2IPQX

Crystal structure of c-terminal domain of salmonella enterica protein sty4665, pfam duf1528
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
121
Chain Sequence
LSSTELGDLFWSWLRDGLREGDIPVNTADACVHLTCGFVFISVPGVFFLFLKSHGRKEQVQAAFEKMRKHRVSDSRRFWQCCLYEEPGGRGRYKKLTGYLIKMSEIYNGNFPDDSLFLKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein STY4665
publication title Structure of C-terminal domain of Hypothetical protein STY4665
rcsb
source organism Salmonella typhi
molecule tags Structural genomics, unknown function
total genus 29
structure length 121
sequence length 133
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ipqX01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 2ipqX02
4PZJA 2Z3YA 1B9NA 5F64A 1FSEA 1FBQA 2A6EF 4EM1A 2EWNA 3GXOA 3KCCA 3QPTA 4A5MA 3K1PA 3MZYA 3KP4A 3SZTA 3F6VA 1G3SA 1LDDA 3O6BB 1QZYA 1DPUA 4JBAA 1XCBA 2MD5A 1Z05A 4WXCA 2STTA 4CICA 3RDIA 1J5YA 1P4XA 4WCGA 5E20A 3DEUA 2V1UA 2Y0MA 3FMQA 5AONA 3SFZA 2UXXA 2QWWA 2RV8A 3V7RA 1YW9A 3M9AA 1W7PA 1FNNA 1REPC 3E5XA 1ZGAA 3C1DA 2VBXA 3C18A 1HXDA 1XGOA 2PJPA 2MLGA 3T5XA 3K1NA 1I27A 3C7JA 3P9IA 4I2OA 4B8XA 3G3ZA 5DYMA 5JVTA 3WTWC 2EFNA 3KE2A 4OINF 2M5WA 1FYLA 1MZBA 4BAYA 3LA7A 3HSFA 1OKRA 2V79A 3FM3A 2CQKA 1DP7P 1W5TA 2DI3A 1YG2A 3QP5A 3OOPA 5CVJA 3WTZA 3BOQA 5BPDA 3CUOA 1JHFA 2P6TA 1O3SA 1P92A 1XMKA 1FPQA 3RYPA 2FNAA 2Z9OA 2P8TA 3QAHA 3TOBA 4BQAA 1IXCA 1ZH5A 3IC7A 3GZ6A 4A6DA 2IP2A 2Z33A 5D8KB 1LNWA 3PQKA 1SFEA 2FSWA 1HKQA 2FRHA 1U78A 3HSEA 3BJ6A 5J8CA 4HX8A 2HZTA 1P4AA 1YS7A 4I02A 3IL2A 1DUXC 5FD6A 4WK8F 1FBSA 4HX4A 2G7UA 5ILVA 1ZAOA 4CXFA 3TO7A 1QGPA 1Y0UA 3IRRA 2BYVE 2P7CB 2UWMA 1WRJA 2KRFA 3JTGA 2NNYA 1BI1A 2M1BA 4UUVA 5E8IA 2YR2A 3MAJA 4P9FA 1S7OA 2NNNA 3K69A 5FLXK 1B6AA 3HHGA 3EUHA 1OMIA 2LSOA 3F22A 2HOEA 1EH6A 3ABTA 3HRUA 1J7KA 4DQ2A 5IT9Z 2COMA 1XCVA 2HWVA 1OYWA 5HS8A 4ZZDA 1WI9A 1Z7UA 5H6RA 1HW5A 4PCQA 1W4MA 2D1VA 1FY7A 3F21A 2QZ8A 3DPLC 2XKOA 4UHTA 2VBZA 2GIVA 3F8FA 3SQNA 1O3TA 2X0LA 3FF5A 4HV6A 4RB0A 1D8JA 3NEUA 4WXDA 3U9GA 2QLZA 3ZMZA 1IW7F 2C6YA 1S3JA 2OD5A 2JPCA 1IAWA 3N97A 1R36A 5D5VB 1MKMA 1T6SA 4BHCA 4LFUA 4N9HA 4R8HA 5DCMB 2PQ8A 5L3GA 1KQ0A 2D2WA 2HTSA 3KZZA 4I0BA 4BHBA 4XSZF 4EMSA 3Q9SA 3I59B 1E2XA 3R4KA 1K6OA 3GO5A 3MEXA 4HLYA 4L9JA 1HW1A 2V6CA 4AIKA 1U2WA 4HLXA 1A04A 4EGYA 2ZFWA 2M30A 5ILUA 3V8LA 1R5GA 3RKWA 1FOKA 2VC1A 1SD5A 2A6HF 1S8NA 1J75A 4YFNF 1V4RA 4GO1A 3ZPLA 1FX7A 5D6FA 3MWMA 4S04A 4WX9A 3C3WA 2P5KA 1SFUA 3ZMUA 5LHGA 2VOOA 4KN7X 3WTYC 4E70A 5D5UB 3LSTA 5DUIA 2PI0A 4IHTA 1O7LA 4ASNA 3I0TA 3WTTC 3W6JB 4LK1F 2CFXA 5A2QZ 1TQIA 3ZMTA 4LLNA 3DFGA 1TW2A 4ENNA 3RTRA 3ZN0A 2VODA 1ON2A 4CDGA 4KFCA 1MJAA 1FWZA 2GAUA 1JHHA 2O0YA 1HBXG 3CDHA 5J8FA 3LWFA 4A6EA 3KFWX 1L3LA 5DCMA 4RGSA 4I09A 2P5VA 1ZARA 5HOOA 3I59A 1RUOA 2H94A 2HDCA 3ZQ7A 1USTA 3QOPA 1BOAA 2EV6A 2FEZA 1XSDA 4EM2A 2RVCA 1FYMA 2IPQX 4F7ZA 1YIOA 1EH7A 5IT9K 2M45A 1YYVA 5HDGA 4G6DA 2KIMA 4ESFA 2LNBA 3MZHA 3I4PA 3GF2A 3ISPA 4A0XA 3FXQA 4ENJA 4G6QA 3KP6A 2W25A 5HS7A 2BE5F 4HDUA 4I01A 2Z5UA 4ENKA 3RPQA 3F8NA 1FP1D 3V8JA 4UVBA 3LA2A 5HLIA 1PUEE 5JFRA 2VN2A 2QUFA 2YX7A 5CYVA 3JAMZ 4GGGA 1P6RA 5H6QA 2Y75A 4K2EA 1O7FA 3SXYA 2XAJA 5ILSA 1YLFA 1FT9A 2ZNZA 2STWA 3KP5A 2XV4S 4UNOA 4ON0A 2YX4A 1MDMB 3D5LA 3ZN1A 5BPIA 1YFHA 1IRGA 1SAXA 4WXHA 3F6OA 1F4KA 3HSRA 1TW3A 1U8RA 4EGZA 4Q47A 1ZRDA 4WWCA 4B09A 1KU7A 1R00A 3ZMVA 5KK1A 1H9TA 3GEZA 5TJJA 2XIGA 3I53A 2NRAC 5FO5A 1JGSA 2K27A 3U2RA 3ULQB 4TV7A 5CJ9A 1YQAA 1KQ8A 2KKOA 2ZKZA 3K9TA 1VTNC 3BJAA 1XGSA 3ECOA 4L5IA 1T0FA 2DLLA 1BI0A 4ENMA 4L5JA 1KYZA 1I6XA 2XAHA 3ERED 5ICGA 1UCRA 1SMYF 4OIPF 1IN8A 2RQPA 1T2KA 2VT3A 1BM9A 4H0EA 1UHWA 1E17A 5A2QK 1P2FA 2A61A 2RGVA 4HF0A 4I7HA 3J80Z 4KIBA 4YFKF 4QLCU 4KYWA 1U6GA 1Z1DA 2KIUA 2L3DA 2MH9A 4RB2C 4U7BA 3EYYA 3PFIA 4XLPF 2DQLA 3WE3A 4MHGA 1ZHFA 4OMYA 1EH8A 3I5UA 3RYRA 2HS5A 3U1DA 3M1EA 4ZYEA 1KU2A 1K78B 2WTEA 1MDMA 1KU9A 3EETA 2Z99A 1PP7U 3FXUA 4MEYF 4OIOF 5HS9A 5CVUA 1TQMA 3WE2A 4KICA 1T38A 5L3EA 4U7DA 4FX0A 3O3KA 1ZLJA 2O8XA 2HR3A 3GFLA 3IKVA 3DP7A 4HYEA 4AWXB 1TNTA 4GYIA 3F8MA 4IF4A 4IRGA 3BPXA 3SZPA 1O3QA 2ELHA 2OQRA 5K5OA 1R22A 2F5DA 1U5TC 5ICCA 3Q9VA 5LGTA 3FMSA 1PDNC 2PG4A 2WC2A 2ZMEB 3E6MA 2D1HA 2MC3A 3AAFA 4L9NA 3JAMK 3WGIA 2A3SA 3R6SA 2F5EA 3BY6A 3ML6A 1UB9A 1STZA 1LDKB 5AIQA 5JI6A 3ABUA 4XSXF 4HV5A 3EQLF 3DQVC 3VOEA 1FSHA 1J9IA 2JSCA 2LKPA 2OZUA 1H9GA 2D45A 3RKYA 2KIFA 1O57A 3H3UA 4A5NA 4U0YA 3FX3A 1RUNA 1BC7C 4I0AA 3ZMDA 2K4BA 3GW2A 2EV0A 3Q5FA 4G7HF 1FC3A 2GWRA 2KJCA 1G3WA 4IXAA 1Z9CA 4PGGA 3FMRA 1XSXA 3IWFA 2DK5A 5LEKA 4ETSA 2GXBA 1K78A 1B59A 1ZYRF 2NAZA 4LB5A 1SFXA 4AIHA 2V9VA 4G94A 2HTJA 1W5SA 5ERIA 2V1DA 3BJOA 4HDVA 1BBYA 4M73A 1HW2A 3K0LA 4Y15A 2UXNA 3KETA 2MBFA 4M9ZA 5BOXA 4D0PA 4L18B 2CYYA 1G4DA 4LB6B 2XHKA 1KA8A 4ZH4F 3T1BA 5FFZA 2MH2A 2E1CA 4LD5A 5HLHA 4JQFA 3HRMA 3BDDA 2H6CA 3J80K 2QYOA 4NQWA 4KN4X 1R5HA 3IKTA 4MQVA 4M74A 3P7NA 2ZMEA 4L0ZB 2PN6A 3TOAA 4CZZA 5HDKA 2JZYA 3M8FA 2O6GE 1WSUA 4HAMA 4AVPA 5JHUA 1FYKA 1WQ2A 1MD0A 3GZ5A 1LDJA 3VEPA 3KP2A 3VODA 3WTUC 4PDKA 3DV8A 2FF4A 2FMYA 3IWZA 4L9VA 1J2XA 2PLYA 3JSPA 4A0YA 2WWYA 3GVAA 2DK8A 4EJOA 5LGUA 3WG9A 4UV8A 3GLXA 4EJUA 2CWEA 5HVQC 1R1TA 5DD4A 3KLNA 5BQTA 4BNCA 2HGCA 3WU1B 2FXAA 4I98B 4HOBA 4KNYA 4A0ZA 3TDUC 2HYFA 3KEOA 1BI2A 5TRDA 1AWCA 1KYWA 3QU6A 1QPMA 2AXLA 4IRIA 5L3BA 1CGPA 4P9UA 2RNJA 2BEOA 1IN4A 2PMHA 2L01A 5F6FA 3ZMSA 5FB2A 3H3ZA 3F3XA 4AD9A 4GCVA 5DEQA 2QQAA 3RI4A 4RAYA 1OYYA 3RPUA 3HOSA 1USSA 2A07F 2E7XA 3WTXC 3F72A 4M9SA 2OQGA 3HHHA 4PGHA 3L00A 2EFOA 2YU3A 4LGWA 5EEHA 3HRSA 5E1XA 1GHCA 5E18F 1RI7A 3WTSC 1ZN2A 2GZWA 2HEOA 5LEJA 2OAZA 2HYGD 5DDGA 1BJAA 2VXZA 2HFHA 2P6SA 3FM5A 1NHAA 3CUQA 4LLGF 1LB2A 1D5VA 3GUDA 3HIFA 4OMZA 1IZ1A 4QWQA 3B73A 3SHFA 1ZGJA 1R7JA 2VE9A 4ZZLA 3CJNA 2G9WA 3KQ5A 2ACJA 4OU0A 3PQJA 1T39A 3CO7C 3VB2A 1I1GA 3REOA 4R1HA 4KIGA 4BH9A 3J81Z 3IHUA 2GA1A 5K5RA 2M8EA 2IRFG 3ELKA 2ZXJA 4RAZA 4HF2A 3QP6A 2FOKA 3KP3A 1J59A 2A68F 2Q8KA 2DTRA 1IXRC 3E3VA 4RS8A 3GWZA 4O5VA 1JXSA 3E97A 2IA0A 1XN7A 3S2WA 5IT3A 1BIAA 2UZKA 1U5TB 4UXNA 4G7OF 1LEBA 3WGGA 2ZNYA 3CUQC 3HRTA 5KVRA 4HQMA 2K7LA 4NB5A 4LG0B 5L3CA 3FZVA 3WGHA 1G3TA 1ZRFA 1CF7B 1KU3A 1Z6TA 1ZLKA 4YIIA 1Z91A 1OPCA 5ICEA 2BBYA 3K1MA 2GA2A 1WKMA 2ISYA 1XSVA 3NRVA 2XAFA 2EFQA 4HW0A 4Q48A 5D6EA 3P9KA 2O3FA 1U3EM 1XDUA 2P7VB 3V7SA 4KA4A 4XRFA 4LK0F 1XGNA 2DT5A 4G7ZF 4EJTA 3ROUA 3GFIA 2DO7A 4DNCA 4Q5SF 5E1ZB 2RKHA 1ZG1A 6PAXA 4S05A 1ZG3A 2LF7A 3L2CA 2Q0OA 4HA8A 5JR3A 1V3FA 4UV9A 4WF2A 5FGMA 2KJBA 3RIRA 5K1YA 4O3MA 2EV5A 2WV0A 2IA2A 3LA3A 1J0RA 1ONVA 4UVCA 4HX7A 2VOPA 4M6YA 2L4MA 3L09A 3JSOA 2RDPA 1OR7A 1OYIA 4OIRF 2DAOA 4MEXF 5ICFA 3TKYA 4P5OA 1WWXA 3HTSB 3MQ0A 4L9TA 4Q4ZF 4RGXA 5CVIA 1QZZA 5DD8A 1LJ9A 2MA3A 3KZYA 1U5TA 1ULYA 1IF1A 2J5OA 4M71A 2W85A 3NQOA 5FFXA 2V1XA 3KP7A 1HSJA 4LG0A 3I54A 1F5TA 4HQEA 2QENA 1CF7A 1AOYA 4MGRA 1F1ZA 2DPUA 5HLGA 2A5YB 2P4WA 3BZ6A 4EM0B 4OIQF 2JTVA 2QQBA 1FP2A 2E1NA 2F2EA 4M6XA 3V7CA 2FBKA 3R61A 3EYIA 3J81K 3IRQA 4KUMA 4IVNA 3LAPA 1Z6RA 1D8KA 1SMTA 2DU9A 5DCFA 1XGMA 1I1SA 2OZ6A 3JW4A 3K2ZA 4YFXF 4A12A 2XUBA 3LQRA 2ISZA 5K5QA 2W84A 2HQNA 2H09A 3TQNA 5EEGA 4HZFA 4IHSA 3FXRA 1IN5A 2H6BA 1QO0D 4RB3C 4RB1A 4RGUA 5CVRA 1MJBA 2CGPA 1S7AA 3E5QA 3D0SA 1YW8A 4IJAA 2CO5A 2VE8A 2X4HA 3MFKA 4CO8A 3W6KB 3I58A 5L3DA 2PEXA 3EDPA 2PBIA 3O2PE 1R58A 1SD6A 2YPRA 3E5UA 3T0YA 1F9NA 1KGSA 2FE3A 3VFZA 4N0BA 2EJRA 2RN7A 2LF8A 1YW7A 5LBQA 5F1RA 1ZG5A 1L0OC 2AS5F 3E6BA 3JTHA 1BIBA 1LEAA 4LJZF 3GX4X 1R1VA 2QVOA 4EV0A 5LGNA 1QQIA 3QU3A 1RIOH 1HSTA 1UHMA 3F8CA 3HTUA 2FBHA 2OA4A 3DPTA 1EV7A 3J7AO 3MCZA 3OV8A 4FT8A 1IN7A 4HBLA 2XAGA 2R7FA 5AIPA 2NS0A 4KT5C 1H0MA 4N9IA 2ADUA 2ZO4A 4UVAA 4YG2F 2ESNA 2XRNA 1PP8F 3KLOA 5LHHA 1XB4A 4XBFA 2JRTA 1BI3A 4EQQA 2FU4A 1RZ4A 4KMFA 1X3UA 2TDXA 3R0AA 4M72A 4KMUX 3B02A 2VT2A 3GFMA 1IUYA 3WODF 5D5WB 1S6LA 5D5XB 3CO6C 2IT0A 4LLLA 1C0WA 2DPDA 1HKSA 2XASA 3BP8A 1SD7A 4IRHA 1ZRCA 1YS6A 2B0LA 1QNTA 2IW5A 4FHTA 1G6NA 2JPBA 4ZYHA 3CUQB 1R23A 1YO5C 2VONA 4MTEA 1TLHB 3FWEA 2R7DA 2CSOA 3V4GA 2IVMA 2K02A 5L3FA 3KEQA 1LVAA 4BXUA 3FHZA 1HKTA 3HUGA 2G7HA 3BWGA 4P96A 5CVVA 2BV6A 2IJLA 4YIFA 4LMYA 4CYDA 4GYGA 2HQRA 2XKPA 1ON1A 4EJVA 4P55A 2NYXA 3DKWA 2YSRA 5FD5A 3LAJA 2EA4A 1O3RA 4O6JA 1HQCA 3F8BA 1B1BA 4MNUA 5LLQA 3F23A 2QBYB 2HKXA 2EFPA 2RC4A 4JK1X 4U0VA 4ESJA 2P5LC 3DF8A 3CLOA 1G3YA 3M8EA 2FBIA 4FX4A 4IPAA 2L54A 5LHIA 1GVJA 1W7PD 2CW0F 3T8TA 5D4SA 1S29A 1TTYA 5E1WA 3TGNA 2F5CA 1BC8C 1QBJA 5DV5A 2QQ9A 2L02A 4BHPA 2L4AA 1B4AA 3CTAA 3R60A 2IA1A 5BS6A 4Y13A 1FLIA 3HOTA 3GYHX 4Z2YA 4CGZA 3COAC 3BROA 2QM3A 2O03A 1GXPA 3P9CA 2O61A 3RJPA 2ESHA 1SD4A 1ZREA 5LRRA 2ETHA 4A2UA 5E17F 1B9MA 1IRFA 4EJWA 3HYIA 1LQ1A 2JT1A 3E6DA 5D8LB 2VBYA 2XVCA 4BYYA 4RGRA 1XDSA 2R3SA 3I64A 2DBBA 2H27A 2LDUA 2XROA 4CHUA 3RKXA 1TNSA 3I71A 4AIJA 3TO6A 2F5FA 2OBPA 2PMUA 4M9XA 1IN6A 3QPHA 4XLNF 2PFBA 5HDNA 1D3YA 3M7GA 1K7AA 1K79A 2QBYA 4Y17A 2ZJ2A 3WTVC 4GXOA 3H92A 2BGCA 1FZPB 2HKOA 1DPRA 1TQPA 4OOIA 5LRSA 4MTDA 2EA2A 2Q2EA 2ZBKA 4U88A 3DXJF 4ZYDA 3BPVA 1XD7A 1T98A 4KDPA 3LFKA 1KQ9A 1UFMA 3L9FA 1IXSB 4EVIA 5E8GA 4G9YA 2XAQA 1BN5A 4ZYGA 2FA5A 2EFWA 4KIFA 5ED4A 3T8RA 5H20A 4L0YB 3WU0A 2K86A 1ODDA 3N4MA 2VBWA 5D4RA 2FQ3A 2DQRA 2VC0A 4NHJA 2EK5A 1MJ9A 1P4WA 1RNLA 2W57A 1W7PB 5J6XA 2W24A 2E7WA 2FMLA 2Y48A 3ECHA 3ZP5A 3G73A 1GXQA 2J5PA 3LQQA 1I5ZA 2EB7A 2DFIA 4HF1A 1FBUA 2GQQA 1JE8A 2DW4A 4R79A 3TO9A 3R0JA 5BMZA 4G8XA 3V8KA 1TBXA 1MGTA 2A69F 5CLSA 3E6CC 2FNPA 2MLKA 2GXGA 1DDNA 4U0WA 4ESBA 2CG4A 4MQ9F 3TDZC 2XGXA 1XMAA 3GFJA 2M87A 3L7WA 2OU2A 1Q1HA 1YTYA 5DUKA 2K4JA 2ZCWA 1R1UA 3QRFF 5FLXZ
chains in the Genus database with same CATH superfamily
3IUOA 4PZJA 4X2WA 4PJNA 1B9NA 2QA9E 3QN7A 2HDDA 2A6EF 4EM1A 2BDBA 2H5DA 1ZJDA 1MH4A 3QPTA 1HIAA 1TX6A 3ATMA 1MU6B 3F6VA 4TPYA 4GRIA 1G3SA 2F4OB 1QY6A 2ZA5A 4JBAA 1O2QA 1AD8H 1XCBA 1O2KA 1WGXA 3RDIA 2ME6A 1GHWH 2O9QA 2JQ7A 2A4RA 3FMQA 3SFZA 2UXXA 2QWWA 1IQNA 4Y8ZA 1YW9A 1J15A 1P12E 3M9AA 1FY5A 1EJMA 1W0TA 1GLNA 1UTLM 1LVBA 1O36A 1HLTH 2GCHG 1K28D 1ETXA 3BG4C 1SGTA 4B8XA 2QCOA 5JVTA 3LOCA 3NZIA 1ABJH 2EFNA 4Y3OA 2HVRA 1AI8H 3DU5A 2V79A 2Q6DA 1W5TA 3AKZA 4X1SU 3M7QA 2HXOA 2H9EH 1XVMA 2P6TA 5BRRE 1O3SA 1T8MA 1XMKA 2H5CA 2FNAA 3T5FH 1QB6A 2J5UA 3QAHA 4CZCA 2ZDNA 3GTMJ 1KTSB 2ZXWH 2BDYA 1YP9A 3GZ6A 3NAUA 1K9OE 4D9RA 2OCCH 5D8KB 1O3IA 2HNTC 3PQKA 1EB1H 3K70C 1THPB 5K7HA 1HKQA 3PSIA 4O03A 2STBE 4Z1MD 2X1DA 3BJ6A 1K6YA 1BITA 1OYTH 3RU4E 1HDPA 4OWRB 1YS7A 1MQ6A 1TABE 3MD2A 1MW7A 2BHYA 2FOFA 3RU4T 3LSHA 1DUXC 2IS2A 1R4MB 1BTHH 1UG2A 1BRAA 2ZSIB 2JUCA 5ILVA 1IV8A 1CHOF 2P7CB 1X4PA 1ZK8A 5ESBA 3S9CA 5CMXH 4V2FA 1HAVB 3ZZ9A 2A7HA 2FTLE 3LC3A 1HUTH 3ZQIA 2ZU2A 4DYQA 3BF6H 1GDNA 5DTDA 4CH8B 3PNTA 2BDCA 1A4WH 2KT0A 2RA0A 2DTZA 3LKWA 1EH6A 4Y0ZE 3PROA 2WAFA 1SGFA 5IT9Z 2COMA 4ZZDA 3QYFA 4X1NU 1WI9A 1V2NT 5H6RA 4L5EA 2IGMA 2XKOA 2XRLA 1O2GH 4UHTA 1C9PA 4CRFA 2GIVA 1O2MA 4HV6A 1D3TB 1DICA 1D8JA 4WMDA 3F9GA 3NEUA 4WXDA 3ZMZA 1S83A 2C6YA 1XKBC 5BNGA 4WJG2 2B9LA 3N97A 1UTNA 1UAAA 4BTUB 4BHCA 5DG6A 3NUMA 2H8RA 4R8HA 5DCMB 4NZLA 2D2WA 1G3EA 1GI3A 1YLCA 1S0QA 3IAM2 2WB1N 2ZQ2A 1K6OA 5B3SH 3JRDA 2ZFFH 1KXDA 1HW1A 2P3FH 1Y3UA 1KXAA 2IJD1 1CA0C 4AIKA 3M5NA 5A0CA 1WJBA 4Y79A 4HLXA 4EGYA 3LSRA 1F7ZA 3MO3A 1BBRH 2CQ7A 4NUBA 3RKWA 4BAKB 2Z3EA 4K8BA 2X9DA 1HAZB 5CHBA 2A6HF 1J75A 4F55A 4YFNF 1V4RA 1V2LT 1FX7A 3CS7A 3ZVBA 4FQGA 1Z1IA 1P57B 2OTJI 2VQLA 3O8RA 2ZGCA 4I99C 1AU8A 4AU7A 3GS9A 3QLPH 3WTYC 1RS0A 3LSTA 1FEXA 2OC6A 2XBXA 3KYDB 5F0HA 2ZXHA 2DXIA 3W6VA 3LJJA 2VODA 5C2ZA 5EJZA 1TT5B 2TGPZ 4ABDA 4KFCA 2GIZA 1K0HA 4UUTA 3SJ8A 5TJXA 1JHHA 2O0YA 1HBXG 3CDHA 1N75A 1B8IA 2HXIA 2ZFUA 1BB0B 4A1XA 1DU6A 4I09A 3CJRB 3CJQB 3I59A 3CCQI 2PKSC 3LONA 2EINH 2K9LA 2H94A 5E79C 1X2NA 5FKNA 1AWFH 1DXPA 2EILH 1USTA 2EV6A 2FEZA 1JIRA 2LR8A 3S9BA 3S1QJ 4INLA 4G6DA 1NBMD 1ZSJA 5KECA 1SL3A 3KP6A 3GTJJ 1X7AC 5E8EH 1N78A 2HVYB 1KZHA 3KN2A 2Z5UA 1NH3A 2P81A 5F1JA 5HLIA 1PUEE 2GZ7A 3SHCH 2YX7A 5DM7F 1P6RA 5EF6A 5DP7A 2ZO3H 1THRH 1WFXA 2Y75A 4XBDA 5ILSA 2NOGA 2ZNZA 2STWA 4K1SA 4B6FA 4ON0A 1EPTC 3D5LA 2GCTC 4AYVB 1Y39A 5BPIA 4C9YA 1TGSZ 4Q7XA 4WXHA 1F4KA 4IC6A 1U8RA 1WH5A 2SNVA 2R93J 1DUEA 1AKHA 4B09A 1O2WA 2EQNA 1DGRM 4NSVA 3GEZA 2PUXB 2D8WA 2CV3A 3LGWA 1MU8B 5FO5A 2NWNA 4YLQH 3ZZ3A 3HC7A 1VQLI 4MNVA 2GTBA 2FM2A 1RR7A 3U2RA 4IHWA 4TY6A 2IOTA 3PIPF 1FX0B 1KQ8A 2MD0A 3BJAA 3BR3A 3H36A 3ECOA 3IH2A 1HFDA 4L5IA 1UVOA 3HEFA 3D1NI 3A81A 1BI0A 1WI3A 4L5JA 1VQPI 1GI7B 3CDLA 1UCYH 1YKTA 1V2VT 2QGRA 2O8WA 2P95A 2GCHF 1TNIA 3RXGA 1BM9A 1BJUA 3NPSA 4YLUA 3FBNB 5A2QK 3WWFA 1QRWA 3SV2H 2A61A 3G2BA 4KIBA 4YFKF 4QLCU 1MKWH 2ZC9H 2DMUA 1Z1DA 2L3DA 4RB2C 2KAIB 5T6DA 3PFIA 1MSFC 5DP5A 4XLPF 1ZHFA 1FOWA 3RYRA 3MKWB 4J1YA 3FVFB 3U1DA 2DN0A 1TAWA 1SFQB 2BOLA 1K78B 1MDMA 2ZCHP 4XNFA 1ZQ3P 3QPLA 1O5CB 3SGAE 3FXUA 4DBQA 3U8TH 3TH3H 3M61U 1QPIA 3LPRA 2ZGJA 4U7DA 2FOEA 3I77A 1F0UA 2DOFA 2A2XH 2O8XA 4WH6A 3GFLA 3V0XA 3DP7A 3SDGA 4IF4A 4IRGA 3BPXA 2F4LA 1O3QA 2ZF0H 1ZRBA 3S1RJ 1LE8A 1ETRH 5K5OA 2F3CE 1SKYE 1VNDA 5ICCA 5LGTA 1MMJN 4JYTA 2ZMEB 3AAFA 4L9NA 3JAMK 3H9JA 3L2QA 2WPHS 1PPFE 2JA7J 1TQ0B 1Y6IA 4JZDH 3VDXA 3ML6A 5C0TA 2Q1ZB 1GVZA 3HOYJ 1O5FH 4HV5A 1Y1WJ 1A7SA 3RM0H 4HGCA 1FSHA 1J9IA 2NU2E 2LKPA 2R0KA 3PMAB 2OTVA 3FO8D 3BT9A 3RXKA 2KIFA 3H3UA 1RXPA 1BMNH 4CRDA 1BC7C 1C5NH 5IYCJ 3Q5FA 2VGCC 3OTJE 3FMRA 1XSXA 3TGIE 2KM0A 3PUFA 4ETSA 1B59A 1ZYRF 2NAZA 1TGBA 9ANTA 1O35A 8LPRA 3RSNA 4XN0A 5ERIA 4CBOA 4HDVA 4ZKNU 4M3FA 3K0LA 5DJ7A 2MBFA 4D0PA 2CYYA 1BOBA 4LB6B 2XHKA 4X1QU 5LH8A 2JWTA 1UCYK 2OPTA 4UFFH 3SGQE 2Y81A 5F6MA 2MH2A 4LD5A 3U1IB 3Q3YA 3BDDA 5GTIC 1O2NA 4I33A 1S6FA 4NG9H 3J80K 1G3BA 2DMPA 1C5WB 1GI6A 1K22H 5FLVA 1TA6A 3EA9A 4X1EA 3TOAA 1GUUA 4CZZA 3JCUC 2MSYA 2XRCA 2LTPA 1WSUA 2VPRA 3RMNH 1ZHRA 3RXOA 3AW0A 3OS2A 3QTVH 3A86A 3KP2A 2QSGX 1X1DA 1FN8A 4PDKA 4X6NA 3V7TA 2XCFA 1YI2I 1O5BB 4I6ZA 3TGJE 2ZI2H 3JSPA 2WWYA 2DK8A 3ZZCA 4EJOA 3STIA 3V3MA 1LVYA 3GLXA 1WJEA 4D9QA 2HPMA 4JZIA 4BQQA 5HVQC 1RKWA 3F2FA 2J94A 5K7FA 2P94A 1PPGE 2THFB 3MU4A 3VXFH 3KIOA 4KNYA 4A0ZA 2HYFA 1YC0A 2XSJC 2ZDKA 1KYWA 2LRDA 2AXLA 4IRIA 4YT6H 2RNJA 5F6FA 3ZMSA 3KZIC 1DWDH 3PO1C 3H3ZA 1P0SH 3GISB 4GCVA 5FBEA 3RI4A 1YX3A 4RAYA 3RPUA 2VXDA 1USSA 2OF7A 2A07F 2G00A 1NFUA 3WTXC 5FLMJ 3F72A 4M9SA 1LTOA 2Z9KA 2PMZA 1WCZA 2BVMA 3MH5A 4Y0YE 3L00A 2ZXIA 2EFOA 3F2HA 5E18F 3M5LA 2W5EA 1ZN2A 1G32B 4ZKRU 2H1KA 2HEOA 1P2QA 1OCPA 1WAYB 5DP8A 2GMTC 2BXTH 2VXZA 4F93B 5CHAB 4UUSA 5FRNA 1EAWA 3QK1A 4OM9A 4QWQA 1BOQA 3H0DA 3UIRA 2ZGHA 2VE9A 2XPVA 3ZQHA 3CJNA 4Y10E 2G9WA 2CF9H 5HIYA 2ZC2A 3I55I 3HGNA 5JB9S 3AG4H 2QXGA 1EPTA 4CCNA 1Q31A 3VPKA 3ZZ7A 1SBWA 1T08B 3LIWA 3CO7C 3VB2A 4R1HA 3D5SC 1O2JA 5EODA 5DN6D 2BZ6H 4IC5A 2IRFG 3PNYA 4CCKA 4YELA 1UHBB 4YO9A 2AO9A 2XWBI 2BY8X 2FOKA 1Y3XA 4C3JJ 1IXRC 3GWZA 2ANYA 4A1VA 4O5VA 1HF0A 4BS9A 4XOTA 4NCYA 3PB1E 3S2WA 2BY5X 1GG6C 1BL0A 2F9UA 3P70B 4ISOA 2NS7A 3SJMA 3ZQFA 1U5TB 2WINI 5GP9A 1QBVH 1UK3A 5J1YA 2BD4A 1GBFA 2VIXA 5KVRA 1QZ8A 4HQMA 1G3TA 1T4UH 1CF7B 1KU3A 3KPHA 1SGPE 1OXGA 2JA5J 1PQ7A 5JDUB 2AYWA 2GA2A 1XSVA 1QURH 1LHFH 4HW0A 1F0SA 3GY6A 2IS1A 2A7JA 5E3MA 4E7JA 5L6NH 1YGCH 3P9KA 2P7VB 1W10U 3Q3KA 3SV6A 1XGNA 1QFKH 2F91A 2HVSA 3ROUA 3GFIA 2QSFX 5E1ZB 1POGA 2CUJA 1UG0A 1ZG3A 3UTUH 3KQBA 1AA7A 3SNBA 2KJBA 1TRYA 4B47A 1VZQH 5EG0B 3OYPA 2UWPA 1WJFA 2NU3E 1LPGB 3LA3A 3A7TA 4K1EA 1MZAA 4K8YA 4HX7A 2A7CA 2EZIA 2DAOA 2IXSA 3OL3A 4Y71A 4MEXF 4LIUA 5ICFA 4HFPB 3V13A 3HTSB 2O8TA 3LC5A 4BU2A 1V2WT 2MA3A 2FOHA 1X1PA 1IQHA 2LLKA 1IF1A 1Q3XA 2V1XA 1W0UA 1HSJA 4XDEA 3TITA 2WV4A 4Y6DA 4HQEA 4E05H 3VSKA 2WHXA 2DE8A 1PQ5A 2VKVA 1HAPH 2P4WA 2JTVA 4OS4A 3TPIZ 1FP2A 4FU8A 4M6XA 4S0HB 4AGKA 1K1OA 2HPIA 2FI5E 4GCHG 4E7NA 1N8OC 3FBIB 2TPIZ 3LAPA 3K7AJ 3K2ZA 4F92B 2LC2A 1AQ7A 3R0FA 3LQRA 2E35A 5F27A 3CDIA 2HQNA 1QVTA 2H09A 2R5YA 1DGWY 1AUTC 4HZFA 1I6HJ 2GLOA 1XUHA 3GTQJ 2WAEA 5GPIB 2ZTYA 4HPQA 3KNXA 2H6BA 1QO0D 1YX5A 5F53A 1G36A 3S69A 2R7XA 4RGUA 3Q0UA 1GI1A 3ABLH 2CGPA 2CQXA 2X48A 3D0SA 1MTVA 2YMSD 4IJAA 2WSSD 1G3CA 1LPKB 4ABBA 1VCQA 2X4HA 1WBGB 1V3XA 1C5QA 1YPJH 3W6KB 3UNRA 5G4BA 1GBMA 2PSYA 4ZHAA 2PBIA 2EZHA 3OR1C 1P3EA 2ZIQH 4XKWA 4B1TA 2K9SA 5E3NA 3T0YA 1RJXB 1ZPBA 2H1UA 2SGAA 5AHGH 4I86A 2M7AA 2RN7A 1ZG5A 3E6BA 4GHTA 4A3GJ 1BIBA 3ZYDA 3GX4X 3KQEA 2QVOA 4B44A 1QQIA 3HBLA 3QOEA 1HSTA 1SFIA 1OP2A 1SGDE 4XLFA 2Z16A 3F8CA 2PR3A 2FBHA 1VR1H 2BTCE 2BY2A 3MCZA 3RXPA 4E7ZA 3U1JB 3H1CA 2V35A 2R7FA 4XLAA 1RTKA 2ADUA 1Y59T 3LFUA 2Y6TA 2ZO4A 1YPMH 1FY1A 1XM1A 5K7RA 2A6TA 1XB4A 4XBFA 1QU3A 3A88A 2FU4A 2CGAA 1H89C 2HOTA 5DP3A 3O8CA 3B02A 1N77A 1IUYA 3I29A 2FOCA 3H9QA 3PLBA 1EOJA 1J16A 5D5WB 5D5XB 2DPDA 2XASA 3BP8A 2KMUA 2ODQA 1W14U 1YITI 3W94A 1D6RA 2VBCA 4DVAU 1WVRA 3A01B 1BQYA 2L2OA 1YO5C 4MTEA 3FWEA 2R7DA 1GVLA 3DD2H 1BIOA 2K02A 1ZR4A 3SV9A 1OFCX 2E1MB 3NARA 3VYRB 4CRBA 4BY1J 3MH7A 2R7TA 1XUFA 3DTKA 2BV6A 1GBDA 3OYMA 3W3CA 1SC7A 4CA0A 3M7TA 3MWIU 4NWLA 1A2CH 1M9UA 3QYBA 4DT7B 4MNUA 1A36A 1UTJA 3E0JB 2UUKB 1DSUA 4B3XA 3OYBA 4U0VA 2GDEH 4ZCNA 1KYNA 4ESJA 1AWHB 1SHYA 2WYGA 4D7GA 2V6NA 2OD3B 1F36A 4I8LA 3T8TA 5J3LA 2EY4C 1C5OH 1ANBA 2GGVB 5E1WA 1BC8C 1CGJE 3A85A 5FXLA 2QQ9A 2L02A 3OYGA 2OLGA 3R60A 2IA1A 4Y13A 4NC6A 2VIDA 4I31A 3HOTA 4MPXA 2BQ7B 4CGZA 3BROA 1GHVH 2CUFA 1Q2WA 4DJAA 3RJPA 2X6XA 1GBAA 2ESHA 1RPWA 2ETHA 1X3WB 1IRFA 4EJWA 4RAFA 1ZSLA 2LY9A 3RXDA 2JT1A 1P10A 3LGIA 3A82A 2XF6A 3S32A 4BYYA 1GHXH 8ESTE 4GHQA 2J98B 2UUFB 2DA5A 1OCRH 2OBQA 3FKJA 2QSHX 3SU0A 2ZZUH 2H27A 3P8GA 4CR9A 3B23B 1EOLA 3D49H 1ETOA 3I71A 1O2UA 1GVDA 1F43A 2F5FA 1SVOA 1IN6A 3QPHA 2PFBA 1EA3A 4MPVA 1IJWC 3M7GA 4H6TA 1NZQH 2BVRH 2ZU4A 3MU5A 5C3EJ 2ZJ2A 3KEEA 1H9LB 1FZPB 4XLCA 1DY8A 4A93J 1OCCH 3M1CA 2ZBKA 3GY8A 1BRUP 3AG1H 3M5OA 3CLQA 3LFKA 5EXMA 4YOIA 2X1EA 3SUGA 4EVIA 3JR9A 3DTEA 3UPEA 1PYTD 1P2MA 2F43B 1BN5A 2G51A 1C1PA 4INHA 4ZYGA 2WV5A 4U32A 2EFWA 3LOXA 3VYTB 3HATH 2E5ZA 3N4MA 5FKLA 2DQRA 3LGYA 4IGDA 1HNEE 1GCTB 1VI0A 1TL8A 1ELEE 2WB1A 1TGCA 3P6ZB 9LPRA 4Y7NJ 2SGPE 1GDTA 3M5MA 3MVPA 5IY5H 3ZP5A 1BMMH 3ZZ8A 3G73A 1GXQA 1V5GA 1ETWA 3LQQA 2DFIA 1JE8A 1PPZA 5IK2D 1C2FA 3UB0A 3W1EA 4HG6A 1NRNH 5DS9A 4AYBN 4B2BA 3FP6E 2KCOA 5JLWA 2CG4A 1SC8U 4MQ9F 4K5ZA 4BAOB 5GAHJ 4GCHF 4XL9A 1O0DH 1JMOH 1Y3YA 1ELTA 1FV9A 3FIWA 1MBGA 1HAHH 4FUCA 3TNTA 2OU2A 1Q1HA 2HOBA 2ZCWA 1UO6A 1R1UA 4HRIA 1TIOA 3GCHB 3QRFF 3SHAH 4ZKSU 3HKIB 4OAYA 2D2DA 2Z3YA 5K0HA 1CBWC 2Z9IA 2R0LA 1BBRE 2Y31A 1ZTRA 3PMJA 3BLYA 3GTGJ 3MZYA 1ITYA 3SZTA 1ZLRA 3S1NJ 3M7UA 3SI3H 1MABB 1QZYA 1E0FD 1ETKA 2JMWA 1EJNA 2MD5A 1O2XA 1YPLH 1Z05A 1SFKA 4YOGA 4WXCA 4AG1A 4WCGA 5E20A 3DEUA 2V1UA 2Y0MA 3BR5A 1NU7B 3GICB 2OV7A 3QPSA 1W7PA 1FNNA 3E5XA 1ZGAA 3PJRA 1U8BA 3GY5A 1RKTA 5ETXA 2BMGB 2JRMA 1X4OA 2VBXA 3OIPA 3MOCA 5LPRA 5FBIA 1XGOA 3OYDA 1TMBH 2KFWA 3T5XA 1K61A 2FOAA 4BXSA 4K69A 3K1NA 1DQUA 2ZU3A 5GAGJ 3P9IA 1ARCA 4I2OA 2ULLA 1V2TT 2Q1JA 4ZAEA 1X1BA 4PROA 3KE2A 4FUFA 1OP8A 4IMQA 4OINF 2M5WA 1JGGA 3UQOA 4BAYA 3VG8A 1HGTH 3LA7A 3HSFA 2TCTA 2SFAA 1YG2A 3QP5A 3WTZA 1W7GH 3BOQA 1OYQA 5C5OA 5BPDA 4ZYAA 1PUFB 3HOWJ 1LKAA 4INKA 2M0CA 3RYPA 2Z9OA 5IOZA 1EZUC 1XX9A 3GDVA 3VWBA 4NZQA 5EXNA 2DDAA 3E1SA 4A6DA 8GCHG 1H8AC 5B6OA 2ZKSA 1C1VH 3D5RC 1D3DB 4KTUA 1C5SA 1LNWA 5C67A 2FSWA 2NVYJ 1U78A 1LUJB 2EIJH 5J8CA 2LY1A 1E38B 4RBOA 3IL2A 2JJ7A 1TWGJ 3BTME 1GJ8B 3OYJA 3DCFA 2Z9GA 4WK8F 1FBSA 4JZFH 1AU7A 3U69H 1O31A 2G7UA 4XSKU 1GJBB 1ZAOA 2ZDAH 4CXFA 3BTGE 3E90B 3TO7A 3DFLA 1Y0UA 4BBRJ 1PPCE 2X1CA 3IRRA 4E7IA 2PJRA 2UWMA 1WRJA 2KRFA 1JRTA 2NNYA 1HRTH 2M1BA 3S3MA 2J4IA 1VJ9U 1TMTH 3TU7H 2WPIS 1MMNA 1WJ5A 1S7OA 2NNNA 2X6WA 2HVXA 2M2AA 4BAHB 1C1UH 1SQOA 1A35A 1O2LA 3QODA 1O3DA 2LSOA 2N8GA 1MMGA 3F22A 2HOEA 2ANKH 3ABTA 2P93A 1IDYA 4A6LA 4DQ2A 2DOAA 2YNBA 4RM3A 3MO9A 2PFEA 1MTSA 4JK6A 2ID3A 2HWVA 5HMAA 1Z7UA 1HW5A 2HWLB 2QZ8A 1UCYE 3F9FA 3A1YA 4FASD 3F8FA 4ZTJA 2X0LA 4CHAC 3K4LA 3U9GA 3ZQQA 3SBKA 1ETTH 2Y5GA 5FPTA 3K4MA 2BLOA 2JPCA 4GDFA 2XTTB 1E3PA 3G1LA 1GGDC 3M36A 2NVXJ 1KQ0A 5I25A 2HTSA 3KZZA 4I0BA 4BHBA 4ZC3A 3Q9SA 1E2XA 3BN9A 3CCUI 1V5FA 3MEXA 3FKSD 2VB0A 2BLQA 1GBCA 3L2RA 4L9JA 1D1CA 5HM2A 4BY7J 2R7WA 4XMYA 2EI8A 2P16A 4QT8C 1T56A 3JZ1B 3U8OH 3QGNB 1R5GA 2FWWA 4XLEA 4XE4A 4A3KJ 2E19A 2LK2A 1J17T 1ORKA 1IQIA 1V55H 4Y33A 5CPRB 5FHTA 2XAUA 1SFUA 3ZMUA 4NGAH 2AGEX 5B5EC 1WSSH 5C0UA 3JRCA 1O7LA 2TGDA 2FLBH 5EQRA 3I0TA 2IBDA 1SFOJ 3W6JB 3KX2A 1HAXB 3SO3A 3NKKA 3CP7A 3RTRA 3ZN0A 3FZZA 1GVKB 2PKAB 1P05A 4CDGA 2FXRA 2EI6A 1YLDA 1YJWI 4IL6C 3KFWX 1ZTJA 3SJKA 3RZDJ 4II2A 2P5VA 2BW3B 1ZARA 2VI6A 5E3LA 3BSQA 2Z94A 2RA3A 1RUOA 2PHBA 2WPMS 4ABAA 2TGAA 1F92A 1D3PB 1WOFA 2OCEA 1EUFA 1SQTA 3ZQ7A 1KDQA 1BOAA 1YCPM 1XSDA 4EM2A 2RVCA 1FYMA 2C93B 2CUZA 4F7ZA 2FTMA 3SUFA 1EH7A 1FAKH 1CGHA 1YYVA 2BQWB 1OOKB 1AE8H 1CT0E 3I4PA 1GI2A 3GF2A 4LOYH 4A0XA 1XXFA 3ZVDA 4FUHA 4IMZA 1O3EA 2A4QA 1O39A 2J92A 3VYSB 3PV2A 4UEHH 5EGOB 3T25A 4TPIZ 4X8UH 2A1DB 3LA2A 4B74A 2B7EA 3KYLA 4Z0KA 1VQ5I 1EKEA 1D4PB 1RIWB 3DCLA 4K2EA 4IN2A 3QUMP 3E0NB 1GHZA 4UNOA 5B66C 1OKXA 2XGCA 2YX4A 5GCHG 4CBNA 2V7FA 1WU1A 3PMHB 2VKEA 4ABEA 3HSRA 4RM2A 1OWKA 3L2VA 2LVSA 2IPHA 1B72B 1EXFA 4RT0A 1H9TA 3HKJB 2QXJA 1NRSH 5TJJA 3E16B 3OX7U 1UELB 2NRAC 1QRXA 4B2AA 1GI0A 1HV7A 1E34B 2DA6A 2K0QA 1VJAU 3ULQB 1C1WH 5CJ9A 4XK4A 2YUSA 1XKAC 4B4CA 4W97A 2SGFE 4OS6A 2DLLA 4EEFG 4X6OA 2XW9A 1KYZA 1I6XA 1HBTH 2F5VA 3ERED 5ICGA 5J47A 1IG7A 4UB8C 3VEQB 2OQ5A 1TOCB 3SJ9A 2SGQE 3BCBA 3ATKA 2HDWA 4H0EA 4Y11E 3MHWU 5E2PA 2P8OB 1UHWA 1E17A 4B76A 2KRCA 5IP7J 2ASUB 1ZELA 2RGVA 4AOQA 1Z8IB 4KYWA 3L1PA 1GDQA 1U6GA 4U7BA 5L2YH 2XGEA 3EYYA 3SUEA 2OC8A 1RRKA 5GPCA 2HQAA 4MHGA 1EH8A 3I5UA 2VH6A 4J00A 3CENA 4EATA 1HB0B 3MTYA 3RMMH 4ZYEA 1VQ8I 3CESA 1YPEH 2DA3A 1W0YH 4X2YA 3BTKE 1MZDA 2FX4A 3OEHD 1PP7U 1V6DA 4MEYF 4OIOF 8GCHF 3IH4A 1QIXB 4THNH 1JTYA 3VB7A 4KICA 1NESE 4WWYA 4QSHA 1K4TA 1AVXA 2QF4A 3H9GA 2KP6A 3OYAA 4HYEA 4AWXB 1ACBE 3F8MA 1P09A 3A7XA 3FISA 1C2DA 3MU1A 4HSTA 1R22A 3H09A 1ZTKA 3Q0VA 2XSDC 1PDNC 1ZOMA 2ZG0H 2EIMH 4BGDA 3SQEE 2MC3A 4CRGA 2A3SA 4ZROA 3A4CA 3BY6A 3UWIA 3VGCB 4AB9A 1UB9A 3R3GB 1CHGA 1VGCB 4D5FA 1LDKB 5JI6A 3ABUA 4XSXF 1BTUA 1DANH 3RUOA 1ACIA 1H9GA 4A3EJ 1L1NA 3S0NA 2DMTA 2R2WU 4U0YA 3HGPA 4I0AA 4B71A 2K4BA 4G7HF 4IQ4A 2OC1A 2GWRA 2KJCA 5GXPA 1G3WA 2CH0A 4E7LA 4IXAA 2M7BA 4PGGA 4GUXA 2C8YB 1MBFA 1L1GA 1V2PT 2DK5A 2XC5A 2GXBA 4UDWH 2R7VA 3SU1A 1RESA 2UV1A 4AIHA 4G94A 4HNTA 4WH8A 4U30A 1XPXA 2ZFRH 2HTJA 2AGGX 3CC4I 3UY9A 2BDHA 2V1DA 3BJOA 1XUGA 2DMQA 3RXHA 2RNGA 3BTIA 5FX6A 4MNXA 2KQRA 4M9ZA 5BOXA 1GBHA 1G4DA 5T6FA 4DBRA 5CQEA 1GT0C 2G4UA 1KA8A 3T1BA 3PRBA 5FFZA 2WAQN 2IJOB 4JQFA 1GL1A 3ITIA 3A03A 3WG7H 1NG6A 5HIZA 3ZOBA 1CSOE 1D0XA 3M3YJ 4NQWA 1C2JA 1BUIA 4TWWA 3IKTA 4FUJA 3EUAA 4MQVA 4JYVH 1KMHB 1Z67A 3EGKH 4L0ZB 2ZJRF 1NRRH 5HDKA 1AHTH 1P2OA 4HAMA 3ERMA 1P9QC 1FYKA 3PRDA 5FRMA 5GNDA 1FY8E 2EI7A 3WTUC 1MBKA 1ESTA 3DV8A 3IWZA 2PLYA 1A5HA 1X58A 2GV7A 2GBYA 3CCRI 1DFPA 4A0YA 3GVAA 1RR8C 4UV8A 1O3MA 4BEHB 2V9PA 4M9FA 3CJTB 1MKXH 3KLNA 3DBLB 1Z7KA 4FE4A 1P06A 3CMMA 1VITG 3F9EA 1NTPA 3WU1B 3FANA 1YHQI 3TDUC 1BI2A 4Y8XA 4RAGA 5TRDA 1HAIH 3SORA 1O37A 3CD6I 5L3BA 4P9UA 2BEOA 4A3DJ 2PMHA 3KGPA 4G12A 4DIIH 1T4VH 2OC0A 3OYLA 1SSXA 3FHNA 1YCPH 3RXFA 3UNSA 3V42A 3EYDA 2QEXI 3F3BA 3H5CB 3FKIJ 2ZGBH 3OOUA 5EPNA 1WXRA 3TMOA 4ZMAH 1OYYA 5FKMA 2E7XA 2Z6BD 5JPMH 2M0MA 5GADJ 2OQGA 5A8XA 1TPOA 5M5WJ 3OIOA 3RXEA 5EEHA 1IQKA 3HRSA 3OAAD 3I4MJ 2I6QA 4Z6YA 4LIVA 3B9FH 2GKVE 5EZGA 2QCYA 3RM2H 1YM0A 2JVGA 3WTSC 2BD7A 4AC9A 2FS8A 2GZWA 4K2YA 5LEJA 2CQNA 1IRXA 2Y82A 2OAZA 2HYGD 5DDGA 3ZVFA 1BR4A 4HI3A 3N05A 2OBOA 3IITA 1SVMA 2O8UA 1MCVA 1QNJA 2WUBA 1P2IA 4N4OB 1D5VA 3SHFA 1TPAE 3GCTG 1R7JA 4UD9H 3DEWA 1KY9A 2LPRA 4ZZLA 2ZFTA 4KISA 1TX8A 1QJ6B 1T8LA 2YNAA 1BTYA 2AFQB 4CYCA 4FUGA 4BH9A 3J81Z 5GCHF 3IHUA 2GA1A 5K5RA 3CF2A 1MNDA 3ZZDA 2ZXJA 4HF2A 3ESTA 3S17J 4RA2A 4U01A 3KP3A 2A68F 4A3CJ 2ZHEH 1YIJI 4MO7A 1JXSA 4JYUH 4TWYA 4UONA 1DT2A 5IT3A 1SLVB 4XICA 1BIAA 3RXBA 2L7ZA 2ZNYA 2O5RA 3CUQC 1AGJA 5EQSA 3BTEE 5L3CA 5EQQA 2ZGXH 1Z7LA 1ZRFA 4BE2A 3ATWA 3C2GA 1ZLKA 2PW8H 5A0BA 1SGCA 1Z91A 4JX6A 5LPFA 4ESTE 2A4GA 1D0YA 1WKMA 2XAFA 1X2MA 4DURA 1EF4A 2YMSC 2O3FA 1E1RD 1XDUA 4XRFA 3S3OA 3BQZA 2DT5A 2GP9B 1IO2A 3RDZA 2Q6FA 1ESBA 5EJ1A 4DNCA 4Q5SF 2AQFA 1QB1A 2OTLI 1HC8A 3PWBA 1ZG1A 1LVMA 6PAXA 4M3BA 4HA8A 2BX4A 5JR3A 4PJ0C 3E1XB 1XUJA 4Q2KA 3RIRA 5K1YA 2LELA 1O3FA 3RQIA 1W13U 4DCDA 4WVPE 2EV5A 1CT4E 1VQNI 2CMPA 4Y76A 4UVCA 1NRQH 2VOPA 2HNHA 3L09A 2RDPA 1OYIA 4X0GA 1TBZH 8KME2 2XC7A 5A09A 2JH5D 3KEYA 3A8DA 3LSKA 1FONA 1BW5A 2E5NA 3CMYA 4F4OC 2ELJA 1BR2A 1WWXA 1Z3YA 3MQ0A 4Q4ZF 1NK3P 4BKXA 2M8GX 1CU1A 5CVIA 1QZZA 4IHYA 3KZYA 1ULYA 2J5OA 1GJ7B 4M71A 3SN8A 2W85A 3T29A 2I6SA 5FFXA 1RTLA 4D1QA 1ZGIA 1RD3B 4LG0A 1IUFA 4KP0A 2LFBA 3A0HC 4TSFD 3I54A 4AIDA 4BXXJ 1ZKGA 2AIPA 2A31A 1K1NA 4BXFA 4IHVA 2FYRA 4MGRA 1F1ZA 2DPUA 5HLGA 3RCOA 4OIQF 1B0EA 2QQBA 3A83A 3BZCA 2ALPA 2FBKA 1BT7A 3EYIA 4C2MJ 3TK6A 2W7NA 2FP7B 4KELA 1GHAG 1SMTA 5DCFA 3E0PB 1I1SA 2OZ6A 3JW4A 2F9NA 4AFQA 3UQVA 3ZQGA 5T6GA 5M3MJ 1MTUA 4IHSA 3ZVAA 3FXRA 1B5GH 2FMJA 2FOMB 1FNIA 1VQOI 3FDYA 1L4DA 2JA6J 1Z8GA 2B0FA 3FXLA 5CVRA 4NSYA 2QGUA 1S7AA 1YW8A 2CO5A 1C4U2 3KL6A 1SMFE 1FN6A 1G8XA 1D6WA 3D65E 2EH3A 3AVZA 4ACBA 1C5MD 1OWJA 4HG2A 1Z6JH 3I58A 1V2JT 1YPHE 2JETB 1HCGA 1R5ID 2YPRA 3RXUA 4AN7A 4UFGH 1TWXB 3RXCA 4BXWA 4NIWA 3HUGB 1YW7A 5LBQA 2GD4B 1L0OC 4D7NA 3JTHA 2ZEBA 1R1VA 2F9BH 2OC7A 3UOUA 1RIOH 1UHMA 4BDYA 3HTUA 2OA4A 4J01A 4YEJA 4AYBA 4A3LJ 9ESTA 3A7WA 3OYFA 1EV7A 2BXZA 4FT8A 3A0BC 5GDSH 1F5RA 1PPEE 4SGBE 1XTAA 4KT5C 2LP0A 4BL0B 2BYAX 5T1VA 5A0AE 5I46H 5KHDA 4RKJB 1UZCA 4UVAA 4YG2F 5J4YA 3SU2A 1BI3A 2CV0A 4KMFA 2TDXA 3LMMA 3R0AA 1KONA 1VITF 3ZZBA 3PM3A 3GFMA 3GCNA 3S2DJ 1VQMI 1DITH 4XOPA 3FOAA 5F08A 1C2IA 1AKSB 1HKSA 2A2QH 4BQOA 3PMBB 1ZRCA 1DVAH 1NBME 3CCJI 3HPTB 3ZV8A 1HYLA 1CGIE 3F0OA 4A3FJ 4DYRA 2FESH 1QNTA 2Z3CA 4XRNA 5E0JA 2IW5A 2GV6A 3HK6B 1G6NA 5ESTE 1RFNA 2J34A 3C27B 2A4OA 4X6PA 3SDBA 2R4GA 4FUDA 1MNMC 1R71A 3CCMI 3V4GA 4MFEA 1SQRA 4BXUA 2W26A 3TBIA 3FHZA 4BUPA 1HKTA 4FISA 3UNQA 4FUBA 3BWGA 3P8OA 4LMYA 4GYGA 4YXWD 1O3NA 4A3BJ 1ON1A 1O32A 2YSRA 3LAJA 2EA4A 1O3RA 5J4QA 2R5ZA 2HOAA 1PYTC 2LBFA 1OQYA 1IQJA 2VJ5A 3AFHA 2QBYB 2HKXA 2ZU1A 1TALA 3EUHC 1XUIA 3A7YA 3MZ8A 2PX9A 4F3QA 5IYDJ 3K2UA 1O2SA 3DF8A 2FBIA 1B0FA 4IOAF 4TYDA 4B75A 2Q2EB 1OJLA 3WHBA 3SQHE 5D4SA 2VH0A 1A0JA 1GI9B 1FDPA 1HPGA 2F5CA 1W3CA 5E0HA 1C1SA 2XNIA 5E3OA 4Q7ZA 5FPSA 1F2SE 4RKOB 1O4XA 1B4AA 3CTAA 1P01A 1C2LA 1GJAB 4ABHA 1FLIA 3A89A 4FETA 3G01A 3GYHX 2AH4X 1EX3A 3EE7A 4CH7A 1FUJA 2QM3A 1R4NB 2O03A 5F04A 4LZ1H 5LD2C 1OP0A 4ISLA 1Z21A 1SD4A 1ZREA 4XLHA 5LRRA 1IOEA 2B9SA 5E17F 4HNUA 3LJOA 3FK6A 4BNRA 5SGAE 2XOKD 4H4FA 3E6DA 5D8LB 1TX7A 2P0WA 3Q00A 1ZPZA 1XDSA 1YRNA 1SOTA 1E35B 2VVCA 2DA2A 1YOVB 3L2UA 3RMOH 1A31A 4ZDLA 2XROA 3OU0A 3F9HA 1LHDH 2OJED 3QO6A 4IS5A 2OBPA 5HDNA 5B1BH 1E3OC 1D3YA 1U0JA 2Y5HA 1Y5UT 5KEDA 2A05A 3GYMA 1K79A 2F6CA 3SEZA 1FMVA 4Y17A 3WTVC 3BTLA 3AL0B 1UVSH 2BGCA 3VB4A 2V6EA 4MIMA 3G71I 4XIDA 3DLLF 1DPRA 1TQPA 1NG7A 5AVDA 2W48A 1FOXA 1ZHPA 5E2OA 4BJ5C 4U88A 4ZYDA 1XD7A 4MLFB 2KZVA 3OY6U 1KQ9A 3L9FA 1HIAB 5L2ZH 2B5TB 4YZUA 3SYTA 2BY9X 2RQQA 2XAQA 3BR1A 1UVUH 1SPJA 2FX6A 1ABIH 2FA5A 4XR6A 4BE1A 4KIFA 3DTIA 1D0ZA 4L0YB 1FIPA 2K86A 2ZHWH 3DWLE 5D4RA 5GWZA 6GCHG 1HJAB 2BD3A 4BJ6C 2WPDD 1BA5A 1Z6EA 4Q63A 2W57A 1DX5M 4YM9A 4NA9H 2Y7ZA 2E7WA 1QJ7B 3ECHA 3RKQA 2LNCA 3HOUJ 4KKDA 1WCMJ 1I5ZA 2EB7A 4KTSA 1VZ0A 1C5ZB 2CHAB 2Y9ZA 1S0RA 3TO9A 3IAS2 5BMZA 1JKPC 3V8KA 1QGFA 1MGTA 5CLSA 3E6CC 1TFXA 2XBVA 1ZPCA 2VLAA 3FZDA 2MLKA 4JK5A 2RFKC 4DGJA 2LKXA 3L33A 2NS8A 1FJLA 1ELFA 4U0WA 2XXLA 3S7KB 1MNEA 5EXLA 3STJA 3OS1A 1Y1VJ 4WMEA 4GFBA 2M87A 2IGOA 1GHAF 3L7WA 2CW7A 1YTYA 4DW6A 5DUKA 1A61H 3ZQCA 5F64A 4O97A 2ZQ1A 2EWNA 3GXOA 5KAIC 1O2YA 1VKYA 3K1PA 2OK5A 2X6OA 4QIWN 3KP4A 2QA4I 3C1KA 3F9KA 5EW1H 5KNLA 1LDDA 1T8IA 1FY4A 4E7KA 1H1BA 3M8JA 5GTHC 1L2EA 3MMYB 1JUSA 2STTA 2QY0B 1ELAA 4D7MA 4K3JA 4F48B 3ENSB 1IV6A 1NPMA 1QA0A 1REPC 1FMWA 3BIUH 4ZUHA 1T0FC 3C18A 1G37A 1TGTA 1ETQA 3PSFA 4BOHA 5C1YA 3G3ZA 5DYMA 3OY9A 3WTWC 3Q0WA 1DY9A 2ZTZA 1SGNE 1MZBA 5DO4H 3E91A 2OUMA 3ZZ4A 3DBRB 4V2GA 1AMHA 2CQKA 2ODPA 2PP6A 1TPPA 3GZNB 2DI3A 3OOPA 5CVJA 1O3CA 3CUOA 1GHYH 3ZR8X 3UREA 1XS9A 3M4OJ 3CNRA 2ZFQH 1FPQA 2P8TA 1F5KU 3EE0B 2DFFA 3G1MA 3TOBA 4BQAA 2YOLA 3ODFA 2TRTA 2A5KA 1RETA 4GSOA 4P00A 2E60A 2IP2A 1FIWA 3WWBA 1SFEA 1NM6A 3HB9A 2FRHA 1EB2A 3HSEA 2KDZA 5JVGF 1UVPA 4HX8A 1C5LH 1P4AA 1RTFB 1FIAA 4C2TA 1GMHG 2WUCA 4I02A 4B1RA 2R5ZB 2BD9A 5EZHA 2V9KA 3JRBA 2V0BA 2FI3E 4IEJA 4YTAA 3OS0A 3NCLA 3NWUA 5JHFA 5F0CA 4RMNA 2XPUA 3BV9B 2FDAA 3BTQE 1JKQC 4B2CA 1HDTH 3FXKA 1QVUA 3QX5H 1IQFA 1ELCA 4OS5A 4P9FA 2ZHFH 5FLXK 3ZVCA 1IHSH 3HHGA 3EUHA 1KLTA 2VWNA 3M3TA 4B43A 1J7KA 1TNKA 2CJJA 3U9AH 1GJ4H 4Q7YA 2TBSA 4Y52J 3TK9A 2GDDA 4PCQA 1GHBG 2HALA 1QHRB 3JRHA 1W4MA 6CHAB 2FOGA 1FY7A 1JT6A 2QF0A 3OSYA 3LT3A 1S72I 3DPLC 1ORFA 4MVNA 3SQNA 4XN3A 1GI5A 2ANMH 4D7FA 3FF5A 2AQEA 1IC8A 1AY6H 4RB0A 4VGCB 3FFGA 2BX3A 2QLZA 2QV1A 1SB1H 2OD5A 5FX5A 5D5VB 4X8SH 4F49A 1T6SA 1TWFJ 1B8IB 1P3CA 1NY22 2HQ5A 3L6PA 2XF7A 4XSZF 4EMSA 2HZDA 3BTWE 5EPYA 3I59B 3F0CA 5C4XJ 4E6KG 1WJDA 3GO5A 5EG4A 1MTNB 4HLYA 1NFYA 4AB8A 1O38A 3OTPA 3BTHE 1T8OA 1MH3A 4K1TA 2V6CA 1MBEA 2M34A 1U2WA 2HU9A 5C44J 5J1RA 1A04A 2DFHA 1HAVA 1NS3A 2ZFWA 2ZMEC 5FKOA 2GOMA 5ILUA 3B6AA 1JJ8C 1FOKA 1ESAA 1SD5A 2QC2A 2PWXA 3U28C 4ABJA 4NIYA 3MWMA 3C3WA 1KTTB 5IP6A 1EJ9A 2O8LA 2ID6A 2P5KA 7LPRA 5LHGA 2VOOA 4KN7X 2D5VA 2DT7B 3BTCA 5D5UB 3HZJA 1ENHA 2PI0A 4Z6AH 4ASNA 3LL7A 3WTTC 3GTOJ 2WZQA 2CFXA 5A2QZ 1P8VC 2FEQH 1UTOA 3ZMTA 4LLNA 2CU7A 1S84A 2QF3A 3DFGA 1FTZA 1QTFA 2CQQA 1AKHB 1ON2A 5FCKA 2QKMB 3MYWA 3KHVA 1VITH 1MJAA 5IP9J 4I8KA 3UNGC 3T28A 2EZLA 1HLVA 3LWFA 1GI8B 3QZQA 4U2WA 1QHHD 1L3LA 3K10A 5DCMA 4RGSA 2ECCA 4CSWA 1LHCH 1OWEA 2E71A 3X2QH 3FXMA 4A69C 6GCHF 5LFAA 1XXDA 2HDCA 2WAQA 3QOPA 6ESTA 4B73A 2R7ZJ 2IPQX 1YIOA 5IT9K 2M45A 3CCYA 4MNYA 3LSIA 1LCYA 3ZV9A 3BG4B 4ESFA 4ABFA 1ARBA 3ISPA 3FXQA 4IOCF 4DYCA 4A3JJ 4C2UA 5A2MH 4MFDA 1QQUA 4G6QA 3K6YA 5HS7A 1WTHD 4HDUA 1R6RA 4ENKA 5DP4A 4JX4A 3F8NA 1FP1D 1ANDA 2CJIA 2ZHDA 1GI4A 3CF5F 4NWKA 1C9TA 2IN2A 3TL4X 2VN2A 5C20A 3JAMZ 4GGGA 5H6QA 2MYSA 2GT7A 1SLXB 1HA8A 2HLCA 1O7FA 2XAJA 1YLFA 3KP5A 1TLDA 2XV4S 4XOJA 3TJVA 1MDMB 4IO9F 1TQ7B 3ZN1A 1YFHA 2FX0A 1IRGA 2ESTE 3F6OA 1O3HA 1TW3A 1QRZA 3I3LA 1UW7A 4O9VA 1ZRDA 4N4NB 3BQYA 4WWCA 3W2WA 5H4IB 1O3JA 2R7SA 4ASHA 1R00A 4MNWA 4ZJZA 4AM3A 3U1KA 2KZGA 3GOVB 3I53A 4QPOA 1TGNA 3SJOA 4TV7A 2COBA 1H9IE 2KPMA 3OYEA 1LE8B 3MU0A 3FXOA 2KKOA 1ZRKA 2ZKZA 3K9TA 4XORA 1T0FA 1AN1E 2BY7X 1GMDG 2G81E 4ENMA 3GTPJ 1Z77A 3N7OA 2NVUB 2FLRH 1J09A 1OWDA 2VU8E 4OIPF 2HVQA 2VB6A 2GM4A 2RQPA 2VT3A 4O3TA 4II3A 3WU2C 2ZFSA 2JH6D 1TWAJ 1VFCA 3K2AA 1P2FA 4I7HA 3J80Z 3TW6A 3OYCA 2MABA 1AO5A 4GAWA 5CHAC 1K1JA 1T31A 3DUXH 2MH9A 4JYKA 1ANEA 1V2RT 3MH6A 1RRJA 2DQLA 3NRLA 3WE3A 1MMSA 4OMYA 2K3PA 2HS5A 1L0ZA 1O3KA 1C1TA 4YT7H 3EETA 3H5RA 1MSEC 3GY3A 4OS7A 2V1NA 5JBBS 1ZHMA 5CVUA 1PQ8A 2HGTH 5EW2H 1TQMA 1NROH 2KLOA 1T38A 1NU9A 1DM4B 3ATLA 1OR7C 4FX0A 3O3KA 3RZOJ 3TJOA 2WA0A 1ZLJA 2QXIA 1K1MA 2HR3A 1GCDA 1MD8A 3FAOA 3MU8A 1GMHF 3N7EA 1TNTA 1LVKA 1Y3WA 3SZPA 2Y30A 2OQRA 1QCPA 3GBGA 2XGDA 4IKFA 1K4SA 2F5DA 1JT0A 1U5TC 1CA0B 3AK5A 3CQZJ 1QRYA 3FMSA 1KXEA 2PG4A 1TE0A 1TT0A 2WC2A 3E6MA 2D1HA 4LK4A 3WGIA 2R2MB 2F5EA 5F8XA 4NIXA 3UAIC 5GAEJ 1STZA 1YJNI 1ELBA 3EQLF 2L7FP 3VOEA 4NIVA 3ZXSA 2W7SA 2OZUA 2D45A 3RKYA 4ZH8A 4CCMA 1SGEE 1KLJH 3LSGA 1TMUH 1TRNA 4A5NA 1PQAA 4X0WU 1RUNA 2KAIA 1Z71A 3TEDA 3GW2A 4HSRA 2EV0A 1V2ST 2Q6GA 3G1OA 4ZHLU 2RAEA 1GHBF 2AERH 3J7AY 2JVHA 1MUEB 3IWFA 3H3VK 1K78A 2AS9A 1E1QD 1GJ9B 4LB5A 3BG8A 2V9VA 2L0KA 1Y56A 2XWAA 2XYAA 4DIQA 1W5SA 4NFEA 1OWHA 1BBYA 5M3FJ 3P5JA 4M73A 5J1UA 4Y15A 3GTKJ 2FUG2 1K1LA 2PGBB 4D8NA 2PKSB 1PPBH 3KETA 2HPPH 1O2ZA 2CUEA 2UWOA 2DA7A 3UFAA 5HLHA 3HRMA 1N25A 3MH4A 2H6CA 1W0JD 2XNDD 4WY3A 2FJ1A 4ZDOA 1OPHB 2BB4A 2JSPA 1OSSA 4KN4X 4FOUC 3OY5U 2ZMEA 2A5IA 2PN6A 5KCMA 4AYYB 2ZPSA 2JZYA 2FO9A 2O6GE 1JBUH 1WQ2A 1A5JA 2J2UA 1MD0A 3GZ5A 4HTCH 3VODA 1SGYE 3LSMA 1W0ZU 1J2XA 4UUSB 2M4KA 1U9NA 4ABZA 2QXHA 4E7HA 2XB5A 3KQCA 1J14A 5IPAA 4B6EA 1D1AA 1SEUA 2CWEA 3RMLH 4FUEA 2KDOA 3BR2A 3SEQA 1EPTB 2GCTB 5BQTA 2OCVB 1LQDB 5E0GA 4BNCA 3UOPA 2FXAA 4I98B 2QAAA 5C3NA 4WXIA 3A7VA 4XQFA 1AWCA 5CDFE 1QPMA 1CGPA 5F03A 2HPQH 5HNFA 1IHTH 1MD7A 4XKBA 4A92A 1WPKA 2VWOA 2ZECA 3F3XA 4Y7BA 3BTFE 4A1TA 4AD9A 1W36C 1G2LA 2QQAA 2ELKA 3ZZ6A 2LY2A 3DEEA 3HOSA 1AFEH 2ZNKH 2KZ4A 2LP6A 1ZMNA 2LH9A 1CE5A 1A46H 3BEIB 2YU3A 4LGWA 1HAYB 1UTMA 1GHCA 4MDSA 2P3TB 1SGQE 1UK2A 2PSXA 5K7ZA 4XD7D 2TGTA 3S1MJ 2WY8Q 3RU4D 1BJAA 2ILNA 3CP8A 2KX4A 2HFHA 2P6SA 3FM5A 3ZRGA 1LB2A 4A7IB 3HIFA 4OMZA 2B7DH 1IZ1A 1OCTC 4ZDPA 3LGUA 4PSXA 3ZVGA 1UTQA 1A3EH 4XRMA 1NTCA 1K21H 3KQ5A 4GPGA 1X19A 3SV7A 1APLC 1GWAA 1SLWB 1IQGA 3JRAA 1T39A 4D5CA 1I1GA 2VIVA 2W6ID 5EOKA 2ZP0H 3SNAA 4B3AA 5TGTA 2M8EA 3OYNA 4K60A 2DYSH 4RAZA 3QP6A 5KAFC 1Y0NA 2CW8A 4UY8I 4M3GA 3E3VA 2BD5A 4RS8A 4ZXXH 3RXVA 3SI4H 3RC5A 4BACA 4IW4E 1LO6A 2Y80A 2BD2A 1WHUA 1MMDA 1SAUA 1J8AA 2UZKA 4DZPA 2O9LA 1KXFA 1TP4A 4UXNA 1LEBA 4X8VH 3D62A 3CS0A 2K7LA 4NB5A 1Y5AT 4ABIA 1MH0A 2E1MC 1GMDF 2BLVA 3H35A 3P8FA 1O5DH 2VIWA 4KITB 5ICEA 2BBYA 2HYJA 3K1MA 2ISYA 4Y8YA 5AFZH 3NRVA 2LOOA 4Q48A 2ZB9A 3DKXA 1U3EM 2ZPQA 2SGDE 3IP4B 5DKMA 1QL8A 1LHEH 4G7ZF 2L9NA 4EJTA 2VGCB 2NVQJ 1C5YB 3HPGA 1WQVH 3AASA 1MIJA 3L2CA 2Q0OA 3S8PA 2R5YB 2M5TA 1MAYA 4AC0A 1BBRK 1T95A 2XBYA 3H0GJ 5JLXA 4O3MA 3T62A 4BANB 4HNVA 3PNVA 3TIUA 3RQ4A 5FROA 4CCJA 1XMXA 4RLFA 4M6YA 2I10A 2L4MA 1FAXA 2PTNA 2Z9JA 3JSOA 1OR7A 3MO6A 2ZPRA 1UHBA 2L5QA 2ALVA 2V26A 3M37A 3TKYA 4P5OA 3A2KA 1C1MA 1F0TA 2C4FH 1JXPA 2BHZA 5GJ4B 3BTTE 2DDBA 5KGOA 5L30H 1YBWA 1U5TA 3BR0A 2F4MB 1S9HA 3K65B 5HODA 3KP7A 3DKYA 1ELGA 1F5TA 2UUYA 2QENA 1CF7A 2UUZA 5ABWA 1Y5BT 4WXVA 1AOYA 2VQCA 4D9JA 3BZ6A 5CQGA 6LPRA 1VQ4I 1G59A 1Z3XA 1O2VA 1QL9A 3U8RH 3V7CA 1SLUB 3GDSA 3RXIA 3CC7I 4DJZB 3IRQA 4XRSA 3MKLA 2DODA 4FE7A 4KTCA 3P95A 2AMQA 3MQKC 1Z6RA 1ZGWA 1D8KA 1XGMA 2XUBA 2ZHQH 2WPKS 1MCTA 2W84A 1ANCA 4Q4LA 5EEGA 1BMLA 3SV8A 2FOBA 5F8TA 1EKBB 5EG0A 3NWSA 7GCHG 1IN5A 3I9V2 3A80A 2J38A 2WV9A 4CCLA 1VQ9I 1H8DH 3PO1B 2Y5FA 2DOEA 3E5QA 3FP8E 4ZTFA 3OYKA 1K1PA 1W8BH 3TP0A 3DA9B 2PEXA 1THSH 3O2PE 1R58A 2VKHA 1SD6A 3ABMH 3E5UA 1AFQC 1F9NA 1GCTC 2L9SA 3I78A 1UMQA 3VFZA 4N0BA 4FU9A 2MW8A 2EJRA 2LF8A 3K4NA 4I8JA 5F1RA 1LEAA 4BE0A 5C1XA 5LGNA 4ISHH 2GMTB 1A1RA 1WTGH 2RDLA 1FY3A 1YPHC 2FPZA 2ECBA 3DPTA 3BEFB 1O2TA 3OV8A 3PTNA 1IN7A 4TY7A 5DK1A 5AIPA 1H0MA 3HM5A 3ASOH 1L1JA 1SVPA 1AB9C 2L6OA 3K4KA 1BMAA 2ZDVH 2ESNA 1PP8F 2DYRH 1XUKA 1YLNA 1C5UA 4EQQA 5FAHA 1RZ4A 1GBBA 2FYQA 1YWUA 4M72A 4KMUX 3GCHC 2OUAA 1ZR2A 1OLTA 3BG6A 3WODF 1S6LA 3CO6C 2IT0A 1C0WA 1A5GH 1SD7A 2I5UA 4IRHA 1GJCB 1MKWK 1C4V2 1YS6A 1C5XB 1GG6B 1MQ5A 1LFBA 4FHTA 1I3AA 2JPBA 2GXAA 2X6YA 2MGQA 1BHXF 2CK3D 3O8BA 2EEKA 2CSOA 2IVMA 2G55A 1V2MT 3KEQA 1Y3VA 1F5LA 4F52A 1GV2A 5B1AH 3HOXJ 3TLOA 4P96A 5CVVA 3A8AA 1TPSA 4AG2A 2HQRA 2IS6A 1PFXC 1GV5A 4EJVA 4ASUD 1KXCA 3DKWA 5FD5A 2VWMA 2M3AA 3JRIA 1O3AA 3EUKL 3F8BA 1B1BA 4PFPA 5LLQA 4ZHMU 1R49A 1ELVA 2RC4A 3RXJA 1JRSA 2J9NA 5HNHA 1EJAA 2CS3A 4AFSA 4DG4A 4UFEH 3KYCB 1G3YA 3M8EA 1BTWA 1HJ9A 4FX4A 1WUNH 2XC0A 2CW0F 4KGAA 4X2XA 3W2VA 1S29A 1TTYA 3IWMA 1HDDC 3TGNA 4RDUA 3SOSA 1QBJA 3JREA 5FPYA 1YJ9I 5H2FC 4C30A 2L4AA 4I8GA 4J19A 3OR2C 4UE7H 3URDA 4Z2YA 1GDUA 4NA8A 3COAC 4AX9H 2O61A 5B6LA 2Z3DA 1BZXE 1MMAA 2ZTXA 2I8DA 1G30B 1O2RA 2ANWA 3A01A 3MNBA 1LQ1A 2CN0H 5AFYH 3JZ2B 3TH2H 2XVCA 1MTWA 3I64A 2R3SA 3BC8A 4Q80A 2H8WA 4R0IA 4WF8A 4FVBA 2LDUA 5FL7D 4CHUA 3GDUA 2L7MP 1XX5A 4AIJA 3TO6A 1O34A 2JA2A 2KISA 1EZXC 1W5CC 2PMUA 4M9XA 3ZCOA 5HM9A 1N8OB 4ZXYH 3KYFA 1FPCH 1V2KT 3PTBA 1DWCH 2XB0X 1P7JA 4GXOA 3DFJA 5FKKA 2EZKA 2R3UA 3RXSA 1TNHA 2GT8A 1TONA 1HXFH 1U9OA 2A45B 2YU9J 1OX1A 1Z1JA 1X1CA 2EA2A 2F48A 1A6IA 2KHMA 4HZHA 1QL7A 5DPAA 1V54H 4DGWB 3SGBE 3SU5A 4KDPA 1LHGH 2NXNB 4PSWA 1ZSKA 3GCOA 2G5NA 1TBRH 1E0EA 1FQ3A 1ERDA 2G52A 3T8RA 1DU0A 5H20A 1GJ6A 3WU0A 4BBSJ 3HJEA 1FMGA 1GJ5H 2VBWA 1SGFG 2JIZD 2FQ3A 5DP9A 3DHKH 3S3NA 2ZJPF 2DCEA 1MJ9A 1RNLA 1W7PB 4SGAE 2BY6X 2Y0SN 2Y48A 1JIMA 3I4NJ 2KL4A 1SGIB 1CQQA 4PFOA 2J98A 3BTDE 4AZ2B 2J5PA 4BAMB 1LKBA 3HGYA 2W3KA 4HF1A 1FBUA 1EP5A 2GQQA 1EAIA 1IAUA 2DW4A 1TNJA 4G8XA 4D76A 2H9HA 4CRCA 2VINA 2FNPA 1Z8RA 2GXGA 3CCVI 4IN1A 5T3HA 2IGKA 1C5PA 4ESBA 3RLYH 3SFIA 3MN2A 3TDZC 3V12A 2SNWA 2XGXA 1XMAA 2BZAA 3M3VA 1YPGH 1UTPA 3ZVEA 4DOZA 4NA7A 2XBWA 4WMFA 4YOJA 2ME0A 3RXQA 3OMYA 1W12U 2V7QD 2VASA 3SUDA 2Z1DA 1FSEA 1C1NA 1FBQA 3HGGA 1C1RA 1OISA 1T8NA 2QF5A 1T7CA 1GBJA 3KCCA 4A5MA 3E8LA 3U21A 2DJIA 7GCHF 2XCNA 2K1QA 2PLXA 4X2VA 4J2YB 1ZTLA 3O6BB 3ESWB 5HGGA 2GX4A 5DM6F 5C5NA 1DPUA 1NO9H 3VYUB 1S81A 2KCAA 1V2OT 3P8NA 3RP2A 4CICA 2QYIA 1J5YA 1P4XA 1AUJA 4MPUA 5AONA 1BRBE 3LGTA 3PV5A 1DLEA 2RV8A 3V7RA 2Y7XA 2DMNA 3LU9B 2J95A 3PYHA 2PJRB 5HLTA 3C1DA 3AAUA 2BM2A 3HKZA 2F9PA 1A3BH 1HXDA 1QR3E 4YRVA 2PJPA 2MLGA 1WZ2A 1QB9A 1I27A 3KIDU 3C7JA 5JB8S 3BG7A 1Y8TA 1FXYA 3EPZA 3HPHA 1FYLA 3TGKE 1OKRA 1F0RA 2HNTE 3FM3A 2CRGA 1DP7P 4OS2A 1VCWA 1P02A 1JWTA 1BTZA 1LVOA 1JHFA 2WV1A 1ZGVA 1P92A 3BR6A 5IOYA 2LYCA 1ETYA 2A0QB 1RIWC 2LD5A 3M3SA 1LMWB 1IXCA 2K3FA 5DP6A 1HAOH 2BZTA 2WYJA 1BJZA 1ZH5A 2OXSA 3IC7A 2O8KA 3ZZ5A 1C5RA 2Z33A 1TA2A 4X1PU 2XF5A 1WH7A 1FOYA 5C17A 4AORA 3SJIA 1NT1A 2B8OH 3EDXB 2F83A 2HZTA 1OHHD 1SGRE 3URCA 1QBOA 2VUMJ 5FD6A 2BOHB 1FPHH 1DUAA 3VB3A 4BTIB 3A8BA 2ZFPH 4HX4A 4LITA 2Z9LA 1QGPA 3J7ZI 5M5YJ 2BYVE 2RDEA 2IGNA 1EP6A 3UR6A 4QTRA 2VWLA 3JTGA 2TIOA 1BI1A 2OP9A 4UUVA 5E8IA 2YR2A 3MAJA 1TWHJ 1WJCA 1BMFD 3K69A 1A5IA 1B6AA 3GLLA 1C1OA 2W1OA 1JKOC 1L4ZA 1OMIA 1DSTA 1XG1A 4PJJA 4CR5A 1H88C 1UTKA 2XDVA 2P8OC 2HI3A 3HRUA 1QA6A 3UKGA 1AIXH 4CCOA 1C2GA 1XCVA 1P2KA 1OYWA 5HS8A 3A8CA 3OIQA 1PUFA 1I50J 3H7OA 2D1VA 1DWBH 1EATA 3F21A 2AIQA 2VBZA 2B63J 1O3TA 1N6XA 2BXUH 1JUPA 1JOUB 2AGIX 1YF4A 1IW7F 1S3JA 1IAWA 4IHXA 2F9OA 1R36A 4ACAA 3CMEI 3UUZA 4R8TB 1MKMA 3VB5A 3SU6A 2ZU5A 4LFUA 4N9HA 2GOXB 2PQ8A 5L3GA 2VJ4A 3QYEA 3ZZAA 4PJMA 2K9NA 1SOZA 3RXAA 3LNQA 1ETSH 2IS4A 3T26A 3R4KA 3CCLI 3MKZA 1KDQB 1FIZA 1V2UT 4C3HJ 2MC4A 2BVXH 1DXWA 3P17H 3K4CA 2WPLS 3Q3SA 3C2HA 1O5AB 2M30A 4YESB 3K70D 2R92J 2L74A 3V8LA 3EA8A 3SZGA 1TWCJ 2VC1A 2NOJB 1S8NA 3VGCC 4GO1A 2GVFA 1VGCC 3ZPLA 5D6FA 4S04A 2EIKH 4FCYA 2PGQB 4BJTA 4WX9A 1IQEA 2DT6A 3DPUA 4LOCA 3TK5A 1D1BA 1IQMA 4AFZA 4MPWA 3TJUA 4E70A 3D23A 5DUIA 4IHTA 1CBWB 3E3TA 4W1UA 1Z0XA 2CV1A 4LK1F 4G6TB 1TQIA 3A7ZA 1O5EH 4HEA2 1TW2A 4ENNA 3P92A 1IGNA 1XC5A 3FP7E 2RG3A 2STAE 1HOMA 2H6MA 3UR9A 1VCPA 4FVDA 1FWZA 2GAUA 3ELAH 1SHHB 1DLKB 2CF8H 5J8FA 1NRPH 3OL4A 4A6EA 1PJPA 3KQDA 1ID5H 5FJ8J 4UFDH 1X3ZB 2C3SA 5HOOA 4CRAA 1QA7A 1KSNA 1SQAA 1O2OA 1OWIA 4XBCA 3K4BA 3K4JA 3IH3A 1ZR0A 3TNSA 4IBLH 5HDGA 2K9MA 2KIMA 4CH2B 2LNBA 3DSGA 3MZHA 4X8TH 1I39A 3SZNA 4ENJA 4ZKOU 2W25A 1P9SA 2BE5F 3TP3A 3OSGA 4I01A 1RGQA 3RPQA 3V8JA 4UVBA 3S93A 1QQ4A 1EFRD 5JFRA 2QUFA 5CYVA 3I56I 3FN8A 4ANJA 3A02A 3SXYA 1AFQB 4DZJA 1FT9A 1EAXA 1PYVA 1BDAA 2CFOA 3F1SB 1W2KH 5AF9H 2YS9A 1SAXA 2GZ9A 2H1LA 3W2AA 2HRVA 4OS1A 4EGZA 4Q47A 5EJLA 2W3IA 2PKAA 2WPJS 2WADA 1P03A 1KU7A 1BHXB 3ZMVA 5KK1A 1LPQA 2ZDLA 3TJNA 4ABGA 4P02A 2XIGA 1NFXA 2JJ1D 4KT6A 2R0QC 1WJAA 1H8ED 2CMYA 3N99A 1JGSA 2XPWA 2K27A 3BG9A 1DP3A 2BW3A 1W1WE 4E7RG 3ABKH 1YQAA 1AB9B 1VTNC 4E4HA 1XGSA 5EEAA 3QTOH 3O8DA 5JBTA 3F68H 2XAHA 3A84A 5EIYA 2ZJQF 1UCRA 1SMYF 3KF2A 1IN8A 2RCEA 1H4WA 2C8XB 2LREA 3HOVJ 1T2KA 3ZQLA 2AHQA 4XM3A 1UJ8A 3PV4A 2ZCKP 2M2EA 2UWLA 2JUGA 3IV5A 4HF0A 4IZZA 5EGOA 3SW2B 5HKKD 2X85A 2KIUA 1OCZH 1AVWA 3RPUD 2PV9B 1N1LA 2Y2ZA 2E2JJ 2M4GA 3S2HJ 1QJ1B 3H7TA 4OAZA 2A5AA 5JBAS 4NC7A 4PK4A 2BY0A 4CHAB 3M1EA 1KU2A 3NWTA 3Q76A 2WTEA 4AVZA 1KU9A 2G5VA 1YE9A 1TZLA 1C5TA 3G4SI 2W00A 2Z99A 5IYBJ 4FUIA 5HS9A 1V5EA 3VFEA 2AEIH 1GGDB 3WE2A 2C8WB 2IEKA 5L3EA 3OWTA 1B72A 1C4Y2 2AMDA 7KMEH 1O2PA 5IYTA 3SNDA 2R9PA 3F0PA 3IKVA 4GYIA 4XFQA 1D5YA 1NC6A 3PM1A 1TRMA 2ELHA 3SNCA 1BRCE 3Q9VA 3B6CA 3M07A 4NQWB 3JRFA 2L7KA 1E36B 3T2NA 1OS8A 2DE9A 5F0FA 4BAQB 3R6SA 1S82A 1FI8A 2VNTA 3HL2A 1BJVA 1ZMJA 1COWD 5AIQA 1WYKA 1IQLA 1G9IE 2F4IA 3DQVC 1BCUH 1P04A 2IAIA 2JSCA 2FD5A 5HYOA 1INCA 1VQ7I 1O57A 1SR5C 3FX3A 3ZMDA 2L9RA 1TNLA 1FC3A 4DOQA 5LGOA 1Z9CA 5A8ZA 3ZYEA 4BDZA 1WDIA 2FIRH 5LEKA 1JKRC 2J97A 4DIHH 7ESTE 4XONA 1SFXA 1ZZZA 4GVUA 2E34A 2XC4A 1UMAH 3KYGA 3OE7D 3VXEH 2AHME 1HW2A 2UXNA 4H42U 1YY3A 4L18B 1P7IA 2MFZA 2C8ZB 3VPRA 1YYY1 4XKCA 4ZH4F 1KXBA 4PUSA 2E1CA 2FQ4A 2FI4E 3ATIA 2V3MA 1DPOA 2QYOA 4ITVA 3JRGA 1LFPA 1R5HA 4BTTB 4DW2U 4M74A 3P7NA 2BDIA 1O3OA 3BG5A 2LG4A 3M8FA 1C2KA 2HNTF 4AVPA 1TB6H 5JHUA 1K2I1 1B7XB 1FZZA 1AE5A 1LDJA 3VEPA 4U87A 1G3DA 4DT4A 2FF4A 2FMYA 4L9VA 4FTHA 5IDKA 2JJ2D 5LGUA 3WG9A 1I3QJ 4NDLA 2VIQA 4AGJA 4EJUA 5DSFA 3EQ0H 4CUGA 1OCOH 3Q3XA 1DS2E 1R1TA 5DD4A 4NC8A 1J9CH 1GMCG 1AHDP 1A0HB 3VSLA 3PWCA 5EDNA 2HGCA 4CYCB 4HOBA 3N7DA