1V2QT

Trypsin inhibitor in complex with bovine trypsin variant x(sswi)bt.b4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSWIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
total genus 47
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2qT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2qT02
1C5VA 1ZPCA 4ABIA 4Y8ZA 1HJ8A 2R9PA 4WMDA 3HK6B 1IAUA 1TAWA 3FANA 5TJXA 3SGAE 1O3BA 3FZZA 1O2UA 2P95A 2FIRH 3ATWA 4Q7YA 1HAVB 1Z8GA 4A1VA 3M7UA 2CXVA 3PLPA 2G4UA 4GUXA 1VGCB 1O2IA 1ELAA 2F91A 2F9UA 3B9FH 2SGPE 1W3CA 1DICA 1AZZA 3CS7A 2FX6A 2XBWA 2A4GA 3SNBA 4I8HA 4CH2B 3UR9A 1ESTA 1EB1H 4FUCA 2ZZUH 1AHTH 5CE1A 2A2XH 1Z71A 3IG6B 3TJOA 2ZGHA 1XMNB 1BMMH 4DOQA 3LKWA 4KELA 3SJKA 3O8DA 1W7XH 2QC2A 2JH6D 2C8XB 3B8JA 1EPTB 4YOGA 1V2VT 3I77A 1EOJA 1SGFA 1TRYA 2FOFA 1Z7KA 4YO9A 3M35A 4JZDH 1RS0A 1LCYA 1QB9A 4BAOB 3E0PB 1TWXB 2ZFTA 1A3EH 2WYJA 2G52A 4JYTA 1TMTH 1SVPA 3WY8A 1V2NT 1IQMA 3UTUH 1HJAB 5GIBA 1XUGA 4K60A 1YCPK 3GISB 2NU0E 1PYTC 1V2MT 1AE5A 1TRMA 4LOYH 3TGIE 1EJAA 1NTPA 5CHAB 8ESTE 2ZFFH 1DWDH 4TY7A 3SU4A 4NFFA 1C5ZB 1C2JA 3D65E 1ABIH 3UNSA 5F8XA 1GBCA 4ZXYH 3U9AH 1BHXB 1TE0A 1GMDG 1GVZA 1J16A 1FJSA 4B75A 1SQOA 1SFIA 1YCPH 1EB2A 1XUHA 2BDYA 3MNXA 1AWFH 1HAIH 2Y5FA 3SV2H 1QQ4A 3QK1A 4FUFA 1DLEA 1AFQC 1LKAA 1Q3XA 1UTJA 2Y7XA 1TALA 2Q6GA 1GBMA 1OWJA 2V6NA 1RD3B 2PWXA 4I8GA 1S84A 2GTBA 2ZCHP 2ZG0H 2YNAA 3ODDA 1GJDB 1XXFA 4X1SU 2WPJS 1P10A 8KME2 2FOGA 1T7CA 2RCEA 2ZKSA 1C2EA 4GAWA 4NG9H 3RMOH 2Y5HA 4LXBH 1DLKB 1ORFA 1J9CH 1C5RA 3T26A 2C4FH 9LPRA 3FFGA 1HBTH 3Q00A 2PFEA 2VH0A 1BZXE 4JMYA 2ZF0H 3BEFB 1KSNA 2BDHA 1TOCB 3FP7E 3GCTG 3H7OA 2PTNA 1TRNA 1CE5A 5EXMA 1PPEE 1O33A 3F9GA 1MCVA 1GBEA 1QHRB 3NCLA 2W3IA 1THPB 3GY7A 1KXCA 1K28D 2F9BH 1P05A 4ABFA 2CN0H 1SG8B 1TGCA 3S7KB 3RXOA 1BTYA 2BX4A 2FXRA 3S7HB 2XXLA 1DY9A 2Z3DA 1CT4E 3GY4A 1S82A 2UUYA 3PTBA 1V6DA 4K8BA 1FNIA 2H2ZA 4Y71A 3RXHA 4ZHLU 3A7VA 3DFLA 8GCHG 2ZU2A 4OGYA 3UPEA 2ZHFH 3TK6A 2BMGB 1LHEH 4AGKA 4Y7AA 1NESE 2UWLA 1FY5A 2J95A 4IGDA 4K5ZA 3L6PA 2BD8A 1BTPA 2BX3A 2Z3EA 3RXCA 4CRBA 2VNTA 1S6FA 1QL9A 1QBVH 4X6MA 3ZV8A 2G00A 4A7IB 1C1VH 2JETC 4AYYB 4D7FA 1ZJDA 1NN6A 5H4IB 3ZZ4A 3MOCA 5FPYA 5FPSA 1UK3A 3RMMH 1INCA 1SSXA 1LQEA 3KQDA 1AFQB 1QBOA 2A5AA 2HPPH 1WV7H 1J14A 3GDUA 1XVOA 1TX8A 2ZU5A 1ACBE 1G9IE 1C5QA 1B7XB 1NO9H 4JK6A 5JYIA 1P57B 2HLCA 1A3BH 2UWPA 1YLCA 3UY9A 3SI4H 1Y5AT 3A84A 2Z9JA 1F7ZA 4B73A 1NRPH 4O03A 2I6QA 2A7JA 4IMZA 3SJ9A 3TH4H 3RLYH 2W7SA 5DP8A 1MAYA 4DURA 5PTPA 2WUCA 4AGJA 1BTUA 2CGAA 4Y8YA 1A1RA 2O8WA 4B74A 1BMAA 1HAXB 1E37B 1ANBA 2AERH 3A8AA 3MU5A 5FX6A 3PYHA 2DE9A 3M36A 1CGIE 4OS1A 1AWHB 1J17T 4YOJA 1PQAA 3GOVB 1GDNA 5JBTA 4TYDA 3A89A 2QCYA 1P2MA 4WJG2 3L33A 1C1RA 2GD4B 1C4Y2 1Z8RA 3V3MA 2ZHDA 3PMAB 3BN9A 1IQIA 3PWBA 1V2RT 2AIPA 2Q6DA 3A85A 1KDQA 3AVZA 2QXJA 4AZ2B 1IQHA 1NFUA 2TGPZ 2O8MA 2XWBI 3VFEA 1P9UA 2STBE 2PSXA 4KP0A 9ESTA 4D9QA 1GBIA 2BM2A 3MNSA 2TGAA 1K22H 3TJNA 1MZDA 2HRVA 5GCHF 5DK1A 2JETB 4DT7B 3DT0H 3VB7A 2OQUA 2ZQ2A 4I8JA 1OYTH 1ZRKA 3V12A 1CA8B 2Y6TA 3LIWA 4NGAH 1C2DA 1P2QA 2BDIA 2A32A 1ZRBA 3VPKA 1C5UA 2GV6A 1F92A 3FAOA 3PLKA 1KXAA 4XBCA 2XBXA 1LTOA 3BSQA 4FUHA 3T5FH 5G4BA 3ZVEA 1Q31A 3RXGA 1IOEA 4IN1A 2I6SA 3SNDA 1DDJA 2XNIA 1CHOG 4MNWA 1JMOH 1TNJA 2QXHA 4KTCA 5IYTA 1GI0A 5C67A 2J38A 2AMPA 4DIHH 1F0SA 4RKJB 3SGQE 3PO1C 1ANDA 2HOBA 5DGJA 3GYLB 1JIRA 5J4SA 3S9BA 3ZZBA 1GVKB 4KKDA 1G36A 4WH8A 1FN8A 3E1XB 4B1TA 4NSYA 1P9SA 4PROA 1S83A 3SJOA 2EA3A 1UMAH 3OY5U 1CQQA 2BZAA 1V2ST 4NWKA 5EPNA 1ETTH 3ENSB 1MTUA 2AIQA 1MTVA 1VITG 1NFWA 3A7YA 2GCHG 2VVVA 3S69A 3DD2H 2ZDVH 1X7AC 3RDZA 6ESTA 1AKSA 4I32A 3GY2A 1A0HB 1W7GH 2R3YA 1DXWA 1PPZA 4ZHMU 1P01A 4Y8XA 1V2TT 1GCTC 2AFQB 4FU9A 1QIXB 1N1LA 4IBLH 4LZ4B 2V3OH 2OC8A 4JZ1A 1FV9A 3ZZ3A 1QJ7B 3RC4A 1F0RA 2BXUH 2OP9A 1TGSZ 2UUFB 5K0HA 1BHXF 4ZAEA 2FLRH 1AVXA 1S0QA 3A8BA 1C2KA 2ZFRH 1GL0E 2BLOA 1ELCA 1GJ8B 5I46H 2O8TA 2Z9LA 1FPHH 5E0JA 2PV9B 4Y79A 5FX5A 3A81A 3E6PH 4CRAA 1VITH 1QR3E 1G3CA 1UVOA 4QT8C 2P3TB 1YP9A 1C4U2 1GVLA 1F0TA 4ZHAA 4INHA 3RXIA 5C20A 2HGTH 1TYNA 3GCHC 3TNTA 1LPGB 1UTLM 3BIVH 4IMQA 1GHAF 1UO6A 3F9FA 3RXJA 2SGQE 1J15A 4YTAA 2Y7ZA 1MQ6A 3PMBB 2BLWA 1D6WA 1XUJA 3PO1B 5A0AE 1NT1A 1O2YA 1SLVB 4SGAE 4B2BA 2FESH 4UFGH 2JH0D 1OWDA 3TH3H 1C9PA 1V2QT 1TNHA 4O3UA 1TQ7B 3RXUA 3A7XA 1EZSC 3U1JB 1ETSH 2QXGA 3R0FA 2ZI2H 3MU0A 2ZHEH 3P8OA 2JKHA 2XC0A 1NZQH 4AYVB 2QAAA 1BMLA 1QJ6B 1K9OE 1CGHA 3RXTA 4DGJA 3RM0H 1QTFA 1LPZB 1AGJA 3BV9B 5A0BA 1D3QB 2AYWA 1TONA 6CHAC 1GBBA 4Y6DA 1C2FA 1JXPA 2J9NA 2AMQA 4KGAA 4OS6A 2ZC9H 4K2YA 1GCTB 1TNGA 1Z8IB 1HV7A 2BDGA 1P2JA 4MG3A 5GJ4B 2IOTA 5EQSA 1OWKA 2BD5A 2D8WA 1A0LA 1QA0A 1K1JA 2FWWA 1GMCG 5C5OA 4BTTB 2TBSA 1N6XA 2DE8A 5LH8A 1ZYOA 2XYAA 7GCHG 1O3OA 1ZMLA 2PUXB 1RTFB 3SUGA 1DX5M 4YM9A 1EQ9A 2UUJB 2EEKA 1K1PA 1QB1A 2FPZA 1AB9C 2ILNA 1Z6JH 4X1PU 3RXKA 1CVWH 2XCNA 1BMNH 1BBRE 1GI5A 3HATH 3SU0A 3GCOA 3HKIB 1BIOA 3G01A 5EXLA 5T6FA 3V7TA 2G51A 2CF8H 2CJIA 3RXBA 5JBCS 3URCA 1AE8H 1GJCB 2F9VA 2ZA5A 2Y80A 4WMEA 1O5CB 1ZHMA 3V13A 4A92A 2Z9GA 2Q1JA 1SLXB 3TLOA 2XRCA 3K2UA 1QQUA 3LJOA 3RXSA 1Y5UT 1ANCA 2W3KA 4Q80A 3NK8A 2AGGX 1SGPE 3ZYEA 4X6PA 1OXGA 3RUOA 6GCHF 2XTTB 4I8KA 1ELGA 3SJIA 1BTWA 2ZQ1A 4FUJA 1EP5A 1XKBC 4LK4A 3EE0B 2ZP0H 4O3TA 3KIDU 3E3TA 4ZH8A 3UWJH 5DP5A 5DKMA 5HM2A 4MNYA 1GMHG 3SORA 2BOKA 5A8YA 4WVPE 4D8NA 3FP8E 4ESTE 3QTOH 2Z94A 2OLGA 1KLTA 1O3DA 3QZQA 6CHAB 1U6QA 4K69A 1OPHB 1CBWC 1GJ4H 1TMBH 1ZHPA 1GI2A 1SLWB 4GCHG 1XXDA 3LGTA 3MU1A 1EZXC 1IQKA 4ABBA 1DANH 2QF3A 1OKXA 1GCDA 1VR1H 1KLIH 2GT7A 4Y10E 1O38A 1TIOA 1Z6EA 1D9IA 2WV4A 1EZUC 3TGJE 2ZNKH 1N6YA 1QA7A 1THSH 4FUIA 5EW2H 2ZDMA 3Q76A 3PV4A 5C3NA 1MTWA 5ABWA 2THFB 2M5TA 1J8AA 1WBGB 1HFDA 1SLUB 1LHFH 1AN1E 1AB9B 2ZU4A 2BD3A 2CV3A 3LPRA 1JWTA 2ODPA 2PR3A 3JZ1B 3OX7U 2ZPSA 4NIVA 4OGXA 1TNLA 2PW8H 3RXAA 3T28A 5EU8A 2ZTXA 3LJJA 1GWAA 3LC3A 3ITIA 1KTTB 3TU7H 2FS9A 4K1TA 1LQDB 3AW0A 2P94A 4ISIH 4YT7H 1SGIB 1HJ9A 3RXMA 4Z6AH 3SQEE 3GCNA 3MNBA 5FAHA 1RGQA 3F1SB 3AAUA 4H4FA 4U2WA 3OYPA 1C5NH 4MPXA 4AB9A 1O2VA 2VH6A 1L4ZA 3N7OA 1TA2A 3PMJA 2GZ8A 1CT2E 2AH4X 4MDSA 1DOJA 1S81A 3H7TA 2OQ5A 1HXFH 1SR5C 1O3NA 3TPIZ 3P8GA 4UONA 4I7YH 4A1XA 3ZZDA 5LGOA 3PROA 2BDAA 4BAKB 1H8DH 1QURH 5DP4A 3UNRA 1AKSB 1UTPA 5EG4A 1UHBA 1P09A 4KTSA 2C93B 3ATMA 1XUFA 5E2OA 2XW9A 3ESTA 4X6OA 4DVAU 4XBDA 3A8DA 2HNTC 2SGFE 1S5SA 5E2PA 1FY8E 1MU8B 3D49H 5EPYA 5C1UA 8GCHF 1Y3VA 3SW2B 1GJ7B 1MH0A 2J94A 5DP3A 2D2DA 2XBYA 5E8EH 3CP7A 3LT3A 1QFKH 4CRGA 2ASUB 4IC6A 2ZDAH 4Y0ZE 4DY7B 1C1NA 3VEQB 2ALPA 3KGPA 4FUBA 2LPRA 3NKKA 8LPRA 2J4IA 1ZMNA 2CMYA 1L1GA 3M3VA 2SNWA 3ATKA 1EKBB 1KXFA 1H8IH 1YPHC 4Q7XA 5ESTE 2XWAA 3UREA 3O8RA 1K1LA 2QIQA 1ID5H 3Q77A 2F9PA 4FU7A 4F4OC 3RC6A 4CRFA 3VXFH 2J34A 4ISLA 1O3JA 2B0FA 4AORA 2PKAB 1O31A 3TJUA 5A09A 3BTTE 3F9EA 1DWBH 3EDXB 1Y3UA 1SI5H 3GDVA 5BPEA 1PPHE 1TGBA 2NU3E 5JDUB 3E90B 2UWOA 1T31A 1DXPA 1TBZH 3PB1E 4IN2A 2GV7A 3BTFE 3UUZA 1WTGH 2JH5D 4E05H 2ZTYA 3F9HA 3S9CA 1SGFG 4E06H 1NROH 1YGCH 3KL6A 2FTMA 1OSSA 4Y76A 1O3EA 1AQ7A 4UFEH 5DP6A 5E0GA 3UQOA 2FMJA 1V2LT 3Q3KA 3TITA 5HYOA 3LGWA 1O2JA 2P59A 2GMTC 3VB5A 4JZIA 1C5XB 3QX5H 1P06A 1GPZA 5GWZA 5C1XA 1XX9A 3TGKE 1UJ1A 1W0YH 4UD9H 5L2YH 2RA0A 1ZTLA 1QB6A 3EGKH 1AU8A 1W8BH 1SHHB 1YPHE 2VU8E 1BJUA 4BXWA 3MHWU 1O2NA 5A8XA 1O2RA 4NCYA 2GX4A 5L6NH 4NSVA 2F9OA 1UCYK 4HFPB 1WTHD 1G3DA 1V2PT 1UTQA 4K1SA 1EX3A 1BQYA 1FXYA 4ISNA 4MNXA 1EASA 1T8NA 3P92A 1GHBG 2GCTC 3C27B 2VWLA 3QTVH 3W94A 1GBJA 1O2MA 3ZZ6A 1GJBB 4OS7A 4BAHB 2RA3A 4M7GA 7ESTE 1UCYH 5IDKA 3DFJA 4ISHH 3SN8A 1W2KH 2BVSH 4HGCA 2OTVA 4B71A 1QRWA 2A5KA 2GGVB 4NFEA 1TX6A 3MU8A 4Q2KA 3OY6U 3ZVDA 1GI6A 1CGJE 1TNKA 5EQQA 4XFQA 1XVMA 1KIGH 4ABAA 4I31A 5AHGH 3CENA 4X0WU 1CHOF 4MPUA 3HK3B 2B8OH 2A7CA 3RXDA 3RXFA 1PPGE 1FONA 1Y3YA 5EGMA 1AD8H 3NZIA 2PGQB 5TCAA 1KXEA 1SQAA 4TWYA 3SNCA 3ATLA 1E36B 1PPFE 3VB3A 4GVUA 1Y59T 4X2YA 2UUKB 3GYMA 4O97A 2F83A 2STAE 1O3GA 1YPMH 2SGEE 1TBRH 2GMTB 1SHYA 3BTHE 1SGYE 1ZLRA 3PTNA 4OS2A 1VCPA 1SBWA 1KLJH 1FY4A 2BY8X 1Y8TA 1P02A 4JZEH 1A5GH 3MYWA 2PLXA 1VZQH 2D1JA 3A7WA 3SGBE 1LVOA 2FLBH 2ZGXH 3A87A 3KN2A 4WMFA 4AN7A 2GCHF 3UOUA 4FUEA 1KY9A 4ZXXH 1NU9A 5F8ZA 2AGIX 1FY3A 1W0ZU 2FM2A 1V3XA 1BA8B 3A8CA 1SC8U 2WUBA 3SV7A 3EA9A 1GL1A 3HGPA 1GJAB 4KTUA 1AFEH 4NIXA 2FI5E 1TX7A 2O8UA 5HGGA 2FP7B 4J1YA 4ABEA 4A5TS 2ZCLP 4WY3A 1OWHA 1MZAA 1P12E 3BG4C 1K1OA 2Q6FA 2VIQA 3MO9A 4OS5A 3MH4A 3BTKE 1C1WH 3MWIU 1UVPA 1G32B 3M5LA 4THNH 1GI4A 2ANKH 2EI6A 1L2EA 1F5LA 1LPKB 1NFYA 1QCPA 1MMJN 1YPKH 3GY6A 2XC4A 4Q7ZA 3P8NA 3UNQA 1HXEH 1YM0A 2VGCC 3F6UH 1QNJA 4X1NU 2G81E 3PMHB 2Z6BD 2B9LA 4R0IA 4FUGA 3KF2A 4JYVH 5C5NA 1TOMH 3MMGA 1TNIA 3H5CB 1GBTA 1YLDA 1C5SA 1VJAU 1G3EA 1XKAC 3GY8A 1UTOA 1P2NA 3W95A 5HM9A 1LVYA 3BEUA 1PYTD 1CT0E 1C1TA 1ELFA 1P2OA 2ODYB 1C1SA 2XCFA 4H6TA 1NRSH 4TY6A 1TLDA 4DJZB 4IW4E 2A4RA 3V0XA 1JBUH 1GBFA 1ESAA 1UHBB 2FX4A 1K1MA 3ZZ8A 1O5EH 1GJ6A 4GLYA 4NIYA 4X1RU 1BCUH 1ZGIA 2AEIH 2HVXA 2G5VA 1SFQB 1C5LH 3P17H 2BTCE 1W13U 4JCNA 4ASHA 1CU1A 1VCWA 3O8BA 3RLWH 2VIVA 1NRRH 1UK2A 2FOAA 4X8TH 2FI3E 5EODA 1P3CA 4MTBA 2OBOA 3FVFB 2SFAA 2BD4A 2OD3B 3TIUA 1SOTA 3SO3A 5EQRA 1QRZA 3ZZ5A 2QF0A 3U8RH 2A5IA 1ZPBA 4J2YB 1HAOH 1GMCF 4XSKU 4AFUA 1ZSLA 1DVAH 2H9HA 4AFQA 1SGDE 1HUTH 4I33A 7GCHF 2ODQA 3TJVA 2TIOA 3SZNA 4GHQA 3UWIA 1IQLA 4WXVA 3RXLA 3VB6A 1E34B 3BG4B 4UFDH 2GP9B 4U32A 1HAHH 2PKAA 1LKBA 2HWLB 4F49A 3A80A 3BTME 4TPYA 4E7NA 1L1JA 3BTQE 5CMXH 3L3TA 2FOEA 1V2JT 4DCDA 1GI1A 1NRQH 1Z1IA 3BG8A 1EJMA 2GDDA 2VGCB 3M5MA 2O8LA 4X8SH 3OSYA 4CBOA 2PHBA 3ZVBA 3LGIA 2R3UA 5A0CA 3KEEA 4CHAC 3LGYA 1PQ5A 1K1IA 2B7DH 1Y3XA 2BLVA 2G4TA 3QZRA 1OP0A 4ZKRU 1BUIA 1O34A 2FO9A 3A82A 3E0NB 1DUAA 2VIWA 4JYUH 2VIDA 1IQGA 1FAXA 3EYDA 3NWUA 4MPVA 3STIA 1O3IA 2LNCA 1NY22 3UFAA 1BRAA 1HB0B 2BQ7B 2RDLA 2C3SA 2NU2E 5L2ZH 1ZGVA 2RG3A 1MKXK 2TGTA 3ZZAA 1L0ZA 5LPEA 1HNEE 1ZMJA 3RMLH 1FAKH 2FYQA 2AGEX 3T2NA 4UDWH 4K3JA 1NU7B 1GBDA 2BB4A 1TPOA 5T6DA 3R3GB 1EAXA 1EAWA 1O35A 1O5FH 1O2PA 2A4OA 2FYRA 1Y5BT 4ABHA 2DUCA 2HNTF 5F8TA 4GCHF 1HGTH 2VIPA 3T62A 2XC5A 1IQFA 2KAIB 2Y5GA 1BTZA 4AB8A 1MAXA 1MKXH 2WPHS 2D26C 3RU4E 3T27A 1UVUH 1A7SA 1RIWC 3GICB 2R0KA 3BTDE 1C2IA 1O2WA 4XOJA 4ZUHA 1S85A 1O2TA 3GCHB 3KQBA 2P3UB 1C1QA 1GHAG 1GBLA 4OS4A 1BRUP 1C5OH 1P3EA 1O2KA 4XDEA 1PPCE 1S0RA 1O2OA 3NPSA 1JRTA 1ELBA 4CR5A 5FCRA 2FOBA 5TCCA 1O5GH 3ELAH 3EQ0H 2H6MA 2VWOA 1EPTC 1B0FA 2A7HA 1G30B 3U69H 4NZLA 3U8OH 1PQ7A 4WH6A 4YLUA 3M7QA 1G3BA 2BDCA 3MTYA 1OS8A 2BYAX 2NWNA 4CHAB 1Q2WA 4MNVA 2A4QA 4VGCC 1BT7A 1T8OA 3QWCH 3M3SA 5I25A 1LMWB 4CH8B 4XE4A 3BTGE 2A31A 1WUNH 3QGJA 1HJAC 1B5GH 3GY3A 2C90B 5F03A 1WOFA 1P2IA 1GHWH 5L30H 3M7TA 4WF8A 3ZYDA 2ESTE 2OBQA 1O2ZA 4FVBA 4ZKNU 1ZHRA 1C5MD 2FOMB 2R2MB 1P03A 1ELVA 3M37A 4BXSA 2ZWLH 3DHKH 1NPMA 1N8OC 1HAPH 4K1EA 5DP7A 1G2MA 2A45B 1OWEA 4GSOA 1GMDF 2OCVB 3PWCA 4BAQB 3RXPA 3A7ZA 1WYKA 1BITA 2ALVA 1A61H 3QO6A 1SGEE 4HI3A 1PPBH 3ZZ9A 1DUEA 1RIWB 1TMUH 1OP2A 2Z9IA 2ZGCA 2ZTZA 2BD9A 2IPHA 4B2AA 1V2KT 1ARCA 1Z1JA 3SHCH 1IQNA 4AFSA 1ZZZA 4NWLA 1SQTA 2ZGBH 2P8OC 4E7RG 3U1IB 2GZ9A 3FZDA 5J4QA 3URDA 1CO7E 3EA8A 1T4UH 3SBKA 4YESB 2ZFQH 1MUEB 2CHAC 3ZVGA 1QJ1B 4ISOA 1Z8JB 5AFYH 4HZHA 1NM6A 6GCHG 3ATIA 1O3AA 1K21H 1O2GH 3M5OA 3GCTF 4X8UH 4WWYA 3TH2H 4INKA 2OINA 4ZROA 3NUMA 3RU4T 1ZJKA 3LDXH 1WSSH 1BTXA 3KCGH 1UVTH 3LU9B 1D6RA 2VINA 5JB9S 3ODFA 3PLBA 1YYY1 3P95A 2YOLA 1T8LA 4VGCB 4IC5A 1ESBA 2ZDLA 5DO4H 4CRCA 4Y7BA 4X2WA 2BXTH 2QY0B 1EUFA 2FI4E 3SNAA 4RN6A 3A83A 5FXLA 3LOXA 5ETXA 1BRBE 1ELTA 1F5KU 1MKWK 5GPIB 5C2ZA 1KXDA 1WCZA 2SNVA 1O5DH 4TPIZ 1DE7H 4WXIA 1XM1A 1CBWB 1KXBA 4BOHA 1W14U 2FEQH 2WPMS 3C1KA 1WQVH 1F2SE 1THRH 1N8OB 2TGDA 5GDSH 1Y3WA 1C5YB 2Z7FE 3QN7A 1P11E 1GHZA 2OC0A 5LPFA 4ZKSU 1HPGA 1G2LA 4JZFH 1MKWH 1TPAE 3SUEA 1AVGH 1GDQA 4NA7A 1HYLA 3A88A 1K2I1 3QLPH 1GI7B 2J2UA 4CR9A 1RJXB 3RP2A 1EJNA 3HPTB 1CSOE 3LGVA 2W5EA 1FIZA 1M9UA 1O2SA 1PQ8A 2OUAA 4D76A 1GHBF 1CHGA 4BTUB 2R2WU 3ZVFA 4NA8A 3MFJA 1EAIA 4HTCH 1SGQE 1MU6B 4RKOB 5DP9A 3MU4A 2O9QA 1HAYB 1C1PA 1GI9B 2OXSA 3ZZCA 2P8OB 5F6MA 2PUQH 1LHGH 3A7TA 2BQWB 4Y11E 3TK5A 5BRRE 2QA9E 1C2HA 2CHAB 1H9HE 1PJPA 1T4VH 3LH3A 3AAVA 3SQHE 3RU4D 1AZ8A 4K8YA 2HNTE 2A1DB 2ZPRA 3BTEE 5EW1H 3RXRA 3RXQA 2V35A 3SUFA 1ABJH 1DSTA 2CF9H 4MPWA 1ZOMA 2SGAA 1TFXA 1UTNA 3E16B 6LPRA 1YC0A 2VB0A 1FY1A 1HIAB 1ZR0A 2PKSC 2SGDE 3AASA 5ESBA 4H42U 1LO6A 1O3MA 2GDEH 3KQEA 2AMDA 4CRDA 2FODA 3UQVA 4MQAA 5FPTA 1O39A 1A5IA 1FN6A 3PM3A 3SU5A 2PGBB 4YOIA 3EAJA 1XUKA 1BDAA 2VWNA 1D3TB 2FZZA 1GHYH 3RXEA 4FVDA 5FBIA 4XBBA 1YPLH 2GVFA 1L4DA 3QUMP 1C1MA 1AI8H 1TB6H 1A4WH 1O32A 1A46H 1GJ5H 3BF6H 1S6HA 1V2WT 4B76A 2KAIA 4GPGA 2VWMA 4NZQA 1XUIA 1T8MA 4X8VH 5T6GA 3O8CA 1JOUB 1BRCE 2ZHQH 1HLTH 2ZU3A 3SU2A 1L1NA 1AY6H 2C8WB 1EAUA 2HPQH 2H5DA 1ELEE 2BLQA 4BTIB 4MVNA 3GDSA 5GXPA 2EI7A 3K65B 4A6LA 1ZSJA 4D7GA 2BY9X 1O5BB 3LC5A 3GY5A 2EI8A 3KNXA 1OOKB 3SV9A 5E0HA 5FHTA 2ZU1A 4DG4A 3T29A 3SV6A 2A0QB 1LVMA 1FLEE 3NXPA 1LHCH 3S0NA 3B23B 3SU3A 1MBMA 5HXFA 1TPPA 1FQ3A 1H9IE 1UTMA 1AMHA 1LHDH 1HCGA 2BD7A 1A5HA 1H4WA 1SL3A 2QV1A 3ZZ7A 1V2UT 2PKSB 1ZSKA 2FOHA 1O3LA 3RM2H 2V0BA 3Q3YA 1C5PA 1F5RA 1GDUA 2GZ7A 1VITF 3RMNH 1W10U 4Z0KA 3LH1A 5DPAA 1FPCH 1RTLA 2W26A 1TPSA 3QGNB 1GBHA 1W11U 1FDPA 3F68H 4NA9H 5AF9H 2BY6X 1BTHH 3S9AA 2VIOA 1P0SH 2BQ6B 2R0LA 4UEHH 1VJ9U 4CBNA 1GBAA 1RRKA 1GHVH 4BNRA 4B2CA 1YBWA 1P8VC 2ZFPH 1AUTC 2WINI 3ZVCA 3TNSA 2J92A 3SV8A 2GCTB 4GHTA 2WPKS 3DA9B 3DUXH 1DT2A 3BTWE 1HAVA 3MI4A 1GHXH 1D3PB 3D23A 2ZIQH 1EZQA 4UE7H 4AFZA 1WQSA 3CS0A 3IWMA 1C1OA 1JIMA 1UCYE 1ZTKA 1RTKA 1AVWA 2ZFSA 1SGNE 3M3TA 5EXNA 3SU6A 1DPOA 4AG1A 1EP6A 2YNBA 3KHVA 2TPIZ 1HRTH 1MTSA 4X1QU 4R8TB 1O37A 1IHTH 3MH5A 2IN2A 1EXFA 5T3HA 1EPTA 1GGDC 2ZEBA 3SU1A 4D9RA 1O2XA 5B6OA 4AG2A 2ANWA 2BVRH 4DW2U 1UVSH 1MBQA 1FIWA 1UK4A 1DITH 4X2XA 3SUDA 2Y81A 1C5WB 3MO6A 1VCQA 4X6NA 2H9TH 3RC5A 1FMGA 1SGTA 2A2QH 3ZVAA 2NU1E 4JK5A 2IJOB 2BHGA 1O2HA 3LONA 3STJA 2P3FH 2ZGJA 2ZDKA 2VVCA 1SGRE 1H9LB 7KMEH 2QYIA 1TBQH 2OC1A 1C2MA 5GCHG 1QRXA 1ZPZA 3E8LA 5JBBS 5FCKA 1SB1H 1O3PB 2QGRA 2F3CE 1ELDE 1BBRK 1BB0B 2V3HH 3D62A 1CA0C 2ZDNA 1DWCH 2WV5A 3BIUH 2ZECA 3TVJB 3VGCC 3MNCA 3EA7A 1B0EA 3I78A 4NIWA 1SMFE 1K1NA 3RXVA 4AOQA 2BY5X 1H1BA 1KTSB 1NC6A 1FUJA 2W7UA 1BBRH 2G8TA 1FI8A 3FP6E 4O9VA 1D4PB 2B5TB 1MCTA 5EOKA 3QDZB 1C2LA 4U30A 4YT6H 1O3HA 3M61U 1E0FD 1LDTT 1QBNA 2BOHB 2Z3CA 1UTKA 4A1TA 4BANB 2QN5T 1ANEA 1ETRH 1RXPA 2K1QA 4BAMB 1C9TA 1A0JA 2ANMH 3Q3XA 1WU1A 1TGTA 1EOLA 1O0DH 2ZPQA 1C2GA 1G37A 2Y82A 2G55A 3P70B 1DWEH 3K9XB 4YZUA 1GGDB 2TRMA 1IHSH 5JPMH 4ABJA 7LPRA 1MTNC 1WAYB 1KYNA 1TGNA 1RFNA 2XBVA 3P6ZB 4FU8A 3VB4A 5SGAE 5DG6A 1OWIA 1DSUA 1YPEH 1MQ5A 2OC7A 1V2OT 1HIAA 3M5NA 1P2KA 2QXIA 3BEIB 5JBAS 1LVBA 3I29A 1E35B 2FOCA 3SJ8A 3KQCA 4ZMAH 2PTCE 3E91A 1OYQA 1QL8A 3HKJB 1O3FA 1GG6C 1DY8A 2ZO3H 3MH6A 1DFPA 1GMHF 1OX1A 2BVXH 2PSYA 4YLQH 2F9NA 1YKTA 3IITA 1DS2E 4DIIH 1O2QA 3SI3H 2H9EH 1W12U 4U01A 2P93A 1AIXH 2BZ6H 2P16A 1YF4A 2GKVE 5JB8S 1NRNH 1AO5A 3MO3A 3UR6A 1CA0B 1TA6A 1HAGE 1MD8A 1BOQA 3TK9A 3OU0A 1QL7A 2FS8A 1GI8B 4SGBE 3VGCB 3MH7A 3SOSA 4UFFH 1E38B 4FUDA 5AFZH 1O3KA 3ZV9A 3A86A 1VGCC 2FDAA 3U8TH 1GI3A 4RSPA 1A2CH 3HGNA 4ABGA 4ZKOU 1YPGH 2BD2A 4X2VA 3SHAH 3K6YA 4H6SB 3AW1A 1NFXA 1C4V2 3LGUA 4AX9H 1O36A 4IS5A 5K7RA 2Z9KA 2AS9A 2ZCKP 5HMAA 4MLFB 1D3DB 1HAZB 1TQ0B 1ARBA 2H1UA 2WPLS 1HDTH 3VXEH 2ZHWH 1O5AB 1NS3A 2H5CA 2HALA 4INLA 1QY6A 2ULLA 3T25A 2C8YB 1DM4B 1SPJA 1EATA 1YPJH 2BY7X 1SOZA 1AUJA 1PFXC 5DJ7A 2FTLE 3JZ2B 1TABE 5FBEA 2C8ZB 2NU4E 1MTNB 1MD7A 3SNEA 1JRSA 5LPRA 3UOPA 5C1YA 5AVDA 2VJ1A 1FZZA 1GJ9B 5A2MH 2ANYA 1O3CA 2WYGA 4FXGH 1IQJA 3P8FA 1P04A 3K6ZA 4LZ1H 1QGFA 4TWWA 3UIRA 1SGCA 5A8ZA 4CREA 1C1UH 2WPIS 5CHAC 4ABDA 1O30A 4I8LA 2GT8A 1ZTJA 1F0UA 3OTJE 1GG6B 1GBKA 2VVUA 2G5NA 1T32A 4Y0YE 1OP8A 2BDBA 1IQEA 1KDQB 3U98H 1BJVA 1YCPM 1C5TA 1O2LA 2EC9H
chains in the Genus database with same CATH superfamily
1C5VA 1ZPCA 4ABIA 4Y8ZA 1HJ8A 2R9PA 3OFND 4WMDA 3HK6B 1IAUA 1TAWA 3FANA 5TJXA 3SGAE 1O3BA 3FZZA 1O2UA 2P95A 2FIRH 3ATWA 4Q7YA 1HAVB 1Z8GA 2EY4C 4A1VA 3M7UA 2CXVA 3PLPA 2G4UA 4GUXA 1VGCB 1O2IA 1ELAA 2F91A 2F9UA 3B9FH 2SGPE 1W3CA 1DICA 1AZZA 3CS7A 2FX6A 2XBWA 2A4GA 3SNBA 4I8HA 4CH2B 3UR9A 1ESTA 1EB1H 4FUCA 2ZZUH 1AHTH 5CE1A 2A2XH 1Z71A 3IG6B 3TJOA 2ZGHA 1XMNB 1WXRA 1BMMH 4DOQA 3LKWA 4KELA 3SJKA 3O8DA 1W7XH 2QC2A 2RFKC 2JH6D 2C8XB 3B8JA 1EPTB 4YOGA 1V2VT 3I77A 1EOJA 4B6EA 1SGFA 1TRYA 2FOFA 1Z7KA 4YO9A 4B6FA 4ACAA 3M35A 4JZDH 1RS0A 1LCYA 1QB9A 4BAOB 3E0PB 1TWXB 2ZFTA 1A3EH 2WYJA 2G52A 4JYTA 1TMTH 1SVPA 3WY8A 1V2NT 3PRDA 1IQMA 3UTUH 1HJAB 5GIBA 1XUGA 4K60A 1YCPK 3GISB 2NU0E 3OAAD 1PYTC 1V2MT 1AE5A 1TRMA 4LOYH 3TGIE 2L6OA 1EJAA 1NTPA 5CHAB 8ESTE 2ZFFH 1DWDH 4TY7A 3SU4A 4NFFA 1C5ZB 1C2JA 3D65E 1ABIH 3UNSA 5F8XA 1GBCA 4ZXYH 3U9AH 1BHXB 1TE0A 1GMDG 1GVZA 1J16A 1FJSA 4B75A 1SQOA 1SFIA 1YCPH 1EB2A 1XUHA 2BDYA 3MNXA 1AWFH 1HAIH 2Y5FA 3SV2H 1QQ4A 3QK1A 4FUFA 1DLEA 1AFQC 1LKAA 1Q3XA 1UTJA 2Y7XA 1TALA 2Q6GA 1GBMA 1OWJA 2V6NA 1RD3B 2PWXA 4I8GA 1S84A 2GTBA 2ZCHP 2ZG0H 2YNAA 3ODDA 1GJDB 1XXFA 4X1SU 2WPJS 1P10A 8KME2 2FOGA 5DSFA 1T7CA 4M9FA 5EJLA 2RCEA 2ZKSA 1C2EA 4GAWA 4NG9H 3RMOH 2Y5HA 4LXBH 1DLKB 1ORFA 3KYFA 1J9CH 1C5RA 3T26A 2C4FH 9LPRA 3FFGA 3MQKC 1HBTH 3Q00A 2PFEA 2VH0A 1BZXE 4JMYA 2ZF0H 3BEFB 1KSNA 2BDHA 1TOCB 3FP7E 3GCTG 3H7OA 2PTNA 1TRNA 4HG6A 1CE5A 5EXMA 1PPEE 1O33A 3F9GA 1MCVA 1GBEA 1QHRB 3NCLA 2W3IA 1THPB 3GY7A 1KXCA 1K28D 2F9BH 1P05A 4FETA 4ABFA 2CN0H 1SG8B 1TGCA 3S7KB 3RXOA 1BTYA 2BX4A 2FXRA 3S7HB 2XXLA 1DY9A 2Z3DA 1CT4E 3GY4A 1S82A 2UUYA 3PTBA 1V6DA 4K8BA 1FNIA 5EJ1A 2H2ZA 4Y71A 3RXHA 4ZHLU 5DN6D 3A7VA 3DFLA 8GCHG 2ZU2A 4OGYA 3UPEA 2ZHFH 3TK6A 2BMGB 1LHEH 4AGKA 2V3MA 4Y7AA 1NESE 2UWLA 1FY5A 5HIYA 2J95A 4IGDA 4K5ZA 5B6LA 3L6PA 2BD8A 1BTPA 2BX3A 2Z3EA 3RXCA 4CRBA 2VNTA 1S6FA 1QL9A 1QBVH 3GS9A 4X6MA 3ZV8A 5KECA 2G00A 4A7IB 1C1VH 2JETC 4AYYB 4D7FA 1ZJDA 1NN6A 5H4IB 3ZZ4A 3MOCA 5FPYA 5FPSA 2RDEA 1UK3A 3RMMH 1INCA 1SSXA 1LQEA 3KQDA 1AFQB 1QBOA 2A5AA 2HPPH 2J98A 1WV7H 1J14A 3GDUA 1XVOA 1TX8A 2ZU5A 1ACBE 1G9IE 1C5QA 1B7XB 1NO9H 4JK6A 5JYIA 1P57B 2HLCA 1A3BH 2UWPA 1YLCA 3UY9A 3SI4H 1Y5AT 3A84A 2Z9JA 1F7ZA 4B73A 5CDFE 1NRPH 4O03A 2I6QA 2A7JA 4IMZA 3SJ9A 3TH4H 3RLYH 2W7SA 5DP8A 1MAYA 4DURA 5PTPA 2WUCA 3F2FA 4AGJA 1BTUA 2CGAA 4Y8YA 1A1RA 2O8WA 4B74A 1BMAA 1HAXB 1E37B 1ANBA 2AERH 3EE7A 3A8AA 3MU5A 5FX6A 3PYHA 2DE9A 3M36A 1CGIE 4OS1A 1AWHB 1J17T 4YOJA 1NBMD 1PQAA 3GOVB 1GDNA 5JBTA 4TYDA 3A89A 2QCYA 1P2MA 4WJG2 3L33A 1C1RA 2GD4B 1C4Y2 2CK3D 1Z8RA 3V3MA 2ZHDA 3PMAB 3BN9A 4Q4LA 1IQIA 3PWBA 1V2RT 2AIPA 2Q6DA 3A85A 1KDQA 3AVZA 2QXJA 4AZ2B 1IQHA 1NFUA 2TGPZ 2O8MA 2XWBI 3VFEA 4Z1MD 1P9UA 2STBE 2PSXA 4KP0A 9ESTA 4D9QA 1GBIA 2BM2A 2KCYA 3OEED 3MNSA 2TGAA 1K22H 3TJNA 1MZDA 2HRVA 5GCHF 5DK1A 2JETB 4DT7B 3DT0H 3VB7A 2OQUA 2ZQ2A 4I8JA 1OYTH 1ZRKA 3V12A 1CA8B 2Y6TA 3LIWA 4NGAH 3AK5A 1C2DA 1P2QA 2BDIA 2A32A 1ZRBA 3VPKA 1C5UA 2GV6A 1F92A 3FAOA 3PLKA 1KXAA 4XBCA 2XBXA 1LTOA 3BSQA 1KMHB 4FUHA 3N99A 3T5FH 5G4BA 3ZVEA 1Q31A 3RXGA 1IOEA 4IN1A 2I6SA 3SNDA 1DDJA 2XNIA 1CHOG 4MNWA 1JMOH 1TNJA 1E79D 2QXHA 4KTCA 5IYTA 1GI0A 5C67A 2J38A 2AMPA 4DIHH 1F0SA 4RKJB 3SGQE 3PO1C 1ANDA 2HOBA 5DGJA 3GYLB 3OTPA 1JIRA 3N7DA 5J4SA 3S9BA 3ZZBA 1GVKB 4KKDA 1G36A 1SQRA 4WH8A 1FN8A 3E1XB 4B1TA 4NSYA 1P9SA 4PROA 1S83A 3SJOA 2EA3A 1UMAH 3OY5U 1CQQA 2BZAA 3N7EA 1V2ST 4NWKA 5EPNA 4XRNA 1ETTH 3ENSB 1MTUA 2AIQA 1MTVA 1VITG 1NFWA 2J97A 3A7YA 2GCHG 2VVVA 3S69A 3DD2H 1FX0B 2ZDVH 1X7AC 3RDZA 6ESTA 2OK5A 1AKSA 4I32A 3GY2A 1A0HB 1W7GH 2R3YA 1DXWA 1PPZA 4ZHMU 1P01A 4Y8XA 1V2TT 3NRLA 1GCTC 2AFQB 4FU9A 2JJ2D 1QIXB 1N1LA 4IBLH 4LZ4B 2V3OH 2OC8A 4JZ1A 1FV9A 3ZZ3A 1QJ7B 3RC4A 1F0RA 2BXUH 2OP9A 1TGSZ 2UUFB 5K0HA 1BHXF 4ZAEA 2FLRH 1WDIA 1AVXA 1S0QA 5EIYA 3A8BA 1C2KA 2HLDD 4F55A 2ZFRH 1GL0E 2BLOA 1ELCA 1GJ8B 4F48B 5I46H 2O8TA 2Z9LA 1FPHH 5E0JA 2PV9B 4Y79A 5FX5A 3A81A 3E6PH 4CRAA 1VITH 1QR3E 1G3CA 1UVOA 4QT8C 2P3TB 1YP9A 1C4U2 2LELA 1GVLA 1F0TA 4ZHAA 4INHA 3RXIA 5C20A 2HGTH 1TYNA 3GCHC 3TNTA 1LPGB 4TT3D 1UTLM 3BIVH 4IMQA 1GHAF 1UO6A 3F9FA 3RXJA 2SGQE 5C94A 1J15A 4YTAA 2Y7ZA 1MQ6A 3PMBB 2BLWA 1D6WA 1XUJA 3PO1B 5A0AE 2HVYB 1NT1A 1O2YA 1SLVB 4SGAE 4B2BA 2FESH 4UFGH 2JH0D 1OWDA 2KZ4A 3TH3H 1C9PA 1V2QT 1TNHA 4O3UA 1TQ7B 5F53A 3RXUA 2YMSD 3A7XA 1EZSC 3U1JB 1ETSH 2QXGA 2XOKD 3R0FA 2KCPA 2ZI2H 3MU0A 2ZHEH 3P8OA 2JKHA 2XC0A 1NZQH 4AYVB 2QAAA 1BMLA 1QJ6B 1K9OE 1CGHA 3RXTA 2IJD1 4DGJA 3KYGA 3RM0H 1QTFA 1LPZB 1AGJA 3BV9B 5A0BA 1D3QB 2AYWA 1TONA 6CHAC 1GBBA 4Y6DA 1C2FA 1JXPA 2J9NA 2AMQA 4KGAA 4OS6A 2ZC9H 4K2YA 1GCTB 1TNGA 1Z8IB 1HV7A 2BDGA 1P2JA 4MG3A 5GJ4B 2IOTA 5EQSA 1OWKA 2BD5A 2D8WA 1A0LA 1QA0A 1K1JA 2FWWA 1GMCG 4OM9A 2J5UA 5C5OA 4BTTB 5GNDA 2KCOA 1N6XA 2TBSA 2DE8A 5LH8A 1ZYOA 2XYAA 7GCHG 1O3OA 1QZ8A 1ZMLA 2PUXB 2J98B 1RTFB 4RI0A 3SUGA 1DX5M 4YM9A 1EQ9A 2UUJB 2EEKA 1K1PA 1QB1A 2FPZA 1AB9C 2ILNA 1Z6JH 4X1PU 3RXKA 1CVWH 2XCNA 1BMNH 1BBRE 1GI5A 3HATH 3SU0A 3GCOA 3HKIB 1BIOA 3G01A 5EXLA 5T6FA 3V7TA 2G51A 2CF8H 2CJIA 3RXBA 5JBCS 3URCA 1AE8H 1GJCB 2F9VA 2ZA5A 2Y80A 4WMEA 1O5CB 1ZHMA 3V13A 4A92A 2Z9GA 2GJGA 2Q1JA 1SLXB 3TLOA 2XRCA 3K2UA 1QQUA 3LJOA 1YWUA 3RXSA 1Y5UT 3DSOA 5CHBA 1ANCA 2VBCA 2W3KA 4Q80A 3NK8A 2AGGX 1SGPE 3ZYEA 4X6PA 1OXGA 3RUOA 6GCHF 2XTTB 4I8KA 1ELGA 3SJIA 1BTWA 2ZQ1A 4FUJA 1EP5A 1XKBC 4LK4A 3EE0B 2ZP0H 4O3TA 3KIDU 3E3TA 4ZH8A 3UWJH 5DP5A 5DKMA 5HM2A 4MNYA 1GMHG 3SORA 2BOKA 5A8YA 4WVPE 4D8NA 3FP8E 4ESTE 3QTOH 2Z94A 2OLGA 1KLTA 1O3DA 3QZQA 6CHAB 4I86A 1U6QA 4K69A 1OPHB 1CBWC 1GJ4H 1TMBH 1ZHPA 1GI2A 1SLWB 4GCHG 1XXDA 3LGTA 3MU1A 1EZXC 1IQKA 4ABBA 1DANH 2QF3A 1OKXA 1GCDA 1VR1H 1KLIH 2GT7A 4Y10E 1O38A 1TIOA 1Z6EA 1D9IA 2WV4A 1EZUC 3TGJE 3FN8A 2ZNKH 1N6YA 1QA7A 1THSH 4FUIA 5EW2H 2ZDMA 3Q76A 3PV4A 5C3NA 1MTWA 5ABWA 2THFB 2M5TA 1J8AA 1WBGB 1HFDA 1SLUB 1LHFH 1AN1E 1AB9B 2ZU4A 2BD3A 2CV3A 3LPRA 1JWTA 2ODPA 2PR3A 3JZ1B 3OX7U 2ZPSA 4NIVA 4OGXA 1TNLA 2PW8H 3RXAA 3T28A 5EU8A 2ZTXA 4AC9A 3LJJA 3CNRA 1GWAA 3LC3A 5IK2D 3ITIA 1KTTB 3TU7H 2FS9A 4K1TA 1LQDB 3AW0A 2P94A 4ISIH 4YT7H 1SGIB 1HJ9A 3RXMA 4Z6AH 3SQEE 3F2GA 3GCNA 3MNBA 5FAHA 1RGQA 3F1SB 3AAUA 4H4FA 4U2WA 3OYPA 1C5NH 4MPXA 4AB9A 1O2VA 4ASUD 2VH6A 1L4ZA 3N7OA 1TA2A 3PMJA 2GZ8A 1CT2E 2AH4X 4MDSA 1DOJA 1S81A 3H7TA 2KCAA 2OQ5A 1HXFH 1SR5C 1O3NA 3TPIZ 3P8GA 4UONA 4I7YH 4A1XA 3ZZDA 5LGOA 3PROA 2BDAA 4BAKB 1H8DH 1QURH 5DP4A 3UNRA 1AKSB 1UTPA 5EG4A 1UHBA 1P09A 4KTSA 2C93B 3ATMA 1XUFA 5E2OA 2XW9A 3ESTA 4X6OA 4DVAU 4XBDA 3A8DA 2HNTC 2SGFE 1S5SA 5E2PA 1FY8E 1MU8B 3D49H 5EPYA 5C1UA 8GCHF 1Y3VA 3SW2B 1GJ7B 1MH0A 2J94A 5DP3A 2D2DA 2XBYA 3F0OA 3CP7A 3LT3A 5E8EH 1QFKH 4CRGA 2ASUB 4IC6A 2ZDAH 4Y0ZE 4DY7B 1C1NA 3VEQB 2ALPA 3KGPA 4FUBA 2LPRA 3NKKA 8LPRA 2J4IA 1ZMNA 2CMYA 1L1GA 3M3VA 2SNWA 3ATKA 1EKBB 1KXFA 1H8IH 1YPHC 4Q7XA 5ESTE 2XWAA 3UREA 3O8RA 2KFWA 1K1LA 2QIQA 1ID5H 3Q77A 2F9PA 4FU7A 4F4OC 3RC6A 4CRFA 3VXFH 2J34A 4ISLA 1O3JA 2B0FA 4AORA 2PKAB 2PP6A 1O31A 3TJUA 5A09A 3OEHD 3BTTE 3F9EA 1DWBH 3EDXB 1Y3UA 1SI5H 3GDVA 5BPEA 1PPHE 1TGBA 2NU3E 5JDUB 3E90B 3PV2A 2UWOA 1T31A 1DXPA 1TBZH 3PB1E 4IN2A 2GV7A 3BTFE 3UUZA 1WTGH 2JH5D 4E05H 2ZTYA 3F9HA 3S9CA 1OHHD 1SGFG 4E06H 1NROH 1YGCH 3KL6A 2FTMA 1OSSA 4Y76A 1O3EA 1AQ7A 4UFEH 5DP6A 5E0GA 3UQOA 2FMJA 1E1QD 1V2LT 3Q3KA 3TITA 5HYOA 3LGWA 1O2JA 2P59A 2GMTC 3VB5A 4JZIA 1C5XB 3QX5H 1P06A 1GPZA 5GWZA 5C1XA 3UB0A 1XX9A 3TGKE 1UJ1A 1W0YH 4UD9H 5L2YH 2RA0A 1ZTLA 1QB6A 3EGKH 1AU8A 1W8BH 1SHHB 1YPHE 2VU8E 1BJUA 4BXWA 3MHWU 1O2NA 5A8XA 1O2RA 2F4LA 4NCYA 4Q63A 2GX4A 5L6NH 4NSVA 2F9OA 1UCYK 4HFPB 3VG8A 1WTHD 1G3DA 1V2PT 1UTQA 4K1SA 1EX3A 1BQYA 1FXYA 4ISNA 4MNXA 1EASA 1T8NA 3P92A 1GHBG 2GCTC 3C27B 2VWLA 3QTVH 3W94A 1GBJA 1O2MA 3ZZ6A 1GJBB 4OS7A 4BAHB 2RA3A 4M7GA 7ESTE 1UCYH 5IDKA 3DFJA 4ISHH 3SN8A 1W2KH 2M2AA 2BVSH 4HGCA 2OTVA 4B71A 1QRWA 2A5KA 2GGVB 4NFEA 1TX6A 3MU8A 4Q2KA 3OY6U 3ZVDA 1GI6A 1CGJE 1TNKA 2KM0A 5EQQA 4XFQA 1XVMA 1KIGH 4ABAA 4I31A 5AHGH 3CENA 4X0WU 3OE7D 1S6LA 1CHOF 4MPUA 3HK3B 1VKYA 2B8OH 2A7CA 3RXDA 3RXFA 1PPGE 1FONA 1Y3YA 5EGMA 1AD8H 3NZIA 2PGQB 5TCAA 1KXEA 1SQAA 4TWYA 3SNCA 3ATLA 1E36B 1PPFE 3VB3A 4GVUA 1Y59T 4X2YA 2UUKB 3GYMA 4O97A 1EFRD 2F83A 2STAE 1O3GA 1YPMH 2SGEE 1TBRH 4RT0A 2GMTB 1SHYA 3BTHE 1SGYE 1ZLRA 3PTNA 4OS2A 1VCPA 1SBWA 1KLJH 1FY4A 2BY8X 1Y8TA 1P02A 4JZEH 1A5GH 3MYWA 2PLXA 1VZQH 2D1JA 3A7WA 3SGBE 1LVOA 2FLBH 2ZGXH 3A87A 3KN2A 4WMFA 4AN7A 2GCHF 3UOUA 4FUEA 1KY9A 4ZXXH 1NU9A 5F8ZA 2AGIX 1FY3A 1W0ZU 2FM2A 1V3XA 1BA8B 3A8CA 1SC8U 2WUBA 3SV7A 3EA9A 1GL1A 3HGPA 1GJAB 4KTUA 4YXWD 5C17A 1AFEH 4NIXA 2FI5E 2W6ID 3H09A 1TX7A 2O8UA 5HGGA 2FP7B 4J1YA 4ABEA 4A5TS 2ZCLP 4WY3A 1OWHA 1MZAA 1P12E 3BG4C 1K1OA 2Q6FA 2VIQA 3MO9A 2K8IA 4OS5A 3MH4A 3BTKE 1C1WH 3MWIU 1UVPA 1G32B 3M5LA 4THNH 1GI4A 2ANKH 2EI6A 1L2EA 1F5LA 1LPKB 1NFYA 1QCPA 1MMJN 1YPKH 3GY6A 2XC4A 4Q7ZA 3P8NA 3UNQA 1HXEH 1YM0A 2VGCC 3F6UH 1QNJA 4X1NU 2G81E 3PMHB 2Z6BD 2B9LA 4R0IA 4FUGA 3KF2A 4JYVH 5C5NA 1TOMH 3MMGA 1TNIA 3H5CB 1GBTA 3PV5A 3WWFA 1YLDA 1C5SA 1VJAU 1G3EA 1XKAC 3GY8A 1UTOA 1P2NA 3W95A 5HM9A 1LVYA 3BEUA 1PYTD 1CT0E 1C1TA 1SKYE 3U28C 1ELFA 1P2OA 2ODYB 1C1SA 2XCFA 4H6TA 1NRSH 4TY6A 1YY3A 1TLDA 4DJZB 4IW4E 2A4RA 3V0XA 1JBUH 1GBFA 1ESAA 1UHBB 2FX4A 1K1MA 3ZZ8A 1O5EH 1GJ6A 4GLYA 5FL7D 4NIYA 4X1RU 1BCUH 1ZGIA 2AEIH 2HVXA 2G5VA 1SFQB 1C5LH 3P17H 2BTCE 1W13U 4JCNA 4ASHA 1CU1A 1VCWA 3O8BA 3RLWH 2VIVA 1NRRH 1UK2A 2FOAA 4X8TH 2FI3E 5EODA 1P3CA 4MTBA 2OBOA 3FVFB 2SFAA 2LP6A 2BD4A 2OD3B 3TIUA 1SOTA 4FOUC 5EQRA 1QRZA 3SO3A 3ZZ5A 2QF0A 3U8RH 2A5IA 1ZPBA 4J2YB 1HAOH 1GMCF 4XSKU 4AFUA 1ZSLA 1DVAH 2H9HA 4AFQA 1SGDE 1HUTH 4I33A 7GCHF 2ODQA 3TJVA 2TIOA 3SZNA 4GHQA 3UWIA 3SZEA 1IQLA 4WXVA 3RXLA 3VB6A 1E34B 3BG4B 4UFDH 2GP9B 4U32A 1HAHH 2PKAA 1LKBA 3ZIAD 2HWLB 4F49A 3A80A 3BTME 4TPYA 4E7NA 1L1JA 3BTQE 5CMXH 3L3TA 2FOEA 1V2JT 4DCDA 1GI1A 1NRQH 1Z1IA 3BG8A 1EJMA 2GDDA 2VGCB 3M5MA 2O8LA 4X8SH 3OSYA 1BMFD 4CBOA 2PHBA 3ZVBA 3LGIA 2R3UA 5A0CA 3KEEA 4CHAC 3LGYA 1PQ5A 1K1IA 2B7DH 1Y3XA 2BLVA 2G4TA 3QZRA 1OP0A 4ZKRU 1BUIA 1O34A 2FO9A 3A82A 3E0NB 1DUAA 2VIWA 4JYUH 2VIDA 1IQGA 1FAXA 3EYDA 3PRBA 3NWUA 4MPVA 3STIA 1O3IA 2LNCA 1NY22 3UFAA 1BRAA 1W0JD 1HB0B 2BQ7B 2RDLA 2C3SA 2NU2E 5L2ZH 1ZGVA 2RG3A 1MKXK 2TGTA 3ZZAA 1L0ZA 5LPEA 1HNEE 1YLNA 1ZMJA 3RMLH 1FAKH 2FYQA 2AGEX 3T2NA 4UDWH 4K3JA 1NU7B 1GBDA 2BB4A 1TPOA 5T6DA 3R3GB 1EAXA 1EAWA 1O35A 1O5FH 1O2PA 2A4OA 2FYRA 1Y5BT 4ABHA 2DUCA 2HNTF 5F8TA 4GCHF 1HGTH 2VIPA 3T62A 2XC5A 1IQFA 2KAIB 2Y5GA 1BTZA 4AB8A 1MAXA 1MKXH 2WPHS 2D26C 3WW7A 3RU4E 3T27A 1UVUH 1A7SA 1RIWC 3GICB 2R0KA 3BTDE 1C2IA 1O2WA 4XOJA 4ZUHA 1S85A 1O2TA 3GCHB 3KQBA 2P3UB 1C1QA 1GHAG 1GBLA 4OS4A 1BRUP 1C5OH 1P3EA 1O2KA 4XDEA 1PPCE 1S0RA 1O2OA 3NPSA 1JRTA 1ELBA 2JJ1D 4CR5A 5FCRA 2FOBA 5TCCA 1O5GH 3ELAH 3FO8D 3EQ0H 2H6MA 2VWOA 1EPTC 1B0FA 2A7HA 1G30B 3U69H 4NZLA 3U8OH 1PQ7A 4WH6A 4YLUA 3M7QA 1G3BA 2BDCA 3MTYA 1OS8A 2BYAX 2NWNA 4CHAB 1Q2WA 4MNVA 2A4QA 4VGCC 1BT7A 1T8OA 3QWCH 3M3SA 5I25A 1LMWB 4CH8B 4XE4A 3BTGE 2A31A 1WUNH 3QGJA 1HJAC 1B5GH 3GY3A 2C90B 5F03A 1WOFA 1P2IA 1GHWH 5L30H 3M7TA 4WF8A 3ZYDA 2ESTE 2OBQA 1O2ZA 4FVBA 4ZKNU 1ZHRA 1C5MD 2FOMB 2R2MB 1P03A 1ELVA 3M37A 4BXSA 2ZWLH 3DHKH 1NPMA 1N8OC 2EQNA 1HAPH 4K1EA 5DP7A 1G2MA 2A45B 1OWEA 4GSOA 4P00A 1GMDF 2OCVB 3PWCA 3F3BA 4BAQB 3RXPA 3A7ZA 1WYKA 1BITA 1W0KD 2ALVA 5HKKD 1A61H 3QO6A 1SGEE 4HI3A 5KGOA 1PPBH 3ZZ9A 1DUEA 1RIWB 1TMUH 1OP2A 2Z9IA 2ZGCA 2ZTZA 2BD9A 2IPHA 4B2AA 1V2KT 1ARCA 1Z1JA 3SHCH 1IQNA 4AFSA 1ZZZA 4NWLA 1SQTA 2ZGBH 2P8OC 4E7RG 2F43B 3U1IB 2GZ9A 3FZDA 5J4QA 3URDA 1CO7E 1NBME 1T4UH 3EA8A 3SBKA 4YESB 2ZFQH 1MUEB 2CHAC 3ZVGA 1QJ1B 4ISOA 1Z8JB 5AFYH 4HZHA 1NM6A 2WZQA 6GCHG 3ATIA 1O3AA 1K21H 1O2GH 3M5OA 3GCTF 4X8UH 4WWYA 3TH2H 4INKA 2OINA 4ZROA 2WPDD 3NUMA 3RU4T 1ZJKA 3LDXH 1WSSH 1BTXA 3KCGH 1UVTH 3LU9B 1D6RA 2VINA 5JB9S 3ODFA 3PLBA 1YYY1 3P95A 2YOLA 1T8LA 4VGCB 4IC5A 1ESBA 2ZDLA 5DO4H 4CRCA 4Y7BA 4X2WA 2BXTH 2QY0B 1EUFA 2FI4E 4XD7D 3SNAA 4RN6A 3A83A 5FXLA 3LOXA 5ETXA 1BRBE 1ELTA 1F5KU 1MKWK 5GPIB 5C2ZA 1KXDA 1WCZA 2SNVA 1O5DH 4TPIZ 1DE7H 4WXIA 1XM1A 1CBWB 1KXBA 4BOHA 1W14U 2FEQH 2WPMS 3C1KA 1WQVH 1F2SE 1THRH 1N8OB 2TGDA 5GDSH 1Y3WA 1C5YB 2Z7FE 3QN7A 1P11E 1GHZA 2OC0A 5LPFA 4ZKSU 1HPGA 1G2LA 4JZFH 1MKWH 1TPAE 2QF4A 3SUEA 1AVGH 1GDQA 4NA7A 1HYLA 3A88A 1K2I1 3QLPH 1GI7B 2J2UA 4CR9A 1RJXB 3RP2A 1EJNA 3HPTB 1CSOE 3LGVA 2W5EA 1FIZA 1M9UA 1O2SA 1PQ8A 2OUAA 4D76A 1GHBF 1CHGA 4BTUB 2R2WU 3ZVFA 4NA8A 3MFJA 1EAIA 4HTCH 1SGQE 1MU6B 4RKOB 5DP9A 3MU4A 2O9QA 1HAYB 1C1PA 1GI9B 2OXSA 2JDID 3ZZCA 2P8OB 5F6MA 2PUQH 1LHGH 3SYJA 3A7TA 2BQWB 4Y11E 3TK5A 5BRRE 2QA9E 1C2HA 2CHAB 1H9HE 1PJPA 1T4VH 3LH3A 3AAVA 3SQHE 3RU4D 3UAIC 1AZ8A 4K8YA 2HNTE 2A1DB 2ZPRA 3BTEE 5EW1H 3RXRA 3RXQA 2V35A 3SUFA 1ABJH 1DSTA 2CF9H 4MPWA 1ZOMA 2SGAA 1TFXA 1UTNA 3E16B 6LPRA 1YC0A 2VB0A 1FY1A 1HIAB 1ZR0A 2PKSC 2SGDE 3AASA 5ESBA 2YMSC 4H42U 1LO6A 1O3MA 2GDEH 3KQEA 2AMDA 4CRDA 4ZCNA 2FODA 3UQVA 2JIZD 4MQAA 2XNDD 5FPTA 1O39A 1A5IA 1FN6A 3PM3A 3SU5A 2PGBB 4YOIA 3EAJA 1XUKA 1BDAA 2VWNA 1D3TB 2FZZA 1GHYH 3RXEA 4FVDA 5FBIA 4XBBA 1YPLH 2GVFA 1L4DA 3QUMP 1C1MA 1AI8H 1TB6H 1A4WH 1O32A 1A46H 1GJ5H 3BF6H 1S6HA 1V2WT 4B76A 2KAIA 4GPGA 2VWMA 3FKSD 4NZQA 1XUIA 1T8MA 4X8VH 4TSFD 5T6GA 3O8CA 1JOUB 1BRCE 2ZHQH 1H8ED 1HLTH 2ZU3A 3SU2A 1L1NA 1AY6H 2C8WB 1EAUA 2HPQH 2H5DA 1ELEE 2BLQA 4BTIB 4MVNA 3GDSA 5GXPA 2EI7A 3K65B 3F2HA 4A6LA 1ZSJA 4D7GA 2W6JD 2BY9X 3FOAA 1O5BB 3LC5A 3GY5A 2EI8A 3KNXA 1OOKB 3SV9A 5E0HA 5FHTA 2ZU1A 4DG4A 3T29A 3SV6A 2A0QB 1LVMA 1FLEE 3NXPA 1LHCH 3S0NA 3B23B 3SU3A 1MBMA 5HXFA 1TPPA 1FQ3A 1H9IE 1UTMA 1AMHA 1LHDH 5HIZA 1HCGA 2BD7A 1A5HA 1H4WA 1SL3A 2QF5A 2QV1A 3ZZ7A 1V2UT 2PKSB 1ZSKA 2FOHA 2YMSB 1O3LA 3RM2H 2V0BA 3Q3YA 1C5PA 1F5RA 1GDUA 2GZ7A 2WV9A 1VITF 3RMNH 1W10U 4Z0KA 3LH1A 5DPAA 1FPCH 1RTLA 2W26A 1TPSA 2WSSD 3QGNB 1GBHA 1W11U 1FDPA 3F68H 4NA9H 5AF9H 2BY6X 1BTHH 3S9AA 2VIOA 1P0SH 2BQ6B 2R0LA 4UEHH 1VJ9U 4CBNA 1GBAA 1RRKA 1GHVH 4BNRA 4B2CA 1YBWA 1P8VC 2ZFPH 1AUTC 2WINI 3ZVCA 3TNSA 2J92A 3SV8A 2GCTB 4P02A 4GHTA 2WPKS 3DA9B 3DUXH 1DT2A 1UW7A 3BTWE 1HAVA 1COWD 3MI4A 1GHXH 1D3PB 3D23A 2ZIQH 1EZQA 4UE7H 2AHME 4AFZA 1WQSA 3CS0A 3IWMA 4ACBA 1C1OA 1JIMA 1UCYE 1ZTKA 1RTKA 1AVWA 2ZFSA 1SGNE 3M3TA 5EXNA 3SU6A 1DPOA 4AG1A 1EP6A 2YNBA 3KHVA 2TPIZ 3DSGA 1HRTH 1MTSA 4X1QU 4R8TB 1O37A 1IHTH 3MH5A 2IN2A 1EXFA 5T3HA 3F0PA 1EPTA 1GGDC 2ZEBA 3SU1A 4D9RA 1O2XA 5B6OA 4AG2A 2ANWA 2BVRH 4DW2U 1UVSH 1MBQA 1FIWA 1UK4A 1DITH 4X2XA 3SUDA 2Y81A 1C5WB 3MO6A 1VCQA 4X6NA 2H9TH 3RC5A 1FMGA 1SGTA 2A2QH 3ZVAA 2NU1E 4JK5A 2IJOB 5C0UA 2BHGA 2KX4A 1O2HA 3LONA 3STJA 2P3FH 2ZGJA 2ZDKA 2VVCA 5KEDA 1SGRE 1H9LB 7KMEH 2QYIA 1TBQH 2OC1A 1C2MA 5GCHG 1QRXA 1ZPZA 3E8LA 5JBBS 5FCKA 1SB1H 1O3PB 2QGRA 2F3CE 1ELDE 1BBRK 1BB0B 2V3HH 3D62A 1CA0C 2ZDNA 1DWCH 2WV5A 3BIUH 2ZECA 3TVJB 3VGCC 3MNCA 3EA7A 1B0EA 3I78A 4NIWA 1SMFE 1K1NA 3RXVA 4AOQA 2BY5X 1H1BA 1KTSB 1NC6A 1FUJA 2W7UA 1BBRH 2G8TA 1FI8A 3FP6E 4O9VA 1D4PB 2B5TB 1MCTA 5EOKA 3QDZB 1C2LA 4U30A 4YT6H 1O3HA 3M61U 1E0FD 1LDTT 1QBNA 2BOHB 2Z3CA 1UTKA 4A1TA 4BANB 2QN5T 1ANEA 1ETRH 1RXPA 2V7QD 2K1QA 4BAMB 1C9TA 1A0JA 2ANMH 1H8HD 1WU1A 1TGTA 3Q3XA 1EOLA 2WHXA 1O0DH 2ZPQA 1C2GA 1G37A 2Y82A 2G55A 3P70B 1DWEH 3K9XB 4YZUA 1GGDB 2TRMA 1IHSH 4RT1A 5JPMH 4ABJA 7LPRA 1MTNC 1WAYB 1KYNA 1TGNA 1RFNA 2KR7A 2XBVA 3P6ZB 4FU8A 3VB4A 5SGAE 5DG6A 1OWIA 1DSUA 1YPEH 1MQ5A 2OC7A 1V2OT 1HIAA 3M5NA 3WWBA 1P2KA 2QXIA 3BEIB 5JBAS 1LVBA 3I29A 1E35B 2FOCA 3SJ8A 3KQCA 4ZMAH 1K0HA 2PTCE 3E91A 1OYQA 1QL8A 3HKJB 1O3FA 1E1RD 1GG6C 1DY8A 2ZO3H 3MH6A 1DFPA 1GMHF 1OX1A 2BVXH 2PSYA 4YLQH 2F9NA 1YKTA 3IITA 1DS2E 4DIIH 1O2QA 3SI3H 2H9EH 1W12U 2K0QA 4U01A 3KQ5A 2P93A 1AIXH 2BZ6H 2P16A 1YF4A 2GKVE 5JB8S 1MABB 1NRNH 1AO5A 3MO3A 3UR6A 1CA0B 1TA6A 1HAGE 1MD8A 1BOQA 3TK9A 3OU0A 1QL7A 2FS8A 1GI8B 4SGBE 3VGCB 3MH7A 2QE7D 3SOSA 4UFFH 1E38B 4FUDA 5AFZH 1O3KA 3ZV9A 3A86A 1VGCC 2FDAA 3U8TH 1GI3A 4RSPA 1A2CH 3HGNA 5T1VA 4ABGA 4ZKOU 1YPGH 2BD2A 4X2VA 3SHAH 2L74A 3K6YA 4H6SB 3AW1A 5C0TA 1NFXA 1C4V2 3LGUA 4AX9H 1O36A 4IS5A 5K7RA 2Z9KA 2AS9A 2ZCKP 5HMAA 4MLFB 1D3DB 1HAZB 1TQ0B 1ARBA 2H1UA 2WPLS 1HDTH 3VXEH 2ZHWH 1O5AB 1NS3A 2H5CA 2HALA 4INLA 1QY6A 2ULLA 3T25A 2C8YB 1DM4B 1SPJA 1EATA 1YPJH 2BY7X 1SOZA 1AUJA 1PFXC 5DJ7A 2FTLE 3JZ2B 1TABE 5FBEA 2C8ZB 2NU4E 1MTNB 1MD7A 3SNEA 1JRSA 5LPRA 3UOPA 5EJZA 5C1YA 5AVDA 4DT4A 2VJ1A 1FZZA 1GJ9B 5A2MH 2ANYA 1O3CA 2WYGA 4FXGH 1IQJA 3P8FA 1P04A 3K6ZA 4LZ1H 1QGFA 4TWWA 3UIRA 1SGCA 5A8ZA 4CREA 1C1UH 2WPIS 3DSPA 5CHAC 4ABDA 1O30A 4I8LA 2GT8A 1ZTJA 3DCLA 1F0UA 3OTJE 1GG6B 1GBKA 2VVUA 2G5NA 1T32A 4Y0YE 1OP8A 2BDBA 1IQEA 2IPQX 1KDQB 3U98H 1BJVA 1YCPM 1C5TA 1O2LA 2EC9H 3W1EA
chains in the Genus database with same CATH topology
1C5VA 1ZPCA 4ABIA 4Y8ZA 1HJ8A 2R9PA 4WMDA 3HK6B 1IAUA 1TAWA 3FANA 5TJXA 3SGAE 1O3BA 3FZZA 1O2UA 2P95A 2FIRH 3ATWA 4Q7YA 1HAVB 1Z8GA 4A1VA 3M7UA 2CXVA 3PLPA 2G4UA 4GUXA 1VGCB 1O2IA 1ELAA 2F91A 2F9UA 3B9FH 2SGPE 1W3CA 1DICA 1AZZA 3CS7A 2FX6A 2XBWA 2A4GA 3SNBA 4I8HA 4CH2B 3UR9A 1ESTA 1EB1H 4FUCA 2ZZUH 1AHTH 5CE1A 2A2XH 1Z71A 3IG6B 3TJOA 2ZGHA 1XMNB 1BMMH 4DOQA 3LKWA 4KELA 3SJKA 3O8DA 1W7XH 2QC2A 2JH6D 2C8XB 3B8JA 1EPTB 4YOGA 1V2VT 3I77A 1EOJA 1SGFA 1TRYA 2FOFA 1Z7KA 4YO9A 3M35A 4JZDH 1RS0A 1LCYA 1QB9A 4BAOB 3E0PB 1TWXB 2ZFTA 1A3EH 2WYJA 2G52A 4JYTA 1TMTH 1SVPA 3WY8A 1V2NT 1IQMA 3UTUH 1HJAB 5GIBA 1XUGA 4K60A 1YCPK 3GISB 2NU0E 1PYTC 1V2MT 1AE5A 1TRMA 4LOYH 3TGIE 1EJAA 1NTPA 5CHAB 8ESTE 2ZFFH 1DWDH 4TY7A 3SU4A 4NFFA 1C5ZB 1C2JA 3D65E 1ABIH 3UNSA 5F8XA 1GBCA 4ZXYH 3U9AH 1BHXB 1TE0A 1GMDG 1GVZA 1J16A 1FJSA 4B75A 1SQOA 1SFIA 1YCPH 1EB2A 1XUHA 2BDYA 3MNXA 1AWFH 1HAIH 2Y5FA 3SV2H 1QQ4A 3QK1A 4FUFA 1DLEA 1AFQC 1LKAA 1Q3XA 1UTJA 2Y7XA 1TALA 2Q6GA 1GBMA 1OWJA 2V6NA 1RD3B 2PWXA 4I8GA 1S84A 2GTBA 2ZCHP 2ZG0H 2YNAA 3ODDA 1GJDB 1XXFA 4X1SU 2WPJS 1P10A 8KME2 2FOGA 1T7CA 2RCEA 2ZKSA 1C2EA 4GAWA 4NG9H 3RMOH 2Y5HA 4LXBH 1DLKB 1ORFA 1J9CH 1C5RA 3T26A 2C4FH 9LPRA 3FFGA 1HBTH 3Q00A 2PFEA 2VH0A 1BZXE 4JMYA 2ZF0H 3BEFB 1KSNA 2BDHA 1TOCB 3FP7E 3GCTG 3H7OA 2PTNA 1TRNA 1CE5A 5EXMA 1PPEE 1O33A 3F9GA 1MCVA 1GBEA 1QHRB 3NCLA 2W3IA 1THPB 3GY7A 1KXCA 1K28D 2F9BH 1P05A 4ABFA 2CN0H 1SG8B 1TGCA 3S7KB 3RXOA 1BTYA 2BX4A 2FXRA 3S7HB 2XXLA 1DY9A 2Z3DA 1CT4E 3GY4A 1S82A 2UUYA 3PTBA 1V6DA 4K8BA 1FNIA 2H2ZA 4Y71A 3RXHA 4ZHLU 3A7VA 3DFLA 8GCHG 2ZU2A 4OGYA 3UPEA 2ZHFH 3TK6A 2BMGB 1LHEH 4AGKA 4Y7AA 1NESE 2UWLA 1FY5A 2J95A 4IGDA 4K5ZA 3L6PA 2BD8A 1BTPA 2BX3A 2Z3EA 3RXCA 4CRBA 2VNTA 1S6FA 1QL9A 1QBVH 4X6MA 3ZV8A 2G00A 4A7IB 1C1VH 2JETC 4AYYB 4D7FA 1ZJDA 1NN6A 5H4IB 3ZZ4A 3MOCA 5FPYA 5FPSA 1UK3A 3RMMH 1INCA 1SSXA 1LQEA 3KQDA 1AFQB 1QBOA 2A5AA 2HPPH 1WV7H 1J14A 3GDUA 1XVOA 1TX8A 2ZU5A 1ACBE 1G9IE 1C5QA 1B7XB 1NO9H 4JK6A 5JYIA 1P57B 2HLCA 1A3BH 2UWPA 1YLCA 3UY9A 3SI4H 1Y5AT 3A84A 2Z9JA 1F7ZA 4B73A 1NRPH 4O03A 2I6QA 2A7JA 4IMZA 3SJ9A 3TH4H 3RLYH 2W7SA 5DP8A 1MAYA 4DURA 5PTPA 2WUCA 4AGJA 1BTUA 2CGAA 4Y8YA 1A1RA 2O8WA 4B74A 1BMAA 1HAXB 1E37B 1ANBA 2AERH 3A8AA 3MU5A 5FX6A 3PYHA 2DE9A 3M36A 1CGIE 4OS1A 1AWHB 1J17T 4YOJA 1PQAA 3GOVB 1GDNA 5JBTA 4TYDA 3A89A 2QCYA 1P2MA 4WJG2 3L33A 1C1RA 2GD4B 1C4Y2 1Z8RA 3V3MA 2ZHDA 3PMAB 3BN9A 1IQIA 3PWBA 1V2RT 2AIPA 2Q6DA 3A85A 1KDQA 3AVZA 2QXJA 4AZ2B 1IQHA 1NFUA 2TGPZ 2O8MA 2XWBI 3VFEA 1P9UA 2STBE 2PSXA 4KP0A 9ESTA 4D9QA 1GBIA 2BM2A 3MNSA 2TGAA 1K22H 3TJNA 1MZDA 2HRVA 5GCHF 5DK1A 2JETB 4DT7B 3DT0H 3VB7A 2OQUA 2ZQ2A 4I8JA 1OYTH 1ZRKA 3V12A 1CA8B 2Y6TA 3LIWA 4NGAH 1C2DA 1P2QA 2BDIA 2A32A 1ZRBA 3VPKA 1C5UA 2GV6A 1F92A 3FAOA 3PLKA 1KXAA 4XBCA 2XBXA 1LTOA 3BSQA 4FUHA 3T5FH 5G4BA 3ZVEA 1Q31A 3RXGA 1IOEA 4IN1A 2I6SA 3SNDA 1DDJA 2XNIA 1CHOG 4MNWA 1JMOH 1TNJA 2QXHA 4KTCA 5IYTA 1GI0A 5C67A 2J38A 2AMPA 4DIHH 1F0SA 4RKJB 3SGQE 3PO1C 1ANDA 2HOBA 5DGJA 3GYLB 1JIRA 5J4SA 3S9BA 3ZZBA 1GVKB 4KKDA 1G36A 4WH8A 1FN8A 3E1XB 4B1TA 4NSYA 1P9SA 4PROA 1S83A 3SJOA 2EA3A 1UMAH 3OY5U 1CQQA 2BZAA 1V2ST 4NWKA 5EPNA 1ETTH 3ENSB 1MTUA 2AIQA 1MTVA 1VITG 1NFWA 3A7YA 2GCHG 2VVVA 3S69A 3DD2H 2ZDVH 1X7AC 3RDZA 6ESTA 1AKSA 4I32A 3GY2A 1A0HB 1W7GH 2R3YA 1DXWA 1PPZA 4ZHMU 1P01A 4Y8XA 1V2TT 1GCTC 2AFQB 4FU9A 1QIXB 1N1LA 4IBLH 4LZ4B 2V3OH 2OC8A 4JZ1A 1FV9A 3ZZ3A 1QJ7B 3RC4A 1F0RA 2BXUH 2OP9A 1TGSZ 2UUFB 5K0HA 1BHXF 4ZAEA 2FLRH 1AVXA 1S0QA 3A8BA 1C2KA 2ZFRH 1GL0E 2BLOA 1ELCA 1GJ8B 5I46H 2O8TA 2Z9LA 1FPHH 5E0JA 2PV9B 4Y79A 5FX5A 3A81A 3E6PH 4CRAA 1VITH 1QR3E 1G3CA 1UVOA 4QT8C 2P3TB 1YP9A 1C4U2 1GVLA 1F0TA 4ZHAA 4INHA 3RXIA 5C20A 2HGTH 1TYNA 3GCHC 3TNTA 1LPGB 1UTLM 3BIVH 4IMQA 1GHAF 1UO6A 3F9FA 3RXJA 2SGQE 1J15A 4YTAA 2Y7ZA 1MQ6A 3PMBB 2BLWA 1D6WA 1XUJA 3PO1B 5A0AE 1NT1A 1O2YA 1SLVB 4SGAE 4B2BA 2FESH 4UFGH 2JH0D 1OWDA 3TH3H 1C9PA 1V2QT 1TNHA 4O3UA 1TQ7B 3RXUA 3A7XA 1EZSC 3U1JB 1ETSH 2QXGA 3R0FA 2ZI2H 3MU0A 2ZHEH 3P8OA 2JKHA 2XC0A 1NZQH 4AYVB 2QAAA 1BMLA 1QJ6B 1K9OE 1CGHA 3RXTA 4DGJA 3RM0H 1QTFA 1LPZB 1AGJA 3BV9B 5A0BA 1D3QB 2AYWA 1TONA 6CHAC 1GBBA 4Y6DA 1C2FA 1JXPA 2J9NA 2AMQA 4KGAA 4OS6A 2ZC9H 4K2YA 1GCTB 1TNGA 1Z8IB 1HV7A 2BDGA 1P2JA 4MG3A 5GJ4B 2IOTA 5EQSA 1OWKA 2BD5A 2D8WA 1A0LA 1QA0A 1K1JA 2FWWA 1GMCG 5C5OA 4BTTB 2TBSA 1N6XA 2DE8A 5LH8A 1ZYOA 2XYAA 7GCHG 1O3OA 1ZMLA 2PUXB 1RTFB 3SUGA 1DX5M 4YM9A 1EQ9A 2UUJB 2EEKA 1K1PA 1QB1A 2FPZA 1AB9C 2ILNA 1Z6JH 4X1PU 3RXKA 1CVWH 2XCNA 1BMNH 1BBRE 1GI5A 3HATH 3SU0A 3GCOA 3HKIB 1BIOA 3G01A 5EXLA 5T6FA 3V7TA 2G51A 2CF8H 2CJIA 3RXBA 5JBCS 3URCA 1AE8H 1GJCB 2F9VA 2ZA5A 2Y80A 4WMEA 1O5CB 1ZHMA 3V13A 4A92A 2Z9GA 2Q1JA 1SLXB 3TLOA 2XRCA 3K2UA 1QQUA 3LJOA 3RXSA 1Y5UT 1ANCA 2W3KA 4Q80A 3NK8A 2AGGX 1SGPE 3ZYEA 4X6PA 1OXGA 3RUOA 6GCHF 2XTTB 4I8KA 1ELGA 3SJIA 1BTWA 2ZQ1A 4FUJA 1EP5A 1XKBC 4LK4A 3EE0B 2ZP0H 4O3TA 3KIDU 3E3TA 4ZH8A 3UWJH 5DP5A 5DKMA 5HM2A 4MNYA 1GMHG 3SORA 2BOKA 5A8YA 4WVPE 4D8NA 3FP8E 4ESTE 3QTOH 2Z94A 2OLGA 1KLTA 1O3DA 3QZQA 6CHAB 1U6QA 4K69A 1OPHB 1CBWC 1GJ4H 1TMBH 1ZHPA 1GI2A 1SLWB 4GCHG 1XXDA 3LGTA 3MU1A 1EZXC 1IQKA 4ABBA 1DANH 2QF3A 1OKXA 1GCDA 1VR1H 1KLIH 2GT7A 4Y10E 1O38A 1TIOA 1Z6EA 1D9IA 2WV4A 1EZUC 3TGJE 2ZNKH 1N6YA 1QA7A 1THSH 4FUIA 5EW2H 2ZDMA 3Q76A 3PV4A 5C3NA 1MTWA 5ABWA 2THFB 2M5TA 1J8AA 1WBGB 1HFDA 1SLUB 1LHFH 1AN1E 1AB9B 2ZU4A 2BD3A 2CV3A 3LPRA 1JWTA 2ODPA 2PR3A 3JZ1B 3OX7U 2ZPSA 4NIVA 4OGXA 1TNLA 2PW8H 3RXAA 3T28A 5EU8A 2ZTXA 3LJJA 1GWAA 3LC3A 3ITIA 1KTTB 3TU7H 2FS9A 4K1TA 1LQDB 3AW0A 2P94A 4ISIH 4YT7H 1SGIB 1HJ9A 3RXMA 4Z6AH 3SQEE 3GCNA 3MNBA 5FAHA 1RGQA 3F1SB 3AAUA 4H4FA 4U2WA 3OYPA 1C5NH 4MPXA 4AB9A 1O2VA 2VH6A 1L4ZA 3N7OA 1TA2A 3PMJA 2GZ8A 1CT2E 2AH4X 4MDSA 1DOJA 1S81A 3H7TA 2OQ5A 1HXFH 1SR5C 1O3NA 3TPIZ 3P8GA 4UONA 4I7YH 4A1XA 3ZZDA 5LGOA 3PROA 2BDAA 4BAKB 1H8DH 1QURH 5DP4A 3UNRA 1AKSB 1UTPA 5EG4A 1UHBA 1P09A 4KTSA 2C93B 3ATMA 1XUFA 5E2OA 2XW9A 3ESTA 4X6OA 4DVAU 4XBDA 3A8DA 2HNTC 2SGFE 1S5SA 5E2PA 1FY8E 1MU8B 3D49H 5EPYA 5C1UA 8GCHF 1Y3VA 3SW2B 1GJ7B 1MH0A 2J94A 5DP3A 2D2DA 2XBYA 5E8EH 3CP7A 3LT3A 1QFKH 4CRGA 2ASUB 4IC6A 2ZDAH 4Y0ZE 4DY7B 1C1NA 3VEQB 2ALPA 3KGPA 4FUBA 2LPRA 3NKKA 8LPRA 2J4IA 1ZMNA 2CMYA 1L1GA 3M3VA 2SNWA 3ATKA 1EKBB 1KXFA 1H8IH 1YPHC 4Q7XA 5ESTE 2XWAA 3UREA 3O8RA 1K1LA 2QIQA 1ID5H 3Q77A 2F9PA 4FU7A 4F4OC 3RC6A 4CRFA 3VXFH 2J34A 4ISLA 1O3JA 2B0FA 4AORA 2PKAB 1O31A 3TJUA 5A09A 3BTTE 3F9EA 1DWBH 3EDXB 1Y3UA 1SI5H 3GDVA 5BPEA 1PPHE 1TGBA 2NU3E 5JDUB 3E90B 2UWOA 1T31A 1DXPA 1TBZH 3PB1E 4IN2A 2GV7A 3BTFE 3UUZA 1WTGH 2JH5D 4E05H 2ZTYA 3F9HA 3S9CA 1SGFG 4E06H 1NROH 1YGCH 3KL6A 2FTMA 1OSSA 4Y76A 1O3EA 1AQ7A 4UFEH 5DP6A 5E0GA 3UQOA 2FMJA 1V2LT 3Q3KA 3TITA 5HYOA 3LGWA 1O2JA 2P59A 2GMTC 3VB5A 4JZIA 1C5XB 3QX5H 1P06A 1GPZA 5GWZA 5C1XA 1XX9A 3TGKE 1UJ1A 1W0YH 4UD9H 5L2YH 2RA0A 1ZTLA 1QB6A 3EGKH 1AU8A 1W8BH 1SHHB 1YPHE 2VU8E 1BJUA 4BXWA 3MHWU 1O2NA 5A8XA 1O2RA 4NCYA 2GX4A 5L6NH 4NSVA 2F9OA 1UCYK 4HFPB 1WTHD 1G3DA 1V2PT 1UTQA 4K1SA 1EX3A 1BQYA 1FXYA 4ISNA 4MNXA 1EASA 1T8NA 3P92A 1GHBG 2GCTC 3C27B 2VWLA 3QTVH 3W94A 1GBJA 1O2MA 3ZZ6A 1GJBB 4OS7A 4BAHB 2RA3A 4M7GA 7ESTE 1UCYH 5IDKA 3DFJA 4ISHH 3SN8A 1W2KH 2BVSH 4HGCA 2OTVA 4B71A 1QRWA 2A5KA 2GGVB 4NFEA 1TX6A 3MU8A 4Q2KA 3OY6U 3ZVDA 1GI6A 1CGJE 1TNKA 5EQQA 4XFQA 1XVMA 1KIGH 4ABAA 4I31A 5AHGH 3CENA 4X0WU 1CHOF 4MPUA 3HK3B 2B8OH 2A7CA 3RXDA 3RXFA 1PPGE 1FONA 1Y3YA 5EGMA 1AD8H 3NZIA 2PGQB 5TCAA 1KXEA 1SQAA 4TWYA 3SNCA 3ATLA 1E36B 1PPFE 3VB3A 4GVUA 1Y59T 4X2YA 2UUKB 3GYMA 4O97A 2F83A 2STAE 1O3GA 1YPMH 2SGEE 1TBRH 2GMTB 1SHYA 3BTHE 1SGYE 1ZLRA 3PTNA 4OS2A 1VCPA 1SBWA 1KLJH 1FY4A 2BY8X 1Y8TA 1P02A 4JZEH 1A5GH 3MYWA 2PLXA 1VZQH 2D1JA 3A7WA 3SGBE 1LVOA 2FLBH 2ZGXH 3A87A 3KN2A 4WMFA 4AN7A 2GCHF 3UOUA 4FUEA 1KY9A 4ZXXH 1NU9A 5F8ZA 2AGIX 1FY3A 1W0ZU 2FM2A 1V3XA 1BA8B 3A8CA 1SC8U 2WUBA 3SV7A 3EA9A 1GL1A 3HGPA 1GJAB