3N7OA

X-ray structure of human chymase in complex with small molecule inhibitor.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
223
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymase
publication title Potency variation of small-molecule chymase inhibitors across species.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 223
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3n7oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3n7oA02
3P8OA 3ZYEA 3RXTA 2PTCE 1C2GA 4UEHH 1WUNH 2ANKH 2BTCE 1XXFA 2UWPA 5LPFA 1QQ4A 6GCHF 1GGDB 4A6LA 1SQOA 5GPIB 1BTWA 3PWBA 3SQHE 1HAVB 5ESTE 1O3MA 1THSH 1AUJA 1AWHB 1AUTC 3BG4B 1O34A 3RXIA 5DGJA 1MD7A 5GJ4B 3KN2A 3SJIA 1C1OA 2ZGBH 5EU8A 5IDKA 2VWNA 3ZVCA 5EXLA 4ASHA 2AEIH 2WUCA 3T62A 1FIZA 1GVKB 1GJ9B 5T6DA 2JH5D 1ANEA 3OYPA 3PROA 3T2NA 3SU3A 5HXFA 2IPHA 3SORA 1ETSH 4AGKA 3M3VA 3O8RA 1WTGH 1DPOA 2ZPRA 3PMBB 2UWLA 4H4FA 2FYRA 1CA0C 4U30A 3MFJA 3LH3A 1BRBE 4J2YB 1H8IH 4KKDA 1U6QA 5GCHG 1GBFA 1OWKA 2QY0B 3G01A 4K60A 1O5BB 4TPYA 4TYDA 1KTTB 1S82A 2GDEH 2C4FH 3ZZ6A 1SGRE 1Y3VA 3ATMA 4WVPE 3BTFE 4Y71A 2O8WA 3QK1A 3OX7U 1H9LB 4ABIA 2HPPH 4ZXYH 1NFXA 1O38A 2Z9KA 4MDSA 2BDAA 2XNIA 1EPTB 4KP0A 3ATKA 4DCDA 4ZKRU 3RUOA 2PUXB 1W14U 3ZVBA 3A83A 1MTVA 3K65B 3P6ZB 1P03A 1ID5H 3GCNA 1PJPA 1C4Y2 3ZVGA 5LH8A 4O3UA 2FS9A 3A8DA 2ZU3A 3EQ0H 4GCHG 4JYUH 2G00A 5EQRA 4UFDH 1EATA 1P05A 2FLBH 9LPRA 4AFUA 1D9IA 2IJOB 1ELGA 5HMAA 5ABWA 2ZFQH 1L0ZA 4K2YA 1ZPBA 3SBKA 1K1LA 2FX6A 4B2CA 4AGJA 1A3EH 2A2XH 1CT0E 3ATLA 1WYKA 1QJ1B 4X6NA 2FOGA 1LQEA 2ZHDA 1O3AA 5LGOA 3DUXH 1F0TA 2Y5GA 5DP6A 2ZFSA 5FPTA 2A5AA 3BF6H 4Y6DA 2C3SA 1GDQA 2AGGX 1S0QA 4AYVB 1C5LH 5A09A 2V35A 1BITA 4DURA 1TIOA 2FXRA 2O9QA 2A0QB 3QLPH 1C2KA 3L6PA 4FUHA 3RXFA 1O30A 1C5SA 3TK5A 3V7TA 5E2PA 3RMOH 2R9PA 3GY4A 1B0FA 1UJ1A 3IITA 1Z71A 3WY8A 4YOGA 3GCOA 2Q6DA 3BIVH 5FBIA 4D76A 2FLRH 3U1IB 1TWXB 3PO1B 2GZ7A 1ARCA 5C67A 3A81A 1F92A 1YM0A 2M5TA 2ZA5A 3SGBE 1CBWB 1TBQH 2G52A 2VIPA 3F6UH 4H42U 3RU4E 1SGNE 2OCVB 3VB6A 1MBQA 2F3CE 2VNTA 5CHAB 3SV2H 3MU1A 1GG6C 5DG6A 4WXVA 2YNBA 1SB1H 1Z8GA 3RM0H 1EOLA 1LDTT 5T3HA 5GXPA 2PGQB 1ANDA 1CT2E 2W26A 5EQSA 1DOJA 4UFFH 1A4WH 1ABJH 1EAUA 2H6MA 1AHTH 1HGTH 5I25A 3E0NB 4WMEA 2IN2A 2B9LA 5AFYH 2SGAA 1V2NT 4K8BA 4NA9H 3F9HA 4FUEA 4ISLA 1C5YB 3KCGH 1DUAA 2ALPA 1HAPH 2KAIA 1O39A 1XUGA 2EI8A 3E1XB 4MPWA 1CT4E 2TRMA 3A8BA 2BY7X 1GHYH 5L30H 2RG3A 1BRUP 1GBHA 3LPRA 1DSUA 1F7ZA 1MTNC 2XRCA 3LGVA 2OBQA 1KLIH 4Z6AH 3H7OA 3LC3A 1GBJA 3NCLA 4O03A 1EP6A 1MZAA 2HGTH 4VGCC 4CRGA 3UNQA 1K28D 2ZDLA 3E6PH 2J94A 7LPRA 5T6GA 3K2UA 3PB1E 3EA8A 1ZPCA 2JETC 2Z9GA 4A92A 7GCHF 4IBLH 2ZI2H 1S84A 3TH3H 3CS0A 2GDDA 1WU1A 2OC0A 4THNH 1XX9A 1KXDA 4X2YA 3W94A 1GJCB 2Z6BD 2ZU4A 1DDJA 1TNIA 2ODYB 3V13A 2OP9A 3D49H 1ELEE 3A80A 4HTCH 1O2KA 1FN8A 3F9EA 4OGXA 5E2OA 5GDSH 1P01A 3F1SB 4NIVA 5GIBA 1C5XB 1TA6A 4A1XA 3VB4A 1F5KU 1NESE 1PYTD 1C5TA 1KDQB 4JK6A 3K6YA 3KIDU 3ZVEA 1YCPH 4X1QU 4R8TB 3SUEA 1SLVB 1P3CA 1EAWA 1SOTA 1DSTA 1BMMH 1N6YA 5DP4A 3EGKH 1GL1A 2O8TA 6ESTA 3M7UA 1GBLA 1IQHA 1T4UH 1V2PT 2BZ6H 4ABJA 4LZ1H 1AU8A 4NFEA 3P92A 1E0FD 4MNXA 1PFXC 1KXFA 3ELAH 2WUBA 2ZFRH 1J15A 3K9XB 3BTTE 1CGJE 4DY7B 4YLQH 3PMAB 3JZ2B 3RXDA 1F0UA 2WPLS 3MWIU 1ZSKA 4WMDA 1O3GA 1F5RA 1E38B 4Y7AA 3K6ZA 2STAE 2UUJB 1AQ7A 1RFNA 3TGJE 3AASA 1MUEB 4JZFH 1UTKA 4XBBA 2ALVA 2ZEBA 2C8WB 2PSYA 1BJUA 3SHCH 3T26A 4ABAA 1O2PA 1HJAC 4ABGA 4X6MA 1K1IA 2AMPA 1A2CH 5E0JA 4YM9A 1Y5BT 1IHTH 5PTPA 3NUMA 3E0PB 6CHAC 3P8GA 2C8XB 2VB0A 1V2MT 4AG1A 1TGSZ 2J38A 5DK1A 1V2ST 2QC2A 1TGTA 1ZMJA 1TOCB 2ZFTA 2A5IA 3MU4A 1SHHB 3QGNB 3RXPA 4R0IA 2BXTH 3D23A 3B8JA 1LVYA 1SLXB 3GDUA 1ZR0A 1YPMH 1Y3XA 2J95A 2QXHA 1V2LT 2SGQE 3FVFB 1HXFH 2GMTB 2ANWA 3ODFA 1ZPZA 4D9RA 1MCTA 1ZTKA 3GY2A 1GI3A 3A86A 2AS9A 3TJNA 1HPGA 1DANH 4NZLA 3Q76A 5F8ZA 1GI7B 2Y5HA 2FYQA 1ZRBA 4KTUA 3I29A 5LPEA 1ELFA 4HGCA 1ELDE 2DE8A 1LHFH 1P11E 3BTEE 1HFDA 1EZXC 4HZHA 1GHZA 1BB0B 3PTBA 2FX4A 2Z9LA 3SUFA 1J14A 4CH8B 1C1WH 1O2LA 4ZKOU 3QWCH 2A4GA 3OSYA 1N8OB 7GCHG 1MTUA 1NO9H 1O3OA 2TBSA 4JCNA 3VXFH 1HUTH 3ATWA 2JH0D 3DFLA 1TNHA 1GI6A 2A7CA 4XSKU 2SGFE 1FNIA 1YF4A 1X7AC 1A5HA 2PKAA 1EZSC 1EQ9A 2VINA 3DA9B 2Y80A 4D7GA 4NG9H 4TY6A 1EB1H 4FU8A 3AAUA 3SNEA 1VITH 2FOEA 1V2TT 3ZZ9A 4YTAA 4IS5A 4AFSA 1C2DA 4YT7H 1O3JA 5HYOA 1RS0A 1SFIA 1GCTC 2BLOA 2J2UA 3ZZ5A 2D8WA 1IQNA 2G5VA 2HLCA 1UK4A 3SV8A 2DE9A 1BTXA 3ZZ8A 5FXLA 1XUKA 3NKKA 1P2IA 3UNSA 2ANMH 4FUIA 4FUBA 4Y76A 1LPKB 1XUJA 5GCHF 1TGCA 2XCNA 1QRXA 3KNXA 4ISIH 2FIRH 5EQQA 4CHAC 3SOSA 1K22H 3SO3A 2ZHQH 3PLBA 5I46H 3U69H 1TYNA 3V0XA 2QCYA 5FCRA 3P8FA 3BIUH 3F9GA 3VPKA 2Y7ZA 1UVSH 2XTTB 3VEQB 1GJBB 1C5UA 1C9TA 1KXEA 1BQYA 3ZVAA 4ABHA 1IQIA 2FOFA 1IQGA 1CA0B 1O5EH 1K9OE 4JZ1A 3TNSA 1LVOA 1C1VH 1V2VT 3M7TA 4CRBA 4IN2A 1TX8A 3A8AA 2H1UA 1F2SE 1OP0A 3AW1A 2ZC9H 1TQ0B 3NWUA 3SJKA 1B7XB 1O35A 2TGDA 1VJ9U 3SJ9A 1O2RA 1KIGH 3BSQA 4CREA 1ZMNA 1W0YH 5E0HA 1AVGH 2A5KA 1BMLA 2AMDA 2QGRA 1P8VC 1NRPH 1GI8B 3LH1A 1ZSLA 2J34A 3A7YA 2FO9A 4LZ4B 2BM2A 1L4DA 2G5NA 4I8HA 1BBRK 1JXPA 1GCDA 1Z6JH 1HNEE 1QBOA 4AB9A 4X6PA 2HALA 5EW1H 2BD2A 2ZDKA 1HAXB 1IQFA 2GKVE 2EA3A 2ZNKH 4IMZA 5HM9A 1FY3A 2PV9B 2P59A 1O3FA 1ZYOA 5TCCA 1MD8A 1WV7H 1T8NA 2ZIQH 3SGQE 1YGCH 3SNCA 4CH2B 2ODQA 3SHAH 4DIIH 3RC5A 2VWMA 2BVXH 1UTNA 5A8XA 2ZWLH 1S6HA 2XBVA 1Q31A 4Y0ZE 1GI2A 4YOIA 2VGCB 4CR5A 1AB9C 1UVTH 1NPMA 4JYTA 3UTUH 2GV7A 3VGCB 4Y8XA 1DWBH 1NRRH 3OY6U 1C2IA 2P95A 2Z3EA 2KAIB 2FWWA 4E05H 8LPRA 3M7QA 1OWEA 1XXDA 1ZRKA 3ZVDA 4BAMB 5EPYA 1P2KA 1G3EA 5AVDA 3I78A 1XVMA 3AVZA 5F6MA 4IGDA 4WF8A 2SGDE 2AIQA 2I6QA 5FPSA 2ZQ1A 2RDLA 3JZ1B 1V3XA 3TJUA 5JBAS 2FM2A 3I77A 4OS5A 3UOPA 2GT7A 2PGBB 4ISNA 3STIA 2PLXA 4CR9A 4NCYA 4OS1A 2OLGA 4UD9H 3TNTA 2OC8A 1ZGIA 1CHGA 3SU6A 4UDWH 4ZHMU 1O2IA 2BLVA 3UOUA 2BMGB 3BEIB 1C1SA 1DUEA 3SI4H 1WSSH 1P0SH 3RU4D 1HV7A 1GVZA 3FP7E 2Z7FE 3MOCA 1O2HA 4D9QA 4H6SB 1ZHMA 1FLEE 1MCVA 2AERH 1J16A 2XWBI 3BTME 3LU9B 3P8NA 5BPEA 1Z8IB 2EI6A 4K5ZA 1XM1A 2F83A 1S83A 3D65E 1UTOA 2PTNA 4K1TA 3M35A 4AFQA 1EB2A 1Q2WA 2WV4A 1QR3E 3UY9A 1JRSA 4AX9H 4MNWA 2XC4A 3KF2A 2F91A 3HPTB 4BXWA 3KQEA 1SGDE 1JIRA 1JBUH 1GHWH 2QF3A 1EZUC 1MTNB 3MNCA 1UCYH 3SU2A 2WYGA 4NGAH 1OWIA 2OC1A 2GVFA 2OD3B 3W95A 3RC6A 7ESTE 1WBGB 1VCQA 1EP5A 1EOJA 2WPHS 3S0NA 3BEUA 1GDUA 3LOXA 3MH4A 4ZHAA 1P2OA 2JETB 1C1TA 1LTOA 1UO6A 1FY5A 4X1SU 1SGFG 2YNAA 4CRAA 1LKAA 1O5AB 3HKIB 1MKWH 4JZIA 1GI4A 1O2TA 3MO9A 1XKAC 1DFPA 1GBCA 2V3OH 1BT7A 3Q77A 4F4OC 1TGBA 3MU8A 4UE7H 4DG4A 1AGJA 3O8DA 1GMHF 1NRSH 1ZSJA 2BY5X 2VIVA 4U01A 2ZFPH 2FP7B 2Z9JA 3C1KA 1P9UA 3DT0H 1QL8A 1Z7KA 1O5DH 1FMGA 1ELTA 2ESTE 2WPKS 3A8CA 4BANB 4OS2A 3QZRA 1ACBE 1BZXE 2PWXA 4CRCA 1FAKH 4K69A 1YPHE 3FAOA 3IWMA 4DT7B 5A2MH 3RM2H 1FXYA 1BTUA 1XUIA 1QTFA 1GWAA 2G4UA 1RIWC 8KME2 1BHXB 1O2OA 3PWCA 4MPUA 4NSVA 1ESBA 1T7CA 4UONA 4X1RU 1NU9A 1W12U 4ZXXH 1KY9A 1DWEH 1JMOH 4TY7A 3SU1A 2XBYA 5DP3A 3TK6A 2OQUA 5K0HA 1C5QA 2B0FA 1C9PA 2FTMA 4ESTE 1P06A 3OU0A 2VIQA 2BD5A 3RXJA 1KTSB 2W3IA 4YLUA 5FCKA 3ZZBA 2VIDA 2OXSA 1L1GA 1GJ6A 1HBTH 2P8OC 5EXNA 5C20A 3RXOA 1O5GH 3M3SA 2P3TB 2BDIA 4I8LA 2WPMS 3TH4H 2EEKA 4WMFA 3NK8A 5L2YH 1UTLM 1EAXA 2Q6FA 1MQ6A 4SGAE 4U32A 4ZHLU 1HRTH 4X6OA 3HATH 1GVLA 2A2QH 1TOMH 4UFGH 5AFZH 3O8CA 1QA7A 1V2RT 3A85A 3MH5A 1NRQH 2EC9H 2AGIX 2ZQ2A 1MU6B 4IMQA 1AY6H 1HIAA 1EASA 1VGCB 3BG4C 1ZLRA 1JWTA 4JMYA 8ESTE 1OP2A 2BDHA 1P09A 5FX6A 3LGYA 1SGYE 3S7HB 3MMGA 1P2JA 1S85A 3U98H 1C5VA 1HJ8A 3MH6A 1HJAB 1WTHD 4AZ2B 1VCPA 4DJZB 1UTMA 3UPEA 2BY6X 1W11U 2PKAB 3ZZ4A 2VVVA 4NA8A 1EUFA 3M5LA 1QL7A 1CQQA 1ETRH 3A89A 1ANBA 2H9HA 2ZU2A 3BTWE 2IOTA 2QIQA 2UWOA 1L1NA 1FV9A 3SZNA 5DKMA 1Z6EA 3LGTA 1L4ZA 5C5NA 3P17H 3R0FA 1LO6A 1BA8B 4FVDA 4FU9A 2Z9IA 3GY3A 3BN9A 2XW9A 1F0SA 1IQLA 3IG6B 3RXQA 3SV6A 2YOLA 1CHOF 2BD4A 2A4QA 1W0ZU 1EAIA 1EPTC 1UK2A 4KTSA 1V6DA 4AG2A 2Y5FA 1DLKB 1E34B 1BBRE 2ZGXH 3F9FA 1TPOA 2C8YB 5DP9A 1W8BH 5J4QA 1AFEH 1ZTJA 1OPHB 3FP8E 5T6FA 3E16B 2BLWA 1IQMA 3A7WA 1A46H 2FOAA 2GCHF 1SSXA 4B2AA 1QB9A 3GY5A 1RGQA 5DJ7A 2ZKSA 5C3NA 1A0HB 1IQKA 1GMHG 1AFQC 2Y82A 4BTTB 1XUHA 5C1YA 1CGIE 2ZECA 4OS7A 2OC7A 3F68H 1N1LA 1SPJA 2Y81A 3PM3A 2V3HH 2EI7A 1GBDA 5H4IB 4I31A 1QJ6B 3N7OA 1BRAA 1KXBA 2AH4X 4AORA 2GGVB 1GCTB 2HNTF 5A0BA 1VR1H 1D6RA 1BUIA 2W7SA 3MTYA 2QAAA 4X8TH 3CP7A 4FUDA 1GBEA 3U9AH 2ZHFH 1YCPK 3RMNH 4AYYB 3SJ8A 1FY1A 1GJ5H 1T8LA 1TPPA 3UQVA 4CHAB 4I33A 1C1NA 1FONA 1GHAF 1O31A 3M5MA 1J9CH 5F8TA 1EJNA 1TABE 2JH6D 1GBMA 2TIOA 2FOBA 5FAHA 4YESB 1H8DH 2QXGA 2H2ZA 2TGTA 2D1JA 3FFGA 3A7VA 1A7SA 1CBWC 4B71A 2UUFB 1KSNA 2BX3A 1D3TB 1CSOE 1ESAA 2AIPA 1BJVA 1SMFE 1SFQB 4A7IB 2ZPSA 2NU1E 1E35B 4ABBA 1FJSA 1Y5UT 3U8RH 4DVAU 3SUGA 2GD4B 1DWDH 4E7NA 1TX7A 2Z94A 4FVBA 2FI5E 3SU0A 3GY6A 2CHAC 2R2WU 2CF9H 1C4U2 3GYLB 5L6NH 4OS6A 2DUCA 4IN1A 3VFEA 2O8LA 3BTDE 5C1UA 4ABDA 4KGAA 2W7UA 4X2VA 2BOHB 1SOZA 1W7GH 1PPFE 1CU1A 2QXJA 1C1QA 1QBNA 2ZPQA 1SQAA 1O0DH 1FAXA 3GY8A 8GCHF 1QNJA 1MKXH 1BIOA 1AKSA 3PV4A 4OGYA 3ESTA 2FMJA 3O8BA 5E8EH 4OS4A 2VVCA 3LONA 3PLKA 4GHQA 2XC0A 2FTLE 2H9EH 2VIWA 4FUJA 4NZQA 3ZZCA 1THRH 2ZHWH 2WPJS 1MTSA 4ABFA 2GZ9A 2BDBA 2GV6A 1KXAA 3PYHA 5EGMA 3ATIA 1QQUA 3TK9A 4Q80A 3T29A 1MQ5A 2ULLA 1G36A 4CBNA 1TE0A 1OWJA 3GCHB 2C8ZB 1RTLA 1TLDA 5L2ZH 3MI4A 4INKA 2GP9B 1UVOA 5F8XA 1Z8RA 4GPGA 1CHOG 2FOMB 4I8JA 3L3TA 4K1EA 3UFAA 1TMUH 3DHKH 3UWIA 1O3DA 2XBWA 4XBDA 2BQ7B 3QN7A 1L2EA 1O3PB 1O2GH 1GBAA 2TGAA 2J4IA 4B73A 2BX4A 1YC0A 3T5FH 1IQEA 1LMWB 1GJAB 2CXVA 1O2ZA 2QXIA 1DVAH 1SGIB 2PHBA 3VXEH 4MPXA 1J8AA 1O3BA 1BTHH 2GCHG 5C5OA 1QURH 2UUYA 1AVWA 4FUCA 1TNKA 1P2MA 1Y8TA 1SGCA 1K1NA 2QF0A 1D3DB 2FZZA 1C2JA 1Y5AT 3DFJA 1BMAA 4ZUHA 3SNBA 3QO6A 1E37B 4NIYA 4QT8C 5FPYA 3RXCA 1TPSA 4FUGA 7KMEH 2NU4E 1SBWA 1BOQA 4X0WU 1HXEH 5FBEA 4LOYH 3KQBA 2HNTE 2C93B 4NFFA 1P10A 1A5GH 3EA9A 1GI0A 4E7RG 2VWLA 2CGAA 3B23B 2FEQH 4WXIA 6LPRA 2O8UA 1V2KT 1CA8B 1VCWA 5CMXH 4AN7A 1S0RA 2GTBA 1N6XA 3UR6A 3CENA 1AVXA 4ZAEA 2SGEE 1GHAG 1G32B 2HNTC 4ZKSU 3S9CA 3A7XA 1ZJDA 3UREA 5JB9S 2PKSC 3FZDA 4BAHB 5C1XA 1O3LA 3E8LA 4B2BA 1QGFA 5CE1A 5J4SA 4BNRA 2J9NA 1EJMA 3QGJA 1O36A 3M3TA 2CF8H 5JYIA 1AZZA 1TBRH 4AFZA 1YPEH 1VZQH 3GDVA 3H5CB 1BMNH 1GBIA 1EKBB 1OYTH 2BHGA 2QV1A 4GAWA 1H4WA 1FY4A 3LJJA 2A7HA 2ZG0H 1BTYA 5FHTA 2BLQA 3MO3A 1C5MD 3TGIE 4ZMAH 4X2WA 1ESTA 2GMTC 1WAYB 1W7XH 1HIAB 1V2WT 4WY3A 2QA9E 1LHDH 2XCFA 2FOCA 1Y3UA 4XFQA 5AF9H 2G8TA 1GBBA 1UTPA 1WCZA 4O3TA 3A87A 1HJ9A 2ZU1A 1HAIH 2NWNA 1TX6A 1YLDA 2H9TH 4WWYA 8GCHG 1DT2A 3AAVA 5JDUB 1D4PB 2ASUB 1ORFA 1O2SA 1YLCA 1S5SA 1AWFH 1QIXB 4FUFA 4NA7A 3H7TA 3LGWA 1Y3YA 1C2EA 3TIUA 1AN1E 2F9PA 1TRMA 3A82A 3U8TH 4NIWA 5A0CA 1C1UH 3RXSA 1QY6A 3DD2H 2GCTC 2OTVA 1G3BA 2B8OH 3HK3B 1ZMLA 3NXPA 3GICB 1N8OC 1NM6A 1AO5A 3E91A 2SNWA 4GUXA 4X8UH 1DY8A 3VB3A 2BDYA 2RCEA 1TB6H 5JBBS 3EA7A 3PLPA 3V12A 3M5OA 1QRWA 2CV3A 1H9IE 1P57B 3HGPA 4MQAA 1BTZA 4GHTA 2P8OB 1O2MA 1RTFB 2BDGA 5LPRA 1VITF 2ZDVH 1RRKA 1UK3A 2XYAA 2NU2E 1T32A 3MU0A 1BRCE 1IQJA 4TWYA 2FPZA 3STJA 1ELAA 1Y3WA 1O2YA 1OP8A 2OBOA 2VU8E 1TPAE 4XOJA 3RXRA 3RLWH 1O5CB 1C1RA 3M36A 2RA3A 2XXLA 3UNRA 4D7FA 3SN8A 2BDCA 2BY8X 4A5TS 1GG6B 1O3EA 2F9VA 2BY9X 2Q1JA 1MTWA 4ZKNU 1O3KA 2NU0E 2BD7A 2PFEA 1CVWH 3UWJH 1T8MA 2FESH 2A31A 3MNSA 1TMTH 1ARBA 1NTPA 2ZFFH 1DM4B 3KL6A 1GMDF 5ETXA 2ZCHP 1C1MA 1CO7E 1UVPA 1HB0B 4ISHH 1K2I1 2GX4A 1FIWA 3GCTF 1ELCA 3A84A 4CRDA 4XDEA 4U2WA 1LPGB 5JBCS 2SFAA 1OYQA 1G3DA 2ZTYA 1KLJH 1OWHA 2XWAA 2I6SA 2OINA 1GJ4H 1RTKA 2ZGCA 1KYNA 1SGEE 1OWDA 3L33A 3Q3YA 3SNDA 4VGCB 4KTCA 1Z1JA 2Q6GA 3UIRA 4A1TA 3RXLA 3BG8A 5DP8A 5A8ZA 1QCPA 1QA0A 1O3CA 1MZDA 5HGGA 1BHXF 3ZZ3A 4DOQA 1A3BH 2BYAX 1C4V2 4JYVH 3SUDA 1O3NA 5EPNA 1UVUH 3M37A 1G2LA 2HPQH 1EJAA 4E06H 5DP7A 2JKHA 2NU3E 2P3FH 1LHGH 1OS8A 3OTJE 1GHBF 1BTPA 2V6NA 1UCYK 1O2WA 1T4VH 2Y7XA 4XE4A 1YPKH 2A4OA 1PPCE 1THPB 1SI5H 2HWLB 1C5NH 4JK5A 2C90B 3HKJB 3EDXB 1YYY1 2BQWB 3TGKE 1FQ3A 1MKWK 1NC6A 2TPIZ 3TITA 2VH0A 3QZQA 1DS2E 3UR9A 3QDZB 5EOKA 1C2FA 3RXUA 5A8YA 1AFQB 1C2LA 2R3UA 2Z3DA 4YZUA 1S6FA 1AD8H 2ILNA 2VGCC 4Q7YA 1YPHC 3M61U 4MVNA 1HCGA 4LXBH 1P3EA 4AB8A 3GY7A 1FPCH 1C1PA 5AHGH 4I8KA 4H6TA 3VGCC 1P9SA 1C5RA 1YP9A 2G55A 2O8MA 1D3PB 5TCAA 3RXMA 3T28A 4SGBE 2AFQB 2VH6A 4UFEH 1AZ8A 1FUJA 3TPIZ 1GDNA 2BD9A 3NZIA 1W13U 1ELVA 1AKSB 2R0KA 5ESBA 4GVUA 1W3CA 1SVPA 4DGJA 1GI5A 2ZDMA 2W3KA 1GGDC 2J92A 1O32A 2A1DB 1Z1IA 2GT8A 1LHEH 1K1PA 1ZZZA 4RKOB 4INHA 1IOEA 3TU7H 4YT6H 3QTVH 3URDA 2BXUH 5EW2H 1TQ7B 1P2NA 1VITG 1SGFA 4BXSA 1GJ7B 5JB8S 1WQVH 4Y7BA 2ZU5A 3URCA 1O3IA 2HRVA 4Q2KA 4Y11E 4BTUB 5DPAA 1H9HE 2R3YA 1SLUB 4DIHH 1O2NA 4K8YA 6GCHG 3LKWA 6CHAB 1XKBC 1O2VA 1AMHA 2A32A 3FANA 1P02A 2FODA 2F9UA 4X2XA 1QB6A 1A61H 1NFUA 1H1BA 2CHAB 1NROH 4A1VA 3RXGA 3MYWA 4BAKB 1YPGH 2ANYA 1A5IA 3CS7A 1UTQA 3GOVB 2R0LA 1GMDG 3UUZA 1OOKB 2LNCA 1V2UT 1UHBA 4WJG2 1WQSA 4TPIZ 1MU8B 3RU4T 3ENSB 3GCTG 4XBCA 3ZYDA 1TONA 4BAQB 1L1JA 3TH2H 1K21H 3KEEA 4FXGH 3QUMP 1GPZA 2BD3A 3RC4A 3FZZA 1IHSH 1SC8U 5K7RA 1FZZA 3MH7A 2ZCKP 1HAVA 2GZ8A 2CN0H 1Z8JB 1SLWB 3Q3XA 1ZHPA 3A88A 3ZVFA 2XC5A 3SI3H 2LPRA 4AOQA 3VB5A 4I7YH 3P70B 3ZZAA 2FI3E 1RJXB 4M7GA 2WV5A 4CBOA 3NPSA 1ELBA 1EX3A 2PUQH 1FY8E 3BTGE 3RLYH 5F03A 3HK6B 1RXPA 3LIWA 1INCA 4GLYA 1GJ8B 3EAJA 4HFPB 2BOKA 1LPZB 1G3CA 1QJ7B 2H5CA 2VVUA 1GHBG 1RD3B 1SHYA 1W2KH 4D8NA 1TNJA 3BTQE 1TFXA 2VIOA 2HOBA 5TJXA 1UTJA 2FDAA 1HAYB 3BEFB 2FOHA 1TNLA 1PPHE 4I8GA 1S81A 3ZV8A 3SNAA 3RMLH 1YKTA 1KXCA 1TAWA 4B1TA 1AE8H 1PQAA 4MPVA 1YCPM 1IAUA 1DITH 2HVXA 3MU5A 4YO9A 2CMYA 1DY9A 4X8SH 2WPIS 3LGUA 3TJOA 1EPTA 3FP6E 2F9NA 3U8OH 2OUAA 2ZDNA 1D6WA 1HAGE 1B5GH 1TALA 2QYIA 1T8OA 4ZH8A 1SL3A 2ZP0H 2G4TA 3RXVA 4MLFB 1AE5A 3EYDA 1QL9A 1OXGA 3ODDA 2Y6TA 1C5ZB 2D26C 4HI3A 1QRZA 1LKBA 2SGPE 3PO1C 1OSSA 1DX5M 4X8VH 3MHWU 2ZGJA 1K1JA 2THFB 3PMJA 3T25A 1J17T 2ZF0H 2WINI 5CHAC 2ZZUH 4Q7XA 1VGCC 2F9BH 3ZZ7A 4DW2U 1P04A 1MAYA 1ETTH 1EZQA 3E90B 4KELA 1GBTA 1A0LA 1HDTH 2D2DA 1F5LA 3UQOA 1O2UA 1BCUH 1KLTA 5E0GA 3KQCA 3Q3KA 4BAOB 2PKSB 1F0RA 3E3TA 3MNBA 3PTNA 4MG3A 2ODPA 4NIXA 1P12E 3PMHB 1PQ7A 1ABIH 4INLA 1GMCF 5DO4H 1FPHH 2STBE 1SGPE 4O9VA 1NS3A 2UUKB 4WH6A 3A7TA 1MMJN 4X1PU 1UMAH 1QFKH 2W5EA 3C27B 1OX1A 3U1JB 1HAHH 1GL0E 4NWKA 1TRNA 4J1YA 4Y79A 3TLOA 3GISB 4ABEA 1C2MA 2F9OA 3SQEE 4GSOA 4NWLA 2PSXA 3RDZA 2ZGHA 1O5FH 5SGAE 4Q7ZA 1FI8A 3BV9B 3S7KB 1K1MA 3A7ZA 1PQ5A 1BDAA 1QBVH 3QTOH 1G9IE 5EXMA 1AB9B 1LVMA 4JZEH 4BTIB 1MKXK 1UCYE 2P93A 4IW4E 1GHXH 3GDSA 3EE0B 2PW8H 5G4BA 1LHCH 2FI4E 2R2MB 3LGIA 1HAZB 1JRTA 4FU7A 3RP2A 1PPEE 3MNXA 1NT1A 5HM2A 2GCTB 1WOFA 3GYMA 3S69A 1AI8H 4RKJB 2ZDAH 1CE5A 2B7DH 1TMBH 1W10U 3LT3A 2BQ6B 3ITIA 4MTBA 1DICA 1GBKA 2ZHEH 4JZDH 1OKXA 1PPGE 4WH8A 1XUFA 2BVRH 1ANCA 1E36B 1K1OA 1NN6A 1SGQE 1MBMA 1HAOH 4LK4A 1G37A 3KGPA 1V2JT 5FX5A 5DP5A 5EODA 1XMNB 4RSPA 3TJVA 1PYTC 3ZV9A 2Z3CA 3VB7A 2XBXA 1TA2A 1AIXH 5BRRE 4Y8YA 1SR5C 4K1SA 1NRNH 1NY22 2B5TB 1GHVH 4F49A 4NSYA 2ZCLP 4IC6A 2ZTZA 1LCYA 1MH0A 2OQ5A 3V3MA 2BD8A 1A1RA 1YBWA 2P94A 1TGNA 1LVBA 3S9AA 1O33A 1Q3XA 4RN6A 1ZJKA 4ISOA 1DLEA 1HYLA 2AGEX 3P95A 3SV7A 3SU4A 1O2QA 4K3JA 1DWCH 3OY5U 5JBTA 4MNYA 3RMMH 1GJDB 3Q00A 3S9BA 1D3QB 2A4RA 1G30B 1TRYA 1FDPA 2VWOA 5JPMH 1EXFA 3M5NA 3HGNA 3SW2B 1YPLH 2QN5T 5EG4A 1Y59T 1ZOMA 2K1QA 3SGAE 1NU7B 1MAXA 2P16A 2CJIA 4YOJA 5B6OA 3MO6A 2AMQA 3LJOA 1QB1A 1DE7H 1KDQA 3RXKA 2BB4A 2ZO3H 1C5WB 4B76A 2ZTXA 1BBRH 1B0EA 3D62A 1JIMA 1VJAU 3TVJB 4Y8ZA 1C5PA 1NFYA 1YPJH 1XVOA 4Y0YE 1ZTLA 4GCHF 2G51A 3LDXH 1G2MA 1PPZA 4TWWA 1SQTA 1NZQH 2H5DA 3ZZDA 1V2OT 9ESTA 2VJ1A 3RXEA 4MNVA 1GI9B 4CRFA 2A7JA 4IC5A 2V0BA 4X1NU 3T27A 2WYJA 2SNVA 2A45B 1DXWA 1T31A 1PQ8A 3LC5A 3SJOA 1DXPA 3SU5A 4ZROA 3B9FH 1QHRB 1V2QT 3RXBA 1GMCG 1PPBH 1SGTA 1O2JA 3RXAA 3SV9A 5IYTA 2TGPZ 2AYWA 4Z0KA 2RA0A 3AW0A 2FS8A 1C5OH 2BVSH 1NFWA 4BOHA 3KQDA 3KHVA 1RIWB 1TBZH 1GI1A 4I32A 1O37A 2PR3A 5A0AE 1FN6A 1SG8B 3QX5H 3R3GB 4PROA 1TNGA 1HLTH 3GCHC 5GWZA 2BZAA 4O97A 4B75A 3BTKE 1P2QA 1O2XA 1A0JA 1JOUB 4B74A 1C2HA 2P3UB 1M9UA 1LQDB 1CGHA 3RXHA 1ZHRA 4Y10E 5C2ZA 1O3HA 1ZGVA 1UHBB 3BTHE 2G81E
chains in the Genus database with same CATH superfamily
3P8OA 3ZYEA 3RXTA 2PTCE 1C2GA 4UEHH 1WUNH 2ANKH 2BTCE 1XXFA 2UWPA 5LPFA 1QQ4A 6GCHF 1GGDB 4A6LA 1SQOA 5GPIB 1BTWA 3PWBA 3SQHE 1HAVB 5ESTE 1O3MA 1THSH 1AUJA 1AWHB 1AUTC 1SQRA 3BG4B 1O34A 3RXIA 5DGJA 1MD7A 5GJ4B 3KN2A 3SJIA 1C1OA 2ZGBH 5EU8A 5IDKA 2VWNA 3ZVCA 5EXLA 4ASHA 2AEIH 2WUCA 3T62A 1FIZA 1GVKB 1GJ9B 5T6DA 2JH5D 1ANEA 3OYPA 3PROA 3T2NA 3SU3A 5HXFA 3F3BA 2IPHA 3SORA 1ETSH 4AGKA 3M3VA 3O8RA 1WTGH 1DPOA 2ZPRA 3PMBB 2UWLA 4H4FA 2FYRA 1CA0C 4U30A 3MFJA 3LH3A 1BRBE 4J2YB 1H8IH 4KKDA 1U6QA 5GCHG 1GBFA 1OWKA 2QY0B 3G01A 4K60A 1O5BB 4TPYA 4TYDA 1KTTB 1S82A 2GDEH 2C4FH 3ZZ6A 1SGRE 1Y3VA 3ATMA 4ASUD 4WVPE 3BTFE 4Y71A 2O8WA 3QK1A 3WWBA 3OX7U 1H9LB 4ABIA 2HPPH 4ZXYH 1NFXA 1O38A 2Z9KA 4MDSA 2BDAA 2XNIA 1EPTB 4KP0A 3ATKA 4DCDA 4ZKRU 3RUOA 1NBMD 2PUXB 2KM0A 1W14U 3ZVBA 3A83A 1MTVA 3SYJA 3K65B 3P6ZB 1E1RD 1P03A 3SZEA 1ID5H 3GCNA 1PJPA 1C4Y2 3ZVGA 5LH8A 4O3UA 2FS9A 3A8DA 2ZU3A 3EQ0H 4GCHG 4JYUH 2G00A 5EQRA 4UFDH 1EATA 1P05A 2FLBH 9LPRA 4AFUA 4YXWD 1D9IA 2IJOB 1ELGA 5HMAA 5ABWA 2ZFQH 1L0ZA 4K2YA 1ZPBA 3SBKA 1K1LA 2FX6A 4B2CA 4AGJA 1A3EH 2A2XH 1CT0E 3ATLA 1WYKA 1QJ1B 2PP6A 4X6NA 2FOGA 1LQEA 2ZHDA 1O3AA 5LGOA 3DUXH 1F0TA 2Y5GA 5DP6A 2ZFSA 5FPTA 2A5AA 3BF6H 4Y6DA 2C3SA 1GDQA 2AGGX 1S0QA 4AYVB 1C5LH 5A09A 2V35A 2YMSD 1BITA 4DURA 1TIOA 2FXRA 2O9QA 2A0QB 3QLPH 1C2KA 3L6PA 4FUHA 3RXFA 1O30A 1C5SA 3TK5A 3V7TA 5E2PA 3RMOH 2R9PA 3GY4A 1B0FA 1UJ1A 3IITA 1Z71A 3WY8A 4YOGA 3GCOA 2Q6DA 3BIVH 3PV5A 5FBIA 4D76A 2FLRH 4F55A 3U1IB 1TWXB 3PO1B 2GZ7A 1ARCA 2JJ2D 5C67A 3A81A 1F92A 1YM0A 2M5TA 2ZA5A 3SGBE 1CBWB 1TBQH 2G52A 2VIPA 3F6UH 4H42U 3RU4E 5EJZA 1SGNE 2OCVB 3VB6A 1MBQA 2F3CE 2VNTA 5CHAB 3SV2H 4HG6A 3MU1A 1GG6C 5DG6A 4WXVA 2YNBA 1SB1H 1Z8GA 3RM0H 1EOLA 1LDTT 5T3HA 5GXPA 2PGQB 1ANDA 1CT2E 2W26A 5EQSA 1DOJA 4UFFH 1A4WH 1ABJH 1EAUA 2H6MA 1AHTH 1HGTH 2QF5A 3E0NB 5I25A 4WMEA 2IN2A 2B9LA 5AFYH 2SGAA 1V2NT 4K8BA 4NA9H 2J97A 3F9HA 4FUEA 4ISLA 1C5YB 4B6EA 3KCGH 1DUAA 2ALPA 1HAPH 2KAIA 1O39A 1XUGA 2EI8A 3E1XB 4MPWA 1CT4E 2TRMA 3A8BA 2BY7X 1GHYH 5L30H 2RG3A 1BRUP 1GBHA 3LPRA 2XNDD 1DSUA 1F7ZA 1MTNC 2XRCA 3LGVA 2OBQA 1KLIH 4Z6AH 3H7OA 3LC3A 1GBJA 3NCLA 4O03A 1EP6A 1MZAA 2HGTH 4VGCC 4CRGA 3UNQA 1K28D 2ZDLA 3E6PH 2J94A 7LPRA 5T6GA 3K2UA 3PB1E 3EA8A 1ZPCA 2JETC 2Z9GA 4A92A 7GCHF 4IBLH 2ZI2H 1S84A 3TH3H 3CS0A 2GDDA 1WU1A 2OC0A 4THNH 4RT1A 1XX9A 2WHXA 1KXDA 4X2YA 3W94A 1GJCB 2Z6BD 2ZU4A 1DDJA 1TNIA 2ODYB 3V13A 2OP9A 3D49H 1ELEE 3A80A 4HTCH 1O2KA 1FN8A 3F9EA 4OGXA 5E2OA 5GDSH 1K0HA 1P01A 3F1SB 4NIVA 5GIBA 1C5XB 2L6OA 1E79D 1TA6A 4A1XA 3VB4A 1F5KU 1NESE 1PYTD 1C5TA 1KDQB 4JK6A 3K6YA 3KIDU 3ZVEA 1YCPH 4X1QU 4R8TB 3SUEA 1SLVB 3N7DA 1P3CA 1EAWA 1SOTA 1DSTA 1BMMH 1N6YA 5DP4A 3EGKH 1GL1A 2O8TA 6ESTA 3M7UA 1GBLA 1IQHA 1T4UH 1UW7A 1V2PT 1W0KD 2BZ6H 4TSFD 4ABJA 4LZ1H 1AU8A 4NFEA 3U28C 3P92A 1E0FD 4MNXA 1PFXC 1KXFA 3ELAH 2WUBA 2ZFRH 1J15A 3K9XB 3BTTE 1CGJE 4FETA 4DY7B 4YLQH 3PMAB 5KEDA 3JZ2B 3RXDA 1F0UA 2WPLS 3MWIU 2J98B 1ZSKA 4WMDA 1O3GA 1F5RA 1E38B 4Y7AA 3K6ZA 2STAE 2UUJB 1AQ7A 1RFNA 3TGJE 3AASA 1MUEB 4JZFH 1UTKA 4XBBA 2ALVA 2ZEBA 2C8WB 2PSYA 1BJUA 3SHCH 3T26A 4ABAA 1O2PA 1HJAC 4ABGA 4X6MA 1K1IA 2AMPA 1A2CH 5E0JA 4YM9A 1Y5BT 2W6JD 1IHTH 5PTPA 3NUMA 3E0PB 6CHAC 3P8GA 2C8XB 2VB0A 1V2MT 4AG1A 1TGSZ 2J38A 5DK1A 1V2ST 2QC2A 1TGTA 1ZMJA 1TOCB 2ZFTA 2A5IA 3MU4A 1SHHB 3QGNB 3RXPA 4R0IA 2BXTH 3D23A 3B8JA 1LVYA 1SLXB 3GDUA 1ZR0A 1YPMH 1Y3XA 2J95A 2QXHA 1V2LT 2SGQE 3FVFB 1HXFH 2GMTB 2ANWA 3ODFA 1ZPZA 4D9RA 1MCTA 4P02A 1ZTKA 3GY2A 1GI3A 3A86A 2AS9A 3TJNA 1HPGA 1DANH 4NZLA 3Q76A 5F8ZA 1GI7B 2Y5HA 2FYQA 1ZRBA 4KTUA 3WWFA 3I29A 5LPEA 1ELFA 4HGCA 1ELDE 2DE8A 1LHFH 1P11E 3BTEE 1HFDA 2KFWA 1EZXC 4HZHA 1GHZA 1BB0B 3PTBA 2FX4A 2Z9LA 3SUFA 1J14A 4CH8B 2JIZD 1YLNA 1C1WH 1O2LA 4ZKOU 3QWCH 2A4GA 3OSYA 1N8OB 7GCHG 1MTUA 1NO9H 1O3OA 2TBSA 3OE7D 4JCNA 3VXFH 1HUTH 3ATWA 2JH0D 3DFLA 1TNHA 1GI6A 2A7CA 5F53A 4XSKU 2SGFE 1FNIA 1QZ8A 2RFKC 1YF4A 1X7AC 1A5HA 2PKAA 1EZSC 1EQ9A 2VINA 3DA9B 2Y80A 4D7GA 4NG9H 3WW7A 4TY6A 1EB1H 4FU8A 3AAUA 3SNEA 1VITH 2FOEA 1V2TT 3ZZ9A 4YTAA 4IS5A 4AFSA 1C2DA 4YT7H 1O3JA 5HYOA 1RS0A 1SFIA 1GCTC 2BLOA 2J2UA 3ZZ5A 2D8WA 1IQNA 2G5VA 2HLCA 1UK4A 3SV8A 2DE9A 1BTXA 3ZZ8A 5FXLA 1XUKA 3NKKA 1P2IA 3UNSA 2ANMH 4FUIA 4FUBA 4Y76A 1LPKB 1XUJA 5GCHF 1TGCA 2XCNA 1QRXA 3KNXA 4ISIH 1YWUA 2FIRH 5EQQA 4CHAC 3SOSA 1K22H 3SO3A 2ZHQH 3PLBA 5I46H 3U69H 1TYNA 3V0XA 2QCYA 5FCRA 3P8FA 3BIUH 3F9GA 3VPKA 2Y7ZA 1UVSH 2XTTB 3VEQB 1GJBB 5HIYA 1C5UA 1C9TA 1KXEA 4P00A 1BQYA 3ZVAA 4ABHA 1IQIA 2FOFA 1IQGA 1CA0B 1O5EH 1K9OE 4JZ1A 3TNSA 1LVOA 1C1VH 1V2VT 3M7TA 4CRBA 1COWD 4IN2A 1TX8A 3A8AA 2H1UA 1F2SE 1OP0A 3AW1A 2ZC9H 2RDEA 1TQ0B 3NWUA 3SJKA 1B7XB 1O35A 2TGDA 1VJ9U 3SJ9A 1O2RA 2HLDD 2JJ1D 1KIGH 3BSQA 4CREA 1ZMNA 1W0YH 5E0HA 1AVGH 2A5KA 1BMLA 2AMDA 2QGRA 1P8VC 1NRPH 1GI8B 3LH1A 1ZSLA 3ZIAD 2J34A 3A7YA 2FO9A 4LZ4B 2BM2A 1L4DA 2G5NA 4I8HA 1BBRK 1JXPA 1GCDA 1Z6JH 1HNEE 1QBOA 4AB9A 4X6PA 2HALA 5EW1H 2BD2A 2ZDKA 1HAXB 1IQFA 2GKVE 2EA3A 2ZNKH 4IMZA 5HM9A 1FY3A 2PV9B 2P59A 1O3FA 1ZYOA 5TCCA 1MD8A 1WV7H 5EJLA 1T8NA 2ZIQH 3SGQE 1YGCH 3SNCA 4CH2B 2ODQA 3SHAH 4DIIH 3RC5A 3EE7A 2VWMA 2BVXH 1UTNA 5A8XA 2ZWLH 5GNDA 1S6HA 2XBVA 1Q31A 4Y0ZE 1GI2A 4YOIA 2VGCB 4CR5A 1AB9C 1UVTH 1NPMA 4JYTA 3UTUH 2GV7A 2F4LA 3VGCB 4Y8XA 1DWBH 1NRRH 3OY6U 1C2IA 2P95A 2Z3EA 2KAIB 2FWWA 4E05H 8LPRA 2WZQA 3M7QA 3OTPA 1OWEA 1XXDA 1ZRKA 3ZVDA 4BAMB 5EPYA 1P2KA 1G3EA 3FOAA 5AVDA 3I78A 1XVMA 3AVZA 5F6MA 1H8ED 4IGDA 4WF8A 2SGDE 2AIQA 1SKYE 2I6QA 5FPSA 2ZQ1A 2RDLA 3JZ1B 1V3XA 3TJUA 5JBAS 2FM2A 3I77A 4OS5A 3UOPA 2GT7A 2PGBB 4ISNA 3STIA 2V7QD 2PLXA 4CR9A 4NCYA 4OS1A 2OLGA 4UD9H 3TNTA 1MABB 2OC8A 1ZGIA 1CHGA 3FO8D 3SU6A 4UDWH 4ZHMU 1O2IA 2BLVA 3UOUA 2BMGB 3BEIB 1C1SA 1DUEA 3SI4H 1W0JD 1WSSH 1P0SH 3RU4D 1HV7A 1GVZA 3FP7E 2Z7FE 3MOCA 1O2HA 4D9QA 4H6SB 1ZHMA 1FLEE 1MCVA 2AERH 1J16A 2XWBI 3BTME 3LU9B 3P8NA 5BPEA 1Z8IB 2EI6A 4K5ZA 1XM1A 2F83A 1S83A 3D65E 1UTOA 2PTNA 4K1TA 3M35A 4AFQA 1EB2A 1Q2WA 2WV4A 1QR3E 3UY9A 1JRSA 1YY3A 4AX9H 4MNWA 2XC4A 3KF2A 2F91A 3HPTB 4BXWA 3KQEA 1SGDE 3OAAD 1JIRA 1S6LA 1JBUH 1GHWH 2QF3A 1EZUC 1MTNB 3MNCA 1UCYH 3SU2A 2WYGA 4NGAH 1OWIA 2OC1A 2GVFA 2OD3B 3W95A 3RC6A 7ESTE 1WBGB 1VCQA 1EP5A 1EOJA 2WPHS 3S0NA 3BEUA 1GDUA 3LOXA 3MH4A 4ZHAA 1P2OA 2JETB 1C1TA 1LTOA 1UO6A 1FY5A 4X1SU 1SGFG 2YNAA 4CRAA 1LKAA 1O5AB 3HKIB 1MKWH 4JZIA 1GI4A 1O2TA 3MO9A 1XKAC 1DFPA 1GBCA 2V3OH 1BT7A 3Q77A 3W1EA 4F4OC 1TGBA 3MU8A 4UE7H 4DG4A 1AGJA 3O8DA 1GMHF 1NRSH 1ZSJA 2BY5X 2VIVA 4U01A 2ZFPH 2FP7B 2Z9JA 3C1KA 1P9UA 3DT0H 1QL8A 1Z7KA 2EY4C 1O5DH 1FMGA 1ELTA 2ESTE 2WPKS 3A8CA 4BANB 4OS2A 3QZRA 1ACBE 1BZXE 2PWXA 4CRCA 1FAKH 4K69A 3F2GA 1YPHE 3FAOA 3IWMA 4DT7B 5A2MH 3RM2H 1FXYA 1BTUA 1XUIA 1QTFA 1GWAA 2G4UA 1RIWC 8KME2 1BHXB 1O2OA 3PWCA 4MPUA 4NSVA 1ESBA 3KYGA 1T7CA 4UONA 4X1RU 1NU9A 1W12U 4ZXXH 1KY9A 1DWEH 1JMOH 4TY7A 3SU1A 2XBYA 5DP3A 3TK6A 2OQUA 5K0HA 5C0UA 1C5QA 2B0FA 1C9PA 2FTMA 4ESTE 1P06A 2JDID 2VIQA 3OU0A 2BD5A 3RXJA 1KTSB 2W3IA 4YLUA 4ACBA 3ZZBA 5FCKA 2VIDA 2YMSB 2OXSA 1L1GA 1GJ6A 1HBTH 2P8OC 5EXNA 5C20A 3RXOA 1O5GH 3M3SA 2P3TB 2BDIA 4I8LA 2WPMS 3TH4H 2EEKA 4WMFA 3NK8A 5L2YH 1UTLM 1EAXA 2Q6FA 1MQ6A 4SGAE 4U32A 4ZHLU 1HRTH 4X6OA 3HATH 1GVLA 2A2QH 1TOMH 4UFGH 5AFZH 3O8CA 2IJD1 1QA7A 1V2RT 2KX4A 3A85A 3MH5A 1NRQH 2EC9H 2AGIX 2ZQ2A 1MU6B 4IMQA 1AY6H 1HIAA 1EASA 1VGCB 2LELA 3BG4C 1ZLRA 1JWTA 4JMYA 8ESTE 1OP2A 2BDHA 1P09A 5FX6A 3LGYA 1SGYE 4RT0A 3S7HB 3MMGA 1P2JA 2AHME 1S85A 3U98H 1C5VA 1HJ8A 3MH6A 1HJAB 1WTHD 4AZ2B 1VCPA 4DJZB 1UTMA 3UPEA 2BY6X 1W11U 2PKAB 3ZZ4A 2VVVA 4NA8A 1EUFA 3M5LA 1QL7A 1CQQA 1ETRH 3A89A 1ANBA 2H9HA 2ZU2A 3BTWE 2IOTA 2QIQA 2UWOA 1L1NA 2L74A 1FV9A 3SZNA 5DKMA 1Z6EA 3LGTA 1L4ZA 5C5NA 3P17H 3R0FA 1LO6A 1BA8B 4FVDA 4FU9A 2Z9IA 3GY3A 3BN9A 2XW9A 1F0SA 1IQLA 1NBME 3IG6B 3RXQA 3SV6A 2YOLA 1CHOF 2BD4A 2A4QA 1W0ZU 3OEED 1EAIA 1EPTC 1UK2A 4KTSA 1V6DA 4AG2A 2Y5FA 1DLKB 1E34B 1BBRE 2ZGXH 3F9FA 4ACAA 2K8IA 1TPOA 2C8YB 5DP9A 1W8BH 5J4QA 1AFEH 1ZTJA 1OPHB 3FP8E 5T6FA 3E16B 2BLWA 1IQMA 3A7WA 1A46H 2FOAA 2GCHF 1SSXA 4B2AA 1QB9A 3GY5A 5C17A 1RGQA 5DJ7A 2ZKSA 5C3NA 1A0HB 1IQKA 1GMHG 1AFQC 3DSPA 2Y82A 4BTTB 1XUHA 5C1YA 1CGIE 2ZECA 3F2HA 4OS7A 2OC7A 3F68H 1N1LA 1SPJA 2Y81A 3PM3A 3VG8A 2V3HH 2EI7A 1GBDA 5H4IB 4I31A 1QJ6B 3N7OA 1BRAA 1KXBA 2AH4X 4XRNA 2QF4A 4AORA 2GGVB 1GCTB 2HNTF 5A0BA 1VR1H 1D6RA 1BUIA 2W7SA 3MTYA 2QAAA 4X8TH 3CP7A 4FUDA 1GBEA 3U9AH 2ZHFH 1YCPK 3RMNH 4AYYB 3SJ8A 1FY1A 1GJ5H 1T8LA 1TPPA 3UQVA 4CHAB 4I33A 1C1NA 1FONA 1GHAF 1O31A 3M5MA 1J9CH 5F8TA 1EJNA 1TABE 2JH6D 1GBMA 2TIOA 2FOBA 5FAHA 4YESB 3UB0A 1H8DH 2WSSD 2QXGA 2H2ZA 2TGTA 2D1JA 3FFGA 3A7VA 1A7SA 1CBWC 4B71A 2UUFB 1KSNA 2BX3A 1D3TB 1CSOE 1ESAA 2AIPA 1BJVA 1SMFE 1SFQB 4A7IB 2ZPSA 2NU1E 1E35B 4ABBA 1FJSA 1Y5UT 3U8RH 4DVAU 3SUGA 2GD4B 1DWDH 4E7NA 1TX7A 2Z94A 4FVBA 2LP6A 2FI5E 4OM9A 3SU0A 3GY6A 2CHAC 2R2WU 2CF9H 1C4U2 3GYLB 3UAIC 5L6NH 4OS6A 2DUCA 4IN1A 3VFEA 2O8LA 3BTDE 5C1UA 4ABDA 5C0TA 4KGAA 2W7UA 4X2VA 2BOHB 1SOZA 1W7GH 1PPFE 4I86A 1CU1A 2QXJA 1C1QA 1QBNA 3F0PA 2ZPQA 1SQAA 1O0DH 1FAXA 3GY8A 8GCHF 1QNJA 3FKSD 1MKXH 1BIOA 1AKSA 3PV4A 2EQNA 4OGYA 3ESTA 2FMJA 3O8BA 5E8EH 4OS4A 2VVCA 5B6LA 3LONA 2XOKD 3PLKA 4GHQA 2XC0A 2FTLE 2H9EH 2VIWA 4FUJA 4NZQA 3ZZCA 1THRH 2ZHWH 2WPJS 1MTSA 4ABFA 2GZ9A 3PRDA 2BDBA 2GV6A 1KXAA 3PYHA 5EGMA 3ATIA 1QQUA 3TK9A 4Q80A 3T29A 1MQ5A 2ULLA 1G36A 4CBNA 1TE0A 1OWJA 3GCHB 2C8ZB 1RTLA 1TLDA 5L2ZH 3MI4A 4INKA 2GP9B 1UVOA 5F8XA 1Z8RA 4GPGA 1CHOG 2FOMB 4I8JA 3L3TA 4K1EA 3UFAA 1TMUH 3DHKH 3UWIA 1O3DA 2XBWA 4XBDA 2BQ7B 3QN7A 1L2EA 1O3PB 1O2GH 1GBAA 2KZ4A 2TGAA 2J4IA 4B73A 2BX4A 1YC0A 3T5FH 1IQEA 1LMWB 1GJAB 2CXVA 1O2ZA 2QXIA 1DVAH 1SGIB 2PHBA 3VXEH 4MPXA 1J8AA 1O3BA 1BTHH 2GCHG 5C5OA 1QURH 2UUYA 1AVWA 4FUCA 1TNKA 1P2MA 1Y8TA 1SGCA 1K1NA 2QF0A 1D3DB 2FZZA 1C2JA 1Y5AT 3DFJA 1BMAA 4ZUHA 3SNBA 3QO6A 1E37B 4NIYA 4QT8C 5FPYA 3RXCA 1TPSA 4FUGA 7KMEH 2NU4E 1SBWA 1BOQA 4X0WU 1HXEH 3F0OA 5FBEA 4LOYH 3KQBA 2HNTE 2C93B 4NFFA 1P10A 1A5GH 3EA9A 1GI0A 4E7RG 2VWLA 2CGAA 3B23B 2FEQH 4WXIA 6LPRA 2O8UA 1V2KT 1CA8B 1VCWA 5CMXH 1BMFD 4AN7A 1S0RA 2GTBA 1N6XA 3UR6A 3CENA 1AVXA 4ZAEA 2SGEE 1GHAG 2K0QA 1G32B 2HNTC 4ZKSU 3S9CA 3A7XA 1ZJDA 3UREA 5JB9S 2PKSC 3FZDA 4BAHB 4F48B 5C1XA 1O3LA 3E8LA 4B2BA 1QGFA 2WV9A 5CE1A 5J4SA 4BNRA 2J9NA 1EJMA 3QGJA 1O36A 3M3TA 2CF8H 5JYIA 1AZZA 1TBRH 4AFZA 1YPEH 1VZQH 2KR7A 3GDVA 1E1QD 3H5CB 1BMNH 1GBIA 1EKBB 1OYTH 2BHGA 2QV1A 4GAWA 1H4WA 1FY4A 3LJJA 2A7HA 2ZG0H 1BTYA 5FHTA 2BLQA 3MO3A 1C5MD 3TGIE 4ZMAH 4X2WA 1ESTA 2GMTC 1WAYB 1W7XH 1HIAB 1V2WT 4WY3A 2QA9E 1LHDH 2XCFA 2FOCA 1Y3UA 4XFQA 5AF9H 2G8TA 1GBBA 1UTPA 1WCZA 4O3TA 3A87A 1HJ9A 2ZU1A 1HAIH 2NWNA 1TX6A 1YLDA 2H9TH 4WWYA 8GCHG 1DT2A 3AAVA 5JDUB 1D4PB 2ASUB 1ORFA 1O2SA 1YLCA 1S5SA 1AWFH 1QIXB 4FUFA 4NA7A 3H7TA 3LGWA 1Y3YA 1C2EA 3TIUA 1AN1E 2F9PA 1TRMA 3A82A 3U8TH 4NIWA 5A0CA 1C1UH 3RXSA 1QY6A 3DD2H 2GCTC 2OTVA 1G3BA 2B8OH 3HK3B 1ZMLA 3NXPA 3GICB 1N8OC 1NM6A 1AO5A 3E91A 2SNWA 4GUXA 4X8UH 1DY8A 3VB3A 2BDYA 2RCEA 1TB6H 5JBBS 3EA7A 3PLPA 3V12A 3M5OA 1QRWA 2CV3A 1H9IE 1P57B 3HGPA 4MQAA 1BTZA 4GHTA 2P8OB 1O2MA 1RTFB 2BDGA 5LPRA 1VITF 2ZDVH 1RRKA 1UK3A 2XYAA 2NU2E 1T32A 3MU0A 1BRCE 1IQJA 4TWYA 2FPZA 3STJA 1ELAA 1Y3WA 1O2YA 1OP8A 2OBOA 2VU8E 2GJGA 1TPAE 4XOJA 3RXRA 3RLWH 1O5CB 5DN6D 1C1RA 1WDIA 3M36A 2RA3A 2XXLA 4FOUC 4D7FA 3UNRA 3SN8A 2BDCA 2BY8X 4A5TS 1GG6B 1O3EA 2F9VA 2BY9X 2Q1JA 1MTWA 4ZKNU 1O3KA 2NU0E 2BD7A 2PFEA 1CVWH 3UWJH 1T8MA 2FESH 2A31A 3MNSA 1TMTH 1ARBA 1NTPA 2ZFFH 1DM4B 3KL6A 5HKKD 1GMDF 5ETXA 2ZCHP 1C1MA 1CO7E 1UVPA 1HB0B 4ISHH 1K2I1 2GX4A 1FIWA 3GCTF 1ELCA 3A84A 4CRDA 2F43B 4XDEA 4U2WA 1LPGB 5JBCS 2SFAA 1OYQA 1G3DA 2ZTYA 1KLJH 1OWHA 2XWAA 2I6SA 2OINA 1GJ4H 1RTKA 2ZGCA 1KYNA 1SGEE 1OWDA 3L33A 3Q3YA 3SNDA 4VGCB 4KTCA 5DSFA 1Z1JA 2Q6GA 3UIRA 4M9FA 4A1TA 3RXLA 3BG8A 5DP8A 5A8ZA 1QCPA 1QA0A 1O3CA 1MZDA 5HGGA 1BHXF 3ZZ3A 4DOQA 1A3BH 2BYAX 1C4V2 4JYVH 3SUDA 1O3NA 5EPNA 1UVUH 3M37A 1G2LA 2HPQH 1EJAA 4E06H 5DP7A 2JKHA 2NU3E 2P3FH 1LHGH 1OS8A 3OTJE 1GHBF 1BTPA 2V6NA 1UCYK 2VBCA 1O2WA 1T4VH 2Y7XA 4XE4A 1YPKH 2A4OA 1PPCE 1THPB 1SI5H 2HWLB 1C5NH 4JK5A 2C90B 3HKJB 3EDXB 1YYY1 3GS9A 2BQWB 3TGKE 1FQ3A 1MKWK 1NC6A 2TPIZ 3OEHD 2VH0A 3TITA 3QZQA 1DS2E 3UR9A 3QDZB 5EOKA 1C2FA 3RXUA 5A8YA 1AFQB 1C2LA 2R3UA 2Z3DA 4YZUA 1S6FA 1AD8H 2ILNA 2VGCC 4Q7YA 1YPHC 3M61U 4MVNA 1HCGA 4LXBH 1P3EA 4Q63A 4B6FA 4AB8A 3GY7A 1FPCH 1C1PA 5AHGH 2HVYB 4I8KA 4H6TA 3VGCC 4TT3D 1P9SA 1C5RA 1YP9A 2G55A 2O8MA 1D3PB 5TCAA 3RXMA 3T28A 4SGBE 2AFQB 2QE7D 2VH6A 4UFEH 1AZ8A 1FUJA 3TPIZ 1GDNA 2BD9A 3NZIA 1W13U 1ELVA 1AKSB 2R0KA 1H8HD 4GVUA 5ESBA 1W3CA 1SVPA 4DGJA 1GI5A 2ZDMA 2W3KA 1GGDC 2J92A 1O32A 2A1DB 3H09A 1Z1IA 2GT8A 1LHEH 1K1PA 1ZZZA 4RKOB 4INHA 1IOEA 3TU7H 4YT6H 3QTVH 3URDA 2BXUH 5EW2H 1TQ7B 1P2NA 1VITG 1SGFA 4BXSA 1GJ7B 5JB8S 1WQVH 4Y7BA 2ZU5A 3URCA 1O3IA 2HRVA 4Q2KA 4Y11E 4BTUB 5DPAA 1H9HE 2R3YA 1SLUB 4DIHH 1O2NA 4K8YA 6GCHG 3LKWA 6CHAB 1XKBC 1O2VA 1AMHA 2A32A 3FANA 1FX0B 1P02A 2FODA 2F9UA 4X2XA 1QB6A 1A61H 1NFUA 1H1BA 2CHAB 4Z1MD 1NROH 4A1VA 4AC9A 3RXGA 3MYWA 4BAKB 1YPGH 2ANYA 1A5IA 3CS7A 1EFRD 1UTQA 3GOVB 2R0LA 1GMDG 3UUZA 1OOKB 2LNCA 1V2UT 1UHBA 4WJG2 1WQSA 4TPIZ 1MU8B 3RU4T 3ENSB 3GCTG 4XBCA 3ZYDA 1TONA 4BAQB 1L1JA 3TH2H 5EIYA 1K21H 3KEEA 4FXGH 3QUMP 1GPZA 2BD3A 3RC4A 3FZZA 1IHSH 1SC8U 5K7RA 1FZZA 3MH7A 3DSGA 2ZCKP 1HAVA 2GZ8A 2CN0H 1Z8JB 1SLWB 3Q3XA 1ZHPA 3A88A 3ZVFA 2XC5A 3SI3H 2LPRA 4AOQA 5KGOA 3VB5A 4I7YH 3P70B 3ZZAA 1WXRA 2FI3E 1RJXB 4M7GA 2WV5A 4CBOA 3NPSA 1ELBA 1EX3A 2PUQH 1FY8E 3BTGE 3RLYH 3NRLA 5F03A 3HK6B 1RXPA 3LIWA 1INCA 4GLYA 1GJ8B 3EAJA 4HFPB 1KMHB 2BOKA 1LPZB 1G3CA 1QJ7B 2H5CA 2VVUA 1GHBG 1RD3B 1SHYA 1W2KH 4D8NA 1TNJA 3BTQE 1TFXA 2VIOA 2HOBA 5TJXA 1UTJA 2FDAA 1HAYB 3BEFB 2FOHA 1TNLA 3AK5A 1PPHE 4I8GA 1S81A 3PV2A 3ZV8A 3SNAA 3RMLH 1YKTA 1KXCA 1TAWA 4B1TA 1AE8H 3DSOA 1PQAA 4MPVA 1YCPM 1IAUA 1DITH 2HVXA 3MU5A 4YO9A 2CMYA 1DY9A 4X8SH 2WPIS 3MQKC 2KCAA 3LGUA 1EPTA 3FP6E 3TJOA 2F9NA 3U8OH 2OUAA 2ZDNA 1D6WA 1HAGE 1B5GH 1TALA 2QYIA 2YMSC 1T8OA 4ZH8A 1SL3A 2ZP0H 2G4TA 3RXVA 4MLFB 1AE5A 3EYDA 1QL9A 5EJ1A 1OXGA 3ODDA 2Y6TA 1C5ZB 2D26C 4HI3A 1QRZA 1LKBA 2SGPE 3PO1C 1OSSA 1DX5M 4X8VH 3MHWU 2ZGJA 1K1JA 2THFB 3PMJA 3T25A 1J17T 2ZF0H 2WINI 5CHAC 2ZZUH 4Q7XA 5IK2D 1VGCC 2F9BH 3ZZ7A 4DW2U 1P04A 1MAYA 1ETTH 1EZQA 3E90B 4KELA 1GBTA 1A0LA 5C94A 1HDTH 2D2DA 1F5LA 3UQOA 1O2UA 1BCUH 1KLTA 5E0GA 3KQCA 3Q3KA 4BAOB 2PKSB 1F0RA 4DT4A 3E3TA 3MNBA 3PTNA 4MG3A 2ODPA 4NIXA 1P12E 3PMHB 1PQ7A 1ABIH 4INLA 1GMCF 5DO4H 1FPHH 2STBE 1SGPE 4O9VA 1NS3A 2UUKB 3N99A 4WH6A 3A7TA 4Q4LA 1MMJN 4X1PU 1UMAH 1QFKH 2W5EA 3C27B 1OX1A 3U1JB 3N7EA 1HAHH 1GL0E 4NWKA 1TRNA 4J1YA 4Y79A 3TLOA 3GISB 4ABEA 1C2MA 2F9OA 5HIZA 3SQEE 2V3MA 4GSOA 4NWLA 2PSXA 3RDZA 2ZGHA 1O5FH 5SGAE 4Q7ZA 1FI8A 3BV9B 3S7KB 1K1MA 3A7ZA 1PQ5A 1BDAA 1QBVH 3QTOH 1G9IE 5EXMA 1AB9B 1LVMA 4JZEH 4BTIB 1MKXK 1UCYE 2P93A 4IW4E 1GHXH 3GDSA 3EE0B 2PW8H 5G4BA 1LHCH 2FI4E 2R2MB 3LGIA 1HAZB 1JRTA 4FU7A 3RP2A 1PPEE 3MNXA 1NT1A 5HM2A 2GCTB 1WOFA 3GYMA 3S69A 1AI8H 4RKJB 2ZDAH 1CE5A 2B7DH 1TMBH 1W10U 3LT3A 2BQ6B 3ITIA 4MTBA 1DICA 1GBKA 2ZHEH 4JZDH 1OKXA 1PPGE 3CNRA 4WH8A 1XUFA 2BVRH 2M2AA 1ANCA 1E36B 1K1OA 1NN6A 1SGQE 1MBMA 1HAOH 4LK4A 1G37A 3KGPA 1V2JT 5FX5A 5DP5A 5EODA 1XMNB 4RSPA 3TJVA 1PYTC 3ZV9A 2Z3CA 3VB7A 2XBXA 1TA2A 1AIXH 5BRRE 2KCOA 4Y8YA 2KCPA 1SR5C 4K1SA 1NRNH 1NY22 2B5TB 1GHVH 4F49A 4NSYA 2ZCLP 4IC6A 2ZTZA 1LCYA 1MH0A 2OQ5A 3V3MA 2BD8A 2OK5A 1A1RA 1YBWA 2P94A 1TGNA 1LVBA 3S9AA 1O33A 1Q3XA 4RN6A 1ZJKA 4ISOA 1DLEA 1HYLA 2AGEX 4ZCNA 3P95A 3FN8A 3SV7A 3SU4A 1O2QA 4K3JA 1DWCH 5FL7D 3OY5U 1OHHD 5JBTA 4MNYA 3RMMH 1GJDB 3F2FA 3Q00A 5CDFE 3S9BA 1D3QB 2A4RA 1G30B 1TRYA 1FDPA 2VWOA 2W6ID 1EXFA 3M5NA 5JPMH 3HGNA 3SW2B 1YPLH 2QN5T 5EG4A 1Y59T 1ZOMA 4XD7D 2K1QA 3PRBA 3SGAE 1NU7B 1MAXA 2P16A 2CJIA 4YOJA 5B6OA 3MO6A 2AMQA 3LJOA 1QB1A 1DE7H 1KDQA 3OFND 3RXKA 2BB4A 2ZO3H 1C5WB 1VKYA 4B76A 2ZTXA 1BBRH 1B0EA 3D62A 1JIMA 1VJAU 3TVJB 4Y8ZA 1C5PA 1NFYA 1YPJH 1XVOA 4Y0YE 1ZTLA 4GCHF 2G51A 3LDXH 1G2MA 1PPZA 2CK3D 4TWWA 1SQTA 1NZQH 2H5DA 3ZZDA 1V2OT 9ESTA 2VJ1A 3RXEA 2KCYA 4MNVA 1GI9B 4CRFA 2A7JA 4IC5A 2V0BA 4X1NU 3T27A 2WYJA 5T1VA 2SNVA 2A45B 1DXWA 4RI0A 1T31A 1PQ8A 3LC5A 3SJOA 1DXPA 3SU5A 4ZROA 3B9FH 1QHRB 1V2QT 3RXBA 1GMCG 1PPBH 1SGTA 1O2JA 3RXAA 2J98A 3KQ5A 3SV9A 5IYTA 2TGPZ 2AYWA 4Z0KA 5KECA 3DCLA 2RA0A 3AW0A 2FS8A 1C5OH 3KYFA 2BVSH 1NFWA 4BOHA 3KQDA 3KHVA 1RIWB 1TBZH 1GI1A 4I32A 1O37A 2J5UA 2PR3A 5A0AE 1FN6A 1SG8B 3QX5H 3R3GB 4PROA 1TNGA 1HLTH 3GCHC 5GWZA 2BZAA 4O97A 4B75A 3BTKE 1P2QA 1O2XA 1A0JA 1JOUB 4B74A 1C2HA 2P3UB 2WPDD 1M9UA 1LQDB 1CGHA 3RXHA 1ZHRA 2IPQX 4Y10E 5CHBA 5C2ZA 1O3HA 1ZGVA 1UHBB 3BTHE 2G81E
chains in the Genus database with same CATH topology
3P8OA 3ZYEA 3RXTA 2PTCE 1C2GA 4UEHH 1WUNH 2ANKH 2BTCE 1XXFA 2UWPA 5LPFA 1QQ4A 6GCHF 1GGDB 4A6LA 1SQOA 5GPIB 1BTWA 3PWBA 3SQHE 1HAVB 5ESTE 1O3MA 1THSH 1AUJA 1AWHB 1AUTC 3BG4B 1O34A 3RXIA 5DGJA 1MD7A 5GJ4B 3KN2A 3SJIA 1C1OA 2ZGBH 5EU8A 5IDKA 2VWNA 3ZVCA 5EXLA 4ASHA 2AEIH 2WUCA 3T62A 1FIZA 1GVKB 1GJ9B 5T6DA 2JH5D 1ANEA 3OYPA 3PROA 3T2NA 3SU3A 5HXFA 2IPHA 3SORA 1ETSH 4AGKA 3M3VA 3O8RA 1WTGH 1DPOA 2ZPRA 3PMBB 2UWLA 4H4FA 2FYRA 1CA0C 4U30A 3MFJA 3LH3A 1BRBE 4J2YB 1H8IH 4KKDA 1U6QA 5GCHG 1GBFA 1OWKA 2QY0B 3G01A 4K60A 1O5BB 4TPYA 4TYDA 1KTTB 1S82A 2GDEH 2C4FH 3ZZ6A 1SGRE 1Y3VA 3ATMA 4WVPE 3BTFE 4Y71A 2O8WA 3QK1A 3OX7U 1H9LB 4ABIA 2HPPH 4ZXYH 1NFXA 1O38A 2Z9KA 4MDSA 2BDAA 2XNIA 1EPTB 4KP0A 3ATKA 4DCDA 4ZKRU 3RUOA 2PUXB 1W14U 3ZVBA 3A83A 1MTVA 3K65B 3P6ZB 1P03A 1ID5H 3GCNA 1PJPA 1C4Y2 3ZVGA 5LH8A 4O3UA 2FS9A 3A8DA 2ZU3A 3EQ0H 4GCHG 4JYUH 2G00A 5EQRA 4UFDH 1EATA 1P05A 2FLBH 9LPRA 4AFUA 1D9IA 2IJOB 1ELGA 5HMAA 5ABWA 2ZFQH 1L0ZA 4K2YA 1ZPBA 3SBKA 1K1LA 2FX6A 4B2CA 4AGJA 1A3EH 2A2XH 1CT0E 3ATLA 1WYKA 1QJ1B 4X6NA 2FOGA 1LQEA 2ZHDA 1O3AA 5LGOA 3DUXH 1F0TA 2Y5GA 5DP6A 2ZFSA 5FPTA 2A5AA 3BF6H 4Y6DA 2C3SA 1GDQA 2AGGX 1S0QA 4AYVB 1C5LH 5A09A 2V35A 1BITA 4DURA 1TIOA 2FXRA 2O9QA 2A0QB 3QLPH 1C2KA 3L6PA 4FUHA 3RXFA 1O30A 1C5SA 3TK5A 3V7TA 5E2PA 3RMOH 2R9PA 3GY4A 1B0FA 1UJ1A 3IITA 1Z71A 3WY8A 4YOGA 3GCOA 2Q6DA 3BIVH 5FBIA 4D76A 2FLRH 3U1IB 1TWXB 3PO1B 2GZ7A 1ARCA 5C67A 3A81A 1F92A 1YM0A 2M5TA 2ZA5A 3SGBE 1CBWB 1TBQH 2G52A 2VIPA 3F6UH 4H42U 3RU4E 1SGNE 2OCVB 3VB6A 1MBQA 2F3CE 2VNTA 5CHAB 3SV2H 3MU1A 1GG6C 5DG6A 4WXVA 2YNBA 1SB1H 1Z8GA 3RM0H 1EOLA 1LDTT 5T3HA 5GXPA 2PGQB 1ANDA 1CT2E 2W26A 5EQSA 1DOJA 4UFFH 1A4WH 1ABJH 1EAUA 2H6MA 1AHTH 1HGTH 5I25A 3E0NB 4WMEA 2IN2A 2B9LA 5AFYH 2SGAA 1V2NT 4K8BA 4NA9H 3F9HA 4FUEA 4ISLA 1C5YB 3KCGH 1DUAA 2ALPA 1HAPH 2KAIA 1O39A 1XUGA 2EI8A 3E1XB 4MPWA 1CT4E 2TRMA 3A8BA 2BY7X 1GHYH 5L30H 2RG3A 1BRUP 1GBHA 3LPRA 1DSUA 1F7ZA 1MTNC 2XRCA 3LGVA 2OBQA 1KLIH 4Z6AH 3H7OA 3LC3A 1GBJA 3NCLA 4O03A 1EP6A 1MZAA 2HGTH 4VGCC 4CRGA 3UNQA 1K28D 2ZDLA 3E6PH 2J94A 7LPRA 5T6GA 3K2UA 3PB1E 3EA8A 1ZPCA 2JETC 2Z9GA 4A92A 7GCHF 4IBLH 2ZI2H 1S84A 3TH3H 3CS0A 2GDDA 1WU1A 2OC0A 4THNH 1XX9A 1KXDA 4X2YA 3W94A 1GJCB 2Z6BD 2ZU4A 1DDJA 1TNIA 2ODYB 3V13A 2OP9A 3D49H 1ELEE 3A80A 4HTCH 1O2KA 1FN8A 3F9EA 4OGXA 5E2OA 5GDSH 1P01A 3F1SB 4NIVA 5GIBA 1C5XB 1TA6A 4A1XA 3VB4A 1F5KU 1NESE 1PYTD 1C5TA 1KDQB 4JK6A 3K6YA 3KIDU 3ZVEA 1YCPH 4X1QU 4R8TB 3SUEA 1SLVB 1P3CA 1EAWA 1SOTA 1DSTA 1BMMH 1N6YA 5DP4A 3EGKH 1GL1A 2O8TA 6ESTA 3M7UA 1GBLA 1IQHA 1T4UH 1V2PT 2BZ6H 4ABJA 4LZ1H 1AU8A 4NFEA 3P92A 1E0FD 4MNXA 1PFXC 1KXFA 3ELAH 2WUBA 2ZFRH 1J15A 3K9XB 3BTTE 1CGJE 4DY7B 4YLQH 3PMAB 3JZ2B 3RXDA 1F0UA 2WPLS 3MWIU 1ZSKA 4WMDA 1O3GA 1F5RA 1E38B 4Y7AA 3K6ZA 2STAE 2UUJB 1AQ7A 1RFNA 3TGJE 3AASA 1MUEB 4JZFH 1UTKA 4XBBA 2ALVA 2ZEBA 2C8WB 2PSYA 1BJUA 3SHCH 3T26A 4ABAA 1O2PA 1HJAC 4ABGA 4X6MA 1K1IA 2AMPA 1A2CH 5E0JA 4YM9A 1Y5BT 1IHTH 5PTPA 3NUMA 3E0PB 6CHAC 3P8GA 2C8XB 2VB0A 1V2MT 4AG1A 1TGSZ 2J38A 5DK1A 1V2ST 2QC2A 1TGTA 1ZMJA 1TOCB 2ZFTA 2A5IA 3MU4A 1SHHB 3QGNB 3RXPA 4R0IA 2BXTH 3D23A 3B8JA 1LVYA 1SLXB 3GDUA 1ZR0A 1YPMH 1Y3XA 2J95A 2QXHA 1V2LT 2SGQE 3FVFB 1HXFH 2GMTB 2ANWA 3ODFA 1ZPZA 4D9RA 1MCTA 1ZTKA 3GY2A 1GI3A 3A86A 2AS9A 3TJNA 1HPGA 1DANH 4NZLA 3Q76A 5F8ZA 1GI7B 2Y5HA 2FYQA 1ZRBA 4KTUA 3I29A 5LPEA 1ELFA 4HGCA 1ELDE 2DE8A 1LHFH 1P11E 3BTEE 1HFDA 1EZXC 4HZHA 1GHZA 1BB0B 3PTBA 2FX4A 2Z9LA 3SUFA 1J14A 4CH8B 1C1WH 1O2LA 4ZKOU 3QWCH 2A4GA 3OSYA 1N8OB 7GCHG 1MTUA 1NO9H 1O3OA 2TBSA 4JCNA 3VXFH 1HUTH 3ATWA 2JH0D 3DFLA 1TNHA 1GI6A 2A7CA 4XSKU 2SGFE 1FNIA 1YF4A 1X7AC 1A5HA 2PKAA 1EZSC 1EQ9A 2VINA 3DA9B 2Y80A 4D7GA 4NG9H 4TY6A 1EB1H 4FU8A 3AAUA 3SNEA 1VITH 2FOEA 1V2TT 3ZZ9A 4YTAA 4IS5A 4AFSA 1C2DA 4YT7H 1O3JA 5HYOA 1RS0A 1SFIA 1GCTC 2BLOA 2J2UA 3ZZ5A 2D8WA 1IQNA 2G5VA 2HLCA 1UK4A 3SV8A 2DE9A 1BTXA 3ZZ8A 5FXLA 1XUKA 3NKKA 1P2IA 3UNSA 2ANMH 4FUIA 4FUBA 4Y76A 1LPKB 1XUJA 5GCHF 1TGCA 2XCNA 1QRXA 3KNXA 4ISIH 2FIRH 5EQQA 4CHAC 3SOSA 1K22H 3SO3A 2ZHQH 3PLBA 5I46H 3U69H 1TYNA 3V0XA 2QCYA 5FCRA 3P8FA 3BIUH 3F9GA 3VPKA 2Y7ZA 1UVSH 2XTTB 3VEQB 1GJBB 1C5UA 1C9TA 1KXEA 1BQYA 3ZVAA 4ABHA 1IQIA 2FOFA 1IQGA 1CA0B 1O5EH 1K9OE 4JZ1A 3TNSA 1LVOA 1C1VH 1V2VT 3M7TA 4CRBA 4IN2A 1TX8A 3A8AA 2H1UA 1F2SE 1OP0A 3AW1A 2ZC9H 1TQ0B 3NWUA 3SJKA 1B7XB 1O35A 2TGDA 1VJ9U 3SJ9A 1O2RA 1KIGH 3BSQA 4CREA 1ZMNA 1W0YH 5E0HA 1AVGH 2A5KA 1BMLA 2AMDA 2QGRA 1P8VC 1NRPH 1GI8B 3LH1A 1ZSLA 2J34A 3A7YA 2FO9A 4LZ4B 2BM2A 1L4DA 2G5NA 4I8HA 1BBRK 1JXPA 1GCDA 1Z6JH 1HNEE 1QBOA 4AB9A 4X6PA 2HALA 5EW1H 2BD2A 2ZDKA 1HAXB 1IQFA 2GKVE 2EA3A 2ZNKH 4IMZA 5HM9A 1FY3A 2PV9B 2P59A 1O3FA 1ZYOA 5TCCA 1MD8A 1WV7H 1T8NA 2ZIQH 3SGQE 1YGCH 3SNCA 4CH2B 2ODQA 3SHAH 4DIIH 3RC5A 2VWMA 2BVXH 1UTNA 5A8XA 2ZWLH 1S6HA 2XBVA 1Q31A 4Y0ZE 1GI2A 4YOIA 2VGCB 4CR5A 1AB9C 1UVTH 1NPMA 4JYTA 3UTUH 2GV7A 3VGCB 4Y8XA 1DWBH 1NRRH 3OY6U 1C2IA 2P95A 2Z3EA 2KAIB 2FWWA 4E05H 8LPRA 3M7QA 1OWEA 1XXDA 1ZRKA 3ZVDA 4BAMB 5EPYA 1P2KA 1G3EA 5AVDA 3I78A 1XVMA 3AVZA 5F6MA 4IGDA 4WF8A 2SGDE 2AIQA 2I6QA 5FPSA 2ZQ1A 2RDLA 3JZ1B 1V3XA 3TJUA 5JBAS 2FM2A 3I77A 4OS5A 3UOPA 2GT7A 2PGBB 4ISNA 3STIA 2PLXA 4CR9A 4NCYA 4OS1A 2OLGA 4UD9H 3TNTA 2OC8A 1ZGIA 1CHGA 3SU6A 4UDWH 4ZHMU 1O2IA 2BLVA 3UOUA 2BMGB 3BEIB 1C1SA 1DUEA 3SI4H 1WSSH 1P0SH 3RU4D 1HV7A 1GVZA 3FP7E 2Z7FE 3MOCA 1O2HA 4D9QA 4H6SB 1ZHMA 1FLEE 1MCVA 2AERH 1J16A 2XWBI 3BTME 3LU9B 3P8NA 5BPEA 1Z8IB 2EI6A 4K5ZA 1XM1A 2F83A 1S83A 3D65E 1UTOA 2PTNA 4K1TA 3M35A 4AFQA 1EB2A 1Q2WA 2WV4A 1QR3E 3UY9A 1JRSA 4AX9H 4MNWA 2XC4A 3KF2A 2F91A 3HPTB 4BXWA 3KQEA 1SGDE 1JIRA 1JBUH 1GHWH 2QF3A 1EZUC 1MTNB 3MNCA 1UCYH 3SU2A 2WYGA 4NGAH 1OWIA 2OC1A 2GVFA 2OD3B 3W95A 3RC6A 7ESTE 1WBGB 1VCQA 1EP5A 1EOJA 2WPHS 3S0NA 3BEUA 1GDUA 3LOXA 3MH4A 4ZHAA 1P2OA 2JETB 1C1TA 1LTOA 1UO6A 1FY5A 4X1SU 1SGFG 2YNAA 4CRAA 1LKAA 1O5AB 3HKIB 1MKWH 4JZIA 1GI4A 1O2TA 3MO9A 1XKAC 1DFPA 1GBCA 2V3OH 1BT7A 3Q77A 4F4OC 1TGBA 3MU8A 4UE7H 4DG4A 1AGJA 3O8DA 1GMHF 1NRSH 1ZSJA 2BY5X 2VIVA 4U01A 2ZFPH 2FP7B 2Z9JA 3C1KA 1P9UA 3DT0H 1QL8A 1Z7KA 1O5DH 1FMGA 1ELTA 2ESTE 2WPKS 3A8CA 4BANB 4OS2A 3QZRA 1ACBE 1BZXE 2PWXA 4CRCA 1FAKH 4K69A 1YPHE 3FAOA 3IWMA 4DT7B 5A2MH 3RM2H 1FXYA 1BTUA 1XUIA 1QTFA 1GWAA 2G4UA 1RIWC 8KME2 1BHXB 1O2OA 3PWCA 4MPUA 4NSVA 1ESBA 1T7CA 4UONA 4X1RU 1NU9A 1W12U 4ZXXH 1KY9A 1DWEH 1JMOH 4TY7A 3SU1A 2XBYA 5DP3A 3TK6A 2OQUA 5K0HA 1C5QA 2B0FA 1C9PA 2FTMA 4ESTE 1P06A 3OU0A 2VIQA 2BD5A 3RXJA 1KTSB 2W3IA 4YLUA 5FCKA 3ZZBA 2VIDA 2OXSA 1L1GA 1GJ6A 1HBTH 2P8OC 5EXNA 5C20A 3RXOA 1O5GH 3M3SA 2P3TB 2BDIA 4I8LA 2WPMS 3TH4H 2EEKA 4WMFA 3NK8A 5L2YH 1UTLM 1EAXA 2Q6FA 1MQ6A 4SGAE 4U32A 4ZHLU 1HRTH 4X6OA 3HATH 1GVLA 2A2QH 1TOMH 4UFGH 5AFZH 3O8CA 1QA7A 1V2RT 3A85A 3MH5A 1NRQH 2EC9H 2AGIX 2ZQ2A 1MU6B 4IMQA 1AY6H 1HIAA 1EASA 1VGCB 3BG4C 1ZLRA 1JWTA 4JMYA 8ESTE 1OP2A 2BDHA 1P09A 5FX6A 3LGYA 1SGYE 3S7HB 3MMGA 1P2JA 1S85A 3U98H 1C5VA 1HJ8A 3MH6A 1HJAB 1WTHD 4AZ2B 1VCPA 4DJZB 1UTMA 3UPEA 2BY6X 1W11U 2PKAB 3ZZ4A 2VVVA 4NA8A 1EUFA 3M5LA 1QL7A 1CQQA 1ETRH 3A89A 1ANBA 2H9HA 2ZU2A 3BTWE 2IOTA 2QIQA 2UWOA 1L1NA 1FV9A 3SZNA 5DKMA 1Z6EA 3LGTA 1L4ZA 5C5NA 3P17H 3R0FA 1LO6A 1BA8B 4FVDA 4FU9A 2Z9IA 3GY3A 3BN9A 2XW9A 1F0SA 1IQLA 3IG6B 3RXQA 3SV6A 2YOLA 1CHOF 2BD4A 2A4QA 1W0ZU 1EAIA 1EPTC 1UK2A 4KTSA 1V6DA 4AG2A 2Y5FA 1DLKB 1E34B 1BBRE 2ZGXH 3F9FA 1TPOA 2C8YB 5DP9A 1W8BH 5J4QA 1AFEH 1ZTJA 1OPHB 3FP8E 5T6FA 3E16B 2BLWA 1IQMA 3A7WA 1A46H 2FOAA 2GCHF 1SSXA 4B2AA 1QB9A 3GY5A 1RGQA 5DJ7A 2ZKSA 5C3NA 1A0HB 1IQKA 1GMHG 1AFQC 2Y82A 4BTTB 1XUHA 5C1YA 1CGIE 2ZECA 4OS7A 2OC7A 3F68H 1N1LA 1SPJA 2Y81A 3PM3A 2V3HH 2EI7A 1GBDA 5H4IB 4I31A 1QJ6B 3N7OA 1BRAA 1KXBA 2AH4X 4AORA 2GGVB 1GCTB 2HNTF 5A0BA 1VR1H 1D6RA 1BUIA 2W7SA 3MTYA 2QAAA 4X8TH 3CP7A 4FUDA 1GBEA 3U9AH 2ZHFH 1YCPK 3RMNH 4AYYB 3SJ8A 1FY1A 1GJ5H 1T8LA 1TPPA 3UQVA 4CHAB 4I33A 1C1NA 1FONA 1GHAF 1O31A 3M5MA