5GPIB

Crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
154
structure length
154
Chain Sequence
ETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease
publication title Crystal structure of unlinked NS2B-NS3 protease from Zika virus
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein
total genus 23
structure length 154
sequence length 154
chains with identical sequence D, F, H
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gpiB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5gpiB01
2ZKSA 1OYTH 2ZU4A 3PTNA 4K3JA 2P93A 2XWBI 2Z3CA 1VJAU 2ZFTA 4WXVA 1ZHPA 2TGTA 4GHQA 1WYKA 1O5EH 2BTCE 2XCNA 2ALPA 1YM0A 1O2TA 3ZZBA 1PQ7A 4XDEA 5HM9A 2ODYB 4B73A 1O5DH 1BUIA 2GCHG 3V12A 3DA9B 1VR1H 1MAYA 1P12E 1B5GH 2ZCLP 1ELAA 1C2KA 3M35A 2AYWA 1LHFH 1V2UT 3BSQA 4A1TA 2ZFPH 4DCDA 2FLRH 3LH1A 1MU6B 2Q6GA 1A3EH 1MH0A 2EI8A 1DUAA 2FODA 2EA3A 1GMHG 2OTVA 3GDVA 5C1YA 3TJOA 4I7YH 1C2DA 1P09A 1MBQA 4M7GA 3MNXA 3V3MA 3M7QA 4GLYA 5DP6A 4Y10E 3MO6A 2BB4A 2H9HA 2R0KA 3A7ZA 3VB6A 2TGAA 1XUGA 3LGVA 3BEFB 3RLWH 3QK1A 1TGBA 3I78A 1SLUB 3T26A 4NWKA 5EPNA 1B7XB 1UCYK 2YNBA 5DP4A 1IQHA 5EGMA 3G01A 4X2YA 3QZRA 1AE8H 1UJ1A 3M7UA 3PWCA 3VXEH 1ZSKA 3GOVB 2FOHA 5JBBS 3SNDA 2LNCA 5A2MH 1Y3VA 1KYNA 4Y7BA 3MFJA 1MTWA 1O2JA 2ZFSA 1ORFA 5EW2H 2AFQB 4IC5A 2W26A 1MU8B 2BY8X 1MKXH 1MD7A 4ABHA 2OP9A 1TB6H 4CRDA 3NPSA 1Z8RA 3OY5U 4CR5A 2ZG0H 2BZAA 4I8GA 2BLVA 2RA0A 2ZHDA 2Q1JA 5GXPA 2W3KA 2Z9JA 5AF9H 4ZHAA 2JH0D 3O8CA 1FIWA 2QXIA 1GHAG 4AFZA 1AB9B 1ANBA 2FI5E 2C8YB 3URDA 1MQ5A 2TRMA 4Q7ZA 4WY3A 3TPIZ 2OLGA 4K1SA 2TPIZ 3C27B 3BIUH 1O3HA 3I29A 1C5QA 2ZPSA 4B2AA 5ETXA 1FY1A 4HFPB 4CHAB 4DG4A 1Z6EA 1TGNA 2Q6DA 4A7IB 5C2ZA 2FI4E 2OC0A 1TNLA 1EOJA 2ZP0H 1OYQA 5T6FA 1AFQB 2P3TB 5LH8A 5DP3A 1BJUA 1HAGE 2QF0A 6GCHF 2VBCA 1AE5A 1O3IA 2STBE 4ABFA 2XRCA 2FIRH 1C2HA 2P16A 1V2VT 1P3EA 1SGDE 2EC9H 1PPCE 4UEHH 1P06A 3O8BA 3ZVDA 1GG6C 3MH6A 3MU0A 3D62A 1SMFE 3RXCA 1CA0B 3ZVFA 1KLJH 3BIVH 1V2OT 4ISNA 1FAXA 2VU8E 1BITA 3P92A 1TNKA 2CHAC 2XBXA 2WUCA 3E16B 5JYIA 1C5SA 1Y3XA 2Z9LA 4E05H 1O0DH 5DK1A 3SU6A 1E38B 4GCHF 1EAXA 4ZROA 9LPRA 1YLCA 1P2MA 5EQRA 1BHXB 1YCPM 3GY4A 5GCHG 2BX3A 1GI5A 3GCHC 3VB4A 1V2TT 1QQUA 3K2UA 2P94A 2UUYA 1C1MA 1BDAA 3TLOA 1GI0A 1LVMA 1S84A 3GCTF 5CHAC 1CO7E 1GJDB 1O2WA 1ZOMA 1TWXB 1QL9A 2PSXA 3BTME 3RMOH 3SO3A 1DY9A 1MMJN 1BMNH 3A8AA 1DT2A 2AEIH 2ZFFH 3PLBA 1IQEA 2GCHF 4AYVB 1VCWA 1MCVA 3GY8A 4TWYA 1WQVH 1YPLH 4FVDA 1O2VA 1D6WA 1MTNC 1NFUA 3OY6U 3S7KB 5DP9A 3GY7A 1UVPA 3KHVA 1VJ9U 1J8AA 1CGHA 2AMPA 3MH4A 1KDQA 2FESH 3MNSA 1O32A 1UHBB 1LVYA 2HNTE 3RXBA 2ZI2H 4Y76A 1GMHF 3SU5A 4D7FA 5SGAE 1RIWC 5L2ZH 1IQIA 3PYHA 1DICA 2G55A 2R2MB 1GJ7B 1P9UA 2C8XB 4FXGH 3EQ0H 1FZZA 3VXFH 4ZXYH 4ZKSU 1V2MT 1O5BB 1VGCB 2WHXA 2M5TA 2HRVA 2Z9IA 5A8XA 1WTGH 4Z6AH 3MMGA 1CHOG 3B9FH 1ELTA 1S0QA 1O2RA 1TNJA 1AZ8A 1G36A 3V0XA 2B8OH 1DWDH 1UHBA 1DX5M 2WPKS 3MYWA 2FTLE 3CP7A 4BTIB 2PSYA 3K9XB 3PROA 3HPTB 1H8IH 4HI3A 3DFJA 2IJOB 4X1SU 4JZFH 1HFDA 3A8BA 3KQDA 4ZUHA 3SOSA 4WVPE 3RXIA 1SHYA 1HAPH 1GDNA 1GVKB 1GGDC 1JRTA 1T7CA 1SG8B 2OXSA 2ZTZA 3S9CA 1HIAA 1O2LA 5AFZH 2CF8H 1DFPA 4WMFA 1EPTB 1O2XA 1C5TA 1HAIH 5EODA 1C5VA 1AKSA 3VEQB 3E3TA 2G4UA 8GCHF 2ZPRA 5HXFA 3M3SA 2FPZA 1GHAF 1Y59T 2OQUA 3SUDA 2SGQE 1O3KA 4K8BA 3DFLA 1D3DB 1A7SA 3SGBE 4H6SB 3BN9A 2V3HH 1ABIH 1GHYH 4NA7A 3KQCA 1TOCB 1ZGVA 1JMOH 4I31A 1SLWB 5EXNA 4DY7B 1O3FA 4LK4A 3T25A 4ABJA 3SBKA 3P95A 1ANDA 1BQYA 1EPTA 3SN8A 3HKJB 2BXTH 2D8WA 4TWWA 4D8NA 3OYPA 4FUDA 2PKSB 1X7AC 3KF2A 5ABWA 3MH5A 1TMBH 1DANH 3T28A 3FFGA 2A0QB 1QCPA 1G3EA 2FI3E 5A0BA 4MPWA 1OWKA 2R3UA 1HB0B 5C1UA 5EPYA 1AQ7A 3P8OA 1TQ0B 4AFUA 1DE7H 1UCYE 1SGQE 2CXVA 3U69H 1BCUH 2ZF0H 2H9EH 4YOIA 1Z7KA 1EQ9A 1GCTB 4BXWA 1O2QA 2FYQA 4DURA 1O2HA 2ZDAH 2EEKA 2GKVE 2VWLA 4FVBA 4Y7AA 4ASHA 2WPMS 3ZZ6A 2Y7ZA 1AUJA 4OS1A 2XNIA 2VIDA 3AW1A 3SI3H 3M5MA 1UCYH 4BAQB 3QGNB 2GX4A 3M37A 1OS8A 1YGCH 2AS9A 2HPQH 2AIQA 4A6LA 4NA9H 2XCFA 3UR6A 1QBNA 2P3UB 1RTLA 1SQAA 3PB1E 5GCHF 4X2VA 2ZA5A 4I8LA 1NU7B 1GL0E 3ZVAA 3ZYDA 3OTJE 1SQTA 1V2QT 3QTOH 2QN5T 3TVJB 5L6NH 1C2LA 3MOCA 3QZQA 3ZVBA 3VFEA 1QHRB 2D26C 2OBQA 1G2MA 4FUCA 1O3LA 3RXEA 3NXPA 1W7XH 1QFKH 7KMEH 2OINA 1OPHB 1KXEA 1G9IE 3SJOA 2FYRA 1GJ5H 1EB2A 5I46H 1GI1A 2G5NA 1KTTB 4Y8ZA 1MQ6A 3EDXB 5EU8A 1K1MA 2HNTF 4I8JA 1NROH 3SHAH 2PGBB 1K9OE 2SGFE 2ANYA 1M9UA 1NN6A 1O33A 1MAXA 4YOGA 1TX7A 3SU2A 1GBKA 5T3HA 4ZH8A 1W8BH 1MTVA 5C3NA 1ZRBA 1GBHA 3RU4E 5FPSA 1SLXB 4MDSA 3VGCC 2BDAA 3O8RA 3LU9B 4JYTA 1FPCH 4A1XA 1EZQA 1GI6A 5I25A 1CHOF 1GBCA 1P57B 3SHCH 1C1TA 3KNXA 4CRGA 4XSKU 1YPKH 3RXLA 1Y5UT 8KME2 3AVZA 5C67A 4O97A 1VITG 1JIRA 1PPBH 1MCTA 4NWLA 1TPOA 4CR9A 3PV2A 2BD9A 1ID5H 4K1EA 1TRYA 3LONA 3W94A 5JDUB 3RXDA 5A09A 2BM2A 1ABJH 2SGEE 2ZU2A 3ZVCA 2H2ZA 3RUOA 4R8TB 2GDDA 2G8TA 1VITH 2CF9H 1MZDA 1O36A 1K1LA 1OWIA 1QBOA 2SGAA 1F5LA 4O3TA 4XBDA 1OSSA 1SR5C 3GCNA 1ELCA 5E0HA 2WPJS 1BMLA 3FZZA 2AGGX 1LO6A 2SGPE 1V6DA 3GYLB 1SGFA 1GMDG 2OC8A 2A5IA 3RXVA 1XX9A 3Q76A 3NZIA 3QUMP 4THNH 4CRAA 4D76A 5FAHA 1MTSA 4NGAH 3UOUA 3SI4H 1D6RA 5EXLA 1HLTH 5K0HA 3VB5A 2GZ8A 1O3MA 3M36A 1BTXA 2J2UA 1GVLA 1L2EA 1V2WT 2J92A 2J94A 4MPXA 1EP5A 1ZSJA 1KLIH 1QB6A 2ZHFH 3RC4A 4OS7A 1C2MA 3ELAH 3GDUA 3O8DA 3EE0B 1THSH 3GDSA 1O31A 1L1NA 4AN7A 3AK5A 1S81A 1C5MD 1J14A 2FS9A 1L4DA 1QJ7B 2BD3A 3SV8A 3U8RH 1YYY1 3L3TA 5JB9S 7GCHG 1FDPA 1GI7B 1CBWC 2VH0A 2A2XH 3TH4H 2UUKB 2GTBA 1RTFB 5E0JA 2J4IA 3SZEA 3S0NA 1DOJA 1ARBA 3ZVGA 1XVMA 1Z8IB 2AGIX 5B6LA 3KIDU 3ODFA 1F7ZA 1N8OC 1QA7A 2B5TB 1F2SE 1W10U 2F9PA 1KLTA 1KXCA 1WCZA 2VVUA 2ZGJA 1OX1A 1O3BA 1GG6B 1AFEH 4INLA 5HMAA 2WV9A 1ESAA 1Y5BT 3E8LA 3E91A 3ZZ8A 1C5ZB 2CHAB 4K5ZA 2BDHA 5FBEA 4BXSA 1FPHH 2OCVB 4NA8A 5GWZA 1WOFA 2A7CA 3TJNA 2HNTC 1NPMA 3KQBA 2C93B 3SUEA 2AERH 1SGNE 2VIWA 3GCHB 4NSYA 1A5GH 1H4WA 3BG8A 2ZDVH 1CGJE 2RG3A 2VVCA 1TX6A 3FP7E 1FN6A 1TBQH 4TPIZ 2Y81A 5CHAB 5EW1H 3LOXA 2XXLA 1SGYE 2NU4E 4O9VA 4NFFA 2FP7B 4YO9A 1O2YA 1EZXC 2KAIB 2BD4A 1LVBA 1TGSZ 2WPIS 3C1KA 4B6FA 5GNDA 1BMAA 1K1OA 1MTNB 2FEQH 2ZU1A 1LHDH 4OGYA 2QGRA 2P8OC 4X1RU 2BD7A 4U2WA 4IBLH 4WF8A 2Z3DA 3TNSA 4WJG2 3H5CB 1LQDB 1ZTJA 3MO9A 1FIZA 1EJNA 4IMZA 1CT4E 4AB8A 1RIWB 2QA9E 3RXPA 4ABGA 2EI6A 1ELBA 1TA2A 3BTDE 2BD5A 3GCOA 1O3EA 4F49A 5JPMH 3RC5A 1CT0E 2AMQA 2FX4A 3T62A 3TH3H 1OP2A 1HXFH 4I8KA 3A8CA 3A7WA 2F9VA 1KY9A 2AIPA 1V2RT 2Z3EA 1DSUA 2ANWA 4BOHA 5T6DA 1BIOA 1SBWA 1TNHA 3SNEA 1C1QA 1K1NA 4X1QU 1W11U 5FPYA 3U98H 3ZZDA 2BQWB 3NWUA 1BOQA 2ZCHP 1P2JA 6LPRA 1GMDF 1GBAA 1T8LA 3I77A 3QX5H 1EATA 4ZKNU 2BLOA 4X6PA 3Q3KA 1GGDB 2WZQA 4Y71A 3OX7U 3BF6H 1WAYB 4TYDA 2GCTC 1QR3E 2Z6BD 2ODPA 4BTUB 1IAUA 1SOTA 2Y5HA 3M5NA 4MPVA 4GHTA 3RC6A 4UFFH 5J4SA 3SV9A 2A4QA 3LGIA 2TIOA 2STAE 4XE4A 1O2ZA 5F8ZA 4OM9A 1DXWA 5JBTA 5AHGH 1XVOA 3RMNH 1T4VH 4ABBA 2PTCE 1A61H 2VIQA 3UUZA 1V2JT 7GCHF 1F92A 1W0ZU 5G4BA 4ABIA 2BDGA 7LPRA 3FVFB 4RKOB 3A8DA 1F0UA 3F1SB 4FUBA 2FLBH 3TK5A 4MQAA 4E06H 1CSOE 1HAOH 3BTWE 1TBRH 4WH6A 3BTFE 3K65B 4FUEA 2R2WU 3H7TA 1BT7A 5PTPA 4ZAEA 1GHWH 4GUXA 4ISOA 1P2OA 3RMLH 2ZHQH 1GPZA 1BRUP 1NT1A 2ZEBA 5T1VA 1T32A 5DJ7A 1WSSH 1N6YA 4NIWA 4D9QA 2O9QA 1C9TA 1UVTH 3ZZAA 2BY6X 3FP6E 1BTHH 4Y8XA 4VGCC 1AWHB 3RXSA 1E34B 1P3CA 1XXDA 1TNIA 2NU2E 2GGVB 1XUHA 2O8MA 3P70B 1NS3A 1NRNH 1HDTH 1J17T 1O2NA 1FMGA 1QQ4A 1IQLA 3MU1A 3A84A 4Y0YE 1V2PT 1SC8U 5F8TA 3UQOA 2ZDLA 3SU1A 1SSXA 2OD3B 1ZJKA 1THRH 2GMTC 1NY22 2GT8A 1C5WB 1GDUA 3LGUA 4RN6A 1TABE 4NFEA 1C4V2 1Y3UA 2O8TA 1K2I1 3PO1C 2ZFQH 5C5OA 1GJ8B 1GBIA 4UD9H 3UFAA 3RU4T 2XC5A 5C1XA 2XTTB 4UFEH 1ETTH 3RP2A 4BAHB 3M7TA 1A5IA 1O30A 1UK4A 2PR3A 1JOUB 1YPMH 2W7UA 1JIMA 4AFQA 1P03A 1UMAH 2ESTE 2UUJB 3RDZA 1BHXF 2THFB 2A31A 5F8XA 5J4QA 2DE9A 2FWWA 5HYOA 1AHTH 2J9NA 3E6PH 2W7SA 2XYAA 2TBSA 1KXBA 1C4U2 1TNGA 1TFXA 3OU0A 2VWMA 2ULLA 1HBTH 1K21H 1HJ9A 1SGCA 4YM9A 4YOJA 1N6XA 1UK3A 4D7GA 1ZTKA 3RM0H 1GBJA 1HAZB 1DY8A 1O39A 1WV7H 3VGCB 1O5FH 3JZ2B 4Y0ZE 3UREA 1K1IA 1QL8A 4DIIH 1DUEA 1P01A 1TX8A 2UWLA 3P17H 1ZPZA 1GI9B 3P6ZB 1NRSH 1Y3YA 3A88A 3CS0A 2A45B 4K8YA 1QRZA 1DVAH 1LHCH 3CS7A 3LGYA 1FI8A 1C4Y2 1SI5H 1UTQA 3R3GB 3QLPH 1QBVH 5AFYH 1BBRH 2B9LA 1C5UA 2J95A 3A86A 4DJZB 1ZGIA 3BTQE 1UTOA 2V35A 2GZ7A 4AGKA 1L1JA 1Q2WA 1GHXH 1YLDA 1YPHC 2GV7A 5A8YA 5IDKA 2BOKA 3P8NA 1TAWA 1TLDA 4ESTE 2SGDE 3P8FA 6CHAC 1JRSA 3PMJA 4QT8C 3PLKA 4IW4E 3EA8A 5GJ4B 1HV7A 2ZIQH 1WU1A 1E36B 2ZQ2A 1AD8H 4NZQA 3ATWA 2QXGA 1FQ3A 1IHTH 1FLEE 2RCEA 3RXTA 1GL1A 1TIOA 3M3VA 2BLQA 2FTMA 1D4PB 1SGFG 2Y5GA 1A2CH 1AUTC 4MLFB 3TNTA 1PJPA 3A7TA 2FX6A 5FHTA 2GVFA 4HGCA 1HPGA 2F83A 2C4FH 1TMUH 2AH4X 3BTGE 1G3CA 2DUCA 1T8MA 4FUIA 4B76A 1YPGH 5F03A 2ALVA 3MNCA 1DPOA 1SFIA 3BEUA 2VINA 3F9GA 3RXAA 3STIA 3UOPA 4OGXA 1SLVB 3QN7A 4XBBA 2GD4B 3ATIA 1KXDA 1TOMH 3MWIU 4YTAA 4AZ2B 4BTTB 1FUJA 4MTBA 2HWLB 2C8WB 1TBZH 5GPIB 1C1UH 1CBWB 2GP9B 1GJ9B 3W95A 1LKBA 5DP7A 3RXQA 3SV2H 4JYUH 1IOEA 1BTZA 1DDJA 1EASA 1F0SA 3MU5A 3LPRA 2W3IA 2ZDNA 1O5AB 2HPPH 1BTYA 1QURH 2VJ1A 1LMWB 2ZDKA 2A4OA 2A4RA 3U1IB 1HXEH 2VWNA 2VH6A 1TPSA 2XWAA 4Q7YA 1FY4A 5TCCA 3ZV9A 1TALA 5A8ZA 3K6YA 1CVWH 1UVUH 4X8UH 1RJXB 4JZ1A 2UUFB 4M9FA 4ISLA 3TH2H 1PPZA 1E37B 1O2GH 3LC5A 4SGAE 3SGQE 4ABAA 2FZZA 2IPHA 3KEEA 2PFEA 4KKDA 2G5VA 3OTPA 1HAHH 4X8VH 4X1PU 3RMMH 1SL3A 1BMMH 2CN0H 4X6NA 1NM6A 1P05A 2BDBA 1O3AA 1SB1H 4YESB 4MNYA 4MPUA 1DSTA 1GI2A 2O8UA 2BOHB 2QAAA 1XKBC 2D2DA 1LTOA 1QRXA 2CJIA 2BLWA 4CH8B 3FZDA 1Y5AT 4X2WA 1RD3B 1O38A 1O2KA 1SPJA 1IQFA 1OKXA 4IMQA 2AMDA 4INHA 2NU3E 1LDTT 3A83A 4GAWA 4GVUA 1S83A 1H1BA 1LHGH 1KXAA 1L0ZA 2ZTXA 3E90B 1QJ6B 2Z7FE 3HK6B 3ZZ4A 1U6QA 1D3QB 1GJ6A 2FOBA 3IITA 3SU4A 4YLQH 2BVXH 3TK9A 1LPKB 3AAVA 3DT0H 2P8OB 2CGAA 2FM2A 3TGJE 2VVVA 4NIVA 1QY6A 3RXFA 3TGIE 4DIHH 1YCPH 2I6QA 5IYTA 4BNRA 1MD8A 2R3YA 4TY7A 1C5OH 2PGQB 1C1SA 1MBMA 4SGBE 3V7TA 1FY3A 1NTPA 3ZZ9A 2BY7X 3LIWA 1Y3WA 3GY3A 1OWHA 3B23B 4LZ4B 1QIXB 3AASA 3E0NB 1P04A 1E0FD 2ZQ1A 3SU0A 2G4TA 4LZ1H 1GI3A 4Q80A 4FU7A 2PTNA 3ODDA 1F5KU 2A5AA 2PKAB 3NKKA 1IQNA 2F3CE 3MH7A 3LH3A 4H42U 1ZHRA 1HGTH 3VB7A 3A87A 4AGJA 3JZ1B 1A4WH 3UNRA 3GICB 1SOZA 1XXFA 8LPRA 1S6HA 1AVGH 1H9HE 1BTUA 2BDYA 1A3BH 1DWEH 4AX9H 4WMDA 3SQHE 2PWXA 2GCTB 1HRTH 2QV1A 3RXKA 3LDXH 1IQMA 4K1TA 2BVSH 1E35B 1GWAA 1EB1H 2JH6D 3KN2A 3UIRA 3UNQA 1DLKB 2FS8A 5LGOA 3GISB 1YPHE 4IN2A 5K7RA 2Y6TA 2UWPA 3UNSA 1PPEE 1G37A 3EA9A 3RLYH 4FUGA 1XUFA 1P9SA 4TY6A 1BRCE 2G51A 1P0SH 2D1JA 5DP5A 2OBOA 1ZPBA 3MNBA 2VIPA 4J1YA 1TPPA 1MKWK 1B0FA 3MO3A 1K1PA 4KP0A 2V6NA 3TJVA 4ISHH 1SGEE 1AZZA 1GBLA 3K6ZA 1CU1A 1J9CH 1EZUC 1NFXA 1EAWA 1ZRKA 1ZR0A 2UWOA 3TK6A 2GT7A 2ZU3A 1WTHD 2Y7XA 1PPGE 4X2XA 4RI0A 3IWMA 2PUQH 3PMHB 1FXYA 4B2BA 2GZ9A 2WUBA 1YPEH 1GHZA 1RXPA 4U32A 4CBNA 3F68H 4IGDA 2Y5FA 3SJKA 5ESBA 1BBRK 4YT7H 1Q31A 4K2YA 2CMYA 5DPAA 1NRRH 5CE1A 1ELEE 1T8NA 3QGJA 4UFGH 1O2IA 5HM2A 4OS6A 1FV9A 3Q3XA 3VB3A 1UTLM 1GMCG 3TGKE 3SUFA 5FBIA 3IG6B 1DWCH 2GMTB 1ZMLA 2NU0E 4XBCA 5CMXH 2A7JA 2NWNA 1C9PA 3KQEA 3MHWU 3PO1B 3HK3B 1UK2A 3Q00A 4YZUA 1ELVA 2ZFRH 1SGIB 2A5KA 1EXFA 3UQVA 1PQ5A 4LOYH 5C20A 3EAJA 3T2NA 1C5PA 3A82A 3RXHA 1EX3A 1QTFA 4XOJA 4INKA 2EI7A 1P2KA 3SORA 1ANCA 2GV6A 5GIBA 1NU9A 1DXPA 1C1PA 1G30B 3HATH 2BQ6B 3GCTG 2XC4A 3ATMA 1EOLA 1SGRE 4JZDH 4O03A 4TPYA 1KSNA 1IHSH 4X0WU 1G3BA 1BA8B 1ZMJA 1JBUH 5FCRA 4CRFA 1VITF 4JYVH 4Z0KA 3D65E 1TYNA 3UR9A 1C5LH 4Y8YA 3F6UH 4DT7B 1GI4A 4ZKOU 3NK8A 3T29A 2C90B 2ZGCA 2KAIA 4HTCH 4E7RG 3SV6A 1RTKA 1TGCA 3SJIA 2TGPZ 5DKMA 3ZZCA 2SFAA 2ZGBH 2FMJA 1F0RA 1ZHMA 1OP0A 4Y79A 3RM2H 1C5NH 1YKTA 1GJCB 1XKAC 1TRNA 2RDLA 2WPLS 4ZHLU 1S5SA 1SFQB 1GJBB 3UTUH 4YLUA 1S6FA 1Z8GA 2XBWA 5L2YH 3OSYA 2ZHWH 1P02A 1AY6H 1CE5A 3P8GA 2BYAX 3L33A 3N7OA 1O5CB 4YT6H 4WWYA 1O34A 3SJ8A 3SNCA 4FU8A 4Y6DA 1LCYA 1LKAA 4CRBA 1KTSB 1QL7A 1V2KT 5EQSA 1KIGH 3SGAE 1NZQH 1N1LA 6CHAB 5A0AE 4Y11E 2WYJA 1LPZB 4GPGA 1LPGB 1W14U 1L4ZA 1QB1A 1O3DA 2VNTA 1YP9A 4RKJB 3SQEE 4KTCA 4MNXA 5FX6A 3SJ9A 3VPKA 1FY5A 1W13U 4ZMAH 1P8VC 1XM1A 4AG2A 1FY8E 3LT3A 3RXMA 1NRPH 1OP8A 1VZQH 4LXBH 3RXJA 2QYIA 1HJAC 3M3TA 3PV5A 1FONA 3DUXH 8GCHG 4X6OA 1WUNH 1AU8A 1Y8TA 2ZGHA 1HYLA 3HGNA 3GY5A 5FCKA 3A89A 4B1TA 1LHEH 3BTTE 1SHHB 1O2MA 2QY0B 5ESTE 2J34A 1GDQA 3BG4C 4OS4A 2BZ6H 1UTNA 1C5YB 2F9UA 3A7VA 1GBDA 4IC6A 1C2IA 9ESTA 1TONA 1AMHA 1W2KH 1EAIA 1XMNB 2W5EA 5EOKA 2FDAA 3S69A 1DS2E 2ZCKP 2JH5D 1ELDE 3AW0A 4AFSA 3A7XA 1YCPK 4KTUA 4WH8A 4JCNA 3FAOA 4NIXA 3QDZB 1EJMA 1C1NA 1UO6A 1P11E 1DM4B 1A0LA 1O2PA 2PV9B 2BVRH 5FPTA 3ZVEA 5E2OA 1GMCF 1FAKH 1UTKA 1W12U 3QO6A 4JZEH 5FX5A 2F9BH 1D3PB 2VGCC 3ESTA 1LVOA 1A46H 1SGTA 2ZU5A 2C3SA 2O8WA 2ZGXH 3AAUA 1RS0A 3FANA 5EXMA 1UVOA 2PHBA 1W3CA 1ACBE 2H9TH 5DP8A 2WV5A 4RSPA 1PQAA 1HAXB 1PYTD 1IQJA 1Z8JB 2GDEH 4B6EA 1PPFE 1QJ1B 2V3OH 3ITIA 3GY2A 2ZHEH 6ESTA 4A5TS 3QTVH 1SQOA 1J16A 1ELGA 4JZIA 2JETC 4ZKRU 3LJOA 3ZZ7A 1OOKB 1MTUA 1TA6A 4NG9H 2VWOA 4NCYA 1KDQB 1VCQA 5TJXA 4E7NA 4FUFA 1ZYOA 2XBYA 3RXGA 1GBMA 3S9BA 3H7OA 1SVPA 1C2FA 4I33A 3PV4A 1V2LT 1AWFH 1O3PB 4JK5A 3MTYA 3DD2H 1MKWH 1V2NT 1QA0A 2H5CA 2PUXB 2OUAA 3MI4A 4X8SH 4MG3A 1BZXE 5C5NA 3D49H 5JB8S 1DITH 1L1GA 2B7DH 1XUKA 1D3TB 4NZLA 1GBEA 2BXUH 1ARCA 1BBRE 1ZTLA 4DOQA 1J15A 2A2QH 3LC3A 2C8ZB 4CBOA 1A1RA 1MZAA 2Y80A 1Z6JH 1C5RA 2H6MA 2ANMH 2YNAA 1UVSH 1G2LA 1HIAB 1P2IA 1O3NA 1YPJH 1GJAB 1P2QA 2P59A 3NUMA 1UTMA 4BANB 2ILNA 2JKHA 5JBCS 1AO5A 1EUFA 4IN1A 1QRWA 5EQQA 1AKSB 2BD2A 2FOGA 1GBFA 2RA3A 3ZYEA 3BTEE 4AG1A 5LPEA 1NESE 4ABEA 3A81A 2G00A 5E2PA 1G32B 4IS5A 1HAVB 2QCYA 4CH2B 2HVXA 1WBGB 2ZNKH 2WPHS 3UPEA 4O3UA 4B71A 1BB0B 3ZZ3A 1CHGA 2VIOA 4A92A 3E0PB 2PW8H 2ZWLH 4AYYB 1A0JA 1QB9A 1ZLRA 5DO4H 1LQEA 4K60A 1K28D 1AB9C 3TIUA 2OQ5A 3ATKA 1A5HA 1B0EA 2Q6FA 1CA8B 3UWIA 2Z94A 3PLPA 1AVXA 1HAVA 4R0IA 3M61U 4CHAC 1T8OA 3BEIB 2ZO3H 1P10A 3RXUA 3BTKE 1ETRH 2SNWA 2AGEX 3U8OH 2QXHA 1C2JA 1OWDA 2Y82A 2O8LA 2H5DA 3F9EA 3SUGA 2OC1A 2QIQA 1GJ4H 1AFQC 1H8DH 4A1VA 4I32A 3BTHE 4ZHMU 2F9NA 2FOEA 3SV7A 1NFWA 1GHBG 1CGIE 2J38A 1C5XB 2BY5X 3EYDA 3KL6A 2ASUB 2QF3A 3U8TH 2ZDMA 3SW2B 3A7YA 5B6OA 4WXIA 3TJUA 4ISIH 5T6GA 1AIXH 2F4LA 2YOLA 1MUEB 2ANKH 1N8OB 1DLEA 2G52A 3T5FH 2WV4A 1CA0C 1HUTH 2BY9X 3ZZ5A 2A4GA 5JBAS 1ZZZA 1C1RA 1O37A 2FXRA 1W7GH 2XW9A 1O3JA 1EJAA 1H9LB 2BHGA 1NRQH 1BTPA 4KELA 4WMEA 1INCA 3B8JA 3HGPA 1NC6A 1A0HB 3MU4A 4MNWA 2TGDA 2BDCA 1C2GA 1AGJA 1YF4A 4H6TA 3SYJA 1ESTA 1T31A 2FOCA 1PYTC 3CENA 1FN8A 2SNVA 2H1UA 3EGKH 1BJVA 3U9AH 3TU7H 2DE8A 1CQQA 1D9IA 4Q2KA 1EP6A 1TRMA 4OS5A 1IQKA 1P2NA 4X1NU 4DW2U 3S7HB 3A80A 1MKXK 1SGPE 4NIYA 4UE7H 2IJD1 3ZV8A 3HKIB 3SZNA 1ZMNA 2QXJA 3URCA 2ZC9H 1GI8B 1RRKA 1C1OA 1TQ7B 1GHVH 2R0LA 1K22H 1PPHE 1BTWA 1WQSA 8ESTE 1UTPA 1BRBE 2IOTA 4I8HA 1HAYB 2VB0A 3BV9B 1Z1JA 1TGTA 3GY6A 5EG4A 1GBBA 1PQ8A 2G81E 1VGCC 3TITA 2P95A 4CREA 2K1QA 5HGGA 1F5RA 3GYMA 2WYGA 1TMTH 1RGQA 3KCGH 3PM3A 3H09A 3T27A 4ZXXH 1YBWA 3RXOA 2V0BA 1O2OA 5AVDA 3RXRA 1ESBA 1FNIA 3L6PA 2NU1E 1S85A 1FJSA 4HZHA 1GCDA 1ETSH 2BMGB 1EKBB 1JWTA 2BX4A 1ZSLA 2F91A 2IN2A 1IQGA 7ESTE 4FUHA 1Z1IA 4X8TH 3ATLA 5E0GA 1EPTC 2ZZUH 3Q77A 1C1WH 1RFNA 2HOBA 3A85A 4UFDH 4J2YB 3V13A 1PFXC 2P3FH 2FOFA 1HNEE 2FOMB 3SNAA 4K69A 2ODQA 3WY8A 4FUJA 2PKAA 5BRRE 2QC2A 4Q7XA 3UWJH 1NFYA 4DGJA 4PROA 1S82A 2LPRA 4B74A 4AB9A 4U01A 2BDIA 5DGJA 3PWBA 1ELFA 1S0RA 4JMYA 1ZJDA 2XBVA 3MU8A 4KGAA 1V3XA 4B75A 4F4OC 2VIVA 4AOQA 3D23A 1W0YH 4FU9A 4BAMB 4X6MA 3PMBB 5BPEA 4DVAU 1KXFA 1G3DA 2OC7A 2PKSC 1ZPCA 1ANEA 1GHBF 1HJAB 1VCPA 2Z9GA 4BAKB 5A0CA 3Q3YA 3EA7A 3FP8E 2HGTH 5GDSH 1O3CA 4XFQA 1K1JA 3LGTA 3E1XB 2ZPQA 1AVWA 3F9HA 1V2ST 1NO9H 5TCAA 2HALA 2BQ7B 3F9FA 1O35A 4UDWH 1C2EA 2A32A 2FO9A 5LPFA 1O3OA 2CV3A 5H4IB 1THPB 3BG4B 2PLXA 4BAOB 2I6SA 1HJ8A 4OS2A 4H4FA 1TPAE 1GCTC 1C1VH 2R9PA 5FXLA 3STJA 3M5OA 4JK6A 1YC0A 2XC0A 2BD8A 1CT2E 1Z71A 4VGCB 4MVNA 1O2SA 6GCHG 1TE0A 2HLCA 3QWCH 3LGWA 1DWBH 1WXRA 5F6MA 5LPRA 4KTSA 2OK5A 3DHKH 1XUJA 3LJJA 5DG6A 1BRAA 3ENSB 1GVZA 2WINI 3KGPA 4AORA 3U1JB 5L30H 1O3GA 2ZECA 5E8EH 4NSVA 4ABDA 1T4UH 4CRCA 1EZSC 3M5LA 4MNVA 2A7HA 4GSOA 3UY9A 2ZTYA 4UONA 1F0TA 4D9RA 3S9AA 1AN1E 1UTJA 2VGCB 1OWEA 1AI8H 1JXPA 2A1DB 2Z9KA 1H9IE 2F9OA 3PMAB 4B2CA 3NCLA 3R0FA 2FOAA 3RU4D 3SNBA 4GCHG 1OWJA 1O2UA 1OXGA 4U30A 3PTBA 1O5GH 1GBTA 1Q3XA 1QGFA 1XUIA 3LKWA 1HCGA 3SU3A 1EAUA 2JETB 2B0FA 1QNJA
chains in the Genus database with same CATH superfamily
2ZKSA 1OYTH 2ZU4A 3PTNA 4K3JA 2P93A 1SKYE 2XWBI 2Z3CA 1VJAU 2ZFTA 4WXVA 1ZHPA 2TGTA 4GHQA 1WYKA 1O5EH 2BTCE 2XCNA 2ALPA 1YM0A 1O2TA 3ZZBA 1PQ7A 4XDEA 5HM9A 2ODYB 4B73A 1O5DH 1BUIA 2GCHG 3V12A 3DA9B 1VR1H 1MAYA 1P12E 1B5GH 2ZCLP 1ELAA 1C2KA 3M35A 2AYWA 1LHFH 1V2UT 3BSQA 4A1TA 2ZFPH 4DCDA 3DSOA 2FLRH 3LH1A 1MU6B 2Q6GA 1A3EH 1MH0A 2EI8A 1DUAA 2FODA 2EA3A 1GMHG 2OTVA 3GDVA 5C1YA 3TJOA 4I7YH 1C2DA 1P09A 1MBQA 4M7GA 3MNXA 3WWBA 3V3MA 3M7QA 4GLYA 5DP6A 3GS9A 4Y10E 3MO6A 2BB4A 2H9HA 2R0KA 3A7ZA 3VB6A 2TGAA 1XUGA 3LGVA 3BEFB 3RLWH 3QK1A 1TGBA 3I78A 1SLUB 3T26A 4NWKA 5EPNA 5KGOA 1B7XB 1UCYK 2YNBA 5DP4A 1IQHA 5EGMA 3KYFA 3G01A 4X2YA 3QZRA 1AE8H 1UJ1A 3M7UA 3PWCA 3VXEH 1ZSKA 3GOVB 2FOHA 5JBBS 3SNDA 2LNCA 5A2MH 1Y3VA 1KYNA 4Y7BA 3MFJA 1MTWA 1O2JA 2ZFSA 1ORFA 5EW2H 2AFQB 4IC5A 2W26A 1MU8B 2BY8X 1MKXH 1MD7A 2V7QD 4ABHA 2OP9A 1TB6H 2F43B 3NPSA 1Z8RA 3OY5U 4XRNA 4CRDA 4CR5A 2ZG0H 2BZAA 1NBME 4I8GA 2BLVA 2RA0A 2ZHDA 2Q1JA 5GXPA 2W3KA 2Z9JA 3VG8A 5AF9H 4ZHAA 2JH0D 3O8CA 1FIWA 2QXIA 1GHAG 4AFZA 1AB9B 1ANBA 2FI5E 2C8YB 3URDA 1MQ5A 2TRMA 4Q7ZA 4WY3A 3TPIZ 2OLGA 4K1SA 2TPIZ 3C27B 3BIUH 1O3HA 3I29A 1C5QA 2ZPSA 1YLNA 5ETXA 1FY1A 4HFPB 4B2AA 4CHAB 4DG4A 1Z6EA 1TGNA 2Q6DA 4A7IB 5C2ZA 2LP6A 2FI4E 2OC0A 1TNLA 1EOJA 2ZP0H 1OYQA 5T6FA 1AFQB 2P3TB 5LH8A 5DP3A 1BJUA 1HAGE 2QF0A 2VBCA 6GCHF 1AE5A 1O3IA 2W6ID 2STBE 4ABFA 2XRCA 2FIRH 1C2HA 2P16A 1V2VT 1P3EA 1SGDE 2EC9H 1PPCE 4UEHH 1P06A 3O8BA 3ZVDA 1GG6C 3MH6A 3MU0A 3D62A 2KZ4A 1SMFE 3RXCA 1CA0B 3ZVFA 1KLJH 3BIVH 1V2OT 4ISNA 1FAXA 2VU8E 1BITA 3P92A 1TNKA 2CHAC 2J98A 2XBXA 2WUCA 3E16B 5JYIA 1C5SA 1Y3XA 2Z9LA 4E05H 1O0DH 5DK1A 3SU6A 1E38B 4GCHF 1EAXA 4ZROA 9LPRA 1YLCA 1P2MA 5EQRA 1BHXB 1YCPM 3GY4A 5GCHG 2BX3A 1GI5A 3GCHC 3VB4A 3F0OA 1V2TT 1QQUA 3K2UA 2P94A 2UUYA 1C1MA 1BDAA 3TLOA 1GI0A 1LVMA 1S84A 3GCTF 5CHAC 1CO7E 2J5UA 1GJDB 1O2WA 1ZOMA 1TWXB 1QL9A 2PSXA 1YWUA 3BTME 3RMOH 1DY9A 1MMJN 3SO3A 1BMNH 2IPQX 3A8AA 1DT2A 2AEIH 2ZFFH 3PLBA 1IQEA 2GCHF 4AYVB 1VCWA 1MCVA 3GY8A 4TWYA 1WQVH 1YPLH 4FVDA 1O2VA 1D6WA 1MTNC 1NFUA 3OY6U 3S7KB 5DP9A 1BMFD 3GY7A 1UVPA 3KHVA 1VJ9U 1J8AA 1CGHA 2AMPA 3MH4A 5F53A 1KDQA 2FESH 3MNSA 1O32A 1UHBB 1LVYA 2HNTE 3RXBA 2ZI2H 4Y76A 1GMHF 3SU5A 4D7FA 5SGAE 1RIWC 5L2ZH 1IQIA 3PYHA 1DICA 2G55A 2R2MB 1GJ7B 1P9UA 2C8XB 4FXGH 3EQ0H 1FZZA 3VXFH 4ZXYH 1W0KD 4ZKSU 1V2MT 1O5BB 1VGCB 2WHXA 2M5TA 2HRVA 2Z9IA 5A8XA 1WTGH 4Z6AH 3MMGA 1CHOG 3B9FH 1ELTA 1S0QA 1O2RA 1TNJA 1AZ8A 1G36A 3V0XA 2B8OH 1DWDH 1UHBA 1DX5M 2WPKS 3MYWA 2FTLE 3CP7A 4BTIB 2PSYA 3K9XB 3PROA 3HPTB 3KQ5A 1H8IH 4HI3A 5EJ1A 3DFJA 2IJOB 4X1SU 4JZFH 1HFDA 3A8BA 3KQDA 4ZUHA 3SOSA 5C0TA 4WVPE 3RXIA 1SHYA 1HAPH 1GDNA 1GVKB 3FO8D 1GGDC 1JRTA 1T7CA 1SG8B 2OXSA 2ZTZA 3S9CA 1HIAA 1O2LA 5AFZH 2CF8H 1DFPA 4WMFA 1EPTB 1O2XA 1C5TA 1HAIH 5EODA 1C5VA 1AKSA 3VEQB 3E3TA 2G4UA 8GCHF 2ZPRA 5HXFA 3M3SA 2FPZA 1GHAF 1Y59T 2OQUA 3SUDA 2SGQE 1O3KA 4K8BA 5KEDA 3DFLA 1D3DB 1A7SA 3SGBE 4H6SB 3BN9A 2V3HH 1ABIH 1GHYH 4NA7A 3KQCA 1TOCB 1ZGVA 1JMOH 2KCOA 1SLWB 4I31A 5EXNA 4DY7B 1O3FA 4LK4A 3T25A 4ABJA 3SBKA 3P95A 1ANDA 5EJZA 1BQYA 1EPTA 3SN8A 3HKJB 2BXTH 2D8WA 4TWWA 4D8NA 3OYPA 4FUDA 2PKSB 1X7AC 3KF2A 5ABWA 3MH5A 1TMBH 1DANH 3T28A 3FFGA 2A0QB 1QCPA 1G3EA 2FI3E 4TSFD 5A0BA 4MPWA 1OWKA 2R3UA 1HB0B 2W6JD 5C1UA 5EPYA 1AQ7A 3P8OA 1TQ0B 4AFUA 1DE7H 1UCYE 1SGQE 2CXVA 3U69H 1BCUH 2ZF0H 2H9EH 4YOIA 1Z7KA 1EQ9A 1GCTB 3F3BA 4BXWA 1O2QA 2FYQA 4DURA 1O2HA 2ZDAH 2EEKA 2GKVE 2VWLA 4FVBA 4Y7AA 4ASHA 2WPMS 3ZZ6A 2Y7ZA 1AUJA 4OS1A 2XNIA 2VIDA 3AW1A 3SI3H 3M5MA 1UCYH 4BAQB 3QGNB 2GX4A 3M37A 1OS8A 1YGCH 2AS9A 2HPQH 2AIQA 4A6LA 4NA9H 2XCFA 3UR6A 1QBNA 1RTLA 1SQAA 2P3UB 3PB1E 5GCHF 4X2VA 2ZA5A 4I8LA 1NU7B 1GL0E 3ZVAA 3ZYDA 3OTJE 1SQTA 1V2QT 3QTOH 2QN5T 3TVJB 5L6NH 1C2LA 3MOCA 3QZQA 3ZVBA 3VFEA 1QHRB 2D26C 2OBQA 1G2MA 4FUCA 1O3LA 3RXEA 3NXPA 1W7XH 1QFKH 7KMEH 2OINA 1OPHB 1KXEA 1G9IE 3SJOA 2FYRA 1GJ5H 1EB2A 5I46H 1GI1A 2K8IA 2G5NA 1KTTB 4Y8ZA 1MQ6A 3EDXB 5EU8A 1K1MA 2HNTF 4I8JA 1NROH 3SHAH 1K9OE 2PGBB 2SGFE 2ANYA 1M9UA 1NN6A 1O33A 1MAXA 4YOGA 1TX7A 3SU2A 1GBKA 2WSSD 2QF5A 5T3HA 4ZH8A 1W8BH 1MTVA 5C3NA 1ZRBA 1GBHA 3RU4E 5FPSA 1SLXB 4MDSA 3VGCC 2BDAA 3O8RA 3LU9B 4JYTA 2EY4C 1FPCH 4A1XA 1EZQA 1GI6A 5I25A 1CHOF 1GBCA 1P57B 3SHCH 1C1TA 3KNXA 4CRGA 4XSKU 1YPKH 3RXLA 1E79D 1Y5UT 8KME2 3AVZA 2EQNA 5C67A 4O97A 1VITG 1JIRA 1PPBH 1MCTA 4NWLA 1TPOA 4CR9A 3PV2A 2BD9A 4DT4A 1ID5H 4K1EA 1TRYA 3LONA 3W94A 5JDUB 3RXDA 5A09A 2BM2A 1ABJH 2SGEE 2ZU2A 3ZVCA 2H2ZA 3RUOA 4R8TB 2GDDA 2G8TA 1VITH 2CF9H 1MZDA 1O36A 1K1LA 1OWIA 1QBOA 2SGAA 1F5LA 4O3TA 4XBDA 1OSSA 1SR5C 3GCNA 1ELCA 5E0HA 2WPJS 1BMLA 3FZZA 2AGGX 1LO6A 2SGPE 5HKKD 1V6DA 3GYLB 1SGFA 1GMDG 2OC8A 2A5IA 3RXVA 1XX9A 3Q76A 3NZIA 3QUMP 4THNH 4CRAA 4D76A 5FAHA 1MTSA 4NGAH 3UOUA 3SI4H 1D6RA 5EXLA 1HLTH 4AC9A 5K0HA 3VB5A 2KFWA 2GZ8A 1O3MA 3M36A 1BTXA 1VKYA 1GVLA 1L2EA 2J2UA 1V2WT 2J92A 2J94A 4MPXA 1EP5A 1ZSJA 1KLIH 1QB6A 2ZHFH 3RC4A 4OS7A 1C2MA 3ELAH 3GDUA 3O8DA 3EE0B 1THSH 3GDSA 1O31A 1L1NA 4AN7A 3AK5A 1S81A 1C5MD 1J14A 2FS9A 1L4DA 1QJ7B 1E1RD 2BD3A 3SV8A 3U8RH 1YYY1 3L3TA 5JB9S 7GCHG 1FDPA 1GI7B 1CBWC 2VH0A 2A2XH 3TH4H 2UUKB 2GTBA 1RTFB 5E0JA 2J4IA 5EIYA 3SZEA 3S0NA 1DOJA 1ARBA 2HLDD 3ZVGA 1XVMA 1Z8IB 4F55A 2AGIX 5B6LA 3KIDU 3ODFA 1F7ZA 1N8OC 1QA7A 2B5TB 2KX4A 1F2SE 1W10U 2F9PA 1KLTA 1KXCA 1WCZA 2VVUA 2ZGJA 1OX1A 1O3BA 5CHBA 1GG6B 1AFEH 4INLA 5HMAA 2WV9A 1ESAA 1Y5BT 3E8LA 3E91A 3ZZ8A 1C5ZB 2CHAB 4K5ZA 2BDHA 5FBEA 4BXSA 1FPHH 1WDIA 2OCVB 4NA8A 5GWZA 1WOFA 2A7CA 3TJNA 2HNTC 1NPMA 3KQBA 2C93B 3SUEA 2AERH 1SGNE 2VIWA 3GCHB 4NSYA 1A5GH 1H4WA 3EE7A 3BG8A 2ZDVH 1CGJE 2RG3A 2VVCA 1TX6A 3FP7E 1FN6A 1TBQH 4TPIZ 2Y81A 5CHAB 5EW1H 3LOXA 2XXLA 1SGYE 2NU4E 4O9VA 4NFFA 2FP7B 4YO9A 1O2YA 1EZXC 2KAIB 2BD4A 1LVBA 1TGSZ 2WPIS 3C1KA 4B6FA 5GNDA 1BMAA 1K1OA 1MTNB 2FEQH 2XNDD 1LHDH 2ZU1A 4OGYA 2QGRA 2P8OC 4X1RU 5C94A 2BD7A 4U2WA 4IBLH 4WF8A 2Z3DA 3TNSA 3F2GA 4WJG2 3H5CB 1LQDB 1ZTJA 3MO9A 1FIZA 1EJNA 4IMZA 1CT4E 4AB8A 1RIWB 2PP6A 2QA9E 3RXPA 4ABGA 4ASUD 2EI6A 1ELBA 1TA2A 3BTDE 2BD5A 3GCOA 1O3EA 4F49A 5JPMH 3RC5A 1CT0E 2AMQA 2FX4A 3T62A 3TH3H 1OP2A 1HXFH 4I8KA 3A8CA 3A7WA 2F9VA 1KY9A 2AIPA 3ZIAD 1V2RT 2Z3EA 1DSUA 2ANWA 4BOHA 5T6DA 1BIOA 1SBWA 1TNHA 3SNEA 1C1QA 1K1NA 4X1QU 1W11U 5FPYA 5IK2D 3U98H 3ZZDA 2BQWB 3NWUA 1BOQA 2ZCHP 1P2JA 6LPRA 1GMDF 1GBAA 1T8LA 3I77A 3QX5H 1EATA 4ZKNU 2BLOA 4X6PA 3Q3KA 1GGDB 2WZQA 4Y71A 3OX7U 3MQKC 3BF6H 1WAYB 4TYDA 2GCTC 1QR3E 2Z6BD 2ODPA 4BTUB 1IAUA 1SOTA 2Y5HA 3M5NA 4MPVA 4GHTA 3RC6A 4UFFH 5J4SA 3SV9A 2V3MA 2A4QA 3LGIA 2TIOA 2STAE 4XE4A 1O2ZA 4OM9A 5F8ZA 4YXWD 1DXWA 5JBTA 5AHGH 1XVOA 3RMNH 3UAIC 1T4VH 4ABBA 2PTCE 1A61H 2VIQA 1H8HD 3UUZA 1V2JT 7GCHF 1F92A 1W0ZU 5G4BA 4ABIA 3FN8A 2BDGA 7LPRA 1UW7A 3FVFB 4RKOB 3A8DA 1F0UA 3F1SB 4FUBA 2FLBH 3TK5A 4MQAA 4E06H 1CSOE 1HAOH 3BTWE 1TBRH 4WH6A 3BTFE 3K65B 4FUEA 2R2WU 3H7TA 1BT7A 5PTPA 4ZAEA 1GHWH 4GUXA 4ISOA 1P2OA 3RMLH 2ZHQH 1GPZA 1BRUP 1NT1A 2ZEBA 5T1VA 1T32A 5DJ7A 1WSSH 1N6YA 4NIWA 4D9QA 2O9QA 1C9TA 1UVTH 3ZZAA 2BY6X 3FP6E 1BTHH 4Y8XA 4VGCC 1AWHB 3RXSA 2L6OA 1E34B 1P3CA 5DN6D 1XXDA 1TNIA 2NU2E 2GGVB 1XUHA 2O8MA 3P70B 1NS3A 1NRNH 1HDTH 1J17T 1O2NA 1FMGA 1QQ4A 1IQLA 3MU1A 3N99A 3A84A 4Y0YE 1V2PT 1SC8U 2CK3D 5F8TA 3UQOA 2ZDLA 3SU1A 1SSXA 2OD3B 1ZJKA 1THRH 2GMTC 1NY22 2GT8A 1C5WB 1GDUA 3LGUA 4RN6A 1TABE 4NFEA 1C4V2 1Y3UA 3F2FA 2O8TA 1K2I1 3PO1C 1E1QD 2ZFQH 5C5OA 1GJ8B 1GBIA 4UD9H 3UFAA 3RU4T 2XC5A 5C1XA 2XTTB 4UFEH 1ETTH 3RP2A 4BAHB 3M7TA 1A5IA 1O30A 1UK4A 3OEHD 2HVYB 2PR3A 1JOUB 1YPMH 2W7UA 1JIMA 4ACAA 4AFQA 1P03A 1UMAH 2ESTE 4P02A 2UUJB 3RDZA 1BHXF 2THFB 2A31A 5F8XA 5J4QA 2DE9A 2FWWA 5HYOA 1AHTH 2J9NA 3E6PH 2W7SA 2XYAA 2TBSA 1KXBA 1C4U2 1TNGA 1TFXA 3OU0A 2VWMA 2ULLA 1HBTH 1K21H 1HJ9A 1SGCA 4YM9A 4YOJA 1N6XA 1UK3A 4D7GA 1ZTKA 3RM0H 1GBJA 1HAZB 1DY8A 1O39A 1WV7H 3VGCB 1O5FH 3JZ2B 4Y0ZE 3UREA 1K1IA 1QL8A 4DIIH 1DUEA 1P01A 1TX8A 2UWLA 3P17H 1ZPZA 1GI9B 3P6ZB 1NRSH 1Y3YA 4HG6A 3A88A 3CS0A 2A45B 4K8YA 1QRZA 1DVAH 1LHCH 3CS7A 3LGYA 1FI8A 1C4Y2 1SI5H 4RT0A 1UTQA 3R3GB 3QLPH 1QBVH 5AFYH 1BBRH 2B9LA 1C5UA 2J95A 3A86A 4DJZB 1ZGIA 3BTQE 1UTOA 2V35A 2GZ7A 4AGKA 1L1JA 1Q2WA 3W1EA 1GHXH 1YLDA 3N7DA 1YPHC 2GV7A 5A8YA 5IDKA 2BOKA 3P8NA 1TAWA 1YY3A 1TLDA 4ESTE 2SGDE 3P8FA 6CHAC 1JRSA 3PMJA 4QT8C 3WWFA 3PLKA 4IW4E 3EA8A 5GJ4B 1HV7A 2ZIQH 1WU1A 1E36B 2ZQ2A 1AD8H 4NZQA 3ATWA 2QXGA 1FQ3A 1IHTH 1FLEE 2RCEA 3RXTA 1GL1A 1TIOA 3M3VA 2BLQA 2FTMA 1D4PB 1SGFG 2Y5GA 1SQRA 1A2CH 1AUTC 4MLFB 3TNTA 1PJPA 3A7TA 2FX6A 5FHTA 2GVFA 4HGCA 1HPGA 2F83A 2C4FH 1TMUH 2AH4X 3BTGE 1G3CA 2DUCA 1K0HA 1T8MA 4FUIA 4B76A 1YPGH 5F03A 2ALVA 3MNCA 1DPOA 5DSFA 1SFIA 3BEUA 2VINA 3F9GA 3RXAA 3STIA 3UOPA 4OGXA 1SLVB 3QN7A 4XBBA 2GD4B 3ATIA 1KXDA 1TOMH 3MWIU 4YTAA 4AZ2B 4BTTB 1FUJA 4MTBA 2HWLB 2C8WB 1TBZH 5GPIB 1C1UH 1CBWB 2GP9B 1GJ9B 3W95A 1LKBA 4RT1A 5DP7A 3RXQA 3SV2H 4JYUH 1IOEA 1BTZA 1DDJA 1EASA 1F0SA 3MU5A 3LPRA 2W3IA 2ZDNA 1O5AB 2HPPH 1BTYA 1QURH 2VJ1A 1LMWB 2ZDKA 2A4OA 2A4RA 3U1IB 1HXEH 2VWNA 4P00A 3PRBA 2VH6A 1TPSA 2XWAA 4Q7YA 1FY4A 5TCCA 3ZV9A 1TALA 5A8ZA 3K6YA 1CVWH 1UVUH 4X8UH 1RJXB 2JJ2D 4JZ1A 2UUFB 4M9FA 4ISLA 3TH2H 1PPZA 1E37B 1O2GH 3LC5A 4SGAE 3SGQE 2KCYA 2FZZA 4ABAA 2IPHA 3KEEA 2PFEA 4KKDA 2G5VA 3OTPA 1HAHH 4X8VH 4X1PU 3RMMH 1SL3A 1BMMH 2CN0H 4X6NA 1NM6A 1P05A 2BDBA 1O3AA 1SB1H 4YESB 4MNYA 4MPUA 1DSTA 1GI2A 2O8UA 2BOHB 2QAAA 1XKBC 2D2DA 1LTOA 1QRXA 2CJIA 2BLWA 4CH8B 3FZDA 1Y5AT 4X2WA 1RD3B 1O38A 1O2KA 1SPJA 1IQFA 2KR7A 1OKXA 4IMQA 2AMDA 4INHA 2NU3E 1LDTT 3A83A 4GAWA 4GVUA 3U28C 1S83A 1H1BA 1LHGH 1KXAA 1L0ZA 2ZTXA 3E90B 1QJ6B 2Z7FE 3HK6B 3ZZ4A 1U6QA 1D3QB 1GJ6A 2FOBA 3IITA 3SU4A 4YLQH 2BVXH 3TK9A 1LPKB 3AAVA 3KYGA 3DT0H 2P8OB 2CGAA 2FM2A 3TGJE 2VVVA 4NIVA 1QY6A 3RXFA 3TGIE 4DIHH 1YCPH 2I6QA 5IYTA 4BNRA 1MD8A 2R3YA 4TY7A 1C5OH 1C1SA 1MBMA 2PGQB 4SGBE 3V7TA 4FOUC 1FY3A 1NTPA 3ZZ9A 2BY7X 3LIWA 1Y3WA 3GY3A 1OWHA 3B23B 4LZ4B 1QIXB 3AASA 3DSGA 3E0NB 1P04A 1E0FD 2ZQ1A 3SU0A 2G4TA 4LZ1H 1GI3A 4Q80A 4FU7A 2PTNA 3ODDA 1F5KU 2A5AA 2PKAB 3NKKA 4I86A 1IQNA 2F3CE 2K0QA 3MH7A 3LH3A 4H42U 1ZHRA 1HGTH 3VB7A 3A87A 4AGJA 3JZ1B 1A4WH 3UNRA 5CDFE 3GICB 1SOZA 1XXFA 8LPRA 1S6HA 1AVGH 1H9HE 1BTUA 2BDYA 1A3BH 1DWEH 4AX9H 4WMDA 3SQHE 2PWXA 2L74A 2GCTB 1HRTH 2QV1A 3RXKA 3LDXH 1IQMA 4K1TA 2BVSH 1E35B 1GWAA 1EB1H 2JH6D 3KN2A 3WW7A 3UIRA 3UNQA 5KECA 1DLKB 1S6LA 2FS8A 5LGOA 3GISB 1YPHE 4IN2A 5K7RA 2Y6TA 2UWPA 3UNSA 1PPEE 1G37A 3EA9A 3RLYH 4FUGA 1XUFA 2YMSD 2WPDD 1P9SA 4TY6A 1BRCE 2G51A 1P0SH 2D1JA 5DP5A 2OBOA 1ZPBA 3MNBA 2VIPA 4J1YA 1TPPA 1QZ8A 1MKWK 1B0FA 3MO3A 1K1PA 4KP0A 2V6NA 3TJVA 4ISHH 1SGEE 1AZZA 1GBLA 3K6ZA 1CU1A 1J9CH 1EZUC 1NFXA 1EAWA 1ZRKA 1ZR0A 2UWOA 3TK6A 2GT7A 2ZU3A 1WTHD 2Y7XA 1PPGE 4X2XA 4RI0A 3IWMA 2PUQH 3PMHB 1FXYA 4B2BA 2GZ9A 2WUBA 1YPEH 1GHZA 1RXPA 4U32A 4CBNA 3F68H 4IGDA 2Y5FA 3SJKA 5ESBA 1BBRK 4YT7H 1Q31A 5HIYA 4K2YA 2CMYA 5DPAA 1NRRH 5CE1A 1ELEE 1T8NA 3QGJA 4UFGH 1O2IA 5HM2A 4OS6A 1FV9A 3Q3XA 3VB3A 1UTLM 1GMCG 3TGKE 3SUFA 5FBIA 3IG6B 1DWCH 2GMTB 1ZMLA 2NU0E 4XBCA 5CMXH 2A7JA 2NWNA 1C9PA 3KQEA 3FOAA 3MHWU 3PO1B 3HK3B 1UK2A 3Q00A 4YZUA 1ELVA 2QE7D 2ZFRH 1SGIB 2A5KA 1EXFA 3UQVA 1PQ5A 4LOYH 5C20A 3EAJA 3T2NA 1C5PA 3A82A 3RXHA 1EX3A 1QTFA 4XOJA 4INKA 2EI7A 1P2KA 3SORA 1ANCA 2GV6A 5GIBA 1NU9A 1DXPA 1C1PA 1G30B 3HATH 2BQ6B 3GCTG 2XC4A 3ATMA 1EOLA 1SGRE 4JZDH 4O03A 4TPYA 1KSNA 1IHSH 4X0WU 1G3BA 4XD7D 4Q4LA 1BA8B 1ZMJA 1JBUH 5FCRA 4CRFA 1VITF 4JYVH 4Z0KA 3D65E 1TYNA 3UR9A 1C5LH 4Y8YA 3F6UH 3UB0A 1GI4A 4DT7B 4ZKOU 1OHHD 3NK8A 3T29A 2C90B 2ZGCA 2KAIA 4HTCH 4E7RG 3SV6A 1RTKA 1TGCA 3SJIA 2TGPZ 5DKMA 3ZZCA 2SFAA 2ZGBH 1W0JD 2FMJA 1F0RA 1ZHMA 1OP0A 4Y79A 3RM2H 1C5NH 1YKTA 1GJCB 1XKAC 1TRNA 2RDLA 3NRLA 2WPLS 4ZHLU 1S5SA 1SFQB 1GJBB 3UTUH 4YLUA 1S6FA 1Z8GA 2XBWA 5L2YH 3OSYA 2ZHWH 1P02A 1AY6H 2XOKD 1CE5A 3P8GA 2BYAX 3L33A 3N7OA 1O5CB 4YT6H 4WWYA 1O34A 3SJ8A 3SNCA 3OFND 4FU8A 4Y6DA 1LCYA 1LKAA 4CRBA 1KTSB 1QL7A 1V2KT 5EQSA 1KIGH 3SGAE 1NZQH 1N1LA 6CHAB 5A0AE 4Y11E 2WYJA 1LPZB 4GPGA 1LPGB 1W14U 1L4ZA 1QB1A 1O3DA 2VNTA 1YP9A 4RKJB 3SQEE 4KTCA 4MNXA 5FX6A 3SJ9A 3VPKA 1FY5A 1W13U 4ZMAH 1P8VC 1XM1A 4AG2A 1FY8E 3LT3A 3RXMA 1NRPH 5C0UA 1OP8A 1VZQH 4LXBH 3RXJA 2QYIA 1HJAC 3M3TA 3PV5A 1FONA 3DUXH 8GCHG 4X6OA 1WUNH 1AU8A 1Y8TA 2ZGHA 1HYLA 3HGNA 3GY5A 5FCKA 3A89A 3FKSD 4B1TA 5FL7D 1LHEH 3BTTE 1SHHB 2YMSC 1O2MA 2QY0B 5ESTE 2J34A 1GDQA 3BG4C 4OS4A 2BZ6H 1UTNA 1C5YB 2F9UA 3A7VA 1GBDA 4IC6A 1C2IA 9ESTA 1TONA 1AMHA 1W2KH 1EAIA 1XMNB 2W5EA 5EOKA 2FDAA 3S69A 1DS2E 2ZCKP 2JH5D 1ELDE 3AW0A 4AFSA 3A7XA 1YCPK 2J98B 4KTUA 4ZCNA 4WH8A 4JCNA 3FAOA 4NIXA 3QDZB 1EJMA 1C1NA 1UO6A 1P11E 1DM4B 1A0LA 1O2PA 2PV9B 2BVRH 5FPTA 3ZVEA 5E2OA 1GMCF 1FAKH 1UTKA 4F48B 2JDID 1W12U 3QO6A 4JZEH 5FX5A 2F9BH 1D3PB 2VGCC 3ESTA 5C17A 1LVOA 1A46H 1SGTA 2ZU5A 2C3SA 2O8WA 2ZGXH 3AAUA 5HIZA 1RS0A 3FANA 5EXMA 1UVOA 2PHBA 1W3CA 1ACBE 2H9TH 5DP8A 2WV5A 4RSPA 1PQAA 1HAXB 1PYTD 1IQJA 1Z8JB 2GDEH 4B6EA 2JJ1D 1PPFE 1QJ1B 2V3OH 3ITIA 3GY2A 2ZHEH 6ESTA 4A5TS 3QTVH 1SQOA 1J16A 1ELGA 1FX0B 4JZIA 2JETC 4ZKRU 3LJOA 3ZZ7A 1OOKB 1MTUA 1TA6A 4NG9H 2VWOA 4NCYA 1KDQB 1VCQA 5TJXA 4E7NA 4FUFA 1ZYOA 2XBYA 3RXGA 1GBMA 3S9BA 3H7OA 1SVPA 1C2FA 4I33A 2KCPA 3PV4A 2J97A 1V2LT 1AWFH 1O3PB 4JK5A 3MTYA 3DD2H 1MKWH 1V2NT 1QA0A 2H5CA 2PUXB 2OUAA 3MI4A 4X8SH 4MG3A 1BZXE 5C5NA 2RFKC 3D49H 5JB8S 1DITH 1L1GA 2B7DH 1XUKA 1D3TB 3F0PA 4NZLA 2AHME 1GBEA 2BXUH 1ARCA 1BBRE 1ZTLA 4DOQA 1J15A 2A2QH 3LC3A 2C8ZB 4CBOA 1A1RA 1MZAA 2Y80A 1Z6JH 1C5RA 2H6MA 4ACBA 2ANMH 2YNAA 1UVSH 1G2LA 1HIAB 1P2IA 1O3NA 1YPJH 1NBMD 1GJAB 1P2QA 2P59A 3NUMA 1UTMA 4BANB 2ILNA 2JKHA 5JBCS 1AO5A 1EUFA 4IN1A 1QRWA 5EQQA 1AKSB 2BD2A 2FOGA 1GBFA 2RA3A 3ZYEA 3BTEE 4AG1A 5LPEA 1NESE 4ABEA 3A81A 2G00A 5E2PA 1G32B 4IS5A 1HAVB 2QCYA 4CH2B 2HVXA 1WBGB 2ZNKH 2WPHS 3UPEA 4O3UA 4B71A 1BB0B 3ZZ3A 1CHGA 2VIOA 4A92A 3E0PB 4FETA 2PW8H 2ZWLH 4AYYB 1A0JA 1QB9A 1ZLRA 5DO4H 3DSPA 1LQEA 1EFRD 4K60A 1K28D 1AB9C 3TIUA 2OQ5A 3ATKA 3PRDA 1A5HA 1B0EA 2Q6FA 1CA8B 3UWIA 2Z94A 3PLPA 1AVXA 1HAVA 4R0IA 3M61U 4CHAC 1T8OA 3BEIB 2ZO3H 1P10A 3RXUA 3BTKE 1ETRH 2SNWA 2AGEX 3U8OH 2QXHA 1C2JA 1OWDA 2Y82A 2O8LA 2H5DA 1MABB 4Q63A 3F9EA 3SUGA 3OAAD 2OC1A 2QIQA 1GJ4H 1AFQC 1H8DH 4A1VA 4I32A 2RDEA 3BTHE 4ZHMU 2F9NA 2FOEA 3SV7A 1NFWA 1GHBG 1CGIE 2J38A 1C5XB 2BY5X 3EYDA 3KL6A 2ASUB 2QF3A 3U8TH 2ZDMA 3SW2B 3A7YA 5B6OA 4WXIA 3TJUA 4ISIH 5T6GA 1AIXH 2F4LA 2YOLA 1MUEB 2ANKH 1N8OB 1DLEA 2G52A 3T5FH 2JIZD 2WV4A 1CA0C 1HUTH 2BY9X 3ZZ5A 2A4GA 5JBAS 1ZZZA 2M2AA 1C1RA 1O37A 2FXRA 1W7GH 2XW9A 1O3JA 1EJAA 1H9LB 2BHGA 1NRQH 1BTPA 4KELA 4WMEA 1INCA 3B8JA 3HGPA 1NC6A 1A0HB 3MU4A 4MNWA 2TGDA 2BDCA 1C2GA 1AGJA 1YF4A 4H6TA 3SYJA 1ESTA 3OEED 1T31A 2FOCA 1PYTC 3CENA 1FN8A 2SNVA 2H1UA 3EGKH 1BJVA 3U9AH 3TU7H 2DE8A 1CQQA 1D9IA 4Q2KA 1EP6A 1TRMA 2KM0A 4OS5A 1IQKA 1P2NA 4X1NU 4DW2U 3S7HB 3A80A 1MKXK 1SGPE 4NIYA 4UE7H 1KMHB 2IJD1 3ZV8A 3HKIB 3SZNA 1ZMNA 2QXJA 3URCA 2ZC9H 1GI8B 5EJLA 1RRKA 1C1OA 1TQ7B 4Z1MD 1GHVH 2R0LA 1K22H 1PPHE 1BTWA 1WQSA 8ESTE 1UTPA 1BRBE 2IOTA 4I8HA 1HAYB 2VB0A 3BV9B 1Z1JA 1TGTA 3GY6A 5EG4A 1GBBA 1PQ8A 2G81E 1VGCC 3TITA 1COWD 2P95A 4CREA 2K1QA 5HGGA 1F5RA 3GYMA 2WYGA 1TMTH 1RGQA 3KCGH 3H09A 3PM3A 3T27A 4ZXXH 1YBWA 3RXOA 2V0BA 2LELA 1O2OA 5AVDA 3F2HA 3RXRA 1ESBA 1FNIA 3L6PA 4TT3D 2NU1E 1S85A 3N7EA 1FJSA 4HZHA 1GCDA 1ETSH 2BMGB 1EKBB 1JWTA 2BX4A 3OE7D 1ZSLA 2F91A 2IN2A 3DCLA 1IQGA 7ESTE 4FUHA 1Z1IA 4X8TH 3ATLA 5E0GA 1EPTC 2ZZUH 3Q77A 1C1WH 1RFNA 2HOBA 3A85A 4UFDH 4J2YB 3V13A 1PFXC 2P3FH 2FOFA 1HNEE 2FOMB 3SNAA 4K69A 2ODQA 3WY8A 4FUJA 2PKAA 5BRRE 2QC2A 4Q7XA 3UWJH 1NFYA 4DGJA 4PROA 1S82A 2LPRA 4B74A 4AB9A 4U01A 2BDIA 5DGJA 3PWBA 2GJGA 1ELFA 1S0RA 2QF4A 4JMYA 1ZJDA 2XBVA 3MU8A 4KGAA 1V3XA 1H8ED 4B75A 4F4OC 2VIVA 4AOQA 3D23A 1W0YH 4FU9A 4BAMB 4X6MA 3PMBB 5BPEA 4DVAU 1KXFA 1G3DA 2OC7A 2PKSC 1ZPCA 1ANEA 1GHBF 1HJAB 1VCPA 2Z9GA 4BAKB 5A0CA 3Q3YA 3EA7A 3FP8E 2HGTH 5GDSH 1O3CA 4XFQA 1K1JA 3LGTA 3E1XB 2ZPQA 1AVWA 3F9HA 1V2ST 1NO9H 5TCAA 2HALA 2BQ7B 3F9FA 3CNRA 1O35A 4UDWH 1C2EA 2A32A 2YMSB 2FO9A 5LPFA 1O3OA 2CV3A 5H4IB 1THPB 3BG4B 2PLXA 4BAOB 2I6SA 1HJ8A 4OS2A 4H4FA 1TPAE 1GCTC 1C1VH 2R9PA 5FXLA 3STJA 3M5OA 4JK6A 1YC0A 2XC0A 2BD8A 1CT2E 1Z71A 4VGCB 4MVNA 1O2SA 6GCHG 1TE0A 2HLCA 3QWCH 3LGWA 1DWBH 1WXRA 5F6MA 5LPRA 4KTSA 2OK5A 3DHKH 1XUJA 3LJJA 5DG6A 1BRAA 3ENSB 1GVZA 2WINI 3KGPA 4AORA 3U1JB 5L30H 1O3GA 2ZECA 5E8EH 4NSVA 4ABDA 1T4UH 4CRCA 1EZSC 3M5LA 4MNVA 2A7HA 4GSOA 3UY9A 2ZTYA 4UONA 1F0TA 4D9RA 2KCAA 3S9AA 1AN1E 1UTJA 2VGCB 1OWEA 1AI8H 1JXPA 2A1DB 2Z9KA 1H9IE 2F9OA 3PMAB 4B2CA 3NCLA 3R0FA 2FOAA 3RU4D 3SNBA 4GCHG 1OWJA 1O2UA 1OXGA 4U30A 3PTBA 1O5GH 1GBTA 1Q3XA 1QGFA 1XUIA 3LKWA 1HCGA 3SU3A 1EAUA 2JETB 2B0FA 1QNJA
chains in the Genus database with same CATH topology
2ZKSA 1OYTH 2ZU4A 3PTNA 4K3JA 2P93A 1SKYE 2XWBI 2Z3CA 1VJAU 2ZFTA 4WXVA 1ZHPA 2TGTA 4GHQA 1WYKA 1O5EH 2BTCE 2XCNA 2ALPA 1YM0A 1O2TA 3ZZBA 1PQ7A 4XDEA 5HM9A 2ODYB 4B73A 1O5DH 1BUIA 2GCHG 3V12A 3DA9B 1VR1H 1MAYA 1P12E 1B5GH 2ZCLP 1ELAA 1C2KA 3M35A 2AYWA 1LHFH 1V2UT 3BSQA 4A1TA 2ZFPH 4DCDA 3DSOA 2FLRH 3LH1A 1MU6B 2Q6GA 1A3EH 1MH0A 2EI8A 1DUAA 2FODA 2EA3A 1GMHG 2OTVA 3GDVA 5C1YA 3TJOA 4I7YH 1C2DA 1P09A 1MBQA 4M7GA 3MNXA 3WWBA 3V3MA 3M7QA 4GLYA 5DP6A 3GS9A 4Y10E 3MO6A 2BB4A 2H9HA 2R0KA 3A7ZA 3VB6A 2TGAA 1XUGA 3LGVA 3BEFB 3RLWH 3QK1A 1TGBA 3I78A 1SLUB 3T26A 4NWKA 5EPNA 1B7XB 1UCYK 2YNBA 5DP4A 1IQHA 5EGMA 3G01A 4X2YA 3QZRA 1AE8H 1UJ1A 3M7UA 3PWCA 3VXEH 1ZSKA 3GOVB 2FOHA 5JBBS 3SNDA 2LNCA 5A2MH 1Y3VA 1KYNA 4Y7BA 3MFJA 1MTWA 1O2JA 2ZFSA 1ORFA 5EW2H 2AFQB 4IC5A 2W26A 1MU8B 2BY8X 1MKXH 1MD7A 2V7QD 4ABHA 2OP9A 1TB6H 4CRDA 3NPSA 1Z8RA 3OY5U 2F43B 4CR5A 2ZG0H 2BZAA 1NBME 4I8GA 2BLVA 2RA0A 2ZHDA 2Q1JA 5GXPA 2W3KA 2Z9JA 3VG8A 5AF9H 4ZHAA 2JH0D 3O8CA 1FIWA 2QXIA 1GHAG 4AFZA 1AB9B 1ANBA 2FI5E 2C8YB 3URDA 1MQ5A 2TRMA 4Q7ZA 4WY3A 3TPIZ 2OLGA 4K1SA 2TPIZ 3C27B 3BIUH 1O3HA 3I29A 1C5QA 2ZPSA 4B2AA 5ETXA 1FY1A 4HFPB 4CHAB 4DG4A 1Z6EA 1TGNA 2Q6DA 4A7IB 5C2ZA 2FI4E 2OC0A 1TNLA 1EOJA 2ZP0H 1OYQA 5T6FA 1AFQB 2P3TB 5LH8A 5DP3A 1BJUA 1HAGE 2QF0A 6GCHF 2VBCA 1AE5A 1O3IA 2W6ID 2STBE 4ABFA 2XRCA 2FIRH 1C2HA 2P16A 1V2VT 1P3EA 1SGDE 2EC9H 1PPCE 4UEHH 1P06A 3O8BA 3ZVDA 1GG6C 3MH6A 3MU0A 3D62A 2KZ4A 1SMFE 3RXCA 1CA0B 3ZVFA 1KLJH 3BIVH 1V2OT 4ISNA 1FAXA 2VU8E 1BITA 3P92A 1TNKA 2CHAC 2XBXA 2WUCA 3E16B 5JYIA 1C5SA 1Y3XA 2Z9LA 4E05H 1O0DH 5DK1A 3SU6A 1E38B 4GCHF 1EAXA 4ZROA 9LPRA 1YLCA 1P2MA 5EQRA 1BHXB 1YCPM 3GY4A 5GCHG 2BX3A 1GI5A 3GCHC 3VB4A 3F0OA 1V2TT 1QQUA 3K2UA 2P94A 2UUYA 1C1MA 1BDAA 3TLOA 1GI0A 1LVMA 1S84A 3GCTF 5CHAC 1CO7E 2J5UA 1GJDB 1O2WA 1ZOMA 1TWXB 1QL9A 2PSXA 3BTME 3RMOH 3SO3A 1DY9A 1MMJN 1BMNH 3A8AA 1DT2A 2AEIH 2ZFFH 3PLBA 1IQEA 2GCHF 4AYVB 1VCWA 1MCVA 3GY8A 4TWYA 1WQVH 1YPLH 4FVDA 1O2VA 1D6WA 1MTNC 1NFUA 3OY6U 3S7KB 5DP9A 1BMFD 3GY7A 1UVPA 3KHVA 1VJ9U 1J8AA 1CGHA 2AMPA 3MH4A 5F53A 1KDQA 2FESH 3MNSA 1O32A 1UHBB 1LVYA 2HNTE 3RXBA 2ZI2H 4Y76A 1GMHF 3SU5A 4D7FA 5SGAE 1RIWC 5L2ZH 1IQIA 3PYHA 1DICA 2G55A 2R2MB 1GJ7B 1P9UA 2C8XB 4FXGH 3EQ0H 1FZZA 3VXFH 4ZXYH 1W0KD 4ZKSU 1V2MT 1O5BB 1VGCB 2WHXA 2M5TA 2HRVA 2Z9IA 5A8XA 1WTGH 4Z6AH 3MMGA 1CHOG 3B9FH 1ELTA 1S0QA 1O2RA 1TNJA 1AZ8A 1G36A 3V0XA 2B8OH 1DWDH 1UHBA 1DX5M 2WPKS 3MYWA 2FTLE 3CP7A 4BTIB 2PSYA 3K9XB 3PROA 3HPTB 1H8IH 4HI3A 3DFJA 2IJOB 4X1SU 4JZFH 1HFDA 3A8BA 3KQDA 4ZUHA 3SOSA 5C0TA 4WVPE 3RXIA 1SHYA 1HAPH 1GDNA 1GVKB 3FO8D 1GGDC 1JRTA 1T7CA 1SG8B 2OXSA 2ZTZA 3S9CA 1HIAA 1O2LA 5AFZH 2CF8H 1DFPA 4WMFA 1EPTB 1O2XA 1C5TA 1HAIH 5EODA 1C5VA 1AKSA 3VEQB 3E3TA 2G4UA 8GCHF 2ZPRA 5HXFA 3M3SA 2FPZA 1GHAF 1Y59T 2OQUA 3SUDA 2SGQE 1O3KA 4K8BA 3DFLA 1D3DB 1A7SA 3SGBE 4H6SB 3BN9A 2V3HH 1ABIH 1GHYH 4NA7A 3KQCA 1TOCB 1ZGVA 1JMOH 4I31A 1SLWB 2KCOA 5EXNA 4DY7B 1O3FA 4LK4A 3T25A 4ABJA 3SBKA 3P95A 1ANDA 1BQYA 1EPTA 3SN8A 3HKJB 2BXTH 2D8WA 4TWWA 4D8NA 3OYPA 4FUDA 2PKSB 1X7AC 3KF2A 5ABWA 3MH5A 1TMBH 1DANH 3T28A 3FFGA 2A0QB 1QCPA 1G3EA 2FI3E 4TSFD 5A0BA 4MPWA 1OWKA 2R3UA 1HB0B 2W6JD 5C1UA 5EPYA 1AQ7A 3P8OA 1TQ0B 4AFUA 1DE7H 1UCYE 1SGQE 2CXVA 3U69H 1BCUH 2ZF0H 2H9EH 4YOIA 1Z7KA 1EQ9A 1GCTB 3F3BA 4BXWA 1O2QA 2FYQA 4DURA 1O2HA 2ZDAH 2EEKA 2GKVE 2VWLA 4FVBA 4Y7AA 4ASHA 2WPMS 3ZZ6A 2Y7ZA 1AUJA 4OS1A 2XNIA 2VIDA 3AW1A 3SI3H 3M5MA 1UCYH 4BAQB 3QGNB 2GX4A 3M37A 1OS8A 1YGCH 2AS9A 2HPQH 2AIQA 4A6LA 4NA9H 2XCFA 3UR6A 1QBNA 2P3UB 1RTLA 1SQAA 3PB1E 5GCHF 4X2VA 2ZA5A 4I8LA 1NU7B 1GL0E 3ZVAA 3ZYDA 3OTJE 1SQTA 1V2QT 3QTOH 2QN5T 3TVJB 5L6NH 1C2LA 3MOCA 3QZQA 3ZVBA 3VFEA 1QHRB 2D26C 2OBQA 1G2MA 4FUCA 1O3LA 3RXEA 3NXPA 1W7XH 1QFKH 7KMEH 2OINA 1OPHB 1KXEA 1G9IE 3SJOA 2FYRA 1GJ5H 1EB2A 5I46H 1GI1A 2K8IA 2G5NA 1KTTB 4Y8ZA 1MQ6A 3EDXB 5EU8A 1K1MA 2HNTF 4I8JA 1NROH 3SHAH 2PGBB 1K9OE 2SGFE 2ANYA 1M9UA 1NN6A 1O33A 1MAXA 4YOGA 1TX7A 3SU2A 1GBKA 2WSSD 2QF5A 5T3HA 4ZH8A 1W8BH 1MTVA 5C3NA 1ZRBA 1GBHA 3RU4E 5FPSA 1SLXB 4MDSA 3VGCC 2BDAA 3O8RA 3LU9B 4JYTA 1FPCH 4A1XA 1EZQA 1GI6A 5I25A 1CHOF 1GBCA 1P57B 3SHCH 1C1TA 3KNXA 4CRGA 4XSKU 1YPKH 3RXLA 1E79D 1Y5UT 8KME2 3AVZA 5C67A 4O97A 1VITG 1JIRA 1PPBH 1MCTA 4NWLA 1TPOA 4CR9A 3PV2A 2BD9A 4DT4A 1ID5H 4K1EA 1TRYA 3LONA 3W94A 5JDUB 3RXDA 5A09A 2BM2A 1ABJH 2SGEE 2ZU2A 3ZVCA 2H2ZA 3RUOA 4R8TB 2GDDA 2G8TA 1VITH 2CF9H 1MZDA 1O36A 1K1LA 1OWIA 1QBOA 2SGAA 1F5LA 4O3TA 4XBDA 1OSSA 1SR5C 3GCNA 1ELCA 5E0HA 2WPJS 1BMLA 3FZZA 2AGGX 1LO6A 2SGPE 5HKKD 1V6DA 3GYLB 1SGFA 1GMDG 2OC8A 2A5IA 3RXVA 1XX9A 3Q76A 3NZIA 3QUMP 4THNH 4CRAA 4D76A 5FAHA 1MTSA 4NGAH 3UOUA 3SI4H 1D6RA 5EXLA 1HLTH 5K0HA 3VB5A 2KFWA 2GZ8A 1O3MA 3M36A 1BTXA 2J2UA 1GVLA 1L2EA 1V2WT 2J92A 2J94A 4MPXA 1EP5A 1ZSJA 1KLIH 1QB6A 2ZHFH 3RC4A 4OS7A 1C2MA 3ELAH 3GDUA 3O8DA 3EE0B 1THSH 3GDSA 1O31A 1L1NA 4AN7A 3AK5A 1S81A 1C5MD 1J14A 2FS9A 1L4DA 1QJ7B 1E1RD 2BD3A 3SV8A 3U8RH 1YYY1 3L3TA 5JB9S 7GCHG 1FDPA 1GI7B 1CBWC 2VH0A 2A2XH 3TH4H 2UUKB 2GTBA 1RTFB 5E0JA 2J4IA 3SZEA 3S0NA 1DOJA 1ARBA 2HLDD 3ZVGA 1XVMA 1Z8IB 4F55A 2AGIX 5B6LA 3KIDU 3ODFA 1F7ZA 1N8OC 1QA7A 2B5TB 1F2SE 1W10U 2F9PA 1KLTA 1KXCA 1WCZA 2VVUA 2ZGJA 1OX1A 1O3BA 5CHBA 1GG6B 1AFEH 4INLA 5HMAA 2WV9A 1ESAA 1Y5BT 3E8LA 3E91A 3ZZ8A 1C5ZB 2CHAB 4K5ZA 2BDHA 5FBEA 4BXSA 1FPHH 2OCVB 4NA8A 5GWZA 1WOFA 2A7CA 3TJNA 2HNTC 1NPMA 3KQBA 2C93B 3SUEA 2AERH 1SGNE 2VIWA 3GCHB 4NSYA 1A5GH 1H4WA 3BG8A 2ZDVH 1CGJE 2RG3A 2VVCA 1TX6A 3FP7E 1FN6A 1TBQH 4TPIZ 2Y81A 5CHAB 5EW1H 3LOXA 2XXLA 1SGYE 2NU4E 4O9VA 4NFFA 2FP7B 4YO9A 1O2YA 1EZXC 2KAIB 2BD4A 1LVBA 1TGSZ 2WPIS 3C1KA 4B6FA 5GNDA 1BMAA 1K1OA 1MTNB 2FEQH 2ZU1A 1LHDH 2XNDD 4OGYA 2QGRA 2P8OC 4X1RU 2BD7A 4U2WA 4IBLH 4WF8A 2Z3DA 3TNSA 3F2GA 4WJG2 3H5CB 1LQDB 1ZTJA 3MO9A 1FIZA 1EJNA 4IMZA 1CT4E 4AB8A 1RIWB 2QA9E 3RXPA 4ABGA 4ASUD 2EI6A 1ELBA 1TA2A 3BTDE 2BD5A 3GCOA 1O3EA 4F49A 5JPMH 3RC5A 1CT0E 2AMQA 2FX4A 3T62A 3TH3H 1OP2A 1HXFH 4I8KA 3A8CA 3A7WA 2F9VA 1KY9A 2AIPA 3ZIAD 1V2RT 2Z3EA 1DSUA 2ANWA 4BOHA 5T6DA 1BIOA 1SBWA 1TNHA 3SNEA 1C1QA 1K1NA 4X1QU 1W11U 5FPYA 5IK2D 3U98H 3ZZDA 2BQWB 3NWUA 1BOQA 2ZCHP 1P2JA 6LPRA 1GMDF 1GBAA 1T8LA 3I77A 3QX5H 1EATA 4ZKNU 2BLOA 4X6PA 3Q3KA 1GGDB 2WZQA 4Y71A 3OX7U 3BF6H 1WAYB 4TYDA 2GCTC 1QR3E 2Z6BD 2ODPA 4BTUB 1IAUA 1SOTA 2Y5HA 3M5NA 4MPVA 4GHTA 3RC6A 4UFFH 5J4SA 3SV9A 2A4QA 3LGIA 2TIOA 2STAE 4XE4A 1O2ZA 5F8ZA 4OM9A 4YXWD 1DXWA 5JBTA 5AHGH 1XVOA 3RMNH 1T4VH 4ABBA 2PTCE 1A61H 2VIQA 1H8HD 3UUZA 1V2JT 7GCHF 1F92A 1W0ZU 5G4BA 4ABIA 3FN8A 2BDGA 7LPRA 3FVFB 4RKOB 3A8DA 1F0UA 3F1SB 4FUBA 2FLBH 3TK5A 4MQAA 4E06H 1CSOE 1HAOH 3BTWE 1TBRH 4WH6A 3BTFE 3K65B 4FUEA 2R2WU 3H7TA 1BT7A 5PTPA 4ZAEA 1GHWH 4GUXA 4ISOA 1P2OA 3RMLH 2ZHQH 1GPZA 1BRUP 1NT1A 2ZEBA 5T1VA 1T32A 5DJ7A 1WSSH 1N6YA 4NIWA 4D9QA 2O9QA 1C9TA 1UVTH 3ZZAA 2BY6X 3FP6E 1BTHH 4Y8XA 4VGCC 1AWHB 3RXSA 2L6OA 1E34B 1P3CA 5DN6D 1XXDA 1TNIA 2NU2E 2GGVB 1XUHA 2O8MA 3P70B 1NS3A 1NRNH 1HDTH 1J17T 1O2NA 1FMGA 1QQ4A 1IQLA 3MU1A 3N99A 3A84A 4Y0YE 1V2PT 1SC8U 2CK3D 5F8TA 3UQOA 2ZDLA 3SU1A 1SSXA 2OD3B 1ZJKA 1THRH 2GMTC 1NY22 2GT8A 1C5WB 1GDUA 3LGUA 4RN6A 1TABE 4NFEA 1C4V2 1Y3UA 3F2FA 2O8TA 1K2I1 3PO1C 1E1QD 2ZFQH 5C5OA 1GJ8B 1GBIA 4UD9H 3UFAA 3RU4T 2XC5A 5C1XA 2XTTB 4UFEH 1ETTH 3RP2A 4BAHB 3M7TA 1A5IA 1O30A 1UK4A 3OEHD 2PR3A 1JOUB 1YPMH 2W7UA 1JIMA 4AFQA 1P03A 1UMAH 2ESTE 2UUJB 3RDZA 1BHXF 2THFB 2A31A 5F8XA 5J4QA 2DE9A 2FWWA 5HYOA 1AHTH 2J9NA 3E6PH 2W7SA 2XYAA 2TBSA 1KXBA 1C4U2 1TNGA 1TFXA 3OU0A 2VWMA 2ULLA 1HBTH 1K21H 1HJ9A 1SGCA 4YM9A 4YOJA 1N6XA 1UK3A 4D7GA 1ZTKA 3RM0H 1GBJA 1HAZB 1DY8A 1O39A 1WV7H 3VGCB 1O5FH 3JZ2B 4Y0ZE 3UREA 1K1IA 1QL8A 4DIIH 1DUEA 1P01A 1TX8A 2UWLA 3P17H 1ZPZA 1GI9B 3P6ZB 1NRSH 1Y3YA