2ZGHA

Crystal structure of active granzyme m bound to its product
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
231
structure length
231
Chain Sequence
IIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Granzyme M
publication title Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 231
sequence length 231
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zghA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zghA02
4XE4A 1AZZA 2EC9H 3TK5A 4BTIB 3GISB 2ZA5A 4RSPA 5EXLA 5LH8A 3SJOA 3OU0A 1GBFA 3UQOA 3Q77A 2PFEA 1NZQH 2J9NA 3MOCA 2RG3A 1W0ZU 2OC1A 5DGJA 1OWDA 2CN0H 2FDAA 2FYQA 1WV7H 3BTQE 5EW1H 1GHZA 3RXLA 1EB1H 4IMQA 1QNJA 4A1XA 2BD3A 5CHAC 2GV6A 3ESTA 1L1NA 4GPGA 5GCHF 1ZHMA 3AAUA 1IQEA 3KQDA 1THPB 3KCGH 3PB1E 3TGIE 1EJMA 1GBMA 1UO6A 2XBVA 3HKIB 4AGJA 5GWZA 2A32A 1B0EA 1M9UA 4UONA 1XXDA 3L3TA 2QYIA 1NRSH 1OP2A 5L6NH 2AERH 5F8XA 3SI3H 1K9OE 1ZZZA 4WVPE 1NTPA 3E0PB 1O3OA 4AX9H 5EQRA 3SU2A 1HXEH 1GBEA 1K28D 4AB8A 1EUFA 1K1JA 1QL8A 3Q3XA 1EPTB 4KELA 1BJUA 1XVOA 2Y7XA 1QBOA 1O2ZA 1YPMH 3EGKH 1AE5A 2ZGXH 5E2PA 1D4PB 3GY5A 1TX6A 3SHAH 1VCWA 2F91A 1QJ1B 3RXDA 3UNSA 1HFDA 3CENA 3GCTG 2THFB 1AIXH 3SJIA 4GCHF 2QXHA 1RTKA 4E06H 4YZUA 4NFEA 3BN9A 2ULLA 3DA9B 1RD3B 1T8OA 1YPHC 2J94A 4FU9A 2ZGJA 4BAHB 3RXRA 3F68H 2WPJS 1ZPBA 3MTYA 5EPYA 1QRZA 3RXMA 1ELEE 4IC6A 5C1XA 1A0HB 2GV7A 1G9IE 1OXGA 1C4V2 2BD5A 1J9CH 3BG4B 5F8ZA 3VB4A 1IHTH 2F9BH 1P05A 2VVCA 3IWMA 3PMBB 2OC0A 3PYHA 1F0TA 2VIQA 4X6MA 1O3DA 1GWAA 4NA9H 4GUXA 1K2I1 1TLDA 1SB1H 1O3LA 2EA3A 1CA0B 3GCHC 3RXUA 1EB2A 5TCAA 1VGCB 2ZU1A 1GI4A 1JMOH 4MPWA 1BOQA 4WY3A 2VIPA 2WUBA 1O32A 3RXHA 1CHOF 1FXYA 4GHQA 3MO6A 1WTHD 4AYYB 3LDXH 2OQUA 2G00A 3ELAH 1PPEE 3F9HA 1WU1A 2GCHF 1O2TA 1BRUP 4X2WA 1TRMA 1ELCA 4FUIA 2KAIB 1C1UH 4X1RU 1TX8A 1BMAA 4YOGA 3T2NA 4ABFA 1GJCB 1AMHA 4ZH8A 1F2SE 1TA2A 3CS7A 3TITA 3KEEA 4ISLA 1B5GH 2VNTA 5H4IB 3SUGA 5L30H 2GGVB 1LPZB 3Q00A 1O35A 1SI5H 1C1SA 4D8NA 1GJAB 1TOMH 1W7XH 3A89A 2AYWA 2C8WB 4ZROA 1UTMA 4R8TB 3ZZ9A 3UNQA 1CT2E 1GBLA 1O2WA 3UWIA 4AFZA 3SJKA 3M3VA 4DURA 1JIRA 2GT7A 2OD3B 1PPFE 3M5OA 1AWHB 5ESTE 1ID5H 1RJXB 3QUMP 1BMNH 2BLVA 3MU5A 4KGAA 1T7CA 2OLGA 2EEKA 4D9QA 2CV3A 2HGTH 2VGCC 2H5DA 1DPOA 1V2QT 1O3GA 1O3NA 4YT7H 2H9HA 3UOPA 3ZYEA 3A8CA 2P8OC 1EX3A 4Q7XA 1GJDB 3MI4A 2ZGCA 2FX6A 4X1QU 1HAYB 5GDSH 4WF8A 4FUEA 4ZAEA 4F49A 2FLBH 3RMMH 3NCLA 3QO6A 3SO3A 3SOSA 1XUFA 3RU4T 4KTSA 1LVBA 1O5GH 5DKMA 1ESAA 1IQHA 1UJ1A 1O30A 2OC7A 1O2SA 2PKSC 4JZEH 1MQ5A 3VXFH 2Z94A 5FCRA 1W2KH 3I77A 2STAE 2NU1E 2AGGX 2C8YB 1YPJH 5IDKA 3SNAA 5C1UA 4E7NA 1D3PB 4GSOA 9LPRA 3M3TA 1C4U2 1KTTB 4UFDH 5FBEA 1BCUH 4NFFA 2TGAA 4DW2U 1GBDA 2ZPRA 2UUJB 4ISOA 2WPHS 3RXAA 1ZGIA 1L1GA 4FUBA 1GI8B 1ZMLA 1GDUA 1Y3YA 2GMTB 3P8FA 1FUJA 1HIAB 1RS0A 3A7ZA 1RIWB 1XM1A 3U69H 4ZHMU 1O31A 1C2DA 4ZXXH 3ZZ5A 2F9NA 1TNHA 3LGUA 1BBRE 4I7YH 1YCPH 2PTNA 3BIUH 2FP7B 3SZNA 3HK3B 2AEIH 3TU7H 2P3UB 4CRCA 2VJ1A 4LOYH 1BQYA 5JPMH 2FI5E 1O2JA 4AG2A 1FONA 1MH0A 1F7ZA 2W26A 1C5RA 2WPKS 4MPXA 4AGKA 8ESTE 5G4BA 1ELBA 3E6PH 1DOJA 1SSXA 4HI3A 1MAYA 1BTPA 3RMNH 1IQIA 1TOCB 3D65E 1IQFA 4INHA 4CHAB 2D26C 1BA8B 1E34B 3ZVDA 8KME2 1BTHH 4JYVH 1P0SH 3KQBA 3S9CA 1VJAU 1DWDH 4ZKNU 3LT3A 4YM9A 4DIHH 4KKDA 1IQJA 2VWMA 2F9UA 1P12E 1GVZA 4UEHH 2BLWA 2ASUB 1MAXA 1NU9A 1Z6EA 4WXIA 2G5VA 1GVLA 1SQOA 3UY9A 4AN7A 4ZKOU 1O33A 3RXPA 1O39A 3M37A 1HAZB 3GDSA 4OS6A 3BF6H 3NK8A 3BTFE 4B2CA 3KNXA 4DY7B 5K0HA 1HJ8A 2PV9B 3RXOA 1FY5A 4ISIH 1ZPZA 1O5EH 1GHYH 2ZPSA 1HJAC 3A7VA 1OKXA 2D2DA 2G5NA 5C5NA 3EA8A 1SGIB 4WJG2 1KYNA 2SNVA 3GY4A 4X2VA 3A7XA 1PFXC 3GICB 1C5OH 1P11E 2ANMH 2TGTA 4Q7ZA 1C2EA 2ZU3A 1SLXB 1ANCA 1C1NA 1ZTKA 3KHVA 1GMCF 1QRWA 1OSSA 1BB0B 2AFQB 2ZWLH 2OCVB 2OBOA 5AHGH 3GCNA 3HPTB 4ABAA 1KY9A 4MDSA 3SGAE 1SG8B 1PQ7A 2ZIQH 2Z3CA 2ZKSA 3VB5A 1ZGVA 2P59A 2PHBA 2OUAA 1EKBB 2Z3EA 4H42U 4K3JA 1CGJE 2BDAA 1MTSA 1FIZA 1ELVA 1XUJA 2BOHB 1RGQA 1BTXA 4I8KA 1C2JA 2SGFE 2VB0A 2PGBB 1GI2A 4WXVA 2BD7A 2ZO3H 1C2MA 5JYIA 1D3DB 3EDXB 2FEQH 1O36A 3S7KB 2Z9KA 4LXBH 2BY5X 1A5IA 1L4ZA 3L33A 4Q7YA 1D6WA 2TBSA 3T28A 3LH3A 3SHCH 1C5TA 5GPIB 2PKAB 2B9LA 1W12U 2AIQA 4JCNA 1K1MA 1GMDF 1W10U 1C5ZB 1O3PB 5A8YA 4DT7B 2R0LA 2QAAA 4JMYA 2ZU2A 3OSYA 2OTVA 3ODDA 2FIRH 3M5NA 1LMWB 1AZ8A 3FP6E 2XNIA 2XYAA 1F5LA 4GHTA 5AVDA 3GOVB 2P16A 3V12A 3G01A 3DD2H 3D23A 1BTWA 3RC5A 3LKWA 3DFJA 4HTCH 2Z9JA 2PKAA 4YOJA 1IQLA 2FOEA 1P04A 4CRFA 5DP9A 3SU5A 3K65B 1TGCA 1G30B 3P8NA 1H9LB 1GCTB 1TFXA 2XBYA 1QA7A 1NN6A 4AFQA 4I8GA 4JK6A 4Y0YE 1TYNA 5T3HA 2VIOA 1MCVA 5K7RA 2NU4E 2BDYA 1OP8A 3A88A 4D7GA 3FVFB 1JRTA 2BQWB 2BDCA 1OWIA 3BTHE 1W0YH 1C1RA 1IAUA 3UNRA 1FY1A 1FMGA 1GJ4H 1T8NA 3PLKA 1S83A 2GT8A 1YF4A 1QBVH 3C27B 2C8XB 1C5LH 4XSKU 1DFPA 2ILNA 4TWWA 4NWLA 2FOAA 2D1JA 4CBNA 1QCPA 7LPRA 1TGBA 4HZHA 1VCPA 3MO9A 4A7IB 1AB9B 1O3HA 3SBKA 3TK9A 1S85A 2P3FH 2VWLA 3OYPA 2XC0A 4YOIA 1TQ7B 1NS3A 3M7QA 1VITF 5DP4A 1HYLA 2PLXA 3BEFB 3RC4A 1ELTA 1C9PA 1F0SA 2GDDA 5FPTA 1GI6A 1DUEA 1GJ8B 1T4VH 3ENSB 4U30A 1FPCH 3CS0A 6CHAC 1PJPA 3DT0H 3BSQA 4LZ1H 2Y6TA 2OINA 1KXFA 4I33A 4MNYA 1KXEA 2FX4A 2RA0A 4FU7A 1SGTA 1DY8A 8LPRA 2A31A 1V2JT 2YNAA 3SV7A 4CH8B 1C1WH 4Z0KA 3IITA 3SU1A 2FWWA 3RXCA 3ZZDA 1DANH 1XMNB 3ZV8A 4FUGA 1GMHF 1SGQE 2BXTH 4CR5A 3ZVBA 1W7GH 1MKXH 4XOJA 3LGWA 5BPEA 3VXEH 4BTTB 4ASHA 1W14U 1UK3A 3VEQB 1TONA 3O8DA 4CREA 1RRKA 3GY8A 4UDWH 1GMCG 1HPGA 2R9PA 2ZI2H 1ZOMA 2BQ6B 2AGIX 1K21H 3T5FH 3TJOA 2ZDAH 5T6FA 3BTEE 1S81A 1LHGH 3S69A 3PO1B 1GHXH 5DP7A 1CO7E 1GI1A 1MQ6A 5E0GA 8GCHG 3K6YA 3SNBA 2HWLB 1TA6A 3GDVA 5C2ZA 2BLOA 3LC5A 1DXWA 4BAMB 3EE0B 4JZDH 1ZHRA 4A1VA 3MH4A 1P2NA 2HRVA 2O9QA 4TPYA 2TRMA 4VGCC 1KTSB 1GBIA 1WQVH 3MU1A 1GJ9B 3OTJE 3E0NB 2P94A 2ANYA 1O5AB 1YLDA 1AUTC 1CHGA 1TMUH 1ELAA 1C2KA 1E35B 3H7OA 5DPAA 5JBTA 2FS9A 4LZ4B 4DIIH 1RIWC 2C4FH 1MKWH 2FO9A 3M5LA 1BDAA 4TPIZ 2G81E 1YCPK 3B9FH 1GJ6A 4Y79A 2HVXA 2ODQA 3A87A 4NZLA 4B75A 5A0BA 3KQEA 1TABE 5CMXH 1CU1A 4H6SB 2TGDA 2V3OH 2FESH 1O3FA 4K2YA 3ZVFA 1C5SA 5DP3A 2XWBI 3LONA 2FM2A 1SC8U 3EA7A 4B2BA 1TX7A 1GI7B 1V2PT 2BZAA 4NG9H 4Y71A 1LQDB 1DWBH 1Z71A 1CSOE 1LVOA 2ZDKA 1FNIA 4JZFH 1SGDE 4B74A 1SGEE 1GG6C 3GY7A 3S9BA 5DP5A 1C2HA 1A0LA 3DHKH 3FP7E 1TNLA 2O8UA 4E05H 1KLJH 1ZLRA 2VIWA 3MFJA 2UUYA 1QURH 3SU4A 3SJ8A 1N8OB 3F9GA 5EOKA 3MNSA 2ZDVH 3MU0A 3ZZAA 1TMBH 3Q76A 1GGDB 4F4OC 3FP8E 1O2GH 1BZXE 1Y59T 2W5EA 1TBQH 3UREA 2A4RA 2JETC 4MTBA 4FU8A 3RXQA 1P06A 1MMJN 1G3BA 1G3EA 2Z9LA 3JZ2B 4MNVA 3ATKA 3FANA 3K6ZA 2ODPA 2ZTYA 1V2RT 1VITG 2A5AA 4MNXA 1EQ9A 1C5YB 6GCHG 4MQAA 2FZZA 5EG4A 1O5CB 3SV2H 3SNDA 1F0UA 1EPTA 1ZMJA 3MNCA 1YBWA 2UWOA 2NWNA 5FX6A 2J38A 1WSSH 1DSTA 4MG3A 1TRNA 2ZPQA 1NESE 3PWCA 1EZXC 5DP6A 2OQ5A 1SMFE 2BYAX 1ESTA 3LC3A 1DITH 4Y8ZA 3E8LA 3GCOA 3PMHB 4ZKRU 5LPEA 1V6DA 1UTPA 2EI8A 4MLFB 3SUFA 1IQNA 3A86A 3RC6A 5LPFA 5HM2A 2G8TA 3I78A 3GY2A 1UCYK 1BRCE 3EA9A 5EXMA 3ZVGA 1SLUB 4JYUH 4ABBA 3EAJA 2HLCA 1UTNA 2ZFQH 3UIRA 3QTVH 1XUKA 3QDZB 3E90B 4KTCA 1LKBA 4NA7A 2BXUH 2ZEBA 2YNBA 1P57B 2ZDLA 2BD2A 5TJXA 1LTOA 1C1OA 5A8XA 1GPZA 4IW4E 1QBNA 1SGYE 1PPGE 1FAKH 2FOBA 1GBAA 1ZSLA 2QXIA 1ABIH 3E91A 2W7UA 1Z8RA 2VWOA 2K1QA 2QF3A 1HAGE 2A4OA 3RDZA 4ABJA 2ZQ2A 2FI4E 1T32A 2UUKB 4RKJB 3M7TA 5C20A 3BV9B 2W7SA 3MU4A 4SGBE 3ATMA 2SGAA 4AFUA 1UTJA 5SGAE 2FOHA 4OS4A 2KAIA 4ZMAH 1G3DA 1ETRH 2V0BA 1Y5AT 3SQHE 4Y8XA 2CGAA 2WPLS 3M35A 1EOJA 2QGRA 1IQGA 1UK2A 2TIOA 1MBMA 2ZU5A 2XC5A 3SV8A 1O2UA 1AKSB 1A61H 1WOFA 4ZHAA 3GY6A 1NFXA 2FLRH 3F9EA 3GDUA 5EQQA 1V2UT 2JH0D 1Y3UA 1FLEE 1T8MA 2SFAA 1KXCA 1O2HA 1XUHA 1FIWA 1TWXB 1SQAA 5GCHG 1S5SA 3A82A 2Q6DA 4CRGA 2GCTC 4WMEA 2Y5GA 1CGIE 2A7CA 2QA9E 2JH6D 3NKKA 1PPCE 4K69A 1O3CA 2PW8H 1SGFA 2TGPZ 3TNTA 2ZTXA 1TE0A 3A8BA 3L6PA 1N6YA 1XKAC 3URDA 1GHBF 1NRNH 3Q3YA 3PTNA 3QGNB 3V3MA 3MO3A 1ARBA 1L1JA 2ZHEH 4BAOB 3ZYDA 4FVDA 2OP9A 7GCHF 1WQSA 1HAVB 2F9VA 1FPHH 1MKXK 4GCHG 3PMJA 3RUOA 1MZAA 1L2EA 3D62A 1CBWC 1AO5A 1EAIA 3ZZBA 1A1RA 1AFQC 1LVYA 1GHAF 4A1TA 1DWCH 1TNKA 3U1JB 1ACBE 1P10A 1ZYOA 1SHYA 3P70B 1C1PA 2UUFB 2VVVA 3PWBA 5EW2H 3ZZ3A 2A7HA 3ATIA 1TIOA 4CBOA 4LK4A 1Z8IB 3PM3A 1LKAA 1AVWA 4JK5A 2BLQA 5DO4H 1O38A 2IPHA 1ZTLA 1O3IA 2AS9A 1SFIA 1YCPM 1XXFA 3RXEA 4JZ1A 3VB6A 1FZZA 3M3SA 3VB3A 3VPKA 1WTGH 2A2QH 4D76A 1YPKH 2ZCKP 4ABIA 1QB6A 1Z7KA 1UHBB 2BD4A 2G55A 2BDBA 1LDTT 2VU8E 1UTQA 5C67A 4M7GA 1HIAA 3GY3A 2ESTE 2JH5D 1HAOH 1HJ9A 1EATA 4A6LA 3O8CA 1CHOG 4FUJA 3R3GB 1MKWK 2Z9GA 5LGOA 4UFGH 1NRRH 4OGXA 2GCHG 3RMLH 4O9VA 4HFPB 1TPAE 3U98H 1A46H 1IOEA 1THSH 5CHAB 5A09A 2ZQ1A 2ANWA 1C5PA 1GBBA 4TY6A 1EASA 3ZZ8A 1GJ5H 3BIVH 4BAQB 4K60A 1WUNH 2AMDA 2FTMA 3A83A 3FZZA 1HUTH 2FODA 4I8JA 1OOKB 2BY9X 3QGJA 1ANEA 5ABWA 1GCDA 3MHWU 2PTCE 1L0ZA 4X8VH 2BQ7B 1CA8B 1V3XA 3QZRA 1QJ6B 5ESBA 4MNWA 2YOLA 2UWPA 1V2ST 5HYOA 1EJNA 1V2MT 2V35A 4HGCA 1AVXA 1UVSH 4WMDA 3A7TA 1INCA 4J1YA 1FN8A 3SNEA 1P2IA 3V13A 1KSNA 2F9PA 3UTUH 4X0WU 3MH6A 4O03A 4AB9A 2TPIZ 2D8WA 1EPTC 1XX9A 1ORFA 1HB0B 4YTAA 1T31A 1GL0E 2AIPA 1BRAA 1IQKA 1YPGH 3RXGA 3HK6B 3P95A 2Y81A 2H5CA 1QL7A 3T26A 2CF9H 2QIQA 1C2IA 3BTDE 1Z6JH 3P6ZB 1S0QA 1H4WA 1HAHH 2A45B 2ZHDA 5GJ4B 1P02A 4NSYA 2GX4A 5F03A 1GJ7B 1SGNE 4B71A 4D9RA 1Y5BT 4X6NA 1BMMH 1V2NT 7KMEH 1NROH 1ZMNA 3MYWA 4KTUA 4BAKB 1NT1A 2WPIS 5IYTA 1LHCH 3PROA 3GCHB 1TALA 1AE8H 2IJOB 3BG4C 2VIDA 5FAHA 3QZQA 2J92A 2QCYA 4WWYA 1BTYA 1TRYA 3A84A 2O8TA 1UVUH 2B7DH 4ABGA 2PUXB 3UOUA 3UFAA 4UD9H 5C1YA 1YYY1 7GCHG 5AFYH 4JZIA 3P8GA 1CA0C 1PYTD 1LO6A 1VGCC 1UCYE 4IN1A 3PTBA 3LH1A 4YT6H 1P03A 2Z7FE 2UWLA 1RXPA 3TH2H 1P9SA 2Y7ZA 1JRSA 3ZZ4A 4MVNA 3TJUA 1K1PA 1MZDA 3OY5U 1O2MA 1TQ0B 5EQSA 1QR3E 4DCDA 1OWKA 1V2TT 2GZ9A 1SHHB 4FUDA 1OP0A 2DE9A 4BNRA 1LHDH 1C5QA 1GBTA 1AWFH 4XFQA 4OS2A 1P3CA 4X1SU 5HXFA 1J16A 1O2LA 2WPMS 3SI4H 3DFLA 2HALA 3KGPA 1PQ5A 1EZUC 1NFUA 4X2XA 5L2ZH 4AOQA 3E1XB 3U8OH 1FN6A 2OC8A 4IBLH 1CT0E 2FOMB 2FXRA 2J4IA 4GLYA 2BDIA 1FJSA 2BY8X 3SJ9A 1SBWA 1KXBA 2P8OB 1O3JA 1OPHB 1BJVA 5A8ZA 1A2CH 2ZU4A 1DLEA 2Z3DA 2ZDMA 4YLUA 2P3TB 1O5FH 1SGCA 1VCQA 4NA8A 1OWJA 1UVPA 3S9AA 3STJA 3SV9A 1ZTJA 1ARCA 3GYLB 3LGTA 1EAWA 1ABJH 1KDQB 1NFYA 4Z6AH 3RM0H 2BVRH 1PYTC 4U01A 3B23B 4BXSA 2PKSB 1O2OA 1AFEH 5E0HA 2BZ6H 1H8IH 2J95A 4Y0ZE 1ZR0A 3H7TA 2FMJA 3AVZA 1CVWH 4X2YA 4XBBA 1ZPCA 3K9XB 3MH7A 2GTBA 3SV6A 3A80A 4SGAE 1FDPA 1DS2E 3ZZ7A 3SUEA 1KXDA 1QHRB 1ZHPA 3HGPA 5E8EH 1NM6A 3ZVEA 3VGCB 5DK1A 5E0JA 5DP8A 1MU8B 1MTWA 1BHXB 3PLPA 3SU3A 1UVTH 1GHVH 3NUMA 1DX5M 4MPUA 3RLYH 2ZF0H 1BHXF 1ELGA 5GXPA 1G3CA 3AW1A 2ZFTA 3E3TA 1OWHA 1BIOA 3KF2A 1GDQA 1A5GH 1SLVB 1U6QA 2ZGHA 2ZHWH 3A8AA 3PMAB 1J8AA 1EP5A 3UPEA 3ZVCA 1YPHE 1NPMA 2Q6GA 3BTWE 4GVUA 3BTME 4X1NU 2F3CE 1PPHE 4Y7BA 2CHAB 5BRRE 4OS5A 2CF8H 1TPSA 2PR3A 2GMTC 1FY3A 1AQ7A 1O37A 1T4UH 3LJOA 1K1OA 1ELFA 2CJIA 3C1KA 6LPRA 4IMZA 1O2YA 3TJVA 1A7SA 4X8TH 3RM2H 2XXLA 1GMDG 1HNEE 1MU6B 4Y10E 3CP7A 5FBIA 1UK4A 3TIUA 1P2KA 4CH2B 1O3AA 2R0KA 1C4Y2 1YKTA 3R0FA 3RXIA 4B2AA 4NCYA 1LPGB 2G4TA 3TH4H 2XCNA 4RN6A 1V2KT 1K1IA 2W3KA 4YLQH 1C1MA 2V6NA 3NPSA 3KIDU 5FCKA 3MH5A 1UTOA 2WYGA 4CHAC 3BTGE 3HATH 2G4UA 2F83A 2B0FA 3TPIZ 1G32B 2H9EH 5EPNA 3W95A 4TYDA 3IG6B 4ISHH 4CRDA 1RTFB 5EGMA 3M5MA 1ETSH 3LJJA 2SGDE 3P17H 1O2NA 1HJAB 3EYDA 1P3EA 5JB9S 2STBE 1Y8TA 1QTFA 4CRAA 3PLBA 3ATWA 3SUDA 3V7TA 1C5VA 2ZG0H 2XC4A 3PV4A 4GAWA 3LGIA 2H1UA 1OWEA 2GZ7A 4QT8C 1O5DH 2QV1A 2XRCA 3LPRA 2A4QA 2ZGBH 4O97A 1FY8E 4INKA 3U9AH 4I31A 5C3NA 2A5IA 1VITH 1D3TB 2IOTA 3RP2A 4Q80A 1OX1A 3MU8A 1THRH 4B1TA 3TGJE 4XBCA 1K22H 1YM0A 1GDNA 5E2OA 1DSUA 1DLKB 2BD9A 3I29A 1C9TA 1W3CA 1H1BA 1W11U 1Q31A 3P8OA 3RXVA 5I46H 2FYRA 1TPPA 5J4QA 3LU9B 1N6XA 4J2YB 1GJBB 2FOGA 4CR9A 1A3EH 1QQUA 1HV7A 5PTPA 1SR5C 2R3YA 1CGHA 1CQQA 4ABHA 1RFNA 2BVXH 3SGQE 1MTUA 2ZTZA 1CE5A 4X6PA 1LVMA 2I6SA 3RXTA 3VB7A 3OX7U 5DJ7A 1W13U 1AD8H 1AGJA 4JYTA 1A3BH 1GMHG 1A5HA 1Y3VA 1SGRE 3M36A 5GIBA 2HNTF 5HM9A 1YP9A 2VINA 3ITIA 5TCCA 1QFKH 7ESTE 2LNCA 1V2LT 1LHFH 1EJAA 3MNXA 3KQCA 2R2MB 3TJNA 1O2PA 2BDGA 5AFZH 1C2GA 2B8OH 5I25A 1NC6A 4NGAH 1GBHA 1HGTH 2H2ZA 1SGPE 1HXFH 3T29A 4XDEA 1FQ3A 1E0FD 2EI7A 2P93A 3ATLA 5EODA 4ABDA 3SN8A 3UR6A 2QF0A 1TNGA 3FFGA 2ZC9H 4UFFH 1WCZA 4KP0A 2BMGB 3QN7A 4WH6A 2Y82A 1J14A 1Y3XA 1YLCA 1AY6H 2OBQA 3EQ0H 2FOFA 3FZDA 1QGFA 4ESTE 4BTUB 1DXPA 1DDJA 4IN2A 3OY6U 3TNSA 1GCTC 2CMYA 1AI8H 2XBXA 3B8JA 2F9OA 3T25A 1V2OT 2ZDNA 5C5OA 3E16B 4NZQA 3AW0A 1BUIA 1QA0A 2Y5FA 1WYKA 5EU8A 4AYVB 3URCA 2Q1JA 1BTUA 2VWNA 1GBKA 2ZECA 2DE8A 1QRXA 2CXVA 3HKJB 1IHSH 5HMAA 1KIGH 3RLWH 1RTLA 3LIWA 3V0XA 1Y3WA 4DOQA 1O34A 3A81A 1MUEB 1E37B 1Y5UT 4BXWA 9ESTA 4CRBA 2FS8A 4ZUHA 2QXJA 1GI3A 6CHAB 1QB9A 1SQTA 2M5TA 1KLIH 1TBRH 1AB9C 1S0RA 5A0AE 4Y76A 2SGPE 1P2MA 2P95A 1BITA 1QB1A 3ZZ6A 2QC2A 2V3HH 3A8DA 1QIXB 2BOKA 2A0QB 1EOLA 1OS8A 2GP9B 2PSYA 4DJZB 4YESB 5JB8S 1O2XA 1AKSA 1PQ8A 2BVSH 4FVBA 4A5TS 1GL1A 1SVPA 1LPKB 1MD8A 1TGNA 5FX5A 2B5TB 1C5XB 1G36A 3BTKE 4NIVA 1DUAA 2VVUA 2Z6BD 1S6HA 5L2YH 1ANBA 1JOUB 4Y7AA 1HAXB 2O8WA 3BEIB 4NSVA 3RMOH 1S6FA 2QY0B 1C5UA 1UTLM 1O2QA 1J15A 2PWXA 1C2LA 3H5CB 2GDEH 2VH6A 2SNWA 1ELDE 4I32A 1BBRH 3WY8A 2BD8A 1C1QA 4BANB 3DUXH 5B6OA 2AMQA 1SOZA 1O2KA 1KLTA 1L4DA 1F5KU 3NXPA 1MTNB 1C5NH 3O8RA 1MD7A 4AG1A 1Z1JA 4DVAU 2ALPA 4VGCB 1UVOA 2J2UA 1EAXA 3VGCC 3F9FA 4DG4A 5FXLA 3KN2A 3PO1C 3MMGA 1TAWA 5FPYA 2A5KA 3Q3KA 3RXJA 3QTOH 1GVKB 2ZNKH 4IS5A 3SORA 3MNBA 2R3UA 1HAVA 2NU2E 3STIA 2HOBA 2ZZUH 1T8LA 2GD4B 1NO9H 3RXFA 2BDHA 4TY7A 2ZHQH 1FV9A 4Q2KA 2HNTE 4Y8YA 2AGEX 2HPPH 1XVMA 2CHAC 1P2QA 3MWIU 3NWUA 1F5RA 3ZVAA 1K1LA 2GKVE 3D49H 1GI9B 2WYJA 2GZ8A 1X7AC 1PPBH 1P8VC 3TLOA 1WBGB 1EZSC 1P2JA 5LPRA 2A2XH 1AVGH 1O3BA 2ANKH 1O3MA 1BT7A 1H8DH 1GG6B 1UHBA 3O8BA 4A92A 1ZJKA 1E38B 2C8ZB 1K1NA 1WAYB 1S82A 2A7JA 2BTCE 3A7YA 4NIWA 4ZXYH 4RKOB 3W94A 1TNJA 2BY6X 1QQ4A 1Z1IA 1UMAH 5CE1A 1ZSJA 1O2VA 5FPSA 3LOXA 1E36B 1DWEH 2WINI 1AUJA 4WMFA 1HBTH 2FOCA 1XUIA 3S0NA 1GHWH 1Q3XA 1W8BH 2FTLE 2WV5A 4K5ZA 2VH0A 1ZRBA 3S7HB 1H9IE 2ALVA 1ZJDA 2I6QA 1V2VT 1AN1E 2H9TH 5HGGA 3SQEE 3U8TH 3KL6A 4XBDA 4WH8A 2JETB 2ODYB 4BOHA 2Y80A 1HCGA 1C5WB 1CT4E 1NFWA 2ZFPH 3QK1A 4K1EA 1S84A 1VR1H 4E7RG 1N8OC 2XTTB 4OS1A 1LCYA 1ZSKA 3QX5H 4H4FA 1GGDC 1SGFG 1AHTH 1YPEH 3TVJB 5JBCS 1V2WT 4Y11E 1FAXA 1LHEH 2C90B 4I8HA 1VJ9U 2BY7X 3SU0A 1O2IA 1G2MA 1TB6H 3UUZA 3BTTE 2C3SA 3BG8A 1VZQH 8GCHF 3U8RH 1XUGA 1DVAH 2RDLA 1TPOA 4AORA 1BRBE 1D3QB 1EAUA 3QWCH 2ZCLP 1NRPH 4FUHA 1TGSZ 3NZIA 4FUCA 2O8LA 1HDTH 3A7WA 2ZHFH 4I8LA 3RXSA 3FAOA 5DG6A 1A0JA 1SL3A 4ZHLU 1G2LA 1GHBG 3P92A 1EP6A 2IN2A 2NU3E 4X1PU 4YO9A 5T6GA 1Z8GA 1UCYH 4AFSA 4FUFA 1SOTA 3GYMA 2HNTC 2FPZA 3SU6A 3SNCA 1GI0A 1QJ7B 2H6MA 4UFEH 1HRTH 1O0DH 4NIYA 2G51A 3F1SB 4B73A 1FY4A 3AAVA 1YPLH 5EXNA 1TGTA 1O5BB 3TGKE 3N7OA 3SW2B 1GHAG 5JBBS 5T6DA 4IC5A 1F92A 1PPZA 2NU0E 4INLA 5A2MH 5JDUB 4O3TA 2R2WU 1BMLA 1MCTA 1XKBC 4ABEA 1TNIA 3RU4E 4O3UA 1AU8A 3QLPH 3AASA 3UQVA 3HGNA 3ODFA 2PSXA 2Y5HA 1NY22 4X6OA 1B7XB 3M7UA 1NRQH 3A85A 4OGYA 1LQEA 3LGVA 3RXBA 1P09A 2QXGA 2PUQH 1KXAA 4AZ2B 5F8TA 1GI5A 1P01A 3M61U 2DUCA 2G52A 1YGCH 2BB4A 4R0IA 2VGCB 2XCFA 4THNH 1JXPA 3TK6A 2A4GA 1DICA 2Q6FA 5FHTA 2BHGA 1Z8JB 4UE7H 1EXFA 5JBAS 4K8YA 2AH4X 3RXKA 3RU4D 3K2UA 3GCTF 2WV4A 3F6UH 5ETXA 1ANDA 5J4SA 3UWJH 1C5MD 4NWKA 3ZZCA 2BM2A 2GVFA 1OYTH 2VIVA 1QL9A 1DM4B 1IQMA 2GCTB 2O8MA 1QY6A 2Z9IA 6GCHF 4ZKSU 2EI6A 2QN5T 3VFEA 1MTVA 4U2WA 2ZP0H 1F0RA 2ZFRH 1D6RA 2ZFSA 1H9HE 2WUCA 1EZQA 1TBZH 1NU7B 2XWAA 4B76A 4X8SH 1A4WH 2AMPA 1DY9A 1C1VH 1HAIH 1N1LA 2C93B 1ZRKA 1ESBA 1FI8A 1P9UA 1DT2A 3ZV9A 4X8UH 2W3IA 1C1TA 4NIXA 1C2FA 4TWYA 4FXGH 1JBUH 3BEUA 3T27A 1O2RA 3TH3H 5AF9H 1KDQA 2BX4A 1CBWB 4PROA 4ISNA 3SGBE 1BTZA 1TMTH 3UR9A 1AFQB 1SLWB 3JZ1B 1ETTH 1DE7H 1SFQB 1HAPH 1O3KA 4D7FA 1PQAA 4IGDA 1GBJA 4K1TA 2XW9A 2A1DB 1J17T 1O3EA 1P2OA 6ESTA 2RCEA 4H6TA 1BBRK 1G37A 2ZCHP 4DGJA 1YC0A 1D9IA 2HPQH 1B0FA 1GBCA 4Y6DA 2PGQB 1JIMA 1MTNC 2BX3A 3U1IB 1UTKA 1MBQA 2ZFFH 3T62A 2JKHA 2FI3E 1OYQA 2XBWA 1SPJA 1HLTH 3LGYA 4K8BA 2OXSA 4OS7A 2J34A 1Q2WA 5A0CA 4U32A 4K1SA 4MPVA 2SGEE 1JWTA 2LPRA 2SGQE 5F6MA 2RA3A
chains in the Genus database with same CATH superfamily
4XE4A 1AZZA 2EC9H 3TK5A 4BTIB 2PP6A 3GISB 2ZA5A 4RSPA 5EXLA 5LH8A 3SJOA 3OU0A 1GBFA 3UQOA 3Q77A 2PFEA 1NZQH 2IJD1 2J9NA 3MOCA 2RG3A 1W0ZU 2OC1A 5DGJA 1OWDA 2CN0H 2FDAA 2FYQA 4YXWD 1WV7H 3BTQE 5EW1H 1GHZA 3RXLA 1EB1H 4IMQA 1QNJA 4A1XA 2BD3A 5CHAC 2K0QA 2KCPA 2GV6A 3ESTA 1UW7A 1L1NA 4GPGA 5GCHF 1ZHMA 3AAUA 1IQEA 3KQDA 1THPB 3KCGH 3PB1E 3TGIE 1EJMA 1GBMA 1UO6A 2XBVA 3HKIB 4AGJA 5GWZA 2A32A 1B0EA 1M9UA 4UONA 1XXDA 3L3TA 2QYIA 1NRSH 1OP2A 5L6NH 2AERH 5F8XA 3SI3H 1K9OE 1ZZZA 4WVPE 1NTPA 3E0PB 1O3OA 4AX9H 5EQRA 3SU2A 1HXEH 1GBEA 1K28D 4AB8A 1EUFA 1K1JA 1QL8A 3Q3XA 1EPTB 4KELA 1BJUA 1XVOA 2Y7XA 1QBOA 1O2ZA 1YPMH 3EGKH 1AE5A 2ZGXH 5E2PA 1D4PB 3GY5A 1TX6A 3SHAH 1VCWA 2F91A 1QJ1B 3RXDA 3UNSA 1HFDA 3CENA 3GCTG 2THFB 1AIXH 3SJIA 4GCHF 2QXHA 1RTKA 4E06H 4YZUA 4NFEA 3BN9A 2ULLA 3DA9B 1RD3B 1T8OA 3H09A 1YPHC 2J94A 4FU9A 2ZGJA 4BAHB 3RXRA 3F68H 2WPJS 1ZPBA 3MTYA 5EPYA 1QRZA 3RXMA 1ELEE 4IC6A 5C1XA 1A0HB 2GV7A 1G9IE 1OXGA 1C4V2 2BD5A 1J9CH 3BG4B 5F8ZA 3VB4A 1IHTH 2F9BH 1P05A 2VVCA 4ACAA 3IWMA 3PMBB 2OC0A 3PYHA 3CNRA 1F0TA 2VIQA 4X6MA 1O3DA 1GWAA 4NA9H 4GUXA 1K2I1 1TLDA 1SB1H 1O3LA 2EA3A 1CA0B 3GCHC 3RXUA 1EB2A 5TCAA 1VGCB 2ZU1A 1GI4A 1JMOH 5C17A 4MPWA 5F53A 1BOQA 4WY3A 2VIPA 2WUBA 1O32A 3RXHA 1CHOF 1FXYA 2JJ1D 4GHQA 3MO6A 1WTHD 4AYYB 3LDXH 2OQUA 2G00A 3PRBA 3ELAH 1PPEE 3F9HA 1WU1A 2GCHF 1O2TA 1BRUP 4X2WA 1TRMA 1ELCA 4FUIA 2KAIB 3DSPA 1C1UH 4X1RU 1TX8A 1BMAA 4YOGA 3T2NA 4ABFA 1GJCB 1AMHA 4ZH8A 1F2SE 1TA2A 3CS7A 3TITA 3KEEA 4ISLA 1B5GH 2VNTA 5H4IB 3SUGA 5L30H 2GGVB 1LPZB 3Q00A 1O35A 1SI5H 1C1SA 2J97A 3F3BA 4D8NA 1GJAB 1TOMH 1W7XH 3A89A 4P02A 2AYWA 2C8WB 4ZROA 1UTMA 4R8TB 3ZZ9A 3UNQA 1CT2E 1GBLA 1O2WA 3UWIA 4AFZA 3SJKA 3M3VA 4DURA 1JIRA 2GT7A 2OD3B 1PPFE 3M5OA 1AWHB 5ESTE 1ID5H 1RJXB 3QUMP 1BMNH 2BLVA 3MU5A 4KGAA 1T7CA 2OLGA 2EEKA 4D9QA 2CV3A 2HGTH 2VGCC 2H5DA 1DPOA 1V2QT 1O3GA 1O3NA 4YT7H 2H9HA 3UOPA 3ZYEA 3A8CA 2P8OC 1EX3A 4Q7XA 1GJDB 3MI4A 2ZGCA 2FX6A 4X1QU 1HAYB 5GDSH 4WF8A 4FUEA 4ZAEA 4F49A 2FLBH 3RMMH 3NCLA 3QO6A 3SO3A 3SOSA 1XUFA 3RU4T 4KTSA 1LVBA 1O5GH 5DKMA 1ESAA 1IQHA 1UJ1A 1O30A 2OC7A 1O2SA 2PKSC 4JZEH 1MQ5A 3VXFH 2Z94A 5FCRA 1W2KH 3I77A 2STAE 2NU1E 2AGGX 2C8YB 1YPJH 3DSGA 5IDKA 3SNAA 5C1UA 1YLNA 4E7NA 1D3PB 4GSOA 9LPRA 3M3TA 1C4U2 1KTTB 4UFDH 5FBEA 1BCUH 4NFFA 2TGAA 4DW2U 1GBDA 2ZPRA 2UUJB 4ISOA 2WPHS 3W1EA 3RXAA 1ZGIA 1L1GA 2LP6A 4FUBA 1GI8B 1ZMLA 1GDUA 1Y3YA 2GMTB 3P8FA 1FUJA 1HIAB 1RS0A 3A7ZA 1RIWB 1XM1A 3U69H 4ZHMU 1O31A 1C2DA 4ZXXH 3ZZ5A 2F9NA 1TNHA 3LGUA 1BBRE 4I7YH 1YCPH 2PTNA 3KYGA 5C0UA 3BIUH 2FP7B 3SZNA 3HK3B 2AEIH 3TU7H 2P3UB 4CRCA 2VJ1A 4LOYH 1BQYA 5JPMH 2FI5E 1O2JA 4AG2A 3UB0A 1FONA 1MH0A 1F7ZA 2W26A 1C5RA 2WPKS 4MPXA 4AGKA 8ESTE 5G4BA 1ELBA 3E6PH 1DOJA 1SSXA 4HI3A 1MAYA 1BTPA 3RMNH 1IQIA 1TOCB 3D65E 1IQFA 4INHA 4CHAB 2D26C 1BA8B 1E34B 3ZVDA 8KME2 1BTHH 4JYVH 1P0SH 3KQBA 3S9CA 1VJAU 1DWDH 4ZKNU 3LT3A 4YM9A 4DIHH 4KKDA 1IQJA 2GJGA 2VWMA 2F9UA 5CDFE 1P12E 1GVZA 4UEHH 2BLWA 2ASUB 1MAXA 1NU9A 1Z6EA 4WXIA 2G5VA 1GVLA 1SQOA 3UY9A 4AN7A 4ZKOU 1O33A 3RXPA 4Q63A 1O39A 3M37A 1HAZB 3GDSA 4OS6A 3BF6H 3NK8A 3BTFE 4B2CA 3KNXA 4DY7B 5K0HA 1HJ8A 2PV9B 3RXOA 1FY5A 4ISIH 1ZPZA 1O5EH 1GHYH 2ZPSA 1HJAC 3DCLA 3A7VA 1WXRA 1OKXA 2D2DA 2G5NA 5C5NA 3EA8A 1SGIB 4WJG2 1KYNA 2SNVA 3GY4A 4X2VA 3A7XA 1PFXC 3GICB 1C5OH 1P11E 2ANMH 2TGTA 4Q7ZA 1C2EA 2ZU3A 1SLXB 1ANCA 1C1NA 1ZTKA 3KHVA 1GMCF 1QRWA 1OSSA 1BB0B 2AFQB 2ZWLH 2OCVB 2OBOA 5AHGH 3GCNA 3HPTB 4ABAA 1KY9A 4MDSA 3SGAE 1SG8B 1PQ7A 2ZIQH 2Z3CA 2ZKSA 3VB5A 1ZGVA 2P59A 2PHBA 2OUAA 1EKBB 2Z3EA 4H42U 2RDEA 4K3JA 1CGJE 2BDAA 1MTSA 1FIZA 1ELVA 1XUJA 2BOHB 1RGQA 1BTXA 4I8KA 1C2JA 2SGFE 2VB0A 2PGBB 1GI2A 4WXVA 2BD7A 2ZO3H 1C2MA 5JYIA 1D3DB 3EDXB 2FEQH 1O36A 3S7KB 2Z9KA 4LXBH 2BY5X 1A5IA 1L4ZA 3L33A 1OHHD 4Q7YA 1D6WA 2TBSA 3T28A 3LH3A 3SHCH 1C5TA 5GPIB 1QZ8A 2PKAB 2B9LA 1W12U 2AIQA 4JCNA 1K1MA 2W6JD 1GMDF 1W10U 1C5ZB 2WPDD 1O3PB 4P00A 3F0OA 5A8YA 4DT7B 2R0LA 2QAAA 4JMYA 2ZU2A 3OSYA 2OTVA 3ODDA 2FIRH 3M5NA 1LMWB 1AZ8A 3FP6E 2XNIA 2XYAA 1F5LA 4GHTA 5AVDA 3GOVB 2P16A 3V12A 3G01A 3DD2H 3D23A 1BTWA 3RC5A 3LKWA 3DFJA 4HTCH 2Z9JA 2PKAA 4YOJA 1IQLA 2FOEA 1P04A 4CRFA 5DP9A 3SU5A 3K65B 1TGCA 1G30B 3P8NA 1H9LB 1GCTB 1TFXA 2XBYA 3F0PA 1QA7A 1NN6A 4AFQA 4I8GA 4JK6A 4Y0YE 1TYNA 5T3HA 2VIOA 5FL7D 1MCVA 5K7RA 2NU4E 2BDYA 1OP8A 3A88A 4D7GA 3FVFB 1JRTA 2BQWB 2BDCA 1OWIA 3BTHE 1W0YH 1C1RA 1IAUA 3UNRA 1FY1A 1FMGA 1GJ4H 1T8NA 3PLKA 1S83A 4Q4LA 2GT8A 1YF4A 1QBVH 3C27B 2C8XB 1C5LH 4XSKU 1DFPA 2ILNA 4TWWA 4NWLA 2FOAA 4HG6A 2D1JA 4CBNA 1QCPA 7LPRA 1TGBA 4HZHA 1VCPA 3MO9A 4A7IB 1AB9B 1O3HA 3SBKA 3TK9A 1S85A 2P3FH 2EQNA 3OAAD 2VWLA 3OYPA 2XC0A 4YOIA 1TQ7B 1NS3A 3M7QA 1VITF 5DP4A 1HYLA 2PLXA 3BEFB 3RC4A 1ELTA 1C9PA 1F0SA 2GDDA 5FPTA 1GI6A 1DUEA 1GJ8B 1T4VH 3ENSB 4U30A 1FPCH 3CS0A 6CHAC 1PJPA 3DT0H 3BSQA 4LZ1H 2Y6TA 2OINA 1KXFA 4I33A 4MNYA 1KXEA 2FX4A 2RA0A 4FU7A 1SGTA 1DY8A 2HLDD 3NRLA 8LPRA 2A31A 1V2JT 2YNAA 3SV7A 4CH8B 1C1WH 4Z0KA 3IITA 3SU1A 3PRDA 2FWWA 3RXCA 3ZZDA 1DANH 1XMNB 3ZV8A 4FUGA 1GMHF 1SGQE 2BXTH 4CR5A 3ZVBA 1W7GH 1MKXH 4XOJA 3LGWA 5BPEA 3VXEH 4BTTB 1E79D 2HVYB 4ASHA 2XNDD 1W14U 1UK3A 3VEQB 1TONA 3KQ5A 3O8DA 4CREA 1RRKA 3GY8A 4UDWH 2F43B 1GMCG 1HPGA 2R9PA 2ZI2H 1ZOMA 3N7DA 2BQ6B 2AGIX 1K21H 3T5FH 3TJOA 2ZDAH 5T6FA 3BTEE 1S81A 1LHGH 3S69A 3PO1B 1GHXH 5DP7A 1CO7E 1GI1A 1MQ6A 5E0GA 8GCHG 3K6YA 3WW7A 3SNBA 2HWLB 1TA6A 3GDVA 5C2ZA 2BLOA 3LC5A 1DXWA 4BAMB 3EE0B 4JZDH 1ZHRA 4A1VA 2LELA 3MH4A 4FETA 1P2NA 2HRVA 2O9QA 4TPYA 2TRMA 4VGCC 1KTSB 1GBIA 1WQVH 3MU1A 1GJ9B 3OTJE 3E0NB 2P94A 2ANYA 1O5AB 1YLDA 1AUTC 1CHGA 1TMUH 2WV9A 1ELAA 1C2KA 1E35B 3H7OA 5DPAA 5JBTA 2FS9A 4LZ4B 4DIIH 1RIWC 2C4FH 1MKWH 2FO9A 3M5LA 1BDAA 4TPIZ 2G81E 1YCPK 3B9FH 1GJ6A 4Y79A 2HVXA 2ODQA 3A87A 4NZLA 4B75A 5A0BA 1E1QD 1TABE 3KQEA 5CMXH 1CU1A 4H6SB 5KGOA 2TGDA 2V3OH 2FESH 1O3FA 4K2YA 3ZVFA 1C5SA 5DP3A 2XWBI 3LONA 2FM2A 1SC8U 3EA7A 4B2BA 1TX7A 1GI7B 1V2PT 2BZAA 4NG9H 4Y71A 1LQDB 1DWBH 1Z71A 1CSOE 1LVOA 5EJLA 2ZDKA 1FNIA 2IPQX 4JZFH 1SGDE 4RT0A 4B74A 1SGEE 1GG6C 3GY7A 3S9BA 5DP5A 1C2HA 1A0LA 3DHKH 3FP7E 1TNLA 2O8UA 4E05H 1KLJH 1ZLRA 2VIWA 3MFJA 4M9FA 2UUYA 1QURH 3F2HA 3SU4A 3SJ8A 1N8OB 2KFWA 3F9GA 5EOKA 3MNSA 2ZDVH 3MU0A 3ZZAA 1TMBH 3Q76A 1GGDB 3GS9A 4F4OC 3FP8E 1O2GH 1BZXE 1Y59T 2W5EA 1TBQH 2OK5A 3UREA 2A4RA 2J5UA 3MQKC 2JETC 4MTBA 4FU8A 5EJ1A 3RXQA 1P06A 1MMJN 3VG8A 1G3BA 1G3EA 2Z9LA 3JZ2B 4ACBA 4MNVA 2WZQA 3ATKA 3FANA 2ODPA 3K6ZA 2ZTYA 1V2RT 1VITG 2A5AA 4MNXA 1EQ9A 1C5YB 6GCHG 2RFKC 4MQAA 2FZZA 3OEHD 5EG4A 1O5CB 3SV2H 3SNDA 1F0UA 1EPTA 1ZMJA 3MNCA 1YBWA 2UWOA 2NWNA 2YMSB 2J38A 5FX6A 5B6LA 1WSSH 1DSTA 4MG3A 1TRNA 2ZPQA 1NESE 3PWCA 1EZXC 5DP6A 2OQ5A 1SMFE 2BYAX 1ESTA 3LC3A 1DITH 4Y8ZA 3E8LA 3GCOA 3PMHB 4ZKRU 5LPEA 1V6DA 1UTPA 2EI8A 4MLFB 3SUFA 1IQNA 3A86A 3RC6A 5LPFA 5HM2A 2G8TA 3I78A 3GY2A 1UCYK 1BRCE 3EA9A 5EXMA 3ZVGA 2QF4A 1SLUB 4JYUH 4ABBA 3EAJA 2HLCA 1UTNA 2ZFQH 5CHBA 3QTVH 1XUKA 3QDZB 3UIRA 3E90B 4KTCA 1LKBA 4NA7A 2BXUH 2ZEBA 2YNBA 1P57B 2ZDLA 2BD2A 5TJXA 1LTOA 1C1OA 5A8XA 1EFRD 1GPZA 4IW4E 1QBNA 1SGYE 1PPGE 1FAKH 2FOBA 1GBAA 1COWD 1ZSLA 2QXIA 1ABIH 3E91A 2W7UA 1Z8RA 2VWOA 4XD7D 2K1QA 2QF3A 1HAGE 2A4OA 3RDZA 4ABJA 2ZQ2A 2FI4E 1T32A 2UUKB 4RKJB 3M7TA 5C20A 5DSFA 3BV9B 2AHME 2W7SA 3MU4A 4SGBE 3ATMA 2SGAA 4AFUA 1UTJA 5SGAE 2FOHA 4OS4A 2KAIA 4ZMAH 1G3DA 1ETRH 2V0BA 1Y5AT 3SQHE 4Y8XA 2CGAA 2WPLS 3M35A 1EOJA 2QGRA 1IQGA 1UK2A 2TIOA 1MBMA 2ZU5A 2XC5A 3SV8A 1O2UA 1AKSB 1A61H 1WOFA 4ZHAA 3GY6A 1NFXA 2FLRH 3F9EA 3GDUA 5EQQA 1V2UT 2JH0D 1Y3UA 1FLEE 1T8MA 2SFAA 1KXCA 1O2HA 1XUHA 1FIWA 4F55A 1TWXB 2EY4C 1SQAA 5GCHG 2WHXA 1S5SA 3A82A 2Q6DA 4CRGA 2GCTC 4WMEA 2Y5GA 1CGIE 2A7CA 2QA9E 2JH6D 3NKKA 1PPCE 4K69A 1O3CA 2PW8H 1SGFA 2TGPZ 3TNTA 2ZTXA 1TE0A 3A8BA 3L6PA 1N6YA 1XKAC 3URDA 1GHBF 1NRNH 3Q3YA 3PTNA 3QGNB 3V3MA 3MO3A 4ASUD 1ARBA 1L1JA 2ZHEH 4BAOB 3ZYDA 4FVDA 2OP9A 4I86A 7GCHF 1WQSA 1HAVB 2F9VA 1FPHH 1MKXK 3FKSD 4GCHG 3PMJA 3RUOA 1MZAA 1L2EA 3D62A 1CBWC 1AO5A 1EAIA 3ZZBA 1A1RA 1AFQC 1LVYA 1GHAF 4A1TA 1DWCH 1TNKA 3U1JB 1ACBE 1P10A 1ZYOA 1SHYA 3P70B 1C1PA 2UUFB 2VVVA 3PWBA 5EW2H 3ZZ3A 2A7HA 3ATIA 1TIOA 4CBOA 4LK4A 1Z8IB 3PM3A 1LKAA 1AVWA 4JK5A 2BLQA 5DO4H 1O38A 2IPHA 1ZTLA 1O3IA 2AS9A 1SFIA 1YCPM 1XXFA 5EJZA 4JZ1A 3RXEA 3VB6A 1FZZA 3M3SA 3VB3A 3VPKA 1WTGH 2A2QH 4D76A 1YPKH 2ZCKP 4ABIA 1QB6A 2JJ2D 1Z7KA 1UHBB 2BD4A 2G55A 2BDBA 1LDTT 2VU8E 1UTQA 5C67A 4M7GA 1HIAA 3GY3A 1MABB 2ESTE 2JH5D 1HAOH 1HJ9A 1EATA 4A6LA 3O8CA 1CHOG 4FUJA 4TSFD 3R3GB 1MKWK 2Z9GA 5LGOA 4UFGH 1NRRH 5HKKD 4OGXA 2GCHG 3RMLH 4O9VA 4HFPB 1TPAE 3U98H 1A46H 1IOEA 1KMHB 1THSH 5CHAB 5A09A 2ZQ1A 2ANWA 1C5PA 1GBBA 4TY6A 1EASA 3ZZ8A 1GJ5H 3BIVH 4BAQB 4K60A 1WUNH 2YMSD 2AMDA 1W0JD 2FTMA 3A83A 3FZZA 1HUTH 2FODA 4I8JA 1OOKB 2BY9X 3QGJA 1ANEA 5ABWA 1GCDA 3MHWU 2PTCE 1L0ZA 4X8VH 2BQ7B 1CA8B 1V3XA 3QZRA 1QJ6B 5ESBA 4MNWA 2YOLA 2UWPA 1V2ST 5HYOA 1EJNA 1V2MT 2V35A 4HGCA 1AVXA 1UVSH 4WMDA 3A7TA 1INCA 4J1YA 1FN8A 3SNEA 1P2IA 3V13A 1KSNA 2F9PA 3UTUH 4X0WU 3MH6A 4O03A 4AB9A 2TPIZ 2D8WA 1EPTC 1XX9A 1ORFA 1HB0B 4YTAA 1T31A 1GL0E 2AIPA 1BRAA 2KZ4A 1IQKA 1YPGH 3RXGA 3HK6B 3P95A 2Y81A 2H5CA 1QL7A 3T26A 2CF9H 2QIQA 1C2IA 3BTDE 1NBME 1Z6JH 2KCOA 3P6ZB 1S0QA 1H4WA 1HAHH 2A45B 2ZHDA 5GJ4B 1P02A 4NSYA 2GX4A 5F03A 5EIYA 1GJ7B 1SGNE 4B71A 4D9RA 1Y5BT 4X6NA 1BMMH 1V2NT 7KMEH 1NROH 1ZMNA 3MYWA 4KTUA 4BAKB 1NT1A 2WPIS 5IYTA 1LHCH 3PROA 3GCHB 1TALA 1AE8H 2IJOB 3BG4C 2YMSC 2VIDA 5FAHA 3QZQA 4B6EA 2J92A 2QCYA 4WWYA 1BTYA 1TRYA 3A84A 2O8TA 1UVUH 2B7DH 4ABGA 2PUXB 3UOUA 3UFAA 4UD9H 2VBCA 5C1YA 1YYY1 7GCHG 5AFYH 4JZIA 3P8GA 1CA0C 1NBMD 1PYTD 1LO6A 1VGCC 1UCYE 4IN1A 3PTBA 3LH1A 4YT6H 1P03A 2Z7FE 2UWLA 1RXPA 3TH2H 1P9SA 2Y7ZA 1JRSA 3ZZ4A 4MVNA 3TJUA 1K1PA 1MZDA 3OY5U 1O2MA 1TQ0B 5EQSA 1QR3E 4DCDA 1OWKA 1V2TT 2GZ9A 1SHHB 4FUDA 1OP0A 1W0KD 2DE9A 4BNRA 1LHDH 1C5QA 1GBTA 2CK3D 1AWFH 4XFQA 4OS2A 1P3CA 4X1SU 5HXFA 1J16A 1O2LA 2WPMS 3SI4H 3DFLA 2HALA 3KGPA 5KEDA 1PQ5A 1EZUC 1NFUA 4X2XA 5L2ZH 4AOQA 3E1XB 3U8OH 1FN6A 2OC8A 4IBLH 1CT0E 2FOMB 2FXRA 3DSOA 2J4IA 4GLYA 5HIZA 2BDIA 1FJSA 2BY8X 3SJ9A 1SBWA 1KXBA 2P8OB 1O3JA 1OPHB 1BJVA 5A8ZA 1A2CH 2ZU4A 1DLEA 2Z3DA 2ZDMA 4YLUA 2L74A 2P3TB 1O5FH 1SGCA 1VCQA 4NA8A 1OWJA 1UVPA 3S9AA 3STJA 3SV9A 1ZTJA 1ARCA 3GYLB 3LGTA 5C94A 1E1RD 1EAWA 1ABJH 1KDQB 1NFYA 3KYFA 4Z6AH 3RM0H 2BVRH 1PYTC 4U01A 3B23B 4BXSA 2PKSB 1O2OA 3PV2A 1AFEH 5E0HA 2BZ6H 1H8IH 2J95A 4Y0ZE 1ZR0A 3H7TA 2FMJA 3AVZA 1CVWH 4X2YA 4XBBA 1ZPCA 3K9XB 3MH7A 2GTBA 3SV6A 3A80A 4SGAE 1FDPA 1DS2E 3ZZ7A 3SUEA 1KXDA 1QHRB 1ZHPA 3HGPA 5E8EH 1NM6A 3ZVEA 3VGCB 5DK1A 5E0JA 5DP8A 1MU8B 1MTWA 1BHXB 3PLPA 3SU3A 1UVTH 3U28C 1GHVH 3NUMA 1DX5M 4MPUA 3RLYH 2ZF0H 4Z1MD 1BHXF 1ELGA 5GXPA 1G3CA 1YWUA 3AW1A 2ZFTA 3E3TA 1OWHA 1BIOA 3KF2A 1GDQA 1A5GH 1SLVB 1U6QA 2ZGHA 2ZHWH 3A8AA 3PMAB 1J8AA 1EP5A 3UPEA 3ZVCA 4F48B 1YPHE 1NPMA 2Q6GA 3BTWE 4GVUA 3BTME 4X1NU 2F3CE 1PPHE 4Y7BA 2CHAB 5BRRE 4OS5A 2CF8H 1TPSA 2PR3A 2GMTC 1FY3A 1AQ7A 1O37A 1T4UH 3LJOA 1K1OA 1ELFA 2CJIA 3C1KA 6LPRA 4IMZA 1O2YA 3TJVA 1A7SA 4X8TH 5C0TA 5DN6D 3RM2H 2XXLA 1GMDG 1HNEE 1MU6B 4Y10E 3CP7A 5FBIA 1UK4A 3TIUA 1P2KA 4CH2B 1O3AA 2R0KA 1C4Y2 1YKTA 2JIZD 1S6LA 3R0FA 3RXIA 4B2AA 4NCYA 1LPGB 2G4TA 3TH4H 2XCNA 4RN6A 1V2KT 1BMFD 1K1IA 2W3KA 4YLQH 1C1MA 2V6NA 3NPSA 3KIDU 5FCKA 3MH5A 1UTOA 2WYGA 4CHAC 3BTGE 3HATH 2G4UA 2F83A 2B0FA 2JDID 2XOKD 4DT4A 3TPIZ 1G32B 2H9EH 5EPNA 3W95A 4TYDA 3IG6B 4ISHH 4CRDA 1RTFB 5EGMA 3M5MA 1ETSH 4FOUC 3LJJA 2SGDE 3P17H 1O2NA 1HJAB 3EYDA 1P3EA 5JB9S 2STBE 1Y8TA 1QTFA 4CRAA 3PLBA 3ATWA 3SUDA 3V7TA 1C5VA 2ZG0H 2XC4A 3PV4A 4GAWA 3LGIA 2H1UA 1OWEA 2GZ7A 4QT8C 1O5DH 2QV1A 2XRCA 3LPRA 2A4QA 2ZGBH 4O97A 1FY8E 4INKA 3U9AH 4I31A 5C3NA 2A5IA 1VITH 1D3TB 2IOTA 3RP2A 4Q80A 1OX1A 3MU8A 1THRH 4B1TA 3TGJE 4XBCA 1YY3A 1K22H 1YM0A 1GDNA 5E2OA 1DSUA 1DLKB 2KR7A 2BD9A 3I29A 1C9TA 1W3CA 2L6OA 1H1BA 1W11U 1Q31A 2KCYA 3P8OA 3RXVA 5I46H 2FYRA 1TPPA 5J4QA 3LU9B 1N6XA 4J2YB 1GJBB 2FOGA 4CR9A 1A3EH 1QQUA 1HV7A 5PTPA 1SR5C 2R3YA 1CGHA 3FOAA 1CQQA 4ABHA 2M2AA 1RFNA 2BVXH 3SGQE 1MTUA 2ZTZA 1CE5A 4X6PA 1LVMA 2I6SA 3RXTA 3VB7A 3OX7U 5DJ7A 1W13U 1AD8H 1AGJA 4JYTA 1A3BH 1GMHG 1A5HA 1Y3VA 1SGRE 3M36A 5GIBA 2HNTF 5HM9A 1YP9A 2VINA 4RI0A 3ITIA 5TCCA 1QFKH 1SQRA 7ESTE 2LNCA 1V2LT 1LHFH 3N7EA 1EJAA 4TT3D 3MNXA 3OFND 3KQCA 2R2MB 3TJNA 1O2PA 2BDGA 5AFZH 1C2GA 2B8OH 5I25A 2KM0A 1NC6A 4NGAH 1GBHA 1HGTH 2H2ZA 1SGPE 1HXFH 3T29A 4XDEA 1FQ3A 1E0FD 2EI7A 2P93A 3ATLA 5EODA 4ABDA 3SN8A 3UR6A 2QF0A 1TNGA 3FFGA 2ZC9H 4UFFH 1WCZA 4KP0A 2BMGB 1WDIA 3QN7A 4WH6A 2Y82A 1J14A 1Y3XA 1YLCA 1AY6H 2OBQA 3EQ0H 2FOFA 3FZDA 1QGFA 2KCAA 4ESTE 4BTUB 1DXPA 1DDJA 4IN2A 3OY6U 3TNSA 1GCTC 2CMYA 1AI8H 2XBXA 3B8JA 2F9OA 3T25A 1V2OT 4OM9A 2ZDNA 5C5OA 3E16B 4NZQA 3AW0A 1BUIA 1QA0A 2Y5FA 3OTPA 1WYKA 5EU8A 4AYVB 3URCA 2Q1JA 1BTUA 2VWNA 3SYJA 1GBKA 2ZECA 2DE8A 1QRXA 2CXVA 3HKJB 1IHSH 5HMAA 1KIGH 3RLWH 1RTLA 3PV5A 1SKYE 3LIWA 3V0XA 1Y3WA 4DOQA 1O34A 3A81A 3ZIAD 1MUEB 1E37B 1Y5UT 4BXWA 2QE7D 9ESTA 4CRBA 2FS8A 4ZUHA 2QXJA 1GI3A 6CHAB 1QB9A 1SQTA 2M5TA 1KLIH 1TBRH 3F2GA 1AB9C 3SZEA 1S0RA 5A0AE 4Y76A 2SGPE 1P2MA 2P95A 1BITA 1QB1A 3ZZ6A 2QC2A 2V3HH 3A8DA 1QIXB 2BOKA 2A0QB 1EOLA 1OS8A 2GP9B 2PSYA 4DJZB 4YESB 5JB8S 3UAIC 1O2XA 1AKSA 1PQ8A 2BVSH 4FVBA 4A5TS 1GL1A 1SVPA 1LPKB 1MD8A 1TGNA 5FX5A 2B5TB 1C5XB 1G36A 3BTKE 4NIVA 1DUAA 2VVUA 2Z6BD 1S6HA 5L2YH 1ANBA 1JOUB 3WWFA 4Y7AA 1HAXB 2O8WA 3BEIB 4NSVA 3RMOH 1S6FA 2QY0B 1C5UA 1UTLM 1O2QA 1J15A 2PWXA 1C2LA 3H5CB 2GDEH 2VH6A 1K0HA 2SNWA 1ELDE 4I32A 1BBRH 3WY8A 2BD8A 1C1QA 4BANB 3DUXH 5B6OA 2AMQA 1SOZA 1O2KA 1KLTA 1L4DA 1F5KU 3NXPA 3AK5A 1MTNB 1C5NH 3O8RA 1MD7A 4AG1A 1Z1JA 4DVAU 2ALPA 4VGCB 1UVOA 2J2UA 1EAXA 3VGCC 3F9FA 4DG4A 5FXLA 3KN2A 2QF5A 3PO1C 3MMGA 1TAWA 3OEED 5FPYA 2A5KA 3Q3KA 3RXJA 3QTOH 1GVKB 2ZNKH 4IS5A 3SORA 2W6ID 3MNBA 2R3UA 1HAVA 2NU2E 3STIA 2HOBA 2ZZUH 1T8LA 2GD4B 1NO9H 3RXFA 2BDHA 4TY7A 2ZHQH 1FV9A 1FX0B 4Q2KA 2HNTE 4Y8YA 2AGEX 2HPPH 1XVMA 2CHAC 1P2QA 3MWIU 3NWUA 1F5RA 5HIYA 1K1LA 3ZVAA 2GKVE 3D49H 1GI9B 2WYJA 2GZ8A 1X7AC 1PPBH 3F2FA 1P8VC 3TLOA 1WBGB 1EZSC 3FO8D 1P2JA 5LPRA 2A2XH 1AVGH 1O3BA 4XRNA 2ANKH 1O3MA 1BT7A 1H8DH 1GG6B 1UHBA 2J98B 3O8BA 4A92A 1ZJKA 1E38B 2C8ZB 1K1NA 1WAYB 1S82A 2A7JA 2BTCE 3A7YA 4NIWA 4ZXYH 4RKOB 3W94A 1TNJA 2BY6X 1QQ4A 1Z1IA 1UMAH 5CE1A 1ZSJA 1O2VA 5FPSA 3LOXA 1E36B 1DWEH 2WINI 1AUJA 4WMFA 1HBTH 2FOCA 1XUIA 3S0NA 1GHWH 1Q3XA 1W8BH 2FTLE 2WV5A 4K5ZA 5KECA 2VH0A 1ZRBA 3S7HB 1H9IE 2ALVA 1ZJDA 2I6QA 1V2VT 1AN1E 2H9TH 5HGGA 3SQEE 3U8TH 3KL6A 4XBDA 4WH8A 2JETB 2ODYB 2J98A 4B6FA 4BOHA 2Y80A 1HCGA 1C5WB 1CT4E 1NFWA 2ZFPH 3QK1A 4K1EA 1S84A 1VR1H 4E7RG 1N8OC 2XTTB 4ZCNA 4OS1A 1LCYA 1ZSKA 3QX5H 3EE7A 4H4FA 1GGDC 1SGFG 1AHTH 1YPEH 3TVJB 5JBCS 1V2WT 4Y11E 1FAXA 1LHEH 2C90B 4I8HA 1VJ9U 2BY7X 3SU0A 1O2IA 1G2MA 1TB6H 3UUZA 3BTTE 2C3SA 3BG8A 1VZQH 8GCHF 3U8RH 1XUGA 1DVAH 2RDLA 1TPOA 4AORA 1BRBE 1D3QB 1EAUA 3QWCH 2ZCLP 1NRPH 4FUHA 1TGSZ 3NZIA 3OE7D 4FUCA 2O8LA 1HDTH 3A7WA 2ZHFH 4I8LA 3RXSA 3FAOA 5DG6A 1A0JA 1SL3A 4ZHLU 1G2LA 1GHBG 2V3MA 3P92A 1EP6A 2IN2A 2NU3E 4X1PU 4YO9A 5T6GA 1Z8GA 1UCYH 4AFSA 4FUFA 1SOTA 3GYMA 2HNTC 2FPZA 3SU6A 3SNCA 1GI0A 1QJ7B 2H6MA 4UFEH 1HRTH 1O0DH 4NIYA 2G51A 3F1SB 4B73A 1FY4A 3AAVA 1YPLH 5EXNA 1TGTA 1O5BB 3TGKE 3N7OA 3SW2B 1GHAG 5JBBS 5T6DA 4IC5A 1F92A 1PPZA 2NU0E 1VKYA 4INLA 5A2MH 5JDUB 4O3TA 1H8HD 2R2WU 1BMLA 1MCTA 1XKBC 4ABEA 1TNIA 3RU4E 4O3UA 1AU8A 3QLPH 5GNDA 3AASA 3UQVA 2V7QD 3HGNA 3ODFA 2PSXA 2Y5HA 1NY22 4X6OA 1B7XB 3M7UA 1NRQH 3A85A 4OGYA 1LQEA 3LGVA 3RXBA 1P09A 2QXGA 2PUQH 1KXAA 4AC9A 4AZ2B 5F8TA 1GI5A 1P01A 3M61U 2DUCA 2G52A 1YGCH 2BB4A 4RT1A 4R0IA 2VGCB 2XCFA 4THNH 1JXPA 3TK6A 2A4GA 1DICA 2Q6FA 5FHTA 2BHGA 1Z8JB 4UE7H 1EXFA 1H8ED 5JBAS 4K8YA 2AH4X 3RXKA 3RU4D 3K2UA 3GCTF 2WV4A 3F6UH 3FN8A 5ETXA 1ANDA 5J4SA 3UWJH 1C5MD 4NWKA 3ZZCA 2BM2A 2GVFA 1OYTH 2VIVA 1QL9A 1DM4B 1IQMA 2GCTB 2O8MA 1QY6A 2Z9IA 3N99A 6GCHF 4ZKSU 2EI6A 2QN5T 3VFEA 1MTVA 4U2WA 2ZP0H 1F0RA 2ZFRH 1D6RA 2ZFSA 1H9HE 2WUCA 1EZQA 1TBZH 1NU7B 2XWAA 4B76A 4X8SH 1A4WH 2AMPA 2K8IA 1DY9A 1C1VH 1HAIH 1N1LA 2C93B 1ZRKA 1ESBA 1FI8A 1P9UA 2F4LA 2WSSD 1DT2A 3ZV9A 4X8UH 2W3IA 1C1TA 4NIXA 1C2FA 4TWYA 4FXGH 1JBUH 3BEUA 3T27A 1O2RA 3TH3H 5AF9H 1KDQA 2BX4A 1CBWB 4PROA 4ISNA 3SGBE 1BTZA 1TMTH 3UR9A 1AFQB 1SLWB 3JZ1B 1ETTH 1DE7H 1SFQB 1HAPH 1O3KA 4D7FA 1PQAA 4IGDA 1GBJA 4K1TA 2XW9A 2A1DB 1J17T 1O3EA 1P2OA 6ESTA 2RCEA 4H6TA 1BBRK 5IK2D 1G37A 2ZCHP 4DGJA 1YC0A 1D9IA 2KX4A 2HPQH 1B0FA 1GBCA 5T1VA 4Y6DA 2PGQB 1JIMA 1MTNC 2BX3A 3U1IB 1UTKA 1MBQA 2ZFFH 3T62A 2JKHA 2FI3E 1OYQA 2XBWA 1SPJA 1HLTH 3LGYA 3WWBA 4K8BA 2OXSA 4OS7A 2J34A 1Q2WA 5A0CA 4U32A 4K1SA 4MPVA 2SGEE 1JWTA 2LPRA 2SGQE 5F6MA 2RA3A
chains in the Genus database with same CATH topology
4XE4A 1AZZA 2EC9H 3TK5A 4BTIB 3GISB 2ZA5A 4RSPA 5EXLA 5LH8A 3SJOA 3OU0A 1GBFA 3UQOA 3Q77A 2PFEA 1NZQH 2J9NA 3MOCA 2RG3A 1W0ZU 2OC1A 5DGJA 1OWDA 2CN0H 2FDAA 2FYQA 1WV7H 3BTQE 5EW1H 1GHZA 3RXLA 1EB1H 4IMQA 1QNJA 4A1XA 2BD3A 5CHAC 2GV6A 3ESTA 1L1NA 4GPGA 5GCHF 1ZHMA 3AAUA 1IQEA 3KQDA 1THPB 3KCGH 3PB1E 3TGIE 1EJMA 1GBMA 1UO6A 2XBVA 3HKIB 4AGJA 5GWZA 2A32A 1B0EA 1M9UA 4UONA 1XXDA 3L3TA 2QYIA 1NRSH 1OP2A 5L6NH 2AERH 5F8XA 3SI3H 1K9OE 1ZZZA 4WVPE 1NTPA 3E0PB 1O3OA 4AX9H 5EQRA 3SU2A 1HXEH 1GBEA 1K28D 4AB8A 1EUFA 1K1JA 1QL8A 3Q3XA 1EPTB 4KELA 1BJUA 1XVOA 2Y7XA 1QBOA 1O2ZA 1YPMH 3EGKH 1AE5A 2ZGXH 5E2PA 1D4PB 3GY5A 1TX6A 3SHAH 1VCWA 2F91A 1QJ1B 3RXDA 3UNSA 1HFDA 3CENA 3GCTG 2THFB 1AIXH 3SJIA 4GCHF 2QXHA 1RTKA 4E06H 4YZUA 4NFEA 3BN9A 2ULLA 3DA9B 1RD3B 1T8OA 1YPHC 2J94A 4FU9A 2ZGJA 4BAHB 3RXRA 3F68H 2WPJS 1ZPBA 3MTYA 5EPYA 1QRZA 3RXMA 1ELEE 4IC6A 5C1XA 1A0HB 2GV7A 1G9IE 1OXGA 1C4V2 2BD5A 1J9CH 3BG4B 5F8ZA 3VB4A 1IHTH 2F9BH 1P05A 2VVCA 3IWMA 3PMBB 2OC0A 3PYHA 1F0TA 2VIQA 4X6MA 1O3DA 1GWAA 4NA9H 4GUXA 1K2I1 1TLDA 1SB1H 1O3LA 2EA3A 1CA0B 3GCHC 3RXUA 1EB2A 5TCAA 1VGCB 2ZU1A 1GI4A 1JMOH 4MPWA 1BOQA 4WY3A 2VIPA 2WUBA 1O32A 3RXHA 1CHOF 1FXYA 4GHQA 3MO6A 1WTHD 4AYYB 3LDXH 2OQUA 2G00A 3ELAH 1PPEE 3F9HA 1WU1A 2GCHF 1O2TA 1BRUP 4X2WA 1TRMA 1ELCA 4FUIA 2KAIB 1C1UH 4X1RU 1TX8A 1BMAA 4YOGA 3T2NA 4ABFA 1GJCB 1AMHA 4ZH8A 1F2SE 1TA2A 3CS7A 3TITA 3KEEA 4ISLA 1B5GH 2VNTA 5H4IB 3SUGA 5L30H 2GGVB 1LPZB 3Q00A 1O35A 1SI5H 1C1SA 4D8NA 1GJAB 1TOMH 1W7XH 3A89A 2AYWA 2C8WB 4ZROA 1UTMA 4R8TB 3ZZ9A 3UNQA 1CT2E 1GBLA 1O2WA 3UWIA 4AFZA 3SJKA 3M3VA 4DURA 1JIRA 2GT7A 2OD3B 1PPFE 3M5OA 1AWHB 5ESTE 1ID5H 1RJXB 3QUMP 1BMNH 2BLVA 3MU5A 4KGAA 1T7CA 2OLGA 2EEKA 4D9QA 2CV3A 2HGTH 2VGCC 2H5DA 1DPOA 1V2QT 1O3GA 1O3NA 4YT7H 2H9HA 3UOPA 3ZYEA 3A8CA 2P8OC 1EX3A 4Q7XA 1GJDB 3MI4A 2ZGCA 2FX6A 4X1QU 1HAYB 5GDSH 4WF8A 4FUEA 4ZAEA 4F49A 2FLBH 3RMMH 3NCLA 3QO6A 3SO3A 3SOSA 1XUFA 3RU4T 4KTSA 1LVBA 1O5GH 5DKMA 1ESAA 1IQHA 1UJ1A 1O30A 2OC7A 1O2SA 2PKSC 4JZEH 1MQ5A 3VXFH 2Z94A 5FCRA 1W2KH 3I77A 2STAE 2NU1E 2AGGX 2C8YB 1YPJH 5IDKA 3SNAA 5C1UA 4E7NA 1D3PB 4GSOA 9LPRA 3M3TA 1C4U2 1KTTB 4UFDH 5FBEA 1BCUH 4NFFA 2TGAA 4DW2U 1GBDA 2ZPRA 2UUJB 4ISOA 2WPHS 3RXAA 1ZGIA 1L1GA 4FUBA 1GI8B 1ZMLA 1GDUA 1Y3YA 2GMTB 3P8FA 1FUJA 1HIAB 1RS0A 3A7ZA 1RIWB 1XM1A 3U69H 4ZHMU 1O31A 1C2DA 4ZXXH 3ZZ5A 2F9NA 1TNHA 3LGUA 1BBRE 4I7YH 1YCPH 2PTNA 3BIUH 2FP7B 3SZNA 3HK3B 2AEIH 3TU7H 2P3UB 4CRCA 2VJ1A 4LOYH 1BQYA 5JPMH 2FI5E 1O2JA 4AG2A 1FONA 1MH0A 1F7ZA 2W26A 1C5RA 2WPKS 4MPXA 4AGKA 8ESTE 5G4BA 1ELBA 3E6PH 1DOJA 1SSXA 4HI3A 1MAYA 1BTPA 3RMNH 1IQIA 1TOCB 3D65E 1IQFA 4INHA 4CHAB 2D26C 1BA8B 1E34B 3ZVDA 8KME2 1BTHH 4JYVH 1P0SH 3KQBA 3S9CA 1VJAU 1DWDH 4ZKNU 3LT3A 4YM9A 4DIHH 4KKDA 1IQJA 2VWMA 2F9UA 1P12E 1GVZA 4UEHH 2BLWA 2ASUB 1MAXA 1NU9A 1Z6EA 4WXIA 2G5VA 1GVLA 1SQOA 3UY9A 4AN7A 4ZKOU 1O33A 3RXPA 1O39A 3M37A 1HAZB 3GDSA 4OS6A 3BF6H 3NK8A 3BTFE 4B2CA 3KNXA 4DY7B 5K0HA 1HJ8A 2PV9B 3RXOA 1FY5A 4ISIH 1ZPZA 1O5EH 1GHYH 2ZPSA 1HJAC 3A7VA 1OKXA 2D2DA 2G5NA 5C5NA 3EA8A 1SGIB 4WJG2 1KYNA 2SNVA 3GY4A 4X2VA 3A7XA 1PFXC 3GICB 1C5OH 1P11E 2ANMH 2TGTA 4Q7ZA 1C2EA 2ZU3A 1SLXB 1ANCA 1C1NA 1ZTKA 3KHVA 1GMCF 1QRWA 1OSSA 1BB0B 2AFQB 2ZWLH 2OCVB 2OBOA 5AHGH 3GCNA 3HPTB 4ABAA 1KY9A 4MDSA 3SGAE 1SG8B 1PQ7A 2ZIQH 2Z3CA 2ZKSA 3VB5A 1ZGVA 2P59A 2PHBA 2OUAA 1EKBB 2Z3EA 4H42U 4K3JA 1CGJE 2BDAA 1MTSA 1FIZA 1ELVA 1XUJA 2BOHB 1RGQA 1BTXA 4I8KA 1C2JA 2SGFE 2VB0A 2PGBB 1GI2A 4WXVA 2BD7A 2ZO3H 1C2MA 5JYIA 1D3DB 3EDXB 2FEQH 1O36A 3S7KB 2Z9KA 4LXBH 2BY5X 1A5IA 1L4ZA 3L33A 4Q7YA 1D6WA 2TBSA 3T28A 3LH3A 3SHCH 1C5TA 5GPIB 2PKAB 2B9LA 1W12U 2AIQA 4JCNA 1K1MA 1GMDF 1W10U 1C5ZB 1O3PB 5A8YA 4DT7B 2R0LA 2QAAA 4JMYA 2ZU2A 3OSYA 2OTVA 3ODDA 2FIRH 3M5NA 1LMWB 1AZ8A 3FP6E 2XNIA 2XYAA 1F5LA 4GHTA 5AVDA 3GOVB 2P16A 3V12A 3G01A 3DD2H 3D23A 1BTWA 3RC5A 3LKWA 3DFJA 4HTCH 2Z9JA 2PKAA 4YOJA 1IQLA 2FOEA 1P04A 4CRFA 5DP9A 3SU5A 3K65B 1TGCA 1G30B 3P8NA 1H9LB 1GCTB 1TFXA 2XBYA 1QA7A 1NN6A 4AFQA 4I8GA 4JK6A 4Y0YE 1TYNA 5T3HA 2VIOA 1MCVA 5K7RA 2NU4E 2BDYA 1OP8A 3A88A 4D7GA 3FVFB 1JRTA 2BQWB 2BDCA 1OWIA 3BTHE 1W0YH 1C1RA 1IAUA 3UNRA 1FY1A 1FMGA 1GJ4H 1T8NA 3PLKA 1S83A 2GT8A 1YF4A 1QBVH 3C27B 2C8XB 1C5LH 4XSKU 1DFPA 2ILNA 4TWWA 4NWLA 2FOAA 2D1JA 4CBNA 1QCPA 7LPRA 1TGBA 4HZHA 1VCPA 3MO9A 4A7IB 1AB9B 1O3HA 3SBKA 3TK9A 1S85A 2P3FH 2VWLA 3OYPA 2XC0A 4YOIA 1TQ7B 1NS3A 3M7QA 1VITF 5DP4A 1HYLA 2PLXA 3BEFB 3RC4A 1ELTA 1C9PA 1F0SA 2GDDA 5FPTA 1GI6A 1DUEA 1GJ8B 1T4VH 3ENSB 4U30A 1FPCH 3CS0A 6CHAC 1PJPA 3DT0H 3BSQA 4LZ1H 2Y6TA 2OINA 1KXFA 4I33A 4MNYA 1KXEA 2FX4A 2RA0A 4FU7A 1SGTA 1DY8A 8LPRA 2A31A 1V2JT 2YNAA 3SV7A 4CH8B 1C1WH 4Z0KA 3IITA 3SU1A 2FWWA 3RXCA 3ZZDA 1DANH 1XMNB 3ZV8A 4FUGA 1GMHF 1SGQE 2BXTH 4CR5A 3ZVBA 1W7GH 1MKXH 4XOJA 3LGWA 5BPEA 3VXEH 4BTTB 4ASHA 1W14U 1UK3A 3VEQB 1TONA 3O8DA 4CREA 1RRKA 3GY8A 4UDWH 1GMCG 1HPGA 2R9PA 2ZI2H 1ZOMA 2BQ6B 2AGIX 1K21H 3T5FH 3TJOA 2ZDAH 5T6FA 3BTEE 1S81A 1LHGH 3S69A 3PO1B 1GHXH 5DP7A 1CO7E 1GI1A 1MQ6A 5E0GA 8GCHG 3K6YA 3SNBA 2HWLB 1TA6A 3GDVA 5C2ZA 2BLOA 3LC5A 1DXWA 4BAMB 3EE0B 4JZDH 1ZHRA 4A1VA 3MH4A 1P2NA 2HRVA 2O9QA 4TPYA 2TRMA 4VGCC 1KTSB 1GBIA 1WQVH 3MU1A 1GJ9B 3OTJE 3E0NB 2P94A 2ANYA 1O5AB 1YLDA 1AUTC 1CHGA 1TMUH 1ELAA 1C2KA 1E35B 3H7OA 5DPAA 5JBTA 2FS9A 4LZ4B 4DIIH 1RIWC 2C4FH 1MKWH 2FO9A 3M5LA 1BDAA 4TPIZ 2G81E 1YCPK 3B9FH 1GJ6A 4Y79A 2HVXA 2ODQA 3A87A 4NZLA 4B75A 5A0BA 3KQEA 1TABE 5CMXH 1CU1A 4H6SB 2TGDA 2V3OH 2FESH 1O3FA 4K2YA 3ZVFA 1C5SA 5DP3A 2XWBI 3LONA 2FM2A 1SC8U 3EA7A 4B2BA 1TX7A 1GI7B 1V2PT 2BZAA 4NG9H 4Y71A 1LQDB 1DWBH 1Z71A 1CSOE 1LVOA 2ZDKA 1FNIA 4JZFH 1SGDE 4B74A 1SGEE 1GG6C 3GY7A 3S9BA 5DP5A 1C2HA 1A0LA 3DHKH 3FP7E 1TNLA 2O8UA 4E05H 1KLJH 1ZLRA 2VIWA 3MFJA 2UUYA 1QURH 3SU4A 3SJ8A 1N8OB 3F9GA 5EOKA 3MNSA 2ZDVH 3MU0A 3ZZAA 1TMBH 3Q76A 1GGDB 4F4OC 3FP8E 1O2GH 1BZXE 1Y59T 2W5EA 1TBQH 3UREA 2A4RA 2JETC 4MTBA 4FU8A 3RXQA 1P06A 1MMJN 1G3BA 1G3EA 2Z9LA 3JZ2B 4MNVA 3ATKA 3FANA 3K6ZA 2ODPA 2ZTYA 1V2RT 1VITG 2A5AA 4MNXA 1EQ9A 1C5YB 6GCHG 4MQAA 2FZZA 5EG4A 1O5CB 3SV2H 3SNDA 1F0UA 1EPTA 1ZMJA 3MNCA 1YBWA 2UWOA 2NWNA 5FX6A 2J38A 1WSSH 1DSTA 4MG3A 1TRNA 2ZPQA 1NESE 3PWCA 1EZXC 5DP6A 2OQ5A 1SMFE 2BYAX 1ESTA 3LC3A 1DITH 4Y8ZA 3E8LA 3GCOA 3PMHB 4ZKRU 5LPEA 1V6DA 1UTPA 2EI8A 4MLFB 3SUFA 1IQNA 3A86A 3RC6A 5LPFA 5HM2A 2G8TA 3I78A 3GY2A 1UCYK 1BRCE 3EA9A 5EXMA 3ZVGA 1SLUB 4JYUH 4ABBA 3EAJA 2HLCA 1UTNA 2ZFQH 3UIRA 3QTVH 1XUKA 3QDZB 3E90B 4KTCA 1LKBA 4NA7A 2BXUH 2ZEBA 2YNBA 1P57B 2ZDLA 2BD2A 5TJXA 1LTOA 1C1OA 5A8XA 1GPZA 4IW4E 1QBNA 1SGYE 1PPGE 1FAKH 2FOBA 1GBAA 1ZSLA 2QXIA 1ABIH 3E91A 2W7UA 1Z8RA 2VWOA 2K1QA 2QF3A 1HAGE 2A4OA 3RDZA 4ABJA 2ZQ2A 2FI4E 1T32A 2UUKB 4RKJB 3M7TA 5C20A 3BV9B 2W7SA 3MU4A 4SGBE 3ATMA 2SGAA 4AFUA 1UTJA 5SGAE 2FOHA 4OS4A 2KAIA 4ZMAH 1G3DA 1ETRH 2V0BA 1Y5AT 3SQHE 4Y8XA 2CGAA 2WPLS 3M35A 1EOJA 2QGRA 1IQGA 1UK2A 2TIOA 1MBMA 2ZU5A 2XC5A 3SV8A 1O2UA 1AKSB 1A61H 1WOFA 4ZHAA 3GY6A 1NFXA 2FLRH 3F9EA 3GDUA 5EQQA 1V2UT 2JH0D 1Y3UA 1FLEE 1T8MA 2SFAA 1KXCA 1O2HA 1XUHA 1FIWA 1TWXB 1SQAA 5GCHG 1S5SA 3A82A 2Q6DA 4CRGA 2GCTC 4WMEA 2Y5GA 1CGIE 2A7CA 2QA9E 2JH6D 3NKKA 1PPCE 4K69A 1O3CA 2PW8H 1SGFA 2TGPZ 3TNTA 2ZTXA 1TE0A 3A8BA 3L6PA 1N6YA 1XKAC 3URDA 1GHBF 1NRNH 3Q3YA 3PTNA 3QGNB 3V3MA 3MO3A 1ARBA 1L1JA 2ZHEH 4BAOB 3ZYDA 4FVDA 2OP9A 7GCHF 1WQSA 1HAVB 2F9VA 1FPHH 1MKXK 4GCHG 3PMJA 3RUOA 1MZAA 1L2EA 3D62A 1CBWC 1AO5A 1EAIA 3ZZBA 1A1RA 1AFQC 1LVYA 1GHAF 4A1TA 1DWCH 1TNKA 3U1JB 1ACBE 1P10A 1ZYOA 1SHYA 3P70B 1C1PA 2UUFB 2VVVA 3PWBA 5EW2H 3ZZ3A 2A7HA 3ATIA 1TIOA 4CBOA 4LK4A 1Z8IB 3PM3A 1LKAA 1AVWA 4JK5A 2BLQA 5DO4H 1O38A 2IPHA 1ZTLA 1O3IA 2AS9A 1SFIA 1YCPM 1XXFA 3RXEA 4JZ1A 3VB6A 1FZZA 3M3SA 3VB3A 3VPKA 1WTGH 2A2QH 4D76A 1YPKH 2ZCKP 4ABIA 1QB6A 1Z7KA 1UHBB 2BD4A 2G55A 2BDBA 1LDTT 2VU8E 1UTQA 5C67A 4M7GA 1HIAA 3GY3A 2ESTE 2JH5D 1HAOH 1HJ9A 1EATA 4A6LA 3O8CA 1CHOG 4FUJA 3R3GB 1MKWK