2ZGHA

Crystal structure of active granzyme m bound to its product
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
231
structure length
231
Chain Sequence
b'IIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme M
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
pubmed doi rcsb
total genus 49
structure length 231
sequence length 231
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zghA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zghA02
4NIWA 1H8DH 1SGNE 2ZWLH 2BZ6H 2H5DA 5A0AE 3U1JB 7GCHG 2G00A 1Q3XA 1S6FA 2ZPRA 4I32A 5CHAB 3URCA 1FPHH 2CF8H 2YNBA 1ELDE 3RXUA 2PTCE 3RU4E 3BTWE 1K1PA 3BIVH 1O5BB 3KQCA 2SGPE 2J92A 4O3UA 1C1PA 3UREA 3RXCA 3LGWA 5GDSH 1Z6EA 3KCGH 5GCHF 1S82A 3MH5A 2QA9E 4BAQB 3Q3KA 5HM9A 2ZDVH 2ZFTA 4B74A 4Y0ZE 2PSYA 2P8OB 1ZGIA 2BQWB 2AMDA 2GV6A 1ARBA 5AHGH 1AUTC 1Z1JA 2BD8A 1GBJA 2QN5T 3U9AH 1ZTKA 4BAKB 2A7JA 3PLKA 1O3NA 4X1QU 3URDA 1YYY1 1OKXA 1NU9A 1VITF 2J94A 3FP6E 1G36A 3ZZ7A 1TNHA 3E90B 1PYTC 4NFFA 1W7XH 3M5MA 3TGIE 1GL1A 3PM3A 3U8RH 3GCNA 2J38A 1MH0A 3BG4C 4TPIZ 1O3KA 1S0RA 1D3PB 3T62A 1TIOA 1V2WT 1LVOA 2FOEA 2ZI2H 2XWBI 5TCCA 4CBOA 1HJAC 3QGJA 4WH8A 1J17T 1C1RA 1T8NA 1TRNA 4DVAU 4MPWA 2BD9A 1DWBH 5JB8S 1FN6A 2NU0E 2HALA 5DO4H 1KXDA 5ESBA 3RXJA 2WV5A 1O2PA 4X1SU 1ZMJA 2OBOA 1HAYB 2HPPH 1RTKA 1LPZB 1FJSA 1A5HA 1VJ9U 3UNSA 3ZZDA 2UWPA 2QF0A 3RDZA 1O33A 3QX5H 1HJ9A 1YKTA 1NRSH 3A8DA 3QUMP 1ZTLA 1BTUA 1O5AB 2BDCA 2FLRH 2PR3A 4GAWA 1QJ6B 2XRCA 5BRRE 3MOCA 4IBLH 3EA7A 4X1RU 2BDIA 2BD3A 1IQNA 2FWWA 1J16A 1PFXC 1BOQA 1O2JA 2FX6A 3GDVA 3D62A 1A5IA 3UQOA 3PWCA 1EAWA 2SGFE 4A1TA 1WU1A 2VIOA 7LPRA 4TYDA 4AX9H 1E37B 5AF9H 3TJOA 4ISHH 3TPIZ 2C8YB 1UVSH 1SGTA 4B2AA 4X6MA 5K0HA 4TWWA 4CRDA 1J15A 1C2DA 2R3YA 1L2EA 1V2NT 1XXDA 3NUMA 1OYTH 1P8VC 1W2KH 1PPEE 2BOHB 2QAAA 4JYTA 4K1EA 2GMTC 2ZO3H 1GJ6A 2Z3CA 1KDQB 2CMYA 2VVVA 1F7ZA 1CHOG 3GY8A 4NSYA 1P2QA 1AI8H 1YLCA 1KLTA 1XUHA 1HLTH 2ASUB 3AVZA 3P8NA 3RP2A 1GJCB 2HWLB 3L3TA 2GDDA 1P0SH 1W13U 5A2MH 4SGAE 2XCNA 4YO9A 5L2ZH 1GBHA 3L33A 1K1LA 2BY9X 1N8OB 2BDHA 1YCPM 1DM4B 3PLPA 1DWCH 1O2UA 2BY8X 3IG6B 3SJ9A 3K9XB 1QB9A 1GG6C 1OWHA 2OCVB 3NKKA 3S69A 1SL3A 1QL9A 3BTFE 3BG8A 4FUIA 4VGCB 1ETSH 2FXRA 1C5ZB 1DX5M 1EB1H 1FLEE 1ESTA 2C8WB 1SSXA 5LGOA 3ZV9A 4OS7A 2O8LA 2ZCKP 3UOPA 2XTTB 3KF2A 4UFFH 4HTCH 3PWBA 5DP3A 2Y5GA 1C5UA 5CE1A 4INHA 1CGIE 1HAVA 3W95A 1YPKH 4JK6A 2B0FA 1UCYE 2GCHG 2OTVA 4GSOA 1BMLA 3PMAB 1MKWK 5DP4A 1MCTA 4NFEA 7ESTE 1HAXB 1SQOA 3V3MA 4OS6A 4K1TA 2V3OH 3Q77A 4H6TA 4R8TB 5EQQA 1EPTA 1XMNB 1YCPH 3LC3A 1GVKB 2VJ1A 3OU0A 1DXWA 1RRKA 1QIXB 1J9CH 3RM2H 2P93A 1V2MT 1A0LA 2GT8A 1Z8RA 4NA9H 1MKXK 3RXGA 4NZQA 1P01A 1C9TA 1C5PA 3S9AA 3NWUA 2BLQA 3MU1A 3S7KB 3JZ2B 1Y5UT 4X8VH 2RDLA 2P3FH 5JDUB 1QRWA 3P70B 1WQVH 3M5LA 3A86A 3LDXH 3ATLA 4X1NU 4K69A 3T26A 2Y80A 1NU7B 2FI3E 6ESTA 1Y59T 2PUXB 3BEUA 4CHAB 3OTJE 2FLBH 5BPEA 3LGIA 1DS2E 2BLWA 4AGKA 2FS8A 1W8BH 1BTWA 1AVGH 1CBWB 2R0LA 1AB9C 2R0KA 3RXLA 1CA0C 1NFWA 2ZP0H 2BYAX 2ESTE 2AIQA 2TIOA 2SNWA 1ZJKA 2B7DH 4X0WU 5HYOA 4ISIH 1O2XA 1W0ZU 1RD3B 1WSSH 1DT2A 2FTMA 4Y71A 1PPHE 5AVDA 1RJXB 3ZYDA 4XDEA 1ELFA 3D49H 1BRBE 1G2LA 2P94A 2Q1JA 1O3LA 1UTLM 1FQ3A 2QGRA 1L4ZA 5JB9S 4MNVA 5F8ZA 3RXIA 3ELAH 4Y76A 4KELA 2ZHFH 1BHXF 1DXPA 1GDUA 2PTNA 2ZEBA 2AH4X 1YPEH 1V3XA 3GOVB 3OX7U 4MNYA 2FI4E 3MTYA 4D8NA 1BTYA 2BX3A 3SNCA 3GCOA 1EP6A 2RCEA 4QT8C 2QCYA 2FMJA 2TPIZ 1WQSA 3MH6A 3O8CA 1MTUA 1TBZH 1VJAU 2ZQ1A 4XFQA 2WPJS 1EJAA 4B2BA 1H4WA 1T4UH 4M7GA 3UQVA 4DJZB 1OP2A 3NXPA 4BOHA 3M5OA 2TBSA 3KHVA 4CRGA 4ZXYH 1UVTH 5GWZA 4X2VA 1O5GH 2TRMA 8GCHF 1SBWA 3SU6A 3KQEA 3C1KA 4JK5A 1SVPA 4WMDA 2FOFA 1YPGH 5EW2H 1T8MA 3WY8A 1LKBA 4TY6A 1GI2A 1Z7KA 2Q6FA 2QY0B 2HVXA 3LH3A 1KLJH 4FUCA 1GGDB 2BMGB 5EG4A 2A5AA 4OGYA 2VU8E 1DWDH 3ZVGA 2FOAA 2FIRH 2HRVA 2VNTA 3M36A 3MFJA 4TPYA 2YOLA 1BMNH 2OINA 1IQFA 2ANYA 3GCHB 3JZ1B 3UY9A 3GYLB 1OWDA 1HRTH 2ULLA 1MU6B 1VGCC 2ZGJA 1TNLA 1H8IH 1V2VT 3BTTE 4ABGA 2RA3A 4SGBE 1DUAA 1GHYH 4IN2A 3V12A 1BT7A 4ZXXH 4DW2U 1B7XB 2W7SA 3F68H 2O9QA 1MTSA 1VCPA 3F9FA 1XUIA 4UONA 3TIUA 4Y8YA 2VVUA 3GCTG 3ZV8A 4XE4A 3T25A 3OSYA 2PGQB 3SJKA 1AZ8A 4U2WA 1K1NA 2RG3A 1NRRH 4UFGH 3ZVEA 3RMLH 1V2LT 4CREA 1CGJE 1DPOA 2FOCA 3PO1C 4Q7YA 1WUNH 1WTGH 1VR1H 1C1VH 1J8AA 2A45B 5T6FA 5EQRA 1DLKB 3ZZAA 1DDJA 4FUHA 1C1TA 4NIYA 1IHSH 1MZDA 2PKSB 1HCGA 1A1RA 3A7ZA 2ZF0H 5LPRA 4THNH 2VH0A 4O97A 1O2YA 3ZZBA 1CHOF 1GJAB 1EOLA 1IQIA 2F9BH 1UHBB 3BTEE 2ZU1A 4FU7A 1OSSA 4GVUA 4BTIB 1FY5A 1RTFB 1TMUH 3RC5A 4CRCA 2D8WA 2H1UA 1XUKA 1EXFA 1MTWA 1GBKA 4BAMB 2LNCA 1ZMNA 2BXTH 1ZRKA 1OWKA 1Y3VA 3PMBB 3ZZ6A 1FY4A 3SQHE 2GVFA 3C27B 1GBCA 1A46H 1HIAB 3FZZA 4XOJA 3FAOA 3K6YA 1GMDG 3FZDA 1ETRH 4JZFH 1HYLA 1P2IA 1HUTH 2GP9B 4X6PA 1A2CH 2UWOA 1TA2A 1GJBB 4DG4A 1AFEH 2SGDE 4I8LA 5E2OA 1ZYOA 5DK1A 1O2MA 2HOBA 2JETB 4ISNA 3ODDA 4NIVA 2B5TB 2ZC9H 1GCTC 3SV2H 2XW9A 3MNBA 3LGVA 1MU8B 5EPNA 3SUEA 4AOQA 2BQ6B 1AWFH 4KKDA 3VPKA 3BEFB 3BTKE 1A0JA 1ELAA 1PPCE 1TA6A 1ZTJA 1SLXB 4ZMAH 1L1JA 2QXGA 3TJUA 1AKSA 2ZIQH 3K2UA 2PWXA 3MH7A 3BV9B 1GJ5H 1SHHB 3I78A 5FX6A 2FI5E 1KSNA 1QRZA 1SGRE 4Q80A 1C5XB 1GMCG 2PGBB 1ABJH 3BSQA 5LPFA 1GBTA 1PYTD 3PB1E 2ZCLP 1IQGA 2ODYB 4B75A 1C5RA 1SOTA 2G52A 1OPHB 4RSPA 2D2DA 4MQAA 5EODA 3VB6A 5C1XA 1KYNA 4UFEH 1EKBB 4DT7B 5I46H 1C5LH 2XBXA 1P02A 2IN2A 3KL6A 4YT7H 2BDAA 3NZIA 2G55A 1GGDC 1UTQA 3GYMA 2GX4A 4X2XA 2BOKA 3KN2A 1GMCF 2ZKSA 1ETTH 6LPRA 1GBFA 5HM2A 2WYJA 2G51A 1UTNA 1ZR0A 4ZROA 1IQHA 1H9LB 3A8CA 3NK8A 1YP9A 3QK1A 3H7TA 4ISOA 1QA0A 3A82A 3Q3YA 5F03A 1W12U 3M3VA 1O2OA 3O8BA 1YPHC 1TOMH 1C1MA 1ZZZA 1ANCA 4ESTE 1EASA 4LOYH 3VXFH 3S0NA 5C3NA 1YPHE 4K60A 3DT0H 2A0QB 2IOTA 5T6GA 1W14U 3IITA 1BZXE 2OQUA 2VIQA 3SV7A 1CGHA 1AQ7A 1VZQH 2ALVA 3SW2B 1HAGE 1GI5A 1PPZA 2QF3A 3ITIA 3LGTA 1QJ1B 3MO3A 4ABJA 1G32B 3EDXB 1GHBF 3QDZB 5DP8A 1GMDF 3HPTB 3O8RA 1GJ7B 1ZLRA 1Z71A 3TJVA 1AHTH 1V2UT 2AMPA 1C2IA 1PJPA 4YM9A 1O35A 4UD9H 1SGDE 3GISB 3P8OA 1CO7E 3QO6A 1AVXA 2ZA5A 3AAUA 3UPEA 3VFEA 2FM2A 3UNRA 1TNJA 1XKBC 4J2YB 1O32A 1IAUA 3A7WA 1S6HA 1YC0A 1LMWB 1THPB 4I8GA 1G3BA 1MTVA 1FV9A 1ESAA 4OS5A 3BTGE 2J34A 1BITA 4R0IA 2ZHWH 4X8SH 1GI6A 4X2YA 5ETXA 1QURH 5FX5A 2P59A 1SG8B 1OWJA 1XVMA 3RXRA 1A3EH 4XBBA 1FAXA 1L1GA 2EI6A 1O2HA 4BXSA 1IQEA 2CV3A 3SGQE 1CQQA 4JYVH 4ZH8A 1LKAA 1CA8B 3ATWA 4NA7A 4YOGA 5EXMA 1ANDA 4MPUA 4D76A 1PQ7A 3HGNA 1YF4A 1O5EH 1BCUH 1UTJA 2AFQB 4NA8A 4WMFA 1BMAA 1B5GH 2FOBA 3ATIA 5L30H 2EI8A 3RXFA 1C2FA 2ZG0H 3RC6A 1Y3YA 1Z1IA 1MCVA 5FCRA 3RLYH 1BJUA 1O3CA 1GJ8B 2G81E 2P3TB 5DG6A 2BLOA 3FP8E 3VB5A 5FCKA 1RXPA 4OS2A 5JYIA 5IYTA 1YCPK 3EQ0H 3GY3A 2ZGCA 5L2YH 1O3PB 4ABBA 1O3EA 1Z8JB 2SGQE 4XBDA 1TRYA 3MI4A 3R0FA 3ZZ8A 1TONA 4IC6A 4AYYB 3E1XB 1C5WB 1TGTA 1ZSKA 2CXVA 3CENA 1P3CA 1NPMA 1FIWA 3OY5U 2ZGXH 2OUAA 3V7TA 1GI1A 1JOUB 1QGFA 1O3FA 3U8OH 4CH8B 1GHAG 2ZDKA 1AU8A 1P04A 1SQAA 3E0NB 5JPMH 1P2MA 5T3HA 1C2KA 3TH3H 1ELCA 1GHXH 1YPLH 2XYAA 4U32A 1DY8A 4AN7A 3SQEE 4ZKNU 4Q7ZA 2NU3E 3LONA 2ZU4A 2VIWA 1DLEA 2H9EH 1BTZA 2W7UA 4B1TA 4CR5A 2QXIA 4Y6DA 3I77A 2VIPA 4WXVA 2O8TA 1S83A 3SU2A 2Z9JA 1CT0E 3VB7A 2FOMB 3MO9A 1P05A 5TCAA 2ZNKH 1AIXH 3T27A 1C5NH 2A2QH 1G2MA 4Z6AH 2VGCB 4IN1A 1TRMA 1LHCH 1QBVH 2R3UA 3TGKE 1PQ5A 1K21H 1BBRK 3RXMA 2FODA 1TAWA 1TGCA 4OGXA 1A0HB 3HK3B 1DFPA 1UK4A 3BF6H 3LH1A 2ZFFH 1F5KU 3M5NA 1D6WA 2C4FH 4HGCA 1G37A 4CHAC 2PHBA 2UUJB 1T8OA 1YGCH 1KXAA 1GJDB 3PV4A 3HKIB 2BY6X 1ZHMA 2A31A 1CU1A 3DUXH 1H9IE 1GWAA 5AFYH 3RXQA 1TYNA 2W3KA 1EZUC 5FPSA 1A61H 1GDNA 1ELEE 1UHBA 1AFQB 1GBBA 1MAXA 1SMFE 3KGPA 1NTPA 3RXVA 4FVDA 1O2WA 2M5TA 1C5TA 2A4RA 1HB0B 2WYGA 3A83A 2ZDAH 2GZ8A 1GBDA 1EPTC 1N6XA 2ZGHA 3S7HB 1Y5AT 2R2MB 1PPBH 1LCYA 5EPYA 3TGJE 1THSH 3VGCB 2W5EA 4IMQA 2A4GA 5FBIA 1VCWA 3EA8A 5K7RA 1TPOA 2ZU5A 1HIAA 1EUFA 4Y79A 1NFYA 4AFQA 1JMOH 1OYQA 3ATKA 4Y10E 3RC4A 1QCPA 3P95A 1NFUA 3RXOA 4E7NA 1NN6A 5IDKA 2BD7A 5ESTE 3T29A 1C5VA 1GI9B 1AD8H 4NIXA 1QR3E 1TPAE 3M37A 4IGDA 8KME2 1QBNA 3LJJA 2VINA 2V6NA 4RKOB 2G8TA 1SGFG 4KTUA 4BTUB 4ZKSU 3SU1A 3QTVH 1S84A 2Z3EA 3MNCA 2PKAA 1KDQA 1S85A 1UVOA 3R3GB 5FHTA 1O3GA 2GMTB 3P17H 5C1YA 3SNEA 2ALPA 2FOGA 1O3OA 1C5YB 1AZZA 5HGGA 1GI7B 1F5RA 2FYQA 1KXCA 1ID5H 1TWXB 5F6MA 9LPRA 1YPJH 1WTHD 1TGNA 5DP6A 1BJVA 1GHZA 1VCQA 1EAXA 2GZ9A 3B9FH 1GI3A 3STJA 4JMYA 3L6PA 1FN8A 3ZZ9A 5DJ7A 4YT6H 3B8JA 1UJ1A 4FU9A 1BIOA 3LPRA 1IOEA 1RIWB 1KY9A 2OC8A 5DPAA 4Y8ZA 3RU4D 3BTME 4E06H 1G30B 2H9HA 2ILNA 3SNBA 2FS9A 5A8XA 2FDAA 4Y7AA 3VB4A 2RA0A 2O8WA 1HAIH 3MHWU 1SGEE 3SV9A 2UUKB 5B6OA 4H42U 4HI3A 3S9BA 1NC6A 2HNTF 3AAVA 2G5NA 2EEKA 3QTOH 1YBWA 3CS7A 3U8TH 1L0ZA 1O34A 3DFJA 3H5CB 1NM6A 5ABWA 4IW4E 1C1WH 1QTFA 2ZDLA 2GCTB 2PSXA 2DE9A 1JIMA 1JRSA 5A0BA 1EJMA 4OS1A 1ANEA 4AFUA 5J4QA 3UOUA 1S81A 2UWLA 1GBEA 1B0EA 1FY1A 1DANH 1RS0A 1SC8U 2ZZUH 1P2NA 1XX9A 5GIBA 2ODQA 2KAIA 3NPSA 1SLVB 4JZDH 1HAHH 1QRXA 4Y7BA 1LHEH 5L6NH 4RKJB 2WUCA 2G5VA 1MD7A 4I33A 3MU0A 1PQAA 4D7GA 2CGAA 1BDAA 1FXYA 2ANMH 2NU2E 4UEHH 1DVAH 1LQEA 3MU5A 4F49A 4FUEA 1DICA 1ZMLA 1ZSJA 3ZZ3A 1N6YA 3P8GA 5E2PA 1JRTA 1IHTH 3ZYEA 1INCA 2Y5HA 4NWLA 1GHVH 1AFQC 2BVSH 3BTDE 4ZAEA 2BD5A 1C2MA 3TNTA 1G3EA 2P95A 1GI4A 1AO5A 1IQMA 2Y7ZA 4I8KA 1SLWB 4F4OC 2R9PA 3F9EA 1LVBA 2ZCHP 2ZU3A 1UTOA 4UFDH 2J2UA 1TNKA 3RXPA 1OOKB 1NS3A 4CH2B 3A85A 3M7UA 3EA9A 5C5OA 1D9IA 4J1YA 3CP7A 2A2XH 3I29A 3TK6A 3Q00A 1AGJA 2AIPA 1Z6JH 3RM0H 1P09A 2GDEH 3ZVCA 4PROA 2ZPSA 4YLQH 3LGUA 4AYVB 1EAUA 3FFGA 3MU4A 3TK5A 3ATMA 2ZFQH 1T8LA 4DIIH 2A7HA 1O3BA 2JH6D 1GHWH 1P9SA 2BM2A 5T6DA 4YZUA 7KMEH 4INLA 3GDUA 1HGTH 4U30A 1WV7H 4Y0YE 1CT2E 1AMHA 5E8EH 2QXJA 3T5FH 1TE0A 2VGCC 2PKSC 1GDQA 5DP9A 4AFZA 2ZFSA 5TJXA 1MMJN 2ZHDA 1QQUA 1ELVA 1HXEH 2F9PA 1UVPA 1C1NA 3GY2A 2H6MA 4WY3A 2BTCE 4K5ZA 1XVOA 1ACBE 2PKAB 1CE5A 4YTAA 1OP0A 3TNSA 4AZ2B 1AB9B 2VIVA 1A3BH 1EZQA 3FVFB 3RXDA 1HJAB 5C20A 2OC1A 3QZRA 1DOJA 1V2JT 2TGPZ 3EE0B 2J95A 2XC0A 4GCHG 2FO9A 2OD3B 1HAOH 1BTPA 2CHAC 3HATH 3A87A 1FAKH 2WINI 1FY8E 3TH4H 1DY9A 1GJ4H 3HGPA 4YESB 1GCDA 4D9RA 3SNAA 2GKVE 1F0SA 3H7OA 1LVMA 3HK6B 2Z6BD 1O2GH 3BIUH 3AASA 1DITH 3GCHC 3LU9B 3GY4A 1S5SA 2WPLS 3A80A 3SBKA 4ZKOU 1SFQB 1X7AC 4GUXA 2G4UA 2BX4A 4DIHH 4FUBA 1FMGA 1HXFH 3E8LA 3FP7E 4I31A 5EW1H 4I7YH 3RMOH 1O2TA 2GV7A 3BTQE 1BHXB 2K1QA 4B73A 1GMHG 4D9QA 3T2NA 3MNXA 1Y3WA 4ZKRU 1YLDA 1SOZA 3RXEA 2ANWA 1OP8A 5I25A 1K22H 1K1OA 2WUBA 2HGTH 3SNDA 5EXLA 3RXTA 2J9NA 4ZHMU 1V2RT 2Z9LA 1UVUH 2A4OA 1EP5A 3RUOA 1FIZA 1ELBA 1GBMA 1TMBH 4A1XA 3M35A 3SUDA 1FI8A 1EOJA 1EZSC 1O0DH 1SB1H 2ZU2A 1NO9H 2H9TH 1L4DA 3RXBA 5JBCS 3PLBA 3TITA 1DSUA 1QB1A 1P11E 1EZXC 2Z9IA 3RMMH 4RN6A 3M3TA 1JWTA 1TABE 2ZQ2A 1KIGH 3VB3A 3ZVDA 1NT1A 4WJG2 2VWOA 2Z9GA 1AKSB 4YOIA 3SN8A 1QL7A 1ZGVA 2DUCA 3PYHA 5LPEA 2ZFPH 2ZHQH 4GHTA 2EI7A 1CT4E 3QWCH 1LQDB 1PPGE 1C2HA 2V3HH 3M61U 1TPSA 3DD2H 3A7VA 1GMHF 8ESTE 2FOHA 3TU7H 3Q76A 1C1SA 2D1JA 3DFLA 3ZZ5A 4O03A 1Z8IB 1N1LA 2W3IA 2F9NA 2GZ7A 2Q6GA 4E05H 1K1JA 1TX8A 2HNTC 2OP9A 1O3JA 2P8OC 5GJ4B 1Z8GA 4CBNA 1TNGA 1W11U 1Q31A 1TBRH 5H4IB 4NGAH 3K65B 2HLCA 3KQDA 5E0HA 1SGCA 4LK4A 1JXPA 3ZVBA 3U69H 1GHBG 1E0FD 3AW1A 3A84A 1A7SA 1S0QA 2BHGA 2Q6DA 5EOKA 3RXAA 1KXBA 1WYKA 1ZPBA 3LC5A 3M3SA 1DE7H 4A92A 2ODPA 3SUGA 5DP7A 3A7TA 3UR9A 4A7IB 5LH8A 1LHGH 2ZTYA 2FESH 4NG9H 3D65E 1TALA 4CRFA 2AMQA 1SQTA 1P57B 3UNQA 1ESBA 2AGGX 3O8DA 1N8OC 1EQ9A 4FUJA 3TJNA 4AORA 4KTCA 2F9VA 1BUIA 4JCNA 2CF9H 2JETC 1GBIA 1NRNH 2VH6A 1KTSB 1UCYK 3MYWA 1AWHB 1PPFE 1O2NA 4ASHA 1O30A 2F9OA 4Y11E 3TK9A 4NWKA 2STBE 4X1PU 1U6QA 5FPTA 3SU5A 4CRBA 3STIA 1EB2A 1TB6H 2D26C 1ORFA 4XSKU 2QV1A 2XCFA 2XC4A 5A09A 3LIWA 4LZ1H 2JH5D 2ZDNA 2JH0D 1L1NA 2A7CA 3A8AA 3UWJH 2B8OH 4GCHF 3RXKA 3E3TA 5F8TA 5HXFA 1O5DH 4MVNA 3SU0A 1OWIA 1MTNB 4UDWH 4MNWA 1FUJA 1TX6A 1Y8TA 3TVJB 4FUDA 1XM1A 2A5KA 1XUJA 1C5QA 1QJ7B 2O8MA 1WBGB 3MH4A 2Y5FA 1HAPH 1NY22 1GVLA 4IC5A 1C2EA 5SGAE 4B2CA 1RFNA 3PTNA 4ISLA 5EQSA 1F2SE 4ABDA 1AN1E 4KTSA 3EYDA 2XWAA 2BD2A 2QYIA 1W10U 4B71A 4O9VA 1EAIA 3F1SB 1HDTH 1HV7A 1YM0A 1C1QA 4BAOB 3DHKH 1E34B 1XKAC 4Z0KA 4IS5A 2UUFB 5GPIB 4X8TH 2BLVA 5CHAC 4JZEH 4KGAA 3VGCC 1BRUP 1MBQA 1HFDA 3HKJB 3KEEA 1GVZA 2OBQA 4MTBA 1O2SA 1SR5C 2P16A 3F9GA 3ENSB 1UTKA 4DGJA 1T32A 1SI5H 1Y5BT 1LTOA 2AGEX 1WOFA 3ZZ4A 2F83A 1TX7A 1QFKH 4A5TS 3Q3XA 1ZPCA 4K1SA 1B0FA 3SU4A 3E16B 3T28A 2PW8H 4AGJA 1O38A 4ABFA 3OYPA 2V0BA 1YPMH 1EJNA 2XBYA 2JKHA 1ZSLA 1C1OA 3LT3A 2AGIX 1SGFA 2OC7A 1RTLA 3GY5A 1AE5A 2QC2A 2VIDA 1F0UA 5A0CA 2XNIA 1EATA 2NU4E 1NRQH 1LVYA 2EA3A 5G4BA 8LPRA 1XXFA 2GGVB 2Y6TA 4YLUA 1O3DA 2FEQH 4GPGA 1T7CA 2Z7FE 2C93B 1W7GH 3SORA 3BG4B 2G4TA 3F9HA 3A7XA 3SU3A 2BD4A 1WAYB 1K9OE 4BNRA 2FTLE 2C8XB 3SV8A 1C5OH 3TH2H 3NCLA 4WF8A 1P2OA 5JBAS 4WH6A 1OX1A 4FVBA 4BANB 3D23A 1NFXA 3GDSA 2VB0A 1FONA 2BZAA 4U01A 1O2IA 3LGYA 1CSOE 2YNAA 4FUFA 3SOSA 4MNXA 2FYRA 8GCHG 1P03A 3F6UH 1P10A 3LJOA 1ZHRA 1QL8A 4MDSA 3MNSA 4K2YA 2SFAA 1V2ST 5EXNA 3E6PH 3A89A 1E36B 1J14A 3RXSA 3SI3H 3GCTF 1ZOMA 2OC0A 4WWYA 1IQKA 2J4IA 1CVWH 2PLXA 4GHQA 5JBBS 2UUYA 1UMAH 3LKWA 1H1BA 1C2LA 5C67A 2GTBA 1Y3UA 1WCZA 3SHAH 1MKWH 3QLPH 4OS4A 2Y81A 4D7FA 1HAVB 1F0TA 1NZQH 2I6SA 2VWLA 3QZQA 1BB0B 1GBAA 2ZDMA 2BDGA 1IQJA 5J4SA 4AB9A 2VWMA 5CMXH 1G9IE 6CHAB 3ZVFA 4LZ4B 4I8JA 1NRPH 1O2ZA 1O2VA 2A4QA 1AUJA 1BA8B 1P12E 3ESTA 1UK2A 3PTBA 1MAYA 3GY6A 3RLWH 5F8XA 4K8YA 2WPKS 3A88A 1A5GH 2THFB 3P6ZB 4WMEA 3ZVAA 1D3QB 1P3EA 5C2ZA 4ABHA 1GI0A 4VGCC 1FPCH 4K8BA 2QXHA 1P06A 3VXEH 2A32A 1DUEA 2CJIA 2C3SA 1T4VH 1D3DB 3M7TA 1MKXH 2AERH 4B76A 5JBTA 2BQ7B 1O3HA 2ZPQA 1O2KA 1TNIA 2WPIS 3EGKH 3G01A 3LOXA 5DGJA 9ESTA 1C2JA 2XXLA 1HAZB 2NWNA 1V2KT 1O31A 2BVXH 3SGBE 1TGSZ 1LPKB 2Y82A 3M7QA 3UUZA 1C1UH 2Y7XA 1F0RA 4BXWA 1E38B 2OXSA 1KXFA 1EX3A 1V2QT 2BVRH 5A8ZA 1CA0B 4CR9A 1FZZA 3BN9A 4A6LA 1RIWC 1THRH 3PMJA 1RGQA 1SLUB 4NCYA 1GG6B 1O3MA 5E0GA 1D4PB 1UO6A 2TGDA 3SJ8A 1TFXA 3B23B 3KQBA 4WVPE 1TOCB 2I6QA 2HNTE 1SFIA 4I8HA 2ZTZA 4AG1A 2BXUH 1TGBA 3UIRA 3AW0A 3MO6A 4X2WA 3OY6U 3SV6A 3SI4H 1MQ6A 1EPTB 1TQ7B 1O37A 1SGQE 1QA7A 4CRAA 5C1UA 1UK3A 4ABEA 4JZIA 1OXGA 1TLDA 5DKMA 1ELTA 2ANKH 1NESE 1KXEA 2FP7B 1P2KA 3ZZCA 4UE7H 2F9UA 1W0YH 2DE8A 1LHFH 3RU4T 1O5CB 2ZFRH 1M9UA 1SGIB 4E7RG 1H9HE 1MZAA 3UR6A 2TGTA 5A8YA 1C4Y2 2ZECA 1QNJA 4ZUHA 2HPQH 1V2OT 1LPGB 1MTNC 2Z9KA 3UTUH 5FXLA 1DWEH 1TPPA 1BMMH 5FBEA 1GHAF 3V0XA 2VVCA 4WXIA 3UFAA 4ZHAA 3U1IB 3QGNB 4KP0A 1NROH 1HPGA 4IMZA 1TMTH 5GCHG 4XBCA 3SZNA 2W26A 1KLIH 1A4WH 1G3DA 1JBUH 1P2JA 2BY5X 4MLFB 4H4FA 2F91A 1D6RA 3MWIU 4K3JA 2A5IA 4YOJA 1BTXA 1ZJDA 4TWYA 2Z3DA 1C9PA 2LPRA 2GD4B 3RXHA 3A8BA 3RMNH 4A1VA 4H6SB 3EAJA 1E35B 3K6ZA 2SGEE 2GCHF 2XBVA 1GJ9B 3S9CA 3SJOA 1CBWC 3PMHB 2V35A 3KIDU 1ZHPA 2BDBA 5DP5A 4BTTB 3W94A 2CN0H 2ZHEH 3A7YA 3CS0A 4AB8A 1GI8B 3P8FA 4MG3A 1PQ8A 4AG2A 3FANA 1GL0E 1C2GA 1ANBA 1QB6A 1MQ5A 3U98H 4FUGA 6CHAC 3BTHE 5C5NA 2O8UA 1O3AA 4DOQA 2STAE 1GCTB 2F3CE 5EGMA 1UCYH 2EC9H 3UWIA 2XBWA 1XUFA 2WV4A 3SHCH 2C8ZB 1VITH 2GCTC 2PUQH 1T31A 4ZHLU 4TY7A 1VGCB 1KTTB 1AVWA 1QQ4A 1QHRB 1TQ0B 4Q2KA 1MUEB 1XUGA 1SGYE 1F5LA 1O2QA 1FNIA 2QIQA 2VWNA 1BRCE 1G3CA 4DY7B 1FDPA 3E0PB 1BBRH 1O36A 2XC5A 1MD8A 1V2PT 1LO6A 2FZZA 1C4U2 1OWEA 1C4V2 4HFPB 1W3CA 3ODFA 1SPJA 2WPHS 5EU8A 2BDYA 2FX4A 5FAHA 1O2RA 1LHDH 3PROA 2NU1E 2KAIB 4DURA 2AYWA 4ABAA 4X6NA 1AY6H 1ELGA 5E0JA 4Y8XA 5FPYA 2WPMS 1BRAA 2OQ5A 1GBLA 1Q2WA 4LXBH 4FXGH 4ABIA 2FPZA 6GCHF 4MPVA 4JYUH 2R2WU 3TLOA 1UTMA 4INKA 2CHAB 2SNVA 4BAHB 3MMGA 2Z94A 5PTPA 1VITG 1IQLA 1CHGA 4GLYA 1DSTA 4X6OA 6GCHG 1P9UA 3KNXA 1HJ8A 1F92A 5GXPA 1OS8A 2TGAA 1BBRE 2IJOB 1D3TB 4MPXA 3E91A 1SHYA 3GY7A 1K28D 2GT7A 3SO3A 1O2LA 1V2TT 4Q7XA 2PV9B 3IWMA 1HBTH 2BY7X 1K2I1 2AEIH 3BEIB 3SJIA 2IPHA 2PFEA 5HMAA 1TBQH 1ABIH 1MBMA 1Y3XA 2P3UB 1FY3A 1K1IA 1BQYA 2H5CA 3GICB 4FU8A 1C5MD 1SGPE 1O3IA 4JZ1A 2OLGA 1QY6A 3MU8A 1ARCA 1O5FH 4DCDA 4AFSA 2BB4A 3SUFA 1QBOA 3P92A 3PO1B 1V6DA 4O3TA 2AS9A 1HNEE 1JIRA 2ZGBH 1ZRBA 3SGAE 1C5SA 1ZPZA 2H2ZA 2C90B 4HZHA 1GPZA 3V13A 4NZLA 1LDTT 3DA9B 7GCHF 3N7OA 4NSVA 1AE8H 1UTPA 2SGAA 4X8UH 1O39A 2ZTXA 3A81A 3VEQB 5AFZH 1K1MA 2A1DB 2B9LA 1BTHH 3QN7A
chains in the Genus database with same CATH superfamily
4NIWA 1H8DH 1SGNE 2ZWLH 2BZ6H 2H5DA 3PV5A 5A0AE 3U1JB 7GCHG 2G00A 1Q3XA 1S6FA 2ZPRA 4I32A 5CHAB 3URCA 1FPHH 2CF8H 2YNBA 1ELDE 3RXUA 2PTCE 5HKKD 2J5UA 3RU4E 3BTWE 1K1PA 3BIVH 1O5BB 3KQCA 1NBMD 2J92A 2SGPE 4O3UA 1C1PA 3UREA 3RXCA 3LGWA 5GDSH 1Z6EA 3KCGH 5GCHF 1S82A 3MH5A 2QA9E 4BAQB 3Q3KA 5HM9A 2ZDVH 2ZFTA 4B74A 4Y0ZE 2PSYA 2P8OB 1ZGIA 2BQWB 2AMDA 2GV6A 1ARBA 5AHGH 1AUTC 1Z1JA 2BD8A 4TT3D 1GBJA 2QN5T 3U9AH 1ZTKA 4BAKB 2A7JA 3PLKA 1O3NA 4X1QU 3URDA 1YYY1 1OKXA 1NU9A 1VITF 2J94A 3FP6E 1G36A 4B6EA 3ZZ7A 1TNHA 3E90B 1PYTC 4NFFA 1W7XH 3M5MA 3TGIE 1GL1A 3PM3A 3U8RH 3GCNA 2J38A 1MH0A 3BG4C 4TPIZ 1O3KA 1S0RA 1D3PB 3T62A 1TIOA 1V2WT 1LVOA 2FOEA 2ZI2H 2XWBI 5TCCA 4CBOA 1HJAC 3QGJA 4WH8A 1J17T 1C1RA 1T8NA 1TRNA 4DVAU 4MPWA 2BD9A 1DWBH 5JB8S 1FN6A 2NU0E 2HALA 5DO4H 1KXDA 5ESBA 3RXJA 2WV5A 1O2PA 4X1SU 1ZMJA 3VG8A 2OBOA 1HAYB 2HPPH 1RTKA 1LPZB 1FJSA 1A5HA 1VJ9U 3UNSA 3ZZDA 2UWPA 2QF0A 3RDZA 1O33A 3QX5H 1HJ9A 1YKTA 1NRSH 3A8DA 3QUMP 1ZTLA 1BTUA 1O5AB 2BDCA 2FLRH 2PR3A 4GAWA 1QJ6B 2XRCA 5BRRE 3MOCA 4IBLH 3EA7A 4X1RU 2BDIA 2BD3A 1IQNA 2FWWA 1J16A 1PFXC 1BOQA 1O2JA 2FX6A 3GDVA 3D62A 1A5IA 3UQOA 2F4LA 3PWCA 1EAWA 2VBCA 2SGFE 4A1TA 1WU1A 2VIOA 2K0QA 7LPRA 4TYDA 4AX9H 1E37B 5CHBA 5AF9H 3KYFA 3TJOA 4ISHH 3TPIZ 2C8YB 1UVSH 1SGTA 4B2AA 4X6MA 5K0HA 4TWWA 4CRDA 4XRNA 5T1VA 1J15A 1C2DA 2R3YA 1L2EA 1V2NT 1XXDA 3NUMA 1OYTH 1P8VC 1W2KH 1PPEE 2BOHB 2QAAA 4JYTA 4K1EA 2GMTC 1YWUA 1GJ6A 2ZO3H 2Z3CA 1KDQB 2CMYA 2VVVA 2KCYA 1F7ZA 1CHOG 3GY8A 4NSYA 1P2QA 1AI8H 1YLCA 1KLTA 1XUHA 1HLTH 2ASUB 3AVZA 3P8NA 2J98B 3RP2A 1GJCB 2HWLB 3L3TA 2GDDA 1P0SH 1W13U 5A2MH 4SGAE 2XCNA 4YO9A 5L2ZH 1GBHA 3L33A 5EJLA 1K1LA 2BY9X 1N8OB 2BDHA 1YCPM 1DM4B 3PLPA 1DWCH 1O2UA 2BY8X 3IG6B 3SJ9A 3K9XB 1QB9A 1GG6C 1OWHA 2OCVB 3NKKA 3S69A 1SL3A 1QL9A 3BTFE 3BG8A 4FUIA 4VGCB 1ETSH 2FXRA 1C5ZB 1DX5M 1EB1H 1FLEE 1ESTA 2C8WB 1SSXA 5LGOA 3ZV9A 4OS7A 2O8LA 2ZCKP 3UOPA 2XTTB 3KF2A 4UFFH 4HTCH 3PWBA 5DP3A 2Y5GA 1C5UA 5CE1A 4INHA 1CGIE 1HAVA 3W95A 1YPKH 4JK6A 2B0FA 1UCYE 2GCHG 2OTVA 4GSOA 1BMLA 3PMAB 5KGOA 1MKWK 5DP4A 1MCTA 4NFEA 7ESTE 1HAXB 1SQOA 3V3MA 4OS6A 4K1TA 2V3OH 3Q77A 4H6TA 4R8TB 5EQQA 1EPTA 1XMNB 1YCPH 2F43B 3LC3A 1GVKB 2VJ1A 3OU0A 1DXWA 1RRKA 1QIXB 1J9CH 3RM2H 2P93A 3DSPA 1V2MT 1A0LA 2GT8A 1Z8RA 4NA9H 1MKXK 3RXGA 1SQRA 4NZQA 1P01A 1C9TA 1C5PA 3S9AA 3NWUA 2BLQA 3MU1A 3S7KB 3JZ2B 1Y5UT 4X8VH 2RDLA 2P3FH 5JDUB 1QRWA 3P70B 1WQVH 3M5LA 3A86A 3LDXH 3ATLA 4X1NU 4K69A 3T26A 2Y80A 1NU7B 2FI3E 6ESTA 1Y59T 2PUXB 2JDID 3BEUA 4CHAB 3OTJE 2FLBH 5BPEA 3LGIA 1DS2E 2BLWA 4AGKA 2FS8A 1W8BH 1BTWA 1AVGH 1CBWB 2R0LA 1AB9C 2R0KA 3RXLA 1CA0C 1NFWA 2ZP0H 2BYAX 2ESTE 2AIQA 2TIOA 2SNWA 1ZJKA 2B7DH 1K0HA 4X0WU 5HYOA 2WSSD 4ISIH 1O2XA 1W0ZU 1RD3B 2KX4A 3SYJA 1WSSH 1DT2A 5KEDA 2FTMA 4Y71A 1PPHE 1QZ8A 5AVDA 1RJXB 4Q4LA 3ZYDA 4XDEA 1ELFA 3D49H 4RT1A 1BRBE 1G2LA 2P94A 2Q1JA 1O3LA 1UTLM 1FQ3A 2QGRA 3U28C 1L4ZA 2KZ4A 5JB9S 4MNVA 5F8ZA 3RXIA 3ELAH 4Y76A 4KELA 2ZHFH 1BHXF 1DXPA 1GDUA 2PTNA 2ZEBA 2AH4X 1YPEH 1V3XA 3GOVB 3OX7U 4MNYA 2FI4E 3MTYA 4D8NA 1BTYA 2BX3A 3SNCA 3GCOA 1EP6A 2RCEA 4QT8C 2QCYA 2FMJA 2TPIZ 1WQSA 3MH6A 3O8CA 1MTUA 1TBZH 1VJAU 2ZQ1A 4XFQA 2WPJS 1EJAA 4B2BA 1H4WA 1T4UH 4M7GA 3UQVA 4DJZB 1OP2A 3NXPA 4F48B 4BOHA 3M5OA 2TBSA 3KHVA 4CRGA 4ZXYH 1UVTH 5GWZA 4X2VA 1O5GH 2TRMA 8GCHF 1SBWA 3F2FA 3SU6A 3KQEA 3C1KA 4JK5A 1SVPA 4WMDA 2FOFA 1YPGH 5EW2H 1T8MA 3WY8A 1LKBA 4TY6A 1GI2A 4RT0A 1Z7KA 2Q6FA 3MQKC 2QY0B 2HVXA 3LH3A 1KLJH 4FUCA 1GGDB 2BMGB 5EG4A 2A5AA 4OGYA 2VU8E 1DWDH 3ZVGA 2FOAA 2FIRH 2HRVA 2VNTA 3M36A 4DT4A 3MFJA 1WXRA 4TPYA 2YOLA 1BMNH 2OINA 1IQFA 2ANYA 3GCHB 3JZ1B 3UY9A 1E1RD 3GYLB 1OWDA 1HRTH 2ULLA 1MU6B 1VGCC 2ZGJA 1TNLA 1H8IH 1V2VT 3BTTE 4ABGA 2RA3A 4SGBE 1DUAA 1GHYH 4IN2A 3V12A 1BT7A 4ZXXH 4DW2U 1B7XB 2W7SA 3F68H 2O9QA 1MTSA 1VCPA 3F9FA 1XUIA 4UONA 3TIUA 4Y8YA 2VVUA 3GCTG 3ZV8A 4FETA 4XE4A 3T25A 3OSYA 2PGQB 3SJKA 1AZ8A 4U2WA 1K1NA 2RG3A 1NRRH 4UFGH 3ZVEA 3RMLH 1V2LT 2IJD1 4CREA 1CGJE 1DPOA 2FOCA 3PO1C 4Q7YA 1WUNH 1WTGH 1VR1H 1C1VH 1J8AA 2A45B 5T6FA 5EQRA 1DLKB 2WZQA 3ZZAA 1DDJA 4FUHA 1C1TA 4NIYA 1IHSH 1MZDA 2PKSB 1HCGA 1A1RA 3A7ZA 2ZF0H 1S6LA 4THNH 5LPRA 2VH0A 4O97A 1O2YA 3ZZBA 4OM9A 1CHOF 1GJAB 1EOLA 1IQIA 2F9BH 1UHBB 3BTEE 2ZU1A 4FU7A 1OSSA 4GVUA 4BTIB 1FY5A 1RTFB 1TMUH 3RC5A 4CRCA 2D8WA 2H1UA 1XUKA 1EXFA 1MTWA 1GBKA 4BAMB 2IPQX 2LNCA 1ZMNA 2BXTH 1ZRKA 1OWKA 1Y3VA 3PMBB 3ZZ6A 1FY4A 3SQHE 2GVFA 3C27B 1GBCA 1A46H 2LELA 1HIAB 3DSOA 4M9FA 3FZZA 4XOJA 3FAOA 3DCLA 3K6YA 1GMDG 3FZDA 1ETRH 4JZFH 1HYLA 1P2IA 1HUTH 2GP9B 4X6PA 1A2CH 2UWOA 1TA2A 1GJBB 4DG4A 1AFEH 2SGDE 1YY3A 3OAAD 4I8LA 5E2OA 1ZYOA 5DK1A 1O2MA 2HOBA 2JETB 4ISNA 3ODDA 4NIVA 2B5TB 2ZC9H 1GCTC 3SV2H 2XW9A 3MNBA 3LGVA 1MU8B 5EPNA 3SUEA 4AOQA 2BQ6B 1AWFH 4KKDA 3VPKA 3BEFB 3BTKE 1A0JA 1ELAA 1PPCE 1TA6A 4RI0A 1ZTJA 1SLXB 4ZMAH 1L1JA 2QXGA 3TJUA 1AKSA 2ZIQH 3K2UA 2PWXA 2YMSB 3MH7A 3BV9B 1GJ5H 1SHHB 3I78A 5FX6A 2FI5E 1KSNA 1QRZA 1SGRE 4Q80A 1C5XB 1GMCG 2PGBB 1ABJH 3BSQA 5LPFA 1GBTA 1PYTD 3PB1E 2ZCLP 5HIYA 1IQGA 2ODYB 4B75A 1C5RA 1SOTA 2G52A 1OPHB 4RSPA 2D2DA 4MQAA 5EODA 3VB6A 5C1XA 1KYNA 4UFEH 1EKBB 4DT7B 2HLDD 5I46H 1C5LH 2XBXA 1P02A 2IN2A 3KL6A 4YT7H 2BDAA 3NZIA 2G55A 2JIZD 1GGDC 1UTQA 3GYMA 2GX4A 4X2XA 2BOKA 3KN2A 1GMCF 2ZKSA 1ETTH 6LPRA 1GBFA 5HM2A 2WYJA 2G51A 1UTNA 1ZR0A 4ZROA 1IQHA 1H9LB 3OFND 3A8CA 3NK8A 1YP9A 3QK1A 3H7TA 4ISOA 1QA0A 3A82A 3Q3YA 2QF5A 5F03A 1W12U 3M3VA 1O2OA 3O8BA 1YPHC 1TOMH 1C1MA 1ZZZA 1ANCA 4ESTE 1EASA 4LOYH 3VXFH 3S0NA 5C3NA 1YPHE 4K60A 1OHHD 3DSGA 3DT0H 2A0QB 2IOTA 5T6GA 1W14U 3IITA 2KCPA 1BZXE 2OQUA 2VIQA 3SV7A 1CGHA 1AQ7A 1VZQH 2ALVA 3SW2B 1HAGE 1GI5A 1PPZA 2QF3A 3ITIA 3LGTA 1QJ1B 3MO3A 4ABJA 1G32B 3EDXB 1GHBF 3QDZB 5DP8A 1GMDF 3HPTB 3O8RA 1GJ7B 1ZLRA 1Z71A 3TJVA 1AHTH 1V2UT 2OK5A 2AMPA 1C2IA 1PJPA 4YM9A 1O35A 4UD9H 1SGDE 3GISB 3P8OA 1CO7E 3QO6A 1AVXA 2ZA5A 3AAUA 3UPEA 3VFEA 2FM2A 5DSFA 1TNJA 3UNRA 1XKBC 3F0PA 4J2YB 1O32A 1IAUA 3A7WA 3FN8A 1S6HA 3H09A 1YC0A 1LMWB 4AC9A 1THPB 2V3MA 4I8GA 5DN6D 1G3BA 1MTVA 1FV9A 1ESAA 4OS5A 3BTGE 2J34A 1BITA 4R0IA 4ACBA 2ZHWH 4X8SH 1GI6A 4X2YA 5ETXA 1QURH 5FX5A 2P59A 1SG8B 1OWJA 1XVMA 3RXRA 5B6LA 1A3EH 4XBBA 1FAXA 1L1GA 2EI6A 1O2HA 4BXSA 1IQEA 2CV3A 3SGQE 1VKYA 1CQQA 2EY4C 3OTPA 4JYVH 4ZH8A 1LKAA 1CA8B 3ATWA 4NA7A 4YOGA 5EXMA 1ANDA 4MPUA 4D76A 1PQ7A 3HGNA 1YF4A 1O5EH 1BCUH 1UTJA 2AFQB 4NA8A 4WMFA 1BMAA 1B5GH 2FOBA 3ATIA 5L30H 2EI8A 3RXFA 1C2FA 2ZG0H 2RFKC 3RC6A 1Y3YA 1Z1IA 2XOKD 1MCVA 5FCRA 3RLYH 3KYGA 1BJUA 1O3CA 1GJ8B 2G81E 2P3TB 5DG6A 2BLOA 3FP8E 3VB5A 5FCKA 1RXPA 4OS2A 5JYIA 5IYTA 1YCPK 3EQ0H 3GY3A 2ZGCA 5L2YH 1O3PB 4ABBA 1EFRD 1O3EA 1Z8JB 2LP6A 3FOAA 2SGQE 4XBDA 1TRYA 3MI4A 3R0FA 3ZZ8A 1TONA 4IC6A 4AYYB 3E1XB 1C5WB 1TGTA 1ZSKA 5GNDA 2CXVA 3CENA 1P3CA 1NPMA 1FIWA 3OY5U 2ZGXH 2OUAA 3V7TA 1GI1A 1JOUB 5EIYA 1QGFA 1O3FA 3U8OH 4CH8B 1GHAG 2ZDKA 1AU8A 1P04A 1SQAA 3E0NB 3EE7A 1P2MA 5JPMH 5T3HA 1C2KA 3TH3H 1ELCA 1GHXH 1YPLH 2XYAA 4U32A 1DY8A 4AN7A 3SQEE 4ZKNU 4Q7ZA 2NU3E 3LONA 2ZU4A 2W6ID 1E79D 2VIWA 4B6FA 1DLEA 2H9EH 1BTZA 2W7UA 4B1TA 3N7DA 4CR5A 2QXIA 4Y6DA 3I77A 2VIPA 4WXVA 2O8TA 1S83A 3SU2A 2Z9JA 1CT0E 3VB7A 3PV2A 2FOMB 3MO9A 1P05A 5TCAA 2ZNKH 1AIXH 3T27A 1C5NH 2A2QH 1G2MA 4Z6AH 2VGCB 4IN1A 1TRMA 3F0OA 1LHCH 1QBVH 2R3UA 3TGKE 1PQ5A 1K21H 1BBRK 3RXMA 2FODA 1TAWA 1TGCA 4OGXA 1A0HB 3HK3B 1DFPA 1UK4A 3BF6H 3LH1A 2ZFFH 1F5KU 3M5NA 1D6WA 2C4FH 4HGCA 1G37A 2L74A 4CHAC 2PHBA 2UUJB 1T8OA 1YGCH 1KXAA 1GJDB 3PV4A 3HKIB 2BY6X 1ZHMA 2HVYB 2A31A 1CU1A 3DUXH 1H9IE 1GWAA 5AFYH 3RXQA 1TYNA 2W3KA 1EZUC 5FPSA 1A61H 1GDNA 1ELEE 1UHBA 1AFQB 1GBBA 1MAXA 1SMFE 3KGPA 1NTPA 3RXVA 4FVDA 1O2WA 2M5TA 1C5TA 2A4RA 3ZIAD 1HB0B 2WYGA 3PRBA 3A83A 2ZDAH 2GZ8A 1GBDA 1EPTC 1N6XA 2ZGHA 3F2GA 3S7HB 1Y5AT 2R2MB 1PPBH 1LCYA 5EPYA 3TGJE 1THSH 3VGCB 2W5EA 4IMQA 2A4GA 5FBIA 1VCWA 3OEHD 3EA8A 5K7RA 1TPOA 2ZU5A 1HIAA 1EUFA 4Y79A 1NFYA 4AFQA 1JMOH 1OYQA 3ATKA 4Y10E 3RC4A 1QCPA 3P95A 1NFUA 2YMSC 3RXOA 4E7NA 1NN6A 5IDKA 2BD7A 5ESTE 3T29A 1C5VA 1GI9B 1AD8H 4NIXA 1QR3E 1TPAE 3M37A 4IGDA 8KME2 1QBNA 3LJJA 2VINA 2V6NA 4RKOB 2G8TA 1SGFG 4KTUA 4BTUB 4ZKSU 3SU1A 3QTVH 1S84A 2Z3EA 3MNCA 2PKAA 1KDQA 1S85A 1UVOA 3R3GB 5FHTA 1O3GA 2GMTB 3P17H 5C1YA 3SNEA 2ALPA 2FOGA 1O3OA 1C5YB 1AZZA 5HGGA 1GI7B 1F5RA 2FYQA 1KXCA 1ID5H 1TWXB 5F6MA 9LPRA 1YPJH 1WTHD 1TGNA 5DP6A 1BJVA 1GHZA 1VCQA 1EAXA 2GZ9A 2K8IA 3B9FH 1GI3A 3STJA 4JMYA 4F55A 3L6PA 1FN8A 3ZZ9A 5DJ7A 4YT6H 3B8JA 1UJ1A 4FU9A 1BIOA 3LPRA 1IOEA 1RIWB 1KY9A 2OC8A 5DPAA 4Y8ZA 3RU4D 3BTME 4E06H 1G30B 2H9HA 2ILNA 3SNBA 2FS9A 5A8XA 2FDAA 4Y7AA 3VB4A 2RA0A 2O8WA 1HAIH 3MHWU 1SGEE 3SV9A 4TSFD 2UUKB 5B6OA 4H42U 4HI3A 3S9BA 1NC6A 2HNTF 3AAVA 2G5NA 2EEKA 3QTOH 1YBWA 3CS7A 3U8TH 1L0ZA 1O34A 3DFJA 3H5CB 1NM6A 5ABWA 4IW4E 1C1WH 1QTFA 2ZDLA 2GCTB 2PSXA 2DE9A 1JIMA 1JRSA 4Q63A 5A0BA 1EJMA 4OS1A 1ANEA 4AFUA 4YXWD 5J4QA 3UOUA 1S81A 2UWLA 1GBEA 1B0EA 1FY1A 1DANH 1RS0A 1SC8U 2ZZUH 1P2NA 1XX9A 5GIBA 2ODQA 2KAIA 3NPSA 1SLVB 4JZDH 1HAHH 1QRXA 4Y7BA 2KM0A 1LHEH 5L6NH 4RKJB 2WUCA 2G5VA 4XD7D 1MD7A 4I33A 3MU0A 1PQAA 4D7GA 2CGAA 1BDAA 3NRLA 1FXYA 2ANMH 2NU2E 4UEHH 1DVAH 1LQEA 3MU5A 4F49A 4FUEA 1DICA 1ZMLA 1ZSJA 3ZZ3A 1N6YA 3P8GA 5E2PA 1JRTA 1IHTH 3ZYEA 1INCA 2Y5HA 4NWLA 1GHVH 1AFQC 2BVSH 3BTDE 4ZAEA 2BD5A 1C2MA 3TNTA 1G3EA 2P95A 1SKYE 1GI4A 1AO5A 4FOUC 1IQMA 2Y7ZA 4I8KA 1SLWB 4F4OC 2R9PA 2V7QD 3F9EA 1LVBA 2ZCHP 2ZU3A 1UTOA 4UFDH 2J2UA 1TNKA 3RXPA 1OOKB 1NS3A 4CH2B 3A85A 3M7UA 3EA9A 5C5OA 1D9IA 4J1YA 3CP7A 2A2XH 3I29A 3TK6A 3Q00A 1AGJA 2AIPA 1Z6JH 3RM0H 5C0UA 1P09A 1W0KD 2GDEH 3ZVCA 4PROA 2ZPSA 4YLQH 3LGUA 4AYVB 1EAUA 3FFGA 3MU4A 1W0JD 3TK5A 3ATMA 2ZFQH 1T8LA 4DIIH 2A7HA 1O3BA 2JH6D 1NBME 1GHWH 1P9SA 2BM2A 5T6DA 4YZUA 7KMEH 4INLA 3GDUA 1HGTH 4U30A 1WV7H 4Y0YE 1CT2E 4ZCNA 1AMHA 5E8EH 2QXJA 3T5FH 1TE0A 2VGCC 2PKSC 1GDQA 3GS9A 5KECA 5DP9A 4AFZA 2ZFSA 5TJXA 1MMJN 2ZHDA 1QQUA 1ELVA 1HXEH 2F9PA 1UVPA 1C1NA 3GY2A 2H6MA 4WY3A 2RDEA 2BTCE 2GJGA 4K5ZA 1XVOA 1ACBE 2PKAB 1CE5A 4YTAA 1OP0A 3TNSA 4AZ2B 1AB9B 1A3BH 1EZQA 2VIVA 3FVFB 3RXDA 1HJAB 3WW7A 5C20A 2OC1A 3QZRA 1DOJA 1V2JT 2TGPZ 3EE0B 2J95A 2XC0A 4GCHG 2FO9A 2OD3B 1HAOH 1BTPA 2CHAC 3HATH 3A87A 1FAKH 2WINI 1FY8E 3TH4H 1DY9A 1GJ4H 3HGPA 4YESB 1GCDA 4D9RA 3SNAA 2GKVE 1F0SA 3H7OA 1LVMA 3WWBA 1WDIA 3HK6B 2Z6BD 1O2GH 3BIUH 3AASA 1DITH 3GCHC 3LU9B 3GY4A 1S5SA 2WPLS 3A80A 3SBKA 4ZKOU 1SFQB 1X7AC 4GUXA 2G4UA 2BX4A 4DIHH 4FUBA 2JJ2D 1FMGA 1HXFH 1FX0B 3E8LA 3FP7E 4I31A 5EW1H 4I7YH 3RMOH 1O2TA 2GV7A 3BTQE 1BHXB 2K1QA 4B73A 1GMHG 4D9QA 3T2NA 3MNXA 1Y3WA 4ZKRU 1YLDA 1SOZA 3RXEA 2ANWA 1OP8A 5I25A 1K22H 1K1OA 2WUBA 3F2HA 2HGTH 3SNDA 5EXLA 3RXTA 2J9NA 4ZHMU 1V2RT 2Z9LA 1UVUH 2A4OA 1EP5A 4HG6A 3RUOA 3SZEA 1FIZA 1ELBA 1GBMA 1TMBH 4A1XA 3M35A 3SUDA 1FI8A 1EOJA 1EZSC 1O0DH 1SB1H 2ZU2A 1NO9H 2H9TH 1L4DA 3RXBA 5JBCS 3PLBA 3TITA 1DSUA 1QB1A 1P11E 1EZXC 2Z9IA 3RMMH 2J97A 4RN6A 3M3TA 1JWTA 1TABE 2ZQ2A 1KIGH 3VB3A 3ZVDA 1NT1A 4WJG2 3N7EA 2VWOA 2Z9GA 1AKSB 4YOIA 3SN8A 1QL7A 1ZGVA 2DUCA 3PYHA 5LPEA 2ZFPH 2ZHQH 4GHTA 2EI7A 1CT4E 3QWCH 1LQDB 1PPGE 1C2HA 2V3HH 3M61U 1TPSA 3DD2H 3A7VA 1GMHF 8ESTE 2FOHA 3TU7H 3Q76A 1C1SA 2D1JA 3DFLA 3ZZ5A 4O03A 1Z8IB 1N1LA 2W3IA 2F9NA 2GZ7A 2Q6GA 4E05H 1K1JA 1TX8A 2HNTC 2OP9A 1O3JA 2P8OC 5GJ4B 1Z8GA 4CBNA 1TNGA 1W11U 1Q31A 1TBRH 5H4IB 4NGAH 3K65B 2HLCA 3KQDA 5E0HA 1SGCA 4LK4A 1JXPA 3ZVBA 3U69H 1GHBG 1E0FD 3AW1A 3A84A 1A7SA 1S0QA 2BHGA 2M2AA 2Q6DA 5EOKA 3RXAA 1KXBA 1WYKA 1ZPBA 3LC5A 3M3SA 3OE7D 1DE7H 4A92A 2ODPA 3SUGA 5DP7A 3A7TA 3UR9A 4A7IB 5LH8A 1LHGH 2ZTYA 5IK2D 2FESH 4NG9H 3UAIC 3D65E 1TALA 4CRFA 2AMQA 1SQTA 1P57B 3UNQA 1ESBA 2AGGX 3O8DA 1N8OC 1EQ9A 4FUJA 3TJNA 4AORA 4KTCA 2F9VA 1BUIA 4JCNA 2CF9H 2JETC 1GBIA 1NRNH 1UCYK 1KTSB 2VH6A 3MYWA 1AWHB 1PPFE 1O2NA 2WPDD 5C0TA 4ASHA 1O30A 2F9OA 3N99A 4Y11E 3TK9A 4NWKA 2STBE 4X1PU 1U6QA 5FPTA 3SU5A 4CRBA 3STIA 1EB2A 1TB6H 2D26C 1ORFA 4XSKU 2QV1A 2XCFA 2XC4A 5A09A 3LIWA 4ACAA 4LZ1H 2JH5D 2ZDNA 2JH0D 1L1NA 2A7CA 3A8AA 3UWJH 1E1QD 2B8OH 4GCHF 3RXKA 3E3TA 5F8TA 1BMFD 5HXFA 1O5DH 4MVNA 3SU0A 1OWIA 1MTNB 4UDWH 4MNWA 1FUJA 1TX6A 1Y8TA 3TVJB 4FUDA 2XNDD 1XM1A 2A5KA 1XUJA 1C5QA 1QJ7B 2O8MA 1WBGB 3MH4A 2Y5FA 1HAPH 1NY22 1GVLA 2YMSD 4IC5A 1C2EA 5SGAE 4B2CA 1RFNA 3PTNA 4ISLA 5EQSA 1F2SE 4ABDA 1AN1E 4KTSA 3EYDA 2BD2A 2XWAA 2QYIA 1W10U 4B71A 4O9VA 1EAIA 3F1SB 1HDTH 1HV7A 1YM0A 1C1QA 4BAOB 2L6OA 3DHKH 1E34B 1XKAC 4Z0KA 4IS5A 2UUFB 5GPIB 4X8TH 2BLVA 5CHAC 4JZEH 4KGAA 3VGCC 1BRUP 1MBQA 1HFDA 3HKJB 3KEEA 1GVZA 2OBQA 4MTBA 1O2SA 1SR5C 2WV9A 2P16A 3F9GA 3ENSB 1UTKA 4DGJA 1T32A 1SI5H 1Y5BT 1LTOA 2AGEX 1WOFA 3ZZ4A 2F83A 1TX7A 1QFKH 4A5TS 3Q3XA 1ZPCA 4K1SA 1B0FA 3SU4A 3E16B 5C94A 3T28A 2PW8H 2WHXA 4AGJA 1O38A 4ABFA 3OYPA 2V0BA 1YPMH 1EJNA 2QE7D 2XBYA 2JKHA 1ZSLA 1C1OA 3LT3A 2AGIX 1SGFA 2OC7A 1RTLA 3GY5A 1AE5A 2QC2A 2VIDA 1F0UA 5A0CA 2XNIA 1EATA 2NU4E 4I86A 1NRQH 1LVYA 2EA3A 5G4BA 8LPRA 1XXFA 2GGVB 2Y6TA 4YLUA 1O3DA 2FEQH 4GPGA 1T7CA 2Z7FE 2C93B 3CNRA 1W7GH 3SORA 3BG4B 2G4TA 3F9HA 3A7XA 3SU3A 2BD4A 1WAYB 1K9OE 4BNRA 2FTLE 2C8XB 3SV8A 1C5OH 3TH2H 3NCLA 4WF8A 1P2OA 5JBAS 4WH6A 1OX1A 4FVBA 4BANB 3D23A 1NFXA 3GDSA 2VB0A 1FONA 2BZAA 2KCOA 4U01A 1O2IA 3LGYA 1CSOE 2YNAA 4FUFA 3SOSA 4MNXA 2FYRA 3F3BA 8GCHG 1P03A 2AHME 3F6UH 1P10A 3LJOA 1ZHRA 1QL8A 4MDSA 3MNSA 4K2YA 2SFAA 1V2ST 5EXNA 3E6PH 3A89A 1E36B 1J14A 3RXSA 3SI3H 3GCTF 1ZOMA 2OC0A 4WWYA 1IQKA 2J4IA 1CVWH 2PLXA 4GHQA 5JBBS 2UUYA 5C17A 1UMAH 3LKWA 1H1BA 1C2LA 5C67A 2GTBA 1Y3UA 1WCZA 3SHAH 1MKWH 4P00A 3QLPH 2CK3D 3KQ5A 4OS4A 2Y81A 4D7FA 1HAVB 1F0TA 1NZQH 2I6SA 2VWLA 3QZQA 1BB0B 1GBAA 2ZDMA 2BDGA 1IQJA 5J4SA 4AB9A 2VWMA 5CMXH 1G9IE 6CHAB 3ZVFA 4LZ4B 4I8JA 1NRPH 1O2ZA 1O2VA 2A4QA 5EJ1A 1AUJA 1BA8B 1P12E 3ESTA 1UK2A 3FKSD 1MAYA 3GY6A 3PTBA 3RLWH 5F8XA 4K8YA 2WPKS 3A88A 1A5GH 2THFB 3P6ZB 4WMEA 3ZVAA 1D3QB 1P3EA 5C2ZA 4ABHA 1GI0A 4VGCC 1FPCH 4K8BA 2QXHA 1P06A 3VXEH 2A32A 1DUEA 2CJIA 2C3SA 1T4VH 1D3DB 3M7TA 1MKXH 2AERH 4B76A 5JBTA 2BQ7B 1O3HA 5CDFE 2ZPQA 1O2KA 1TNIA 2WPIS 3EGKH 3G01A 3LOXA 1UW7A 5DGJA 9ESTA 1C2JA 1HAZB 2NWNA 2XXLA 1V2KT 2J98A 1O31A 2BVXH 3SGBE 1TGSZ 1LPKB 1H8HD 2Y82A 2KFWA 3M7QA 3UUZA 1C1UH 2Y7XA 1KMHB 1F0RA 4BXWA 1E38B 2OXSA 1KXFA 1EX3A 1V2QT 2BVRH 5A8ZA 3UB0A 1CA0B 4CR9A 1FZZA 3BN9A 4A6LA 1RIWC 1THRH 3PMJA 1RGQA 1SLUB 4NCYA 1GG6B 4ASUD 1O3MA 5E0GA 1D4PB 1UO6A 2TGDA 4P02A 3SJ8A 1TFXA 3B23B 3KQBA 4WVPE 1TOCB 2I6QA 2HNTE 3AK5A 1SFIA 4I8HA 2ZTZA 4AG1A 2BXUH 1TGBA 1YLNA 3UIRA 3AW0A 3MO6A 4X2WA 3OY6U 3SV6A 3SI4H 1MQ6A 1EPTB 1TQ7B 3FO8D 1O37A 1SGQE 1QA7A 4CRAA 5C1UA 1UK3A 4ABEA 4JZIA 1OXGA 1TLDA 5DKMA 1ELTA 2ANKH 1NESE 1KXEA 2FP7B 1P2KA 3ZZCA 4UE7H 2F9UA 1W0YH 2DE8A 1LHFH 2KR7A 3RU4T 1O5CB 2ZFRH 1M9UA 1SGIB 4E7RG 1H9HE 1MZAA 3UR6A 2TGTA 5A8YA 1C4Y2 2ZECA 1QNJA 4ZUHA 2HPQH 1V2OT 1LPGB 1MTNC 2Z9KA 3UTUH 5FXLA 1DWEH 1TPPA 1BMMH 5FBEA 1GHAF 3V0XA 2VVCA 4WXIA 3UFAA 4ZHAA 3U1IB 3QGNB 4KP0A 1NROH 1HPGA 4IMZA 1TMTH 5GCHG 4XBCA 3SZNA 2W26A 1KLIH 1A4WH 1G3DA 1JBUH 1P2JA 2BY5X 4MLFB 4H4FA 2F91A 1D6RA 3MWIU 4K3JA 2A5IA 4YOJA 1BTXA 1ZJDA 4TWYA 5F53A 2Z3DA 1C9PA 2LPRA 2GD4B 3RXHA 3A8BA 3RMNH 4A1VA 4H6SB 3EAJA 1E35B 3K6ZA 2SGEE 2GCHF 2XBVA 1GJ9B 3S9CA 3SJOA 1CBWC 3PMHB 2V35A 3KIDU 2EQNA 1ZHPA 3OEED 2BDBA 2PP6A 5DP5A 5HIZA 4BTTB 3W94A 2CN0H 2ZHEH 3A7YA 3CS0A 4AB8A 1GI8B 3P8FA 4MG3A 1PQ8A 4AG2A 3FANA 1GL0E 1C2GA 1ANBA 1QB6A 1MQ5A 3WWFA 3U98H 4FUGA 6CHAC 3BTHE 5C5NA 2O8UA 1O3AA 4DOQA 2STAE 1GCTB 2F3CE 5EGMA 1UCYH 2EC9H 3UWIA 2XBWA 1XUFA 2WV4A 3SHCH 2C8ZB 1VITH 2GCTC 2PUQH 1T31A 4ZHLU 4TY7A 1VGCB 1KTTB 1AVWA 1QQ4A 1QHRB 1TQ0B 4Q2KA 1MUEB 1XUGA 1SGYE 1F5LA 1O2QA 1FNIA 2QIQA 1BRCE 1G3CA 2VWNA 4DY7B 1FDPA 3E0PB 1BBRH 1O36A 5FL7D 2XC5A 1MD8A 1V2PT 1LO6A 2FZZA 1C4U2 1OWEA 1C4V2 4HFPB 1W3CA 3ODFA 1SPJA 2WPHS 5EU8A 2BDYA 2FX4A 5FAHA 1O2RA 1LHDH 3PROA 2NU1E 2KAIB 4DURA 2AYWA 4ABAA 1H8ED 4X6NA 1AY6H 1ELGA 5E0JA 4Y8XA 5FPYA 2WPMS 1BRAA 2OQ5A 1GBLA 1Q2WA 4LXBH 4FXGH 4ABIA 2FPZA 2KCAA 4MPVA 6GCHF 4JYUH 2JJ1D 2R2WU 3PRDA 1UTMA 4INKA 3TLOA 2CHAB 2SNVA 4BAHB 3MMGA 2Z94A 5PTPA 1COWD 1VITG 1IQLA 1CHGA 4GLYA 1DSTA 4X6OA 6GCHG 1P9UA 3KNXA 4Z1MD 1HJ8A 1F92A 5GXPA 1OS8A 2TGAA 1BBRE 2IJOB 1D3TB 4MPXA 3E91A 1SHYA 3GY7A 1K28D 2GT7A 3SO3A 1O2LA 1V2TT 4Q7XA 2PV9B 3IWMA 1HBTH 2BY7X 1K2I1 2AEIH 3BEIB 3SJIA 2IPHA 2PFEA 5HMAA 1TBQH 1ABIH 1MBMA 1Y3XA 2P3UB 1FY3A 1K1IA 1BQYA 2H5CA 3GICB 4FU8A 1C5MD 1SGPE 1O3IA 4JZ1A 2OLGA 1QY6A 3MU8A 1ARCA 1O5FH 4DCDA 4AFSA 2BB4A 3SUFA 1QBOA 3P92A 3PO1B 3W1EA 1V6DA 1MABB 4O3TA 2AS9A 1HNEE 1JIRA 2ZGBH 1ZRBA 3SGAE 1C5SA 1ZPZA 2H2ZA 2C90B 4HZHA 1GPZA 3V13A 4NZLA 1LDTT 3DA9B 7GCHF 3N7OA 2QF4A 4NSVA 1AE8H 5EJZA 1UTPA 2W6JD 2SGAA 4X8UH 1O39A 2ZTXA 3A81A 3VEQB 5AFZH 1K1MA 2A1DB 2B9LA 1BTHH 3QN7A
chains in the Genus database with same CATH topology
4NIWA 1H8DH 1SGNE 2ZWLH 2BZ6H 2H5DA 5A0AE 3U1JB 7GCHG 2G00A 1Q3XA 1S6FA 2ZPRA 4I32A 5CHAB 3URCA 1FPHH 2CF8H 2YNBA 1ELDE 3RXUA 2PTCE 3RU4E 3BTWE 1K1PA 3BIVH 1O5BB 3KQCA 2SGPE 2J92A 4O3UA 1C1PA 3UREA 3RXCA 3LGWA 5GDSH 1Z6EA 3KCGH 5GCHF 1S82A 3MH5A 2QA9E 4BAQB 3Q3KA 5HM9A 2ZDVH 2ZFTA 4B74A 4Y0ZE 2PSYA 2P8OB 1ZGIA 2BQWB 2AMDA 2GV6A 1ARBA 5AHGH 1AUTC 1Z1JA 2BD8A 1GBJA 2QN5T 3U9AH 1ZTKA 4BAKB 2A7JA 3PLKA 1O3NA 4X1QU 3URDA 1YYY1 1OKXA 1NU9A 1VITF 2J94A 3FP6E 1G36A 3ZZ7A 1TNHA 3E90B 1PYTC 4NFFA 1W7XH 3M5MA 3TGIE 1GL1A 3PM3A 3U8RH 3GCNA 2J38A 1MH0A 3BG4C 4TPIZ 1O3KA 1S0RA 1D3PB 3T62A 1TIOA 1V2WT 1LVOA 2FOEA 2ZI2H 2XWBI 5TCCA 4CBOA 1HJAC 3QGJA 4WH8A 1J17T 1C1RA 1T8NA 1TRNA 4DVAU 4MPWA 2BD9A 1DWBH 5JB8S 1FN6A 2NU0E 2HALA 5DO4H 1KXDA 5ESBA 3RXJA 2WV5A 1O2PA 4X1SU 1ZMJA 2OBOA 1HAYB 2HPPH 1RTKA 1LPZB 1FJSA 1A5HA 1VJ9U 3UNSA 3ZZDA 2UWPA 2QF0A 3RDZA 1O33A 3QX5H 1HJ9A 1YKTA 1NRSH 3A8DA 3QUMP 1ZTLA 1BTUA 1O5AB 2BDCA 2FLRH 2PR3A 4GAWA 1QJ6B 2XRCA 5BRRE 3MOCA 4IBLH 3EA7A 4X1RU 2BDIA 2BD3A 1IQNA 2FWWA 1J16A 1PFXC 1BOQA 1O2JA 2FX6A 3GDVA 3D62A 1A5IA 3UQOA 3PWCA 1EAWA 2SGFE 4A1TA 1WU1A 2VIOA 7LPRA 4TYDA 4AX9H 1E37B 5AF9H 3TJOA 4ISHH 3TPIZ 2C8YB 1UVSH 1SGTA 4B2AA 4X6MA 5K0HA 4TWWA 4CRDA 1J15A 1C2DA 2R3YA 1L2EA 1V2NT 1XXDA 3NUMA 1OYTH 1P8VC 1W2KH 1PPEE 2BOHB 2QAAA 4JYTA 4K1EA 2GMTC 2ZO3H 1GJ6A 2Z3CA 1KDQB 2CMYA 2VVVA 1F7ZA 1CHOG 3GY8A 4NSYA 1P2QA 1AI8H 1YLCA 1KLTA 1XUHA 1HLTH 2ASUB 3AVZA 3P8NA 3RP2A 1GJCB 2HWLB 3L3TA 2GDDA 1P0SH 1W13U 5A2MH 4SGAE 2XCNA 4YO9A 5L2ZH 1GBHA 3L33A 1K1LA 2BY9X 1N8OB 2BDHA 1YCPM 1DM4B 3PLPA 1DWCH 1O2UA 2BY8X 3IG6B 3SJ9A 3K9XB 1QB9A 1GG6C 1OWHA 2OCVB 3NKKA 3S69A 1SL3A 1QL9A 3BTFE 3BG8A 4FUIA 4VGCB 1ETSH 2FXRA 1C5ZB 1DX5M 1EB1H 1FLEE 1ESTA 2C8WB 1SSXA 5LGOA 3ZV9A 4OS7A 2O8LA 2ZCKP 3UOPA 2XTTB 3KF2A 4UFFH 4HTCH 3PWBA 5DP3A 2Y5GA 1C5UA 5CE1A 4INHA 1CGIE 1HAVA 3W95A 1YPKH 4JK6A 2B0FA 1UCYE 2GCHG 2OTVA 4GSOA 1BMLA 3PMAB 1MKWK 5DP4A 1MCTA 4NFEA 7ESTE 1HAXB 1SQOA 3V3MA 4OS6A 4K1TA 2V3OH 3Q77A 4H6TA 4R8TB 5EQQA 1EPTA 1XMNB 1YCPH 3LC3A 1GVKB 2VJ1A 3OU0A 1DXWA 1RRKA 1QIXB 1J9CH 3RM2H 2P93A 1V2MT 1A0LA 2GT8A 1Z8RA 4NA9H 1MKXK 3RXGA 4NZQA 1P01A 1C9TA 1C5PA 3S9AA 3NWUA 2BLQA 3MU1A 3S7KB 3JZ2B 1Y5UT 4X8VH 2RDLA 2P3FH 5JDUB 1QRWA 3P70B 1WQVH 3M5LA 3A86A 3LDXH 3ATLA 4X1NU 4K69A 3T26A 2Y80A 1NU7B 2FI3E 6ESTA 1Y59T 2PUXB 3BEUA 4CHAB 3OTJE 2FLBH 5BPEA 3LGIA 1DS2E 2BLWA 4AGKA 2FS8A 1W8BH 1BTWA 1AVGH 1CBWB 2R0LA 1AB9C 2R0KA 3RXLA 1CA0C 1NFWA 2ZP0H 2BYAX 2ESTE 2AIQA 2TIOA 2SNWA 1ZJKA 2B7DH 4X0WU 5HYOA 4ISIH 1O2XA 1W0ZU 1RD3B 1WSSH 1DT2A 2FTMA 4Y71A 1PPHE 5AVDA 1RJXB 3ZYDA 4XDEA 1ELFA 3D49H 1BRBE 1G2LA 2P94A 2Q1JA 1O3LA 1UTLM 1FQ3A 2QGRA 1L4ZA 5JB9S 4MNVA 5F8ZA 3RXIA 3ELAH 4Y76A 4KELA 2ZHFH 1BHXF 1DXPA 1GDUA 2PTNA 2ZEBA 2AH4X 1YPEH 1V3XA 3GOVB 3OX7U 4MNYA 2FI4E 3MTYA 4D8NA 1BTYA 2BX3A 3SNCA 3GCOA 1EP6A 2RCEA 4QT8C 2QCYA 2FMJA 2TPIZ 1WQSA 3MH6A 3O8CA 1MTUA 1TBZH 1VJAU 2ZQ1A 4XFQA 2WPJS 1EJAA 4B2BA 1H4WA 1T4UH 4M7GA 3UQVA 4DJZB 1OP2A 3NXPA 4BOHA 3M5OA 2TBSA 3KHVA 4CRGA 4ZXYH 1UVTH 5GWZA 4X2VA 1O5GH 2TRMA 8GCHF 1SBWA 3SU6A 3KQEA 3C1KA 4JK5A 1SVPA 4WMDA 2FOFA 1YPGH 5EW2H 1T8MA 3WY8A 1LKBA 4TY6A 1GI2A 1Z7KA 2Q6FA 2QY0B 2HVXA 3LH3A 1KLJH 4FUCA 1GGDB 2BMGB 5EG4A 2A5AA 4OGYA 2VU8E 1DWDH 3ZVGA 2FOAA 2FIRH 2HRVA 2VNTA 3M36A 3MFJA 4TPYA 2YOLA 1BMNH 2OINA 1IQFA 2ANYA 3GCHB 3JZ1B 3UY9A 3GYLB 1OWDA 1HRTH 2ULLA 1MU6B 1VGCC 2ZGJA 1TNLA 1H8IH 1V2VT 3BTTE 4ABGA 2RA3A 4SGBE 1DUAA 1GHYH 4IN2A 3V12A 1BT7A 4ZXXH 4DW2U 1B7XB 2W7SA 3F68H 2O9QA 1MTSA 1VCPA 3F9FA 1XUIA 4UONA 3TIUA 4Y8YA 2VVUA 3GCTG 3ZV8A 4XE4A 3T25A 3OSYA 2PGQB 3SJKA 1AZ8A 4U2WA 1K1NA 2RG3A 1NRRH 4UFGH 3ZVEA 3RMLH 1V2LT 4CREA 1CGJE 1DPOA 2FOCA 3PO1C 4Q7YA 1WUNH 1WTGH 1VR1H 1C1VH 1J8AA 2A45B 5T6FA 5EQRA 1DLKB 3ZZAA 1DDJA 4FUHA 1C1TA 4NIYA 1IHSH 1MZDA 2PKSB 1HCGA 1A1RA 3A7ZA 2ZF0H 5LPRA 4THNH 2VH0A 4O97A 1O2YA 3ZZBA 1CHOF 1GJAB 1EOLA 1IQIA 2F9BH 1UHBB 3BTEE 2ZU1A 4FU7A 1OSSA 4GVUA 4BTIB 1FY5A 1RTFB 1TMUH 3RC5A 4CRCA 2D8WA 2H1UA 1XUKA 1EXFA 1MTWA 1GBKA 4BAMB 2LNCA 1ZMNA 2BXTH 1ZRKA 1OWKA 1Y3VA 3PMBB 3ZZ6A 1FY4A 3SQHE 2GVFA 3C27B 1GBCA 1A46H 1HIAB 3FZZA 4XOJA 3FAOA 3K6YA 1GMDG 3FZDA 1ETRH 4JZFH 1HYLA 1P2IA 1HUTH 2GP9B 4X6PA 1A2CH 2UWOA 1TA2A 1GJBB 4DG4A 1AFEH 2SGDE 4I8LA 5E2OA 1ZYOA 5DK1A 1O2MA 2HOBA 2JETB 4ISNA 3ODDA 4NIVA 2B5TB 2ZC9H 1GCTC 3SV2H 2XW9A 3MNBA 3LGVA 1MU8B 5EPNA 3SUEA 4AOQA 2BQ6B 1AWFH 4KKDA 3VPKA 3BEFB 3BTKE 1A0JA 1ELAA 1PPCE 1TA6A 1ZTJA 1SLXB 4ZMAH 1L1JA 2QXGA 3TJUA 1AKSA 2ZIQH 3K2UA 2PWXA 3MH7A 3BV9B 1GJ5H 1SHHB 3I78A 5FX6A 2FI5E 1KSNA 1QRZA 1SGRE 4Q80A 1C5XB 1GMCG 2PGBB 1ABJH 3BSQA 5LPFA 1GBTA 1PYTD 3PB1E 2ZCLP 1IQGA 2ODYB 4B75A 1C5RA 1SOTA 2G52A 1OPHB 4RSPA 2D2DA 4MQAA 5EODA 3VB6A 5C1XA 1KYNA 4UFEH 1EKBB 4DT7B 5I46H 1C5LH 2XBXA 1P02A 2IN2A 3KL6A 4YT7H 2BDAA 3NZIA 2G55A 1GGDC 1UTQA 3GYMA 2GX4A 4X2XA 2BOKA 3KN2A 1GMCF 2ZKSA 1ETTH 6LPRA 1GBFA 5HM2A 2WYJA 2G51A 1UTNA 1ZR0A 4ZROA 1IQHA 1H9LB 3A8CA 3NK8A 1YP9A 3QK1A 3H7TA 4ISOA 1QA0A 3A82A 3Q3YA 5F03A 1W12U 3M3VA 1O2OA 3O8BA 1YPHC 1TOMH 1C1MA 1ZZZA 1ANCA 4ESTE 1EASA 4LOYH 3VXFH 3S0NA 5C3NA 1YPHE 4K60A 3DT0H 2A0QB 2IOTA 5T6GA 1W14U 3IITA 1BZXE 2OQUA 2VIQA 3SV7A 1CGHA 1AQ7A 1VZQH 2ALVA 3SW2B 1HAGE 1GI5A 1PPZA 2QF3A 3ITIA 3LGTA 1QJ1B 3MO3A 4ABJA 1G32B 3EDXB 1GHBF 3QDZB 5DP8A 1GMDF 3HPTB 3O8RA 1GJ7B 1ZLRA 1Z71A 3TJVA 1AHTH 1V2UT 2AMPA 1C2IA 1PJPA 4YM9A 1O35A 4UD9H 1SGDE 3GISB 3P8OA 1CO7E 3QO6A 1AVXA 2ZA5A 3AAUA 3UPEA 3VFEA 2FM2A 3UNRA 1TNJA 1XKBC 4J2YB 1O32A 1IAUA 3A7WA 1S6HA 1YC0A 1LMWB 1THPB 4I8GA 1G3BA 1MTVA 1FV9A 1ESAA 4OS5A 3BTGE 2J34A 1BITA 4R0IA 2ZHWH 4X8SH 1GI6A 4X2YA 5ETXA 1QURH 5FX5A 2P59A 1SG8B 1OWJA 1XVMA 3RXRA 1A3EH 4XBBA 1FAXA 1L1GA 2EI6A 1O2HA 4BXSA 1IQEA 2CV3A 3SGQE 1CQQA 4JYVH 4ZH8A 1LKAA 1CA8B 3ATWA 4NA7A 4YOGA 5EXMA 1ANDA 4MPUA 4D76A 1PQ7A 3HGNA 1YF4A 1O5EH 1BCUH 1UTJA 2AFQB 4NA8A 4WMFA 1BMAA 1B5GH 2FOBA 3ATIA 5L30H 2EI8A 3RXFA 1C2FA 2ZG0H 3RC6A 1Y3YA 1Z1IA 1MCVA 5FCRA 3RLYH 1BJUA 1O3CA 1GJ8B 2G81E 2P3TB 5DG6A 2BLOA 3FP8E 3VB5A 5FCKA 1RXPA 4OS2A 5JYIA 5IYTA 1YCPK 3EQ0H 3GY3A 2ZGCA 5L2YH 1O3PB 4ABBA 1O3EA 1Z8JB 2SGQE 4XBDA 1TRYA 3MI4A 3R0FA 3ZZ8A 1TONA 4IC6A 4AYYB 3E1XB 1C5WB 1TGTA 1ZSKA 2CXVA 3CENA 1P3CA 1NPMA 1FIWA 3OY5U 2ZGXH 2OUAA 3V7TA 1GI1A 1JOUB 1QGFA 1O3FA 3U8OH 4CH8B 1GHAG 2ZDKA 1AU8A 1P04A 1SQAA 3E0NB 5JPMH 1P2MA 5T3HA 1C2KA 3TH3H 1ELCA 1GHXH 1YPLH 2XYAA 4U32A 1DY8A 4AN7A 3SQEE 4ZKNU 4Q7ZA 2NU3E 3LONA 2ZU4A 2VIWA 1DLEA 2H9EH 1BTZA 2W7UA 4B1TA 4CR5A 2QXIA 4Y6DA 3I77A 2VIPA 4WXVA 2O8TA 1S83A 3SU2A 2Z9JA 1CT0E 3VB7A 2FOMB 3MO9A 1P05A 5TCAA 2ZNKH 1AIXH 3T27A 1C5NH 2A2QH 1G2MA 4Z6AH 2VGCB 4IN1A 1TRMA 1LHCH 1QBVH 2R3UA 3TGKE 1PQ5A 1K21H 1BBRK 3RXMA 2FODA 1TAWA 1TGCA 4OGXA 1A0HB 3HK3B 1DFPA 1UK4A 3BF6H 3LH1A 2ZFFH 1F5KU 3M5NA 1D6WA 2C4FH 4HGCA 1G37A 4CHAC 2PHBA 2UUJB 1T8OA 1YGCH 1KXAA 1GJDB 3PV4A 3HKIB 2BY6X 1ZHMA 2A31A 1CU1A 3DUXH 1H9IE 1GWAA 5AFYH 3RXQA 1TYNA 2W3KA 1EZUC 5FPSA 1A61H 1GDNA 1ELEE 1UHBA 1AFQB 1GBBA 1MAXA 1SMFE 3KGPA 1NTPA 3RXVA 4FVDA 1O2WA 2M5TA 1C5TA 2A4RA 1HB0B 2WYGA 3A83A 2ZDAH 2GZ8A 1GBDA 1EPTC 1N6XA 2ZGHA 3S7HB 1Y5AT 2R2MB 1PPBH 1LCYA 5EPYA 3TGJE 1THSH 3VGCB 2W5EA 4IMQA 2A4GA 5FBIA 1VCWA 3EA8A 5K7RA 1TPOA 2ZU5A 1HIAA 1EUFA 4Y79A 1NFYA 4AFQA 1JMOH 1OYQA 3ATKA 4Y10E 3RC4A 1QCPA 3P95A 1NFUA 3RXOA 4E7NA 1NN6A 5IDKA 2BD7A 5ESTE 3T29A 1C5VA 1GI9B 1AD8H 4NIXA 1QR3E 1TPAE 3M37A 4IGDA 8KME2 1QBNA 3LJJA 2VINA 2V6NA 4RKOB 2G8TA 1SGFG 4KTUA 4BTUB 4ZKSU 3SU1A 3QTVH 1S84A 2Z3EA 3MNCA 2PKAA 1KDQA 1S85A 1UVOA 3R3GB 5FHTA 1O3GA 2GMTB 3P17H 5C1YA 3SNEA 2ALPA 2FOGA 1O3OA 1C5YB 1AZZA 5HGGA 1GI7B 1F5RA 2FYQA 1KXCA 1ID5H 1TWXB 5F6MA 9LPRA 1YPJH 1WTHD 1TGNA 5DP6A 1BJVA 1GHZA 1VCQA 1EAXA 2GZ9A 3B9FH 1GI3A 3STJA 4JMYA 3L6PA 1FN8A 3ZZ9A 5DJ7A 4YT6H 3B8JA 1UJ1A 4FU9A 1BIOA 3LPRA 1IOEA 1RIWB 1KY9A 2OC8A 5DPAA 4Y8ZA 3RU4D 3BTME 4E06H 1G30B 2H9HA 2ILNA 3SNBA 2FS9A