5GPIB

Crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
154
structure length
154
Chain Sequence
ETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NS3 protease
publication title Crystal structure of unlinked NS2B-NS3 protease from Zika virus
pubmed doi rcsb
source organism Zika virus
total genus 23
structure length 154
sequence length 154
chains with identical sequence D, F, H
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gpiB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5gpiB01
1J9CH 2ZDKA 3MU1A 4OGXA 4B2BA 1FPHH 3STJA 1FN8A 2ZHQH 2ZZUH 1GJ4H 2GD4B 4JYVH 1ZHRA 1GVZA 2FO9A 2EC9H 1T8OA 1YCPH 4R8TB 1F5RA 2BVSH 2QIQA 3MH4A 5T6DA 1O33A 4I8GA 1MTNC 2PTNA 1AUTC 1O2UA 1TPOA 3QUMP 9LPRA 1IOEA 2IPHA 2UUYA 1AE8H 4WJG2 4I8JA 1PJPA 3TK6A 4K2YA 1FI8A 4X1SU 2PTCE 1OWKA 1DY8A 4SGBE 4O9VA 1LQEA 3F6UH 1JBUH 1O2XA 1O36A 1GCTB 2ZFQH 3M7UA 4BAQB 5B6OA 1K1OA 1QL7A 1O2RA 1RS0A 2LNCA 1QHRB 2A2QH 3MO3A 2EA3A 5FAHA 1AKSB 1LPGB 1A46H 2ZCKP 4JCNA 3RC6A 1TX6A 1AU8A 1C1TA 1DS2E 4AX9H 5AFYH 3URDA 1PPBH 3TGKE 3E0NB 3F68H 2Y7XA 5K7RA 2GZ8A 5I46H 5BPEA 8KME2 1YPHE 1ZGIA 2BLOA 1OWHA 1ZTLA 1RIWC 1TNHA 2BD2A 1SQOA 1IAUA 2RA3A 4AB8A 4OS6A 2PWXA 4X1PU 1C5ZB 4KELA 1HPGA 4NA8A 1QURH 1TX8A 2W26A 1HAZB 3D62A 3E91A 4DIHH 1E36B 1ELBA 5A8XA 2K1QA 2V0BA 4MG3A 3E1XB 4XSKU 3RLWH 3HGNA 8GCHF 1O5BB 2ZPQA 1CE5A 1V2RT 5EW2H 2QF3A 4ABEA 1UK2A 4Y7BA 4Y0ZE 1RD3B 3RDZA 1YC0A 1G2MA 5E0JA 1N6YA 3VPKA 4ABGA 1O2WA 1C5RA 1WU1A 3T26A 3SJ9A 2P94A 1GGDC 2J9NA 4UFDH 4AZ2B 1C4V2 3A83A 1BHXB 3UTUH 2TRMA 1PQ5A 3UUZA 5DG6A 2PHBA 2SGAA 4J1YA 1T32A 2BDCA 2ZGCA 3MO9A 2ZG0H 4K60A 1O3NA 1FONA 1Z8JB 4IW4E 1HLTH 1XX9A 2A32A 4DW2U 2O8LA 3GY4A 2W3IA 2JETC 1UVUH 1NFXA 3BTKE 1UTLM 1UTJA 2XRCA 4FXGH 4ESTE 1GHWH 1K28D 1VCPA 1CBWB 1Z6JH 1XVOA 1GMHF 1EPTC 1TQ0B 5CE1A 2A4GA 3SUDA 2AGEX 1C1NA 2KAIB 3V12A 2PKAA 4RI0A 3RXGA 1GI7B 5EQSA 1HBTH 2ILNA 4A5TS 2OQ5A 3KNXA 6CHAC 1CSOE 1C5QA 5AFZH 3U98H 5FCRA 1UMAH 1CQQA 3RMLH 3R3GB 1XMNB 3D65E 3U8TH 1P12E 2G4TA 3SO3A 2QYIA 2G4UA 1YBWA 2WUCA 2OUAA 4WMFA 1GJBB 1ORFA 3HGPA 2VU8E 4U01A 1G3DA 3CS0A 1MH0A 2GZ7A 1F7ZA 1OWIA 2A7CA 3SU2A 2Y81A 4AORA 1ZR0A 3FZDA 1K21H 1O3MA 3RMOH 5C2ZA 3BG4B 2WV9A 1O3IA 2F83A 4AGJA 1A5HA 4HZHA 1EPTA 1NTPA 2GMTB 2C8ZB 4B6EA 1TGNA 1BA8B 1DDJA 3OX7U 1MKXH 1UTNA 2H9EH 2OTVA 3Q3KA 3RXJA 2HPQH 4KGAA 5I25A 1TGSZ 2WV4A 3ATKA 2V3OH 1L1JA 2THFB 3UIRA 1TBQH 4DG4A 1GDUA 3VGCB 3K65B 1BJVA 1WUNH 4ABIA 3SNEA 1TGCA 1IHTH 1OOKB 2P93A 3BV9B 5CHAC 4DOQA 3U8OH 3SUEA 2FMJA 4D9RA 2IOTA 3ITIA 2BZAA 1QIXB 1SGQE 1ZSLA 2VGCB 4BANB 1TABE 3LGTA 1DE7H 2ZPSA 4LXBH 1QRZA 2OLGA 1C2GA 4IMZA 2BY6X 3MNCA 3GY8A 3MYWA 5DPAA 1LCYA 1E37B 2BOHB 2FOAA 1NO9H 1RGQA 3SW2B 1MZAA 3GY7A 1GBHA 4IN2A 1SOTA 2ZGHA 4UFFH 3V3MA 2VINA 1GHAF 4MTBA 3UWIA 4H6SB 2F91A 2FOBA 3QGNB 2ANMH 1Y3YA 4YOJA 2WPMS 1O30A 2A1DB 1C5WB 1SLVB 1EZUC 1PPCE 2CMYA 1KLIH 4UFEH 3UNSA 4YLQH 4B2CA 1W7GH 2ZQ2A 2ZGBH 4B74A 2F9PA 2FX4A 1SGRE 3ZVGA 1W2KH 1WQVH 1GJDB 4X0WU 1GG6C 4INLA 3SJOA 1V2UT 2ESTE 2FOCA 4IMQA 1P04A 2DUCA 1IHSH 1XUFA 1FNIA 5L2ZH 3PMHB 4FUIA 3PYHA 4TPYA 2BHGA 1K2I1 1MBQA 3QZQA 1AD8H 4BNRA 1O3FA 1V2KT 4MPXA 5C67A 1BMNH 2AMQA 3LJOA 3P70B 3BTWE 1G3CA 2WINI 2VVUA 1D3TB 1P02A 3Q3YA 2OK5A 1O5DH 1MU8B 2H6MA 4ISHH 1O2LA 2D2DA 5JBCS 1JXPA 1N6XA 5EXLA 4MDSA 4AFQA 2QXJA 1C2EA 1HV7A 3BN9A 3PM3A 1GL1A 1TLDA 2ZU2A 3CENA 1HJAB 3MOCA 4ISIH 4FVDA 4AG1A 1ZPCA 1CGIE 2WZQA 1DPOA 3EA8A 3BEIB 1UVTH 1GJ5H 1SI5H 3SU6A 1P2KA 3M5LA 3ESTA 4K1TA 1A7SA 2XBXA 2BVXH 4JMYA 2Z9JA 3F9HA 1UTKA 3KHVA 2NU0E 2SNVA 1TPPA 3VB7A 2VBCA 3PO1B 1LTOA 3EGKH 3LH1A 4Y79A 3MNBA 1AB9C 4K1EA 4F4OC 4CH8B 4JZDH 1VCQA 1THPB 3JZ1B 1TRNA 1HRTH 2RDLA 5FBEA 1TONA 3ZZAA 4ABBA 3ZZCA 3GCOA 4YTAA 3AAVA 2Q6DA 4Y76A 3M5NA 1PYTC 2V6NA 1SLXB 3TH2H 2J4IA 2A5KA 1ZGVA 3O8CA 2Y5FA 4NIYA 3SU0A 3PV5A 1KYNA 3ZV9A 4SGAE 1FY8E 4AN7A 3TNSA 2PV9B 2ZPRA 5EQRA 5GNDA 3TVJB 3RU4E 1C1SA 1THRH 2XWAA 1GI6A 3MU5A 2C8XB 1Y5UT 2BLQA 1EJAA 4NFFA 1SVPA 2QC2A 3GCHC 3BTHE 4YOIA 1NPMA 1UHBB 1O2QA 2FOHA 2VIOA 1SLWB 1T4VH 2W7UA 5DP4A 1UTMA 1CA0C 1V2PT 1V2QT 3L6PA 1GBCA 5A0CA 2J94A 2G55A 2BB4A 3SJ8A 1AKSA 4B6FA 3LPRA 5L30H 1C1MA 1S83A 1LHDH 1E35B 3QO6A 1TOMH 1GVLA 5T6GA 2BD8A 3EA9A 1O3HA 1SHHB 1GI1A 3FFGA 3DHKH 1YYY1 1MTWA 5FHTA 1KLJH 1GGDB 1HAHH 1VZQH 3NWUA 4FUDA 5EXMA 4CREA 3U1IB 2BD4A 2P3UB 3ZZDA 2QN5T 4MPWA 1HIAB 1O35A 4Q80A 2YOLA 2PKSC 1AHTH 1BMLA 4B76A 4X8VH 3GDVA 1P2NA 1ACBE 3UOUA 1K1IA 2ZP0H 3C1KA 2WYGA 4CRAA 1SPJA 3SN8A 4YT6H 3VB5A 2BD5A 3A88A 2CF9H 1YPHC 1ZYOA 2ZDAH 2ZDMA 3T28A 2J34A 3ZYDA 1KDQB 3A87A 2BY5X 1TYNA 1ZJDA 1KTSB 3RXUA 1OS8A 2BLVA 4U30A 3ZV8A 1P2OA 3M36A 2NU4E 4NFEA 4Y11E 2HWLB 1KXEA 2BXUH 2G81E 2GDEH 1A2CH 1A4WH 5LGOA 5EPYA 4O97A 1HYLA 2H5DA 1Z8IB 2ZU3A 4X1NU 1YPJH 1ABJH 1QQUA 1KXCA 3FAOA 1F92A 2Q1JA 7ESTE 1UCYH 5JB8S 1A1RA 1U6QA 1KLTA 2GCHG 4CBNA 3KGPA 2Y80A 3U8RH 2BYAX 1LVYA 2FI4E 1LO6A 2VWNA 2OC1A 3OU0A 2H2ZA 1BTXA 1XM1A 4DT7B 4THNH 1F0RA 1FY3A 1ELFA 3ODDA 1P3CA 1TE0A 1GHVH 2HOBA 1ZTKA 4K1SA 1B5GH 1WCZA 5H4IB 1NFUA 3O8DA 3VEQB 1V2JT 3LOXA 2ZF0H 4ZHLU 2TGTA 1GI8B 2QY0B 2WV5A 3ZZ4A 1BRBE 1DITH 4TYDA 1V2OT 4DVAU 2AGGX 4FU8A 3DA9B 3MHWU 2ASUB 3MO6A 4BTTB 1BMMH 4D9QA 2XYAA 1KXBA 1ESBA 2RCEA 3MU4A 3OY5U 1AFQC 3RXEA 1IQFA 1XUJA 1DM4B 1TMTH 1C5UA 1WQSA 1MU6B 3SNCA 1C5TA 3MU8A 1O37A 1DUAA 1AIXH 1P03A 4GUXA 2D8WA 3Q76A 4I8KA 1NU9A 1O5AB 2ZCLP 5LPRA 1C5VA 4JZ1A 3VXFH 1YPLH 5FPTA 3LONA 5F03A 3N7OA 1GI9B 2FM2A 2ZDVH 2ZFFH 2VVVA 4KTCA 1TNKA 3SQHE 3UQOA 3AW1A 3ZZ3A 1GBJA 1UVOA 3HPTB 2FLBH 3D23A 2ZI2H 1ELVA 1EZQA 5DP9A 4AFZA 2Z94A 3SGAE 4XBCA 1BZXE 1OPHB 2C93B 5BRRE 3FP8E 2A5AA 4XOJA 1D6RA 1A0HB 1ELDE 3A8BA 8LPRA 1GI0A 1D4PB 3BG8A 1X7AC 3KL6A 4CHAC 4ABDA 4ISNA 5LPEA 3K2UA 1VJAU 1S0RA 1FV9A 1P09A 3ODFA 3UPEA 2XCFA 5TCCA 3RLYH 1GMCG 2C8YB 4B1TA 1SR5C 2G00A 3A80A 1DT2A 2QGRA 1ZMNA 1AUJA 1UVPA 1OKXA 4NZQA 1ANEA 3H7TA 1S81A 2CHAB 5LPFA 3RXMA 1BBRK 1O2GH 1XXDA 2ZDLA 1C4Y2 1HUTH 1P9UA 2AIQA 4LOYH 1O3LA 5J4SA 1ELGA 2HRVA 2BD9A 4I8LA 5GCHG 3BEFB 5ETXA 3A86A 1O2PA 1BRAA 1GI2A 1UO6A 1CT4E 1WXRA 2Z3CA 1VR1H 5AVDA 1K1PA 2ZU1A 4ZUHA 1W8BH 4XFQA 4GAWA 2PLXA 4BAOB 1V2VT 1ETSH 1EX3A 5TJXA 1SFIA 1GWAA 3BIVH 1LQDB 4UFGH 3UY9A 1Q31A 2TPIZ 5DK1A 3TGIE 3QWCH 1V2TT 2B7DH 5DP5A 1MCTA 2G52A 4Z6AH 1Z71A 5K0HA 3BTEE 2F9NA 2BD7A 4RSPA 4RN6A 3M3SA 1L2EA 1W3CA 2W5EA 3QX5H 2ALPA 3EE0B 3OTJE 1GHBG 1W0ZU 9ESTA 2HNTE 1Y3VA 1C9PA 1GJAB 2FS9A 2C90B 1LDTT 4BAHB 2J92A 1O2MA 1LPZB 1C9TA 4GHTA 2ZFTA 4H6TA 2CN0H 3A7WA 3A8DA 1YPGH 1MKWH 1NROH 1GI5A 1KY9A 3LDXH 2Z7FE 5DO4H 1E34B 1BRUP 3S69A 2GZ9A 5FPYA 1FN6A 3SU4A 1O2VA 4DJZB 1QR3E 5HYOA 3SV9A 1H9LB 2J95A 1P3EA 4XDEA 1TMUH 1Y3WA 3KCGH 1O3OA 3FZZA 2H9TH 3LJJA 4FUJA 1FY4A 2EEKA 3GY6A 2M5TA 3S7KB 1J16A 1MTSA 1CO7E 4DGJA 2P3TB 3ZVBA 4BAKB 3TH3H 1L4DA 1ESAA 2NU3E 3S9BA 4WH6A 5L6NH 3ELAH 3VB4A 1IQGA 1UVSH 1S6HA 2GT7A 4OS1A 4IGDA 2BDYA 2AEIH 3T25A 4Q7YA 1YCPM 2HLCA 2SGPE 2GCTC 3LU9B 1YF4A 2DE9A 2Q6FA 3PLBA 5EOKA 1SOZA 2A31A 4NA7A 1DICA 1MQ5A 5TCAA 4JZIA 1C1WH 1SQAA 3SBKA 5B6LA 1UHBA 2UWOA 3PB1E 2ANYA 4FUBA 2STBE 3ATIA 3DFLA 3SV6A 1HAVA 1TRMA 2FLRH 1K1JA 1HNEE 3LH3A 4GCHG 4Q2KA 4X6OA 5FPSA 1PQ7A 3BTME 1PPZA 2A4QA 2Z9LA 1SFQB 4HI3A 3RU4D 4K5ZA 1D9IA 5AF9H 1D6WA 3SHAH 5JDUB 4WXIA 3SUGA 4HTCH 1NN6A 3GY2A 5AHGH 1VJ9U 3A8CA 2A7HA 2BMGB 3SZEA 2JH5D 3EAJA 3MMGA 5EW1H 1Y3UA 2AGIX 4VGCB 4AG2A 1O2JA 2XBWA 5IYTA 2A4RA 1BTZA 1ZZZA 4TWWA 1UCYE 1P06A 2SGDE 4ZHAA 2FX6A 4OS5A 3S0NA 3Q3XA 4E05H 1C2LA 2ZGXH 2ZNKH 4D7GA 3LIWA 1JOUB 1TGTA 3UFAA 1P11E 5E2PA 2VH6A 1HAOH 3Q00A 4Y8XA 3RXAA 3GISB 3SJIA 2BTCE 1M9UA 2ODYB 2R9PA 1HB0B 1O39A 1ELTA 4WMDA 1EAXA 1QA7A 2RA0A 4NZLA 4BAMB 1DXWA 1H4WA 4BXSA 1VGCC 5SGAE 2G5VA 2ZA5A 1Z7KA 1QA0A 1QRXA 2GP9B 5CMXH 2UWLA 1CT2E 1TPSA 4X6NA 1FJSA 2BZ6H 1WAYB 2QF0A 1FXYA 2XBVA 4WXVA 2Q6GA 5EG4A 2ZU5A 1H9HE 1MMJN 1O2NA 1GBKA 3PV4A 4YOGA 2YNAA 2FTLE 1C5NH 2GCHF 2RG3A 3RXIA 1GBBA 2BXTH 2OQUA 5JYIA 2FEQH 1QCPA 1F0SA 2W3KA 5FCKA 1SGPE 1C5LH 3U1JB 1W14U 2FI5E 3AASA 1OSSA 1N8OB 1HGTH 1RRKA 4YLUA 3UWJH 4HGCA 4YZUA 5IDKA 3SGBE 5C1YA 1BRCE 1XUHA 1QTFA 3LGWA 1BQYA 2PSXA 1HFDA 3MI4A 1SLUB 2R3YA 1GBMA 2BDHA 3KQCA 5JB9S 1C2HA 4O03A 3MWIU 4MNWA 3QLPH 1XVMA 2V3HH 1EB1H 4CRBA 1TA2A 3RXBA 3WY8A 1W10U 3MH5A 1KXAA 4AYVB 1IQJA 3GCNA 3NK8A 2Z9IA 1ZSKA 1B7XB 2P8OB 1ID5H 1EAIA 2BOKA 4X8UH 3KIDU 1GJ9B 3V13A 4I33A 2ALVA 4ZMAH 1ZHMA 1MZDA 2GDDA 4YESB 4MQAA 1TOCB 1O3JA 4CHAB 3M5OA 3ZZ8A 4E06H 2OC0A 5GWZA 1YGCH 2PSYA 5F8ZA 1ETTH 3P6ZB 2ZIQH 1Z1IA 3ATLA 1N1LA 1G30B 3TH4H 1TQ7B 2PUQH 5C3NA 2OINA 2XCNA 1FDPA 5HM2A 4ZHMU 4D8NA 2AIPA 3AW0A 1JRSA 5EGMA 1SGFG 1TB6H 1O5EH 4GVUA 2UWPA 5A8ZA 4AFUA 1TBZH 4AGKA 1GMCF 1L1NA 4F49A 4A1VA 3IITA 3ZVDA 4AYYB 1IQEA 2HALA 2O8WA 1V2ST 1Z8RA 3RUOA 1AE5A 3GY3A 3RC4A 1NRRH 1BOQA 1BMAA 1OP0A 2A2XH 2F9UA 1SSXA 2HVXA 1MTNB 4X2WA 4IS5A 1GCTC 1TGBA 2P16A 1NM6A 3SZNA 2Z3EA 1A61H 2PFEA 1FQ3A 1Y5AT 1O2OA 1O3CA 3H5CB 5DJ7A 1LVMA 3B23B 1A3BH 1O5GH 4MLFB 1PYTD 2O8UA 4ZAEA 2Y5GA 3F9FA 5GCHF 1FMGA 1RTLA 3ZZ5A 2Y5HA 4NWKA 1EOJA 5E2OA 2AMDA 4LK4A 3PLPA 5C20A 2FZZA 3I29A 1TBRH 1TAWA 1O0DH 3Q77A 5A2MH 1YLCA 1RIWB 4Q7ZA 4ZXYH 2LPRA 1AY6H 1EJNA 4IC6A 3RM0H 1AWHB 2XC4A 1YCPK 1YP9A 4YT7H 2ANKH 2PR3A 3E16B 3RXCA 1VITG 1BUIA 2CF8H 2C3SA 4X2VA 1JMOH 4FUCA 1O3GA 3FANA 3GCTG 3RMNH 2F9OA 1GHBF 1GCDA 2JH0D 2PKAB 2VB0A 2VIDA 4TY7A 3TJUA 1VITH 3RXVA 1AWFH 2D1JA 4INKA 3LGUA 1SGDE 4RKOB 5FX6A 4U32A 1E0FD 2ZHDA 1FPCH 1V3XA 2VIVA 4GSOA 2C8WB 3TPIZ 4AB9A 3H09A 1C2MA 3CP7A 3LGIA 2A45B 5EU8A 1LKAA 1W13U 2XNIA 3K9XB 2A5IA 1GBAA 1WSSH 1CBWC 3NZIA 1QGFA 4JZEH 3MU0A 1TX7A 2F9VA 1C5OH 1KTTB 2V35A 1A0LA 2XXLA 3SV8A 2JETB 1CGJE 1EXFA 1K1MA 2UUJB 3E0PB 3RXTA 6GCHG 2PGBB 1EPTB 1JIRA 2R2WU 2SFAA 3F9GA 3MNXA 3QZRA 1CT0E 2HNTC 7LPRA 4I7YH 4OS2A 1GBIA 3R0FA 2STAE 4Y6DA 3STIA 1Y5BT 6CHAB 1QNJA 2BDGA 1P05A 1NC6A 1SGFA 1XXFA 1FUJA 1BTPA 1WOFA 1Z8GA 2BLWA 2FPZA 3BTTE 4OS7A 1BTHH 4CH2B 1AQ7A 1GBFA 4XBDA 1OP8A 1PPFE 5PTPA 3M35A 1DWCH 4TWYA 1S6FA 2ZQ1A 3SJKA 5A0AE 2IN2A 3BG4C 3TK5A 4LZ1H 3I77A 3AK5A 4CRDA 3F1SB 2CJIA 4INHA 3SV7A 1CGHA 3GYLB 1NRQH 3QK1A 1UTOA 2GMTC 4GCHF 1O2ZA 2OCVB 2KAIA 2FOMB 3UNRA 1S85A 2GV6A 1T8LA 2AERH 2BD3A 1A0JA 1F0UA 1ANCA 2GTBA 4JYUH 3RC5A 4MPVA 1O5CB 3GOVB 4ZKNU 1CHGA 1DLEA 1LMWB 2PUXB 3P95A 2Z3DA 1Y8TA 1YM0A 2AYWA 3RXHA 3VGCC 1AVWA 4M9FA 2FS8A 3EDXB 4OM9A 5DP6A 2ZGJA 5EXNA 1HAXB 1EAUA 1SB1H 1MCVA 3TGJE 4IN1A 3T27A 2VGCC 1GMDG 3SGQE 3JZ2B 1O38A 2AMPA 5CHAB 1GJCB 4JK6A 1AMHA 4ZXXH 3V7TA 1NFYA 5HM9A 1BITA 3UOPA 1IQNA 2H5CA 2BDBA 1ZPBA 1CHOG 2IJOB 5E0HA 3IWMA 2GGVB 2O8MA 3TITA 1RFNA 3URCA 2QA9E 2P59A 3HK6B 1ZJKA 2VH0A 3MNSA 3RXFA 1P2QA 1FAKH 2TBSA 4I32A 1ELAA 1MTVA 2VIWA 4WVPE 2FDAA 1XUKA 1MKXK 2BDIA 3O8RA 3BEUA 3TLOA 2R0KA 2OC8A 2A4OA 1S82A 4YM9A 1C2KA 1QJ7B 4NSYA 3SI4H 1TALA 2OBOA 1O2HA 2R0LA 4CR5A 3RXOA 4R0IA 1OWDA 1GG6B 1LHEH 1XKBC 5LH8A 1FLEE 3DT0H 2BQ6B 1EZXC 1P57B 2ZFRH 4MVNA 4OGYA 2FOEA 5F8XA 3NXPA 3LGVA 1SGCA 3PTBA 5FXLA 3AVZA 1KXFA 2FYRA 4K69A 1DY9A 1A5GH 4X2YA 5T3HA 3RXDA 1TPAE 1TNJA 1ZHPA 5FBIA 4NIVA 1SGYE 2FODA 1AGJA 1ELEE 1HJAC 4FVBA 1GI4A 1F0TA 2ZU4A 6LPRA 3KF2A 1BB0B 2G51A 2P3FH 2Z9GA 1EZSC 2ODPA 4ASHA 3W94A 2NU2E 4X8TH 1GJ8B 1HCGA 2F4LA 1Y59T 2EI8A 1P10A 4Y7AA 2SNWA 3K6ZA 4UEHH 5C1UA 1T4UH 3L3TA 2ODQA 1WTHD 4WWYA 2TGDA 1TIOA 1ETRH 1GL0E 3A82A 3PO1C 1FIZA 3SQEE 1BTYA 1INCA 1P9SA 2ZTZA 3SOSA 1BHXF 1QB1A 4PROA 2QAAA 3TJOA 2XBYA 4Y10E 2AFQB 1NU7B 1T31A 1A3EH 3ZVFA 1O3KA 1T7CA 2D26C 3DFJA 1G3BA 1UJ1A 5HMAA 1AB9B 1AZ8A 2G5NA 1BT7A 4JYTA 3E8LA 5GDSH 3QGJA 1ZRKA 1WTGH 1TNIA 2ZWLH 3A81A 2WPLS 4GPGA 2GV7A 1ZRBA 4ISLA 3BF6H 5JPMH 1QL8A 4DURA 1QJ1B 1T8NA 1D3DB 1RTKA 2Y6TA 2A7JA 2SGQE 1BCUH 1DUEA 1QBNA 1Q2WA 2VWOA 5L2YH 1C2JA 1AZZA 1DWBH 4A92A 1QQ4A 3T29A 3GDSA 1WV7H 1PPGE 2GT8A 2WUBA 3M37A 4NIWA 3C27B 3DD2H 1TNGA 3RXKA 5DP7A 3SU1A 3B9FH 2EI6A 4BTIB 2HNTF 3IG6B 2FI3E 3GCHB 3U69H 1ZOMA 2TGPZ 3A7TA 1ZMJA 2YNBA 1GHYH 2VNTA 1K1LA 1TRYA 3E6PH 1CA0B 3SU3A 2ZECA 4AOQA 1J8AA 4Z0KA 2Z9KA 2AH4X 1G2LA 4H4FA 3KEEA 1V6DA 1UK4A 3A7YA 3AAUA 1DX5M 1EB2A 4X1QU 5ABWA 5A0BA 3QDZB 2UUKB 1O34A 1C1RA 1VITF 3GY5A 1Y3XA 2ZFSA 3P8FA 4NWLA 2BX4A 4IBLH 3GCTF 3DUXH 2OBQA 2WPKS 1O31A 5J4QA 1SGTA 2GX4A 3SV2H 2AS9A 2EI7A 1LHCH 2G8TA 2Y82A 1V2LT 3RXSA 2DE8A 5G4BA 1DVAH 1LVBA 2PKSB 4K3JA 3ZYEA 1NESE 3G01A 5GIBA 1V2WT 3BTGE 1QJ6B 7GCHG 4OS4A 1C1UH 2FWWA 2VWLA 2ZO3H 4NGAH 1SGIB 1C2FA 3HKJB 2B8OH 3SNBA 4Y0YE 5JBTA 3EA7A 2WPJS 3V0XA 2XTTB 4H42U 1O5FH 2BY9X 3PMJA 3PWCA 1L4ZA 3PROA 3P8OA 3PWBA 1DXPA 2QXGA 5ESTE 2F3CE 3LKWA 1SQTA 2VJ1A 1O2IA 4CRCA 4CR9A 6GCHF 1AVXA 1T8MA 2F9BH 1HXFH 1TA6A 1SG8B 1HIAA 1W11U 2CGAA 8ESTE 2SGFE 4ZH8A 4DCDA 3M3VA 4NG9H 1NY22 1P01A 1GDNA 3OYPA 1LVOA 4Q7XA 5DP8A 3RM2H 1P2IA 1EASA 3NKKA 2W7SA 3M3TA 1AFEH 2ZC9H 4QT8C 1QBVH 2XC0A 3S9CA 1F2SE 1UTPA 3E3TA 3LGYA 1C5PA 7KMEH 4JZFH 5DKMA 3S9AA 1P2JA 1KDQA 3A7XA 5EODA 3ZZ9A 3HKIB 4Y71A 4B73A 3SNDA 3TJNA 4DIIH 4B2AA 5T1VA 1HAPH 3HATH 3K6YA 3L33A 4NA9H 1GVKB 2TIOA 4WH8A 1GBDA 1JIMA 3ATMA 2JKHA 3M7QA 2FP7B 1O3PB 4CRGA 4ABAA 4B71A 3TJVA 4I8HA 4X1RU 1MQ6A 2HPPH 1NT1A 3LT3A 3MTYA 4KTSA 1K22H 1OX1A 3RU4T 4A6LA 3RXRA 3O8BA 3A7VA 2CXVA 1ZTJA 2Z6BD 4K8YA 1AO5A 5GXPA 2B5TB 1LKBA 4D7FA 3ZZ7A 1C1VH 3QTVH 1PPHE 3PLKA 1EP6A 1EQ9A 1PQAA 1P0SH 3SI3H 1BBRH 1W7XH 2QV1A 5C1XA 3NPSA 1HAGE 1AFQB 1O3EA 1K1NA 1ELCA 3P17H 3OTPA 1UCYK 3M61U 4J2YB 3ZZBA 3TK9A 5T6FA 1NFWA 4E7NA 4FU7A 5ESBA 1GMDF 1THSH 3FVFB 1W12U 1UK3A 5HXFA 1PFXC 1DSTA 2XC5A 2BY7X 2CV3A 1H8IH 4ISOA 4Y8YA 1S5SA 1KSNA 1QFKH 4FUEA 1ARCA 1EP5A 1CHOF 1Q3XA 3MFJA 1LHGH 4BXWA 1FY1A 3ENSB 1DANH 3D49H 1QL9A 3BSQA 3FP7E 3TIUA 4O3TA 1OP2A 2PGQB 2ZTYA 1GHZA 3TU7H 1YPKH 2H9HA 2JH6D 3ZZ6A 2ZTXA 2UUFB 1L0ZA 4MNVA 4ZKOU 1ESTA 1DWEH 1PQ8A 1B0EA 1EUFA 2SGEE 3P8NA 2CHAC 2BDAA 1K9OE 1BJUA 2FTMA 2A0QB 1ANBA 1C4U2 1O2YA 5C5NA 3A8AA 3ATWA 2PW8H 1EKBB 1L1GA 3BTFE 5JBAS 2VIQA 1C2IA 3SYJA 1H1BA 3T62A 1ZLRA 1HAYB 3M5MA 2VVCA 2GVFA 3RXPA 3OY6U 1J14A 1DFPA 2WHXA 5E0GA 2BVRH 4NIXA 1B0FA 1OXGA 1QRWA 3EQ0H 5EQQA 3A85A 4X2XA 1IQKA 1C5MD 1ANDA 2I6QA 1IQLA 2ZCHP 5E8EH 1G9IE 5HGGA 1HJ9A 3KN2A 1DSUA 4MNYA 3E90B 1GBEA 2FESH 3SORA 1TMBH 3BTDE 2O8TA 3GDUA 1RJXB 4KTUA 4MPUA 2WPHS 3UNQA 4WF8A 3PMBB 3CS7A 4BTUB 2ZEBA 5JBBS 1EAWA 2R2MB 8GCHG 3UR9A 2ZFPH 4TPIZ 1O2SA 1J17T 1RTFB 3P8GA 2I6SA 1ZSJA 3F9EA 4ZKRU 3UREA 1QY6A 3A89A 3BIUH 2WPIS 2BQ7B 3NUMA 3RXQA 1NS3A 5EPNA 1IQHA 3UR6A 3A7ZA 1BDAA 1YLDA 2P95A 3FP6E 3LC5A 1HDTH 1QB9A 1SGNE 3SHCH 2ZKSA 1O2TA 3RP2A 3U9AH 3I78A 1YPEH 4FUHA 1IQMA 1FAXA 1C1PA 1S84A 4HFPB 1GI3A 4YO9A 1E38B 4ABHA 2BQWB 3LC3A 1UTQA 1MAYA 1GMHG 1HAVB 1GBTA 4UE7H 4U2WA 1VCWA 1O32A 4CBOA 2R3UA 4CRFA 1MD8A 1HXEH 3TNTA 3NCLA 1KIGH 3VFEA 1BTUA 4WMEA 1NZQH 2XWBI 1W0YH 3PMAB 4D76A 1P2MA 1C1QA 2QCYA 2VWMA 4X6MA 1Z6EA 3SU5A 5F6MA 1C5XB 1D3PB 3P92A 3SUFA 1FZZA 4X6PA 4ABFA 1GPZA 4UD9H 4FU9A 4TY6A 2GCTB 2FXRA 1OYQA 1MKWK 1OYTH 2Y7ZA 1IQIA 4ZKSU 2J38A 6ESTA 1PPEE 3PV2A 3MH6A 1C5YB 1G3EA 5F8TA 4XE4A 3T2NA 5DP3A 3SNAA 1V2MT 1YPMH 1EJMA 1LPKB 5A09A 4DY7B 3W95A 1O3DA 4K8BA 5C5OA 3VB3A 2B0FA 3QTOH 4Y8ZA 1MUEB 2O9QA 4VGCC 3PTNA 4ZROA 1MD7A 4E7RG 5GJ4B 1AN1E 1A5IA 1DWDH 4UONA 1F5LA 4B75A 3S7HB 1F5KU 2ANWA 1JWTA 4XBBA 2WYJA 2OD3B 4FUGA 7GCHF 1DOJA 2HGTH 2BX3A 2OXSA 4A1XA 1QB6A 1G32B 1GBLA 4KP0A 1C1OA 1EATA 3KQEA 4AFSA 2OP9A 1BIOA 1GHXH 1H9IE 3M7TA 2FOFA 4IC5A 1SL3A 3VB6A 5GPIB 1O2KA 1ABIH 5A8YA 2XW9A 1ARBA 2C4FH 1HJ8A 1J15A 1HAIH 1GDQA 4NCYA 1VGCB 1XKAC 1WYKA 1MTUA 1GHAG 3H7OA 3OSYA 1CVWH 1BTWA 1FIWA 1C2DA 1ZPZA 1NRNH 1SMFE 4FUFA 4A7IB 3B8JA 2FIRH 4WY3A 4BOHA 1RXPA 2B9LA 1AI8H 1ZMLA 3ZVCA 1O3BA 1OWJA 2QXIA 1BBRE 3RMMH 1AVGH 2OC7A 1TFXA 4GLYA 4KKDA 2TGAA 1N8OC 1NRSH 1CA8B 1SBWA 1OWEA 3MH7A 2VIPA 1CU1A 3A84A 4UDWH 3ZVAA 1SGEE 2J2UA 1KXDA 1S0QA 3ZVEA 1TWXB 4X8SH 2ZHFH 4LZ4B 1MBMA 1NRPH 4MNXA 1C5SA 1FY5A 2NU1E 1MAXA 2P8OC 2IJD1 3EYDA 3VXEH 3RXLA 2NWNA 3KQBA 1XUGA 1TNLA 4A1TA 1QBOA 1SC8U 4I31A 4M7GA 1V2NT 1O3AA 2ZHWH 1G36A 1P8VC 3HK3B 1Z1JA 3GYMA 1XUIA 4JK5A 1G37A 2BY8X 2FYQA 3KQDA 5FX5A 2ZDNA 2GKVE 3UQVA 1SHYA 1D3QB 2H1UA 1YKTA 1JRTA 2ZHEH 3QN7A 1H8DH 1LHFH 2BM2A 3T5FH 2QXHA 3BTQE 4GHQA 1DLKB 2ULLA 1WBGB 1GJ6A 3GICB 4NSVA 5DGJA 1GJ7B 2FOGA 4RKJB 1EOLA 4O3UA 4ABJA
chains in the Genus database with same CATH superfamily
1J9CH 2ZDKA 3MU1A 4OGXA 4B2BA 1FPHH 3STJA 1FN8A 2ZHQH 2ZZUH 1GJ4H 2GD4B 4JYVH 1ZHRA 1GVZA 2FO9A 2EC9H 1T8OA 1YCPH 4R8TB 1F5RA 2BVSH 2QIQA 3MH4A 5T6DA 1O33A 4I8GA 1MTNC 2PTNA 1AUTC 1O2UA 1TPOA 3QUMP 9LPRA 1IOEA 2IPHA 2UUYA 1AE8H 4WJG2 4I8JA 1PJPA 3TK6A 4K2YA 1FI8A 4X1SU 2PTCE 1OWKA 1DY8A 4SGBE 4O9VA 1LQEA 3F6UH 1JBUH 1O2XA 1O36A 1GCTB 2ZFQH 3M7UA 4BAQB 5B6OA 1K1OA 1QL7A 1O2RA 1RS0A 2LNCA 1QHRB 2A2QH 3MO3A 2EA3A 5FAHA 1AKSB 1LPGB 1A46H 2ZCKP 4JCNA 3RC6A 1TX6A 1AU8A 1C1TA 1DS2E 3F0PA 5AFYH 3URDA 4AX9H 3WWFA 1PPBH 3TGKE 3E0NB 3F68H 2Y7XA 5K7RA 2GZ8A 5I46H 5BPEA 8KME2 1YPHE 1ZGIA 2BLOA 1OWHA 1ZTLA 1RIWC 1TNHA 2L74A 4P00A 2BD2A 3FN8A 1SQOA 1IAUA 2RA3A 4AB8A 4OS6A 2PWXA 2W6JD 4X1PU 1C5ZB 4KELA 1HPGA 4NA8A 1QURH 1TX8A 2W26A 1HAZB 3D62A 3E91A 4DIHH 1E36B 1ELBA 5A8XA 2K1QA 2V0BA 4MG3A 3E1XB 4XSKU 3RLWH 3HGNA 8GCHF 1O5BB 2ZPQA 1CE5A 1V2RT 5C17A 5EW2H 2QF3A 4ABEA 1UK2A 4Y7BA 4Y0ZE 1RD3B 3RDZA 1YC0A 1G2MA 5E0JA 1N6YA 3VPKA 4ABGA 1O2WA 1C5RA 1WU1A 3T26A 3SJ9A 2P94A 1GGDC 2J9NA 4UFDH 4AZ2B 1C4V2 3A83A 1BHXB 3UTUH 2TRMA 1PQ5A 2J98A 5DG6A 3UUZA 2PHBA 2SGAA 4J1YA 1T32A 2BDCA 2ZGCA 3MO9A 2ZG0H 4K60A 1O3NA 1FONA 1Z8JB 3W1EA 4IW4E 1HLTH 1XX9A 2A32A 4DW2U 2O8LA 3GY4A 2W3IA 2JETC 1UVUH 1NFXA 3BTKE 1UTLM 1UTJA 2XRCA 4FXGH 4ESTE 1GHWH 1K28D 1VCPA 4AC9A 1CBWB 1Z6JH 1XVOA 1GMHF 1EPTC 1TQ0B 5CE1A 2A4GA 3SUDA 2AGEX 1C1NA 2KAIB 3V12A 2PKAA 4RI0A 3RXGA 1GI7B 5EQSA 1HBTH 2ILNA 4A5TS 2OQ5A 3KNXA 6CHAC 1CSOE 1C5QA 5AFZH 3U98H 5FCRA 1UMAH 1CQQA 3RMLH 2QE7D 3R3GB 1XMNB 3D65E 3U8TH 1P12E 2G4TA 3SO3A 2QYIA 2G4UA 1YBWA 2WUCA 2OUAA 4WMFA 1GJBB 1ORFA 3HGPA 2VU8E 4U01A 1G3DA 3CS0A 1MH0A 2GZ7A 1F7ZA 1OWIA 2A7CA 3SU2A 2Y81A 4AORA 1ZR0A 3FZDA 1K21H 1O3MA 3RMOH 5C2ZA 3BG4B 2WV9A 1O3IA 4TSFD 3OEED 2F83A 4AGJA 1A5HA 4HZHA 1EPTA 1NTPA 2GMTB 2C8ZB 4B6EA 1TGNA 1BA8B 1DDJA 3OX7U 1MKXH 1UTNA 2H9EH 2OTVA 3Q3KA 3RXJA 2HPQH 4KGAA 5I25A 1TGSZ 2WV4A 3ATKA 2V3OH 1L1JA 2THFB 3UIRA 2QF4A 1TBQH 4DG4A 1GDUA 3VGCB 3K65B 1BJVA 1WUNH 4ABIA 3SNEA 1TGCA 1IHTH 1OOKB 2P93A 3BV9B 5CHAC 4DOQA 3U8OH 3SUEA 2FMJA 4D9RA 2IOTA 1W0JD 3ITIA 2BZAA 1QIXB 1SGQE 1ZSLA 5KGOA 2VGCB 4BANB 1TABE 3LGTA 1DE7H 2ZPSA 4LXBH 1QRZA 2OLGA 1C2GA 4IMZA 2BY6X 3MNCA 3GY8A 3MYWA 5DPAA 1LCYA 1E37B 2BOHB 2FOAA 1NO9H 1RGQA 3SW2B 1MZAA 3GY7A 1GBHA 4IN2A 1SOTA 2ZGHA 4UFFH 3V3MA 2VINA 1GHAF 4MTBA 3UWIA 4H6SB 2F91A 2FOBA 3QGNB 2ANMH 1Y3YA 4YOJA 2WPMS 1O30A 2A1DB 1C5WB 1SLVB 1EZUC 1PPCE 2CMYA 1KLIH 4UFEH 3UNSA 4YLQH 4B2CA 1W7GH 2ZQ2A 2ZGBH 4B74A 2F9PA 2FX4A 1SGRE 1W0KD 3ZVGA 1W2KH 1WQVH 1GJDB 4X0WU 1GG6C 3OE7D 4INLA 3SJOA 5EIYA 1V2UT 2ESTE 2FOCA 4IMQA 1P04A 2DUCA 1IHSH 2YMSD 1XUFA 1UW7A 3ZIAD 1FNIA 5L2ZH 3PMHB 4FUIA 3PYHA 4TPYA 2EY4C 2BHGA 1K2I1 1MBQA 3QZQA 1AD8H 4BNRA 1O3FA 1V2KT 4MPXA 5C67A 1BMNH 2AMQA 3LJOA 3P70B 3BTWE 1G3CA 2WINI 2VVUA 1D3TB 1P02A 3Q3YA 2OK5A 1O5DH 1MU8B 2H6MA 4ISHH 1O2LA 2D2DA 5JBCS 1JXPA 2KCYA 1N6XA 5EXLA 4MDSA 4AFQA 2QXJA 1C2EA 1HV7A 3BN9A 3PM3A 3F2HA 1GL1A 1TLDA 3UAIC 2ZU2A 3CENA 1HJAB 3MOCA 4ISIH 4FVDA 4AG1A 1ZPCA 1CGIE 2WZQA 1DPOA 3EA8A 3BEIB 1UVTH 1GJ5H 1SI5H 3SU6A 1P2KA 3M5LA 3ESTA 4K1TA 1A7SA 2XBXA 2BVXH 4JMYA 2Z9JA 3F9HA 1UTKA 3KHVA 2NU0E 2SNVA 1TPPA 2J5UA 3VB7A 2VBCA 3PO1B 1LTOA 3EGKH 3LH1A 4Y79A 3MNBA 1AB9C 4K1EA 4F4OC 4CH8B 4JZDH 1VCQA 1THPB 3JZ1B 1TRNA 1HRTH 2RDLA 5FBEA 1TONA 3ZZAA 4ABBA 3ZZCA 3GCOA 4YTAA 3AAVA 2Q6DA 4Y76A 3M5NA 1PYTC 2V6NA 1SLXB 3TH2H 2J4IA 2A5KA 1ZGVA 3O8CA 2Y5FA 4NIYA 3PV5A 3SU0A 1KYNA 3ZV9A 4SGAE 1FY8E 4AN7A 3TNSA 2PV9B 2ZPRA 2LELA 5EQRA 5GNDA 3TVJB 3RU4E 1C1SA 5HIYA 1THRH 2XWAA 1GI6A 3MU5A 2C8XB 1Y5UT 2BLQA 1EJAA 4NFFA 1SVPA 2QC2A 3GCHC 3BTHE 4YOIA 1NPMA 1UHBB 1O2QA 2FOHA 2VIOA 1SLWB 1T4VH 2W7UA 5DP4A 1UTMA 1CA0C 1V2PT 1V2QT 3L6PA 1GBCA 5A0CA 2J94A 2G55A 2BB4A 1WDIA 3SJ8A 1AKSA 4B6FA 3LPRA 5L30H 1C1MA 1S83A 1LHDH 1E35B 3QO6A 1TOMH 1GVLA 5T6GA 2BD8A 3EA9A 1O3HA 1SHHB 1GI1A 3FFGA 3DHKH 1YYY1 1MTWA 5FHTA 1KLJH 1GGDB 1HAHH 1VZQH 3NWUA 4FUDA 5EXMA 4CREA 3U1IB 2BD4A 2P3UB 3ZZDA 2QN5T 4MPWA 1HIAB 3F3BA 1O35A 4Q80A 2YOLA 2PKSC 1AHTH 1BMLA 4B76A 4X8VH 2HVYB 3GDVA 1P2NA 1ACBE 3WWBA 3UOUA 1K1IA 2ZP0H 3C1KA 2WYGA 4CRAA 1SPJA 3SN8A 4YT6H 3VB5A 2BD5A 3A88A 2CF9H 1YPHC 1ZYOA 2ZDAH 2ZDMA 3T28A 2J34A 3ZYDA 4ZCNA 1KDQB 3A87A 2BY5X 1NBME 1TYNA 1ZJDA 2EQNA 1KTSB 3RXUA 1OS8A 2BLVA 4U30A 3ZV8A 1P2OA 3M36A 2NU4E 4NFEA 4Y11E 2HWLB 1KXEA 2BXUH 2G81E 2GDEH 1A2CH 1A4WH 5LGOA 2KM0A 5EPYA 4O97A 1HYLA 2H5DA 1Z8IB 2ZU3A 4X1NU 1YPJH 1ABJH 1QQUA 1KXCA 3FAOA 1F92A 2Q1JA 3MQKC 7ESTE 1UCYH 5JB8S 1A1RA 1U6QA 1KLTA 3VG8A 2GCHG 4CBNA 3KGPA 2Y80A 3U8RH 2BYAX 5EJZA 1LVYA 2FI4E 1LO6A 2VWNA 2OC1A 3PRBA 3OU0A 2H2ZA 1BTXA 1XM1A 4DT7B 4THNH 1F0RA 1FY3A 1ELFA 1SQRA 3ODDA 1P3CA 1TE0A 1GHVH 2HOBA 1ZTKA 4K1SA 1B5GH 1WCZA 5H4IB 1NFUA 3O8DA 3VEQB 1V2JT 3LOXA 3U28C 2ZF0H 4ZHLU 2TGTA 1GI8B 2QY0B 2WV5A 3ZZ4A 1BRBE 1DITH 4TYDA 1V2OT 4DVAU 2AGGX 4FU8A 3DA9B 3MHWU 2ASUB 3MO6A 4BTTB 1BMMH 4D9QA 2XYAA 1KXBA 1ESBA 2RCEA 3MU4A 3OY5U 1AFQC 3RXEA 1IQFA 1XUJA 1DM4B 1TMTH 1C5UA 1WQSA 1MU6B 3SNCA 1C5TA 3MU8A 3CNRA 1O37A 1DUAA 1AIXH 1P03A 4GUXA 2D8WA 3Q76A 4I8KA 1NU9A 1O5AB 2ZCLP 5LPRA 1C5VA 4JZ1A 3VXFH 1YPLH 5FPTA 3LONA 5F03A 3N7OA 1GI9B 2FM2A 2ZDVH 2ZFFH 2VVVA 4KTCA 1TNKA 3SQHE 3UQOA 3AW1A 3ZZ3A 1GBJA 1UVOA 3HPTB 2FLBH 3D23A 2ZI2H 1ELVA 1EZQA 5DP9A 4AFZA 2Z94A 3SGAE 4XBCA 1BZXE 1OPHB 2C93B 5BRRE 3FP8E 2A5AA 4XOJA 3N99A 1D6RA 1A0HB 1ELDE 3A8BA 8LPRA 1GI0A 1D4PB 3BG8A 1X7AC 3KL6A 4CHAC 4ABDA 4ISNA 5LPEA 3K2UA 1VJAU 1S0RA 1FV9A 1P09A 3ODFA 3UPEA 2XCFA 5TCCA 3RLYH 1GMCG 2C8YB 4B1TA 1SR5C 2G00A 3A80A 1DT2A 2QGRA 4XRNA 1ZMNA 1AUJA 1UVPA 1OKXA 4NZQA 1ANEA 3H7TA 1S81A 2CHAB 5LPFA 2YMSB 3RXMA 1BBRK 1O2GH 1XXDA 2ZDLA 1C4Y2 1HUTH 2KX4A 1P9UA 2AIQA 4LOYH 1O3LA 2AHME 5J4SA 2W6ID 1ELGA 2HRVA 2BD9A 4I8LA 5GCHG 3BEFB 5ETXA 3A86A 1O2PA 1BRAA 1GI2A 1UO6A 1CT4E 1WXRA 2Z3CA 1VR1H 5AVDA 1K1PA 2ZU1A 4ZUHA 1W8BH 4XFQA 4GAWA 2PLXA 4BAOB 4ACBA 1V2VT 1ETSH 1EX3A 5TJXA 1SFIA 1GWAA 3BIVH 1LQDB 4UFGH 3UY9A 1Q31A 2TPIZ 5DK1A 3TGIE 3QWCH 1V2TT 2B7DH 3DCLA 1MCTA 2G52A 5DP5A 1Z71A 4Z6AH 5K0HA 3BTEE 4ACAA 2F9NA 2BD7A 4RSPA 4RN6A 3M3SA 1L2EA 1W3CA 2W5EA 3GS9A 4DT4A 3QX5H 2ALPA 3EE0B 3OTJE 1GHBG 1EFRD 1W0ZU 9ESTA 2HNTE 1Y3VA 1C9PA 1GJAB 2FS9A 2C90B 5KEDA 1LDTT 4BAHB 2J92A 1O2MA 1LPZB 1C9TA 4GHTA 2ZFTA 4H6TA 2CN0H 3A7WA 3A8DA 1YPGH 1MKWH 1NROH 1GI5A 1KY9A 3LDXH 2Z7FE 5DO4H 1E34B 1BRUP 3S69A 2GZ9A 5FPYA 1FN6A 3SU4A 1O2VA 4DJZB 1QR3E 5HYOA 3SV9A 1H9LB 2J95A 1P3EA 4XDEA 1TMUH 1Y3WA 3KCGH 1O3OA 1K0HA 3FZZA 2H9TH 3LJJA 1FX0B 1H8HD 1FY4A 2EEKA 4FUJA 3GY6A 2M5TA 1MABB 3S7KB 1J16A 1MTSA 1CO7E 4DGJA 2P3TB 3ZVBA 4BAKB 3TH3H 1L4DA 1ESAA 2NU3E 2XNDD 3S9BA 3DSOA 2RDEA 4WH6A 5L6NH 3ELAH 3VB4A 1IQGA 1UVSH 3PRDA 1S6HA 2GT7A 4OS1A 4IGDA 2BDYA 2AEIH 2GJGA 3T25A 4Q7YA 1YCPM 1E1QD 2HLCA 2SGPE 2GCTC 3LU9B 1YF4A 2DE9A 2Q6FA 3PLBA 5EOKA 1SOZA 2A31A 4NA7A 1DICA 1MQ5A 5TCAA 4JZIA 1C1WH 1SQAA 3SBKA 5B6LA 1UHBA 2UWOA 3PB1E 2ANYA 4FUBA 2STBE 4I86A 3ATIA 3DFLA 3SV6A 1HAVA 1TRMA 2FLRH 1K1JA 1HNEE 3LH3A 4GCHG 4Q2KA 4X6OA 5FPSA 1PQ7A 3BTME 1PPZA 2A4QA 2Z9LA 1SFQB 4HI3A 3RU4D 4K5ZA 1D9IA 5AF9H 1D6WA 3SHAH 5JDUB 4WXIA 3SUGA 4HTCH 1NN6A 3GY2A 3KYFA 5AHGH 1VJ9U 3A8CA 2A7HA 2BMGB 3SZEA 2JH5D 3EAJA 3MMGA 5EW1H 1Y3UA 2AGIX 3FO8D 4VGCB 4AG2A 1O2JA 2XBWA 5IYTA 2A4RA 1BTZA 1ZZZA 4TWWA 1UCYE 1P06A 2SGDE 4ZHAA 2FX6A 4OS5A 3S0NA 5C0TA 3Q3XA 4E05H 1C2LA 2ZGXH 2ZNKH 3KQ5A 2JJ2D 3LIWA 1JOUB 4D7GA 1TGTA 3UFAA 1P11E 5E2PA 2VH6A 1HAOH 3Q00A 4P02A 4Y8XA 3RXAA 3GISB 3SJIA 2BTCE 1M9UA 2ODYB 2R9PA 1HB0B 1O39A 1ELTA 4WMDA 1EAXA 1QA7A 2RA0A 4NZLA 4BAMB 1DXWA 1H4WA 3UB0A 4BXSA 1VGCC 5SGAE 2G5VA 2ZA5A 1Z7KA 1QA0A 1QRXA 2L6OA 2GP9B 5CMXH 2UWLA 1CT2E 1TPSA 4X6NA 1FJSA 2BZ6H 1WAYB 2QF0A 1FXYA 2XBVA 4WXVA 2Q6GA 5EG4A 2ZU5A 1H9HE 1MMJN 1O2NA 1GBKA 3PV4A 4YOGA 1VKYA 2YNAA 2FTLE 1C5NH 2GCHF 2RG3A 3RXIA 1GBBA 1KMHB 2BXTH 1QZ8A 5HKKD 2OQUA 5JYIA 2FEQH 3N7DA 1QCPA 1F0SA 2W3KA 5FCKA 1SGPE 1C5LH 3U1JB 1W14U 2FI5E 3AASA 1OSSA 1N8OB 1HGTH 1RRKA 4YLUA 3UWJH 4HGCA 4YZUA 5IDKA 3SGBE 5C1YA 1BRCE 1XUHA 1QTFA 3LGWA 1BQYA 2PSXA 1HFDA 3MI4A 1SLUB 2R3YA 1GBMA 2BDHA 3KQCA 5JB9S 1C2HA 4O03A 3MWIU 4MNWA 3QLPH 1XVMA 2V3HH 1EB1H 4CRBA 1TA2A 3RXBA 3WY8A 1W10U 3MH5A 3F0OA 1KXAA 4AYVB 1IQJA 3GCNA 3NK8A 2Z9IA 1ZSKA 1B7XB 2P8OB 1S6LA 1ID5H 1EAIA 2BOKA 4X8UH 3KIDU 1GJ9B 3V13A 4I33A 2ALVA 4ZMAH 1ZHMA 1MZDA 2CK3D 2GDDA 4YESB 4MQAA 1TOCB 1O3JA 4CHAB 3M5OA 3ZZ8A 4E06H 2OC0A 5GWZA 1YGCH 2PSYA 5F8ZA 1ETTH 3P6ZB 2ZIQH 1Z1IA 3ATLA 1N1LA 1G30B 3TH4H 1TQ7B 2PUQH 5C3NA 2OINA 2XCNA 1FDPA 5HM2A 4ZHMU 4D8NA 2AIPA 3AW0A 1JRSA 5EGMA 1SGFG 1TB6H 1O5EH 4GVUA 2UWPA 5A8ZA 4AFUA 1TBZH 4AGKA 4FOUC 1GMCF 1L1NA 4F49A 4A1VA 3IITA 3ZVDA 4AYYB 1IQEA 2HALA 2O8WA 1V2ST 1Z8RA 3RUOA 1AE5A 3GY3A 3RC4A 1NRRH 1BOQA 1BMAA 1OP0A 2A2XH 2F9UA 4RT0A 1SSXA 2HVXA 1MTNB 4X2WA 4IS5A 1GCTC 1TGBA 2P16A 1NM6A 3SZNA 2Z3EA 1A61H 2PFEA 1FQ3A 1Y5AT 1O2OA 1O3CA 3H5CB 4TT3D 5DJ7A 1LVMA 3B23B 1A3BH 1O5GH 4MLFB 1PYTD 2O8UA 4ZAEA 2Y5GA 3F9FA 5GCHF 1FMGA 1RTLA 3ZZ5A 2Y5HA 4NWKA 1EOJA 5E2OA 2AMDA 4LK4A 3PLPA 5C20A 2FZZA 3I29A 1TBRH 1TAWA 1O0DH 3Q77A 3NRLA 5A2MH 1YLCA 3OEHD 1RIWB 4Q7ZA 4ZXYH 2LPRA 1AY6H 1EJNA 4IC6A 3RM0H 1AWHB 2XC4A 1YCPK 1YP9A 4YT7H 2ANKH 2PR3A 3E16B 3RXCA 1VITG 1BUIA 2CF8H 2C3SA 4F55A 4X2VA 1JMOH 4FUCA 1O3GA 3FANA 3GCTG 3RMNH 2F9OA 1GHBF 1GCDA 2JH0D 2PKAB 2VB0A 2VIDA 4TY7A 3TJUA 1VITH 1YWUA 3RXVA 1AWFH 2D1JA 4INKA 3LGUA 1SGDE 4RKOB 5FX6A 4U32A 1E0FD 2ZHDA 1FPCH 1V3XA 2VIVA 4GSOA 2C8WB 3TPIZ 4AB9A 3H09A 1C2MA 3CP7A 3LGIA 2A45B 5EU8A 1LKAA 1W13U 2XNIA 3K9XB 2A5IA 1GBAA 1WSSH 1CBWC 3NZIA 1QGFA 2V3MA 4JZEH 3MU0A 1TX7A 2F9VA 1C5OH 1KTTB 2JDID 2V35A 1A0LA 3N7EA 2XXLA 3SV8A 2JETB 1CGJE 1EXFA 1K1MA 2UUJB 3E0PB 3RXTA 6GCHG 2PGBB 1EPTB 1JIRA 2R2WU 2SFAA 3F9GA 3MNXA 3QZRA 1CT0E 2HNTC 7LPRA 4I7YH 4OS2A 1GBIA 3R0FA 2STAE 4Y6DA 3STIA 1Y5BT 6CHAB 1QNJA 2BDGA 1P05A 1NC6A 1SGFA 1XXFA 1FUJA 1BTPA 1WOFA 1Z8GA 2BLWA 2FPZA 3BTTE 4OS7A 2WSSD 1BTHH 4CH2B 1AQ7A 1GBFA 4XBDA 1OP8A 1PPFE 5PTPA 3M35A 1DWCH 4TWYA 1S6FA 2ZQ1A 3SJKA 5A0AE 2IN2A 3BG4C 3TK5A 4LZ1H 3I77A 3AK5A 4CRDA 3F1SB 2CJIA 2JJ1D 4INHA 3SV7A 1CGHA 3GYLB 1NRQH 3QK1A 5IK2D 1UTOA 2GMTC 4GCHF 1O2ZA 2OCVB 2KAIA 2FOMB 3UNRA 5CHBA 1S85A 2GV6A 1T8LA 2AERH 2BD3A 1A0JA 1F0UA 1ANCA 2GTBA 4JYUH 3RC5A 4MPVA 1O5CB 3GOVB 4ZKNU 1CHGA 1DLEA 1LMWB 2PUXB 3P95A 2Z3DA 1Y8TA 1YM0A 2AYWA 3RXHA 3VGCC 1AVWA 1E79D 4M9FA 2FS8A 3EDXB 4OM9A 5DP6A 2ZGJA 5EXNA 1HAXB 1EAUA 1SB1H 1MCVA 3TGJE 4IN1A 3T27A 2VGCC 1GMDG 3FOAA 3SGQE 3JZ2B 1O38A 2AMPA 5CHAB 1GJCB 4JK6A 1AMHA 4ZXXH 3V7TA 1NFYA 5HM9A 1BITA 3UOPA 1IQNA 2H5CA 2BDBA 1ZPBA 1CHOG 2IJOB 5E0HA 3IWMA 2GGVB 2O8MA 3TITA 1RFNA 3URCA 2QA9E 2P59A 3HK6B 1ZJKA 2VH0A 3MNSA 3RXFA 1P2QA 1FAKH 2TBSA 4I32A 1ELAA 1MTVA 2VIWA 4WVPE 2FDAA 1XUKA 1MKXK 2BDIA 3O8RA 3BEUA 3TLOA 2R0KA 2OC8A 2A4OA 1S82A 4YM9A 1C2KA 1QJ7B 4NSYA 3SI4H 2V7QD 1TALA 2OBOA 1O2HA 2R0LA 4CR5A 3RXOA 4R0IA 1OWDA 1GG6B 1LHEH 1XKBC 5LH8A 1FLEE 3DT0H 2BQ6B 1EZXC 1P57B 2ZFRH 4MVNA 4OGYA 3OAAD 2FOEA 5F8XA 3NXPA 3LGVA 1SGCA 3PTBA 5FXLA 3AVZA 1KXFA 2FYRA 4K69A 1DY9A 1A5GH 4X2YA 5T3HA 3RXDA 1TPAE 1TNJA 1ZHPA 5FBIA 4NIVA 1SGYE 2FODA 1AGJA 1ELEE 1HJAC 4FVBA 1GI4A 1F0TA 2ZU4A 6LPRA 3KF2A 1BB0B 2G51A 2P3FH 2Z9GA 1EZSC 2ODPA 5HIZA 4ASHA 3W94A 2NU2E 4X8TH 1GJ8B 1HCGA 2F4LA 1Y59T 2EI8A 1P10A 4Y7AA 2SNWA 3K6ZA 4UEHH 5C1UA 1T4UH 3L3TA 2ODQA 1WTHD 4WWYA 2TGDA 1TIOA 1ETRH 1GL0E 3A82A 3PO1C 1FIZA 3SQEE 1E1RD 1BTYA 1SKYE 1INCA 1P9SA 2ZTZA 3SOSA 1BHXF 1QB1A 4PROA 2QAAA 3TJOA 2XBYA 4Y10E 4HG6A 2AFQB 1NU7B 1T31A 1A3EH 3ZVFA 1O3KA 1T7CA 2D26C 3DFJA 1G3BA 1UJ1A 5HMAA 1AB9B 1AZ8A 2G5NA 1BT7A 4JYTA 3E8LA 5GDSH 3QGJA 1ZRKA 2XOKD 1WTGH 1TNIA 2ZWLH 3A81A 2WPLS 4GPGA 2GV7A 1ZRBA 4ISLA 3BF6H 5JPMH 1QL8A 4DURA 1QJ1B 1T8NA 1D3DB 1RTKA 2Y6TA 2A7JA 2SGQE 1BCUH 1DUEA 1QBNA 1Q2WA 2VWOA 5L2YH 1C2JA 1AZZA 1DWBH 4A92A 1QQ4A 5DN6D 3T29A 3GDSA 1WV7H 1PPGE 2GT8A 2WUBA 3M37A 4NIWA 3C27B 3DD2H 1TNGA 3RXKA 5DP7A 3SU1A 3B9FH 2EI6A 4BTIB 2HNTF 3IG6B 2FI3E 3GCHB 3U69H 1ZOMA 2TGPZ 3A7TA 1ZMJA 2YNBA 1GHYH 2VNTA 1K1LA 1TRYA 3E6PH 1CA0B 3SU3A 2ZECA 4AOQA 1J8AA 4Z0KA 2Z9KA 2AH4X 1G2LA 3DSPA 4H4FA 3KEEA 1V6DA 1UK4A 3A7YA 3AAUA 1DX5M 1EB2A 4X1QU 5ABWA 5A0BA 3QDZB 2UUKB 4XD7D 1O34A 1C1RA 1VITF 3GY5A 1Y3XA 2ZFSA 3P8FA 4NWLA 2BX4A 4IBLH 3GCTF 3DUXH 2OBQA 2WPKS 1O31A 5J4QA 1SGTA 2GX4A 5CDFE 3SV2H 2AS9A 2EI7A 1LHCH 2G8TA 2Y82A 1V2LT 3RXSA 2DE8A 5G4BA 1DVAH 1LVBA 2PKSB 4K3JA 3ZYEA 5C94A 1NESE 3G01A 5GIBA 1V2WT 2F43B 3BTGE 1QJ6B 7GCHG 4OS4A 1C1UH 2FWWA 2VWLA 2ZO3H 4NGAH 1SGIB 1C2FA 3HKJB 2B8OH 3SNBA 4Y0YE 5JBTA 3EA7A 2WPJS 3V0XA 4Z1MD 2XTTB 4H42U 1O5FH 2BY9X 3PMJA 3PWCA 3DSGA 1L4ZA 3PROA 3P8OA 3PWBA 1DXPA 2QXGA 5ESTE 2HLDD 2F3CE 3LKWA 1SQTA 2VJ1A 1O2IA 4CRCA 4CR9A 6GCHF 1AVXA 1T8MA 2F9BH 1HXFH 1TA6A 1SG8B 1HIAA 1W11U 2CGAA 8ESTE 2KCAA 2SGFE 4ZH8A 4DCDA 3M3VA 3OFND 4NG9H 1NY22 1P01A 1GDNA 3OYPA 1LVOA 4Q7XA 2J97A 5DP8A 3FKSD 3RM2H 1P2IA 1EASA 3NKKA 2W7SA 3M3TA 1AFEH 2ZC9H 4QT8C 1QBVH 2XC0A 3S9CA 1F2SE 1UTPA 3E3TA 3LGYA 2K0QA 1C5PA 7KMEH 1H8ED 4JZFH 5DKMA 3S9AA 1P2JA 1KDQA 3A7XA 5EODA 3ZZ9A 3HKIB 4Y71A 4B73A 3SNDA 3TJNA 4DIIH 4B2AA 5T1VA 1HAPH 3HATH 3K6YA 3L33A 4NA9H 1GVKB 2TIOA 4WH8A 1GBDA 1JIMA 3ATMA 3KYGA 2JKHA 3M7QA 2FP7B 1O3PB 4CRGA 4ABAA 4B71A 3TJVA 4I8HA 4X1RU 1MQ6A 1NBMD 2KZ4A 2HPPH 1NT1A 3LT3A 3MTYA 4KTSA 1K22H 1OX1A 3RU4T 4A6LA 3RXRA 3O8BA 3WW7A 3A7VA 2CXVA 1ZTJA 2Z6BD 5FL7D 4K8YA 1AO5A 5GXPA 2B5TB 1LKBA 4D7FA 3ZZ7A 1C1VH 3QTVH 1PPHE 3PLKA 1EP6A 1EQ9A 1PQAA 1P0SH 3SI3H 1BBRH 1W7XH 2QV1A 5C1XA 3NPSA 1HAGE 1AFQB 1O3EA 1K1NA 1ELCA 3P17H 3OTPA 1UCYK 3M61U 4J2YB 3ZZBA 3TK9A 5T6FA 1NFWA 4E7NA 4FU7A 5ESBA 1YLNA 1GMDF 1THSH 3FVFB 1W12U 1UK3A 5HXFA 1PFXC 1DSTA 2XC5A 2BY7X 2CV3A 1H8IH 4ISOA 4Y8YA 1S5SA 1KSNA 1QFKH 4FUEA 1ARCA 1EP5A 2KFWA 1CHOF 1Q3XA 3MFJA 1LHGH 4BXWA 5KECA 1FY1A 3ENSB 1DANH 3D49H 1QL9A 3BSQA 3FP7E 3TIUA 4O3TA 1OP2A 2PGQB 2ZTYA 1GHZA 3TU7H 1YPKH 4Q4LA 2H9HA 2JH6D 3ZZ6A 2ZTXA 1YY3A 2UUFB 1L0ZA 4MNVA 4ZKOU 1ESTA 1DWEH 1PQ8A 1B0EA 1EUFA 2SGEE 3P8NA 2CHAC 2BDAA 1K9OE 2YMSC 1BJUA 2FTMA 2A0QB 1ANBA 1C4U2 1O2YA 5C5NA 3A8AA 3ATWA 2PW8H 1EKBB 1L1GA 3BTFE 5JBAS 2VIQA 1C2IA 3SYJA 1H1BA 3T62A 1ZLRA 1HAYB 3M5MA 2VVCA 2GVFA 3RXPA 3OY6U 1J14A 1DFPA 4FETA 2WHXA 5E0GA 2BVRH 4NIXA 1B0FA 1OXGA 1QRWA 3EQ0H 5EQQA 3A85A 4X2XA 1IQKA 1C5MD 1ANDA 2I6QA 2QF5A 1IQLA 2ZCHP 5E8EH 1G9IE 5HGGA 1HJ9A 3EE7A 3KN2A 1DSUA 4YXWD 4MNYA 3E90B 1GBEA 2KCOA 2FESH 3SORA 1TMBH 2JIZD 3BTDE 2O8TA 3GDUA 1RJXB 4KTUA 4MPUA 2WPHS 3UNQA 4WF8A 3PMBB 3CS7A 4BTUB 2ZEBA 5JBBS 1EAWA 2R2MB 8GCHG 3UR9A 2ZFPH 4TPIZ 1O2SA 1J17T 1RTFB 3P8GA 2I6SA 2J98B 1ZSJA 3F9EA 4ZKRU 3UREA 1QY6A 3A89A 3BIUH 2WPIS 2BQ7B 3NUMA 3RXQA 1NS3A 5EPNA 1IQHA 3UR6A 3A7ZA 1BDAA 1YLDA 2P95A 3FP6E 3LC5A 1HDTH 1QB9A 1SGNE 3SHCH 2ZKSA 1O2TA 3RP2A 3U9AH 3I78A 1BMFD 1YPEH 4FUHA 1IQMA 1FAXA 1C1PA 1S84A 4HFPB 1GI3A 4YO9A 1E38B 4ABHA 2BQWB 3LC3A 1UTQA 1MAYA 1GMHG 1HAVB 1GBTA 4UE7H 4U2WA 1VCWA 1O32A 4CBOA 2R3UA 4CRFA 1MD8A 3F2FA 1HXEH 3TNTA 3NCLA 1KIGH 3VFEA 1BTUA 4WMEA 1NZQH 2XWBI 1W0YH 3PMAB 4D76A 3F2GA 1P2MA 1C1QA 4F48B 2QCYA 2VWMA 4X6MA 1Z6EA 3SU5A 1OHHD 5F6MA 1C5XB 1D3PB 3P92A 3SUFA 1FZZA 4X6PA 4ABFA 1GPZA 4UD9H 4FU9A 4TY6A 2LP6A 2GCTB 2FXRA 1OYQA 1MKWK 1OYTH 2Y7ZA 1IQIA 4ZKSU 2J38A 6ESTA 1PPEE 3PV2A 3MH6A 1C5YB 1G3EA 5F8TA 4XE4A 3T2NA 5DP3A 3SNAA 1V2MT 1YPMH 1EJMA 1LPKB 5F53A 5A09A 4DY7B 3W95A 1O3DA 4K8BA 5C5OA 3VB3A 2B0FA 3QTOH 4Y8ZA 1MUEB 2O9QA 4VGCC 3PTNA 5DSFA 1MD7A 4ZROA 4E7RG 5GJ4B 1AN1E 1A5IA 1DWDH 4UONA 4Q63A 1F5LA 4B75A 3S7HB 1F5KU 2ANWA 1JWTA 4XBBA 2WYJA 2OD3B 4FUGA 7GCHF 1DOJA 2HGTH 2BX3A 2OXSA 4A1XA 1QB6A 2KR7A 1G32B 1GBLA 4KP0A 1C1OA 1EATA 3KQEA 4AFSA 2OP9A 1BIOA 1GHXH 1H9IE 3M7TA 5C0UA 2FOFA 4IC5A 1SL3A 3VB6A 2PP6A 5GPIB 1COWD 1O2KA 1ABIH 5A8YA 2XW9A 1ARBA 2C4FH 1HJ8A 1J15A 1HAIH 1GDQA 4NCYA 1VGCB 1XKAC 1WYKA 1MTUA 1GHAG 3H7OA 3OSYA 1CVWH 1BTWA 1FIWA 1C2DA 1ZPZA 1NRNH 1SMFE 4FUFA 4A7IB 3B8JA 2FIRH 4WY3A 4BOHA 1RXPA 2B9LA 1AI8H 2IPQX 1ZMLA 3ZVCA 1O3BA 1OWJA 2QXIA 1BBRE 3RMMH 1AVGH 2OC7A 1TFXA 4GLYA 4KKDA 2TGAA 1N8OC 4ASUD 4RT1A 1NRSH 2M2AA 2RFKC 1CA8B 1SBWA 5EJ1A 1OWEA 3MH7A 2VIPA 1CU1A 3A84A 4UDWH 3ZVAA 1SGEE 2K8IA 2J2UA 1KXDA 1S0QA 2KCPA 3ZVEA 1TWXB 4X8SH 2ZHFH 4LZ4B 1MBMA 1NRPH 4MNXA 1C5SA 1FY5A 2NU1E 1MAXA 2P8OC 2IJD1 3EYDA 3VXEH 3RXLA 2NWNA 2WPDD 1XUGA 3KQBA 1TNLA 4A1TA 1QBOA 1SC8U 4I31A 4M7GA 1V2NT 1O3AA 2ZHWH 1G36A 1P8VC 3HK3B 1Z1JA 3GYMA 1XUIA 4JK5A 1G37A 2BY8X 2FYQA 3KQDA 5FX5A 2ZDNA 2GKVE 3UQVA 1SHYA 1D3QB 2H1UA 1YKTA 1JRTA 2ZHEH 3QN7A 1H8DH 1LHFH 2BM2A 5EJLA 3T5FH 2QXHA 3BTQE 4GHQA 1DLKB 2ULLA 1WBGB 1GJ6A 3GICB 4NSVA 5DGJA 1GJ7B 2FOGA 4RKJB 1EOLA 4O3UA 4ABJA
chains in the Genus database with same CATH topology
1J9CH 2ZDKA 3MU1A 4OGXA 4B2BA 1FPHH 3STJA 1FN8A 2ZHQH 2ZZUH 1GJ4H 2GD4B 4JYVH 1ZHRA 1GVZA 2FO9A 2EC9H 1T8OA 1YCPH 4R8TB 1F5RA 2BVSH 2QIQA 3MH4A 5T6DA 1O33A 4I8GA 1MTNC 2PTNA 1AUTC 1O2UA 1TPOA 3QUMP 9LPRA 1IOEA 2IPHA 2UUYA 1AE8H 4WJG2 4I8JA 1PJPA 3TK6A 4K2YA 1FI8A 4X1SU 2PTCE 1OWKA 1DY8A 4SGBE 4O9VA 1LQEA 3F6UH 1JBUH 1O2XA 1O36A 1GCTB 2ZFQH 3M7UA 4BAQB 5B6OA 1K1OA 1QL7A 1O2RA 1RS0A 2LNCA 1QHRB 2A2QH 3MO3A 2EA3A 5FAHA 1AKSB 1LPGB 1A46H 2ZCKP 4JCNA 3RC6A 1TX6A 1AU8A 1C1TA 1DS2E 4AX9H 5AFYH 3URDA 3F0PA 3WWFA 1PPBH 3TGKE 3E0NB 3F68H 2Y7XA 5K7RA 2GZ8A 5I46H 5BPEA 8KME2 1YPHE 1ZGIA 2BLOA 1OWHA 1ZTLA 1RIWC 1TNHA 2BD2A 3FN8A 1SQOA 1IAUA 2RA3A 4AB8A 4OS6A 2PWXA 2W6JD 4X1PU 1C5ZB 4KELA 1HPGA 4NA8A 1QURH 1TX8A 2W26A 1HAZB 3D62A 3E91A 4DIHH 1E36B 1ELBA 5A8XA 2K1QA 2V0BA 4MG3A 3E1XB 4XSKU 3RLWH 3HGNA 8GCHF 1O5BB 2ZPQA 1CE5A 1V2RT 5C17A 5EW2H 2QF3A 4ABEA 1UK2A 4Y7BA 4Y0ZE 1RD3B 3RDZA 1YC0A 1G2MA 5E0JA 1N6YA 3VPKA 4ABGA 1O2WA 1C5RA 1WU1A 3T26A 3SJ9A 2P94A 1GGDC 2J9NA 4UFDH 4AZ2B 1C4V2 3A83A 1BHXB 3UTUH 2TRMA 1PQ5A 3UUZA 5DG6A 2PHBA 2SGAA 4J1YA 1T32A 2BDCA 2ZGCA 3MO9A 2ZG0H 4K60A 1O3NA 1FONA 1Z8JB 3W1EA 4IW4E 1HLTH 1XX9A 2A32A 4DW2U 2O8LA 3GY4A 2W3IA 2JETC 1UVUH 1NFXA 3BTKE 1UTLM 1UTJA 2XRCA 4FXGH 4ESTE 1GHWH 1K28D 1VCPA 1CBWB 1Z6JH 1XVOA 1GMHF 1EPTC 1TQ0B 5CE1A 2A4GA 3SUDA 2AGEX 1C1NA 2KAIB 3V12A 2PKAA 4RI0A 3RXGA 1GI7B 5EQSA 1HBTH 2ILNA 4A5TS 2OQ5A 3KNXA 6CHAC 1CSOE 1C5QA 5AFZH 3U98H 5FCRA 1UMAH 1CQQA 3RMLH 2QE7D 3R3GB 1XMNB 3D65E 3U8TH 1P12E 2G4TA 3SO3A 2QYIA 2G4UA 1YBWA 2WUCA 2OUAA 4WMFA 1GJBB 1ORFA 3HGPA 2VU8E 4U01A 1G3DA 3CS0A 1MH0A 2GZ7A 1F7ZA 1OWIA 2A7CA 3SU2A 2Y81A 4AORA 1ZR0A 3FZDA 1K21H 1O3MA 3RMOH 5C2ZA 3BG4B 2WV9A 1O3IA 4TSFD 3OEED 2F83A 4AGJA 1A5HA 4HZHA 1EPTA 1NTPA 2GMTB 2C8ZB 4B6EA 1TGNA 1BA8B 1DDJA 3OX7U 1MKXH 1UTNA 2H9EH 2OTVA 3Q3KA 3RXJA 2HPQH 4KGAA 5I25A 1TGSZ 2WV4A 3ATKA 2V3OH 1L1JA 2THFB 3UIRA 2QF4A 1TBQH 4DG4A 1GDUA 3VGCB 3K65B 1BJVA 1WUNH 4ABIA 3SNEA 1TGCA 1IHTH 1OOKB 2P93A 3BV9B 5CHAC 4DOQA 3U8OH 3SUEA 2FMJA 4D9RA 2IOTA 1W0JD 3ITIA 2BZAA 1QIXB 1SGQE 1ZSLA 2VGCB 4BANB 1TABE 3LGTA 1DE7H 2ZPSA 4LXBH 1QRZA 2OLGA 1C2GA 4IMZA 2BY6X 3MNCA 3GY8A 3MYWA 5DPAA 1LCYA 1E37B 2BOHB 2FOAA 1NO9H 1RGQA 3SW2B 1MZAA 3GY7A 1GBHA 4IN2A 1SOTA 2ZGHA 4UFFH 3V3MA 2VINA 1GHAF 4MTBA 3UWIA 4H6SB 2F91A 2FOBA 3QGNB 2ANMH 1Y3YA 4YOJA 2WPMS 1O30A 2A1DB 1C5WB 1SLVB 1EZUC 1PPCE 2CMYA 1KLIH 4UFEH 3UNSA 4YLQH 4B2CA 1W7GH 2ZQ2A 2ZGBH 4B74A 2F9PA 2FX4A 1SGRE 3ZVGA 1W0KD 1W2KH 1WQVH 1GJDB 4X0WU 1GG6C 4INLA 3OE7D 3SJOA 1V2UT 2ESTE 2FOCA 4IMQA 1P04A 2DUCA 1IHSH 2YMSD 1XUFA 3ZIAD 1FNIA 5L2ZH 3PMHB 4FUIA 3PYHA 4TPYA 2BHGA 1K2I1 1MBQA 3QZQA 1AD8H 4BNRA 1O3FA 1V2KT 4MPXA 5C67A 1BMNH 2AMQA 3LJOA 3P70B 3BTWE 1G3CA 2WINI 2VVUA 1D3TB 1P02A 3Q3YA 2OK5A 1O5DH 1MU8B 2H6MA 4ISHH 1O2LA 2D2DA 5JBCS 1JXPA 2KCYA 1N6XA 5EXLA 4MDSA 4AFQA 2QXJA 1C2EA 1HV7A 3BN9A 3PM3A 3F2HA 1GL1A 1TLDA 2ZU2A 3CENA 1HJAB 3MOCA 4ISIH 4FVDA 4AG1A 1ZPCA 1CGIE 2WZQA 1DPOA 3EA8A 3BEIB 1UVTH 1GJ5H 1SI5H 3SU6A 1P2KA 3M5LA 3ESTA 4K1TA 1A7SA 2XBXA 2BVXH 4JMYA 2Z9JA 3F9HA 1UTKA 3KHVA 2NU0E 2SNVA 1TPPA 2J5UA 3VB7A 2VBCA 3PO1B 1LTOA 3EGKH 3LH1A 4Y79A 3MNBA 1AB9C 4K1EA 4F4OC 4CH8B 4JZDH 1VCQA 1THPB 3JZ1B 1TRNA 1HRTH 2RDLA 5FBEA 1TONA 3ZZAA 4ABBA 3ZZCA 3GCOA 4YTAA 3AAVA 2Q6DA 4Y76A 3M5NA 1PYTC 2V6NA 1SLXB 3TH2H 2J4IA 2A5KA 1ZGVA 3O8CA 2Y5FA 4NIYA 3SU0A 3PV5A 1KYNA 3ZV9A 4SGAE 1FY8E 4AN7A 3TNSA 2PV9B 2ZPRA 2LELA 5EQRA 5GNDA 3TVJB 3RU4E 1C1SA 1THRH 2XWAA 1GI6A 3MU5A 2C8XB 1Y5UT 2BLQA 1EJAA 4NFFA 1SVPA 2QC2A 3GCHC 3BTHE 4YOIA 1NPMA 1UHBB 1O2QA 2FOHA 2VIOA 1SLWB 1T4VH 2W7UA 5DP4A 1UTMA 1CA0C 1V2PT 1V2QT 3L6PA 1GBCA 5A0CA 2J94A 2G55A 2BB4A 3SJ8A 1AKSA 4B6FA 3LPRA 5L30H 1C1MA 1S83A 1LHDH 1E35B 3QO6A 1TOMH 1GVLA 5T6GA 2BD8A 3EA9A 1O3HA 1SHHB 1GI1A 3FFGA 3DHKH 1YYY1 1MTWA 5FHTA 1KLJH 1GGDB 1HAHH 1VZQH 3NWUA 4FUDA 5EXMA 4CREA 3U1IB 2BD4A 2P3UB 3ZZDA 2QN5T 4MPWA 1HIAB 3F3BA 1O35A 4Q80A 2YOLA 2PKSC 1AHTH 1BMLA 4B76A 4X8VH 3GDVA 1P2NA 1ACBE 3WWBA 3UOUA 1K1IA 2ZP0H 3C1KA 2WYGA 4CRAA 1SPJA 3SN8A 4YT6H 3VB5A 2BD5A 3A88A 2CF9H 1YPHC 1ZYOA 2ZDAH 2ZDMA 3T28A 2J34A 3ZYDA 4ZCNA 1KDQB 3A87A 2BY5X 1NBME 1TYNA 1ZJDA 1KTSB 3RXUA 1OS8A 2BLVA 4U30A 3ZV8A 1P2OA 3M36A 2NU4E 4NFEA 4Y11E 2HWLB 1KXEA 2BXUH 2G81E 2GDEH 1A2CH 1A4WH 5LGOA 5EPYA 2KM0A 4O97A 1HYLA 2H5DA 1Z8IB 2ZU3A 4X1NU 1YPJH 1ABJH 1QQUA 1KXCA 3FAOA 1F92A 2Q1JA 7ESTE 1UCYH 5JB8S 1A1RA 1U6QA 1KLTA 3VG8A 2GCHG 4CBNA 3KGPA 2Y80A 3U8RH 2BYAX 1LVYA 2FI4E 1LO6A 2VWNA 2OC1A 3PRBA 3OU0A 2H2ZA 1BTXA 1XM1A 4DT7B 4THNH 1F0RA 1FY3A 1ELFA 3ODDA 1P3CA 1TE0A 1GHVH 2HOBA 1ZTKA 4K1SA 1B5GH 1WCZA 5H4IB 1NFUA 3O8DA 3VEQB 1V2JT 3LOXA 2ZF0H 4ZHLU 2TGTA 1GI8B 2QY0B 2WV5A 3ZZ4A 1BRBE 1DITH 4TYDA 1V2OT 4DVAU 2AGGX 4FU8A 3DA9B 3MHWU 2ASUB 3MO6A 4BTTB 1BMMH 4D9QA 2XYAA 1KXBA 1ESBA 2RCEA 3MU4A 3OY5U 1AFQC 3RXEA 1IQFA 1XUJA 1DM4B 1TMTH 1C5UA 1WQSA 1MU6B 3SNCA 1C5TA 3MU8A 1O37A 1DUAA 1AIXH 1P03A 4GUXA 2D8WA 3Q76A 4I8KA 1NU9A 1O5AB 2ZCLP 5LPRA 1C5VA 4JZ1A 3VXFH 1YPLH 5FPTA 3LONA 5F03A 3N7OA 1GI9B 2FM2A 2ZDVH 2ZFFH 2VVVA 4KTCA 1TNKA 3SQHE 3UQOA 3AW1A 3ZZ3A 1GBJA 1UVOA 3HPTB 2FLBH 3D23A 2ZI2H 1ELVA 1EZQA 5DP9A 4AFZA 2Z94A 3SGAE 4XBCA 1BZXE 1OPHB 2C93B 5BRRE 3FP8E 2A5AA 4XOJA 3N99A 1D6RA 1A0HB 1ELDE 3A8BA 8LPRA 1GI0A 1D4PB 3BG8A 1X7AC 3KL6A 4CHAC 4ABDA 4ISNA 5LPEA 3K2UA 1VJAU 1S0RA 1FV9A 1P09A 3ODFA 3UPEA 2XCFA 5TCCA 3RLYH 1GMCG 2C8YB 4B1TA 1SR5C 2G00A 3A80A 1DT2A 2QGRA 1ZMNA 1AUJA 1UVPA 1OKXA 4NZQA 1ANEA 3H7TA 1S81A 2CHAB 5LPFA 2YMSB 3RXMA 1BBRK 1O2GH 1XXDA 2ZDLA 1C4Y2 1HUTH 1P9UA 2AIQA 4LOYH 1O3LA 2AHME 5J4SA 2W6ID 1ELGA 2HRVA 2BD9A 4I8LA 5GCHG 3BEFB 5ETXA 3A86A 1O2PA 1BRAA 1GI2A 1UO6A 1CT4E 1WXRA 2Z3CA 1VR1H 5AVDA 1K1PA 2ZU1A 4ZUHA 1W8BH 4XFQA 4GAWA 2PLXA 4BAOB 1V2VT 1ETSH 1EX3A 5TJXA 1SFIA 1GWAA 3BIVH 1LQDB 4UFGH 3UY9A 1Q31A 2TPIZ 5DK1A 3TGIE 3QWCH 1V2TT 2B7DH 5DP5A 1MCTA 2G52A 4Z6AH 1Z71A 3DCLA 5K0HA 3BTEE 2F9NA 2BD7A 4RSPA 4RN6A 3M3SA 1L2EA 1W3CA 2W5EA 3GS9A 4DT4A 3QX5H 2ALPA 3EE0B 3OTJE 1GHBG 1EFRD 1W0ZU 9ESTA 2HNTE 1Y3VA 1C9PA 1GJAB 2FS9A 2C90B 1LDTT 4BAHB 2J92A 1O2MA 1LPZB 1C9TA 4GHTA 2ZFTA 4H6TA 2CN0H 3A7WA 3A8DA 1YPGH 1MKWH 1NROH 1GI5A 1KY9A 3LDXH 2Z7FE 5DO4H 1E34B 1BRUP 3S69A 2GZ9A 5FPYA 1FN6A 3SU4A 1O2VA 4DJZB 1QR3E 5HYOA 3SV9A 1H9LB 2J95A 1P3EA 4XDEA 1TMUH 1Y3WA 3KCGH 1O3OA 3FZZA 2H9TH 3LJJA 1FX0B 4FUJA 1FY4A 2EEKA 1H8HD 3GY6A 2M5TA 1MABB 3S7KB 1J16A 1MTSA 1CO7E 4DGJA 2P3TB 3ZVBA 4BAKB 3TH3H 1L4DA 1ESAA 2NU3E 3S9BA 2XNDD 3DSOA 4WH6A 5L6NH 3ELAH 3VB4A 1IQGA 1UVSH 3PRDA 1S6HA 2GT7A 4OS1A 4IGDA 2BDYA 2AEIH 3T25A 4Q7YA 1YCPM 1E1QD 2HLCA 2SGPE 2GCTC 3LU9B 1YF4A 2DE9A 2Q6FA 3PLBA 5EOKA 1SOZA 2A31A 4NA7A 1DICA 1MQ5A 5TCAA 4JZIA 1C1WH 1SQAA 3SBKA 5B6LA 1UHBA 2UWOA 3PB1E 2ANYA 4FUBA 2STBE 3ATIA 3DFLA 3SV6A 1HAVA 1TRMA 2FLRH 1K1JA 1HNEE 3LH3A 4GCHG 4Q2KA 4X6OA 5FPSA 1PQ7A 3BTME 1PPZA 2A4QA 2Z9LA 1SFQB 4HI3A 3RU4D 4K5ZA 1D9IA 5AF9H 1D6WA 3SHAH 5JDUB 4WXIA 3SUGA 4HTCH 1NN6A 3GY2A 5AHGH 1VJ9U 3A8CA 2A7HA 2BMGB 3SZEA 2JH5D 3EAJA 3MMGA 5EW1H 1Y3UA 2AGIX 3FO8D 4VGCB 4AG2A 1O2JA 2XBWA 5IYTA 2A4RA 1BTZA 1ZZZA 4TWWA 1UCYE 1P06A 2SGDE 4ZHAA 2FX6A 4OS5A 3S0NA 5C0TA 3Q3XA 4E05H 1C2LA 2ZGXH 2ZNKH 4D7GA 3LIWA 1JOUB 2JJ2D 1TGTA 3UFAA 1P11E 5E2PA 2VH6A 1HAOH 3Q00A 4Y8XA 3RXAA 3GISB 3SJIA 2BTCE 1M9UA 2ODYB 2R9PA 1HB0B 1O39A 1ELTA 4WMDA 1EAXA 1QA7A 2RA0A 4NZLA 4BAMB 1DXWA 1H4WA 3UB0A 4BXSA 1VGCC 5SGAE 2G5VA 2ZA5A 1Z7KA 1QA0A 1QRXA 2L6OA 2GP9B 5CMXH 2UWLA 1CT2E 1TPSA 4X6NA 1FJSA 2BZ6H 1WAYB 2QF0A 1FXYA 2XBVA 4WXVA 2Q6GA 5EG4A 2ZU5A 1H9HE 1MMJN 1O2NA 1GBKA 3PV4A 4YOGA 2YNAA 2FTLE 1C5NH 2GCHF 2RG3A 3RXIA 1GBBA 1KMHB 2BXTH 5HKKD 2OQUA 5JYIA 2FEQH 3N7DA 1QCPA 1F0SA 2W3KA 5FCKA 1SGPE 1C5LH 3U1JB 1