5GPIB

Crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
154
structure length
154
Chain Sequence
ETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease
publication title Crystal structure of unlinked NS2B-NS3 protease from Zika virus
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein
total genus 23
structure length 154
sequence length 154
chains with identical sequence D, F, H
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gpiB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5gpiB01
1AFQB 2FMJA 2JH5D 1F92A 3FZDA 1OP0A 2FOEA 2B9LA 1GJ5H 1CBWC 5GIBA 4GVUA 1BTUA 4ISLA 1DSUA 1NN6A 2FLBH 2GV7A 3FAOA 5JBCS 3S9CA 3SJIA 2QN5T 1C9TA 4MPUA 2ZO3H 1ARCA 3LT3A 2ZFRH 4Q80A 1G3DA 3MNBA 2GMTB 4MDSA 3ELAH 1B7XB 3S9AA 5DP7A 3OY5U 3FFGA 3F9HA 2YNAA 1DXPA 3MO9A 3ZZCA 1W11U 3RDZA 4INKA 3T5FH 1WYKA 3A88A 1E37B 4ZXYH 2AGEX 1QQ4A 1UVUH 3SQEE 5E8EH 2F9OA 3ZVAA 5A09A 2I6SA 3B23B 3UREA 1C5WB 4MNVA 1O3MA 1A0LA 1FMGA 5A8ZA 1O31A 2AIQA 1F0RA 3M36A 2FI4E 3I78A 1C4V2 1KXCA 2G8TA 4RI0A 5ETXA 1GL0E 3T62A 1TRNA 1NRRH 2BZAA 1HJ9A 1ZHRA 5F8TA 4DOQA 2ANKH 4Q7YA 1C1SA 1EZXC 1WSSH 4IW4E 1F2SE 1C1WH 1HXEH 2ALPA 2EC9H 2ZGBH 3GCNA 3RC5A 2VIVA 1O3GA 1FPCH 1ZTLA 3SZEA 3IWMA 3ZVEA 1E36B 5TCAA 2W3KA 3MI4A 1FIZA 2ZU4A 4AOQA 1BMMH 7LPRA 2TRMA 2HLCA 1GI0A 5EOKA 1QL7A 1GI3A 1WXRA 1GBTA 1ELAA 3T25A 2QXHA 1ZPZA 1UMAH 2PTNA 4Y8XA 2BVXH 1TNIA 2VVCA 1FY5A 1LVOA 1GI9B 1F5RA 3E1XB 2PHBA 2FPZA 4WMFA 1Z8GA 1SL3A 2FZZA 3B9FH 4ABHA 4CRGA 1CT2E 1KXEA 1FZZA 1EAWA 2C8YB 4NWLA 1GHWH 3H5CB 5C1YA 2UWPA 2ZI2H 1AUTC 3F9FA 4A92A 4ISIH 3GDVA 2SGFE 4CH8B 4XBCA 2WPHS 3STJA 5ESBA 1AO5A 2AMDA 1GDUA 2V3OH 1W7XH 4IN1A 1U6QA 4CH2B 1ELCA 4X2VA 1CGHA 2AGGX 1PQ8A 1O36A 9LPRA 2G55A 2ZZUH 1GCDA 1VZQH 2F9BH 1GPZA 2VGCC 1MD8A 1PQAA 2ZCHP 2XWAA 3QUMP 1ELFA 1S85A 1TX8A 3BEIB 1ESAA 1OP8A 1YM0A 2VINA 5DJ7A 1O32A 3S69A 1F0UA 2ZDAH 5AF9H 3A84A 3RXOA 3ZVBA 2CHAB 2FX6A 4Y8ZA 2QXGA 1Q3XA 2QV1A 2WHXA 1GG6C 2P93A 4HI3A 4YOIA 3SI3H 4NFEA 4Z6AH 3MH4A 3UWJH 1QBOA 4ABJA 3SUGA 4NGAH 2WPLS 1XUFA 3MNSA 1TOMH 2P8OC 3SJ9A 3RXAA 2BHGA 5E0JA 2Q1JA 3NZIA 4OS4A 1QL9A 4WMDA 2TBSA 2JH0D 4Y8YA 3RP2A 2FXRA 1YCPM 3TJVA 1H1BA 4SGBE 1OWEA 3U9AH 3V3MA 1QBVH 3AW0A 4TY6A 3GOVB 1DLEA 1UVSH 1UTOA 3F9GA 3BEUA 4DVAU 1O2LA 5HYOA 2LNCA 2B0FA 1TABE 4Y71A 3LONA 1ZMNA 3RMOH 2EEKA 1CGIE 1BRCE 4AB9A 1SGQE 3LGVA 2FESH 3OSYA 2J34A 1HAZB 1KSNA 1TE0A 4KTCA 4MPVA 2ZDNA 1SQTA 1DITH 3NKKA 1THRH 1CSOE 2YNBA 1V2VT 1T8NA 1C5NH 1GGDB 1HAVB 3MH6A 2O8UA 1J16A 2ZTYA 4LK4A 3T27A 1LO6A 5GCHF 5JB9S 1LPKB 1O35A 1TX6A 1YC0A 1P9SA 5EQRA 4D76A 2WZQA 2PLXA 2AIPA 1W14U 2WPMS 1OWDA 3AW1A 1UO6A 2GCHF 1BA8B 1YLCA 3T26A 1O34A 4D7GA 2EI6A 1IQNA 2ZIQH 1TWXB 2R2WU 1FY1A 1ESBA 1O5EH 3L6PA 1B0FA 1G3BA 1GVKB 4KTUA 4AG1A 1C2KA 3ATKA 3QGJA 5GCHG 1VJAU 2BD9A 1VGCC 1DLKB 1KXAA 2BX3A 1SFQB 2A2XH 1K28D 4M7GA 1SR5C 3UPEA 1O3LA 1QRZA 1P3EA 3AAVA 1BTPA 1K1NA 3SUFA 4AX9H 4LOYH 2BVSH 2WV5A 4LZ4B 1ELTA 1NPMA 1O3CA 4VGCB 2XNIA 1J8AA 2F9PA 3G01A 4M9FA 3NXPA 1UJ1A 1MQ6A 1GJ8B 1SGFG 3QZQA 1XKBC 1A7SA 3BTTE 2A5IA 5FPTA 4FVDA 2EI8A 1V2OT 4FUDA 1JIRA 1GI2A 1L1NA 3P6ZB 4OS1A 5DK1A 1C5RA 3QWCH 1TQ7B 1CQQA 1C4Y2 3LJOA 5E0GA 3GY3A 5DKMA 1AQ7A 2ZQ1A 1GBAA 3Q3YA 3SU5A 4QT8C 1FAXA 1BDAA 1XXFA 1SGCA 2UWOA 1TQ0B 4NZLA 3PMAB 1TGBA 2ZFPH 1ZSJA 1GBKA 2ZDLA 3UR6A 1BCUH 1GVZA 1AKSA 4ABAA 4H4FA 3TU7H 1A0HB 1HAGE 3QTOH 3ZV9A 3RXLA 4B71A 1ETTH 2PKAB 2ZEBA 1Z7KA 1D9IA 5LPEA 2AYWA 1GJAB 2UUFB 3RXIA 1BMAA 2QC2A 1ZPCA 3OU0A 2W7SA 3TIUA 3UWIA 2W5EA 4BTIB 2NU2E 2P95A 4Y79A 1LVBA 2VWNA 4ABIA 1TIOA 4B1TA 4B2AA 1O2NA 4FXGH 2CGAA 1JIMA 4ESTE 1RTKA 3RXJA 1F0TA 2ZFQH 2BM2A 1DOJA 1V2NT 3VB4A 2ZHFH 2ZGJA 1OX1A 1KY9A 5L6NH 2ODPA 1O3AA 1ZSKA 3SN8A 4JYVH 4X8VH 1K1MA 4ZHMU 5B6OA 3MYWA 1C5YB 1GMHG 1DUAA 2FIRH 1C5XB 1GJ6A 4CBOA 1LHEH 4BANB 1W12U 2I6QA 1HDTH 2XC5A 2BY6X 4JZ1A 4IN2A 3TJUA 5FCKA 4BAOB 4DCDA 1PPFE 3W94A 3SI4H 3A8DA 4MPWA 4Q7ZA 2BLVA 3M61U 3U8RH 3UR9A 1UHBA 3GY4A 1C1MA 1NO9H 1OYTH 2DE9A 1BQYA 1K1IA 3S9BA 3GY5A 1HFDA 1EAXA 2R3YA 1QB9A 1F5KU 1UCYK 3RC6A 2QIQA 2ZDVH 4JMYA 1UK4A 1HAHH 1PFXC 3FZZA 3GCHC 1RRKA 4JK5A 3ATWA 4CHAC 4IC6A 2O8TA 2P8OB 3RU4T 4H6TA 3ZYDA 1FDPA 5J4QA 1H9IE 1NU9A 2GZ8A 4X8UH 1T7CA 1WTHD 3UUZA 1JBUH 2BLOA 2VWLA 4I7YH 3ZZ8A 2HGTH 1GJCB 2ALVA 1QL8A 1D3PB 1BJUA 1HAYB 4MG3A 1EJMA 3ZVCA 1ELDE 1AWFH 1QA0A 1FY4A 1MTNC 2ZTZA 1C2GA 1DWDH 5T3HA 4NIYA 1O2ZA 2BDIA 1G2MA 1HJAB 2J9NA 3GY2A 4R0IA 2F9UA 4AB8A 4BTUB 4AFSA 3RXDA 2BXTH 3KN2A 3RU4E 4A1VA 1C2IA 4ABGA 2ANMH 3SU4A 2OC7A 1EPTB 1HLTH 1VITF 1MBQA 3GY6A 4BAKB 1P11E 3E3TA 3GCTG 3QZRA 4WJG2 4ZKNU 2FYRA 2OD3B 3RM2H 3MU8A 2BY9X 4CR5A 2HNTC 4JZIA 5FAHA 2XXLA 3T28A 1K22H 4A5TS 4X0WU 1C2FA 1GVLA 2BY7X 3SOSA 3O8DA 3A7VA 1P04A 3C1KA 2IN2A 1D6RA 2A4GA 1N6XA 1FQ3A 1SHYA 1SLWB 3V0XA 1XMNB 4IBLH 1VITG 1D3TB 3MOCA 3E91A 1LPGB 1E0FD 4TWYA 1ZR0A 2PV9B 2BD7A 1SB1H 1TA2A 1UVPA 3SZNA 4INLA 4FUIA 5F6MA 3ODDA 2ZF0H 1P9UA 2ZTXA 2PGQB 4Y11E 3VB3A 1OS8A 1HBTH 1TYNA 2V3HH 1DY9A 1HGTH 5T6FA 1SQOA 3ESTA 2PUXB 1DY8A 4J1YA 1N8OB 3SJ8A 1XUKA 1O5AB 2PR3A 1V2JT 2ZPRA 1Z1JA 4DJZB 4KELA 1GBBA 2F9NA 1J9CH 3AAUA 2ZGCA 4J2YB 4CRFA 4E7NA 2NU0E 1TNKA 3TGKE 3DT0H 1AZZA 2FS8A 3KF2A 2UUYA 2SGDE 3E16B 1G37A 5DP5A 4CRBA 4NZQA 4NWKA 4DIIH 2JKHA 4MNXA 4IC5A 1Y5AT 1WBGB 3A83A 5FBIA 3WY8A 1ZGIA 1QIXB 3CENA 2GVFA 2ZNKH 3S7HB 3A85A 3PLPA 3M5NA 3U8OH 3BTFE 3BIUH 5JPMH 1E38B 1F0SA 1FPHH 2VNTA 3PV5A 1O3FA 2J94A 2KAIA 1S83A 4GCHF 2XW9A 2XBVA 2J4IA 4FUBA 4YT7H 2PKSC 1A5GH 2G5VA 3A81A 1L1JA 2WYGA 1TMTH 4GHQA 1BTHH 1Y3XA 3BTEE 1CA0C 1XVOA 3LDXH 1TGSZ 4IMQA 2UUKB 2P16A 4E05H 2WPIS 5DP4A 2GCTB 2VIQA 2STAE 3K2UA 2NWNA 3H7OA 3ZYEA 4DY7B 1A61H 2RG3A 3RXGA 1IHSH 1MH0A 4FUJA 4X6PA 4GCHG 5I46H 2A32A 3GYLB 2WPKS 1HCGA 2RCEA 5C2ZA 1T4VH 2R9PA 1CU1A 2BB4A 2RDLA 3A8CA 5LH8A 1YP9A 1OOKB 3GDUA 3ZZAA 2G5NA 1PYTD 2W7UA 1QJ7B 2CF8H 3DUXH 5EXLA 3A7ZA 2THFB 1A2CH 1W2KH 5HXFA 1RJXB 2XC4A 3ODFA 4X2WA 2P59A 5AFYH 1O3OA 4YLQH 1V2LT 1C5TA 5EXNA 2OBOA 1BBRH 2BLQA 4BNRA 2ZKSA 2ULLA 4GSOA 4TWWA 4TY7A 5FX5A 1H4WA 2BDCA 1TMUH 2C4FH 3RMMH 2A7JA 3SU6A 5F8ZA 3O8RA 2GT8A 4E06H 3GDSA 1CHGA 1PPGE 1BBRE 3TNSA 3STIA 4X6OA 1ZJKA 1B0EA 4OS6A 5C1XA 4F4OC 1P2KA 1TFXA 4YESB 1P01A 1A3BH 4Y7BA 2GZ9A 1C2HA 4BAMB 2RA3A 3VEQB 1GJ7B 1EAUA 2F91A 2BD5A 3MO3A 3TVJB 4SGAE 1MQ5A 2PW8H 1L2EA 1IAUA 1RFNA 4I32A 2WPJS 3MU5A 2A5KA 2ZDKA 1OSSA 2P94A 1MTWA 2Z6BD 1EATA 1ZOMA 2QYIA 1S0RA 2H9HA 4H42U 1DVAH 1AB9C 2D8WA 3LGYA 3D49H 3QK1A 3LGTA 3ZZBA 2BXUH 1GCTC 1DX5M 1NT1A 1WTGH 1BRAA 5DGJA 3RXQA 4IMZA 1O2UA 1IQJA 2H9TH 4ISHH 1EZUC 1KDQB 3KQBA 4THNH 3GISB 5EQQA 4DIHH 3BTGE 3UNQA 2BDBA 2WINI 3K65B 1W7GH 1ELEE 3NPSA 1NFYA 1S82A 3NUMA 3TK6A 3KQEA 2FOBA 2BLWA 2Y5HA 4FUFA 3SO3A 2ZGHA 3SORA 1D4PB 1VITH 3TH2H 4AYYB 1GDQA 1TAWA 1CT0E 3MFJA 1ZHMA 1G3CA 1Q31A 3LC5A 1QY6A 2WUBA 2Y7ZA 1GBLA 3I29A 4YO9A 4BOHA 5C5NA 3KQCA 3HKJB 4AFQA 4WH8A 5GDSH 1AFEH 1P05A 1GHVH 2C90B 4I8KA 4XDEA 2XCNA 1HIAA 5FCRA 2EI7A 1GHAF 3SNCA 1MTVA 3BTHE 3SUEA 2SNWA 2XC0A 1DICA 1CO7E 1AI8H 4X8SH 2J38A 1HJ8A 2O8MA 1BBRK 3RXSA 1BMLA 2Y5FA 3BG4C 4HTCH 5HM2A 1BRUP 2Z3DA 1P2IA 3OYPA 1K2I1 3F9EA 3SQHE 2VB0A 1EZSC 3BF6H 3ZZ3A 5EW2H 3RXKA 1DUEA 5A2MH 3RUOA 5F03A 1LQDB 1LKBA 4WH6A 4AGJA 1Z1IA 5EPYA 4ZKOU 5AFZH 1SGIB 1P2JA 1NU7B 3TH4H 1C2DA 2OLGA 1GHAG 3M7QA 1Y59T 3UIRA 2A4OA 1ZSLA 3EA7A 2AEIH 1P06A 3VXFH 2R0KA 1YBWA 5CHAB 1THPB 3P95A 2C3SA 3KGPA 3VFEA 4ZHLU 5C1UA 1QRWA 2VIDA 4TPIZ 2Z9KA 4X8TH 2GD4B 1PPHE 3E0PB 1EOLA 3MU1A 1EP6A 1QR3E 1SPJA 5HMAA 3JZ1B 2OQUA 3RXMA 1LHGH 3LU9B 3GY8A 1BJVA 3ATMA 3MTYA 1FN6A 2R0LA 1T4UH 1EQ9A 4DW2U 5A8XA 1G2LA 3RXBA 4ZKRU 4K8YA 5FX6A 1C5VA 1C1PA 1P8VC 2XCFA 1ACBE 4H6SB 1TALA 3E0NB 1T8LA 1WAYB 2JETC 2SGAA 1O2IA 3EQ0H 4DT7B 5L2ZH 2G4UA 2PTCE 4JZEH 3MH7A 1MCTA 4FUGA 5EW1H 4WWYA 1WV7H 1THSH 2ZP0H 1RGQA 1K21H 4WF8A 2SGQE 1QCPA 1CBWB 1CA0B 4OS2A 1C5QA 1DWCH 3SGQE 2PUQH 4I8JA 1FLEE 1Z6JH 1YPHE 2Q6GA 1P0SH 1JXPA 3AVZA 4ZAEA 1G30B 3KEEA 4UONA 1DANH 2ZHDA 3TK5A 1SG8B 2FEQH 1TGNA 1M9UA 1L1GA 1QB1A 1ZTJA 2PSXA 3CP7A 1J14A 1NRPH 2VH0A 1MKWH 1VCWA 1PJPA 1KXFA 3KCGH 4D7FA 2BY8X 3ZVDA 1HAPH 1C1RA 1FUJA 3B8JA 4XOJA 1YPJH 4K5ZA 6LPRA 5DP8A 1GI8B 2ESTE 3SU0A 2Y81A 5L2YH 3LPRA 2NU3E 1KLJH 4ZH8A 3RU4D 1XM1A 2G81E 2W3IA 5EG4A 2FOCA 5SGAE 1ELVA 1EP5A 1SQAA 4O3TA 2B7DH 1AY6H 1DWBH 1MCVA 1EOJA 4D8NA 8LPRA 1QNJA 1PPEE 1C4U2 1QBNA 4YM9A 2ODQA 4AORA 1CHOF 3SU1A 2OTVA 1AE5A 1GBHA 2FOMB 1EJNA 1C1OA 1AZ8A 2TGPZ 5T6GA 3SHCH 3MU0A 1GMHF 2ZU2A 1ZLRA 2NU4E 1B5GH 4NCYA 1ZHPA 1C5MD 1SHHB 2ZPQA 3EAJA 1SBWA 1C1UH 3M37A 2QF3A 4K1EA 1EKBB 4LXBH 4CREA 1P10A 2FM2A 2SNVA 3ZVFA 1O5FH 5DP6A 1H9LB 3P70B 2BQ7B 1EX3A 1SVPA 4IGDA 1QJ6B 1MBMA 2FYQA 3ZZDA 1HV7A 1GMCG 4I8LA 3PROA 3HK6B 3ZZ4A 1CHOG 1SGFA 2WYJA 4ISNA 5HGGA 3FP6E 1O33A 5AVDA 4UE7H 1AFQC 2P3TB 1YPKH 1W10U 3RXEA 1GCTB 1NY22 1QRXA 3UNSA 1GMDG 1QHRB 1ELGA 1TRMA 4U2WA 3PM3A 5DO4H 1LHCH 4UFEH 1IQEA 1T8MA 4UDWH 4WXIA 2F3CE 1F5LA 3P8FA 3F1SB 1XUIA 1YPEH 3IITA 3DFLA 4OM9A 1EAIA 2VGCB 2Z9JA 4WVPE 2HWLB 1O2VA 1AVXA 2GDDA 2SGPE 3BIVH 2AMQA 4U32A 1L4ZA 1P09A 1HYLA 4WXVA 1HXFH 1UTNA 2OCVB 3UQVA 3NK8A 3TPIZ 3S0NA 2A7HA 3Q3KA 3ZVGA 1BTZA 1Q2WA 2PSYA 1UHBB 4X2XA 3ZZ7A 2GDEH 1MKWK 4AGKA 4YT6H 1Z71A 3UOPA 1GG6B 1CVWH 1O38A 2Z3EA 1NESE 1FAKH 4MQAA 1MZDA 2QCYA 5C67A 3O8CA 1O39A 3RLWH 6GCHF 5C3NA 2OC8A 1NRNH 1F7ZA 1PPBH 3BTDE 1AVWA 3PTBA 2BOKA 2A0QB 1NROH 1WCZA 1OWIA 3PMBB 3EGKH 3OX7U 8GCHF 2VWOA 3PMHB 3V7TA 2ANYA 1L4DA 3CS0A 1LHDH 2BOHB 1UVOA 3GCTF 1LQEA 4CBNA 4TYDA 1O5DH 5BRRE 1SOTA 2M5TA 1MTUA 3OTJE 4BXSA 1IQGA 1N1LA 3SNBA 4FUCA 2XBWA 2O8WA 2FTMA 3K6YA 1SSXA 3UY9A 4E7RG 1MUEB 6GCHG 1KYNA 4MNYA 1BHXB 3LGUA 4CRDA 3TK9A 1BMNH 2FOFA 1C2MA 2FOHA 1C2JA 2YOLA 1W3CA 5E0HA 1G36A 2BQ6B 1G32B 4O3UA 4UD9H 3HGNA 5EGMA 5GPIB 2GX4A 1JWTA 1OWJA 8GCHG 3M7UA 1O2XA 2R3UA 1DWEH 4IS5A 1YPMH 3L33A 3RXPA 2HOBA 3BN9A 4BXWA 4BTTB 2O9QA 1SLUB 2FTLE 2GP9B 1T31A 2Y82A 2ZFFH 4A1XA 4NG9H 2FDAA 3BEFB 4ABFA 5JYIA 2TGAA 3RXVA 1EUFA 2AERH 1PPCE 4BAHB 3ZZ5A 1O3NA 4XFQA 3SHAH 2A4QA 1OP2A 4TPYA 1QB6A 1OYQA 1HNEE 4Z0KA 3H09A 1CE5A 1IQFA 1XUHA 2XBYA 1P12E 4XBBA 3HGPA 2RA0A 1VGCB 1DPOA 5LPRA 2JETB 4MNWA 1NC6A 2A1DB 4K60A 3URDA 3QX5H 3EE0B 5GWZA 1TGCA 2CHAC 1VCPA 5H4IB 2ZHWH 3SV8A 3HATH 1GDNA 2FI5E 3RLYH 1FXYA 4B6FA 3KNXA 3VGCC 2BD3A 3RXTA 3BG8A 1SLXB 1O3EA 1O3JA 2FX4A 1V3XA 1BZXE 1VR1H 1TPPA 3N7OA 2ZC9H 2AS9A 3FP8E 1C5OH 3NWUA 4ZUHA 5A0BA 3PLKA 5GXPA 2VBCA 4K69A 2Z9LA 3K9XB 4O97A 3DFJA 2OQ5A 3DHKH 1MMJN 1EXFA 1P2NA 1LVYA 1AD8H 1TPAE 1RTLA 4JYUH 3OY6U 1HAOH 4CRCA 1ZPBA 2Z9GA 8KME2 3U98H 2UWLA 1O30A 2F83A 3ATIA 1PQ5A 1NRSH 1QJ1B 1V2QT 2H9EH 1AVGH 1Y5UT 1O2WA 1T32A 4ABEA 2BYAX 4X1RU 2XBXA 1AU8A 1A3EH 5FBEA 1GGDC 3NCLA 1O0DH 2VH6A 1KTTB 8ESTE 3RMLH 1V2ST 4NSYA 1RXPA 3EA8A 3SNEA 4B2CA 3A7WA 2Q6DA 3U69H 1C5UA 3PMJA 1KXDA 4I8GA 2QF0A 4XBDA 3QDZB 1GHXH 1EB1H 2ZPSA 3A82A 2BX4A 4RKJB 5TCCA 1S84A 3HPTB 1P3CA 1A5HA 2BDYA 1ID5H 3M3TA 1GJBB 5A0AE 1KLIH 2Y5GA 3RXCA 2Y80A 3A7YA 3LJJA 1LTOA 1K9OE 1V2MT 2C8ZB 1OWHA 4GAWA 1RTFB 3M3SA 1LPZB 2UUJB 2VIWA 1ANDA 2KAIB 2BDHA 5ABWA 1QTFA 1Y8TA 2VWMA 1AUJA 1O5BB 1AN1E 1AHTH 2W26A 1TNLA 1O2YA 2A45B 3DD2H 1TX7A 2G4TA 1MKXH 4VGCC 1QFKH 3RXRA 2IJD1 2ZU5A 3E90B 1P2MA 2HNTF 3FANA 3RXFA 6ESTA 2AFQB 7GCHF 1TNHA 5CE1A 1INCA 1O3DA 5T6DA 4DG4A 3PV2A 1FN8A 2DE8A 4ISOA 1ORFA 4HGCA 4NIWA 1E34B 2V6NA 3AK5A 1GBMA 2Z94A 2LPRA 3SU3A 6CHAC 2CN0H 1C5LH 4ZXXH 4AFZA 4AYVB 3S7KB 4AG2A 1ESTA 1VJ9U 4NIXA 1BRBE 2H5DA 2ZHQH 3AASA 1GJ9B 2FWWA 3FP7E 3M35A 4NA9H 1IHTH 2Z9IA 3BTKE 4NFFA 2FLRH 1Y3WA 2NU1E 1FV9A 7GCHG 1CA8B 1NFXA 4BAQB 1O2JA 3GCHB 1PQ7A 3JZ2B 4K2YA 1GL1A 2IJOB 1DM4B 3IG6B 3U8TH 3VB5A 1YCPH 5DPAA 4CHAB 5LPFA 1A5IA 1V2UT 1O3IA 1T8OA 1LDTT 3Q76A 1TBRH 2GKVE 2HPPH 5FXLA 1YKTA 1KIGH 2IPHA 3DA9B 3Q77A 3LKWA 3QLPH 3F6UH 2CMYA 3P92A 2DUCA 1GBIA 1DE7H 2FOAA 5C5OA 3TGIE 4I31A 4B73A 4B2BA 1NZQH 2CV3A 3KL6A 1MTNB 2HVXA 5A0CA 3GCOA 2TIOA 1D3QB 1O2PA 1DXWA 3SYJA 3SBKA 2BD8A 1ZMJA 1ZRBA 1IQLA 2BVRH 4GUXA 2BDAA 5L30H 2BDGA 2HALA 1ZZZA 2OC0A 1KDQA 4FUHA 3VB7A 3SW2B 1FY8E 4XSKU 3W95A 2G52A 2AH4X 3ZZ9A 1IQKA 3QGNB 3L3TA 2VJ1A 5FHTA 4YTAA 2PFEA 1SLVB 1UTKA 3M5MA 4Q7XA 3TGJE 1IQHA 1TLDA 5K7RA 3A86A 1L0ZA 2OXSA 4U01A 1O2SA 2QY0B 3VXEH 2AGIX 2BMGB 2OBQA 4X1NU 2A2QH 5DP3A 1QURH 1BIOA 1MTSA 1TBQH 4FUEA 1MKXK 1IOEA 1S81A 1W0ZU 5I25A 4JCNA 4B6EA 3BTWE 1JRSA 4Q2KA 3LH3A 2FS9A 4YLUA 1DS2E 3GYMA 1GWAA 1GHYH 3PV4A 1C2EA 1FY3A 1ABJH 2GZ7A 1O3KA 4FU9A 1A0JA 2D26C 2D2DA 3E6PH 3KIDU 3KHVA 3Q00A 2GTBA 3VGCB 2B5TB 1P2OA 1Y3UA 1VCQA 3A7TA 4AN7A 2FO9A 2BZ6H 4ASHA 1UTJA 1TPOA 1QA7A 1Y3VA 2A31A 1YGCH 4OGXA 1H9HE 3Q3XA 1HIAB 1C9PA 2P3UB 4Y76A 2Z7FE 1W13U 3TLOA 2ZHEH 1P03A 1TBZH 2FODA 3RXUA 1HAVA 1EB2A 5B6LA 3BSQA 3RC4A 1YCPK 2H2ZA 1MAXA 1GBFA 3PWCA 2TGTA 4UFDH 2ZWLH 1WQSA 2HPQH 1EZQA 1SGTA 2ZU1A 4O9VA 3D62A 1CGJE 1HJAC 3RXHA 3QO6A 1TA6A 2CF9H 2F4LA 1HAXB 3SV2H 3ATLA 1QGFA 4NA8A 4K8BA 1ANBA 4GHTA 2CJIA 2C8WB 2HRVA 2IOTA 5CMXH 1EPTC 4Y10E 3QN7A 1GJ4H 4AFUA 5F8XA 1O2HA 5E2PA 3SNAA 4A6LA 1ARBA 1KXBA 3U1JB 4UFFH 3HK3B 4ZHAA 3E8LA 2Y7XA 2GT7A 5E2OA 1J17T 1O3PB 2PKSB 1ZGVA 2VIOA 1BITA 3UQOA 4AZ2B 1P57B 3OTPA 2QXJA 1SGNE 3P8NA 2BD4A 2ZFTA 1DDJA 1UTMA 3MNCA 1N6YA 1V2KT 3D65E 2C93B 2Z3CA 1O5GH 1H8DH 3QTVH 1KTSB 2ZFSA 4GLYA 2GCHG 4NA7A 3T29A 1HAIH 1H8IH 3PO1C 1RIWC 3SNDA 1ANEA 4A1TA 3RMNH 2D1JA 1P2QA 5EODA 1SGPE 4K1SA 3MWIU 1D3DB 4LZ1H 4FVBA 4K1TA 5K0HA 2GGVB 4WMEA 3GICB 1UCYH 1V6DA 1N8OC 1J15A 4HFPB 2OC1A 1TPSA 3TJNA 3TITA 1CT4E 3EYDA 1V2RT 2PWXA 1WUNH 1XX9A 6CHAB 3LIWA 1OKXA 2OP9A 2BQWB 1EASA 4JZFH 4ZKSU 1UCYE 1O37A 1BTWA 1TB6H 5T1VA 2K1QA 1XKAC 3VB6A 2ZGXH 1LKAA 1BTXA 4MLFB 1XVMA 1S0QA 1GMCF 1BB0B 2BD2A 4X1PU 2HNTE 1YYY1 4JK6A 2VVVA 4I33A 2PKAA 1ELBA 2PGBB 3UTUH 1NTPA 5DG6A 1O5CB 1OWKA 2G00A 5EQSA 1A46H 3UNRA 1AKSB 1D6WA 4NIVA 1XUGA 3UOUA 1AIXH 1C5SA 1TNGA 3URCA 1A1RA 2J92A 1GMDF 2Y6TA 5DP9A 2OUAA 2QA9E 1TGTA 4INHA 3A8AA 3ZV8A 4X6MA 2WV9A 1O2KA 1S6HA 4D9RA 3M7TA 4O03A 1BHXF 1GJDB 4B76A 4X2YA 3LH1A 4B75A 1LCYA 1Z6EA 3PWBA 4MVNA 3MO6A 5HM9A 3M5LA 4ZROA 1AB9B 1ETRH 1TOCB 2ZCKP 2SGEE 3A87A 4RN6A 4GPGA 1JMOH 1EJAA 1O2OA 3C27B 2QXIA 1C1TA 3A7XA 1SGRE 1K1JA 4OS5A 4MTBA 2GCTC 2STBE 2ZDMA 1LMWB 1OPHB 3SV7A 1UTLM 2ILNA 4R8TB 2C8XB 1O2TA 2VIPA 4YZUA 5AHGH 2WUCA 3CS7A 2GMTC 4Y7AA 5JB8S 4KTSA 1PYTC 3MU4A 2ZCLP 1Z8RA 4RKOB 1DT2A 3KQDA 4Y6DA 1JOUB 4PROA 5IDKA 2SFAA 3P8GA 1GBDA 3SU2A 3MNXA 2QAAA 4WY3A 1Z8IB 5IYTA 1FJSA 2GV6A 1LVMA 5JBAS 1Y5BT 3LGWA 1QQUA 4X1QU 1AE8H 1ETSH 1SGYE 2O8LA 5EPNA 3MH5A 1O2QA 3D23A 5TJXA 1Y3YA 3SV9A 1ANCA 2J2UA 1ZYOA 1UTQA 4A7IB 3MHWU 1OXGA 1E35B 2FP7B 2XYAA 3TJOA 1BOQA 2P3FH 3P17H 3K6ZA 3SUDA 1NS3A 5EU8A 2EA3A 1AMHA 1NFWA 2ZG0H 3EA9A 3M5OA 4YOGA 3ZZ6A 3H7TA 1MU8B 5C20A 1HPGA 4X6NA 4CRAA 1ZRKA 1SI5H 1Z8JB 5A8YA 4CR9A 1K1LA 1SMFE 5PTPA 1O2GH 3PLBA 1NRQH 2J95A 3BG4B 5JDUB 2XWBI 1W0YH 3LGIA 1G3EA 4XE4A 1GI6A 4Y0YE 1GBEA 3T2NA 3I77A 1FI8A 1YPHC 3LC3A 7ESTE 3A89A 3HKIB 3GY7A 1V2TT 1S6FA 2CXVA 1BUIA 1TRYA 1WQVH 1YF4A 3R3GB 1EPTA 3PYHA 3EDXB 4K3JA 3PB1E 1XXDA 2V35A 1O2MA 2H5CA 4UFGH 5JBTA 1NM6A 1SGDE 4U30A 3V13A 1MAYA 1SC8U 1UK3A 4Y0ZE 1ABIH 1W8BH 3MMGA 2XTTB 3A8BA 1AGJA 1MZAA 2R2MB 4YOJA 1TNJA 1GI4A 1FIWA 2A5AA 1YPLH 1UTPA 4NSVA 1HB0B 2OK5A 3SJKA 5BPEA 4ZMAH 3SV6A 4DURA 3F68H 2A4RA 2ASUB 4X1SU 1HUTH 1ZTKA 5GNDA 4ABDA 1BT7A 3SJOA 1TMBH 1WU1A 5EXMA 4F49A 3UFAA 4B74A 2Q6FA 1O3HA 3V12A 1G9IE 1RS0A 4FU7A 4OS7A 2XRCA 1HRTH 1WOFA 1O2RA 2ZA5A 3ENSB 3FVFB 2V0BA 1FNIA 1GHBF 4MPXA 7KMEH 2OINA 3VPKA 1IQMA 2A7CA 1SOZA 1PPZA 3PO1B 1RIWB 3O8BA 1XUJA 3M3VA 3R0FA 4KGAA 1C1NA 1V2PT 2FI3E 1C5PA 2F9VA 9ESTA 5ESTE 4FU8A 4JZDH 1SFIA 2BY5X 1MD7A 4I8HA 1GI1A 3ITIA 1FONA 3BTME 1A4WH 4JYTA 1GI5A 1V2WT 3TNTA 1UVTH 3RM0H 1S5SA 4HZHA 1AWHB 1GHBG 5LGOA 4OGYA 3A80A 2JH6D 1C1VH 1DFPA 3TH3H 5CHAC 3PTNA 1ZMLA 1NFUA 2ZQ2A 5GJ4B 3SGAE 1YLDA 2AMPA 2G51A 2ZECA 1JRTA 1P02A 2BTCE 4DGJA 2H1UA 1C2LA 1ZJDA 5J4SA 3SGBE 1DSTA 1KLTA 2TGDA 3LOXA 1MU6B 4D9QA 1GBCA 1C1QA 1SGEE 4RSPA 1TONA 3U1IB 2B8OH 5G4BA 1K1PA 2WV4A 2FOGA 5FPSA 4KP0A 1X7AC 1YPGH 1RD3B 4KKDA 2ZU3A 1IQIA 2ANWA 1K1OA 2H6MA 2ODYB 1BTYA 5JBBS 1O3BA 1GHZA 4UEHH 4ABBA 1C5ZB 3P8OA 2QGRA 2VU8E 5FPYA 3BTQE 2VVUA 2TPIZ 1GBJA 3BV9B 1GI7B 1LHFH 1UK2A
chains in the Genus database with same CATH superfamily
1AFQB 2FMJA 2JH5D 1F92A 3FZDA 1OP0A 2FOEA 2B9LA 1GJ5H 1CBWC 5GIBA 4GVUA 1BTUA 4ISLA 1DSUA 1NN6A 2FLBH 2GV7A 3FAOA 5JBCS 3S9CA 3SJIA 2QN5T 1C9TA 4MPUA 2ZO3H 3KQ5A 1ARCA 3LT3A 2ZFRH 4Q80A 1G3DA 3MNBA 2GMTB 4MDSA 3ELAH 1B7XB 3S9AA 5DP7A 3OY5U 3FFGA 3F9HA 2YNAA 1DXPA 3MO9A 3ZZCA 1W11U 3RDZA 4INKA 3T5FH 1WYKA 3A88A 1E37B 4ZXYH 2AGEX 1QQ4A 1UVUH 3OEHD 5E8EH 3SQEE 2F9OA 3ZVAA 5A09A 2I6SA 3B23B 3UREA 1C5WB 4MNVA 1O3MA 1A0LA 1FMGA 5A8ZA 1O31A 2AIQA 1F0RA 3M36A 2FI4E 3I78A 1C4V2 1KXCA 2G8TA 4RI0A 5ETXA 1GL0E 1E1QD 4Z1MD 3T62A 1TRNA 1NRRH 2BZAA 1HJ9A 1ZHRA 5F8TA 4DOQA 2ANKH 4Q7YA 1C1SA 1EZXC 1WSSH 4IW4E 1F2SE 1C1WH 1W0KD 1HXEH 2ALPA 2EC9H 2ZGBH 3GCNA 3RC5A 2VIVA 1O3GA 1FPCH 1ZTLA 3SZEA 3IWMA 3ZVEA 1E36B 5TCAA 2W3KA 3MI4A 1FIZA 2ZU4A 4AOQA 1BMMH 7LPRA 2TRMA 2HLCA 1GI0A 5EOKA 1QL7A 1GI3A 1WXRA 1GBTA 1ELAA 3T25A 2QXHA 1ZPZA 1UMAH 2PTNA 4Y8XA 2BVXH 1TNIA 2VVCA 1FY5A 1LVOA 1GI9B 1F5RA 3E1XB 2PHBA 2FPZA 4WMFA 1Z8GA 1SL3A 2FZZA 3B9FH 4ABHA 4CRGA 1CT2E 1KXEA 1FZZA 1EAWA 2C8YB 4NWLA 1GHWH 3H5CB 5C1YA 2UWPA 2ZI2H 1AUTC 3F9FA 4A92A 4ISIH 3GDVA 2KR7A 2SGFE 3VG8A 4CH8B 4XBCA 2WPHS 3STJA 5ESBA 1AO5A 2AMDA 1GDUA 2V3OH 1W7XH 4IN1A 1U6QA 4CH2B 1ELCA 4X2VA 5C0UA 1CGHA 2AGGX 1PQ8A 1O36A 9LPRA 2G55A 2LELA 2ZZUH 1GCDA 1VZQH 2F9BH 1GPZA 2VGCC 1MD8A 1PQAA 2ZCHP 2XWAA 3QUMP 1ELFA 1S85A 5F53A 1TX8A 3BEIB 1ESAA 1OP8A 1YM0A 2VINA 5DJ7A 1O32A 3S69A 1F0UA 2ZDAH 5AF9H 3A84A 3RXOA 3ZVBA 2CHAB 2FX6A 2J5UA 4Y8ZA 2QXGA 1Q3XA 2QV1A 2WHXA 1GG6C 2P93A 4HI3A 4YOIA 3SI3H 4NFEA 4Z6AH 3MH4A 3UWJH 1QBOA 2W6JD 4ABJA 3SUGA 4NGAH 2WPLS 1XUFA 3MNSA 1TOMH 2P8OC 3SJ9A 2KCYA 3RXAA 2BHGA 5E0JA 2Q1JA 3NZIA 4OS4A 1QL9A 4WMDA 2TBSA 2JH0D 4Y8YA 3RP2A 2FXRA 1YCPM 3TJVA 1H1BA 2XOKD 4SGBE 1OWEA 3U9AH 3V3MA 1QBVH 3AW0A 4TY6A 3GOVB 1DLEA 1UVSH 1UTOA 3F9GA 3BEUA 4DVAU 1O2LA 5HYOA 2LNCA 2B0FA 1TABE 1BMFD 4Y71A 3LONA 1ZMNA 3RMOH 2EEKA 1CGIE 1BRCE 4AB9A 1SGQE 3LGVA 2FESH 3OSYA 2J34A 1HAZB 1KSNA 1TE0A 4KTCA 4MPVA 2ZDNA 1SQTA 1DITH 3NKKA 1THRH 1CSOE 2YNBA 1V2VT 1T8NA 1C5NH 1GGDB 1HAVB 3MH6A 2WSSD 2O8UA 1J16A 2ZTYA 4LK4A 3T27A 1LO6A 5GCHF 5JB9S 1LPKB 1O35A 1TX6A 1YC0A 1P9SA 5EQRA 4D76A 2WZQA 2PLXA 2AIPA 1W14U 2WPMS 1OWDA 3AW1A 1UO6A 2GCHF 1BA8B 5CHBA 1YLCA 3T26A 1O34A 4ZCNA 4D7GA 2EI6A 1IQNA 2ZIQH 1TWXB 2R2WU 1FY1A 1ESBA 1O5EH 3L6PA 1B0FA 1G3BA 1GVKB 5EJLA 4KTUA 4AG1A 1C2KA 3ATKA 3FO8D 3QGJA 5GCHG 1VJAU 2JJ1D 2BD9A 1VGCC 1DLKB 1KXAA 2BX3A 1KMHB 1SFQB 2A2XH 1K28D 2JIZD 4M7GA 1SR5C 3UPEA 1O3LA 1QRZA 1P3EA 3AAVA 1BTPA 1K1NA 3SUFA 4AX9H 4LOYH 2JJ2D 2BVSH 2WV5A 4LZ4B 1ELTA 1NPMA 1O3CA 4VGCB 2XNIA 1J8AA 2KCPA 2F9PA 3G01A 4M9FA 3NXPA 1UJ1A 1MQ6A 1GJ8B 1SGFG 3QZQA 1XKBC 1A7SA 3BTTE 2A5IA 5FPTA 4FVDA 5C17A 2EI8A 1V2OT 4FUDA 1JIRA 1GI2A 1L1NA 3P6ZB 4OS1A 5CDFE 4ACAA 5DK1A 1C5RA 3QWCH 1TQ7B 1CQQA 3F0PA 1C4Y2 3LJOA 5E0GA 3GY3A 5DKMA 1AQ7A 2ZQ1A 1GBAA 3Q3YA 3SU5A 4QT8C 1FAXA 1BDAA 1XXFA 1SGCA 2UWOA 1TQ0B 4NZLA 3PMAB 1TGBA 2ZFPH 1ZSJA 1GBKA 2ZDLA 3UR6A 1BCUH 1GVZA 1AKSA 4ABAA 4H4FA 3TU7H 1A0HB 1HAGE 3QTOH 3ZV9A 3RXLA 4B71A 1ETTH 2PKAB 2ZEBA 1Z7KA 1D9IA 5LPEA 2AYWA 1GJAB 2UUFB 5EJ1A 3RXIA 1BMAA 2QC2A 1ZPCA 3OU0A 2W7SA 3TIUA 3UWIA 2W5EA 4BTIB 2NU2E 2P95A 4Y79A 1LVBA 2VWNA 4ABIA 1TIOA 4B1TA 4B2AA 1O2NA 4FXGH 2CGAA 1JIMA 4ESTE 1RTKA 3OE7D 3RXJA 1F0TA 2ZFQH 2BM2A 1DOJA 1V2NT 2RDEA 2ZHFH 3VB4A 2ZGJA 1OX1A 1KY9A 5L6NH 2ODPA 1O3AA 1ZSKA 3SN8A 4JYVH 4X8VH 1K1MA 4ZHMU 5B6OA 3MYWA 1C5YB 1GMHG 1DUAA 2FIRH 1C5XB 1GJ6A 4CBOA 1LHEH 4BANB 1W12U 2I6QA 1HDTH 2XC5A 2BY6X 4JZ1A 4IN2A 3TJUA 5FCKA 4BAOB 4DCDA 1PPFE 3W94A 3SI4H 3A8DA 4MPWA 4Q7ZA 2BLVA 3M61U 3U8RH 3UR9A 1UHBA 3GY4A 1C1MA 1NO9H 1OYTH 2DE9A 1BQYA 1K1IA 3S9BA 4FETA 3GY5A 1HFDA 1EAXA 2R3YA 1QB9A 1F5KU 1UCYK 3RC6A 2QIQA 2ZDVH 4JMYA 1UK4A 1HAHH 1PFXC 3FZZA 3GCHC 1RRKA 5KEDA 4JK5A 3ATWA 4CHAC 4IC6A 2O8TA 2P8OB 3RU4T 4H6TA 3ZYDA 1FDPA 5J4QA 3UAIC 1H9IE 1NU9A 2GZ8A 4X8UH 1T7CA 1WTHD 3UUZA 1JBUH 2BLOA 2VWLA 4I7YH 3ZZ8A 2HGTH 1GJCB 2ALVA 1QL8A 1D3PB 1BJUA 1HAYB 4MG3A 1EJMA 3ZVCA 1ELDE 1AWFH 1QA0A 1FY4A 1WDIA 1MTNC 2ZTZA 1C2GA 1DWDH 5T3HA 4NIYA 1O2ZA 2BDIA 1G2MA 1HJAB 2J9NA 3GY2A 4R0IA 2F9UA 4AB8A 4BTUB 4AFSA 3RXDA 2BXTH 3KN2A 3RU4E 4A1VA 1C2IA 4ABGA 2ANMH 3SU4A 2OC7A 1EPTB 1HLTH 1VITF 2J97A 1MBQA 3GY6A 4BAKB 1P11E 3E3TA 3GCTG 3QZRA 4WJG2 4ZKNU 2FYRA 5FL7D 2OD3B 3RM2H 3MU8A 2BY9X 4CR5A 2HNTC 4JZIA 5FAHA 2XXLA 3T28A 1K22H 4A5TS 4X0WU 5DN6D 1C2FA 1GVLA 2BY7X 3SOSA 2HLDD 3O8DA 2GJGA 3A7VA 4I86A 1P04A 3C1KA 2IN2A 1D6RA 2A4GA 1N6XA 1FQ3A 1SHYA 1SLWB 3V0XA 1XMNB 4IBLH 1VITG 1D3TB 3MOCA 3E91A 1LPGB 1E0FD 4TWYA 1ZR0A 2PV9B 2BD7A 1SB1H 1TA2A 1UVPA 3SZNA 4INLA 4FUIA 5F6MA 2YMSC 3ODDA 2ZF0H 1P9UA 2ZTXA 2PGQB 4Y11E 3VB3A 1OS8A 1HBTH 1TYNA 2V3HH 1DY9A 1HGTH 5T6FA 1S6LA 1SQOA 3ESTA 2PUXB 1DY8A 4J1YA 1N8OB 3SJ8A 1XUKA 1O5AB 2PR3A 1V2JT 2ZPRA 1Z1JA 4DJZB 3OAAD 4KELA 1GBBA 2F9NA 1J9CH 3AAUA 2ZGCA 4J2YB 4CRFA 4E7NA 2NU0E 1TNKA 3TGKE 3DT0H 4XD7D 1AZZA 2KCAA 2FS8A 3KF2A 2UUYA 3F2GA 2SGDE 3E16B 1G37A 5DP5A 4CRBA 4NZQA 4NWKA 4DIIH 2JKHA 4MNXA 4IC5A 1Y5AT 1WBGB 3A83A 5FBIA 3WY8A 3N7DA 1ZGIA 1QIXB 3CENA 2GVFA 2ZNKH 3S7HB 3A85A 3PLPA 3M5NA 3U8OH 3BTFE 3BIUH 5JPMH 1E38B 1F0SA 1FPHH 2VNTA 3PV5A 1YLNA 1O3FA 2J94A 2KAIA 1S83A 4GCHF 4HG6A 2XW9A 4XRNA 2XBVA 2J4IA 4FUBA 4YT7H 2PKSC 1A5GH 2G5VA 3A81A 1L1JA 2WYGA 1TMTH 4GHQA 1BTHH 1Y3XA 3BTEE 1CA0C 1XVOA 3LDXH 3DSOA 1TGSZ 5EIYA 4IMQA 2UUKB 2P16A 4E05H 2WPIS 5DP4A 3DSGA 2GCTB 2VIQA 2STAE 3K2UA 2NWNA 3H7OA 3ZYEA 4DY7B 4P00A 1A61H 2RG3A 3RXGA 1IHSH 1MH0A 4FUJA 4X6PA 2JDID 4GCHG 5I46H 2A32A 3GYLB 2WPKS 1HCGA 2RCEA 5C2ZA 1T4VH 2R9PA 1CU1A 2BB4A 2RDLA 3A8CA 5LH8A 5EJZA 1YP9A 1OOKB 3GDUA 3ZZAA 2G5NA 1PYTD 2W7UA 1QJ7B 2CF8H 3DUXH 5EXLA 3A7ZA 2THFB 1A2CH 1W2KH 1YWUA 5HXFA 1RJXB 2XC4A 3ODFA 4X2WA 2P59A 5AFYH 1O3OA 4YLQH 1V2LT 1C5TA 5EXNA 2OBOA 1BBRH 2BLQA 4BNRA 2ZKSA 5KGOA 2ULLA 4GSOA 3W1EA 4TWWA 4TY7A 5FX5A 1H4WA 2BDCA 1TMUH 2C4FH 3RMMH 2A7JA 3SU6A 5F8ZA 3O8RA 2GT8A 4E06H 3GDSA 1CHGA 1PPGE 1BBRE 3TNSA 3STIA 4X6OA 1ZJKA 1B0EA 4OS6A 5C1XA 4F4OC 1P2KA 1TFXA 4YESB 1P01A 1A3BH 4Y7BA 2GZ9A 1C2HA 4BAMB 2RA3A 3VEQB 1GJ7B 1EAUA 2F91A 2BD5A 3MO3A 3TVJB 4SGAE 1MQ5A 2PW8H 1L2EA 1IAUA 1RFNA 4I32A 2WPJS 3MU5A 2A5KA 5KECA 2ZDKA 1OSSA 2P94A 1MTWA 2Z6BD 1EATA 1ZOMA 2QYIA 1NBME 1S0RA 2H9HA 4H42U 1DVAH 1AB9C 2D8WA 3LGYA 3D49H 3QK1A 3LGTA 3ZZBA 2BXUH 1GCTC 1DX5M 1NT1A 1WTGH 1BRAA 5DGJA 3RXQA 4IMZA 1O2UA 1IQJA 2H9TH 4ISHH 1EZUC 1KDQB 3KQBA 4THNH 3GISB 5EQQA 4DIHH 3BTGE 3UNQA 2BDBA 2WINI 3K65B 1W7GH 1ELEE 3NPSA 1NFYA 1S82A 3NUMA 3TK6A 3KQEA 2FOBA 2BLWA 2Y5HA 4FUFA 3SO3A 2ZGHA 2AHME 3SORA 1D4PB 1VITH 3TH2H 4AYYB 1GDQA 1TAWA 1CT0E 3MFJA 1ZHMA 1G3CA 1Q31A 3LC5A 1QY6A 2WUBA 2Y7ZA 1GBLA 3I29A 4YO9A 4BOHA 5C5NA 3KQCA 3HKJB 4AFQA 4WH8A 5GDSH 3WWFA 4FOUC 1AFEH 4DT4A 1P05A 1GHVH 2C90B 4I8KA 4XDEA 2XCNA 5HIYA 1HIAA 5FCRA 2EI7A 1GHAF 2YMSB 3SNCA 1MTVA 3BTHE 3SUEA 2SNWA 2XC0A 1DICA 1CO7E 1AI8H 3F3BA 4X8SH 2J38A 1HJ8A 2O8MA 1BBRK 3RXSA 1BMLA 2Y5FA 3BG4C 4HTCH 5HM2A 1BRUP 2Z3DA 1P2IA 3OYPA 1K2I1 3F9EA 3SQHE 2VB0A 1EZSC 3BF6H 3ZZ3A 5EW2H 3RXKA 1DUEA 1SKYE 5A2MH 3RUOA 5F03A 1LQDB 1LKBA 4WH6A 2EQNA 4AGJA 1Z1IA 5EPYA 4ZKOU 5AFZH 1SGIB 1P2JA 1NU7B 3TH4H 2F43B 1C2DA 4F55A 2OLGA 1GHAG 3M7QA 1Y59T 3UIRA 2A4OA 1ZSLA 3EA7A 2AEIH 1P06A 3VXFH 2R0KA 5HIZA 1YBWA 5CHAB 1THPB 3P95A 2C3SA 3KGPA 3VFEA 4ZHLU 5C1UA 1QRWA 2VIDA 4TPIZ 2Z9KA 4X8TH 2GD4B 1PPHE 3E0PB 1EOLA 3MU1A 1EP6A 1QR3E 1SPJA 5HMAA 3JZ1B 2K8IA 2OQUA 2V7QD 3RXMA 1LHGH 3LU9B 3GY8A 1BJVA 1UW7A 3DSPA 3ATMA 3MTYA 1FN6A 2R0LA 1T4UH 1EQ9A 4DW2U 5A8XA 1G2LA 3RXBA 4ZKRU 4K8YA 5FX6A 1C5VA 1C1PA 1P8VC 2XCFA 1ACBE 4H6SB 1TALA 3E0NB 1T8LA 4F48B 1WAYB 2JETC 2SGAA 1O2IA 3EQ0H 4DT7B 5L2ZH 2G4UA 2PTCE 4JZEH 3MH7A 1MCTA 4FUGA 5EW1H 4WWYA 1WV7H 1THSH 2ZP0H 1RGQA 1K21H 5C0TA 4WF8A 2SGQE 1QCPA 1CBWB 1CA0B 4OS2A 1C5QA 1DWCH 4ASUD 3SGQE 2PUQH 4I8JA 1FLEE 1Z6JH 1YPHE 2Q6GA 1P0SH 1JXPA 3AVZA 4ZAEA 3DCLA 1G30B 3KEEA 4UONA 1DANH 2ZHDA 3TK5A 1SG8B 2FEQH 1TGNA 1M9UA 1L1GA 1QB1A 1ZTJA 2PSXA 3CP7A 1J14A 1NRPH 2VH0A 1MKWH 1VCWA 1PJPA 1KXFA 3KCGH 4D7FA 2BY8X 3ZVDA 1HAPH 1C1RA 1FUJA 3B8JA 4XOJA 1YPJH 4K5ZA 6LPRA 5DP8A 1GI8B 2ESTE 3SU0A 2Y81A 5L2YH 3LPRA 2NU3E 1KLJH 4ZH8A 3RU4D 1XM1A 2G81E 2W3IA 5EG4A 2FOCA 5SGAE 1ELVA 1EP5A 1SQAA 4O3TA 2B7DH 1AY6H 1DWBH 1MCVA 1EOJA 4D8NA 8LPRA 1QNJA 3KYFA 1PPEE 1C4U2 1QBNA 4YM9A 2ODQA 4AORA 1CHOF 3SU1A 2OTVA 1AE5A 1GBHA 2FOMB 1EJNA 1C1OA 1AZ8A 2TGPZ 5T6GA 3SHCH 3MU0A 1GMHF 2ZU2A 1ZLRA 2NU4E 1B5GH 4NCYA 1ZHPA 1C5MD 1SHHB 2ZPQA 3EAJA 1SBWA 1C1UH 3M37A 2QF3A 4K1EA 1EKBB 4LXBH 4CREA 1P10A 2FM2A 2SNVA 3ZVFA 1O5FH 5DP6A 1H9LB 3P70B 2BQ7B 1EX3A 1SVPA 4IGDA 1QJ6B 1MBMA 2FYQA 4TT3D 3ZZDA 1HV7A 1GMCG 4I8LA 3PROA 3HK6B 3ZZ4A 1CHOG 1SGFA 2WYJA 1COWD 4ISNA 5HGGA 3FP6E 1O33A 5AVDA 1OHHD 4UE7H 1AFQC 2P3TB 1YPKH 1W10U 3RXEA 1GCTB 1NY22 1QRXA 1SQRA 3UNSA 1GMDG 1QHRB 1ELGA 1TRMA 4U2WA 5HKKD 3PM3A 3ZIAD 5DO4H 1LHCH 4UFEH 1IQEA 1T8MA 4UDWH 4WXIA 2F3CE 1F5LA 3P8FA 3F1SB 1XUIA 1YPEH 3IITA 2KM0A 3DFLA 1QZ8A 4OM9A 1EAIA 2VGCB 2Z9JA 4WVPE 2HWLB 3OFND 1O2VA 1AVXA 2GDDA 2SGPE 3BIVH 2AMQA 4U32A 1L4ZA 1P09A 1HYLA 4WXVA 1HXFH 1UTNA 2OCVB 3UQVA 3NK8A 3TPIZ 3S0NA 2A7HA 3Q3KA 3ZVGA 1BTZA 1Q2WA 2PSYA 1UHBB 4X2XA 3ZZ7A 2GDEH 1MKWK 4AGKA 4YT6H 1Z71A 3UOPA 1GG6B 1CVWH 3U28C 1O38A 2Z3EA 1NESE 1FAKH 4MQAA 1MZDA 2QCYA 5C67A 3O8CA 1O39A 3RLWH 6GCHF 5C3NA 2OC8A 1NRNH 1F7ZA 1PPBH 3BTDE 3N99A 1AVWA 2LP6A 3PTBA 2BOKA 2A0QB 1NROH 1WCZA 1OWIA 3PMBB 3EGKH 3OX7U 8GCHF 2VWOA 3PMHB 3V7TA 2ANYA 1L4DA 3CS0A 1LHDH 2BOHB 1UVOA 3GCTF 1LQEA 4CBNA 4TYDA 1O5DH 5BRRE 1SOTA 2M5TA 1MTUA 3OTJE 4BXSA 1IQGA 1N1LA 3SNBA 4FUCA 2XBWA 2O8WA 2FTMA 3K6YA 1SSXA 3UY9A 4E7RG 1MUEB 6GCHG 1KYNA 4MNYA 1BHXB 3LGUA 4CRDA 3TK9A 1BMNH 2FOFA 1C2MA 2FOHA 1C2JA 2YOLA 1W3CA 5E0HA 1G36A 2BQ6B 1G32B 4O3UA 4UD9H 3HGNA 5EGMA 5GPIB 2J98B 2GX4A 5DSFA 1JWTA 1OWJA 8GCHG 3M7UA 1O2XA 2R3UA 1DWEH 4IS5A 1YPMH 3L33A 3RXPA 2HOBA 3BN9A 4BXWA 4BTTB 2O9QA 1SLUB 2FTLE 2GP9B 1T31A 2Y82A 2ZFFH 4A1XA 4NG9H 2FDAA 3BEFB 4ABFA 5JYIA 2TGAA 3RXVA 1EUFA 2AERH 1PPCE 4BAHB 3ZZ5A 1O3NA 4XFQA 3SHAH 2KX4A 2A4QA 1OP2A 4TPYA 1QB6A 1OYQA 1HNEE 4Z0KA 3H09A 1CE5A 1IQFA 1XUHA 2XBYA 1P12E 4XBBA 3HGPA 2RA0A 1VGCB 1DPOA 5LPRA 2JETB 1E79D 4MNWA 1NC6A 2A1DB 4K60A 3URDA 3QX5H 3EE0B 5GWZA 1TGCA 2CHAC 1VCPA 5H4IB 2ZHWH 3SV8A 3HATH 1GDNA 2FI5E 3RLYH 1FXYA 2V3MA 4B6FA 3KNXA 3VGCC 2BD3A 3RXTA 3BG8A 1SLXB 1O3EA 1O3JA 2FX4A 1V3XA 1BZXE 1VR1H 1TPPA 3N7OA 2ZC9H 2AS9A 3FP8E 1C5OH 3NWUA 2VBCA 4ZUHA 3PLKA 5A0BA 5GXPA 4K69A 2Z9LA 3K9XB 3NRLA 4O97A 1NBMD 3DFJA 2OQ5A 3DHKH 1MMJN 1EXFA 1P2NA 1LVYA 1AD8H 1TPAE 1RTLA 4JYUH 3OY6U 1HAOH 4CRCA 1ZPBA 2Z9GA 8KME2 3U98H 2UWLA 1O30A 2F83A 3ATIA 2CK3D 1PQ5A 1NRSH 1QJ1B 1V2QT 2H9EH 2QF4A 1AVGH 1Y5UT 1O2WA 1T32A 4ABEA 2BYAX 4X1RU 3PRBA 2XBXA 1AU8A 1A3EH 5FBEA 1GGDC 3NCLA 1O0DH 2VH6A 1KTTB 8ESTE 3RMLH 1V2ST 4NSYA 1RXPA 3EA8A 3SNEA 4B2CA 3A7WA 2Q6DA 3U69H 1C5UA 3PMJA 1KXDA 4I8GA 2QF0A 4XBDA 3QDZB 1GHXH 1EB1H 2ZPSA 3A82A 2BX4A 4RKJB 5TCCA 1S84A 3HPTB 1P3CA 1A5HA 2BDYA 1ID5H 3M3TA 1GJBB 5A0AE 1KLIH 2Y5GA 3RXCA 2Y80A 3A7YA 3LJJA 1LTOA 1K9OE 1V2MT 2C8ZB 1OWHA 4GAWA 1RTFB 3M3SA 1LPZB 2UUJB 2VIWA 1ANDA 2KAIB 2BDHA 2QF5A 5ABWA 3EE7A 1QTFA 1Y8TA 2VWMA 1AUJA 1O5BB 1AN1E 1AHTH 2W26A 1TNLA 1O2YA 2A45B 3DD2H 1TX7A 2G4TA 1MKXH 4VGCC 1QFKH 3RXRA 2IJD1 2L74A 2ZU5A 3E90B 1P2MA 2HNTF 3FANA 3RXFA 6ESTA 2AFQB 7GCHF 1TNHA 1W0JD 5CE1A 1INCA 1O3DA 3PV2A 5T6DA 4DG4A 1FN8A 2DE8A 4ISOA 1ORFA 4HGCA 4NIWA 1E34B 2V6NA 3AK5A 4Q4LA 1GBMA 2Z94A 2LPRA 3SU3A 6CHAC 2CN0H 2W6ID 1C5LH 4ZXXH 4AFZA 4AYVB 3S7KB 4AG2A 1ESTA 1VJ9U 4NIXA 1BRBE 2H5DA 2K0QA 2ZHQH 3AASA 1GJ9B 2FWWA 3FP7E 3M35A 4NA9H 1IHTH 2Z9IA 3BTKE 4NFFA 4YXWD 2FLRH 1Y3WA 2NU1E 1FV9A 7GCHG 1CA8B 1NFXA 4BAQB 1O2JA 3GCHB 1PQ7A 3JZ2B 4K2YA 1GL1A 2IJOB 1DM4B 3IG6B 3U8TH 3VB5A 1YCPH 5DPAA 4CHAB 5LPFA 1A5IA 1V2UT 1O3IA 1T8OA 1LDTT 3Q76A 1TBRH 2GKVE 2HPPH 5FXLA 1YKTA 1KIGH 2IPHA 3DA9B 3Q77A 3LKWA 3QLPH 1K0HA 3F6UH 2CMYA 2EY4C 3P92A 2DUCA 1GBIA 1DE7H 2FOAA 5C5OA 3TGIE 4I31A 4B73A 4B2BA 1NZQH 2CV3A 3KL6A 3WW7A 1MTNB 2HVXA 5A0CA 3GCOA 2TIOA 1D3QB 1O2PA 3SYJA 1DXWA 4TSFD 3SBKA 2BD8A 1ZMJA 1ZRBA 1IQLA 2BVRH 4GUXA 2BDAA 5L30H 2BDGA 2HALA 1ZZZA 2OC0A 1KDQA 4FUHA 3VB7A 3SW2B 1FY8E 4XSKU 1H8HD 3W95A 2G52A 2AH4X 2KFWA 3ZZ9A 1IQKA 3QGNB 3L3TA 2VJ1A 5FHTA 4YTAA 2PFEA 1SLVB 1UTKA 3M5MA 4Q7XA 3TGJE 1IQHA 1TLDA 5K7RA 3A86A 1L0ZA 2OXSA 4U01A 1O2SA 2QY0B 3VXEH 2AGIX 2BMGB 2OBQA 4X1NU 2A2QH 5DP3A 1QURH 1BIOA 1MTSA 1TBQH 4FUEA 1MKXK 1IOEA 1S81A 1W0ZU 5I25A 4JCNA 4Q63A 4B6EA 3BTWE 1JRSA 4Q2KA 3LH3A 2FS9A 4YLUA 1DS2E 3GYMA 1GWAA 1GHYH 3PV4A 1C2EA 1FY3A 1ABJH 2GZ7A 1O3KA 4FU9A 1A0JA 2D26C 2D2DA 3E6PH 3KIDU 3KHVA 3Q00A 2GTBA 3VGCB 2B5TB 1P2OA 1Y3UA 1VCQA 3A7TA 4AN7A 2FO9A 3MQKC 2BZ6H 4ASHA 2YMSD 1UTJA 1TPOA 1QA7A 1Y3VA 2A31A 1YGCH 4OGXA 1H9HE 3Q3XA 1HIAB 1C9PA 2P3UB 4Y76A 2Z7FE 1W13U 3TLOA 2ZHEH 1P03A 1TBZH 2FODA 3RXUA 1HAVA 1VKYA 1EB2A 5B6LA 3BSQA 3RC4A 1YCPK 2H2ZA 1MAXA 1GBFA 3PWCA 2TGTA 4UFDH 2ZWLH 1WQSA 2HPQH 1EZQA 1SGTA 2ZU1A 3GS9A 4O9VA 3D62A 1CGJE 1HJAC 3RXHA 3QO6A 1TA6A 2CF9H 2F4LA 1HAXB 3SV2H 3ATLA 1QGFA 4NA8A 4K8BA 1ANBA 4GHTA 2CJIA 2C8WB 1EFRD 2HRVA 2IOTA 2L6OA 5CMXH 1EPTC 4Y10E 3QN7A 1GJ4H 4AFUA 2WPDD 5F8XA 1O2HA 5E2PA 3SNAA 4A6LA 1ARBA 1KXBA 3U1JB 4UFFH 3HK3B 4ZHAA 3E8LA 2Y7XA 2GT7A 5E2OA 1J17T 3OEED 1O3PB 2PKSB 1ZGVA 2VIOA 1BITA 3UQOA 4AZ2B 1P57B 3OTPA 2QXJA 1SGNE 3P8NA 2BD4A 2ZFTA 1DDJA 1UTMA 3MNCA 1N6YA 1V2KT 3D65E 2C93B 2Z3CA 1O5GH 1H8DH 3F2HA 3QTVH 1KTSB 2ZFSA 4GLYA 2GCHG 4NA7A 3T29A 1HAIH 1H8IH 3PO1C 1RIWC 3SNDA 1ANEA 4A1TA 3RMNH 2D1JA 1P2QA 5EODA 1E1RD 1SGPE 4K1SA 3MWIU 1D3DB 4LZ1H 4FVBA 4K1TA 3KYGA 3FOAA 5K0HA 2GGVB 4WMEA 3GICB 1UCYH 1V6DA 1N8OC 1J15A 4HFPB 2OC1A 1TPSA 3TJNA 3TITA 1CT4E 3EYDA 1V2RT 2RFKC 2PWXA 1WUNH 1XX9A 6CHAB 3LIWA 1OKXA 2OP9A 2BQWB 1EASA 4JZFH 1H8ED 4ZKSU 1UCYE 1O37A 1BTWA 1TB6H 5T1VA 2K1QA 1XKAC 3VB6A 2ZGXH 1LKAA 2HVYB 1BTXA 4MLFB 1XVMA 1S0QA 1GMCF 1BB0B 2BD2A 4X1PU 2HNTE 1YYY1 4JK6A 2VVVA 4I33A 2PKAA 1ELBA 2PGBB 3UTUH 1NTPA 5DG6A 2XNDD 1O5CB 1OWKA 2G00A 5EQSA 1A46H 3UNRA 1AKSB 1D6WA 4NIVA 1XUGA 3UOUA 1AIXH 1C5SA 1TNGA 3URCA 1A1RA 2J92A 1GMDF 2Y6TA 5DP9A 2OUAA 2QA9E 1TGTA 3CNRA 3A8AA 4INHA 3ZV8A 2WV9A 4X6MA 1O2KA 1S6HA 4D9RA 3M7TA 4O03A 1BHXF 1GJDB 4B76A 4X2YA 3LH1A 4B75A 1LCYA 1Z6EA 3PWBA 4MVNA 3MO6A 5HM9A 3M5LA 4ZROA 1AB9B 3F0OA 1ETRH 1TOCB 2ZCKP 2SGEE 3A87A 4RN6A 4GPGA 1JMOH 1EJAA 1O2OA 4RT1A 3C27B 2QXIA 1C1TA 3A7XA 1SGRE 1K1JA 3FKSD 4OS5A 4MTBA 2GCTC 2STBE 2ZDMA 1LMWB 1OPHB 3SV7A 1UTLM 2ILNA 4R8TB 2C8XB 1O2TA 2VIPA 4YZUA 5AHGH 2WUCA 3CS7A 2GMTC 4Y7AA 5JB8S 4KTSA 1PYTC 3MU4A 2ZCLP 1Z8RA 4RKOB 1DT2A 3KQDA 4Y6DA 1JOUB 4PROA 5IDKA 2SFAA 3P8GA 1GBDA 3SU2A 3MNXA 2QAAA 4WY3A 1Z8IB 5IYTA 1FJSA 2GV6A 1LVMA 5JBAS 1Y5BT 3LGWA 1QQUA 4X1QU 1AE8H 1ETSH 1SGYE 2O8LA 5EPNA 1FX0B 3MH5A 1O2QA 3D23A 3FN8A 5TJXA 1Y3YA 3SV9A 1ANCA 2J2UA 1ZYOA 1UTQA 4A7IB 3MHWU 1OXGA 1E35B 2FP7B 2XYAA 3TJOA 1BOQA 2P3FH 3P17H 3K6ZA 3SUDA 1NS3A 5EU8A 2EA3A 1AMHA 1NFWA 2ZG0H 3EA9A 3M5OA 4YOGA 3ZZ6A 3H7TA 1MU8B 5C20A 1HPGA 4X6NA 4CRAA 1ZRKA 2IPQX 1SI5H 3F2FA 1Z8JB 5A8YA 3PRDA 5IK2D 4CR9A 2KCOA 1K1LA 1SMFE 5PTPA 1O2GH 3PLBA 1NRQH 2J95A 3BG4B 5JDUB 2XWBI 1W0YH 3LGIA 1G3EA 1YY3A 4XE4A 1GI6A 4Y0YE 1GBEA 3T2NA 3I77A 1FI8A 1YPHC 3LC3A 7ESTE 3A89A 3HKIB 3GY7A 4AC9A 1V2TT 1S6FA 2CXVA 1BUIA 1TRYA 2J98A 1WQVH 1YF4A 3R3GB 1EPTA 3PYHA 3EDXB 4K3JA 3PB1E 1XXDA 2V35A 1O2MA 2H5CA 4UFGH 5JBTA 1NM6A 1SGDE 4U30A 3V13A 1MAYA 1SC8U 1UK3A 4Y0ZE 1ABIH 1W8BH 2M2AA 3MMGA 2XTTB 3A8BA 1AGJA 1MZAA 2R2MB 4YOJA 1TNJA 1GI4A 1FIWA 2A5AA 1YPLH 1UTPA 4NSVA 1HB0B 2OK5A 3SJKA 5BPEA 4ZMAH 3SV6A 4DURA 3F68H 2A4RA 2ASUB 4X1SU 1HUTH 1ZTKA 4RT0A 5GNDA 4ABDA 1BT7A 3SJOA 3WWBA 1TMBH 1WU1A 5EXMA 4F49A 3UFAA 4B74A 2Q6FA 1O3HA 3V12A 1G9IE 1RS0A 4FU7A 4OS7A 4ACBA 2KZ4A 2XRCA 1HRTH 1WOFA 1O2RA 2ZA5A 3ENSB 5C94A 3FVFB 2V0BA 1FNIA 1GHBF 4MPXA 4P02A 7KMEH 2OINA 3VPKA 1IQMA 2A7CA 1SOZA 1PPZA 3PO1B 1RIWB 3O8BA 1MABB 1XUJA 3M3VA 3R0FA 4KGAA 1C1NA 1V2PT 2FI3E 1C5PA 2F9VA 9ESTA 5ESTE 4FU8A 4JZDH 1SFIA 2BY5X 1MD7A 4I8HA 1GI1A 3ITIA 1FONA 3BTME 1A4WH 4JYTA 1GI5A 1V2WT 3TNTA 1UVTH 3RM0H 1S5SA 4HZHA 1AWHB 1GHBG 3UB0A 5LGOA 4OGYA 2QE7D 2JH6D 3A80A 1C1VH 1DFPA 3TH3H 5CHAC 3PTNA 1ZMLA 1NFUA 2ZQ2A 5GJ4B 3SGAE 1YLDA 2AMPA 2G51A 2ZECA 1JRTA 1P02A 2BTCE 4DGJA 2H1UA 1C2LA 1ZJDA 3N7EA 3SGBE 5J4SA 1DSTA 1KLTA 2TGDA 3LOXA 1MU6B 4D9QA 1GBCA 1C1QA 1SGEE 4RSPA 1TONA 3U1IB 2B8OH 5G4BA 1K1PA 2WV4A 2FOGA 5FPSA 4KP0A 1X7AC 1YPGH 1RD3B 4KKDA 2ZU3A 1IQIA 2ANWA 1K1OA 2H6MA 2ODYB 2PP6A 1BTYA 5JBBS 1O3BA 1GHZA 4UEHH 4ABBA 1C5ZB 3P8OA 2QGRA 2VU8E 5FPYA 3BTQE 2VVUA 2TPIZ 1GBJA 3BV9B 1GI7B 1LHFH 1UK2A
chains in the Genus database with same CATH topology
1AFQB 2FMJA 2JH5D 1F92A 3FZDA 1OP0A 2FOEA 2B9LA 1GJ5H 1CBWC 5GIBA 4GVUA 1BTUA 4ISLA 1DSUA 1NN6A 2FLBH 2GV7A 3FAOA 5JBCS 3S9CA 3SJIA 2QN5T 1C9TA 4MPUA 2ZO3H 1ARCA 3LT3A 2ZFRH 4Q80A 1G3DA 3MNBA 2GMTB 4MDSA 3ELAH 1B7XB 3S9AA 5DP7A 3OY5U 3FFGA 3F9HA 2YNAA 1DXPA 3MO9A 3ZZCA 1W11U 3RDZA 4INKA 3T5FH 1WYKA 3A88A 1E37B 4ZXYH 2AGEX 1QQ4A 1UVUH 3SQEE 5E8EH 3OEHD 2F9OA 3ZVAA 5A09A 2I6SA 3B23B 3UREA 1C5WB 4MNVA 1O3MA 1A0LA 1FMGA 5A8ZA 1O31A 2AIQA 1F0RA 3M36A 2FI4E 3I78A 1C4V2 1KXCA 2G8TA 4RI0A 5ETXA 1GL0E 1E1QD 4Z1MD 3T62A 1TRNA 1NRRH 2BZAA 1HJ9A 1ZHRA 5F8TA 4DOQA 2ANKH 4Q7YA 1C1SA 1EZXC 1WSSH 4IW4E 1F2SE 1C1WH 1W0KD 1HXEH 2ALPA 2EC9H 2ZGBH 3GCNA 3RC5A 2VIVA 1O3GA 1FPCH 1ZTLA 3SZEA 3IWMA 3ZVEA 1E36B 5TCAA 2W3KA 3MI4A 1FIZA 2ZU4A 4AOQA 1BMMH 7LPRA 2TRMA 2HLCA 1GI0A 5EOKA 1QL7A 1GI3A 1WXRA 1GBTA 1ELAA 3T25A 2QXHA 1ZPZA 1UMAH 2PTNA 4Y8XA 2BVXH 1TNIA 2VVCA 1FY5A 1LVOA 1GI9B 1F5RA 3E1XB 2PHBA 2FPZA 4WMFA 1Z8GA 1SL3A 2FZZA 3B9FH 4ABHA 4CRGA 1CT2E 1KXEA 1FZZA 1EAWA 2C8YB 4NWLA 1GHWH 3H5CB 5C1YA 2UWPA 2ZI2H 1AUTC 3F9FA 4A92A 4ISIH 3GDVA 2SGFE 2KR7A 3VG8A 4CH8B 4XBCA 2WPHS 3STJA 5ESBA 1AO5A 2AMDA 1GDUA 2V3OH 1W7XH 4IN1A 1U6QA 4CH2B 1ELCA 4X2VA 5C0UA 1CGHA 2AGGX 1PQ8A 1O36A 9LPRA 2G55A 2ZZUH 2LELA 1GCDA 1VZQH 2F9BH 1GPZA 2VGCC 1MD8A 1PQAA 2ZCHP 2XWAA 3QUMP 1ELFA 1S85A 5F53A 1TX8A 3BEIB 1ESAA 1OP8A 1YM0A 2VINA 5DJ7A 1O32A 3S69A 1F0UA 2ZDAH 5AF9H 3A84A 3RXOA 3ZVBA 2CHAB 2FX6A 2J5UA 4Y8ZA 2QXGA 1Q3XA 2QV1A 2WHXA 1GG6C 2P93A 4HI3A 4YOIA 3SI3H 4NFEA 4Z6AH 3MH4A 3UWJH 1QBOA 2W6JD 4ABJA 3SUGA 4NGAH 2WPLS 1XUFA 3MNSA 1TOMH 2P8OC 3SJ9A 2KCYA 3RXAA 2BHGA 5E0JA 2Q1JA 3NZIA 4OS4A 1QL9A 4WMDA 2TBSA 2JH0D 4Y8YA 3RP2A 2FXRA 1YCPM 3TJVA 1H1BA 2XOKD 4SGBE 1OWEA 3U9AH 3V3MA 1QBVH 3AW0A 4TY6A 3GOVB 1DLEA 1UVSH 1UTOA 3F9GA 3BEUA 4DVAU 1O2LA 5HYOA 2LNCA 2B0FA 1TABE 1BMFD 4Y71A 3LONA 1ZMNA 3RMOH 2EEKA 1CGIE 1BRCE 4AB9A 1SGQE 3LGVA 2FESH 3OSYA 2J34A 1HAZB 1KSNA 1TE0A 4KTCA 4MPVA 2ZDNA 1SQTA 1DITH 3NKKA 1THRH 1CSOE 2YNBA 1V2VT 1T8NA 1C5NH 1GGDB 1HAVB 3MH6A 2WSSD 2O8UA 1J16A 2ZTYA 4LK4A 3T27A 1LO6A 5GCHF 5JB9S 1LPKB 1O35A 1TX6A 1YC0A 1P9SA 5EQRA 4D76A 2WZQA 2PLXA 2AIPA 1W14U 2WPMS 1OWDA 3AW1A 1UO6A 2GCHF 1BA8B 5CHBA 1YLCA 3T26A 1O34A 4ZCNA 4D7GA 2EI6A 1IQNA 2ZIQH 1TWXB 2R2WU 1FY1A 1ESBA 1O5EH 3L6PA 1B0FA 1G3BA 1GVKB 4KTUA 4AG1A 1C2KA 3ATKA 3QGJA 3FO8D 5GCHG 1VJAU 2JJ1D 2BD9A 1VGCC 1DLKB 1KXAA 2BX3A 1KMHB 1SFQB 2A2XH 1K28D 2JIZD 4M7GA 1SR5C 3UPEA 1O3LA 1QRZA 1P3EA 3AAVA 1BTPA 1K1NA 3SUFA 4AX9H 4LOYH 2JJ2D 2BVSH 2WV5A 4LZ4B 1ELTA 1NPMA 1O3CA 4VGCB 2XNIA 1J8AA 2KCPA 2F9PA 3G01A 4M9FA 3NXPA 1UJ1A 1MQ6A 1GJ8B 1SGFG 3QZQA 1XKBC 1A7SA 3BTTE 2A5IA 5FPTA 4FVDA 5C17A 2EI8A 1V2OT 4FUDA 1JIRA 1GI2A 1L1NA 3P6ZB 4OS1A 5CDFE 5DK1A 1C5RA 3QWCH 1TQ7B 1CQQA 3F0PA 1C4Y2 3LJOA 5E0GA 3GY3A 5DKMA 1AQ7A 2ZQ1A 1GBAA 3Q3YA 3SU5A 4QT8C 1FAXA 1BDAA 1XXFA 1SGCA 2UWOA 1TQ0B 4NZLA 3PMAB 1TGBA 2ZFPH 1ZSJA 1GBKA 2ZDLA 3UR6A 1BCUH 1GVZA 1AKSA 4ABAA 4H4FA 3TU7H 1A0HB 1HAGE 3QTOH 3ZV9A 3RXLA 4B71A 1ETTH 2PKAB 2ZEBA 1Z7KA 1D9IA 5LPEA 2AYWA 1GJAB 2UUFB 3RXIA 1BMAA 2QC2A 1ZPCA 3OU0A 2W7SA 3TIUA 3UWIA 2W5EA 4BTIB 2NU2E 2P95A 4Y79A 1LVBA 2VWNA 4ABIA 1TIOA 4B1TA 4B2AA 1O2NA 4FXGH 2CGAA 1JIMA 4ESTE 1RTKA 3OE7D 3RXJA 1F0TA 2ZFQH 2BM2A 1DOJA 1V2NT 3VB4A 2ZHFH 2ZGJA 1OX1A 1KY9A 5L6NH 2ODPA 1O3AA 1ZSKA 3SN8A 4JYVH 4X8VH 1K1MA 4ZHMU 5B6OA 3MYWA 1C5YB 1GMHG 1DUAA 2FIRH 1C5XB 1GJ6A 4CBOA 1LHEH 4BANB 1W12U 2I6QA 1HDTH 2XC5A 2BY6X 4JZ1A 4IN2A 3TJUA 5FCKA 4BAOB 4DCDA 1PPFE 3W94A 3SI4H 3A8DA 4MPWA 4Q7ZA 2BLVA 3M61U 3U8RH 3UR9A 1UHBA 3GY4A 1C1MA 1NO9H 1OYTH 2DE9A 1BQYA 1K1IA 3S9BA 4FETA 3GY5A 1HFDA 1EAXA 2R3YA 1QB9A 1F5KU 1UCYK 3RC6A 2QIQA 2ZDVH 4JMYA 1UK4A 1HAHH 1PFXC 3FZZA 3GCHC 1RRKA 4JK5A 3ATWA 4CHAC 4IC6A 2O8TA 2P8OB 3RU4T 4H6TA 3ZYDA 1FDPA 5J4QA 1H9IE 1NU9A 2GZ8A 4X8UH 1T7CA 1WTHD 3UUZA 1JBUH 2BLOA 2VWLA 4I7YH 3ZZ8A 2HGTH 1GJCB 2ALVA 1QL8A 1D3PB 1BJUA 1HAYB 4MG3A 1EJMA 3ZVCA 1ELDE 1AWFH 1QA0A 1FY4A 1MTNC 2ZTZA 1C2GA 1DWDH 5T3HA 4NIYA 1O2ZA 2BDIA 1G2MA 1HJAB 2J9NA 3GY2A 4R0IA 2F9UA 4AB8A 4BTUB 4AFSA 3RXDA 2BXTH 3KN2A 3RU4E 4A1VA 1C2IA 4ABGA 2ANMH 3SU4A 2OC7A 1EPTB 1HLTH 1VITF 1MBQA 3GY6A 4BAKB 1P11E 3E3TA 3GCTG 3QZRA 4WJG2 4ZKNU 2FYRA 5FL7D 2OD3B 3RM2H 3MU8A 2BY9X 4CR5A 2HNTC 4JZIA 5FAHA 2XXLA 3T28A 1K22H 4A5TS 4X0WU 5DN6D 1C2FA 1GVLA 2BY7X 3SOSA 2HLDD 3O8DA 3A7VA 1P04A 3C1KA 2IN2A 1D6RA 2A4GA 1N6XA 1FQ3A 1SHYA 1SLWB 3V0XA 1XMNB 4IBLH 1VITG 1D3TB 3MOCA 3E91A 1LPGB 1E0FD 4TWYA 1ZR0A 2PV9B 2BD7A 1SB1H 1TA2A 1UVPA 3SZNA 4INLA 4FUIA 5F6MA 2YMSC 3ODDA 2ZF0H 1P9UA 2ZTXA 2PGQB 4Y11E 3VB3A 1OS8A 1HBTH 1TYNA 2V3HH 1DY9A 1HGTH 5T6FA 1S6LA 1SQOA 3ESTA 2PUXB 1DY8A 4J1YA 1N8OB 3SJ8A 1XUKA 1O5AB 2PR3A 1V2JT 2ZPRA 1Z1JA 4DJZB 3OAAD 4KELA 1GBBA 2F9NA 1J9CH 3AAUA 2ZGCA 4J2YB 4CRFA 4E7NA 2NU0E 1TNKA 3TGKE 3DT0H 4XD7D 1AZZA 2KCAA 2FS8A 3KF2A 2UUYA 3F2GA 2SGDE 3E16B 1G37A 5DP5A 4CRBA 4NZQA 4NWKA 4DIIH 2JKHA 4MNXA 4IC5A 1Y5AT 1WBGB 3A83A 5FBIA 3WY8A 3N7DA 1ZGIA 1QIXB 3CENA 2GVFA 2ZNKH 3S7HB 3A85A 3PLPA 3M5NA 3U8OH 3BTFE 3BIUH 5JPMH 1E38B 1F0SA 1FPHH 2VNTA 3PV5A 1O3FA 2J94A 2KAIA 1S83A 4GCHF 2XW9A 2XBVA 2J4IA 4FUBA 4YT7H 2PKSC 1A5GH 2G5VA 3A81A 1L1JA 2WYGA 1TMTH 4GHQA 1BTHH 1Y3XA 3BTEE 1CA0C 1XVOA 3LDXH 3DSOA 1TGSZ 4IMQA 2UUKB 2P16A 4E05H 2WPIS 5DP4A 2GCTB 2VIQA 2STAE 3K2UA 2NWNA 3H7OA 3ZYEA 4DY7B 1A61H 2RG3A 3RXGA 1IHSH 1MH0A 4FUJA 4X6PA 2JDID 4GCHG 5I46H 2A32A 3GYLB 2WPKS 1HCGA 2RCEA 5C2ZA 1T4VH 2R9PA 1CU1A 2BB4A 2RDLA 3A8CA 5LH8A 1YP9A 1OOKB 3GDUA 3ZZAA 2G5NA 1PYTD 2W7UA 1QJ7B 2CF8H 3DUXH 5EXLA 3A7ZA 2THFB 1A2CH 1W2KH 5HXFA 1RJXB 2XC4A 3ODFA 4X2WA 2P59A 5AFYH 1O3OA 4YLQH 1V2LT 1C5TA 5EXNA 2OBOA 1BBRH 2BLQA 4BNRA 2ZKSA 2ULLA 4GSOA 3W1EA 4TWWA 4TY7A 5FX5A 1H4WA 2BDCA 1TMUH 2C4FH 3RMMH 2A7JA 3SU6A 5F8ZA 3O8RA 2GT8A 4E06H 3GDSA 1CHGA 1PPGE 1BBRE 3TNSA 3STIA 4X6OA 1ZJKA 1B0EA 4OS6A 5C1XA 4F4OC 1P2KA 1TFXA 4YESB 1P01A 1A3BH 4Y7BA 2GZ9A 1C2HA 4BAMB 2RA3A 3VEQB 1GJ7B 1EAUA 2F91A 2BD5A 3MO3A 3TVJB 4SGAE 1MQ5A 2PW8H 1L2EA 1IAUA 1RFNA 4I32A 2WPJS 3MU5A 2A5KA 2ZDKA 1OSSA 2P94A 1MTWA 2Z6BD 1EATA 1ZOMA 2QYIA 1NBME 1S0RA 2H9HA 4H42U 1DVAH 1AB9C 2D8WA 3LGYA 3D49H 3QK1A 3LGTA 3ZZBA 2BXUH 1GCTC 1DX5M 1NT1A 1WTGH 1BRAA 5DGJA 3RXQA 4IMZA 1O2UA 1IQJA 2H9TH 4ISHH 1EZUC 1KDQB 3KQBA 4THNH 3GISB 5EQQA 4DIHH 3BTGE 3UNQA 2BDBA 2WINI 3K65B 1W7GH 1ELEE 3NPSA 1NFYA 1S82A 3NUMA 3TK6A 3KQEA 2FOBA 2BLWA 2Y5HA 4FUFA 3SO3A 2ZGHA 2AHME 3SORA 1D4PB 1VITH 3TH2H 4AYYB 1GDQA 1TAWA 1CT0E 3MFJA 1ZHMA 1G3CA 1Q31A 3LC5A 1QY6A 2WUBA 2Y7ZA 1GBLA 3I29A 4YO9A 4BOHA 5C5NA 3KQCA 3HKJB 4AFQA 4WH8A 5GDSH 3WWFA 1AFEH 4DT4A 1P05A 1GHVH 2C90B 4I8KA 4XDEA 2XCNA 1HIAA 5FCRA 2EI7A 1GHAF 3SNCA 2YMSB 1MTVA 3BTHE 3SUEA 2SNWA 2XC0A 1DICA 1CO7E 1AI8H 3F3BA 4X8SH 2J38A 1HJ8A 2O8MA 1BBRK 3RXSA 1BMLA 2Y5FA 3BG4C 4HTCH 5HM2A 1BRUP 2Z3DA 1P2IA 3OYPA 1K2I1 3F9EA 3SQHE 2VB0A 1EZSC 3BF6H 3ZZ3A 5EW2H 3RXKA 1DUEA 1SKYE 5A2MH 3RUOA 5F03A 1LQDB 1LKBA 4WH6A 4AGJA 1Z1IA 5EPYA 4ZKOU 5AFZH 1SGIB 1P2JA 1NU7B 3TH4H 2F43B 1C2DA 4F55A 2OLGA 1GHAG 3M7QA 1Y59T 3UIRA 2A4OA 1ZSLA 3EA7A 2AEIH 1P06A 3VXFH 2R0KA 1YBWA 5CHAB 1THPB 3P95A 2C3SA 3KGPA 3VFEA 4ZHLU 5C1UA 1QRWA 2VIDA 4TPIZ 2Z9KA 4X8TH 2GD4B 1PPHE 3E0PB 1EOLA 3MU1A 1EP6A 1QR3E 1SPJA 5HMAA 3JZ1B 2K8IA 2OQUA 3RXMA 2V7QD 1LHGH 3LU9B 3GY8A 1BJVA 3DSPA 3ATMA 3MTYA 1FN6A 2R0LA 1T4UH 1EQ9A 4DW2U 5A8XA 1G2LA 3RXBA 4ZKRU 4K8YA 5FX6A 1C5VA 1C1PA 1P8VC 2XCFA 1ACBE 4H6SB 1TALA 3E0NB 1T8LA 1WAYB 2JETC 2SGAA 1O2IA 3EQ0H 4DT7B 5L2ZH 2G4UA 2PTCE 4JZEH 3MH7A 1MCTA 4FUGA 5EW1H 4WWYA 1WV7H 1THSH 2ZP0H 1RGQA 1K21H 5C0TA 4WF8A 2SGQE 1QCPA 1CBWB 1CA0B 4OS2A 1C5QA 1DWCH 4ASUD 3SGQE 2PUQH 4I8JA 1FLEE 1Z6JH 1YPHE 2Q6GA 1P0SH 1JXPA 3AVZA 4ZAEA 3DCLA 1G30B 3KEEA 4UONA