1V2QT

Trypsin inhibitor in complex with bovine trypsin variant x(sswi)bt.b4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSWIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 47
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2qT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2qT02
1V3XA 4MVNA 4VGCB 1Z8GA 1ARCA 1VCQA 1KY9A 5F03A 2P16A 1GBCA 4XBDA 1DE7H 4RSPA 4YT6H 2XBVA 2AMPA 2O8LA 2VGCB 2OC7A 1FN6A 1BZXE 4X1RU 3OSYA 1O5DH 3D65E 3SJ8A 4CRAA 2R0LA 1AHTH 5DJ7A 1IQEA 1QJ1B 1VCWA 1O5FH 4R8TB 3SI3H 2FPZA 8LPRA 1UMAH 3OX7U 1ZJKA 4K1SA 5L2ZH 2ZDMA 1UHBB 8GCHF 1L0ZA 1O36A 1DDJA 4J1YA 5GXPA 3BF6H 1DSUA 3LGTA 3P8FA 1V2ST 1T8MA 4KGAA 2ZFFH 1LVOA 5EXLA 3PM3A 3MO9A 3A85A 2ZTYA 1O3FA 1S6FA 2FDAA 5FPSA 4ISOA 1K1OA 1EZXC 4Y7BA 2JKHA 1CVWH 1MBMA 2R3YA 4NA9H 2ZU4A 1NO9H 1A3BH 1BRBE 3A87A 3M5LA 1A61H 2YNBA 4AB9A 3T27A 2AMDA 1DWCH 3A7VA 1GI4A 3MFJA 1O3OA 2ZG0H 1O3NA 3B23B 2FX4A 2ZF0H 4OS6A 3RU4D 2ILNA 2G55A 3W94A 2XC0A 3I77A 2GX4A 1EP6A 1GJ5H 2GVFA 2PUXB 2EC9H 4OGXA 3FVFB 2ANKH 1KLJH 4FVDA 2ZDAH 1GCDA 1B0FA 4Y8YA 2HGTH 2XW9A 1T8OA 3QWCH 2BX4A 1TOCB 4ZAEA 2XWBI 1F0RA 4I8HA 2ZZUH 3F9EA 1GBFA 1L4DA 3MH6A 1EOLA 2A5AA 2Z9IA 1GMDG 1MTWA 3OTJE 2PSYA 3FP7E 2A32A 4DJZB 1BBRK 1EP5A 1AFEH 1S81A 1XM1A 3ZZ6A 1SSXA 2B7DH 2GKVE 3RXIA 1FMGA 1C5XB 2P3UB 4AG1A 2BD4A 1GBIA 4JZ1A 1ACBE 2ZECA 2BLOA 2FYQA 4INKA 1P2KA 3PWBA 3VB3A 1V2RT 4GPGA 1WYKA 4K3JA 1O30A 1BTZA 1LHFH 1P10A 1UK3A 1EX3A 3VGCB 4FU9A 1G3DA 1P9SA 3MO6A 1CGJE 1C5ZB 1A5IA 2FTMA 4WY3A 1VITH 3FFGA 1DVAH 3RXUA 3SUDA 3U1JB 4KKDA 2AFQB 5C3NA 2SGQE 1H9HE 1C2JA 5GDSH 2BQ7B 1K21H 4O03A 4D76A 1DPOA 3N7OA 4AB8A 1T8NA 3PTBA 2V3HH 3PO1B 2PKSB 2AEIH 2CN0H 4X6PA 1O2WA 3LC5A 2VWNA 1B7XB 5GIBA 1GGDB 3SUGA 4IN2A 4FUGA 3BIVH 4VGCC 1LMWB 2P59A 1V2TT 2IJOB 1V6DA 3RXVA 1T7CA 3CS7A 1FY8E 5L6NH 1YPKH 1WTHD 1QY6A 2KAIB 1WTGH 1WSSH 4ABIA 1GHAF 1NS3A 1QBNA 2H6MA 2VJ1A 1O3LA 2FOGA 1O37A 1YLDA 2ZIQH 2SGFE 5T6GA 3U8RH 1MBQA 1EJNA 1C5SA 3SU1A 3RLYH 2SGPE 3SJOA 3SHAH 1TNHA 2FEQH 1ZZZA 3UWIA 1T32A 1TBQH 1V2LT 1ZRKA 1NZQH 4HGCA 2PGQB 1XUIA 1QA0A 2FX6A 1A5HA 4YM9A 1DY8A 2GT7A 3HATH 1BHXF 1UVOA 1SLVB 1UVPA 1EUFA 1QCPA 4Y0YE 3ZZAA 3M5OA 7KMEH 1F2SE 1TNGA 2QCYA 5FPTA 3MU1A 3RXJA 3RXBA 2ZGHA 1K28D 3SNDA 1JBUH 1OXGA 4MQAA 1G37A 1NPMA 1C4Y2 4ESTE 5HGGA 1AWFH 1QURH 1ELTA 4NG9H 3RLWH 5DP6A 3O8RA 1KTSB 3RXPA 4A92A 1OWDA 2Z3EA 2QC2A 3SNAA 1G2LA 1DSTA 3SV8A 1QB6A 4OS1A 4X2WA 3QTOH 1FZZA 1ZTJA 4RKOB 1PPEE 1V2MT 3QX5H 1RGQA 4IMZA 4TWWA 2Z3DA 3NPSA 2JH5D 3VXFH 3UTUH 3K65B 1GJDB 1BUIA 4H42U 1QB1A 3RXCA 3TGIE 4B2AA 4Q7YA 1UTLM 1ESAA 1SGIB 4CH8B 5EPYA 1AIXH 1O0DH 4JZEH 1J16A 1YPJH 2OQUA 3LGIA 3SJIA 2GZ7A 3T26A 3T5FH 2ZDNA 3TGJE 3GISB 3I29A 1SQOA 1BMAA 5CHAB 1CHGA 1A2CH 2Q1JA 1NFXA 2GZ8A 1C1TA 1GHBG 2ZFTA 3E91A 2R2MB 2PV9B 1BDAA 4YOGA 1GWAA 4D7GA 2FP7B 4IN1A 3L33A 1ZOMA 4DOQA 3DUXH 3TK6A 1TNKA 3EYDA 2ESTE 2F9BH 2WYJA 3TGKE 3A88A 1YM0A 3NKKA 1GJ8B 1ARBA 1O33A 2K1QA 3A80A 3E6PH 2F3CE 3SQHE 1HJ8A 1C9TA 1RJXB 3VGCC 4UE7H 1YPHC 1ANEA 1P2JA 2ZEBA 1D6RA 1H1BA 1ZYOA 2TGTA 5FBIA 4A1VA 1GBHA 5CMXH 1GHWH 3E1XB 3ITIA 3MU8A 2JH0D 1DUEA 3PO1C 2J38A 2PKSC 3UR9A 1IQIA 1C2FA 3MH7A 2NWNA 5JBCS 1C5TA 1ORFA 3VB5A 3ESTA 1THSH 3S9AA 1O3BA 1UVTH 1GGDC 3ZZ9A 2BDGA 4AZ2B 2J92A 1C2EA 4X1NU 3PMHB 2FS9A 1FDPA 1EJAA 1YPGH 1EAIA 1O2SA 3MMGA 1P3CA 3S0NA 2GD4B 1UTPA 3ZVEA 1O2HA 1ELFA 1GHYH 2XCFA 4Y76A 5DPAA 1JIMA 1TPSA 3SU0A 5DG6A 4E05H 1QRXA 1DWDH 2CGAA 1PPBH 2WINI 2BY7X 1TPAE 1IOEA 1CA0B 2BXTH 2F91A 1C2DA 3DFLA 1EAWA 1DWBH 1S0QA 4BAQB 2HLCA 2BXUH 1YLCA 2Y80A 3SUFA 4YTAA 4AFUA 4MNYA 2FLBH 1FI8A 2PKAB 3TH2H 4WXIA 1F0SA 1QRWA 5JDUB 1THPB 3E90B 3H7TA 3SU4A 1J9CH 2RDLA 1GMCF 1LPGB 2ZNKH 3KL6A 2FZZA 3BTWE 3RM2H 3O8BA 2V0BA 2RA3A 5J4QA 4ZKOU 1IQMA 1FAKH 4JZIA 1GI7B 2OC8A 3A8BA 4MPVA 1C5LH 5EQQA 1LDTT 1ZJDA 1TAWA 3QZQA 2QA9E 1GHZA 1FY4A 1OKXA 3AASA 2ZHWH 4TPIZ 2DE9A 2EEKA 3NUMA 2GMTB 1BMLA 3M7TA 4MPXA 2G51A 1FLEE 1QRZA 3GYMA 1C5MD 3SGBE 4YOJA 2H9HA 1K2I1 1OWHA 1PPGE 1YPMH 2BDAA 4X6NA 2ZTXA 1SGFA 1GBAA 4BXSA 2ZFPH 1AKSB 4Q80A 3C27B 3MU5A 3AVZA 3P8NA 2J2UA 2CMYA 3LC3A 4X0WU 2ZU3A 1P9UA 1NN6A 4CRCA 2A5IA 2BMGB 2PUQH 2GDEH 3TJVA 1ZRBA 1FIZA 3NZIA 4NIXA 2CV3A 2HNTC 1TGSZ 1P0SH 1VITG 3EGKH 2A4RA 1HPGA 1CA8B 1LVBA 2IOTA 3ZVAA 1A0JA 1GI2A 2SGEE 4H4FA 4B73A 3ZZ4A 2ULLA 1E36B 1G32B 4Y71A 1LQDB 1TNLA 4K5ZA 2BLVA 2ZQ1A 2I6QA 5BRRE 1DY9A 2AGGX 1AMHA 1IQNA 1P3EA 4ZHAA 3U8TH 6GCHF 3NXPA 3RXRA 1G30B 2VIPA 1RRKA 2F9VA 4BANB 2FOAA 2SGDE 5GCHG 3RXOA 2EI7A 1LPKB 2ALVA 2W3IA 2P3FH 2DE8A 4RN6A 1P8VC 1NM6A 1CSOE 1SL3A 2A2XH 2W7UA 3KF2A 4Z0KA 7GCHF 3FP6E 5J4SA 2ZA5A 2QYIA 2PW8H 4U32A 1L1JA 4WMDA 1ESBA 1ETRH 4K1EA 1SI5H 2G4UA 2C8XB 4ABJA 3A82A 3O8CA 1ANDA 1KXDA 1NU7B 4NIYA 1GI5A 5ESTE 1EAXA 2ZGBH 4INLA 1CA0C 4FXGH 1EOJA 2XC5A 2BD7A 1H8IH 4NCYA 3QGJA 8ESTE 1SGDE 3T25A 2Z9JA 5A8YA 2G4TA 3URCA 3AAVA 5EW2H 2XC4A 3M7QA 4A6LA 5DGJA 4E06H 2ZCHP 2FODA 3UQOA 4AORA 1MD7A 1KDQA 2CF9H 5LGOA 3RXEA 4GHQA 3T2NA 2ZCKP 4BNRA 3S9CA 5E2PA 2CF8H 1SLWB 1C2LA 4HFPB 2ZGJA 1BRUP 2W5EA 3IITA 3H7OA 1BMNH 5FBEA 4X1PU 1C1SA 2O8WA 4BOHA 4F49A 2C8YB 4K8BA 5EQSA 4X8UH 1W2KH 4GSOA 1C2MA 5E0HA 2GMTC 3GY3A 1EB2A 4YLUA 5A0AE 4XBCA 2ANYA 3EAJA 5A0CA 1HGTH 4YO9A 3R3GB 4Y0ZE 4LK4A 2A7CA 3O8DA 2WPJS 1Y3VA 2QXHA 1GDQA 4AGJA 3BN9A 1TMBH 4OS7A 3UNQA 4Y8ZA 1LKBA 1V2UT 3GY7A 1Z6JH 4Y79A 4AN7A 2AH4X 1HJAB 1AD8H 1ESTA 2IPHA 1DLEA 3A84A 2VB0A 4WJG2 1OYTH 2VVCA 5ETXA 4XSKU 4LZ1H 2IN2A 4NIVA 1ELVA 1E37B 1DFPA 3U9AH 3M5NA 1FY3A 3HGPA 1W0YH 1HAHH 5EGMA 2SNVA 3A7XA 1QIXB 4Y8XA 1H9IE 3KQCA 1JRSA 1G9IE 5EOKA 3P70B 1TMTH 3G01A 4IGDA 4TPYA 3EQ0H 4ZKSU 3LPRA 3BIUH 1GJ4H 1DITH 2P8OB 1C5RA 5AFZH 2CXVA 3PMAB 2VIWA 1S0RA 4NWLA 4B2BA 2O9QA 4DURA 2R9PA 2GP9B 1YBWA 1FV9A 1LHDH 4ABGA 2BQ6B 3A7ZA 3GCTG 3RU4T 1A3EH 1TNJA 1ZPCA 1G36A 1AUJA 3TH4H 1ZTKA 2ZU2A 2J94A 3Q3YA 2UWPA 2XYAA 4KP0A 5K7RA 5PTPA 1TRMA 4JK5A 1MZDA 1GMDF 5IYTA 1TFXA 3SJKA 5H4IB 5F8ZA 5GJ4B 1IQKA 1VCPA 1C2KA 9ESTA 1TALA 2NU2E 4UD9H 1Q2WA 1BIOA 3BTFE 1H8DH 3LJJA 2BVSH 3PMJA 3A7YA 4U01A 1W0ZU 5EODA 4LOYH 5DP3A 4Y7AA 3RMOH 4Y6DA 2HPPH 5CE1A 1HIAB 1HAZB 3UIRA 1KXEA 1O2YA 4NZLA 3C1KA 1TX6A 3HK3B 1O2MA 4MTBA 4X6OA 2A1DB 2H2ZA 4Y10E 1J14A 1C5WB 4GHTA 2AIQA 4U2WA 3LGVA 1MQ5A 1O2ZA 3SHCH 2RCEA 4NFFA 3SV7A 1O31A 3PWCA 3KGPA 1VZQH 4K2YA 4X2XA 3RXFA 5EG4A 1YKTA 3U8OH 4WMFA 2YOLA 3DHKH 3U98H 4UONA 3MNBA 4UFFH 1RD3B 2ODPA 3ZV9A 2HNTF 2SNWA 2ZGXH 4ISIH 1IQJA 3ZZ7A 1F0UA 5JB8S 3SU2A 1T4VH 3ATLA 1GMHG 3E8LA 2F9OA 4K1TA 3DFJA 1N6YA 2Y82A 1F7ZA 3B8JA 1VGCB 2ZTZA 3LONA 3Q3KA 1QGFA 3SOSA 4MDSA 1NFWA 3IG6B 3FANA 3P6ZB 4AFQA 5C2ZA 3V7TA 4ABHA 3V12A 5B6OA 1FONA 1LHEH 1ELGA 3VEQB 1O2VA 1TNIA 4UEHH 1K1LA 1H9LB 2J9NA 4FUEA 3MHWU 1HXEH 4I8KA 3A83A 1EPTB 1K1NA 1TX8A 2SFAA 2ZFSA 3ENSB 1DOJA 4THNH 3CENA 1GDNA 1LVYA 3TJOA 2OCVB 4AYVB 1HJAC 1PYTC 1SGYE 1Y3XA 4D7FA 1VJ9U 1WOFA 2A4OA 2VGCC 4JMYA 1OWIA 2QGRA 2ZWLH 2OC0A 3SO3A 1TQ7B 1MD8A 4B74A 1C4U2 1PQ7A 4JZFH 1W11U 5L30H 2XXLA 3LGUA 1UK4A 4OGYA 2XBXA 4I32A 2FOFA 2O8MA 1FY5A 2ZFQH 3R0FA 1ZMNA 4U30A 2AMQA 1Q31A 1F0TA 1O3DA 1UTKA 2FS8A 3M7UA 5C1XA 3BTDE 1QFKH 2P8OC 3NCLA 1QTFA 1BTYA 3BTKE 2QXGA 4CBNA 1LHGH 4ZXXH 2A4GA 2FI5E 3Q00A 4BAOB 2GCHG 1PPFE 1C2HA 4WH6A 1WUNH 1FQ3A 2A7JA 5FX6A 1D3TB 1NRNH 1GI1A 2WPKS 3SI4H 1BMMH 2HPQH 1RFNA 2BDBA 4FUBA 2J4IA 3UFAA 2BD3A 1AE8H 1GHBF 5A8ZA 2R3UA 3SU3A 2ZC9H 2BVRH 1TA6A 5FXLA 3RDZA 4ABFA 4DIIH 1BTUA 1TBRH 1GHVH 2GCTB 3ZVFA 1C5OH 1HAYB 1TYNA 1AFQB 2B0FA 2ZDLA 4IC5A 1DXWA 2PKAA 3E3TA 1P57B 3FP8E 4AFSA 4UFEH 1O5AB 3QTVH 1HAVA 1CT4E 1UTOA 4I7YH 4B1TA 2ODQA 3TPIZ 1GPZA 1GJ7B 1O39A 1O3KA 3EA7A 3GDVA 1MH0A 1TPOA 3T28A 3NK8A 1GVLA 1UVSH 5DKMA 4UFGH 2H5CA 9LPRA 3BTEE 3SU5A 1TRYA 1DANH 2AGIX 4M7GA 1C2GA 1C5PA 3A89A 3ATWA 1C5YB 1DWEH 3A8CA 2G52A 2FTLE 4ZKNU 3MU4A 1Z7KA 1S85A 4BAMB 2ZHDA 3ZVGA 2BLQA 2BY8X 3PLBA 6CHAB 4UDWH 1RTFB 5A2MH 2HOBA 3EA8A 4OS2A 2HALA 2JH6D 1HCGA 1RTLA 1D6WA 4ISHH 3OYPA 4XE4A 1TIOA 1VGCC 4OS4A 4HI3A 2NU4E 3SBKA 1UCYE 4AOQA 1CGHA 1DXPA 1SG8B 3T29A 1V2OT 1YYY1 4ZH8A 1HXFH 1ZGIA 2BQWB 2ZU1A 2G00A 1SVPA 1AKSA 1O3EA 5DP4A 5AF9H 1A7SA 3S69A 2A7HA 3DD2H 4B71A 1P2OA 2AS9A 4E7NA 1OSSA 5IDKA 2BY9X 2OLGA 3UR6A 3EA9A 3BTME 3V0XA 1Y3UA 1EPTC 1RIWB 7LPRA 2CHAB 2WPIS 5FHTA 1OP2A 1KIGH 4GAWA 2BY6X 2ZKSA 3RXKA 4FUCA 3UOUA 2C93B 1XUGA 1GCTB 3UNRA 5C1UA 2BYAX 2C90B 2PTNA 4R0IA 5EQRA 1SGEE 1S83A 1MTUA 2QAAA 3MO3A 3RXAA 1K1JA 2DUCA 4CHAB 2PGBB 1ZMJA 4A7IB 3LT3A 2PR3A 3ODFA 1O3IA 3MOCA 1T31A 2BVXH 3PB1E 2A45B 1P2NA 2BX3A 1P02A 1XXFA 1TONA 3CS0A 3ZZ3A 4X2YA 1HDTH 1HAIH 1WU1A 1UTQA 1ELCA 4NWKA 4FUIA 3MNCA 3S7KB 3M3VA 1CGIE 2FMJA 1AO5A 1ID5H 3SW2B 3F68H 2HWLB 5HM9A 1XX9A 5HM2A 2WV5A 1GI6A 2OD3B 2QY0B 1Z71A 3F6UH 2XWAA 1HAXB 1MU8B 4JYVH 3KHVA 2BTCE 4ZHLU 1U6QA 1KLTA 1IHTH 1CT0E 1BCUH 4F4OC 1MAYA 1SGPE 2BB4A 1C9PA 2BDCA 2VNTA 5JBBS 1AVXA 1SBWA 1OYQA 3QGNB 3DA9B 3STIA 1AVGH 1NY22 2Z9KA 1UCYH 2HRVA 1HAGE 1LKAA 2F9PA 2NU1E 3M3SA 1EKBB 1EZUC 3DT0H 3HKJB 3UWJH 1TRNA 2QXIA 1SQAA 1TE0A 1P03A 4BAHB 1CE5A 3V3MA 4X6MA 1UJ1A 1HV7A 1VITF 1BQYA 3ZZ5A 1O2XA 3GCNA 2GCTC 1XXDA 1O38A 1SGCA 3P17H 1AI8H 5CHAC 3SZNA 1AFQC 2UUFB 2AYWA 1NFYA 1W14U 1HAPH 5E0JA 1SGFG 4HTCH 3PLKA 4Q2KA 3RU4E 1V2KT 3TIUA 3MI4A 1S82A 4FUDA 1K22H 1MCTA 4CRGA 1IQLA 2ZHQH 4CBOA 4BXWA 4H6SB 3TNTA 1AZZA 1MTVA 1C1NA 3MNXA 2WYGA 1GHXH 2ZO3H 2ZHEH 3BTTE 1O3CA 3Q77A 3VB7A 1EJMA 2J34A 1WBGB 4X8TH 1GBKA 1KXBA 1MTSA 1WV7H 3MWIU 4AX9H 3ZVDA 3CP7A 1A4WH 1Z8JB 2G5NA 2XCNA 3QZRA 2TRMA 5GCHF 1NRPH 5JBTA 4BTUB 3MNSA 2OP9A 2FO9A 1C1QA 1EASA 1TMUH 4NA7A 3Q3XA 6CHAC 1VR1H 1M9UA 3TK9A 4KTSA 6LPRA 2ZPSA 1AQ7A 2ASUB 5JPMH 1MTNB 1BJUA 1IQGA 2C8ZB 2PWXA 1O5BB 1O32A 2FI3E 3LH3A 5DP8A 1ELDE 3GDSA 3HKIB 4ISNA 3STJA 2QF3A 1V2QT 5T3HA 3LKWA 5K0HA 1C1VH 2ANMH 3GCOA 1XKAC 2VIQA 1ZMLA 1RIWC 4KELA 4CRBA 1AUTC 5HMAA 2CHAC 4YLQH 5GWZA 1G3BA 4ZHMU 1SLUB 4D9RA 3BTGE 1GCTC 1XUJA 1LQEA 1G2MA 2GZ9A 2Y5HA 1TX7A 2BY5X 1D9IA 1O3JA 2D26C 1P2QA 5DP9A 4CHAC 5LPFA 1P09A 4ABBA 3EE0B 1DM4B 1UHBA 3QUMP 1UCYK 1ZTLA 2Y7XA 1HBTH 1Y5BT 1ZGVA 2FXRA 4HZHA 1C1UH 1ZHRA 2VWOA 1AN1E 1GBJA 5L2YH 2PFEA 4NA8A 1SPJA 4DVAU 5C5NA 3UY9A 4X8SH 4D8NA 3LIWA 4CREA 2BLWA 2VIOA 3I78A 4INHA 1O5EH 1BTHH 5F8XA 1HNEE 2SGAA 3E0PB 3M61U 2FYRA 1OS8A 4ABAA 2FOCA 1C1PA 4TY6A 2Q6DA 1OP8A 4WF8A 3QLPH 3RXQA 3TH3H 4E7RG 1WAYB 1ELBA 1TOMH 3L6PA 1GDUA 3K6ZA 4D9QA 1UTJA 3M5MA 1UTNA 2H1UA 1Y3YA 1SFQB 2VWMA 1NESE 2D1JA 1V2JT 4A5TS 3ELAH 1XUFA 3SGAE 2BOHB 2XNIA 1SFIA 1ANCA 3SV2H 3ZZ8A 1QA7A 1F5LA 1E35B 3AAUA 3OU0A 4GCHG 1AB9B 1Y5UT 2XBYA 4AGKA 1TABE 1QB9A 1J8AA 1ETTH 1L2EA 3GOVB 3GY2A 5ESBA 3UOPA 1BTXA 7ESTE 3W95A 5ABWA 3KCGH 3LJOA 3S7HB 4O9VA 1QR3E 2BZ6H 5E8EH 2O8UA 5TJXA 2Z3CA 1KXFA 3P8OA 3QK1A 3ZZBA 2ZPQA 1H4WA 1ZSKA 1O3AA 1P05A 4WXVA 1P01A 2Y6TA 1W12U 3GCTF 1O3GA 1O2OA 5C1YA 2HVXA 3K2UA 3JZ1B 5FAHA 4FU8A 2BD9A 3BG4B 5HXFA 4ZUHA 4NZQA 4WVPE 4DW2U 1N6XA 1X7AC 1AWHB 1N8OB 2VVVA 2PSXA 3PLPA 1THRH 2FIRH 5E0GA 1YGCH 1CO7E 1PQAA 2P94A 2VINA 1CHOG 2EA3A 4Q7ZA 4MPWA 5G4BA 1MTNC 1O3MA 1XUHA 1EPTA 2YNAA 1PPHE 3GCHB 2FWWA 1MQ6A 3M3TA 1O2LA 1LO6A 1QL9A 1GJ9B 3ATMA 3SN8A 1NRSH 1SGTA 3RM0H 3GY5A 2R0KA 1YPEH 2KAIA 2OXSA 2G5VA 2UUJB 1SGQE 2C3SA 2QIQA 3RXLA 2Y7ZA 4NSYA 5GPIB 3RMMH 2BOKA 2QF0A 1PJPA 4LXBH 3BTHE 3NWUA 4WH8A 1XKBC 2NU0E 3GICB 1ABIH 2STAE 1KDQB 2ZI2H 2TGDA 1O5CB 3KQEA 3TITA 2O8TA 1F92A 1C5VA 8GCHG 3MYWA 4DY7B 1TB6H 5TCCA 3KN2A 3F9GA 1NFUA 5AFYH 3UNSA 1C5NH 3HPTB 1Z1IA 1FJSA 4K69A 1LCYA 1GMHF 4CR9A 3ATKA 1O2NA 1PQ8A 3F9HA 3F1SB 1ZPBA 1P11E 1GBBA 1Q3XA 2QN5T 1ZPZA 2PHBA 2V35A 4H6TA 3TNSA 1XUKA 2A0QB 4YZUA 2VIDA 2VVUA 4BTIB 2R2WU 1TBZH 2FOEA 4XOJA 5F8TA 4XBBA 3ZZCA 3A8DA 5E2OA 2JETB 1DS2E 2UUKB 3ZYDA 1FXYA 2FLRH 5FPYA 2C4FH 1F5KU 1HJ9A 2OTVA 3KIDU 1DT2A 1V2NT 2TBSA 1P04A 4DG4A 2VWLA 3MTYA 3TJNA 2Z9GA 4IMQA 4K60A 1GI8B 2BDIA 2WUCA 2GTBA 4A1TA 1QL7A 1AE5A 1UO6A 1O3HA 1FN8A 3VB4A 1GBTA 3FZDA 2ALPA 4UFDH 4YOIA 3SV9A 4B2CA 1T4UH 2LPRA 3OY5U 1FUJA 2ZQ2A 1AB9C 1E38B 4ZKRU 1TQ0B 1GL0E 1FNIA 3RXMA 4CRFA 2J95A 3UUZA 5JYIA 4ZXYH 2ODYB 5TCAA 3LU9B 3EDXB 4NSVA 1O2RA 3SJ9A 3RC6A 3V13A 1P12E 1GI3A 2A31A 4FUHA 1LTOA 4AYYB 2AERH 3VFEA 3RXGA 1ETSH 1EB1H 1P2MA 1LPZB 2A4QA 3A7TA 3SU6A 3PMBB 1C5QA 1AY6H 1QL8A 1IHSH 1TWXB 2CJIA 3D62A 2GCHF 3K6YA 1BTPA 4JYUH 2Z6BD 3BTQE 1PPCE 1ZHPA 3LH1A 1ANBA 1Y8TA 3RC5A 1UK2A 3BG4C 1OWEA 4I33A 5I25A 1YP9A 2LNCA 1N8OC 2OINA 2XRCA 2P3TB 5T6FA 5FCKA 3HGNA 1L1GA 4O3TA 1DUAA 3ZZDA 1CU1A 3GY6A 3MU0A 3RXTA 5LPRA 1D3QB 2C8WB 3RXDA 4ABDA 2XBWA 1SLXB 1QHRB 4ASHA 1BA8B 2P93A 2VIVA 2GV6A 4FVBA 1GJ6A 3D23A 3P95A 1MCVA 3GCHC 2BDYA 1V2VT 4XDEA 1QQ4A 1YPHE 1SGNE 2NU3E 4MLFB 3RXSA 1GHAG 2BZAA 1O2GH 1WQSA 4MNXA 3H5CB 4I31A 1D3DB 1K1PA 4BAKB 2GV7A 1JIRA 2BD8A 1GVZA 3MH4A 2B8OH 2ZDKA 5AHGH 1OX1A 4KTCA 1P06A 1OWKA 2VH0A 5EXMA 4CR5A 2UUYA 1JOUB 3U69H 1HRTH 1BRAA 1A0HB 2GGVB 2H9EH 1YC0A 1SC8U 1EATA 1C1WH 1JWTA 4I8GA 3RP2A 1SGRE 1HUTH 1ZR0A 1IAUA 4NGAH 1HFDA 4KTUA 1CBWB 1YF4A 1O2UA 5EU8A 3RXHA 2BD5A 3ZV8A 4IW4E 4XFQA 4FUJA 2ZP0H 2VU8E 5JBAS 1GI0A 1GVKB 2STBE 1P2IA 1YCPH 1TPPA 5FCRA 1T8LA 1TGNA 4DIHH 1NRQH 2JETC 1C1RA 1Y5AT 1SHHB 5DP7A 3RMNH 6ESTA 2ZGCA 2THFB 4PROA 1SOZA 1S6HA 3KEEA 4OS5A 3A7WA 3KQDA 1KTTB 3BSQA 4X1QU 3RC4A 1L4ZA 3E16B 2FOHA 3PROA 1QQUA 2Z9LA 1BOQA 1O2PA 2OUAA 2TGAA 1HYLA 2VH6A 1EZQA 1TGCA 1W13U 1AVWA 3D49H 1O2QA 1BRCE 4I8LA 2D8WA 1C2IA 2Y5GA 1AGJA 2F9NA 4MPUA 1HB0B 3RMLH 1QJ6B 1WCZA 5EPNA 1ZHMA 3BEIB 1PYTD 2D2DA 2PLXA 3A81A 3SORA 3PV4A 4K8YA 2ZDVH 3ZVBA 5C67A 3K9XB 2P95A 1JMOH 3VPKA 3LOXA 5BPEA 4JYTA 1IQFA 3M35A 5DP5A 1GBLA 1V2PT 1PQ5A 2FOBA 4GLYA 1A5GH 5AVDA 3VXEH 1DX5M 4ZROA 4B76A 1GJBB 1QBVH 2AIPA 3QN7A 1W10U 2W7SA 3E0NB 1KYNA 5C20A 4JZDH 2FESH 2GDDA 4Q7XA 4SGAE 1V2WT 4CH2B 1W7XH 1RS0A 2F9UA 3B9FH 4WMEA 1E0FD 1KSNA 1GJCB 1B5GH 2HNTE 1EXFA 3P8GA 3UPEA 2RA0A 1GG6B 2B9LA 3GY4A 1NT1A 4DCDA 1BHXB 2I6SA 3BEFB 3WY8A 2PTCE 4I8JA 4NFEA 2Y5FA 3ZVCA 2BHGA 1TGTA 4AFZA 3LDXH 3URDA 4ZMAH 1ELEE 1Y3WA 1TGBA 1W3CA 3SV6A 1SB1H 4IBLH 1Z1JA 2RG3A 4YT7H 3BV9B 5JB9S 3TJUA 1O5GH 1HAVB 3ZYEA 1XMNB 4GUXA 1PFXC 1YCPK 1MMJN 3U1IB 4A1XA 2Q6GA 1GI9B 1FY1A 1O2TA 1DICA 1J15A 1DLKB 1CQQA 3A86A 2Z7FE 5LH8A 1QBOA 1S84A 1W8BH 4X2VA 4YESB 1TA2A 3GYLB 4GVUA 1D3PB 1WQVH 1FAXA 3LGYA 4JK6A 4BTTB 1EZSC 1C4V2 3S9BA 3GY8A 3M36A 3TU7H 4NIWA 4Y11E 1HLTH 5HYOA 1MKXH 1MKWH 4X1SU 3UREA 2QXJA 1GMCG 1RTKA 4RKJB 1K9OE 1NTPA 1CBWC 2H5DA 1N1LA 1IQHA 5EXNA 1FPCH 5I46H 2EI8A 3KQBA 1Z8RA 1QNJA 2TIOA 2W3KA 4TY7A 2A5KA 1RXPA 5EW1H 1GJAB 2FI4E 2Y81A 3T62A 4SGBE 3TVJB 5FX5A 1C5UA 1A46H 2ZU5A 3A8AA 1XVMA 1XVOA 4ABEA 1ZSLA 1A0LA 1O2KA 1MAXA 1O2IA 3LGWA 3KNXA 3VB6A 4O3UA 1ABJH 1AZ8A 4MG3A 1LHCH 1PPZA 2G81E 2UWOA 1O2JA 1YPLH 3BEUA 4IS5A 4O97A 3JZ2B 1MZAA 2H9TH 1C1MA 1G3CA 1YCPM 3ATIA 3SNEA 4J2YB 1J17T 2WPLS 2WPMS 4CRDA 2FM2A 1ELAA 2Q6FA 1FPHH 4Z6AH 3SGQE 1LVMA 1AU8A 3TLOA 3SNCA 1JXPA 3Q76A 1BITA 1W7GH 2FOMB 1BTWA 2ZCLP 3SUEA 1OPHB 1EQ9A 1G3EA 1TLDA 4WWYA 5SGAE 4X8VH 2ZPRA 4IC6A 3P92A 2BDHA 5A8XA 1SQTA 2UWLA 1QJ7B 3MH5A 1O34A 8KME2 1EAUA 1K1MA 3FZZA 1A1RA 2F83A 2WPHS 2BM2A 1D4PB 1BBRE 1BB0B 2OBQA 2QV1A 2ZFRH 2ZHFH 2TGPZ 1CT2E 1JRTA 1INCA 3RUOA 2V3OH 1E34B 2OQ5A 2XTTB 4FU7A 3HK6B 5A0BA 1L1NA 1Y59T 1NC6A 5DK1A 1GBMA 1NROH 4MNWA 4LZ4B 4TYDA 4DGJA 6GCHG 3TK5A 5A09A 1KXCA 2ANWA 4FUFA 3F9FA 3L3TA 1GG6C 1OWJA 2G8TA 5DO4H 2OBOA 3QO6A 3OY6U 5LPEA 1BT7A 1KXAA 1MUEB 3QDZB 1MKXK 4GCHF 1MKWK 3AW1A 2WV4A 5C5OA 1C1OA 3PTNA 3M37A 1SR5C 7GCHG 3PYHA 4TWYA 3IWMA 4QT8C 3SNBA 2BD2A 2TPIZ 1MU6B 1F5RA 1VJAU 1OP0A 5T6DA 1HAOH 4DT7B 1NRRH 1NU9A 3AW0A 2OC1A 3UQVA 1HIAA 2A2QH 1KLIH 2M5TA 1B0EA 2Z94A 2WUBA 4ISLA 3SQEE 2V6NA 1O35A 3BG8A 3FAOA 1GL1A 1Z8IB 5F6MA 1FIWA 1SMFE 4MNVA 4B75A 1Z6EA 2EI6A 1O3PB 4AG2A 4JCNA 3ODDA 1UVUH 1UTMA 1CHOF 1S5SA 1BBRH 1SOTA 3GDUA 1GBEA 2AGEX 1K1IA 1SHYA 2W26A 2GT8A 1ZSJA 2B5TB 1BJVA 1ZLRA 1GBDA 1OOKB
chains in the Genus database with same CATH superfamily
1V3XA 4MVNA 4VGCB 1Z8GA 1ARCA 1VCQA 1KY9A 5F03A 2P16A 1GBCA 4XBDA 1DE7H 4RSPA 4YT6H 2XBVA 2AMPA 2O8LA 2VGCB 2OC7A 1FN6A 3CNRA 1BZXE 4X1RU 3OSYA 1O5DH 3D65E 3SJ8A 4CRAA 2R0LA 1AHTH 5DJ7A 1IQEA 3OEHD 1QJ1B 1VCWA 1O5FH 4R8TB 1WDIA 2FPZA 3SI3H 8LPRA 1UMAH 3OX7U 1ZJKA 4K1SA 5L2ZH 2ZDMA 1UHBB 3UAIC 1L0ZA 1O36A 8GCHF 1DDJA 4J1YA 5GXPA 3BF6H 1DSUA 4TSFD 1COWD 3LGTA 3P8FA 1V2ST 1T8MA 4KGAA 2ZFFH 1LVOA 5EXLA 3PM3A 3MO9A 3A85A 2ZTYA 1O3FA 1S6FA 2FDAA 5FPSA 4ISOA 1K1OA 1EZXC 4Y7BA 2JKHA 1CVWH 1MBMA 2KM0A 2R3YA 4NA9H 2ZU4A 1NO9H 1A3BH 1BRBE 3A87A 3M5LA 1A61H 5CHBA 3WWFA 2YNBA 4AB9A 3T27A 2AMDA 1DWCH 3A7VA 1GI4A 3MFJA 1O3OA 2ZG0H 1O3NA 3B23B 2FX4A 2ZF0H 4OS6A 3RU4D 2ILNA 2G55A 3W94A 2XC0A 3I77A 2GX4A 1EP6A 1GJ5H 4P00A 2GVFA 2PUXB 2EC9H 4OGXA 3FVFB 2ANKH 1KLJH 4FVDA 2ZDAH 1GCDA 1B0FA 4Y8YA 2HGTH 2XW9A 1T8OA 3QWCH 2BX4A 1TOCB 4ZAEA 2XWBI 1F0RA 4I8HA 2ZZUH 3F9EA 1GBFA 1L4DA 3MH6A 1EOLA 2A5AA 2Z9IA 1GMDG 1MTWA 3OTJE 2PSYA 3FP7E 2A32A 4DJZB 1BBRK 1EP5A 1AFEH 1S81A 1XM1A 3ZZ6A 1SSXA 2B7DH 2GKVE 3RXIA 1FMGA 1C5XB 2P3UB 4AG1A 2BD4A 1GBIA 4JZ1A 1ACBE 2ZECA 2BLOA 3OAAD 2FYQA 4INKA 1P2KA 3PWBA 3VB3A 1V2RT 4GPGA 1WYKA 4K3JA 1O30A 1BTZA 1LHFH 1P10A 1UK3A 1EX3A 3DSOA 3VGCB 4FU9A 1G3DA 1P9SA 3MO6A 1CGJE 1C5ZB 1H8ED 1A5IA 2FTMA 4WY3A 1VITH 3FFGA 3OTPA 1DVAH 3RXUA 3SUDA 3U1JB 4KKDA 2AFQB 5C3NA 2SGQE 1H9HE 1C2JA 5GDSH 2BQ7B 1K21H 4O03A 4D76A 1DPOA 3N7OA 4AB8A 1T8NA 3PTBA 2V3HH 3PO1B 2AEIH 2PKSB 4DT4A 2CN0H 4X6PA 1O2WA 3LC5A 4I86A 2VWNA 3N7DA 1B7XB 5GIBA 1GGDB 3SUGA 4IN2A 4FUGA 3BIVH 4VGCC 1LMWB 2P59A 1V2TT 2IJOB 1V6DA 3RXVA 2K8IA 1T7CA 3CS7A 1FY8E 5L6NH 1YPKH 1WTHD 1QY6A 2KAIB 1WTGH 1WSSH 4ACAA 4ABIA 1GHAF 1NS3A 1QBNA 2H6MA 2VJ1A 1O3LA 2FOGA 1O37A 1YLDA 2ZIQH 2SGFE 5T6GA 3U8RH 1MBQA 1EJNA 1C5SA 3SU1A 3RLYH 2SGPE 3SJOA 3SHAH 1TNHA 2FEQH 1ZZZA 3UWIA 1T32A 2JJ1D 1TBQH 1V2LT 1ZRKA 1NZQH 4HGCA 2PGQB 1XUIA 1QA0A 2FX6A 1A5HA 4YM9A 1DY8A 2GT7A 3HATH 1BHXF 1UVOA 1SLVB 1UVPA 1EUFA 1QCPA 4Y0YE 3ZZAA 3M5OA 7KMEH 1F2SE 1KMHB 1TNGA 2QCYA 5FPTA 3MU1A 3RXJA 3RXBA 2ZGHA 1K28D 3SNDA 1JBUH 1OXGA 4MQAA 1G37A 1NPMA 1C4Y2 4ESTE 3PV2A 5FL7D 5HGGA 1AWFH 1QURH 1ELTA 4NG9H 3RLWH 5DP6A 3O8RA 1KTSB 3RXPA 4A92A 1OWDA 2Z3EA 2QC2A 3SNAA 1G2LA 5KECA 1DSTA 3SV8A 1QB6A 4OS1A 3WW7A 4X2WA 3QTOH 1FZZA 1ZTJA 4RKOB 2KFWA 1PPEE 1V2MT 3QX5H 1RGQA 4IMZA 4TWWA 2Z3DA 3NPSA 2JH5D 4ACBA 3VXFH 5KGOA 3UTUH 3K65B 1GJDB 1BUIA 4H42U 1QB1A 3RXCA 3TGIE 4B2AA 4Q7YA 4RT1A 1UTLM 1ESAA 1SGIB 4CH8B 2M2AA 5EPYA 3PRDA 1AIXH 1O0DH 4JZEH 1J16A 1YPJH 2OQUA 3LGIA 3SJIA 2GZ7A 3T26A 3T5FH 2ZDNA 3TGJE 3GISB 3I29A 1SQOA 1BMAA 5CHAB 1CHGA 1A2CH 2Q1JA 1NFXA 2GZ8A 1C1TA 1GHBG 2ZFTA 3E91A 2R2MB 3UB0A 2PV9B 1BDAA 4YOGA 1GWAA 4D7GA 4HG6A 2FP7B 4IN1A 3L33A 1ZOMA 4DOQA 3DUXH 3TK6A 1TNKA 3EYDA 2ESTE 2F9BH 2WYJA 3TGKE 3A88A 1YM0A 3NKKA 1GJ8B 1ARBA 1O33A 2K1QA 3A80A 3E6PH 2F3CE 3SQHE 1HJ8A 1C9TA 1RJXB 3VGCC 4UE7H 1YPHC 1ANEA 1P2JA 2ZEBA 1D6RA 1H1BA 1ZYOA 2TGTA 5FBIA 4A1VA 1GBHA 5CMXH 1GHWH 3E1XB 3ITIA 3MU8A 5HIZA 2JH0D 1DUEA 3PO1C 2J38A 2PKSC 3UR9A 1IQIA 1C2FA 3MH7A 2NWNA 5JBCS 1C5TA 1ORFA 3VB5A 3ESTA 1THSH 3S9AA 1O3BA 1UVTH 1GGDC 3ZZ9A 1WXRA 2BDGA 4AZ2B 2J92A 1C2EA 4X1NU 2JDID 3PMHB 5C17A 2FS9A 3F2FA 1FDPA 1EJAA 1YPGH 1EAIA 1O2SA 3MMGA 3W1EA 1P3CA 3S0NA 2GD4B 1UTPA 3ZVEA 1O2HA 1ELFA 1GHYH 2XCFA 4Y76A 5DPAA 1JIMA 1TPSA 3SU0A 5DG6A 4E05H 1QRXA 1DWDH 2CGAA 1PPBH 5EIYA 1W0JD 2WINI 2BY7X 1TPAE 1IOEA 1CA0B 2BXTH 2F91A 1C2DA 3DFLA 1EAWA 1DWBH 1S0QA 4BAQB 2HLCA 2BXUH 1YLCA 2Y80A 3SUFA 4YTAA 4AFUA 4MNYA 2FLBH 2IPQX 1FI8A 2PKAB 3TH2H 4WXIA 1F0SA 1QRWA 5JDUB 1THPB 3E90B 3H7TA 3SU4A 1J9CH 2RDLA 1GMCF 1MABB 1LPGB 2ZNKH 3KL6A 2FZZA 3BTWE 4Q4LA 3RM2H 3O8BA 2V0BA 2RA3A 5J4QA 4ZKOU 1IQMA 1FAKH 3H09A 4JZIA 1GI7B 2OC8A 3A8BA 4MPVA 1C5LH 5EQQA 1LDTT 1ZJDA 1TAWA 3QZQA 2QA9E 1GHZA 1FY4A 1OKXA 3AASA 2ZHWH 4TPIZ 3WWBA 2DE9A 2EEKA 3NUMA 2GMTB 1BMLA 3M7TA 4MPXA 2G51A 1FLEE 1QRZA 3GYMA 1C5MD 3SGBE 4YOJA 2H9HA 1K2I1 1OWHA 1PPGE 1YPMH 2BDAA 4X6NA 2ZTXA 1SGFA 1GBAA 4BXSA 2ZFPH 1AKSB 4Q80A 3C27B 2WV9A 3MU5A 3AVZA 3P8NA 2J2UA 2CMYA 3LC3A 4X0WU 2ZU3A 1P9UA 1NN6A 4CRCA 2A5IA 2BMGB 2PUQH 2GDEH 3TJVA 1ZRBA 1FIZA 3U28C 3NZIA 4NIXA 2CV3A 2VBCA 2HNTC 1TGSZ 1P0SH 1VITG 3EGKH 2A4RA 1HPGA 1CA8B 1LVBA 2IOTA 3ZVAA 1A0JA 1GI2A 2SGEE 4H4FA 4B73A 3ZZ4A 2ULLA 2V7QD 1E36B 1G32B 4Y71A 1LQDB 1TNLA 4K5ZA 2BLVA 2ZQ1A 2I6QA 5BRRE 1DY9A 2AGGX 3PRBA 1AMHA 4XD7D 1IQNA 1P3EA 4ZHAA 3U8TH 6GCHF 3NXPA 3RXRA 1G30B 2VIPA 1RRKA 2F9VA 4BANB 2FOAA 2SGDE 5GCHG 3RXOA 2EI7A 1LPKB 2ALVA 2W3IA 2P3FH 2DE8A 4RN6A 1P8VC 1NM6A 4XRNA 1CSOE 1SL3A 2A2XH 2W7UA 3KF2A 4Z0KA 5GNDA 7GCHF 3FP6E 5J4SA 2ZA5A 2QYIA 2PW8H 4U32A 1L1JA 4WMDA 1ESBA 1ETRH 4K1EA 1SI5H 2G4UA 2C8XB 4ABJA 3A82A 3O8CA 1ANDA 1KXDA 1NU7B 4NIYA 1GI5A 5ESTE 1EAXA 2ZGBH 2XNDD 4INLA 1CA0C 4FXGH 5B6LA 1EOJA 2XC5A 2BD7A 1H8IH 4NCYA 3QGJA 8ESTE 1SGDE 3T25A 2Z9JA 5A8YA 2G4TA 3URCA 3AAVA 5EW2H 2XC4A 3M7QA 4A6LA 5DGJA 4E06H 2ZCHP 2FODA 3UQOA 4AORA 1MD7A 1KDQA 2CF9H 5LGOA 3RXEA 4GHQA 3T2NA 2ZCKP 4BNRA 3S9CA 5E2PA 2CF8H 1SLWB 1C2LA 4HFPB 2ZGJA 1BRUP 2W5EA 3IITA 3H7OA 1BMNH 5FBEA 4X1PU 1C1SA 2O8WA 4BOHA 4F49A 2C8YB 4K8BA 5EQSA 4X8UH 1W2KH 4GSOA 1C2MA 5E0HA 2GMTC 3GY3A 1EB2A 4YLUA 5A0AE 2OK5A 4XBCA 2ANYA 3EAJA 5A0CA 1HGTH 4YO9A 3R3GB 4Y0ZE 4LK4A 2A7CA 3O8DA 2WPJS 1Y3VA 2QXHA 1GDQA 4AGJA 3BN9A 1TMBH 4OS7A 3UNQA 4Y8ZA 1LKBA 1V2UT 3GY7A 1Z6JH 4Y79A 4AN7A 2AH4X 1HJAB 1AD8H 1ESTA 2IPHA 1DLEA 2KZ4A 3A84A 5C0UA 2VB0A 4WJG2 1OYTH 2VVCA 5ETXA 3F2GA 4XSKU 4LZ1H 2IN2A 4NIVA 1ELVA 1E37B 1DFPA 5KEDA 3U9AH 3M5NA 1FY3A 3HGPA 1W0YH 1HAHH 5EGMA 2SNVA 3A7XA 1QIXB 4Y8XA 1H9IE 3KQCA 1JRSA 1G9IE 5EOKA 3P70B 1TMTH 3G01A 4IGDA 4TPYA 3EQ0H 2KX4A 4ZKSU 3LPRA 3BIUH 2WHXA 1GJ4H 1DITH 2P8OB 1C5RA 5AFZH 2CXVA 2HVYB 3PMAB 2VIWA 1S0RA 4NWLA 4B2BA 2O9QA 4DURA 2R9PA 2GP9B 1YBWA 1FV9A 1LHDH 3N99A 4ABGA 2BQ6B 3A7ZA 3GCTG 3RU4T 1A3EH 1TNJA 1ZPCA 1G36A 1AUJA 3TH4H 1ZTKA 2ZU2A 2J94A 3Q3YA 2UWPA 2XYAA 4KP0A 5K7RA 5PTPA 1TRMA 4JK5A 1MZDA 1GMDF 5IYTA 1TFXA 5C0TA 3SJKA 5H4IB 5F8ZA 5GJ4B 1IQKA 1VCPA 2J97A 1C2KA 1NBME 9ESTA 1TALA 2NU2E 3DSGA 4UD9H 1Q2WA 2J98B 1BIOA 3BTFE 1H8DH 3LJJA 2BVSH 3PMJA 3A7YA 4U01A 1W0ZU 5EODA 4LOYH 5DP3A 4Y7AA 3RMOH 4Y6DA 2HPPH 5CE1A 1HIAB 1HAZB 3UIRA 1KXEA 1O2YA 4NZLA 3C1KA 1TX6A 3HK3B 1O2MA 4MTBA 4X6OA 2A1DB 2H2ZA 4Y10E 1J14A 1C5WB 4GHTA 2AIQA 4U2WA 3LGVA 1MQ5A 1O2ZA 3SHCH 2RCEA 4NFFA 3SV7A 1O31A 3PWCA 3KGPA 1VZQH 4K2YA 4X2XA 3RXFA 5EG4A 1YKTA 3U8OH 4WMFA 2YOLA 3DHKH 2WPDD 3U98H 4UONA 3MNBA 4UFFH 1RD3B 2ODPA 3ZV9A 2HNTF 2SNWA 2ZGXH 4ISIH 2XOKD 4P02A 1IQJA 3ZZ7A 1F0UA 4AC9A 5JB8S 3SU2A 1T4VH 3ATLA 1GMHG 3E8LA 2F9OA 4K1TA 2W6ID 3DFJA 1N6YA 2Y82A 4FOUC 1F7ZA 3B8JA 1VGCB 2ZTZA 3LONA 3Q3KA 1QGFA 3SOSA 4MDSA 1NFWA 3IG6B 3FANA 3P6ZB 4AFQA 5C2ZA 3V7TA 4ABHA 3V12A 5B6OA 1FONA 1LHEH 1ELGA 3VEQB 1O2VA 1TNIA 4UEHH 1K1LA 1H9LB 2J9NA 4FUEA 3MHWU 3MQKC 1HXEH 4I8KA 2WZQA 3A83A 1EPTB 1K1NA 1TX8A 2SFAA 2ZFSA 3ENSB 1DOJA 4THNH 3CENA 1GDNA 1LVYA 3TJOA 2OCVB 4AYVB 1HJAC 1PYTC 1SGYE 1Y3XA 4D7FA 1VJ9U 1WOFA 2A4OA 2VGCC 4JMYA 1OWIA 2QGRA 2ZWLH 4RT0A 2OC0A 3SO3A 1TQ7B 1MD8A 4B74A 1C4U2 1PQ7A 4JZFH 1W11U 5L30H 2XXLA 3LGUA 1UK4A 4OGYA 2XBXA 4I32A 2FOFA 2O8MA 1FY5A 2ZFQH 3R0FA 1ZMNA 4U30A 2AMQA 1Q31A 1F0TA 1O3DA 1UTKA 2FS8A 3M7UA 5C1XA 3BTDE 1QFKH 2P8OC 3NCLA 1QTFA 1BTYA 3BTKE 2QXGA 4CBNA 1LHGH 4ZXXH 2A4GA 2FI5E 3Q00A 4BAOB 2GCHG 2W6JD 3FN8A 1PPFE 4FETA 1C2HA 4WH6A 1WUNH 1FQ3A 2A7JA 5FX6A 1D3TB 1NRNH 1GI1A 2WPKS 3SI4H 1BMMH 2HPQH 1RFNA 2BDBA 4FUBA 2J4IA 3UFAA 2BD3A 1AE8H 2PP6A 1GHBF 5A8ZA 2R3UA 3SU3A 2ZC9H 2BVRH 1TA6A 5FXLA 3RDZA 4ABFA 4DIIH 1BTUA 1TBRH 1GHVH 1QZ8A 2GCTB 3ZVFA 1C5OH 1HAYB 1TYNA 1AFQB 2B0FA 2ZDLA 4IC5A 1DXWA 2PKAA 3E3TA 1P57B 3FP8E 4AFSA 5HIYA 4UFEH 1O5AB 3QTVH 1HAVA 1CT4E 1UTOA 4I7YH 4B1TA 2ODQA 4RI0A 3TPIZ 1GPZA 1GJ7B 1O39A 1O3KA 3EA7A 2KCOA 1MH0A 3GDVA 1TPOA 1OHHD 3NK8A 1GVLA 1UVSH 5DKMA 3T28A 4UFGH 2H5CA 9LPRA 3BTEE 3GS9A 1TRYA 3SU5A 1DANH 2AGIX 4M7GA 1C2GA 1C5PA 3A89A 3ATWA 1C5YB 2AHME 1DWEH 3A8CA 2G52A 2FTLE 4ZKNU 3MU4A 1Z7KA 1S85A 3PV5A 2ZHDA 4BAMB 3ZVGA 2BLQA 2BY8X 3DSPA 3PLBA 4UDWH 6CHAB 1RTFB 5A2MH 2HOBA 3EA8A 4OS2A 2HALA 4ZCNA 2JH6D 1HCGA 1RTLA 1D6WA 4ISHH 3OYPA 4XE4A 1TIOA 1VGCC 4OS4A 4HI3A 2NU4E 3SBKA 1UCYE 4AOQA 1CGHA 1DXPA 1SG8B 3T29A 1V2OT 1YYY1 4ZH8A 1HXFH 1ZGIA 2BQWB 2ZU1A 2G00A 1SVPA 1AKSA 1O3EA 5DP4A 5AF9H 1A7SA 3S69A 2A7HA 3DD2H 4B71A 1P2OA 2AS9A 4E7NA 1OSSA 5IDKA 2BY9X 2OLGA 3UR6A 3EA9A 3BTME 3V0XA 1Y3UA 1EPTC 1RIWB 7LPRA 2CHAB 2WPIS 5FHTA 1OP2A 1KIGH 4GAWA 2BY6X 2ZKSA 3RXKA 4FUCA 3UOUA 2C93B 1XUGA 1GCTB 3UNRA 5C1UA 2BYAX 2C90B 2PTNA 4R0IA 5EQRA 1SGEE 1S83A 1MTUA 2QAAA 3MO3A 3RXAA 1K1JA 2DUCA 4CHAB 2KCPA 2PGBB 1ZMJA 4A7IB 3LT3A 2PR3A 3ODFA 1YY3A 1O3IA 3MOCA 5C94A 1T31A 2BVXH 3PB1E 2A45B 1P2NA 2BX3A 2EQNA 1P02A 2RDEA 1XXFA 1TONA 1EFRD 3CS0A 3ZZ3A 4X2YA 1HDTH 1HAIH 1WU1A 1UTQA 1ELCA 4NWKA 4FUIA 3MNCA 3S7KB 3M3VA 1CGIE 2FMJA 1AO5A 1ID5H 3SW2B 3F68H 2HWLB 5HM9A 1XX9A 5HM2A 2WV5A 1GI6A 2OD3B 2QY0B 1Z71A 3F6UH 2XWAA 1HAXB 1MU8B 3NRLA 3KHVA 2BTCE 4JYVH 4ZHLU 1U6QA 1KLTA 2QF5A 1IHTH 3DCLA 1CT0E 1BCUH 4F4OC 1MAYA 1SGPE 2BB4A 1C9PA 1UW7A 2BDCA 2VNTA 5JBBS 1AVXA 2KCAA 1SBWA 1OYQA 3QGNB 3DA9B 3STIA 1AVGH 1NY22 2Z9KA 1UCYH 1E1QD 2HRVA 1HAGE 2HLDD 1LKAA 1S6LA 2F9PA 2NU1E 3M3SA 1EKBB 1EZUC 3DT0H 3HKJB 3UWJH 1TRNA 2QXIA 1SQAA 1TE0A 3FKSD 1P03A 4BAHB 1CE5A 3V3MA 4X6MA 1UJ1A 1HV7A 1VITF 1BQYA 3ZZ5A 3VG8A 1O2XA 3GCNA 2GCTC 1XXDA 1O38A 1SGCA 3P17H 1AI8H 5CHAC 3SZNA 3ZIAD 1AFQC 2UUFB 2AYWA 1NFYA 1W14U 3FO8D 5E0JA 1HAPH 1SGFG 4HTCH 3PLKA 4Q2KA 3RU4E 1V2KT 3TIUA 3MI4A 1S82A 4FUDA 1K22H 1MCTA 4CRGA 1IQLA 2ZHQH 4Z1MD 4CBOA 4BXWA 4H6SB 3TNTA 1AZZA 1MTVA 1C1NA 3MNXA 2WYGA 1GHXH 2ZO3H 2ZHEH 3BTTE 1O3CA 3Q77A 3VB7A 1EJMA 2J34A 1WBGB 4X8TH 1GBKA 1KXBA 1MTSA 1WV7H 3MWIU 4AX9H 3ZVDA 3CP7A 1A4WH 1Z8JB 2G5NA 2XCNA 3QZRA 2TRMA 5GCHF 1NRPH 5JBTA 4BTUB 3MNSA 2OP9A 5HKKD 4F48B 2FO9A 1C1QA 1EASA 1TMUH 4NA7A 3Q3XA 6CHAC 1VR1H 1M9UA 3TK9A 4KTSA 6LPRA 2ZPSA 1AQ7A 2ASUB 5JPMH 1MTNB 1BJUA 1IQGA 2C8ZB 2PWXA 1O5BB 1O32A 2FI3E 3LH3A 5DP8A 1ELDE 3GDSA 3HKIB 4ISNA 4F55A 3STJA 2QF3A 1V2QT 5T3HA 3LKWA 5K0HA 1C1VH 2ANMH 3SZEA 3GCOA 1XKAC 2VIQA 1ZMLA 1RIWC 3F0OA 4KELA 4CRBA 1AUTC 5HMAA 2CHAC 4YLQH 5GWZA 1G3BA 4ZHMU 1SLUB 4D9RA 3BTGE 1GCTC 1XUJA 1LQEA 1G2MA 2GZ9A 2Y5HA 1TX7A 2BY5X 1D9IA 1O3JA 2D26C 1P2QA 5DP9A 4CHAC 3EE7A 5LPFA 1P09A 4ABBA 3EE0B 1DM4B 1UHBA 3QUMP 1UCYK 1ZTLA 2Y7XA 1HBTH 1Y5BT 1ZGVA 2FXRA 4HZHA 1C1UH 1ZHRA 2VWOA 1AN1E 1GBJA 5L2YH 2PFEA 4NA8A 1SPJA 4DVAU 5C5NA 3UY9A 4X8SH 4D8NA 3LIWA 4CREA 2BLWA 2VIOA 2CK3D 3I78A 4INHA 1O5EH 1BTHH 5F8XA 1HNEE 2SGAA 3E0PB 3M61U 2FYRA 1OS8A 4ASUD 2JJ2D 4ABAA 2FOCA 1C1PA 4TY6A 2Q6DA 1OP8A 4WF8A 3QLPH 3RXQA 3TH3H 4E7RG 1WAYB 1ELBA 1E79D 1TOMH 3L6PA 1GDUA 1SKYE 3K6ZA 4D9QA 1UTJA 3M5MA 1UTNA 2H1UA 1Y3YA 1SFQB 2VWMA 1NESE 2J98A 2D1JA 5EJZA 1V2JT 4A5TS 3ELAH 1XUFA 3SGAE 2BOHB 2XNIA 1SFIA 1ANCA 3SV2H 3ZZ8A 1QA7A 1F5LA 1E35B 3AAUA 3OU0A 4GCHG 1AB9B 1Y5UT 2XBYA 4AGKA 1TABE 5EJ1A 1QB9A 2L6OA 1J8AA 1ETTH 1L2EA 3GOVB 3GY2A 5ESBA 3UOPA 2GJGA 1BTXA 7ESTE 3W95A 5ABWA 3KCGH 3LJOA 3S7HB 4O9VA 1QR3E 2BZ6H 2YMSB 5E8EH 2O8UA 5TJXA 2Z3CA 1KXFA 3P8OA 3QK1A 3ZZBA 2ZPQA 1H4WA 1ZSKA 1O3AA 1P05A 4WXVA 1P01A 2Y6TA 1W12U 3GCTF 1O3GA 1O2OA 5C1YA 2HVXA 3K2UA 4Q63A 2KR7A 3JZ1B 5FAHA 4FU8A 2BD9A 3BG4B 5HXFA 4ZUHA 4NZQA 4WVPE 4YXWD 4DW2U 1N6XA 1X7AC 1AWHB 1N8OB 2VVVA 2WSSD 2PSXA 3PLPA 1THRH 2FIRH 5E0GA 1YGCH 1CO7E 1PQAA 2P94A 2VINA 1CHOG 2EA3A 4Q7ZA 4MPWA 5G4BA 1MTNC 1O3MA 1XUHA 1EPTA 2YNAA 1PPHE 3GCHB 2FWWA 1MQ6A 3M3TA 1O2LA 1LO6A 1QL9A 1GJ9B 3ATMA 3SN8A 1NRSH 1SGTA 3RM0H 3GY5A 2R0KA 2QF4A 1YPEH 2KAIA 2OXSA 2G5VA 2UUJB 1SGQE 2C3SA 2QIQA 3RXLA 2Y7ZA 4NSYA 5GPIB 3RMMH 2BOKA 2QF0A 3KQ5A 1PJPA 2KCYA 4LXBH 3BTHE 3NWUA 4WH8A 4B6EA 1XKBC 2NU0E 3GICB 1ABIH 2STAE 1KDQB 2ZI2H 2TGDA 1O5CB 3KQEA 3TITA 2O8TA 1F92A 1C5VA 8GCHG 3MYWA 4DY7B 1TB6H 5TCCA 3KN2A 3F9GA 1NFUA 5AFYH 3UNSA 1C5NH 3HPTB 1Z1IA 1FJSA 4K69A 1LCYA 1GMHF 4CR9A 3ATKA 1O2NA 1PQ8A 3F9HA 3F1SB 1ZPBA 1P11E 2JIZD 1GBBA 1Q3XA 2QN5T 1ZPZA 2PHBA 2V35A 4H6TA 3TNSA 1XUKA 2A0QB 4YZUA 2VIDA 2VVUA 4BTIB 2R2WU 1TBZH 2FOEA 4XOJA 5F8TA 4XBBA 3ZZCA 3A8DA 5E2OA 2JETB 1DS2E 2UUKB 3ZYDA 1FXYA 2FLRH 5FPYA 2C4FH 1F5KU 2F43B 3KYFA 1HJ9A 2OTVA 3KIDU 1DT2A 1V2NT 2TBSA 1P04A 2F4LA 4DG4A 2VWLA 3MTYA 3TJNA 2Z9GA 4IMQA 4K60A 1GI8B 2BDIA 2WUCA 2GTBA 2QE7D 4A1TA 1QL7A 1AE5A 1UO6A 1O3HA 1FN8A 3VB4A 1GBTA 3F2HA 2ALPA 3FZDA 4UFDH 4YOIA 4B2CA 3SV9A 1T4UH 2LPRA 3FOAA 3OY5U 1FUJA 2ZQ2A 4B6FA 1AB9C 1E38B 4ZKRU 1TQ0B 1GL0E 1FNIA 3RXMA 4CRFA 2J95A 3UUZA 5JYIA 4ZXYH 2ODYB 5TCAA 3LU9B 3EDXB 4NSVA 1O2RA 3SJ9A 3RC6A 3V13A 1P12E 1GI3A 2A31A 4FUHA 1LTOA 4AYYB 2AERH 3VFEA 3RXGA 1ETSH 1EB1H 1P2MA 1LPZB 2A4QA 3A7TA 3SU6A 2YMSC 3OE7D 3PMBB 1C5QA 1AY6H 1QL8A 1IHSH 1TWXB 2CJIA 3D62A 2GCHF 3K6YA 1BTPA 4JYUH 2Z6BD 3BTQE 1PPCE 1ZHPA 3LH1A 1ANBA 1Y8TA 3RC5A 1UK2A 3BG4C 1OWEA 4I33A 5I25A 1YP9A 2LNCA 1N8OC 2OINA 2XRCA 2P3TB 5T6FA 5FCKA 3HGNA 1L1GA 4O3TA 1DUAA 3ZZDA 1CU1A 3GY6A 3MU0A 3RXTA 5LPRA 1D3QB 2C8WB 3RXDA 4ABDA 2XBWA 1SLXB 1QHRB 4ASHA 1BA8B 2P93A 2VIVA 2GV6A 4FVBA 1GJ6A 3D23A 3P95A 1MCVA 3GCHC 2BDYA 1V2VT 4XDEA 1QQ4A 1YPHE 1SGNE 1E1RD 2NU3E 4MLFB 3RXSA 1GHAG 2BZAA 1O2GH 1WQSA 3KYGA 4MNXA 3H5CB 4I31A 1D3DB 1K1PA 4BAKB 2GV7A 1JIRA 2BD8A 1GVZA 3MH4A 2B8OH 2ZDKA 5AHGH 1OX1A 4KTCA 1P06A 1OWKA 2VH0A 5EXMA 2IJD1 4CR5A 2UUYA 1JOUB 3U69H 2EY4C 1HRTH 1BRAA 1A0HB 2GGVB 2H9EH 1YC0A 1SC8U 2V3MA 1EATA 1C1WH 1JWTA 4I8GA 3RP2A 1SGRE 3OFND 1HUTH 1ZR0A 1IAUA 4NGAH 1HFDA 4KTUA 1CBWB 1YF4A 1O2UA 5EU8A 3RXHA 2BD5A 3ZV8A 4IW4E 4XFQA 4FUJA 5DN6D 2ZP0H 2VU8E 5JBAS 1GI0A 1GVKB 2STBE 1P2IA 1YCPH 1TPPA 5FCRA 1T8LA 1TGNA 4DIHH 1H8HD 1NRQH 2JETC 1C1RA 1Y5AT 5DSFA 1SHHB 5DP7A 3RMNH 6ESTA 2ZGCA 5CDFE 2THFB 4PROA 1SOZA 1S6HA 3KEEA 4OS5A 3A7WA 3KQDA 1KTTB 3BSQA 1SQRA 4X1QU 3RC4A 1L4ZA 5F53A 3E16B 2FOHA 3PROA 1YLNA 1QQUA 2Z9LA 1BOQA 1O2PA 2OUAA 2TGAA 1HYLA 2VH6A 1EZQA 1TGCA 1W13U 1AVWA 3D49H 1O2QA 1BRCE 4I8LA 2D8WA 1C2IA 2Y5GA 1AGJA 2F9NA 4MPUA 5T1VA 1HB0B 3RMLH 1QJ6B 1WCZA 5EPNA 1ZHMA 3BEIB 1PYTD 2D2DA 2PLXA 3A81A 3SORA 3PV4A 4K8YA 2ZDVH 3ZVBA 5C67A 3K9XB 2P95A 2YMSD 1NBMD 1JMOH 3VPKA 3LOXA 5BPEA 4JYTA 1IQFA 3M35A 5DP5A 1GBLA 1V2PT 1PQ5A 2FOBA 4GLYA 2J5UA 1A5GH 5AVDA 3VXEH 1DX5M 4ZROA 4B76A 1GJBB 1QBVH 2AIPA 3QN7A 1W10U 2W7SA 3E0NB 1KYNA 5C20A 4JZDH 2FESH 2GDDA 4Q7XA 4SGAE 1V2WT 4CH2B 1W7XH 1RS0A 2F9UA 3B9FH 4WMEA 1E0FD 3F0PA 1KSNA 1GJCB 1B5GH 2HNTE 2RFKC 1EXFA 3P8GA 3UPEA 2RA0A 1GG6B 2B9LA 3GY4A 1NT1A 4DCDA 1BHXB 2I6SA 3BEFB 3WY8A 2PTCE 4I8JA 4NFEA 2Y5FA 3ZVCA 2BHGA 1TGTA 4AFZA 3LDXH 3URDA 4ZMAH 1ELEE 1Y3WA 1TGBA 1W3CA 3SV6A 1SB1H 4IBLH 1Z1JA 2RG3A 4YT7H 3BV9B 5JB9S 3TJUA 1O5GH 1HAVB 3ZYEA 1XMNB 4GUXA 1PFXC 1YCPK 1MMJN 3U1IB 4A1XA 2Q6GA 1GI9B 1FY1A 1O2TA 1DICA 2LP6A 1J15A 1DLKB 1CQQA 3A86A 2Z7FE 5LH8A 1QBOA 3SYJA 1S84A 1W8BH 4X2VA 4YESB 1TA2A 3GYLB 4GVUA 1D3PB 1WQVH 1FAXA 3LGYA 4JK6A 5EJLA 4BTTB 1EZSC 1C4V2 3S9BA 5IK2D 3GY8A 3M36A 3TU7H 4NIWA 4Y11E 1HLTH 5HYOA 1MKXH 1MKWH 4X1SU 3UREA 2QXJA 1GMCG 1RTKA 4RKJB 1K9OE 1NTPA 1CBWC 2H5DA 1N1LA 1IQHA 5EXNA 1FPCH 5I46H 2EI8A 3KQBA 1Z8RA 1QNJA 2TIOA 2W3KA 4TY7A 2A5KA 1RXPA 5EW1H 1GJAB 4OM9A 2FI4E 2Y81A 3T62A 4SGBE 3TVJB 1FX0B 5FX5A 1C5UA 1A46H 2ZU5A 3A8AA 1XVMA 1XVOA 4ABEA 1VKYA 1ZSLA 1A0LA 1O2KA 1MAXA 1O2IA 3LGWA 3KNXA 3VB6A 4O3UA 1ABJH 1AZ8A 4MG3A 1LHCH 1PPZA 2G81E 2UWOA 1W0KD 1O2JA 1YPLH 3BEUA 4IS5A 4O97A 3JZ2B 1MZAA 2H9TH 1C1MA 1G3CA 1YCPM 3ATIA 3SNEA 4J2YB 1J17T 2WPLS 2WPMS 4CRDA 2FM2A 1ELAA 2Q6FA 1FPHH 4Z6AH 3SGQE 1LVMA 1AU8A 3TLOA 3SNCA 1JXPA 3Q76A 1BITA 1W7GH 2FOMB 1BTWA 2ZCLP 3SUEA 1OPHB 1EQ9A 1G3EA 1TLDA 4WWYA 5SGAE 4X8VH 2ZPRA 4IC6A 3P92A 2BDHA 5A8XA 1SQTA 2UWLA 1QJ7B 3MH5A 1O34A 8KME2 1EAUA 1K1MA 3FZZA 1A1RA 2F83A 2WPHS 4M9FA 2BM2A 1D4PB 1BBRE 1BB0B 2OBQA 2QV1A 2ZFRH 3F3BA 2ZHFH 4TT3D 2TGPZ 1CT2E 1JRTA 1INCA 3AK5A 3RUOA 2V3OH 1E34B 2OQ5A 2XTTB 4FU7A 3HK6B 5A0BA 1L1NA 1Y59T 1NC6A 5DK1A 1GBMA 1NROH 4MNWA 1BMFD 4LZ4B 1YWUA 4TYDA 4DGJA 6GCHG 3TK5A 5A09A 1KXCA 2ANWA 4FUFA 3F9FA 3L3TA 1GG6C 1OWJA 2G8TA 5DO4H 2OBOA 3QO6A 3OY6U 5LPEA 1BT7A 1KXAA 1MUEB 3QDZB 1MKXK 4GCHF 1MKWK 3AW1A 2WV4A 5C5OA 1C1OA 3PTNA 2LELA 3M37A 1SR5C 7GCHG 3PYHA 4TWYA 3IWMA 4QT8C 3SNBA 2BD2A 2TPIZ 1MU6B 1F5RA 1VJAU 1OP0A 5T6DA 1HAOH 4DT7B 1NRRH 1NU9A 3AW0A 2OC1A 3UQVA 1HIAA 2A2QH 1KLIH 2M5TA 1B0EA 2Z94A 2WUBA 4ISLA 3N7EA 3SQEE 2V6NA 1K0HA 1O35A 2L74A 3BG8A 3FAOA 1GL1A 1Z8IB 5F6MA 1FIWA 1SMFE 4MNVA 4B75A 1Z6EA 2EI6A 1O3PB 4AG2A 4JCNA 3ODDA 2K0QA 1UVUH 1UTMA 1CHOF 1S5SA 1BBRH 1SOTA 3GDUA 3OEED 1GBEA 2AGEX 1K1IA 1SHYA 2W26A 2GT8A 1ZSJA 2B5TB 1BJVA 1ZLRA 1GBDA 1OOKB
chains in the Genus database with same CATH topology
1V3XA 4MVNA 4VGCB 1Z8GA 1ARCA 1VCQA 1KY9A 5F03A 2P16A 1GBCA 4XBDA 1DE7H 4RSPA 4YT6H 2XBVA 2AMPA 2O8LA 2VGCB 2OC7A 1FN6A 1BZXE 4X1RU 3OSYA 1O5DH 3D65E 3SJ8A 4CRAA 2R0LA 1AHTH 5DJ7A 1IQEA 1QJ1B 1VCWA 1O5FH 4R8TB 3SI3H 2FPZA 8LPRA 1UMAH 3OX7U 1ZJKA 4K1SA 5L2ZH 2ZDMA 1UHBB 8GCHF 1L0ZA 1O36A 1DDJA 4J1YA 5GXPA 3BF6H 1DSUA 3LGTA 3P8FA 1V2ST 1T8MA 4KGAA 2ZFFH 1LVOA 5EXLA 3PM3A 3MO9A 3A85A 2ZTYA 1O3FA 1S6FA 2FDAA 5FPSA 4ISOA 1K1OA 1EZXC 4Y7BA 2JKHA 1CVWH 1MBMA 2R3YA 4NA9H 2ZU4A 1NO9H 1A3BH 1BRBE 3A87A 3M5LA 1A61H 2YNBA 4AB9A 3T27A 2AMDA 1DWCH 3A7VA 1GI4A 3MFJA 1O3OA 2ZG0H 1O3NA 3B23B 2FX4A 2ZF0H 4OS6A 3RU4D 2ILNA 2G55A 3W94A 2XC0A 3I77A 2GX4A 1EP6A 1GJ5H 2GVFA 2PUXB 2EC9H 4OGXA 3FVFB 2ANKH 1KLJH 4FVDA 2ZDAH 1GCDA 1B0FA 4Y8YA 2HGTH 2XW9A 1T8OA 3QWCH 2BX4A 1TOCB 4ZAEA 2XWBI 1F0RA 4I8HA 2ZZUH 3F9EA 1GBFA 1L4DA 3MH6A 1EOLA 2A5AA 2Z9IA 1GMDG 1MTWA 3OTJE 2PSYA 3FP7E 2A32A 4DJZB 1BBRK 1EP5A 1AFEH 1S81A 1XM1A 3ZZ6A 1SSXA 2B7DH 2GKVE 3RXIA 1FMGA 1C5XB 2P3UB 4AG1A 2BD4A 1GBIA 4JZ1A 1ACBE 2ZECA 2BLOA 2FYQA 4INKA 1P2KA 3PWBA 3VB3A 1V2RT 4GPGA 1WYKA 4K3JA 1O30A 1BTZA 1LHFH 1P10A 1UK3A 1EX3A 3VGCB 4FU9A 1G3DA 1P9SA 3MO6A 1CGJE 1C5ZB 1A5IA 2FTMA 4WY3A 1VITH 3FFGA 1DVAH 3RXUA 3SUDA 3U1JB 4KKDA 2AFQB 5C3NA 2SGQE 1H9HE 1C2JA 5GDSH 2BQ7B 1K21H 4O03A 4D76A 1DPOA 3N7OA 4AB8A 1T8NA 3PTBA 2V3HH 3PO1B 2PKSB 2AEIH 2CN0H 4X6PA 1O2WA 3LC5A 2VWNA 1B7XB 5GIBA 1GGDB 3SUGA 4IN2A 4FUGA 3BIVH 4VGCC 1LMWB 2P59A 1V2TT 2IJOB 1V6DA 3RXVA 1T7CA 3CS7A 1FY8E 5L6NH 1YPKH 1WTHD 1QY6A 2KAIB 1WTGH 1WSSH 4ABIA 1GHAF 1NS3A 1QBNA 2H6MA 2VJ1A 1O3LA 2FOGA 1O37A 1YLDA 2ZIQH 2SGFE 5T6GA 3U8RH 1MBQA 1EJNA 1C5SA 3SU1A 3RLYH 2SGPE 3SJOA 3SHAH 1TNHA 2FEQH 1ZZZA 3UWIA 1T32A 1TBQH 1V2LT 1ZRKA 1NZQH 4HGCA 2PGQB 1XUIA 1QA0A 2FX6A 1A5HA 4YM9A 1DY8A 2GT7A 3HATH 1BHXF 1UVOA 1SLVB 1UVPA 1EUFA 1QCPA 4Y0YE 3ZZAA 3M5OA 7KMEH 1F2SE 1TNGA 2QCYA 5FPTA 3MU1A 3RXJA 3RXBA 2ZGHA 1K28D 3SNDA 1JBUH 1OXGA 4MQAA 1G37A 1NPMA 1C4Y2 4ESTE 5HGGA 1AWFH 1QURH 1ELTA 4NG9H 3RLWH 5DP6A 3O8RA 1KTSB 3RXPA 4A92A 1OWDA 2Z3EA 2QC2A 3SNAA 1G2LA 1DSTA 3SV8A 1QB6A 4OS1A 4X2WA 3QTOH 1FZZA 1ZTJA 4RKOB 1PPEE 1V2MT 3QX5H 1RGQA 4IMZA 4TWWA 2Z3DA 3NPSA 2JH5D 3VXFH 3UTUH 3K65B 1GJDB 1BUIA 4H42U 1QB1A 3RXCA 3TGIE 4B2AA 4Q7YA 1UTLM 1ESAA 1SGIB 4CH8B 5EPYA 1AIXH 1O0DH 4JZEH 1J16A 1YPJH 2OQUA 3LGIA 3SJIA 2GZ7A 3T26A 3T5FH 2ZDNA 3TGJE 3GISB 3I29A 1SQOA 1BMAA 5CHAB 1CHGA 1A2CH 2Q1JA 1NFXA 2GZ8A 1C1TA 1GHBG 2ZFTA 3E91A 2R2MB 2PV9B 1BDAA 4YOGA 1GWAA 4D7GA 2FP7B 4IN1A 3L33A 1ZOMA 4DOQA 3DUXH 3TK6A 1TNKA 3EYDA 2ESTE 2F9BH 2WYJA 3TGKE 3A88A 1YM0A 3NKKA 1GJ8B 1ARBA 1O33A 2K1QA 3A80A 3E6PH 2F3CE 3SQHE 1HJ8A 1C9TA 1RJXB 3VGCC 4UE7H 1YPHC 1ANEA 1P2JA 2ZEBA 1D6RA 1H1BA 1ZYOA 2TGTA 5FBIA 4A1VA 1GBHA 5CMXH 1GHWH 3E1XB 3ITIA 3MU8A 2JH0D 1DUEA 3PO1C 2J38A 2PKSC 3UR9A 1IQIA 1C2FA 3MH7A 2NWNA 5JBCS 1C5TA 1ORFA 3VB5A 3ESTA 1THSH 3S9AA 1O3BA 1UVTH 1GGDC 3ZZ9A 2BDGA 4AZ2B 2J92A 1C2EA 4X1NU 3PMHB 2FS9A 1FDPA 1EJAA 1YPGH 1EAIA 1O2SA 3MMGA 1P3CA 3S0NA 2GD4B 1UTPA 3ZVEA 1O2HA 1ELFA 1GHYH 2XCFA 4Y76A 5DPAA 1JIMA 1TPSA 3SU0A 5DG6A 4E05H 1QRXA 1DWDH 2CGAA 1PPBH 2WINI 2BY7X 1TPAE 1IOEA 1CA0B 2BXTH 2F91A 1C2DA 3DFLA 1EAWA 1DWBH 1S0QA 4BAQB 2HLCA 2BXUH 1YLCA 2Y80A 3SUFA 4YTAA 4AFUA 4MNYA 2FLBH 1FI8A 2PKAB 3TH2H 4WXIA 1F0SA 1QRWA 5JDUB 1THPB 3E90B 3H7TA 3SU4A 1J9CH 2RDLA 1GMCF 1LPGB 2ZNKH 3KL6A 2FZZA 3BTWE 3RM2H 3O8BA 2V0BA 2RA3A 5J4QA 4ZKOU 1IQMA 1FAKH 4JZIA 1GI7B 2OC8A 3A8BA 4MPVA 1C5LH 5EQQA 1LDTT 1ZJDA 1TAWA 3QZQA 2QA9E 1GHZA 1FY4A 1OKXA 3AASA 2ZHWH 4TPIZ 2DE9A 2EEKA 3NUMA 2GMTB 1BMLA 3M7TA 4MPXA 2G51A 1FLEE 1QRZA 3GYMA 1C5MD 3SGBE 4YOJA 2H9HA 1K2I1 1OWHA 1PPGE 1YPMH 2BDAA 4X6NA 2ZTXA 1SGFA 1GBAA 4BXSA 2ZFPH 1AKSB 4Q80A 3C27B 3MU5A 3AVZA 3P8NA 2J2UA 2CMYA 3LC3A 4X0WU 2ZU3A 1P9UA 1NN6A 4CRCA 2A5IA 2BMGB 2PUQH 2GDEH 3TJVA 1ZRBA 1FIZA 3NZIA 4NIXA 2CV3A 2HNTC 1TGSZ 1P0SH 1VITG 3EGKH 2A4RA 1HPGA 1CA8B 1LVBA 2IOTA 3ZVAA 1A0JA 1GI2A 2SGEE 4H4FA 4B73A 3ZZ4A 2ULLA 1E36B 1G32B 4Y71A 1LQDB 1TNLA 4K5ZA 2BLVA 2ZQ1A 2I6QA 5BRRE 1DY9A 2AGGX 1AMHA 1IQNA 1P3EA 4ZHAA 3U8TH 6GCHF 3NXPA 3RXRA 1G30B 2VIPA 1RRKA 2F9VA 4BANB 2FOAA 2SGDE 5GCHG 3RXOA 2EI7A 1LPKB 2ALVA 2W3IA 2P3FH 2DE8A 4RN6A 1P8VC 1NM6A 1CSOE 1SL3A 2A2XH 2W7UA 3KF2A 4Z0KA 7GCHF 3FP6E 5J4SA 2ZA5A 2QYIA 2PW8H 4U32A 1L1JA 4WMDA 1ESBA 1ETRH 4K1EA 1SI5H 2G4UA 2C8XB 4ABJA 3A82A 3O8CA 1ANDA 1KXDA 1NU7B 4NIYA 1GI5A 5ESTE 1EAXA 2ZGBH 4INLA 1CA0C 4FXGH 1EOJA 2XC5A 2BD7A 1H8IH 4NCYA 3QGJA 8ESTE 1SGDE 3T25A 2Z9JA 5A8YA 2G4TA 3URCA 3AAVA 5EW2H 2XC4A 3M7QA 4A6LA 5DGJA 4E06H 2ZCHP 2FODA 3UQOA 4AORA 1MD7A 1KDQA 2CF9H 5LGOA 3RXEA 4GHQA 3T2NA 2ZCKP 4BNRA 3S9CA 5E2PA 2CF8H 1SLWB 1C2LA 4HFPB 2ZGJA 1BRUP 2W5EA 3IITA 3H7OA 1BMNH 5FBEA 4X1PU 1C1SA 2O8WA 4BOHA 4F49A 2C8YB 4K8BA 5EQSA 4X8UH 1W2KH 4GSOA 1C2MA 5E0HA 2GMTC 3GY3A 1EB2A 4YLUA 5A0AE 4XBCA 2ANYA 3EAJA 5A0CA 1HGTH 4YO9A 3R3GB 4Y0ZE 4LK4A 2A7CA 3O8DA 2WPJS 1Y3VA 2QXHA 1GDQA 4AGJA 3BN9A 1TMBH 4OS7A 3UNQA 4Y8ZA 1LKBA 1V2UT 3GY7A 1Z6JH 4Y79A 4AN7A 2AH4X 1HJAB 1AD8H 1ESTA 2IPHA 1DLEA 3A84A 2VB0A 4WJG2 1OYTH 2VVCA 5ETXA 4XSKU 4LZ1H 2IN2A 4NIVA 1ELVA 1E37B 1DFPA 3U9AH 3M5NA 1FY3A 3HGPA 1W0YH 1HAHH 5EGMA 2SNVA 3A7XA 1QIXB 4Y8XA 1H9IE 3KQCA 1JRSA 1G9IE 5EOKA 3P70B 1TMTH 3G01A 4IGDA 4TPYA 3EQ0H 4ZKSU 3LPRA 3BIUH 1GJ4H 1DITH 2P8OB 1C5RA 5AFZH 2CXVA 3PMAB 2VIWA 1S0RA 4NWLA 4B2BA 2O9QA 4DURA 2R9PA 2GP9B 1YBWA 1FV9A 1LHDH 4ABGA 2BQ6B 3A7ZA 3GCTG 3RU4T 1A3EH 1TNJA 1ZPCA 1G36A 1AUJA 3TH4H 1ZTKA 2ZU2A 2J94A 3Q3YA 2UWPA 2XYAA 4KP0A 5K7RA 5PTPA 1TRMA 4JK5A 1MZDA 1GMDF 5IYTA 1TFXA 3SJKA 5H4IB 5F8ZA 5GJ4B 1IQKA 1VCPA 1C2KA 9ESTA 1TALA 2NU2E 4UD9H 1Q2WA 1BIOA 3BTFE 1H8DH 3LJJA 2BVSH 3PMJA 3A7YA 4U01A 1W0ZU 5EODA 4LOYH 5DP3A 4Y7AA 3RMOH 4Y6DA 2HPPH 5CE1A 1HIAB 1HAZB 3UIRA 1KXEA 1O2YA 4NZLA 3C1KA 1TX6A 3HK3B 1O2MA 4MTBA 4X6OA 2A1DB 2H2ZA 4Y10E 1J14A 1C5WB 4GHTA 2AIQA 4U2WA 3LGVA 1MQ5A 1O2ZA 3SHCH 2RCEA 4NFFA 3SV7A 1O31A 3PWCA 3KGPA 1VZQH 4K2YA 4X2XA 3RXFA 5EG4A 1YKTA 3U8OH 4WMFA 2YOLA 3DHKH 3U98H 4UONA 3MNBA 4UFFH 1RD3B 2ODPA 3ZV9A 2HNTF 2SNWA 2ZGXH 4ISIH 1IQJA 3ZZ7A 1F0UA 5JB8S 3SU2A 1T4VH 3ATLA 1GMHG 3E8LA 2F9OA 4K1TA 3DFJA 1N6YA 2Y82A 1F7ZA 3B8JA 1VGCB 2ZTZA 3LONA 3Q3KA 1QGFA 3SOSA 4MDSA 1NFWA 3IG6B 3FANA 3P6ZB 4AFQA 5C2ZA 3V7TA 4ABHA 3V12A 5B6OA 1FONA 1LHEH 1ELGA 3VEQB 1O2VA 1TNIA 4UEHH 1K1LA 1H9LB 2J9NA 4FUEA 3MHWU 1HXEH 4I8KA 3A83A 1EPTB 1K1NA 1TX8A 2SFAA 2ZFSA 3ENSB 1DOJA 4THNH 3CENA 1GDNA 1LVYA 3TJOA 2OCVB 4AYVB 1HJAC 1PYTC 1SGYE 1Y3XA 4D7FA 1VJ9U 1WOFA 2A4OA 2VGCC 4JMYA 1OWIA 2QGRA 2ZWLH 2OC0A 3SO3A 1TQ7B 1MD8A 4B74A 1C4U2 1PQ7A 4JZFH 1W11U 5L30H 2XXLA 3LGUA 1UK4A 4OGYA 2XBXA 4I32A 2FOFA 2O8MA 1FY5A 2ZFQH 3R0FA 1ZMNA 4U30A 2AMQA 1Q31A 1F0TA 1O3DA 1UTKA 2FS8A 3M7UA 5C1XA 3BTDE 1QFKH 2P8OC 3NCLA 1QTFA 1BTYA 3BTKE 2QXGA 4CBNA 1LHGH 4ZXXH 2A4GA 2FI5E 3Q00A 4BAOB 2GCHG 1PPFE 1C2HA 4WH6A 1WUNH 1FQ3A 2A7JA 5FX6A 1D3TB 1NRNH 1GI1A 2WPKS 3SI4H 1BMMH 2HPQH 1RFNA 2BDBA 4FUBA 2J4IA 3UFAA 2BD3A 1AE8H 1GHBF 5A8ZA 2R3UA 3SU3A 2ZC9H 2BVRH 1TA6A 5FXLA 3RDZA 4ABFA 4DIIH 1BTUA 1TBRH 1GHVH 2GCTB 3ZVFA 1C5OH 1HAYB 1TYNA 1AFQB 2B0FA 2ZDLA 4IC5A 1DXWA 2PKAA 3E3TA 1P57B 3FP8E 4AFSA 4UFEH 1O5AB 3QTVH 1HAVA 1CT4E 1UTOA 4I7YH 4B1TA 2ODQA 3TPIZ 1GPZA 1GJ7B 1O39A 1O3KA 3EA7A 3GDVA 1MH0A 1TPOA 3T28A 3NK8A 1GVLA 1UVSH 5DKMA 4UFGH 2H5CA 9LPRA 3BTEE 3SU5A 1TRYA 1DANH 2AGIX 4M7GA 1C2GA 1C5PA 3A89A 3ATWA 1C5YB 1DWEH 3A8CA 2G52A 2FTLE 4ZKNU 3MU4A 1Z7KA 1S85A 4BAMB 2ZHDA 3ZVGA 2BLQA 2BY8X 3PLBA 6CHAB 4UDWH 1RTFB 5A2MH 2HOBA 3EA8A 4OS2A 2HALA 2JH6D 1HCGA 1RTLA 1D6WA 4ISHH 3OYPA 4XE4A 1TIOA 1VGCC 4OS4A 4HI3A 2NU4E 3SBKA 1UCYE 4AOQA 1CGHA 1DXPA 1SG8B 3T29A 1V2OT 1YYY1 4ZH8A 1HXFH 1ZGIA 2BQWB 2ZU1A 2G00A 1SVPA 1AKSA 1O3EA 5DP4A 5AF9H 1A7SA 3S69A 2A7HA 3DD2H 4B71A 1P2OA 2AS9A 4E7NA 1OSSA 5IDKA 2BY9X 2OLGA 3UR6A 3EA9A 3BTME 3V0XA 1Y3UA 1EPTC 1RIWB 7LPRA 2CHAB 2WPIS 5FHTA