2IPQX

Crystal structure of c-terminal domain of salmonella enterica protein sty4665, pfam duf1528
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
121
Chain Sequence
LSSTELGDLFWSWLRDGLREGDIPVNTADACVHLTCGFVFISVPGVFFLFLKSHGRKEQVQAAFEKMRKHRVSDSRRFWQCCLYEEPGGRGRYKKLTGYLIKMSEIYNGNFPDDSLFLKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of C-terminal domain of Hypothetical protein STY4665
rcsb
source organism Salmonella typhi
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein STY4665
total genus 29
structure length 121
sequence length 133
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ipqX01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 2ipqX02
1PP7U 1R5GA 3FXRA 4NB5A 4OIPF 4EVIA 1T0FA 2E1CA 3HRSA 2PN6A 2A3SA 1BC8C 1YW8A 5ERIA 1K79A 1G4DA 2RVCA 3FHZA 5K5RA 2A6EF 2WV0A 5CLSA 4G94A 4KIBA 4YIFA 4HX4A 2HYFA 3RI4A 1KYWA 3TOAA 1XDUA 3MCZA 4KN7X 4A0ZA 3KP3A 2WC2A 3EDPA 4ZYEA 5AONA 3KLNA 4MNUA 3KP7A 3M7GA 3BPVA 4O3MA 2ZJ2A 3F8FA 3HHHA 3V7RA 3QU6A 2O61A 3I53A 2PG4A 3K0LA 1O3TA 2H09A 1T2KA 1DUXC 2TDXA 4RGUA 2PEXA 1VTNC 5FLXK 4XLNF 2YX4A 4M9XA 1JHFA 4M74A 3WTUC 4HW0A 3WGIA 5J8FA 2GXBA 1Z6RA 1ZH5A 1XMKA 4M72A 1DPRA 1ZG1A 1J0RA 2OA4A 5FFZA 2QBYA 2GWRA 4CDGA 3FZVA 4JBAA 1XGSA 4WXDA 5D6FA 5E1ZB 3ZMDA 2Z33A 5D5VB 1KU9A 4Q4ZF 2ZXJA 1YQAA 5DCFA 2VBWA 1TQPA 1O3SA 3Q5FA 2ZFWA 3Q9SA 1O57A 4GYIA 3C7JA 5HS8A 2OAZA 4HDUA 5CVJA 1R1UA 2NS0A 2EA4A 2JT1A 3ZMSA 5HS9A 1ZG3A 1LDDA 3GX4X 4MEXF 2FMYA 4EJOA 4ZZDA 4Z2YA 3FWEA 1H9GA 1RZ4A 2FBKA 3BJOA 1HKSA 1KGSA 1TW2A 4NHJA 3ISPA 1OYWA 3E6MA 3WTWC 4M9SA 2BEOA 3I71A 4N9IA 2COMA 4YFKF 2Q8KA 3MAJA 5DV5A 2CQKA 1I1SA 2MA3A 2L54A 5TRDA 4P9UA 3LA7A 2K86A 2HZTA 5CVUA 5BMZA 4EMSA 3TGNA 2AXLA 1B9NA 3QU3A 5BPIA 2OZUA 2X4HA 1TBXA 4Y13A 1FBUA 4BNCA 2Z99A 3WTVC 5JHUA 4EJWA 1AOYA 1ZN2A 1WRJA 4HF0A 5FB2A 2F5EA 3IRQA 4GCVA 1Z91A 4CHUA 2KIFA 1FYMA 3GEZA 2ZBKA 1P4WA 4YG2F 3F23A 2QWWA 4UHTA 5FFXA 2HKOA 1LJ9A 4H0EA 3HRTA 4ZYGA 2A69F 2LKPA 3P9IA 1I5ZA 3R4KA 2G7HA 3KEQA 4LJZF 5HDNA 4RB1A 3VB2A 2DK5A 3LWFA 3F8BA 2VE8A 1FWZA 5DCMB 1DDNA 3KCCA 2Z9OA 2JPBA 4UNOA 5DEQA 2K27A 4XRFA 4P5OA 1RNLA 5BS6A 2VOPA 3N97A 5KK1A 2LF8A 1G3TA 2Q0OA 4G7OF 1TLHB 5D5UB 3S2WA 3HTSB 1XB4A 2B0LA 2RNJA 1S3JA 2VODA 3L09A 1I27A 1V4RA 2IA1A 1XCVA 3IKVA 4LLNA 2ZMEA 5E17F 1YTYA 2JRTA 2ZNYA 2BYVE 1EH6A 2YU3A 5LHHA 3KP6A 5DDGA 1FP2A 1AWCA 4U0YA 1Z6TA 2NAZA 5LRRA 1QPMA 3LA2A 1ZHFA 3HOTA 2DQLA 4CICA 3BPXA 3SZPA 3V4GA 4AIJA 4P55A 1U5TC 3E5UA 1B6AA 2VN2A 5E20A 1USSA 3M1EA 2OQRA 2XAHA 4A2UA 3CJNA 2M5WA 1IN8A 2XAJA 1QBJA 2FMLA 2L4MA 4U7BA 5A2QK 4LLGF 2GA1A 2W84A 3HIFA 2DBBA 2VT2A 4WXHA 4R79A 4RB2C 2H6BA 5EEHA 3MZHA 2V9VA 3T5XA 2IW5A 2HFHA 2R7FA 3KQ5A 3I5UA 1SFUA 1E17A 4FX0A 1XSDA 5D6EA 4L9JA 4CYDA 1W5SA 1U5TB 4TV7A 2UXNA 5E8GA 3CTAA 3J81Z 3RKXA 5D5WB 2O03A 1FP1D 4HX7A 1BI2A 1XCBA 4IRGA 3TDZC 1CGPA 1EH8A 4KDPA 2FOKA 4FT8A 4Q47A 5HDGA 1WQ2A 2FQ3A 2FXAA 3W6JB 2EWNA 2EV5A 2X0LA 3GO5A 1MKMA 4KICA 5D5XB 2C6YA 4MQVA 4LFUA 3L7WA 1U78A 3T8RA 4HX8A 4XLPF 1HBXG 1MD0A 2P7VB 4PDKA 5L3GA 4OIOF 1OMIA 3O3KA 2BE5F 2HKXA 1F4KA 5LGUA 1YYVA 2K4BA 4A0XA 4LD5A 3K1PA 1YLFA 2A68F 5LBQA 3GXOA 1CF7B 2QUFA 1JXSA 1PUEE 2UZKA 4L9VA 2K02A 1RIOH 4I02A 5BPDA 2JZYA 3JW4A 1IXCA 1ZRDA 1T98A 2Y0MA 4OIRF 3WTSC 1KYZA 4KUMA 2H6CA 3CUQA 4OU0A 2FU4A 3IWFA 4LG0B 3HSFA 3E3VA 2XROA 2P6SA 3HTUA 4I98B 3CLOA 3I58A 4I0AA 2W85A 2M1BA 3PQKA 4I09A 1ULYA 2XRNA 1YW9A 2HOEA 4G7HF 4RGSA 3TQNA 1S29A 1IRFA 4K2EA 1D8JA 3LAJA 2RN7A 1J2XA 1I1GA 3IC7A 3JAMK 1TNTA 4L18B 3HSRA 4FX4A 1LVAA 2RDPA 4L5IA 3QOPA 2ZCWA 4Q5SF 3IKTA 2E7WA 1BI1A 3BJ6A 4HA8A 2PMHA 1G3YA 3Q9VA 4B09A 5KVRA 1XSVA 3WTYC 2NNNA 1ZRFA 3LQQA 3WTXC 4LK1F 5HS7A 4LB5A 5L3FA 3T0YA 2FA5A 3ZQ7A 4KT5C 1B4AA 3ZMUA 2PMUA 2PFBA 3HRMA 4LGWA 3VFZA 5JFRA 4S04A 1D5VA 4M6YA 2MH2A 3O6BB 1W7PB 1IN7A 4ESJA 3KZZA 1W5TA 2GZWA 2VBYA 3FM5A 3R6SA 3WU1B 5L3EA 5CVIA 3FXUA 2G7UA 2MLGA 3DPLC 4P9FA 3T8TA 2STTA 2DO7A 1WKMA 4RAYA 5HDKA 5ILUA 2LSOA 3SXYA 4B8XA 3L2CA 1GVJA 2ADUA 4OMZA 3MZYA 4BYYA 1L3LA 2HYGD 3ABUA 1K6OA 4BH9A 3D5LA 2O8XA 2Z5UA 1G3SA 1IAWA 3MEXA 3QRFF 2KRFA 2V79A 2M45A 5J6XA 2GXGA 1L0OC 2IT0A 2ISYA 2XAGA 3GZ5A 1I6XA 1FT9A 3QPTA 1QNTA 2IA0A 3R0AA 2HTSA 5D4SA 2HEOA 2UWMA 4U0WA 4MHGA 1MJBA 4ON0A 3FX3A 2D45A 2O6GE 4A5NA 1YIOA 1SMTA 1HKTA 1QZYA 1BJAA 3L9FA 4CZZA 1JE8A 2JPCA 1CF7A 4ETSA 4KA4A 2EB7A 1JGSA 4M73A 1F9NA 4EJTA 3MWMA 2GQQA 3KP5A 5D4RA 3ROUA 4MGRA 4KNYA 1EV7A 4ENNA 3RPQA 3B02A 4KN4X 4R1HA 4ZYHA 2DAOA 3CUQC 1FLIA 3EETA 1HW2A 3DF8A 2IP2A 5TJJA 2QENA 2AS5F 3EYIA 2QLZA 2OZ6A 5LGTA 1UHMA 4HV5A 4S05A 3H3ZA 5HOOA 3COAC 3P7NA 4UUVA 2JSCA 2O3FA 1R1TA 3LSTA 1IN6A 4LB6B 4UVAA 1H9TA 5LHGA 4ASNA 2GA2A 1IUYA 4MTDA 1U2WA 3DQVC 1XGOA 4GYGA 4UVBA 1Z9CA 1IZ1A 3TDUC 1WI9A 3KETA 2G9WA 2P6TA 1FOKA 1ZRCA 2W57A 4A12A 1HW5A 2A6HF 3E6CC 4UV9A 1FBQA 2GIVA 3ZMVA 2ETHA 3EUHA 3JTHA 5CYVA 3TKYA 1R5HA 3L00A 4HF2A 2ESHA 1ZLJA 1LDJA 1ZARA 1P4AA 1TQMA 5CVVA 4UXNA 3FM3A 4WCGA 1P4XA 1YFHA 1FPQA 4O6JA 1KU3A 2VE9A 3JSPA 3HRUA 3RTRA 1IXSB 2XHKA 3WGGA 3QP5A 3J81K 1XMAA 4KIFA 5LRSA 1BBYA 2XKOA 5D8KB 1R7JA 4U0VA 3D0SA 1YO5C 2DK8A 3LAPA 3IL2A 3ZMZA 3ZMTA 4KFCA 3E6DA 4ZH4F 4HOBA 1E2XA 2HQNA 1MDMA 1TNSA 1G3WA 1Z1DA 4BHBA 3M8FA 3FF5A 4HLXA 3BZ6A 3N4MA 1FNNA 3JAMZ 2OQGA 3HSEA 1O3RA 2QQBA 3GWZA 4G9YA 5FD6A 1ZGJA 2NYXA 1LDKB 2DFIA 3GFLA 1MZBA 2HDCA 5EEGA 3IWZA 3ERED 3WU0A 1WSUA 4QLCU 2WWYA 3BOQA 3RPUA 1ZLKA 1BN5A 5FLXZ 3P9KA 1W4MA 3WODF 5A2QZ 2DI3A 2CSOA 2QZ8A 2W24A 3DPTA 4ZYDA 1BC7C 1C0WA 2K4JA 2XUBA 1XSXA 2UXXA 3F72A 5K5QA 3CO7C 4AIKA 4IPAA 4PGHA 5JVTA 3GF2A 1KA8A 4HAMA 4ENJA 2D1VA 2XIGA 1LEAA 1TTYA 4PCQA 1O7FA 5FD5A 2VBXA 2CG4A 5HVQC 1BI0A 3DKWA 3V7CA 4RGXA 1SD5A 3FMRA 3NEUA 5E1WA 3TOBA 3EYYA 3BROA 5LGNA 2JTVA 4L9TA 3I59A 3GFMA 1ZREA 2BGCA 3GW2A 3SZTA 1Z7UA 2PI0A 1J5YA 2EV0A 2FE3A 2ELHA 4EGZA 2ISZA 1QO0D 5LEJA 4HQMA 2V1UA 3PQJA 1G6NA 3NRVA 3G3ZA 4PZJA 2KKOA 1OKRA 2XV4S 1RUOA 4D0PA 5ICFA 2P8TA 3K9TA 2MD5A 1KQ0A 2CO5A 1P92A 3GLXA 2RC4A 3NQOA 5FO5A 1R58A 3SFZA 3GZ6A 1K78A 3I0TA 1QQIA 3HHGA 2A61A 5JI6A 3W6KB 1Y0UA 4PGGA 1QGPA 1KU2A 4IXAA 4KMUX 2E7XA 5H20A 3DV8A 1HSTA 1P6RA 2FEZA 1OR7A 1FYLA 2P5KA 3P9CA 2QVOA 2QYOA 1HSJA 4UVCA 4GXOA 1H0MA 1S7OA 5CVRA 3WTTC 5IT9Z 4L0YB 1O3QA 2MH9A 4AD9A 5HLHA 2DW4A 1LQ1A 2HGCA 3ZN1A 2IJLA 4MEYF 4RB0A 3U9GA 2V1DA 4AVPA 5LHIA 4GGGA 5CJ9A 1ONVA 5F6FA 3WE3A 1ODDA 1IRGA 3ECOA 3WGHA 1MGTA 2P5LC 1XD7A 3I59B 1UB9A 1LEBA 1IXRC 2FNPA 3LQRA 1SFEA 4LMYA 4F7ZA 3R61A 1EH7A 1MDMB 2FRHA 4ESFA 1S7AA 1B59A 3U2RA 4I01A 3BDDA 3LFKA 4Y17A 3WTZA 3FMQA 4MTEA 4WXCA 2EFNA 3RKYA 2P7CB 2D1HA 4I0BA 5ICGA 3QAHA 2F5CA 2QBYB 2Y48A 3C3WA 1ZG5A 2XGXA 5E18F 2FSWA 2IPQX 5AIQA 2VC1A 5L3DA 1STZA 5LEKA 4EQQA 3F6VA 3V8KA 1YG2A 4NQWA 3GFIA 2DTRA 5IT3A 4WK8F 2CW0F 2R3SA 3C18A 4YIIA 4P96A 2DT5A 2OD5A 4CO8A 4ZZLA 1XDSA 2MC3A 1O7LA 3G73A 2HTJA 4EM2A 3ZPLA 1J59A 2P5VA 4G6DA 4G7ZF 3C1DA 3CO6C 5HLGA 4Q48A 1F1ZA 3OOPA 2H94A 5ICCA 4IRIA 1J9IA 4CXFA 1FBSA 2J5OA 1SAXA 5D8LB 3JSOA 1FX7A 2V1XA 3ZP5A 2KIUA 3WG9A 4N9HA 1FZPB 5AIPA 2IA2A 2V6CA 3F6OA 1HQCA 3QP6A 2VXZA 2EK5A 2CFXA 3I4PA 4E70A 2HR3A 1IN4A 4HQEA 5LLQA 1REPC 4KYWA 3E97A 1J75A 1TQIA 5H6RA 1T6SA 2K7LA 3M8EA 5L3BA 5IT9K 1Z05A 3IRRA 3U1DA 1RUNA 2EFQA 2BV6A 1USTA 1MJAA 2CYYA 2MLKA 2DU9A 4QWQA 1P2FA 4O5VA 2EFWA 3KLOA 1ZYRF 4I2OA 5J8CA 2IRFG 2KJCA 3R0JA 1PP8F 4M6XA 5DD4A 1D3YA 2J5PA 2A07F 3E6BA 1Q1HA 2VC0A 3HUGA 5DYMA 4XBFA 1RI7A 2ESNA 4LG0A 3K1NA 3MFKA 3EQLF 3V8LA 2XVCA 3GYHX 1X3UA 2FF4A 2XKPA 1B9MA 2RGVA 3RYPA 3KP4A 3M9AA 1SD7A 2VT3A 1MJ9A 4M71A 2PBIA 5FGMA 4BQAA 2ZMEB 2CGPA 2H27A 3GVAA 2R7DA 3BY6A 4OOIA 4CGZA 3F8MA 1ZAOA 2F2EA 3J7AO 2W25A 3ELKA 4ENMA 3F8CA 2L02A 2NNYA 2L3DA 2ZKZA 5L3CA 2EFOA 3I54A 2FNAA 4I7HA 2KJBA 1OYIA 4YFXF 1QZZA 3V7SA 3SHFA 1K7AA 2RQPA 4XSXF 4RS8A 1SD6A 1A04A 3TO6A 3CUOA 1FC3A 5H6QA 2GAUA 2HQRA 3K1MA 3RKWA 4RAZA 3RDIA 4WF2A 2XAFA 3LA3A 4KIGA 3J80K 2L4AA 1ZGAA 1OYYA 3IHUA 3KP2A 5ED4A 4WWCA 1HW1A 1FSEA 3BP8A 4YFNF 2EA2A 2ACJA 1K78B 4IVNA 1W7PD 4OMYA 1KQ8A 3H3UA 2MBFA 4AWXB 2L01A 5DCMA 4HYEA 4HZFA 1U8RA 2P4WA 4EJVA 2DQRA 3ML6A 2NRAC 4BXUA 3F3XA 4L5JA 2F5FA 5E8IA 3GUDA 1XN7A 2LDUA 4HF1A 3H92A 3TO9A 1R00A 1NHAA 1B1BA 4BHPA 3QPHA 4L0ZB 2FBIA 5DUKA 3O2PE 2RKHA 1UFMA 2A5YB 3REOA 2DPDA 1BOAA 1GXQA 4LLLA 4A0YA 4A6DA 2XAQA 5F1RA 1UCRA 3V8JA 2QQ9A 4U88A 1UHWA 2LNBA 2HS5A 1YS6A 2YPRA 4XSZF 1GHCA 4U7DA 4IF4A 5BQTA 2IVMA 4DQ2A 1OPCA 3VODA 1R22A 4IRHA 3K2ZA 1BIBA 3RYRA 3AAFA 2XASA 2DLLA 3F21A 2QM3A 3FXQA 2LF7A 5K1YA 3VOEA 3BWGA 4Y15A 1BI3A 2E1NA 4BAYA 2FBHA 1YW7A 4R8HA 1IN5A 2KIMA 2HWVA 4HBLA 2OBPA 1PDNC 4UV8A 1YS7A 1LB2A 2YX7A 3OV8A 6PAXA 1HKQA 3E5XA 3PFIA 1ON2A 3DP7A 2WTEA 4MQ9F 2F5DA 5E1XA 4EM0B 2BBYA 1JHHA 5F64A 3VEPA 4EV0A 4HDVA 2ZNZA 2O0YA 3F22A 1SMYF 3TO7A 2QQAA 1WWXA 1IW7F 1DPUA 4IJAA 2RV8A 1D8KA 4WX9A 1TW3A 3KEOA 3ULQB 4ESBA 3KE2A 1FSHA 3SQNA 3J80Z 4BHCA 1J7KA 5JR3A 1KU7A 4IHSA 2M8EA 3RJPA 3RIRA 2M87A 3DEUA 3GFJA 4JK1X 4HLYA 1LNWA 3HYIA 3DFGA 4A5MA 1U6GA 3MQ0A 5ICEA 4A6EA 1DP7P 5ILSA 3HOSA 3ABTA 3ECHA 4L9NA 1SFXA 3F8NA 4M9ZA 2STWA 2M30A 3DXJF 1GXPA 3BJAA 1R23A 4OINF 5BOXA 4DNCA 1U5TA 2EFPA 1HXDA 3FMSA 3CDHA 2PLYA 4JQFA 1U3EM 1FY7A 5HLIA 1V3FA 5DD8A 4RB3C 2DPUA 4HV6A 4GO1A 1BIAA 5K5OA 4EGYA 1R1VA 1KQ9A 1SD4A 2Z3YA 1S8NA 2OU2A 3ZN0A 2PQ8A 1ON1A 5ILVA 4KMFA 1W7PA 1T38A 4FHTA 1S6LA 2Q2EA 4EJUA 2VBZA 2VONA 2PJPA 4N0BA 3E5QA 1T39A 1XGNA 1BM9A 2D2WA 4G6QA 3WE2A 4RGRA 1XGMA 3JTGA 2VOOA 3R60A 2YSRA 4G8XA 4EM1A 4ENKA 2Y75A 2EJRA 1F5TA 3K69A 3T1BA 4LK0F 2CWEA 2YR2A 5DUIA 3KZYA 4OIQF 2ZO4A 3B73A 4IHTA 1R36A 3CUQB 2EV6A 3I64A 1FYKA 4AIHA 1IF1A 3KFWX
chains in the Genus database with same CATH superfamily
3A8AA 5DJ7A 2FS8A 1D4PB 2E1CA 2PN6A 2A3SA 1K79A 2AMDA 4F91B 4X0WU 1HRTH 4JZEH 1C2LA 4IHXA 3BTLA 2Z9JA 1C1SA 3HPGA 3LSIA 2G5NA 5GTIC 4AYYB 3MCZA 4NSVA 1G3BA 4D7NA 3BG4B 1F43A 1O5CB 4ZYEA 3DBHB 3KQBA 4C3IJ 5EJZA 3BPVA 2W6ID 4O3MA 2ZJ2A 3F8FA 4ITVA 1C1OA 3H5NA 3RKQA 2ZGHA 3QU6A 3R0FA 4D8NA 5FPTA 5H4IB 3PMBB 1GHXH 3K4CA 1WZ2A 2DFFA 5C44J 1Y8QB 2WUCA 2ZC9H 1D3QB 1OYQA 3LPRA 2Y7ZA 2ZZUH 3KX2A 2VVVA 4F3QA 2HZDA 1C5RA 5J8FA 1BR4A 1X4OA 3GCOA 3PV5A 3QOEA 3R3GB 2ODPA 1DPRA 4E7NA 2OA4A 5FFZA 2QBYA 2GWRA 1MKWH 2ZDKA 1EP5A 4CDGA 5A8ZA 4AFZA 3ZMDA 4DGWB 1EZUC 4JOMA 2WV1A 3IV5A 2QA4I 1F92A 2ZWLH 1TQPA 1ENHA 3Q77A 3Q5FA 1VITH 3Q9SA 4GYIA 5HS8A 2OAZA 5B1BH 1D6RA 2HPPH 2NS0A 2F48A 2EA4A 5HS9A 4D7GA 1ZG3A 1LDDA 3GX4X 4Y0ZE 3W3CA 1K9OE 1QY6A 2L9RA 1S6FA 3WU2C 2FS9A 4CSWA 3S69A 4Z2YA 2LBFA 1KTTB 1H9GA 1RZ4A 1IRXA 4DVAU 4XOTA 2B63J 3MNXA 3S32A 1IQMA 1HKSA 1WGXA 3KCGH 1N8OC 1ARBA 1TW2A 2WB1A 1W13U 2DFHA 2OP9A 1JRTA 3I71A 1OWKA 4YFKF 2Q8KA 3BR3A 7LPRA 2WPMS 2M9HA 2CQKA 2MA3A 1ZJDA 1C2IA 2F4LA 4V2GA 1EPTC 4KISA 2K86A 2WAQN 5CVUA 3TGNA 2LR8A 4XD7D 2LH9A 4C3HJ 1UG0A 2AXLA 1FY3A 4J2YB 3P17H 4BNCA 4GDFA 2Z99A 1WUNH 3WTVC 3EE0B 5LPEA 5E0GA 1ZN2A 1WRJA 1GI9B 4D9RA 3GCMA 1HIAB 2AO9A 4GCVA 1SGFG 1Z91A 1WCZA 4CHUA 2SNWA 2KIFA 1TPAE 4Y10E 2ZBKA 1GVDA 4OAZA 1K6YA 2BMGB 3F23A 2R7QA 4X2YA 2HXOA 1G2HA 4UHTA 4AGJA 4K1SA 4H0EA 3HRTA 2HVQA 2R7RA 1TOCB 1ZELA 3HEFA 4ZYGA 2A69F 3S3MA 1QJ6B 3KEQA 1NESE 3FFGA 3EDXB 1N75A 3RXQA 3VWBA 4C9YA 4YELA 1NRNH 2VIOA 2Y5GA 3P70B 1FAXA 1BL0A 4UNOA 1DWDH 3OY9A 2M4GA 2TGTA 2I5UA 2V35A 4L5EA 1QHRB 4JX6A 1GMHG 1LVBA 1CGHA 3SBKA 3UKGA 1ANDA 2YOLA 2BHGA 1BW5A 4Y7AA 1UTMA 2A2QH 3A84A 3LONA 4UEHH 1ZGVA 3SGBE 1EH6A 1AUJA 3HATH 2VVUA 3KP6A 3AG2H 2R7OA 1QPMA 1GBTA 1LPGB 4ABGA 1JT0A 1LHDH 7GCHF 3ZQHA 2CMPA 4AIJA 1EXFA 3ZVFA 3ZZ7A 1C2HA 3E5UA 1ELEE 1XXDA 2XAHA 4A2UA 3MH6A 2KZGA 3CP2A 4FVBA 1K1JA 2FMLA 2L4MA 2AIQA 4A6LA 4LLGF 1SC7A 2W84A 4WXHA 2VIDA 5KECA 2PTNA 2H6BA 3FDYA 2Y2ZA 2V9VA 3RXBA 3A7VA 2BLWA 1XKBC 1PQ5A 1SFUA 1S0QA 2IEKA 5D6EA 4MG3A 3EGKH 5E8GA 1F0SA 4XKVA 1FP1D 3OIOA 2WZQA 3OL3A 1XCBA 4LOCA 4C2UA 4IRGA 4KDPA 4FT8A 1X1DA 1AZ8A 4A3GJ 5JHFA 2QY0B 1O2HA 2EV5A 2IGKA 1F5RA 3GO5A 4KICA 3HOZJ 3MZ8A 4C2MJ 4K60A 2K1QA 3L7WA 4I6ZA 1O2MA 3F2GA 4XLPF 1MD0A 5L3GA 2Y82A 4X1RU 3H5AA 2BE5F 1RR7A 2PJRA 1F4KA 3H9JA 2GV7A 3K1PA 1X58A 4LIVA 3UOPA 1Y3UA 3SZNA 1GJ4H 2E1MB 3IWMA 3M36A 4L9VA 1RIOH 2JZYA 1IXCA 1SKYE 1T98A 3PIOF 1BRBE 1U9OA 4OIRF 3WTSC 3AAUA 1ZLRA 3BCAA 1TWHJ 1AUTC 3OYKA 4OU0A 4ANJA 3A85A 2MFZA 4LG0B 4LITA 2FOGA 2X6OA 1P04A 3CDLA 2P6SA 3F3BA 1ORKA 2P3FH 4I98B 3CLOA 5FX6A 2JWTA 1ELCA 1DDJA 2XF6A 1QIXB 4B6FA 4G7HF 2VGCB 1TQ7B 4CRGA 3BEFB 1T31A 3TQNA 3NAUA 2NS7A 1IOEA 1MBQA 1YLNA 1BMNH 4DIIH 3A7YA 2L7KA 1SR5C 2HQAA 5LFAA 1TRYA 1J2XA 1GMDG 3RXLA 1OQYA 1V5GA 4FX4A 3OWTA 4L5IA 1CO7E 1MBJA 3QOPA 2DE9A 1ETOA 5AFYH 5EG4A 1W0KD 3UIRA 3IKTA 2AHQA 1KIGH 3C1KA 4HA8A 4QPOA 4B74A 2Z9LA 1A1RA 1SGFA 3RZDJ 2DODA 2NNNA 4MTBA 1Z1JA 3GYMA 3M61U 2QF4A 3B9FH 2ZA5A 3S2HJ 2XPWA 4OGXA 4LB5A 5L3FA 3DT0H 4ZHLU 2KISA 1SGRE 5A0BA 8ESTE 3FAOA 3S8PA 4JCNA 1AHDP 3A7TA 2DMPA 3F9KA 2BD2A 3TK5A 3DKYA 4LGWA 3VFZA 6CHAC 4S04A 3O6BB 1K1IA 1SAUA 1W7PB 1LKBA 2XGDA 1W5TA 1BTYA 1DU0A 2A5IA 3DHKH 1Y56A 5L3EA 3CMAI 3S15J 2G7UA 4XICA 3MI4A 4B1RA 2DO7A 2NVQJ 2H2ZA 4E06H 3W6VA 3ITIA 1AKSA 1LKAA 2XB5A 1T08B 5TGTA 3SOSA 3SDBA 1O5BB 1AO5A 3JCUC 1L3LA 3PNTA 5JB8S 2BLQA 1OS8A 1K6OA 3ENSB 3AG4H 2ZFPH 2WAQA 4NA7A 3MEXA 2KRFA 5C1UA 3M3YJ 2V79A 2WUBA 2ZKSA 5J6XA 2DOAA 1NU7B 3GZ5A 1FT9A 2IA0A 2HTSA 4ZTJA 2CV3A 3PMJA 1P2OA 4HZHA 4MHGA 4WJG2 3BG4C 2BVMA 1C5YB 5T6FA 4DW6A 4CCKA 3PNVA 9ANTA 2O6GE 1RESA 1HKTA 5IYCJ 3L9FA 3FP6E 1O3MA 3HKIB 4ETSA 2EB7A 1JGSA 2OC1A 4O03A 3HOXJ 1TE0A 3C2GA 1C1PA 2TRTA 3BZCA 5J1YA 1EOLA 1ZR0A 2GQQA 5M5XJ 1ZPCA 5D4RA 4BS9A 3ROUA 4DURA 1LVMA 1P02A 2K3FA 2V0BA 4ZYHA 1AE8H 1JTYA 3EETA 2QENA 1XVOA 2ZC2A 3EYIA 1VI0A 1OCOH 2FPZA 3M37A 4FQGA 2HYJA 3IAS2 1J8AA 2JSCA 3OR1C 1ANBA 9ESTA 4OS4A 2LLKA 2O3FA 2BDBA 5LPFA 1HBTH 2JVHA 2KCAA 4YM9A 4XORA 1RTKA 1H9TA 2JVGA 2HPIA 4ASNA 4DBQA 1O31A 4FUCA 3BG3A 5GAHJ 3C2HA 3A01B 4DT4A 1HXEH 1Z9CA 1LHCH 2GLOA 1UCYE 1H9LB 3OX7U 1O3HA 4Y7NJ 1FJLA 1HW5A 3E6CC 2GIVA 3TH2H 3EUHA 1OX1A 4NA8A 3HK3B 1GHVH 3UUZA 2TRMA 2WSSD 3L00A 2DA1A 2PR3A 3TNSA 1P4AA 3BTDE 5TCCA 5FAHA 3O8DA 1UCYK 1YFHA 1KY9A 1VZQH 2R7ZJ 3U1JB 1FPQA 4O6JA 5M3FJ 2V6NA 3DEWA 3HRUA 3BG8A 2R4GA 1IXSB 3WGGA 3UWJH 4TT3D 3H0GJ 3J81K 1XMAA 4KIFA 4B44A 3NKKA 3QLPH 9LPRA 1YO5C 2DK8A 3IL2A 3ZMZA 4LK4A 1W36D 3ZMTA 1W5CC 2Y7XA 4BACA 1P57B 2GD4B 1OXGA 2BD3A 1C2DA 3HOUJ 3FISA 1H8HD 2FOAA 4DZPA 2N8GA 2STAE 4OGYA 3AK5A 1MW7A 2OQGA 1X7AC 1KONA 4G9YA 3A2KA 2KFWA 1O2UA 1KXEA 3RQ4A 2DFIA 3JRIA 1NROH 1QL7A 4BNRA 3TH3H 5J3LA 5JVGF 1T33A 2EIMH 4PJMA 2A6TA 3WHCA 2P81A 1O4XA 2O8KA 1WJ5A 3OEED 1EB1H 4Q7ZA 4ZJZA 3HOVJ 2K9NA 5DM7F 1O3GA 2WWYA 1QVUA 1SQOA 2GVFA 4C30A 3WODF 4K69A 3M3SA 2TCTA 4XRMA 1WTGH 2KL4A 3GISB 4HG6A 2UXXA 3F72A 4AIKA 1ZPBA 2PUQH 3GCTG 4DIQA 4R0IA 3GF2A 1KA8A 4HAMA 4ENJA 2D1VA 4F4OC 4PCQA 2AFQB 1O7FA 2O8WA 1ZKGA 2VBXA 5EXNA 1SGEE 4RKOB 3DKWA 2Q1JA 2WYJA 2CQXA 1GBJA 4WMDA 2VQCA 1OOKB 1QQUA 1Z3XA 5LGNA 1V5FA 2QKLB 4Q4LA 3GW2A 2RA0A 1RIWC 5HNFA 1KYNA 1MU8B 4I31A 2O9QA 4NC7A 4WXVA 4HQMA 3PQJA 3NRVA 1JOUB 2ZJPF 4PZJA 2KKOA 3KN2A 1SOTA 2XV4S 1LUJB 1RUOA 3K9TA 1GBLA 1KQ0A 2CO5A 2FLRH 2F4OB 1E36B 2RC4A 3CESA 1QL8A 1V54H 1R58A 3SFZA 1ACIA 1C2KA 4FISA 3I0TA 2VJJA 2YMSD 2KMUA 3RU4E 3BTHE 2ZPQA 5JI6A 3W6KB 1X3WB 1QGPA 4KMUX 1SGQE 2KRHA 4JK5A 1P01A 3KQCA 1P6RA 1N1LA 1D0ZA 1H8DH 1A46H 3ONQA 2QYOA 4GXOA 1ABIH 1QGFA 1BR2A 3OYHA 3L2WA 4BTUB 1VQ9I 2V1DA 2EPFA 1MU6B 3OYLA 5EF6A 2V26A 5F27A 1ODDA 2Z9KA 2AGIX 1DS2E 1MGTA 3RSNA 2P5LC 2VQLA 1A3BH 2VJ1A 3KNXA 1ZR4A 5DS9A 2XNIA 2E71A 1VQPI 1B0EA 3LQRA 4F7ZA 3R61A 1EH7A 1MDMB 1S7AA 1S7EA 1C1TA 4GVUA 2A4OA 2PUXB 2ZTXA 2VKEA 1EUFA 1GHWH 4WMEA 2R7WA 5KGOA 2CRGA 4NSYA 4MTEA 4WXCA 2ZFQH 2P7CB 2D1HA 4I0BA 2F5CA 2QBYB 1C4V2 3HOWJ 2R7UA 2XGXA 4NG9H 2IPQX 2E35A 2VC1A 1STZA 3PUBA 3JRDA 1YG2A 3FXLA 5ETXA 3SN8A 5GXPA 4A93J 1OCCH 5HGGA 2DTRA 3OYCA 2FTMA 4YIIA 4FUEA 3BTTE 2DT5A 2OD5A 4ZZLA 3CMYA 2VIXA 3L6PA 4AU7A 1NG7A 3ASOH 1PYVA 1AFQB 5K7FA 3ZV9A 2ELJA 4DBRA 1O7LA 4ZDOA 2IN2A 3G73A 1ACBE 2XF7A 2Y69H 2XNDD 2CJIA 1D0YA 1MABB 3PJRA 2K5CA 2BDAA 3CZ6A 5IPAA 3DTKA 1F1ZA 3ELAH 5ICCA 1WJEA 4VGCB 3SORA 1RJXB 5FL7D 3JSOA 4M3BA 3ZRGA 2HPQH 4N9HA 1TWCJ 5AIPA 2IA2A 3F6OA 3PO2J 1NRRH 5CMXH 2Q6DA 5EGOB 1IN4A 3CLQA 1SANA 2Y9ZA 2XBWA 2EI8A 1TQIA 3LGIA 5DN6D 1AI8H 2K7LA 5IT9K 4BBSJ 1L0ZA 3ESWB 1MNMC 2A7CA 2GIZA 2XBXA 1MJAA 2VJ5A 2MLKA 3ZVAA 3FXKA 4O5VA 1K21H 3ZV8A 1PJPA 1GJBB 1A2CH 4I2OA 1THRH 5EIYA 4CBNA 3OYFA 5CKTA 1PP8F 3BZKA 2DA5A 2VINA 1N6XA 2J5PA 3E6BA 1YGCH 4YEJA 1HAVB 4D7FA 4XBFA 1A0HB 4LG0A 2LRDA 1C2EA 3K1NA 1IQEA 1NO9H 4A69C 2SGPE 1CT4E 3UPEA 1B9MA 5IOYA 4BE2A 1TOMH 3RQIA 1GG6B 4FU8A 1Y8RB 3OL4A 1L1NA 3ESTA 4BQAA 2CGPA 2A31A 4AUXA 4LIUA 4D9QA 2B9SA 4KELA 1O3OA 2XSDC 2BTCE 4AN7A 1HDDC 4ENMA 3OY5U 3OYPA 5GCHG 2NNYA 1VNDA 2ZKZA 3D49H 4UE7H 2ZDLA 5J4QA 1CVWH 2O8MA 1QZZA 3KQDA 4CCJA 1GI4A 4XSXF 1QB6A 4RS8A 1A04A 1GBDA 2FLBH 1X1PA 3CUOA 2GT8A 2W3IA 2ZHDA 4ZUHA 5IYDJ 1C2MA 3DU5A 2JJ1D 4HSTA 3RKWA 4WF2A 3TBIA 1ANEA 3LA3A 5GTHC 1ZGAA 1OYYA 1TX8A 3K4NA 2W7UA 4ZHAA 2Z9IA 5ED4A 1TGNA 4WWCA 1HW1A 2MGQA 1FSEA 4YFNF 1VCQA 5L2ZH 3NXPA 4E7KA 2BDYA 1X3ZB 1ETYA 3RXOA 4OMYA 3F0PA 5IDKA 2L01A 1S72I 4HZFA 1V6DA 3EA7A 1ESAA 3QWLA 2H1UA 3W2WA 4L5JA 1V2JT 4B6EA 1XN7A 4HF1A 2VXDA 3QDZB 2VKVA 3H92A 1NHAA 3IH2A 3LH3A 4BHPA 3QPHA 2FBIA 5DUKA 3CCYA 5GJ4B 2DPDA 5K7RA 1BOAA 2C93B 2YUSA 4A0YA 1NH3A 5T3HA 2XAQA 4ZC3A 1UCRA 1JIRA 4U88A 2M0CA 1Z8IB 1JUMA 1UHWA 4B47A 1BTZA 3MO3A 2H1LA 5LH8A 4IF4A 3H9QA 4FU7A 2IVMA 4DQ2A 3VB6A 1YCPH 1BIBA 1PFXC 3AAFA 1UO6A 2L5QA 3FXQA 3VOEA 1KMHB 5DKMA 1BI3A 1UTOA 2BZTA 2CV2A 3A87A 3CJRB 4IEJA 1E0EA 1TPPA 1BQYA 2ZG0H 4NWLA 2FUG2 3GTOJ 2OBPA 3K2UA 1Y5BT 3KIDU 3A8DA 4DJZB 1HKQA 1JKRC 1ON2A 3LJJA 4ABHA 2WTEA 5C3NA 1BUIA 2DA7A 2FYRA 2V4JC 5E1XA 3B6CA 2E2HJ 1FY4A 3IAM2 3JRGA 2ZNZA 4CZCA 1MTVA 4Y71A 4J00A 2OC7A 4IJAA 2RV8A 2CK3D 4ESBA 4Y0YE 1SC8U 1KU7A 4IHSA 5GIBA 2R7XA 4LG3A 2BY2A 3GFJA 3P92A 3RXAA 4HLYA 5A09A 2AERH 1QRYA 4A5MA 1U6GA 1JGGA 4DT7B 3MQ0A 4DYQA 4A6EA 5DSFA 1EOJA 3PSFA 1JIMA 1C1VH 1LQDB 2J97A 5LD2C 1Y39A 2JJ7A 3LT3A 2OINA 3I29A 4N4NB 3L2VA 2A0QB 1P7IA 2STWA 1MNDA 3RMOH 2BY3A 4DNCA 3U1KA 5GAGJ 4WY3A 4TWYA 3FMSA 3SUEA 3RXDA 5HLIA 3OYEA 1QZEA 3K6ZA 3ZN0A 3SV2H 2HALA 1ON1A 5EDNA 1W7PA 1T38A 4Z6AH 3FP8E 1S6LA 2XC0A 2Q2EA 3F0OA 2VONA 3RP2A 3M7UA 3TU7H 1TMTH 2JSPA 4IBLH 1IRZA 3PMHB 4G6QA 1SL3A 1IHTH 3AW0A 1FI8A 4ACBA 5GPAA 4INKA 2VIWA 4ENKA 1GBMA 1BHXB 2W82A 2YR2A 1T4UH 4OIQF 2ZO4A 4RDUA 1R36A 2EV6A 1WCMJ 1GI1A 3E0JB 3ZVCA 2R0LA 1PP7U 2QC2A 4UD9H 3FXRA 1WAYB 3HB9A 3A8BA 5AVDA 3Q0WA 2WADA 1T0FA 4XBDA 3HRSA 3TJOA 1BC8C 5ERIA 3K9XB 3FHZA 5EXLA 3HGNA 5M5YJ 1O3KA 2QF5A 1UTLM 4G94A 2VNTA 1OWDA 3CCLI 2CQNA 2HYFA 1D5YA 4UFFH 5EOKA 4KN7X 4A0ZA 3E0PB 3CP8A 2WC2A 2BVRH 3EDPA 3RXFA 1SHYA 4WMFA 3SHAH 3LSHA 1P2MA 1TT0A 2IGOA 1T8MA 3ZGKA 4ZKOU 2Z16A 3RXUA 3M3VA 4CREA 2Z1DA 1MAXA 2O61A 4HG2A 3K0LA 1O3TA 1DUXC 1OCZH 2TDXA 1QU3A 4THNH 1VTNC 4AZ2B 4XLNF 2YX4A 2VH0A 3M3TA 5C67A 4HW0A 4BE1A 2NVTJ 5GADJ 4MPUA 2Y80A 2C8WB 2FXRA 2ZFUA 3D23A 1SBWA 5C4JJ 1IV6A 1ZG1A 1J0RA 3HBLA 2D1JA 4XKWA 4H6TA 3FZVA 1XGSA 4WXDA 1UVSH 3HGYA 3W95A 1NBMD 5E1ZB 1YITI 3QPSA 5D5VB 3HL2A 2SFAA 1NU9A 5DCFA 1YC0A 3HC7A 4YIRX 4XK4A 1LO6A 5CQEA 3DBLB 4TWWA 1GBAA 2THFB 1IC8A 2VBCA 1O3SA 1GWAA 3WW7A 4IHYA 2E36A 1V2QT 3DLAA 2BOLA 2W00A 1N6YA 1K28D 4HDUA 4B2BA 2FM2A 4AM3A 2FMYA 2HXIA 2EQRA 4B73A 1HB0B 3IG6B 1S0RA 3BJOA 1VJAU 1KGSA 3G4SI 1AQ7A 2ZDMA 2F9NA 2XXLA 3OYNA 5M5WJ 5HIZA 4FETA 3MNSA 5DK1A 1ABJH 3A1YA 2BEOA 3TJVA 2COMA 2XB0X 3FXOA 3SGQE 1QB1A 2L54A 5TRDA 5FCKA 3LA7A 2HZTA 4EMSA 1E0FD 1MBKA 1B9NA 5BPIA 1FBUA 3QZRA 1OCPA 2Q1ZB 2V7FA 4EJWA 1W12U 5F8ZA 4K2YA 5FB2A 2F5EA 4Y7BA 4RAGA 3SU4A 3LGYA 2DTZA 3GEZA 2KX4A 1P4WA 4YESB 1AKHA 3VGCC 3LDXH 4DGJA 3JREA 1MSEC 4LZ1H 3P9IA 1XUIA 2G7HA 3SV9A 1MKXK 1WYKA 3CS0A 1I3AA 1SEUA 4RB1A 3ZZCA 2RA3A 3GCTF 2DK5A 1Q2WA 3LWFA 1ID5H 3F8BA 3K10A 2QV1A 1FWZA 2YMSB 1BTPA 3MH7A 1Z8JB 5AHGH 2K27A 3DEEA 5C0UA 1Z3YA 1RNLA 1P09A 1TALA 2LKSA 3N97A 2BD5A 3KYLA 2MSYA 1ZGWA 2X9DA 1E1QD 2CV1A 1BW6A 2Q0OA 1CQQA 1MD7A 5D5UB 1ZMLA 1C2GA 2F4IA 2KFDA 2VODA 3L09A 4C3JJ 3GY2A 1YTYA 1C5MD 2AH4X 2JRTA 2ZNYA 3OYDA 4IHWA 1FY5A 2W7SA 2VIQA 5LHHA 3OR2C 1AE5A 5DDGA 1FP2A 3TITA 2VL8A 1EPTB 6LPRA 2NAZA 3K4JA 1ZHFA 3J7AY 3SZPA 1GJAB 1U5TC 1TX7A 2VN2A 1LFUP 5E20A 3ZZ4A 1USSA 3H5RA 3A8CA 3GDVA 4G12A 4XLFA 2M5WA 2R5ZA 1NK3P 1IN8A 2XAJA 5J40A 1A5HA 3BIVH 2DT7B 2FOWA 4JYTA 2ZHFH 2GA1A 4LOYH 2OUAA 4Y8XA 2PW8H 2XC5A 1UTNA 1NRSH 2ZFFH 1A5IA 1MCVA 2R5YA 1R9TJ 2CUZA 3F2HA 3SI4H 2HFHA 2R7FA 3KQ5A 2VPRA 1E17A 2NU1E 1XSDA 3QX5H 2BQ6B 5FHTA 1U5TB 5C5NA 3CTAA 5JLXA 3J81Z 3RKXA 3VB5A 2ZDVH 5D5WB 1QA0A 1FXYA 2O03A 3CD6I 3S16J 2OC0A 4HX7A 1BI2A 1CA0B 2QAAA 3TDZC 1SQTA 2FOKA 2GKVE 3CC7I 4Q47A 2G51A 1LE8B 4CHAC 4KJZA 2A05A 4JZ1A 4NIXA 2VKDA 3I3LA 1KLTA 2WPLS 3MNCA 4O97A 4MQVA 1FLEE 2B9LA 2BQ7B 1W0UA 2JETB 2ME0A 3G1LA 3AVZA 2Z3CA 5GDSH 1OMIA 3O3KA 3VSLA 1O2VA 3E90B 1UTQA 2ZCLP 2HKXA 3GTQJ 1BJVA 4A0XA 4LD5A 2WPHS 2A68F 2DYSH 4TSFD 1P8VC 1P9SA 1W0YH 2QUFA 2Z3DA 2DMNA 1PUEE 2UZKA 3RC4A 1H4WA 3OYBA 3J7ZI 1MTWA 3NWSA 4Q80A 1WDIA 1MMJN 8GCHF 2ALVA 4AG1A 1KYZA 3ZVDA 5KNLA 5DM6F 2BY5X 4MLFB 1WH7A 2FU4A 2RG3A 3HSFA 2ZNKH 2QIQA 7KMEH 3SDGA 4A5TS 1UHSA 5E3LA 3I58A 5F8XA 2W85A 1FN6A 3SNBA 3PQKA 5DP9A 1ULYA 2CH0A 3N05A 2XRNA 2HOEA 1RFNA 4RGSA 6CHAB 2ECBA 3FK6A 4CRCA 1OYTH 4K2EA 1HCGA 1D8JA 1UHBA 3QK1A 1GI2A 1GDQA 1QHHD 2B8OH 1ZOMA 1I1GA 3IC7A 3JAMK 1TGCA 4ABDA 2PGQB 2ZHWH 5CPRB 3PMAB 2ZCWA 1XVMA 1RTFB 5F0FA 2E7WA 4UB6C 4OAYA 1TONA 4I7YH 1RGQA 1YOVB 1BMLA 3Q9VA 1YLDA 1TC3C 1VKYA 1TWFJ 1LVOA 3WTYC 4Y6DA 1ZRFA 4M3GA 1YX3A 3DUXH 2VQHA 3WTXC 3VB4A 2ID3A 4ZCNA 1SOZA 3BT9A 2BD8A 3CCJI 2QCYA 3T0YA 1OSSA 2JA2A 3ZQ7A 2FD5A 3A02A 2ASUB 2OC6A 2WAFA 2KT0A 1DE7H 5E0JA 1SQAA 2PMUA 4F49A 2JMWA 3HRMA 1NBME 2Y5HA 1Y3YA 5FBEA 3GZNB 7ESTE 1A35A 1NK2P 2X1CA 1EJMA 1BRCE 1GCTC 1HAGE 4M6YA 2MH2A 5GCHF 3EUAA 2D2DA 3KZZA 3ABKH 3CS7A 4U30A 3BIUH 1XUGA 2EINH 2VBYA 1TLDA 3R6SA 3WU1B 5CVIA 1QJ1B 1DSTA 1WV7H 2PV9B 3PIPF 1GBFA 3PTNA 4P9FA 3T8TA 1AU8A 2STTA 3U69H 3OU0A 2B7EA 4RAYA 2BY7X 2KAIB 3ZQQA 1MBGA 5B6OA 3CCEI 4OMZA 3MZYA 2HYGD 2BD4A 1H88C 3ABUA 2Z5UA 1G3SA 3T5FH 2HPMA 2JA7J 4UUTA 3UR3C 2HI3A 4IN2A 2XCNA 2R2MB 2GXGA 4OS5A 4HI3A 4SGBE 2XAGA 4NDLA 1I6XA 4X6AJ 3M5OA 2LELA 1HXFH 3JRFA 1ZSKA 5D4SA 1Z77A 4RM3A 4ON0A 2R93J 1T4VH 5IP7J 3FX3A 2C3SA 2EIKH 1GBEA 4A5NA 1QZYA 1BJAA 2XCFA 3A03A 1C1QA 3BR6A 1CF7A 4KA4A 4M73A 1OWJA 1EKBB 2AMQA 4XKBA 2GZ7A 4QT8C 1S5SA 4NC8A 4E7RG 1C1MA 1LE8A 1SMFE 4MGRA 4KNYA 4G6TB 1C1NA 1EV7A 3RPQA 3K65B 3FKSD 3B02A 1S83A 1FLIA 1R5ID 4DYCA 2WBMA 4CYCA 5C5OA 2AS5F 1MH3A 1EB2A 3LMMA 2VIPA 3SUGA 2VKHA 3KGPA 1UHMA 4GCHG 3FZZA 2LOOA 3H3ZA 5HOOA 5JDUB 1LPKB 3H5CB 2WAEA 4UUVA 1SG8B 1R1TA 1V5EA 3LSTA 1C1RA 4LB6B 5LHGA 2XOKD 5B1AH 2GA2A 4N4OB 1O5DH 1EP6A 3SNEA 2QF7A 2OF7A 3SJMA 3L1PA 1KTSB 3KETA 2G9WA 3I4NJ 2G52A 1LHGH 2DA3A 1ZRCA 2W57A 4A12A 1P2KA 2J98B 3ZMVA 2ETHA 1YX5A 3JTHA 2ZGJA 3LSRA 3TMOA 1SGDE 2LTPA 2BD7A 3VSKA 4HF2A 3ZQLA 1GBCA 3RU4D 1LDJA 1ZARA 2VWNA 2F9OA 2XDVA 1TQMA 5CVVA 1O2NA 3FM3A 3IUOA 3P8NA 3HJEA 2EZKA 1OWIA 5F8TA 4KTCA 2B5TB 4KITB 4V19K 3PLKA 3JSPA 1IO2A 1SFIA 2M5TA 1V2TT 3QP5A 4Y11E 1YKTA 1AWHB 1BBYA 1GDTA 4X6PA 5C0TA 3MU4A 5D8KB 4RI0A 1SLVB 1R7JA 1SGTA 4U0VA 1OFCX 3LC5A 1H8ED 3F1SB 3RXMA 2XGEA 4HOBA 4M3DA 1PPHE 3M8FA 4HLXA 3PWBA 1IQFA 3GCHB 3SUDA 1BHXF 3HSEA 1MBEA 2QQBA 5FD6A 1ZGJA 2JN6A 2XWBI 2NYXA 1XPXA 1LDKB 3BTFE 3DFLA 2FI3E 3KYGA 1FTTA 1VQ8I 1O5GH 5EEGA 2ZJQF 4P1WA 1POGA 1BRUP 2E1OA 3FXMA 3ERED 2SGDE 4JZFH 4X6OA 3U98H 4QLCU 1BN5A 5FLXZ 3T2NA 2ZGXH 4CA0A 2K9QA 3DPTA 4Z0KA 4ZYDA 1PYTD 2IAIA 1C0WA 4IW4E 4UFGH 1OHHD 4PGHA 5JVTA 3ERMA 4B71A 1PPEE 3ABMH 4F93B 2CG4A 1P2JA 4PUSA 4HGCA 2K85A 3BTWE 3ASNH 3V7CA 3NEUA 2PKSC 2PX9A 5J4VA 2ZGBH 2A4QA 1D6WA 4AORA 4BQQA 1RS0A 3RM0H 2JTVA 2R9PA 1M1EB 3V13A 1GGDB 1ESTA 1JKOC 1ELDE 2FE3A 3SV6A 2OXSA 2QYIA 4ZXXH 4EGZA 2AEIH 2UV1A 2V1UA 2JQ7A 3B8JA 2ODYB 1OKRA 2A5KA 1LDTT 1H89C 2MD5A 4AG2A 1G3DA 4CRDA 1IQNA 1W0JD 1P92A 3GLXA 1VR1H 2G00A 5EJ1A 3NQOA 2EA3A 1WJBA 1Q31A 4FU9A 2QXGA 3HHGA 4HEA2 1FPHH 1TWGJ 3L2UA 1RKTA 2X6YA 1PQ8A 1KU2A 1XKAC 3FXJA 1HDPA 2FEQH 5H20A 5IY5H 1HSTA 4E7JA 4E7LA 1C5NH 1OR7A 2P5KA 4H6SB 3P9CA 1HSJA 2DMQA 5FKLA 4IC5A 1MTUA 3N7OA 2XSJC 3P95A 1H0MA 1S7OA 5CVRA 1EQ9A 1BB0B 1BA5A 3ZVEA 4L0YB 1TZLA 3L2RA 2MH9A 4RLQA 3DSGA 2DW4A 1LQ1A 2HGCA 3A81A 2IJLA 3NPSA 1MIJA 2QGUA 3U9GA 1C1UH 2KIQA 5EPNA 1ZTRA 1IRGA 3WGHA 1XC5A 1FIAA 2ZIQH 1PVEA 2VASA 3OS0A 2CHAB 2BZAA 3H36A 2M4KA 1ITYA 4I8KA 2MG4A 5HLTA 4A3MJ 1SFEA 2FRHA 2F4MB 4ESFA 1TNHA 1B59A 2BY8X 4I01A 1W10U 3BDDA 3LFKA 3SU5A 3FKIJ 1APLC 4Y17A 5KHDA 4UDWH 3JRHA 1G8XA 4AYBN 1SVPA 1GG6C 2FOCA 5DG6A 3RXIA 2FSWA 2ZPRA 4X8VH 2C8XB 2P95A 5L3DA 3ZCOA 5LEKA 1G32B 4XRSG 4XN0A 1OWEA 1GBBA 1I39A 3O8CA 4NQWA 5FRNA 4WK8F 1GBHA 1MBFA 4CUGA 1WH5A 2V9PA 4AVZA 1UK3A 4HNVA 2V9KA 2OTJI 4EM2A 2P5VA 4G6DA 4G7ZF 3C1DA 5ABWA 5HLGA 4Q48A 4AC9A 3OOPA 2AYWA 2H94A 4IRIA 3DD2H 3HGPA 2J5OA 3SUFA 2V1XA 3WG9A 3TNTA 4AIDA 2L9NA 2ZU2A 3QP6A 2W7NA 1ZJKA 3PO3J 1IHSH 1GBIA 5T6GA 2IJD1 2CFXA 2FOMB 1GGDC 2HR3A 1O3EA 4HQEA 1V2ST 1REPC 5A0CA 3S93A 3S2DJ 3TH4H 1J75A 1T6SA 2GMTB 5EZGA 5L3BA 1G2LA 4NC6A 3IRRA 4ZTFA 1RUNA 2EFQA 2CYYA 2KDZA 1KXAA 1QBOA 1O3IA 7GCHG 5SGAE 3KLOA 1B5GH 4WWYA 4ZYAA 1HAPH 1RTLA 2QN5T 1ZR2A 2I6SA 1A5GH 5DD4A 1D3YA 2A07F 2I10A 1O34A 1Q1HA 5DYMA 1LHFH 4XLAA 5EG0A 4C2TA 1TT5B 3S9CA 1X3UA 1ZTJA 3FHNA 3PL8A 2XKPA 2TBSA 4A3FJ 4X2XA 2J4IA 2VT3A 4MFEA 4YOIA 2PBIA 4XKCA 2H27A 3GVAA 3P5JA 4WXIA 1PUFA 3BY6A 3ODFA 5M3MJ 1GV2A 3ZYDA 2AQEA 3BG9A 3UR9A 5DGJA 3A82A 3S7HB 4IHVA 2F2EA 3J7AO 3ELKA 3SQEE 3VEQB 1O39A 2K3PA 2L3DA 3MMGA 5L3CA 2KCOA 5FBIA 3DWLE 3UFAA 1E37B 2FNAA 3SZGA 3OYIA 2KJBA 1OYIA 1MNEA 1DITH 1Z6JH 4YFXF 1EJNA 3V7SA 1A4WH 1A6IA 1SD6A 2BHYA 2MD0A 1ETWA 1EKEA 1TP4A 4A1VA 1MBMA 1FC3A 5H6QA 3M35A 2ECCA 4MO7A 4RAZA 5H2FC 2XAFA 1GL0E 3QUMP 3LSJA 3AL0B 1K4TA 3KP2A 2BM2A 3BP8A 1EJ9A 1A6QA 1CE5A 1GPZA 4BAKB 3ZOBA 1D1AA 1FIPA 3ZVGA 1SLXB 1UJ1A 1IUFA 3MH4A 1SSXA 3H3UA 1FAKH 1RRKA 4HYEA 3KYFA 5B5EC 4QPQA 1TB6H 4BXUA 1RD3B 1WJFA 3GUDA 2H9EH 2VVCA 1TGSZ 4KTSA 4BAHB 5EODA 2E5ZA 2G55A 1R00A 3EAJA 3BR2A 3O2PE 4X0GA 3GTPJ 2RKHA 1YJNI 1UFMA 2QEXI 4TY7A 3REOA 1BMAA 2DMUA 1YCPK 4A6DA 1L2EA 1O30A 1K1LA 2ZXHA 4QIWN 2YNBA 3T28A 4NA9H 2HS5A 1GHCA 4U7DA 2VLAA 1OCRH 1SB1H 1Y5AT 5BQTA 1DX5M 1OPCA 3VODA 5B3SH 3RYRA 1LQEA 3UB0A 4AFSA 1TMUH 2JH0D 2VWOA 2BB4A 1DWBH 1H9HE 2SGEE 3V12A 1D9IA 4B3AA 1DY9A 4BAYA 1B72A 5FPSA 1IQIA 4QSHA 4R8HA 5IP6A 1Y0NA 4RM2A 3VG8A 1KZHA 2CUFA 2HWVA 1A31A 3BF6H 1LB2A 2YX7A 8LPRA 3PFIA 1TABE 1KSNA 3H0DA 1P9UA 2HDWA 4NFEA 5GAEJ 3V3MA 1S81A 1P06A 2FX6A 1RXPA 4Y33A 3BCBA 3MFJA 3VEPA 1DM4B 2Q2EB 2IGNA 2ZU4A 1GT0C 1FIZA 4HDVA 1SGCA 2ZSHB 5J4SA 5L30H 2O0YA 2W1OA 1AZZA 3TO7A 3DU6A 1IW7F 1BMFD 1ZGIA 1TW3A 4Q7XA 4BU2A 1VZ0A 3G01A 2LVSA 2IJOB 1Z6EA 1MZAA 1HJ8A 1P10A 3BQZA 3PWCA 1FEXA 6GCHG 1G3EA 1QVTA 3DEUA 3SJKA 2DXIA 4JK1X 1LNWA 1UMAH 8GCHG 2K9MA 1DPOA 3SNDA 3Q3SA 5ICEA 1DP7P 2BOHB 2FQ4A 4XE4A 2XC4A 5A8YA 1K1PA 3SQHE 5F08A 1CHGA 3F8NA 4M9ZA 4IGDA 5JLWA 3W94A 4PROA 2K9SA 2LP0A 2XBVA 1GXPA 3BJAA 1R23A 5BOXA 3LIWA 3QGNB 1U5TA 2L9VA 1PPCE 1IQKA 2EFPA 4MPVA 1HXDA 3CDHA 2PLYA 1Y3WA 3EE7A 4MPWA 4BTTB 2OU2A 2BLVA 3MMYB 1O3LA 1NN6A 1TBRH 2LBFB 1T8LA 1N8OB 2OCEA 1B8IB 3M5NA 5ILVA 4KMFA 2J92A 2XF5A 4ZDPA 1FOXA 1DOJA 3E5QA 1T39A 1QA7A 1BM9A 1FY8E 1W8BH 1L4ZA 4E4HA 2Z9GA 1XGMA 1OP2A 2VOOA 4I33A 2YSRA 2Y75A 1F5TA 3K69A 3T1BA 2PLXA 2CWEA 1JJ8C 3RMLH 4CHAB 4YO9A 2Q6GA 3I64A 1E34B 1IF1A 3F68H 4AIHA 1WI3A 1WQSA 1PPGE 4NB5A 4OIPF 2VUMJ 3K4BA 4A7IB 1L1GA 1LTOA 2ZHQH 1YW8A 2OCVB 3NUMA 2R7SA 2RVCA 4D9JA 3FVFB 2QXIA 2VJIA 2PMZA 3ATKA 4J19A 1ZHPA 3HK6B 2KLOA 2WV0A 3LSKA 4K5ZA 3GY8A 1GI5A 2C4FH 4YIFA 4HX4A 5F0CA 1NFUA 1BTXA 4A3JJ 1D3PB 1KYWA 1XDUA 1C4Y2 2ZU3A 3KP3A 2E34A 2BHZA 1EZQA 3HM5A 2RNGA 5AONA 4M7GA 2MC4A 3PV4A 2R0QC 1XUKA 1NS3A 2IS4A 1WPKA 3KP7A 3K6GA 4XDEA 1C9TA 2PG4A 2H09A 1ANCA 2CHAC 3GTLJ 1T2KA 2PGBB 1ZQ3P 5FLXK 1GMHF 3CCSI 1C5LH 2RREA 2X51A 3A7XA 3VXFH 4PFPA 2NU0E 1V2LT 3WGIA 2IS1A 1DFPA 2GXAA 1Z6RA 4CCNA 1HYLA 1XMKA 1MTSA 4E7SA 4NGAH 3D65E 4E7ZA 3MU8A 4XRNA 2L7ZA 2E2JJ 1T8NA 4X1QU 4JBAA 4K8YA 3ZZDA 2E19A 1HF0A 1UCYH 1O2IA 4M3FA 2Z33A 1KU9A 3KL6A 1X2NA 2JIZD 1CA0C 1SLWB 1SFQB 5FKNA 4ABBA 1ZTLA 2J94A 2VBWA 1AHTH 4HSRA 1YPLH 3CCMI 2NXNB 2SNVA 3SV8A 3S0NA 3DFJA 1Q1VA 4BJTA 4AFQA 3RXVA 4PJNA 3ZMSA 1S6HA 4CRFA 4MEXF 4MQAA 3MU1A 3P6ZB 4JMYA 4FUFA 1BOBA 3SJIA 2VB6A 1VQLI 4IZZA 3URDA 2OPTA 2FBKA 3OSFA 1GHYH 1A7SA 1P11E 1PPZA 3ZYEA 4NHJA 2IS6A 2HQ5A 1HV7A 2FWWA 2RAEA 3T27A 3SU3A 4FUBA 1Z71A 1QTFA 1I1SA 4XBCA 4P9UA 1GI6A 4XIDA 1AD8H 4DW2U 4UY8I 2ZQ1A 2X4HA 1H8IH 3JRBA 4MVNA 1COWD 5JHUA 5ESBA 2LREA 3RXTA 2OQUA 1AOYA 2KP6A 1GDNA 5E3OA 1TFXA 3H35A 3F9HA 4HF0A 3SJ9A 1F5KU 4XR6A 4BJ6C 2CN0H 4J1YA 2G8TA 1WVRA 1TMBH 1FQ3A 1MKXH 4YG2F 1D0XA 3M7QA 2L7MP 3L2QA 2HKOA 3P8GA 2PSXA 2BX3A 1HIAA 5AFZH 2BYAX 1LJ9A 3GDUA 1NFWA 1T0FC 3R4KA 1BZXE 4Y8ZA 3D5RC 1IQGA 1O3NA 1UHBB 1TA2A 4ZKSU 2GX4A 3LGUA 1MH4A 5EJCA 4BDYA 5DCMB 1O2YA 1Y8TA 1DDNA 3E7LA 2Z9OA 2ZFTA 3BEUA 1S84A 2XWAA 2JPBA 5DEQA 2V6EA 1DLEA 2VOPA 3ZZ9A 5AF9H 2LF8A 1HPGA 2EI6A 1G3TA 3MWIU 1FV9A 1Z8RA 4CH7A 3GY3A 3S2WA 3PYHA 2B0LA 2RNJA 1YRNB 3MTYA 2QA9E 1NG6A 2A1DB 1H1BA 3ZQCA 3BTEE 4LLNA 5E17F 2ME6A 1F0TA 2YU3A 3F9FA 2HNHA 1UVOA 4U0YA 1SGPE 1Z6TA 2W26A 5EGOA 1NC6A 5CHAC 4BXSA 1Y1WJ 2F43B 4CICA 3ODDA 2EZIA 1Z7LA 3LGTA 1K22H 4P55A 4QTRA 2M7BA 1UTPA 1MBHA 2CF8H 2VWMA 3PV2A 1VCPA 3M1EA 2R92J 2OQRA 1VGCB 3K4LA 3GTJJ 3CJNA 4NZQA 1YI2I 5A2QK 2LP6A 1XTAA 2DBBA 1DY8A 4RB2C 3K2AA 5EEHA 3MZHA 1O3JA 1HC8A 3G71I 2IW5A 3EUKL 1NT1A 1B72B 4I8GA 1PYTC 4UFDH 4FX0A 4AB9A 4CYDA 2GDEH 2EH3A 2UXNA 3RXJA 4BQOA 2W5EA 2GZ9A 1O2KA 3S3OA 1OJLA 3E1SA 3JZ1B 3OY6U 2JA8J 1OISA 1EH8A 4X1NU 3A7WA 2FI4E 1WQ2A 1EX3A 2FQ3A 1GV5A 2EWNA 1AY6H 3GY5A 4X2WA 1QZ8A 4IS5A 1BTUA 1F0RA 1BBRH 2C6YA 1UMQA 5IYTA 4XSKU 1U78A 3MH5A 1DUEA 3BV9B 2KCYA 4PDKA 5EEAA 3HGGA 1O2TA 3GY4A 3LH1A 1SGIB 1UAAA 1NRQH 3DSOA 2OK5A 1YYVA 2KCPA 2M8GX 4A92A 4FCYA 5LBQA 3H09A 2HDDA 3MO6A 2WY8Q 1JXSA 1WBGB 4U87A 1WU1A 1B8IA 4I02A 3JW4A 2VWLA 2H6MA 2ZTYA 1ZRDA 3GYLB 2FTLE 3SU0A 2Y0MA 2B0FA 1PJRA 1VF9A 4YXWD 4R8TB 2PMZN 2H6CA 4BEHB 3CUQA 1O2JA 3UQOA 1GI0A 3IWFA 4M3EA 4XNFA 1IG7A 3LGWA 4ISLA 2XROA 5KAFC 1Z21A 1KXDA 4F55A 4I0AA 2ANYA 2Z3EA 2QF0A 3ATMA 2M1BA 4ASHA 3MKWB 4I09A 5DTDA 3G6EI 1JKQC 2JJ2D 1S29A 1IRFA 1YJ9I 4ASUD 3OEHD 3FANA 5FROA 1DU6A 3LAJA 4AYVB 1A0LA 2L6OA 2RN7A 4M9FA 1YPHE 2A7HA 4YTAA 3RXSA 3MKLA 1ELTA 5HM2A 2RQQA 5F53A 1LVAA 5T6DA 3FBNB 4NIVA 3G2BA 3KEYA 4ISOA 4Q5SF 2CQQA 1G37A 3LNQA 1CU1A 3RXCA 3BJ6A 1G3YA 4A3IJ 4B09A 2AS9A 5KVRA 3F2FA 2ZQ2A 4IN1A 3EYDA 1A3EH 5HS7A 3ZZBA 2CW7A 2FA5A 2ZDAH 1UK4A 1C5ZB 5J47A 2V3OH 4KT5C 4S0HB 1WJAA 3F6UH 1B4AA 1K1OA 3PM3A 1TWAJ 1UTJA 1N77A 3QN7A 5EQRA 2O5RA 3G1OA 1FOWA 1MMAA 4II3A 1CBWC 1FJSA 3UREA 1CHOF 1G36A 4ESTE 1YM0A 3RMMH 4ESJA 4FASD 2QF3A 2GZWA 5HIYA 3FXUA 4H42U 3M5LA 3SYTA 5A0AE 1W2KH 4MDSA 3DPLC 2AMPA 3OOUA 4Y76A 1WKMA 2LSOA 1BCUH 3SXYA 1C2FA 4E7IA 1GVJA 4PJ0C 1OP8A 2C90B 1KLJH 1EASA 2CUEA 1CSOE 4NIYA 1FY1A 3TK9A 1BR1A 1FX0B 2M3AA 4BH9A 3D5LA 4B1TA 2O8XA 5EJLA 1W11U 1IAWA 3IH4A 5DP5A 3QRFF 3CMEI 2M45A 2L2OA 2DJIA 1L0OC 3V0XA 1C5WB 3A0BC 5JBCS 3QPTA 1O3FA 3R0AA 1VQ4I 2HEOA 1CA8B 1KXBA 1KLIH 1OWHA 1MJBA 3SJOA 1Y3XA 3AG1H 3KYDB 1U0JA 1FUJA 4DZJA 1YIOA 5IYBJ 4ABAA 2JPCA 1L1JA 1Z1IA 1HLTH 3WG7H 1VCWA 1JJ6C 4BAMB 1E3HA 4B48A 3LU9B 3MNBA 5FJ8J 4GHQA 1P2NA 2EY4C 3KP5A 2L7FP 1GVZA 2OCCH 1G3CA 4TY6A 1QRWA 4BBRJ 4KN4X 4R1HA 1RRJA 1HW2A 3DF8A 5TJJA 1W7GH 3S9AA 3PLPA 1DLKB 1HJ9A 1A61H 3P7NA 1XS9A 1X1CA 1ZSLA 1Y5UT 3RXPA 2ZMEC 2BDHA 4UVAA 4DOQA 3GTKJ 1SFOJ 5FRMA 3O8BA 1EZSC 3DQVC 1XGOA 5E2OA 4GYGA 4UVBA 1WJDA 5EW1H 1WI9A 1FOKA 4KT6A 1TBZH 2A6HF 1W0ZU 4UV9A 1FBQA 2BW3A 2IXSA 1CBWB 5CQGA 1TNIA 3BTGE 1UVUH 3BG7A 1R5HA 1N78A 3SW2B 2ZSIB 2OC8A 4B76A 1TNKA 3CCQI 3HPTB 1PQ7A 4UXNA 4XLCA 2CXVA 3QTVH 3FN8A 1J09A 3I9V2 1HAHH 2VE9A 3BTJA 1XUFA 1JI8A 1ZMJA 5EQSA 2XHKA 2TGDA 4INHA 4O9VA 1QRZA 1DWCH 5LRSA 1IDZA 2XKOA 1BT7A 3D0SA 4A3EJ 4KFCA 3SU1A 3E6DA 4ZH4F 1ESBA 2GCTC 1HUTH 1MDMA 1TNSA 4BHBA 1IQHA 3CF2A 1V55H 1AFEH 3BZ6A 2D8WA 1O36A 3N4MA 1FNNA 1HGTH 4ABEA 3JAMZ 2F9VA 1EFRD 3LKWA 2ZU5A 4NCYA 1Y6IA 3GFLA 1MZBA 3Q3XA 2H8WA 2RFKC 2HDCA 3AG3H 1MTNB 2CV0A 4PK4A 3SU2A 3SNAA 3FKJA 3TIUA 1AMHA 3FIWA 1ZLKA 2BXZA 3P9KA 1ZYOA 2F3CE 6GCHF 1YIJI 1V2PT 2DI3A 3RZOJ 2QZ8A 2H1KA 4A3CJ 3SHCH 5FX5A 2W24A 4XRSA 1J15A 2WV5A 4RLFA 1W0TA 2XUBA 1XSXA 2M2AA 5K5QA 3L33A 2A5AA 4IPAA 1T56A 2IPHA 5IK2D 1C2JA 3GMEA 1GDUA 2XIGA 5C4XJ 1LEAA 1K2I1 5GWZA 1TTYA 1UJ8A 3URCA 4Y4RA 1H8AC 3MQKC 4Y3OA 3LFUA 1T32A 1G59A 4RGXA 1SD5A 3FMRA 5E1WA 2C8ZB 3BROA 2R5YB 1TAWA 2Z6BD 2Y0SA 4L9TA 2HOBA 2BGCA 1Z7UA 2XAUA 1EF4A 1K4SA 2PI0A 2EV0A 1RETA 4NFFA 2ISZA 1QA6A 1QO0D 5LEJA 1FDPA 3G3ZA 1UW7A 2P8TA 4CYCB 1O3DA 5CDFE 3OYGA 4UUSB 3GZ6A 1UVPA 1EZXC 1GCTB 3OIQA 3SEZA 2FX0A 2A61A 1Y0UA 1CT2E 4IXAA 2QSHX 4NIWA 4FTHA 3S3NA 2K8IA 2DN0A 3D1NI 3DV8A 2X6XA 2X1EA 3AAVA 2FEZA 3I78A 3AL0C 1BRAA 2OLGA 4UVCA 2F9BH 4ZH8A 3K4MA 1ELFA 4HNTA 2UWOA 2GV6A 1ETSH 1FONA 3VPKA 4GLYA 4AD9A 5HLHA 1P12E 3CCVI 1ARCA 1IAUA 1GHBF 2ZPSA 2OD3B 5JB9S 1S9HA 4AVPA 1Q3XA 5LHIA 2ANWA 3A88A 4GGGA 5EPYA 5CJ9A 1ONVA 3KEEA 4ABFA 5F6FA 4RN6A 2DE8A 5HYOA 2V1NA 2QQ8A 4X1SU 1LEBA 2JUCA 2R7TA 2BVLA 2FNPA 4LMYA 2KZ4A 1YCPM 2STBE 3U2RA 3QPLA 2SGFE 4KTUA 1YY3A 1PPBH 3ATIA 3FMQA 2FP7B 3UNSA 3C2BA 1AWFH 4CH8B 2Y48A 1ZG5A 1P7JA 5AIQA 1Z0XA 3GTGJ 3A80A 4CCOA 4EQQA 1G30B 2G81E 3F6VA 3V8KA 5EU8A 3ZXSA 4YZUA 3GFIA 1AVXA 1K61A 1R4NB 3C18A 2F83A 2DDAA 4CO8A 1EJAA 4U2WA 3MKZA 1XDSA 2MC3A 1MTNC 1O38A 3BLYA 1MH0A 1ZMNA 2FODA 5BRRE 5E0HA 1BTHH 2HTJA 1YPMH 2AHME 3UTUH 1X4PA 3EA9A 1J59A 1YHQI 3CO6C 4XBBA 3FOAA 1GMCG 3MHWU 3DCFA 3K6YA 1G2MA 1J9IA 4CXFA 4I8JA 3A4CA 1H9IE 2P3UB 2YS9A 4WH6A 3K7AJ 1FZPB 1GVKB 2COBA 1EAIA 2X6WA 3A89A 1TBQH 2P94A 3HKZN 1O5AB 2BOKA 3GCNA 3I4PA 2ELKA 2J34A 1WQVH 5JBAS 3E97A 1LPQA 5H6RA 2QSGX 3M8EA 1Z05A 3EA8A 1MMSA 2GJGA 3U1DA 3RXEA 2BV6A 2ZCKP 2Y81A 1P2FA 2O8UA 2JA6J 3UWIA 1ZYRF 5J8CA 1X1AA 2K40A 2DFEA 2KJCA 2HNTC 4M6XA 4XONA 4BQNA 2J95A 3CP7A 4F52A 4JX5A 3HUGA 1RI7A 2ESNA 1PUFB 2TGAA 4CRBA 4OS1A 3SNCA 3EQLF 1P3EA 2Z94A 4H4KC 2AQFA 1KXCA 3WHBA 3DKXA 3WWFA 3RYPA 3KP4A 1SD7A 3VYRB 1GJ6A 4M71A 1GLNA 5FGMA 2ZMEB 3TVJB 1GHZA 1K0HA 1KXFA 2P0WA 1E3OC 1T95A 2R7DA 3HUGB 1DXPA 3TLOA 5F6MA 2NOJB 1YF4A 1P9QC 2GGVB 4OOIA 4CGZA 2UWPA 3F8MA 3VYSB 1BITA 4XFQA 1QNJA 2W25A 3U8RH 4MIMA 2PJRB 3F8CA 3WWBA 2L02A 4BE0A 1THPB 3ZVBA 4FVDA 4IOAF 1WHUA 3I54A 1U9NA 2XRLA 2TPIZ 4I7HA 4HFPB 5FKMA 4BXWA 1Y59T 1GI8B 4BGDA 3CJTB 4YLQH 1YLCA 3E16B 4FUJA 3BEIB 2WPDD 2HQRA 1FIWA 1VJ9U 2FYQA 2H9TH 3K1MA 4BXXJ 2WPJS 5C2ZA 1AKHB 4JZIA 4K1EA 3T29A 5FXLA 3J80K 2WA0A 3IHUA 4A3DJ 1DP3A 1YBWA 1BBRK 1JRSA 2EA2A 2ACJA 2J98A 3F0CA 1GI3A 1K78B 2BDGA 3MYWA 1LFBA 1W7PD 4K8BA 1E1RD 1KQ8A 2IOTA 4AWXB 1XG1A 1EA3A 2VIVA 5I46H 1B0FA 2P4WA 3BTME 4EJVA 3ZZ6A 2CF9H 4D76A 3ML6A 1G9IE 2NRAC 3F3XA 5E8IA 2M0MA 4AGKA 2LDUA 3VGCB 1C5UA 4TPYA 3OYAA 1B1BA 2ZU1A 4AYBA 1P03A 4FUIA 1IV8A 2A5YB 1GXQA 1OLTA 4IC6A 2DJNA 2UWLA 2QQ9A 4KGAA 3PRBA 4DYRA 2LNBA 1C5XB 4XSZF 2LG4A 1K1MA 3Q3KA 5F1JA 2OTVA 2E60A 1PPFE 4BKXA 1ZRBA 3LSPA 4IRHA 3K2ZA 1I3QJ 5B6LA 4MNYA 2DLLA 3SFIA 3CNRA 2LF7A 1GCDA 1YRNA 2VQGA 1KDQB 1FPCH 3GOVB 1N25A 3CMMA 3S14J 1IN5A 1TGBA 2KIMA 1VFCA 6PAXA 4GRIA 2KR7A 1TNJA 3UNGC 1J14A 2GZ8A 1YE9A 3OS1A 2ESTE 1S85A 4MQ9F 2F5DA 4ZHMU 1MCTA 1O32A 2LFBA 3DA9B 6ESTA 4X1EA 4EM0B 2BBYA 4RAFA 2YMSC 3BTQE 2OBQA 1F7ZA 1VQ7I 1C5SA 4IO9F 2KRCA 4XMYA 2R5ZB 3MU5A 1SMYF 2QQAA 1WWXA 1DPUA 2NOGA 5JBTA 1D8KA 1YJWI 2TIOA 3SQNA 3BR1A 5JR3A 1BOQA 3CENA 1R49A 2VGCC 3RIRA 3FK7A 3HYIA 4BY7J 4DIHH 1TL8A 1QBNA 1E79D 4WF8A 3O8HA 4FUGA 3HOSA 1DGRM 3ABTA 3HKJB 2JK3A 4L9NA 1SFXA 2HU9A 1HAIH 2ZF0H 1NY22 2FMJA 1O2RA 1JWTA 3RUOA 2M30A 3OAAD 2Z7FE 4FUHA 3DXJF 2X48A 1MZDA 2LC2A 1AGJA 1YYY1 1U3EM 1FY7A 1BMMH 1GHBG 1MUEB 4GO1A 1D1CA 5K5OA 1R1VA 1E3PA 1KQ9A 4E6KG 1DQUA 2Z3YA 3P8OA 5PTPA 5E8EH 2HWLB 3UR6A 1LFPA 5E3MA 2DA6A 4RA2A 4FHTA 1JKPC 4ZMAH 4KKDA 2R0KA 1HJAC 4II2A 1XGNA 2D2WA 4YLUA 4YT6H 4GFBA 5FPYA 4J01A 3JTGA 3NZIA 3R60A 4EM1A 2O8LA 3RLWH 3GBGA 2EJRA 4DG4A 1WXRA 3SEQA 3Q00A 1DVAH 2WINI 1TYNA 3RDZA 3KZYA 3B73A 4IHTA 2Y9YA 3CUQB 2FESH 4X1PU 2HOTA 3KFWX 2UUZA 4NNJA 1R5GA 3ABLH 2JH6D 3A01A 1MQ5A 4EVIA 3M7TA 3B23B 2WYGA 5HM9A 1G4DA 1S82A 2HRVA 4CH2B 1W7XH 2GT7A 5K5RA 1O2LA 4MNWA 1TRMA 5JBBS 2A6EF 5CLSA 4KIBA 2Y6TA 1CHOG 4EEFG 3VYUB 3RI4A 1VQMI 2D26C 2DOEA 3TOAA 4GPGA 3OFND 4D5CA 1O33A 2B7DH 1UK2A 5EGMA 2JDID 3RCOA 2X1DA 3Q76A 3KF2A 3KLNA 3S9BA 4MNUA 4GSOA 2BVXH 3M7GA 1OKXA 4BUPA 3SZEA 4FXGH 1OR7C 3HOYJ 4F48B 3HHHA 1IQLA 2UUJB 3PB1E 3V7RA 1RKWA 5HMAA 1A0JA 3I53A 3RM2H 2ZXWH 1MMGA 2W48A 1O35A 3BG6A 3S7KB 4RGUA 2GOXB 2PEXA 2VPLA 4JYUH 4K3JA 4Z1MD 3BTKE 1DT2A 1O2SA 4M9XA 1TPOA 1JHFA 4M74A 3QYFA 1LCYA 3HKZA 3TJUA 3FZDA 3JRAA 3WTUC 1MAYA 2JA5J 2GXBA 1JUPA 1ZH5A 4M72A 4IQJA 4U32A 3P8FA 5D6FA 5FCRA 1YPHC 2V7QD 3UOUA 1AVGH 4Q4ZF 2ZXJA 3RXKA 1YQAA 4NBQA 2NVYJ 3TP0A 5K7ZA 1NPMA 1QHGA 3H1CA 2KPMA 2ZFWA 1FNIA 1O57A 4JYKA 3C7JA 2WV9A 1JTXA 2CGAA 5CVJA 1R1UA 2ANMH 2JT1A 1O3CA 3RXHA 3ZR8X 3GS9A 4TPIZ 4EJOA 2H8RA 1C9PA 4ZZDA 2BX4A 3FWEA 3A86A 4Q7YA 1IDYA 4ZROA 2HOAA 4I76A 2XYAA 3ISPA 3EUHC 5HODA 4IOCF 1VGCC 1OYWA 3AW1A 3E6MA 5FKKA 3WTWC 3MVPA 1P0SH 3GDSA 2P3TB 4M9SA 4N9IA 1F0UA 1TNGA 4A3KJ 2ALPA 3OS2A 5A8XA 4YT7H 3MAJA 4FUDA 5DV5A 1BBRE 3W1EA 3ZQGA 1GL1A 1DUAA 3VB7A 2YNAA 5BMZA 3A0HC 4OS2A 1U8BA 1UZCA 3QU3A 3UNQA 2OZUA 1TBXA 4Y13A 1OCTC 1P3CA 2PFEA 2OQ5A 2GM4A 2PWXA 2LK2A 2PTCE 3E3TA 3DSPA 3IRQA 4PFOA 1Z67A 1FYMA 4CCLA 2BY9X 3ATLA 2DMTA 2LNCA 2J38A 3S1QJ 4D5FA 3ZZ3A 2QWWA 5FFXA 4ZXYH 1O3AA 3U1IB 1NTPA 4IMZA 3KZIC 2BY0A 2LKPA 2I6QA 1I5ZA 2DYRH 3RPUD 4K1TA 4IX7A 4LJZF 4HRIA 5HXFA 3STJA 1O3PB 5HDNA 3CDIA 3VB2A 1UELB 2QSFX 2RDEA 3FO8D 4PJLA 2VE8A 2AGGX 2DDBA 1SLUB 3KCCA 4CBOA 1EATA 2NVXJ 4XRFA 4P5OA 5BS6A 4X8UH 2ZFRH 5KK1A 3GY6A 5TISC 2WY7Q 1NZQH 4A3BJ 3GTMJ 4G7OF 1TLHB 5G4BA 4BY1J 3HTSB 1XB4A 3SJ8A 3PO1C 1S3JA 2BW3B 1TA6A 5DP3A 1I27A 1V4RA 2IA1A 2R3UA 1XCVA 3DTIA 3IKVA 2ZMEA 3MU0A 4CR9A 2BYVE 2PSYA 2DT6A 1O2XA 1AWCA 1WSSH 3GICB 5LRRA 3LA2A 3HOTA 2DQLA 2H9HA 2NVUB 2WV4A 4IKFA 1ETQA 3BPXA 5JYIA 2GBYA 3V4GA 3KYCB 4F92B 1B6AA 5EQQA 4BAQB 4RMNA 4B3XA 1QBJA 2BQWB 4U7BA 3SV7A 4XM3A 2ZI2H 1DWEH 1QQ4A 3HIFA 1QRXA 2VT2A 4R79A 2NU3E 3S17J 1SQRA 1W1WE 3T5XA 3JZ2B 1CQTA 3I5UA 2ZCHP 3BG5A 4YOJA 1VQKI 2ZP0H 2DOFA 5KEDA 2MABA 3KQEA 4KP0A 4NZLA 4L9JA 1W5SA 3PSIA 4TV7A 4X6MA 3E0NB 3NWUA 1T7CA 1NRPH 2GCHF 3LC3A 1CGPA 1I50J 2MW8A 5HDGA 1NFYA 1TQ0B 2XW9A 1GHAF 2FXAA 3W6JB 3E91A 1CGJE 2GP9B 2OJED 2X0LA 2WPIS 1MKMA 2YU9J 1ZTKA 5D5XB 3KPHA 4LFUA 3PO1B 3T8RA 1J17T 4HX8A 4M6VA 1HBXG 2IGMA 2P7VB 1YPGH 4XLEA 4XQFA 4OIOF 4B2CA 2XGCA 3RLYH 2O7OA 2HOSA 5LGUA 4ACAA 2K4BA 1HAOH 1W36C 1YLFA 3BTIA 3GXOA 1HFDA 1TNLA 2PKSB 1CF7B 3VDXA 2DA4A 2ODQA 3RXRA 3N7EA 2K02A 3L3TA 5BPDA 1V2RT 4RKJB 1TWXB 4JX4A 1GI7B 3D5SC 1R71A 1LKXA 1ETRH 2BXTH 1AFQC 2UUKB 4KUMA 5KAIC 3NWTA 2EI7A 3F9GA 1BA8B 2LY1A 2HVYB 5F04A 3TK6A 2P16A 3E3VA 4IMQA 2ILNA 2TGPZ 4I8LA 3LSMA 2W4SA 3HTUA 1BIOA 2FOEA 2F5VA 2IBDA 4GAWA 3PTBA 1VITG 1QJ7B 2PKAA 3B6AA 1VQOI 3U8TH 1YW9A 2DA2A 3X2QH 4YRVA 3RC6A 3NRLA 1MMNA 2G4TA 3EQ0H 5A2MH 3PM1A 3H7OA 2HLDD 2VU8E 4X6NA 3ZZ8A 2ZFSA 1TNTA 4L18B 3HSRA 4P02A 5FLMJ 3OSYA 1GUUA 5T1VA 4V2FA 4ZDLA 1ORFA 2ZJRF 2RDPA 5E3NA 1T8IA 1AIXH 2XTTB 1C4U2 1JXPA 2ZXIA 4UB8C 1BI1A 1EAXA 4HPQA 4B75A 2PMHA 2ANKH 3HXLA 1K83J 1SI5H 1XSVA 2Y30A 3LQQA 1I6HJ 4UUSA 1A36A 3BTCA 3OIPA 1K1NA 3A7ZA 2J2UA 3RMNH 4LK1F 1HAXB 5C94A 3PRDA 3RXGA 1PQAA 2JUGA 4IL6C 4I8HA 1A5JA 1TRNA 3ZMUA 3V42A 3DLLF 1X1BA 3QZQA 2PFBA 1MQ6A 2E5NA 5JFRA 4BDZA 2RCEA 1D5VA 2XC7A 4B4CA 1IN7A 4Q2KA 5DP6A 4ISIH 3FM5A 1AB9B 1ZHRA 2NS8A 2EIJH 2MLGA 4XLHA 5FKOA 1HAVA 5HDKA 5ILUA 3QO6A 3ZQIA 4B8XA 3L2CA 1RIWB 2ADUA 5GPCA 2XBYA 1OP0A 1V2KT 1O2ZA 3U28C 5EW2H 4BYYA 3U8OH 2Y5FA 1YPKH 2GTBA 1HDTH 3I55I 4PSWA 3CF5F 2IT0A 2ISYA 3N7DA 2A32A 1QNTA 4DOZA 3SU6A 2UWMA 3BQYA 4U0WA 3VFEA 5DO4H 2D45A 1ZZZA 4LZ4B 3VYTB 3ZQFA 1SMTA 2ZB9A 4FE4A 4CZZA 1JE8A 1RPWA 4INLA 3BC8A 1UG2A 2NU2E 1AKSB 1F9NA 4EJTA 2QKMB 2FZZA 1IGNA 3MWMA 1B7XB 1QURH 4RT1A 3LGVA 2FDAA 2WPKS 1EAWA 3W2AA 4DJAA 4ENNA 1C5TA 2DAOA 3UNRA 3CUQC 4RT0A 1XMXA 3BR0A 2IP2A 2NU4E 3I77A 2QLZA 2Y0SN 2OZ6A 5LGTA 2J9NA 4HV5A 4CCMA 4S05A 4ISNA 3COAC 2EILH 4A3LJ 1FTZA 3SGAE 2GCTB 1ELGA 1J16A 3H3VK 4RBOA 2BZ6H 1HOMA 1IN6A 3DBRB 4MNVA 2EZHA 1HJAB 2F91A 1IUYA 1MMDA 2BXUH 5I25A 1ZPZA 4MTDA 3K4KA 3N99A 1U2WA 2HNTF 1ETKA 2FOBA 1V2WT 1AB9C 1IZ1A 3TDUC 4ZAEA 2P6TA 4MNXA 1HAZB 1FMGA 2FJ1A 4DCDA 4P00A 3WY8A 5CYVA 2LY9A 3TKYA 2ESHA 1ZLJA 2UUYA 2VH6A 2KHMA 1WOFA 2OV7A 5HKKD 1MKWK 1D3DB 2KAIA 4WCGA 1P4XA 1TX6A 2C8YB 2GMTC 1KU3A 3U21A 3IP4B 3RU4T 2ICWG 3RTRA 4LXBH 1FOYA 5TCAA 1O0DH 4OM9A 4XOJA 2M2EA 1SFKA 3MKYB 3UAIC 3LAPA 1ZK8A 1GJ5H 1DXWA 1CT0E 3VPRA 2LY2A 3S1NJ 5L6NH 2LMDA 5C17A