H8ED 5F8ZA 3OY5U 2TGDA 2R9PA 3SUEA 1C5UA 2WPKS 2UWLA 1GBCA 2O8LA 1ZHMA 3BV9B 3E0NB 3RLYH 3T29A 1GJ7B 2XCNA 4LZ4B 4MDSA 1AD8H 2OINA 5KGOA 1BIOA 2XBWA 3TGIE 1QR3E 1TAWA 3BSQA 1UW7A 2GZ8A 1LPKB 1MQ5A 2O9QA 3T28A 1NROH 1ANBA 1FX0B 1YGCH 2D1JA 5C3NA 4X1NU 5CHAB 5HIZA 1P03A 1SGDE 3I78A
chains in the Genus database with same CATH topology
2BD2A 3SNDA 2BDYA 2C8YB 4SGBE 3IG6B 3A8AA 2R2WU 1GI8B 2DE9A 2J9NA 1DXWA 2FTLE 4UEHH 1BTUA 2ZPSA 3HATH 3E3TA 3ZV9A 5JBAS 4OS1A 1ZSKA 2BD8A 1RIWB 3RXAA 3NPSA 3MNBA 3T2NA 5DO4H 3GY6A 4YLQH 2CXVA 2FS8A 1Y59T 2PKSB 3L33A 3PO1B 3E6PH 4MNWA 1DE7H 1WCZA 1NTPA 2QA9E 1D3DB 2A4OA 4Q80A 2G51A 3VXFH 4FUCA 4AB8A 1GBAA 1PPGE 1N6XA 2Z7FE 4Z0KA 1ZTJA 1UTKA 4NZQA 2ZU1A 4BTIB 4ISHH 4O3UA 1WBGB 2ZHWH 3NZIA 2OBQA 4MPXA 3MH6A 1DOJA 2JETC 2QGRA 1GI5A 3M5LA 1SBWA 3U9AH 1HXFH 3F1SB 4Y0ZE 1O3AA 2EC9H 3CS7A 1UCYK 2TGAA 2PGQB 1UTMA 3A8BA 3GY2A 4DVAU 2ZU3A 4K2YA 2F9NA 5I25A 1O5DH 4X2VA 5EODA 1HAYB 1C1SA 3ZZCA 4WF8A 1VGCC 3S69A 3SJOA 1IQEA 3BG4C 3LJOA 4YLUA 1GHZA 1GMCG 3A82A 1O35A 3LC3A 1C5PA 1BBRK 1C5OH 1V2JT 1RXPA 3PLKA 3PWBA 1AVGH 1XUJA 2OC8A 2AERH 1KDQB 1FIWA 3H7OA 2D8WA 1FPCH 4UONA 1DUAA 1YC0A 1N1LA 3M7QA 3ZZDA 1MU6B 4ZHMU 1EP6A 2I6QA 2CF9H 1MKWK 1BRAA 1SVPA 7GCHF 5FXLA 2G8TA 1K2I1 1E38B 1NRSH 1VITF 1TGTA 1UK3A 1BRUP 1D6RA 2G00A 3EA7A 2FLRH 1V2UT 1DWBH 1NU7B 4CHAC 3SGQE 3UNRA 4FUGA 2VWLA 1W3CA 3TK5A 2V0BA 4CBOA 1PPBH 1UTNA 1FV9A 4NFFA 2BX3A 4KGAA 5C5OA 1Y3VA 1HJ8A 1O2KA 2A7JA 2QY0B 1O5BB 1XX9A 5DK1A 3RXSA 5JB9S 1ETSH 2SGEE 2XWBI 1O38A 2F3CE 1GG6B 1GBHA 1BTZA 2TPIZ 9ESTA 4AYYB 2Q1JA 1HAPH 8KME2 1YPHC 4JYTA 2FOFA 4KTCA 4OS4A 1HYLA 2V6NA 3SJKA 1UVTH 2XW9A 1KXDA 3NK8A 3BIUH 5EQRA 1SQOA 2G5NA 6CHAB 3TJVA 3LT3A 1DWDH 1TBQH 1E34B 1GBKA 1FY4A 3RXHA 1C1QA 4M7GA 4O3TA 1HIAB 1QA7A 3B9FH 4AOQA 4FUFA 4YT6H 1TX6A 1C1MA 4CRBA 3ZZ7A 3BF6H 1TB6H 2V3OH 5ESBA 3ESTA 1IQLA 1W11U 2VU8E 5G4BA 1HAVB 2G4TA 1F0UA 2QV1A 1O2LA 1IQMA 1UK4A 1C1UH 2WPMS 3GY3A 5I46H 3T5FH 1K9OE 4GUXA 3A8CA 1GCDA 3BEFB 2PR3A 2HALA 4ISLA 4H4FA 3Q77A 1SHHB 1A0LA 1PPCE 2P16A 4FVBA 1GCTB 5DP3A 1KLTA 1D3TB 1SPJA 2F9BH 5TCCA 1TOMH 3GY5A 2UUKB 4HFPB 1NU9A 1ZYOA 4NWLA 1SGFG 1NPMA 1GI3A 2FM2A 3V13A 1MMJN 1HAVA 2WPLS 1O3BA 1IHSH 3STIA 2CV3A 4X6OA 2F83A 2D26C 1TNIA 2ZHQH 2IPHA 4A6LA 1CBWB 4JK5A 1TABE 1GHBF 2O8TA 3U1IB 2GTBA 4I8KA 4SGAE 4NA9H 1JIRA 2C90B 2BY8X 2R3YA 1O2HA 3QUMP 1RRKA 1TYNA 4MPVA 3Q3YA 1YLCA 1YPLH 2VNTA 5E8EH 1IQKA 2G4UA 1AFQB 2A0QB 1GJ8B 3PLPA 1BMLA 1ABJH 1V6DA 6GCHF 1CHOG 1SOZA 3AW1A 3DFJA 2PV9B 4QT8C 4ASHA 1P04A 1D3QB 1MQ6A 4AYVB 5BPEA 4XBBA 1O2ZA 3MO3A 4IN2A 1P02A 1PPFE 4UFDH 1FQ3A 1TBZH 3A86A 1T31A 3BG8A 3BTWE 4Y8XA 4ZKSU 5F03A 3GCHC 1QFKH 4CREA 2QYIA 2XNIA 1XXFA 2OUAA 3RXLA 1N8OB 2P59A 1KSNA 1DWCH 3ATKA 4DG4A 3OTJE 1EJAA 4VGCC 3A7XA 1O3CA 3A7VA 1VJ9U 2XBXA 5JYIA 2TBSA 5CE1A 1P2JA 2QIQA 2AS9A 3G01A 3R3GB 1ZMJA 1T8NA 5FPSA 4ABIA 4ABDA 4BTUB 1UK2A 2UUFB 3NXPA 1C2FA 1QBVH 3MMGA 1UTQA 2CHAC 3SI4H 3SHAH 1EXFA 1PYTC 2ZGBH 3GISB 1J14A 1TRYA 4LZ1H 2CN0H 2XBYA 2P3UB 4U2WA 1LCYA 3EE0B 1YYY1 2J2UA 3PLBA 4WMDA 1XKAC 1CA0B 4FVDA 3RXMA 2F9UA 5HM9A 2FX6A 1O2QA 1GHAF 1SHYA 2BDHA 1TMTH 3C27B 2VH6A 3RXFA 1O2SA 3HK3B 1AI8H 3RLWH 1P12E 2A2QH 1D4PB 3KN2A 2ZP0H 1C2LA 1KYNA 3LOXA 2VINA 1GBJA 1EJNA 3VB7A 4ZKRU 2FX4A 2ZPRA 2G5VA 2O8WA 2R0LA 2SNWA 2J94A 2H6MA 3C1KA 1GHYH 1C5SA 4R8TB 1ZMNA 2ZQ1A 1AZZA 1ACBE 3P92A 5F8XA 4Y6DA 1FLEE 1CHGA 3URDA 4CBNA 4FUIA 2STAE 1LQEA 3SU6A 5EQSA 1JIMA 4BNRA 3GY7A 1OWKA 2FOMB 3M36A 2JH5D 4CRCA 1GMDF 3SOSA 1HAOH 2VWMA 2WPHS 1O30A 4B76A 4THNH 5EW1H 1XM1A 2A4RA 4YOGA 1QURH 1P3CA 3VGCC 1MUEB 3RXQA 5CHAC 5DG6A 3RMNH 2HLCA 5EU8A 1LKBA 4Y10E 1TNLA 2FYQA 2PKAA 1WTHD 1PQ8A 5L6NH 1P09A 5EPNA 2GZ9A 3DHKH 4X2YA 1TA2A 1BTPA 4FU7A 1OYTH 3GCTG 2BD9A 4BAKB 2J92A 2ASUB 1RTFB 2P8OB 3DT0H 3A7ZA 1QJ1B 1MTSA 5E2PA 1Z6JH 1FNIA 1HJ9A 1PYTD 3ODFA 4ZKOU 2DE8A 2FZZA 4LOYH 3ZZ3A 3ENSB 4I8HA 1SLWB 3GY8A 3RC6A 2ZEBA 1QTFA 2ZFTA 1O3JA 4OGXA 2A31A 2OC0A 2HNTF 1C2KA 4A1VA 1C5WB 2PKSC 2QF3A 2LNCA 3PO1C 1SQTA 4NIWA 1HAXB 3URCA 1C2EA 1UO6A 4H42U 1C1NA 2BB4A 4I8JA 1Q3XA 2G52A 1NS3A 4X6NA 4DCDA 1CGIE 3RXBA 4I31A 2Y7XA 1SI5H 1A2CH 1AWFH 1C9PA 3AVZA 1C5YB 1NFYA 3GY4A 4B1TA 2VVCA 3ZZ8A 1EOLA 1ELGA 2NU0E 1BBRH 3P8NA 1RTKA 3S7HB 3SU3A 5SGAE 1L0ZA 1P2NA 1CGHA 1MH0A 1LDTT 5E2OA 1ORFA 2ZCLP 4U32A 1V2MT 1ARCA 4Y8YA 5FAHA 2RDLA 3SV6A 2H2ZA 1N6YA 7GCHG 1A46H 1CSOE 3MNSA 4GHTA 4IC5A 1VITG 3EGKH 4KTUA 1BJUA 2UWOA 2ZU4A 1FONA 2QXGA 1BZXE 3GYLB 2DUCA 3RMLH 4CRAA 3LPRA 3RXUA 3LGUA 1S0QA 5H4IB 1O3LA 4ZUHA 2BLOA 2CGAA 4OS5A 2F9PA 3A87A 1C1PA 3TNTA 3S9BA 1IQHA 1ANDA 5FBEA 4AG2A 1S82A 2BDBA 5GPIB 3V3MA 1RJXB 1EOJA 1KXBA 1MZAA 1YCPH 2H5CA 3KHVA 4MPUA 4UDWH 1QQ4A 1O5FH 3S9AA 3MH7A 3UY9A 3VFEA 1FMGA 1THRH 2Y5FA 1AU8A 2WPIS 4XE4A 1QB6A 4ZXYH 1DANH 4B75A 3MTYA 4D9RA 5L2ZH 2EI7A 1SGNE 2ODQA 5AVDA 3STJA 5DP9A 4ABJA 1Y5UT 1GBBA 2ZKSA 1FY1A 1CU1A 1BOQA 4Q2KA 4RKJB 1FAXA 1HDTH 2B0FA 2ZWLH 1P10A 3SV7A 2NU1E 2VIQA 3D65E 1TX8A 3LIWA 4FXGH 1OP0A 5A0BA 1G30B 1FY5A 1O3GA 1ZSLA 5A8YA 4YESB 4Y76A 1C2DA 1HCGA 1XMNB 3BIVH 4IC6A 1KTSB 1BDAA 3WY8A 1D3PB 3O8RA 1LHCH 3A7TA 5JPMH 1ZPZA 2VGCB 2GP9B 2BQ6B 1CA8B 2WUCA 1ESAA 3PROA 3W95A 2ANKH 1XVOA 2THFB 1P11E 5GXPA 1WOFA 3GICB 1QL7A 1INCA 2EI8A 2FOAA 2GX4A 1OS8A 6CHAC 3SHCH 3KEEA 1PQAA 4FUHA 2WPJS 5K7RA 3BEUA 1YBWA 1TPAE 3OX7U 1S84A 4GSOA 2BY5X 1KXCA 1LVBA 1DS2E 1EPTA 2FOGA 4K1EA 1OYQA 1F7ZA 2ZECA 3BTTE 1HLTH 1FI8A 1OP2A 1ARBA 2BDIA 5ABWA 4MLFB 5EW2H 1PJPA 2BVXH 1C5ZB 1O3PB 1YPMH 3L6PA 1MTNB 1A5IA 4IMZA 1O32A 1SR5C 3V0XA 1ZLRA 3OU0A 2K7XA 1O3MA 1X7AC 2BY7X 4A1XA 3VXEH 2A1DB 1GHBG 1GJDB 1PQ5A 1O5GH 3M3TA 1UTLM 2ANYA 1FJSA 5TCAA 4BAMB 3UREA 1P57B 2XRCA 3ZYDA 1BUIA 2UUJB 1W10U 1AE5A 1GCTC 1AQ7A 1O39A 2JKHA 4TPYA 3O8CA 1P3EA 3SO3A 2HNTC 4CRGA 2PWXA 2AIPA 2A5KA 4NIVA 1AVWA 3GDSA 2ZTXA 1P9SA 2XXLA 1V2OT 2Y80A 1FDPA 3ATLA 6GCHG 1A5HA 3MHWU 3I77A 3SJIA 4GAWA 4B74A 1C4Y2 4ISOA 4NSVA 3GCTF 1CBWC 3LGTA 4MVNA 4X1RU 2ZQ2A 2GVFA 2H9TH 2WYJA 1GDUA 1ELAA 3MU5A 4J1YA 1NRRH 1NRNH 3E0PB 2Z9IA 1ELDE 3P6ZB 3SGBE 2Y5HA 1CT4E 1EB2A 4Y7BA 1V2WT 1DX5M 2BVRH 2LPRA 1A5GH 1CO7E 4YTAA 2OD3B 2ZFSA 5A2MH 1AFQC 2ZU2A 1ELTA 1BMAA 5HXFA 1AIXH 2ZFQH 4JYUH 1XUFA 1T8MA 2SGPE 5C1XA 2EA3A 1QL8A 4YZUA 3T62A 1QA0A 1HBTH 2W5EA 3O8DA 4Y0YE 5GWZA 1S6HA 3TH4H 1XUIA 3EQ0H 5DP6A 1D9IA 1C1OA 2VIWA 1L4ZA 4ZHLU 1QIXB 2BDCA 4TWYA 3E91A 1W0YH 2A5IA 2GV7A 3K6YA 2OLGA 4CRDA 1SOTA 3MH4A 3S7KB 2BLWA 1O2NA 1LVMA 1IAUA 1C1VH 3ZZ9A 1OKXA 1BRBE 1Y5BT 1OPHB 5GJ4B 1ZHPA 1O2GH 1UVPA 3QX5H 2F9OA 2AH4X 1QQUA 1UVUH 1MU8B 1N8OC 2VIDA 3QZQA 5HM2A 1GHAG 5A8ZA 2FOCA 3CP7A 3RXIA 1G37A 1OWDA 5E0HA 1VCQA 2A4QA 1GI9B 1GI2A 2BLQA 3RXVA 1Z6EA 2VB0A 1NRPH 2VWOA 3QK1A 4CR9A 4X1SU 4PROA 2FOEA 5J4SA 1VR1H 1EP5A 1ZPCA 4JZFH 1WTGH 2WUBA 3RXTA 1YCPK 3QGJA 5C67A 1ZGIA 3BN9A 1TQ0B 3UIRA 2FMJA 1QHRB 1Y3XA 2ZCHP 4MNVA 1SGQE 2STBE 1Y3UA 1Y8TA 2VIPA 4JZDH 1C5LH 5F6MA 1LVOA 2W7SA 4TYDA 3SQEE 1CA0C 1V2LT 1E36B 1P9UA 1DSUA 2OC1A 2PHBA 1A1RA 3SNAA 2WV5A 2BHGA 1F0TA 2ANMH 4CH2B 3TJNA 1O31A 4NZLA 5LH8A 1VITH 1E35B 1W7GH 3JZ1B 2BLVA 5GCHF 5FPTA 2SGAA 1HXEH 1TPSA 1GMDG 3FANA 1P2KA 1AZ8A 3FZZA 9LPRA 1SLUB 2ZFFH 4BTTB 1BTYA 4K3JA 4A1TA 2GV6A 4Y11E 1P2OA 4HZHA 4AGJA 3ZYEA 2KAIB 4TY7A 1AMHA 5DP7A 1C2JA 1VJAU 2YOLA 3ATIA 2IN2A 2PFEA 4X8VH 4BXWA 5J4QA 3GOVB 4DOQA 2P3TB 3BTHE 2PSYA 3RDZA 2Q6FA 2GDDA 2HNTE 3D49H 1P05A 1QL9A 1WV7H 1EAIA 2SGQE 1GL1A 2BXUH 1W14U 1TE0A 3JZ2B 3RXRA 3UOUA 2PTCE 1K1NA 2FP7B 4ZKNU 1SB1H 1A3EH 1NN6A 1O37A 3R0FA 2ZGXH 2P95A 1Y5AT 2OBOA 2RA0A 1O2OA 2KAIA 3SU5A 1UVOA 2RG3A 5FX6A 2H9EH 3KNXA 1BQYA 1C2HA 4U30A 2PTNA 2BDGA 3KQCA 1C1TA 1RFNA 3H7TA 1L4DA 2ALVA 5L30H 1QBOA 2AFQB 1L1NA 3RU4D 1YP9A 8LPRA 1Z8RA 2P3FH 2BMGB 3ELAH 1YLDA 4A92A 1GBEA 4HI3A 4YT7H 5DP8A 1GGDB 1W7XH 5GIBA 2C93B 4GLYA 1PPZA 4I33A 1XUKA 1BB0B 4X8UH 5FCRA 2LIZA 1BA8B 3LGWA 1ZJKA 2EI6A 1GMHF 1THPB 3SV8A 3A88A 4K1TA 1ELBA 1KY9A 4K8BA 5C20A 1VCWA 1G3DA 1V2NT 1V2QT 4MNXA 1O2MA 3OSYA 1QJ6B 1YPJH 1L1JA 1SFQB 1NFWA 3UFAA 1DT2A 4HGCA 1TWXB 2QXIA 4NCYA 2BX4A 1CT2E 2PUXB 1E37B 4YOIA 2TIOA 1IOEA 2A7CA 5EXLA 1AN1E 3F9FA 3UWJH 1EZXC 2GZ7A 4HTCH 2BTCE 1FIZA 4LXBH 1TPPA 1LMWB 1BRCE 1TFXA 1M9UA 3EBNA 2R3UA 4Y7AA 3TK9A 2UUYA 2A45B