2IPQX

Crystal structure of c-terminal domain of salmonella enterica protein sty4665, pfam duf1528
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
121
Chain Sequence
LSSTELGDLFWSWLRDGLREGDIPVNTADACVHLTCGFVFISVPGVFFLFLKSHGRKEQVQAAFEKMRKHRVSDSRRFWQCCLYEEPGGRGRYKKLTGYLIKMSEIYNGNFPDDSLFLKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of C-terminal domain of Hypothetical protein STY4665
rcsb
source organism Salmonella typhi
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein STY4665
total genus 29
structure length 121
sequence length 133
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ipqX01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 2ipqX02
3P7NA 3GO5A 3IWFA 2Z3YA 1NHAA 4MHGA 1MJBA 1ONVA 4YFXF 3KP2A 4ZH4F 1AWCA 1ON2A 1Z9CA 5BPIA 4U0WA 3KLNA 1R5HA 1FY7A 1O3RA 3V4GA 5HLGA 4UV9A 5TJJA 4LG0A 1QNTA 4ZYHA 2FMYA 4BYYA 3K69A 1FT9A 3HRSA 2V1UA 2HGCA 2K4JA 1J2XA 4HOBA 2K02A 3QU6A 3DQVC 2J5OA 2KIMA 3WTVC 1FBUA 2ESNA 1U3EM 4ENMA 1SAXA 3DF8A 4RGRA 1UFMA 4Q48A 3RYRA 4G7HF 4FT8A 3ECHA 2X4HA 2FOKA 1ZRDA 1FBQA 2LDUA 1TQPA 1X3UA 1HKSA 2PMUA 1LEBA 3KP4A 5ICFA 1KU9A 2NRAC 1G3WA 4IHTA 4LK1F 1I6XA 4IHSA 2X0LA 1B9MA 4RGSA 4ZYGA 3J7AO 2VXZA 5LLQA 2PG4A 5J8CA 1TBXA 2CWEA 1YFHA 1U78A 1R7JA 3L09A 1IRGA 2BV6A 1RI7A 5KVRA 2F5EA 4LLGF 3E6BA 2DI3A 3HOTA 1FPQA 2F5CA 4WF2A 4G7ZF 3GF2A 1JE8A 2XAHA 4AIJA 1FOKA 1GVJA 4Y13A 4KIFA 4PGHA 4I2OA 2QVOA 1P4XA 4HAMA 5FO5A 1BI3A 1EH6A 2XAJA 4P55A 4A12A 5LHIA 1P4WA 3ZQ7A 3JAMK 1H9GA 3WE2A 1TNTA 1JXSA 1USSA 2IVMA 2K86A 4PZJA 2RDPA 4M6XA 1BBYA 3GFLA 4JK1X 4ASNA 5IT9Z 1G3TA 2P5LC 1BI2A 3F21A 1JHHA 4L5IA 2D45A 4WWCA 1FNNA 5FB2A 1PP7U 2CO5A 4I01A 3CUQC 3GZ5A 2EFNA 4KICA 1YLFA 5CVJA 1KYZA 3TO6A 2ZNZA 1Q1HA 3RKWA 4L9VA 1YW9A 2H27A 4HLXA 2DPDA 2EA2A 3BP8A 4P9UA 1VTNC 3GW2A 3WTYC 5BOXA 2W24A 5FLXK 3P9CA 1ZRCA 2A07F 3C18A 4H0EA 3ABUA 4LJZF 3H3UA 3GYHX 2E7WA 2OA4A 2KIUA 4OMYA 1OYIA 2MLGA 2ZKZA 4EJTA 2VT2A 1BJAA 4LLLA 5FD5A 2Y48A 3E6MA 3F72A 4A6DA 3T5XA 1UHWA 5D8KB 2P5KA 5K5QA 1YW8A 2E1NA 3V7RA 4IJAA 2VBZA 1FSHA 1XN7A 2OQRA 1QZZA 2BE5F 2FEZA 2JTVA 2G7HA 4BAYA 2P6TA 5E8GA 1FP1D 3NEUA 3RKYA 3EETA 4GCVA 5L3CA 1WI9A 2G9WA 3ZPLA 2MH9A 4OIRF 4XSXF 3HYIA 5CVVA 3QPTA 1YW7A 1FC3A 5A2QZ 2CG4A 3I71A 2EV6A 3F8MA 5D6FA 2ZXJA 4G6DA 3WGIA 2UXXA 1E17A 1SFEA 1XCBA 5AIPA 2LNBA 1BIAA 3KZYA 1QBJA 4RB3C 4ESJA 2GA1A 6PAXA 1IN4A 1R1VA 3HRUA 4IRHA 1UHMA 1H9TA 2P5VA 4HX7A 5L3GA 5D8LB 2V79A 1FLIA 5IT3A 2H6CA 5HS9A 4CZZA 2V9VA 4IF4A 1T0FA 4GGGA 2PLYA 4G94A 4M73A 4ZYDA 1SFXA 4M9ZA 4QLCU 3R0AA 3TGNA 1DPUA 4BHBA 1MDMA 2RVCA 2QBYB 2XASA 1IXCA 1P4AA 1ZARA 3KQ5A 1K79A 4MTEA 4CDGA 3KP6A 3DV8A 2VOPA 5LHGA 3IL2A 3R4KA 5FLXZ 4LG0B 4O5VA 1ZYRF 3HTSB 1BN5A 3VODA 3B73A 3KEQA 5E1XA 4OMZA 1XMKA 2XAFA 4M9XA 1IRFA 1U5TB 3O3KA 4M74A 4HLYA 3K1NA 1P6RA 2JPBA 3DP7A 3GVAA 3F3XA 1B1BA 5CVIA 1O7LA 2CSOA 2GQQA 1P92A 3ERED 3FXQA 1K7AA 1T98A 5CVUA 2EFWA 2FBKA 4OOIA 1IN8A 1F9NA 5K5OA 4HDVA 3E5XA 5LHHA 2CFXA 2YX7A 2PMHA 3DXJF 2M1BA 3R61A 4N9HA 3D0SA 4LB6B 1B59A 3LSTA 1D8JA 3KETA 5FFXA 2ETHA 3B02A 3QAHA 3FM3A 1OR7A 4MGRA 1C0WA 2M8EA 2QQ9A 1YTYA 4OIQF 5HOOA 1XDUA 2F5FA 5F6FA 2HR3A 4PDKA 4KN7X 3DKWA 3ZMZA 1EV7A 2RKHA 1DPRA 2ELHA 2OAZA 4I98B 1SFUA 3HUGA 4EMSA 3J81K 5ICGA 5HLHA 4I02A 4G8XA 1HKTA 2FRHA 4RAYA 3KZZA 5LBQA 2IW5A 1IZ1A 3R6SA 3WU1B 4U0VA 3PFIA 2F2EA 2EB7A 2Y0MA 2ACJA 4TV7A 3LA2A 2FQ3A 4P5OA 2PJPA 2WTEA 2Z9OA 3WTTC 1HXDA 1XDSA 1HSTA 4B8XA 5H6RA 2L4AA 4Y17A 5EEGA 1KQ8A 1YS6A 2IT0A 3U1DA 1BC7C 3DFGA 4U7BA 3RI4A 5LEJA 1R1UA 2FSWA 2Z5UA 1LDJA 4HX8A 3FMRA 3I4PA 4G7OF 2A6HF 3T8RA 5HLIA 1WRJA 1BIBA 1T2KA 2COMA 4GO1A 1XCVA 1GXPA 3BY6A 4MQVA 3BJOA 5ICEA 1B4AA 2OZUA 4WCGA 2QQBA 4EGZA 3MAJA 1B6AA 1GXQA 2ESHA 3V7SA 1OPCA 3F8BA 2JSCA 4RAZA 3QOPA 3RPUA 5E1ZB 3KLOA 3ZP5A 1FYMA 1O57A 5AONA 3FWEA 3RTRA 2EK5A 4RB1A 3TOAA 4N0BA 3VFZA 2XV4S 3U2RA 1F1ZA 3HRTA 1E2XA 2L4MA 1IN5A 5JHUA 3V8KA 2KKOA 3IWZA 4K2EA 2RN7A 5LRSA 4L0ZB 5L3DA 3IKVA 2O03A 1S7AA 1FP2A 1S3JA 1HQCA 4MEYF 4BNCA 1FX7A 1ZGAA 4HW0A 5CYVA 2IP2A 2HYFA 2EJRA 1TQIA 2DTRA 3M1EA 3BPXA 3HHHA 4GYGA 2HQNA 1XGSA 3EYYA 3L7WA 4MQ9F 3ML6A 1KQ0A 3KFWX 3L2CA 1T6SA 1J0RA 3M9AA 4P96A 5AIQA 3C1DA 2PN6A 1DDNA 1I1SA 2Q8KA 3M7GA 2GXBA 1D8KA 3KP5A 4Q47A 3R0JA 2ISYA 5LGTA 3CTAA 4YFKF 3MQ0A 4LGWA 3GWZA 4LB5A 2DLLA 1S29A 5D5XB 2TDXA 1ZG3A 1W7PA 3EDPA 1FWZA 1K6OA 3KE2A 1L0OC 2DT5A 1WQ2A 3JTHA 3ZMUA 2P4WA 2P7VB 4R79A 3FHZA 4L18B 2BEOA 4CICA 4YIFA 4XLNF 4Q4ZF 1BM9A 3PQKA 1U5TA 2D1HA 2YR2A 4DNCA 4RB2C 2DAOA 4EM2A 5E1WA 2YPRA 2QBYA 3ROUA 2PI0A 5F64A 2XAGA 3CO7C 4EQQA 4PCQA 3OV8A 3V8LA 3H92A 1LVAA 4HBLA 1TW3A 3I0TA 4CO8A 2IA0A 2WV0A 4CXFA 4EVIA 1EH7A 4AD9A 2RC4A 2STWA 3LAJA 4KMUX 4CYDA 1MD0A 1Z6RA 2W85A 5D4RA 3ZMSA 3S2WA 3WG9A 4EJOA 1ZG1A 2VBWA 1G4DA 4EM0B 4HF0A 4P9FA 3I53A 2UWMA 5ICCA 2ISZA 4A5MA 1R22A 1QQIA 2QLZA 1IXRC 4UXNA 4OU0A 3RJPA 1XD7A 2VODA 3I64A 4ENKA 1KGSA 2QWWA 4ENJA 2DQRA 1G3YA 4EM1A 3GFMA 2R3SA 5L3EA 4HF2A 3GEZA 1MZBA 2RGVA 3ABTA 3E6CC 1RUOA 3E5UA 1QPMA 3I5UA 4GXOA 3CLOA 1RNLA 3RYPA 1AOYA 1F5TA 3Q9SA 3W6JB 1LJ9A 5K1YA 2VOOA 4BQAA 4I0BA 2VC0A 3SQNA 4ETSA 3SZTA 2GZWA 3NRVA 2DW4A 1G3SA 4UNOA 3LWFA 1KYWA 5J6XA 2FBIA 3RIRA 1J75A 2DBBA 1W4MA 4XLPF 1SMYF 3FXRA 3V8JA 1XGNA 3T1BA 2ZJ2A 3E3VA 5HDGA 2ZFWA 1MDMB 2PBIA 2LSOA 1SD6A 5D5UB 4KN4X 5ILUA 4NHJA 1ZLJA 2STTA 3C3WA 5DCFA 1QGPA 5K5RA 3HOSA 2MH2A 2HTJA 3FF5A 2KJBA 2EWNA 2XRNA 3F23A 3Q5FA 2ZNYA 2OBPA 2XUBA 5FGMA 1H0MA 4S05A 1S8NA 2KRFA 2RNJA 3OOPA 1HW1A 2Z99A 3I54A 4AVPA 4WXHA 5HS8A 3WTSC 2JPCA 5DUKA 4Y15A 4EV0A 2XGXA 1W5SA 3WGHA 2GIVA 3IHUA 3C7JA 1ON1A 2VBYA 1IAWA 2HEOA 1I1GA 3TO7A 3GZ6A 3GUDA 4MNUA 2GWRA 2MA3A 2IA2A 3JSPA 4IXAA 2LF7A 2DFIA 4B09A 3K0LA 2DK5A 5HDNA 1SMTA 5ILVA 4HA8A 3IRRA 1TLHB 4UUVA 1XSXA 2ADUA 1ZH5A 5LRRA 1YQAA 3KCCA 3LFKA 4MEXF 1LEAA 2VT3A 2JZYA 2YU3A 3MCZA 4M72A 4UHTA 2FBHA 1XB4A 3O6BB 4I7HA 4U88A 4KNYA 3G73A 3F6VA 2CW0F 2QENA 3TKYA 4HV6A 5ERIA 3ULQB 3ZMTA 1SD7A 4BHPA 2H6BA 3CUQA 3K1PA 2L01A 5D5VB 1SD4A 1FSEA 2W84A 1HW2A 2EV5A 3HIFA 1ZREA 3ELKA 3V7CA 3HSRA 1Z7UA 4U0YA 1SD5A 2KJCA 5L3FA 4G6QA 1YG2A 2IA1A 1W7PB 2A68F 1V4RA 2L02A 3BOQA 2ZMEB 1ZN2A 5DDGA 2GXGA 4PGGA 3IKTA 4AWXB 3EUHA 2H94A 1ZG5A 3T0YA 1HSJA 2G7UA 4EJWA 2FF4A 2E1CA 4HF1A 1DP7P 3QPHA 3SFZA 2NS0A 1OYWA 3WTZA 4R1HA 5DV5A 4AIHA 3F22A 1LNWA 4UVCA 2GAUA 1Z1DA 1O7FA 2FXAA 2HWVA 2VONA 2K27A 4Q5SF 3LA3A 1LQ1A 4FX4A 3SXYA 3E6DA 1EH8A 4NB5A 4IRIA 3HRMA 3LQRA 2FU4A 4LMYA 3TDUC 4KT5C 1ZHFA 2EFPA 1MKMA 2L54A 3IC7A 2L3DA 3ZN0A 1FBSA 3NQOA 1GHCA 1OKRA 4LLNA 1CF7A 3P9KA 2XKPA 1FZPB 2K7LA 4KUMA 5J8FA 2A3SA 2QYOA 2VBXA 3CUQB 3J80Z 1ZAOA 5JI6A 1HW5A 2QQAA 4JQFA 4M6YA 1T38A 2RQPA 3RPQA 1JGSA 2W25A 4WXDA 4A0YA 3D5LA 2A5YB 2WC2A 2RV8A 2ZMEA 3SHFA 2FMLA 5BPDA 2D2WA 2V6CA 2CYYA 2OQGA 1IXSB 4N9IA 2VE9A 1R58A 3F8FA 2VC1A 3WTWC 1L3LA 3BZ6A 2A61A 2XHKA 1CGPA 1PDNC 1U5TC 2XROA 3H3ZA 1STZA 4KA4A 3VOEA 4E70A 2R7FA 2HS5A 4HX4A 4OIOF 4ESBA 3L00A 4O6JA 2BYVE 2GA2A 5DD4A 5DUIA 4IRGA 2EV0A 5IT9K 2P6SA 3VB2A 3CO6C 3JTGA 1I5ZA 1U2WA 4EJUA 2M45A 2O3FA 3TOBA 1R1TA 3RDIA 2HQRA 2VE8A 4FX0A 4L5JA 4ENNA 2B0LA 2EFQA 4A5NA 3N4MA 1JHFA 5DEQA 2VN2A 5JR3A 2AXLA 2DPUA 4CGZA 2YX4A 5ED4A 4OINF 2XAQA 3U9GA 4L9JA 1BI1A 1D5VA 1A04A 5DD8A 4WK8F 1IW7F 3IRQA 3EYIA 4KFCA 2M87A 2MLKA 4IVNA 4A6EA 2OU2A 1MJAA 1ZLKA 4L9NA 4I09A 4ESFA 4KIGA 1IUYA 3K2ZA 3P9IA 2A69F 1ZRFA 3FZVA 3K1MA 4LFUA 4KYWA 2E7XA 1S7OA 1YIOA 4QWQA 2MBFA 4I0AA 5DCMB 2Q2EA 4ZZDA 1K78B 1XSVA 1J5YA 3M8EA 4OIPF 5FD6A 3GFJA 3W6KB 1FYKA 2XKOA 3J80K 2OD5A 3QP6A 3F8NA 5D4SA 4DQ2A 5E18F 3COAC 3AAFA 4LK0F 3WGGA 3CUOA 1UB9A 2O6GE 3E97A 1G6NA 1IN6A 1YS7A 2LKPA 5LGUA 5A2QK 2HKXA 3O2PE 1XGOA 2PEXA 1R36A 4FHTA 4KMFA 4S04A 1J7KA 4WXCA 4Z2YA 2BBYA 4L9TA 5D5WB 2CGPA 4RS8A 4HQEA 5CJ9A 1OMIA 1YYVA 2O0YA 5TRDA 2OZ6A 1LB2A 3LQQA 2UZKA 2C6YA 3HTUA 1V3FA 2ZBKA 3F8CA 4YFNF 3BDDA 2M5WA 3FMSA 2O61A 4M71A 5BS6A 3G3ZA 2NAZA 1S6LA 1R23A 3L9FA 4AIKA 5CVRA 3WTXC 1QZYA 4HZFA 2DQLA 4XRFA 4XSZF 4KDPA 5JVTA 1BI0A 4NQWA 3GFIA 2PFBA 1USTA 3QU3A 1TW2A 4A0XA 2LF8A 1Z05A 1K78A 2P7CB 4RB0A 5LEKA 1O3SA 3BWGA 4A0ZA 2V1XA 3FX3A 2FE3A 1Z91A 1DUXC 1TQMA 2YSRA 1U8RA 2KIFA 1KU7A 5HVQC 3HSFA 1R5GA 3CDHA 4ZZLA 5HS7A 2DK8A 2WWYA 4YIIA 5JFRA 3WTUC 1Y0UA 1RIOH 4YG2F 4UVAA 2HYGD 4A2UA 2JRTA 5EEHA 2XIGA 4M9SA 1BOAA 3SZPA 3ISPA 5BQTA 1W5TA 2IRFG 3KP3A 2XVCA 1LDDA 2Z33A 3MEXA 5D6EA 3HHGA 2NNYA 2QM3A 2V1DA 3R60A 3QRFF 3MZHA 1RUNA 4CHUA 4EJVA 3ZMDA 1PP8F 2NYXA 2Y75A 3E5QA 5LGNA 2NNNA 1ODDA 5L3BA 1KQ9A 1PUEE 4BHCA 2FNAA 2Q0OA 3HSEA 1XSDA 1J59A 4BH9A 1IF1A 5KK1A 4HV5A 3TQNA 4U7DA 2EA4A 3F6OA 2CQKA 2ZCWA 1WKMA 3J81Z 3KEOA 1XGMA 3BJAA 1YO5C 3FXUA 5DCMA 3JW4A 5F1RA 4ZYEA 3LAPA 2F5DA 3JSOA 4GYIA 3BROA 3GXOA 2P8TA 2EFOA 4KIBA 5BMZA 3CJNA 2HTSA 3BJ6A 3WU0A 1O3TA 5E20A 2DO7A 3N97A 2JT1A 2PQ8A 2IPQX 2O8XA 3MWMA 5H6QA 2QUFA 1KU3A 2BGCA 2H09A 1ZGJA 1P2FA 3I59B 1W7PD 1CF7B 2UXNA 3ECOA 2MC3A 4R8HA 3QP5A 4EGYA 1HKQA 1KU2A 1U6GA 2W57A 1O3QA 3BPVA 3MZYA 1REPC 2HDCA 2HFHA 3T8TA 2IJLA 2HZTA 3LA7A 3I58A 1D3YA 3VEPA 2FNPA 1XMAA 5FFZA 4JBAA 2HKOA 4G9YA 1KA8A 4ON0A 1UCRA 3EQLF 1RZ4A 3PQJA 3DPLC 4D0PA 2R7DA 3KP7A 4XBFA 4O3MA 4WX9A 3FMQA 3TDZC 2DU9A 3MFKA 1FYLA 1T39A 5DYMA 1QO0D 2ZO4A 3FM5A 2QZ8A 3GX4X 5E8IA 5HDKA 2FA5A 2HOEA 3I59A 2MD5A 1TTYA 1HBXG 3M8FA 4UV8A 1ULYA 4HQMA 1BC8C 3ZN1A 4F7ZA 3WODF 3TO9A 3RKXA 1B9NA 2J5PA 4HYEA 4BXUA 3Q9VA 1WSUA 1IN7A 3ZMVA 3DEUA 1R00A 4HDUA 1F4KA 3GLXA 1MJ9A 3REOA 2K4BA 2AS5F 4IPAA 5CLSA 1LDKB 1TNSA 4L0YB 1WWXA 4RGUA 4MTDA 3JAMZ 2D1VA 1OYYA 5E17F 4LD5A 1J9IA 3K9TA 5ILSA 4RGXA 1MGTA 2M30A 5H20A 2A6EF 1Z6TA 3WE3A 3DPTA 1I27A 4UVBA
chains in the Genus database with same CATH superfamily
4DOZA 1XMXA 3IWFA 4J00A 1V2NT 2DA2A 1ONVA 4UFFH 3KP2A 2A31A 3ASNH 5BPIA 2QCOA 2BY2A 2Z16A 3JRCA 3KLNA 1O3RA 1EPTC 4FUCA 3U1IB 5I25A 4YOGA 1TC3C 1YPLH 4A93J 3S3OA 1GBJA 3BTHE 2ZDNA 2DDBA 1QNTA 4ZYHA 4GCHF 2FMYA 1C5PA 4DOQA 4BYYA 2MW8A 2PW8H 1JBUH 4X1QU 3DSGA 4XLHA 4CBNA 1VNDA 2CFOA 1Z77A 2JJ2D 2CRGA 4HOBA 3JRIA 5B5EC 3WTVC 3UTUH 2ESNA 2VIPA 1U3EM 2NU2E 5I46H 4D7MA 3DF8A 1O35A 2HNTF 4Q48A 1GJ6A 3VB3A 1JMOH 2GOMA 4KT6A 2CV2A 2M2EA 2FOKA 3UIRA 2DOAA 3KEEA 1ZRDA 3FAOA 1TQPA 3PLBA 1X3UA 2E5ZA 1NS3A 1HKSA 1VITF 4LZ4B 3K4KA 5HIZA 1IOEA 1TRMA 2NRAC 7KMEH 1I6XA 4ABHA 1B9MA 4RGSA 5LLQA 2PG4A 3CC7I 1O5FH 1YFHA 5HLTA 1R7JA 1UZCA 2EI7A 2J9NA 1RI7A 5KVRA 2LNCA 1ENHA 1JI8A 3M4OJ 1PQ8A 2J4IA 2VWNA 4RKOB 1WXRA 1HAIH 2F5CA 2R7RA 4NIVA 1JGGA 2VXDA 1AKHB 1FOKA 1GVJA 1TLDA 1RTLA 4Y13A 1K1LA 1NFWA 2OF7A 4PGHA 4I2OA 2AMQA 8ESTE 1P4XA 4HAMA 1A5IA 1GGDB 3RXUA 1AWHB 3MWIU 3UR3C 4RM2A 1K9OE 2BDIA 1Z21A 3QZQA 2VB6A 4IHVA 3P92A 3NWSA 3TGKE 2R9PA 3SU3A 2ZJRF 4AM3A 1Y3UA 3GFLA 2DA4A 5IT9Z 4AB9A 1NG7A 1ETQA 3U8RH 3MN2A 1TOMH 3I29A 1ELTA 4I8JA 2BQ7B 1LVOA 3SNBA 1FNNA 1PP7U 1AZ8A 3GTGJ 3CUQC 4KGAA 3CCMI 5CVJA 1IHTH 4B1TA 1KYZA 1SGDE 1SKYE 4AYBA 3JR9A 1BJZA 2R2WU 1QIXB 1H1BA 2EA2A 1RR8C 4FVDA 2ZECA 1KZHA 1BR1A 2W24A 1C2FA 1DY8A 1O36A 1MBHA 2HXOA 2XC0A 3WHBA 2JUCA 3B6CA 1Z3XA 3GISB 3C18A 1QCPA 1O2QA 1FMWA 3RXPA 3H3UA 2OA4A 4OMYA 5JBAS 2BZAA 5FKLA 3Q0VA 2BHGA 2DT7B 4YESB 1MIJA 1R4MB 1KIGH 3ATIA 4A1XA 5DJ7A 1AFQC 3T5XA 3HPGA 2VPRA 2BY7X 1YW8A 5KAFC 4XLEA 1UTOA 3RXJA 2HOBA 3O8GA 4I99C 1QZZA 1EUFA 4WWYA 5JB9S 3RKYA 1MBKA 2WB1A 5EQRA 1QJ6B 3EETA 4GCVA 2ZPSA 1FJLA 3A7XA 3HYIA 1ELGA 1C5MD 1ITYA 4DBQA 3QPTA 1YW7A 3P17H 1BJUA 3RZDJ 2CG4A 3I71A 2GGVB 2W6JD 1GBTA 2G5VA 5EOKA 5K7ZA 1XMNB 2ZXJA 3KF2A 1ZKGA 4PJMA 3PYHA 1ZTJA 1CE5A 2EH3A 1XCBA 1E3HA 1O5DH 1GJ4H 3E1SA 1QBJA 3UNRA 1K83J 1AD8H 1MTUA 2F9UA 2GA1A 1O3GA 2LYCA 4K8BA 4ISOA 4IRHA 1NU9A 2QF7A 1UHMA 2P5VA 1H9TA 5L3GA 1FY4A 1NPMA 3QWLA 4SGBE 3K65B 3GTPJ 5KNLA 1GHBG 1EJMA 4V2GA 3PIOF 2V9VA 4CSWA 3PLPA 4E05H 4ZKOU 3IWMA 4G94A 3MYWA 3VB4A 4ABJA 4M9ZA 1SLVB 3MHWU 1N6YA 3S69A 1YM0A 2B7DH 2IS2A 2Z3EA 4E7JA 5AHGH 2QBYB 3RXCA 2XASA 5BPEA 2OCVB 1V2ST 3KQ5A 4MTEA 4CDGA 1CBWC 5FJ8J 3KP6A 2VOPA 1B8IA 3MH4A 3LSJA 1F5RA 1DWDH 3R4KA 4LG0B 3S32A 3F9HA 4JYUH 4F48B 4BL0B 3A8BA 3B73A 4HG6A 2HQ5A 4F4OC 4DW2U 1UVPA 1XMKA 1U5TB 3SGBE 5ETXA 1ANEA 2BD4A 2XRCA 2JJ7A 1JT0A 2GZ9A 1PQAA 3AG1H 2JKHA 1B1BA 3SU5A 1FIPA 1DDJA 4KELA 3LJJA 1O7LA 4A92A 1P7JA 1T95A 1VZQH 4E4HA 2ZTYA 4GRIA 3FXQA 1BQYA 1JKPC 1ZLRA 1K7AA 2KL4A 4OOIA 6LPRA 1JKQC 2YX7A 2PMHA 3R61A 4UY8I 1B59A 3MU1A 3AK5A 1DANH 4CRAA 2FX4A 1AMHA 1WVRA 1B72A 1OR7A 4B75A 2QQ9A 3DBLB 4DIQA 5HOOA 5C67A 2A2XH 1XDUA 1TNJA 3QX5H 5F8TA 1DPRA 4NGAH 1C5UA 2HLDD 1SFUA 3J81K 2OCCH 4G8XA 1M1EB 1FY8E 5DN6D 2VVCA 1QGFA 3S9CA 2FTLE 2IW5A 1BW5A 1XS9A 2K9QA 3PFIA 2A4QA 2F2EA 2XC4A 3LA2A 5JYIA 1EASA 2VINA 5DP4A 2E36A 3ZXSA 3SJKA 5T6DA 2EZIA 2L4AA 2Y80A 2XSDC 4Y17A 1OKXA 1S5SA 1HAVB 2IT0A 2H1KA 2Y5FA 1LDJA 1P10A 5J4YA 4QPOA 3FDYA 1HJAC 1QHGA 3RPUD 3T8RA 4P1WA 1HDDC 3SOSA 2CH0A 1BIBA 1T2KA 4GO1A 3TK9A 4Q2KA 3SJ8A 1NRNH 1XCVA 3QPLA 1SGNE 2BY6X 2OZUA 2DMNA 4EGZA 3HGYA 3PSFA 3S16J 3MAJA 1B6AA 2BOHB 1FJSA 1OPCA 3PO1C 3LSIA 3F8BA 4RAZA 3BR6A 3RPUA 4BAOB 5E1ZB 3EPZA 3KLOA 1FYMA 4JYVH 1WCZA 3ZQFA 1HYLA 1DE7H 3HOXJ 1P3CA 2XV4S 1D1CA 4CR5A 1E2XA 1QRZA 4XLCA 3LJOA 2L9RA 2BD8A 4QTRA 3KL6A 4Y7NJ 1DP3A 1KDQB 1IN5A 5JHUA 3IAS2 4K2EA 1WYKA 2RN7A 1YPMH 4L0ZB 1YI2I 2OP9A 1S7AA 1MCVA 2W6ID 1DQUA 1KTSB 1P05A 4HW0A 2E60A 3HOYJ 2HYFA 3BG6A 3H9QA 5GTHC 2CW8A 3S14J 4GYGA 1ERDA 1XGSA 3EYYA 1A6QA 2KR7A 1WH7A 4MQ9F 3ML6A 3RXDA 2XOKD 3M9AA 4P96A 3PRBA 3C1DA 3UREA 1I1SA 1ZGVA 3SQEE 1QA7A 2VNTA 2L74A 3S15J 1GI7B 3VDXA 1PYTD 4LGWA 1WJFA 2EEKA 4KTUA 3SU6A 5CHAC 1FWZA 1K6OA 5C1UA 1ELVA 2P4WA 2KZVA 1MSEC 2WAQN 2V4JC 1DITH 3T25A 1BM9A 2WY8Q 3SUGA 1UK4A 4NIWA 2D1HA 3FZDA 2AGEX 5GWZA 3ZQLA 3RXHA 4ISLA 2BLWA 2ZCLP 1ABIH 5K7RA 5DKMA 1XUFA 2F4OB 2YNAA 4XOJA 2F43B 1V2PT 4CO8A 2IA0A 2EIKH 1EH7A 1N78A 4ACBA 1O3LA 4BU2A 1ORFA 1Z7KA 1GBIA 4VGCC 4CYDA 2W85A 4RT0A 2W3IA 1IJWC 3S2WA 4EJOA 4CA0A 1UK3A 1W0JD 2OLGA 1J8AA 4F3QA 1WJDA 3WY8A 4AFQA 2R7ZJ 3MNXA 1LKBA 1TALA 2UWMA 2ZB9A 2CHAB 2R5YA 2QGUA 1IXRC 1Z6EA 4X8UH 5KAIC 1XD7A 4I8LA 1TPSA 2QWWA 1I6HJ 3O8RA 2PSXA 1O2HA 5EZGA 2R3SA 4Q7XA 3ZZ3A 2GIZA 2XGDA 3H5NA 4SGAE 2A5AA 4HF2A 3IH4A 1OCOH 3K4JA 1MZBA 1YJNI 1GBBA 1T8MA 2ZP0H 3E6CC 1LHFH 4KISA 4GXOA 4E7LA 3CLOA 2STBE 3SV6A 1FAXA 1O2VA 1AOYA 1DSUA 2KAIB 5TCAA 3M3TA 4BQAA 2QF3A 4I0BA 3OYAA 1E34B 1QR3E 1SVMA 3SZTA 3X2QH 1C1MA 3M5OA 3I55I 4ZXYH 4UNOA 5J6XA 2TIOA 3RIRA 1J75A 2QN5T 3ITIA 4XLPF 4LK4A 1LUJB 1SMYF 2VB0A 4B76A 2MSYA 3V8JA 1C1WH 5LGOA 4CRCA 2VIXA 2IJD1 3K2AA 1MUEB 2ZJ2A 3A7YA 1W2KH 4TPYA 3F2HA 1HAPH 2LSOA 2TBSA 3PTBA 4ZYAA 2O8LA 2PR3A 4NFEA 4X6AJ 2FDAA 2VGCB 4CCMA 1CHGA 1Y8TA 2Z9KA 3A83A 1MAYA 1GHAG 3ERMA 5JPMH 4XE4A 1L0ZA 5DTDA 4YXWD 5J40A 3W6VA 2OBPA 2XUBA 2P0WA 4S05A 2ZTXA 1MABB 1S8NA 2KRFA 1DWBH 2VH0A 2RNJA 1C1VH 3OOPA 4NDLA 1DX5M 3I54A 1TWAJ 4XBBA 4WXHA 2XGXA 1TMTH 3WGHA 1TWXB 3IHUA 3TLOA 4Y4RA 2SNVA 1IAWA 2X6OA 4Y8YA 4AX9H 1RRJA 1I1GA 3MO3A 1LE8A 1TONA 4II3A 2GWRA 4CH8B 3K0LA 2DK5A 1SFKA 5HDNA 3AAVA 3IRRA 1MTSA 1TLHB 4FVBA 2V7QD 3LFKA 3I56I 2OBOA 1SVPA 1UJ8A 1U6QA 5E0GA 4OAZA 2FBHA 2PKAB 1SLWB 2FI4E 4XKVA 5EQSA 3SJOA 2QENA 4HNUA 1TGSZ 1YHQI 3TBIA 3ULQB 4H42U 4IHWA 1LFUP 2KX4A 2C90B 3CUQA 3K1PA 2O8TA 3GCNA 5D5VB 3AKZA 1WZ2A 2BD5A 2VI6A 2W84A 1FY3A 2DFEA 1G3EA 1GCDA 3ELKA 3EGKH 1YP9A 1GLNA 4U0YA 2XF6A 2KJCA 3F3BA 4FXGH 4G6QA 1CA8B 2A68F 1V4RA 3BOQA 1ZN2A 5KEDA 2Y9ZA 5DDGA 1O3KA 3EUHA 2H94A 1BDAA 1OFCX 1SSXA 2KHMA 2G7UA 3KYCB 4EJWA 2FF4A 5BRRE 1RETA 3RXVA 2WV5A 3BC8A 5FCRA 4DT7B 3WTZA 2AEIH 1MZDA 4A7IB 4AYBN 4CUGA 2X48A 5A8ZA 2HWVA 1RIWC 5FXLA 1D3DB 3K9XB 3E0JB 3HRMA 3QTOH 3M7UA 2KRHA 1MKMA 3GY6A 1C1UH 1MKWH 3NQOA 1BTPA 4LLNA 1CF7A 4KUMA 4H6TA 1JUSA 2OC6A 2QYOA 4ABAA 3CUQB 1FIZA 5JI6A 3GZNB 4M6YA 4WH6A 5B1AH 1RKWA 3M37A 1RTKA 3WU2C 1JGSA 2OTLI 4E6KG 1W36C 2BLQA 4WXDA 2ZDLA 4CREA 1F7ZA 2O8UA 1O2GH 4BTTB 3SHFA 2FMLA 2D2WA 2V6CA 2CYYA 1IXSB 3F0CA 4M6VA 3ZQIA 1BTHH 2VE9A 1R58A 2AFQB 3WTWC 5E3MA 3IG6B 2A61A 3A89A 1CGPA 1U5TC 8KME2 2FX0A 3VOEA 2R7FA 2HS5A 1SGRE 1A0JA 3L00A 5DPAA 4O6JA 3PMBB 4NSYA 3LGTA 4A3KJ 2EV0A 4RI0A 5IT9K 1HXEH 2B9SA 4D9QA 1I5ZA 1NY22 5F04A 2HWLB 2F4MB 2BMGB 3N7OA 2Q1ZB 3MVPA 1F5LA 1ACIA 2VE8A 2B0LA 4JZ1A 3RXSA 3DCLA 3N4MA 4HSTA 2VN2A 4LITA 4BANB 3SGAE 2UWPA 2DPUA 2CW7A 4TY6A 3A8AA 4OINF 4FUGA 5FPYA 5DSFA 2XAQA 1ELCA 3U9GA 1D5VA 2F6CA 2LK2A 3EYIA 3SI4H 2M87A 2L7MP 4ABZA 4ZDLA 1ETTH 2AHME 4DCDA 1X1PA 4L9NA 3ATKA 3OE7D 2G52A 4KIGA 4HNTA 1G2HA 1IUYA 1O30A 2A69F 1ZRFA 2ANWA 2Z2SB 2OK5A 2E7XA 1IQEA 4C2TA 1UG2A 2B5TB 3HPHA 3RXLA 1QL9A 5M3FJ 1R4NB 2RFKC 3A88A 5DCMB 2JA6J 1YX3A 3VGCB 2LREA 3DEWA 3NK8A 4B3AA 1C4V2 1FN6A 1XUIA 1F92A 1D3TB 4OIPF 5FX5A 4X0WU 1BRCE 3A7WA 2BTCE 1GBKA 3QP6A 3BTME 3COAC 1O32A 3TNTA 2ZEBA 3BLYA 5GXPA 4FQGA 5EODA 4RN6A 2W7UA 1O2TA 3BIUH 1HAGE 2LP6A 3AASA 1WJAA 1NO9H 4A3IJ 2PEXA 4FHTA 2DFFA 4S04A 4JYTA 5L2YH 3EUAA 2OTJI 3CLQA 3N7EA 1TMBH 3RXKA 1ZSJA 3G4SI 2K1QA 1VKYA 1OMIA 1CT4E 3LH1A 2YS9A 1MTNB 4OS4A 2ZBKA 5FKNA 3F8CA 1IGNA 4YFNF 2Y9YA 3UOPA 1E36B 4M71A 3GYMA 1OISA 2AGGX 2OUAA 4MIMA 3NUMA 1R23A 1W14U 3F9EA 1DM4B 1NU7B 4XSZF 5JVTA 1N77A 1CA0B 1W3CA 3E1XB 4I31A 4K1EA 5GDSH 2FO9A 2BDAA 3MNCA 4XKCA 2LF8A 1K78A 5KGOA 1AA7A 1NH3A 2YNBA 1OCPA 2H8RA 3OTJE 3A0HC 2FE3A 3SYTA 3T26A 1MNDA 2Y6TA 2KIFA 3EAJA 1A6IA 1V5EA 4ZZLA 2LH9A 3A0BC 3SJIA 3E8LA 1EOJA 3PNYA 1RIOH 1KONA 1QZ8A 4A2UA 4XN0A 2XGCA 2NXNB 1ZMJA 4M9SA 2AO9A 4XK4A 3IITA 5C5NA 3SV2H 3A82A 2IRFG 2XVCA 1O2JA 3BCAA 5IP7J 3HHGA 1C1SA 2OD3B 2M7AA 1P9QC 1DGRM 2Y75A 2E35A 2NNNA 1QFKH 2J2UA 2ZZUH 3F2GA 3PSIA 1ZGWA 2ANMH 3LGUA 1LPQA 1PUEE 5F03A 3UR6A 3LGWA 1W7GH 2CUZA 2FP7B 4BH9A 4HV5A 3TQNA 3G01A 2R7WA 3CMAI 4OWRB 2X1CA 1TNKA 3PWBA 2ZCWA 2IS6A 3S0NA 1FY1A 4YLQH 3NARA 9ANTA 3FK7A 3J81Z 3KEOA 2JA8J 1UMQA 3KN2A 1A35A 1UTMA 3QYFA 3UR9A 2DXIA 2ZFQH 2VJ5A 2CMYA 3TJVA 1C5YB 4NA7A 1MH3A 3QPSA 1DXPA 2F5VA 2WPDD 4LXBH 2G81E 3OIOA 3OYLA 2EZHA 1EPTB 3N97A 2JT1A 1HLTH 2O8XA 3MWMA 5DO4H 3WW7A 1ZGJA 3I59B 2MC3A 3CCSI 3QP5A 1QJ7B 1O5BB 5F8ZA 5EU8A 2DFHA 3WWBA 1REPC 3BTCA 4C9YA 2QF4A 2FMJA 2DTZA 2HDCA 2HFHA 4CRGA 2GJGA 5IDKA 1DXWA 3FK6A 2HZTA 4D5FA 5FFZA 4ON0A 1UTNA 2ZF0H 3W1EA 2X6YA 1UO6A 3DKYA 1C2HA 4VGCB 1G3CA 3SU1A 2BX4A 1UCRA 1RZ4A 1T8LA 3DPLC 4BBRJ 1HFDA 4M3GA 3H7TA 5E2PA 2Z94A 1T39A 5DYMA 2ZO4A 3GX4X 2Y5HA 2HNHA 4CH2B 1FOWA 1H8ED 2RREA 2FA5A 1YPHE 2VQGA 3LIWA 2G4UA 3M8FA 2ILNA 1V2WT 2E2HJ 3PNTA 3F1SB 1H88C 3CS7A 2NU3E 2HZDA 3WODF 3TNSA 3JZ1B 3TO9A 3RKXA 1E0EA 3LGIA 5J1UA 3K2UA 3D49H 4XNFA 2NVYJ 2BXZA 1DSTA 1MBGA 5C0UA 4C3JJ 2OC0A 1F4KA 1MJ9A 4HI3A 1SI5H 2QXGA 2ODQA 2R0KA 3OTPA 5EGMA 1C2DA 4NIYA 1GBFA 4RGUA 3FOAA 3M35A 3DCFA 3UWIA 4RKJB 3JRBA 1LKXA 2CU7A 1GPZA 3DPTA 2RDLA 5EXMA 3SEQA 3IUOA 1APLC 1SHYA 1MJBA 4NZQA 2W7SA 4YFXF 4X2VA 1AWCA 2DCEA 2NU0E 1A61H 1Z9CA 1QVUA 3F0PA 4EATA 1OX1A 2JK3A 8GCHG 4YOIA 1BOBA 1FY7A 1KXBA 1M9UA 3TGIE 5HLGA 4IX7A 4ABBA 1PJPA 1C5OH 3QQAA 2A7CA 2LFBA 1FT9A 1OP0A 1E3OC 4UDWH 1GHWH 2K3PA 3FKSD 4IC6A 1LVBA 3CZ6A 4OS5A 2ZNKH 1ZELA 2BOKA 4WVPE 4NBQA 1CVWH 2J98A 1V2MT 4DGJA 1SAXA 2F9OA 5EXLA 1VCPA 3BIVH 1WHUA 3CP8A 4G7HF 2V1NA 3ZV9A 1WPKA 3ASOH 4JYKA 5LPRA 1FBQA 1SFIA 1PYVA 1GI0A 2PMUA 2P3UB 1Z1IA 3KP4A 1G3WA 4LK1F 2DE9A 4IHSA 4O3TA 2WZQA 2IGKA 1UG0A 1TBXA 3DLAA 1IRGA 1EP5A 1EAUA 5CKTA 4LLGF 3E6BA 1NRRH 2IS4A 2XAHA 5JLXA 4FUIA 1GV2A 1S6FA 5FO5A 1EH6A 2MYSA 1H9LB 2XAJA 4P55A 5LHIA 3EYDA 3GS9A 2J34A 2UWOA 3JAMK 1H9GA 1C1NA 1EJNA 1TNTA 2B8OH 1JXSA 1OSSA 2R93J 1GT0C 1USSA 2K86A 1P04A 3GDVA 4AYVB 2BXYA 1BR2A 4M6XA 2CXVA 4JK1X 2P5LC 1EJAA 1IQLA 2D8WA 3VXFH 1GHZA 4X8VH 1J16A 4BAQB 5JB8S 3BSQA 1Z8JB 2EQRA 2CO5A 2O7OA 3B9FH 3ZVFA 4BY7J 3GZ5A 2I8DA 4KICA 1EP6A 3PUBA 4UUTA 1GJCB 1O2YA 3SDBA 1SR5C 2IGMA 3DTKA 1YW9A 2H27A 1LPZB 1S83A 1NT1A 1VTNC 3WTYC 5C20A 4WH8A 2F9NA 3K10A 5LD2C 3PO3J 5LPEA 4MNVA 5HM9A 5FLXK 2ZWLH 2HGTH 4E7IA 1MD8A 1COWD 4BXSA 2Y0SN 4GAWA 3GYHX 5L30H 3GTOJ 2L0KA 4EJTA 3ZZ4A 3A84A 1UTQA 3HDDA 3F72A 1T31A 4A6DA 2B0FA 3ZVDA 2V3OH 1Y5BT 2LTPA 5D8KB 2X6WA 3Q00A 2E1NA 2ANYA 3CCYA 2VBZA 1FSHA 4YM9A 1X2MA 2OQRA 3RM2H 3GY8A 5IP6A 2JTVA 1TWFJ 7ESTE 2DN0A 1FP1D 3NEUA 3DEEA 5FRNA 3HOVJ 3BTGE 3E6PH 3S1NJ 1WI9A 2G9WA 2VLAA 2GCTB 3WWFA 2LVSA 2DE8A 4OIRF 1SAUA 1PPBH 2JH5D 1GG6B 1IQNA 3TW6A 1T08B 2BLVA 2J97A 1RD3B 1GVLA 1UVUH 1E0FD 1EQ9A 4G6DA 3QUMP 3WGIA 1OHHD 1JXPA 1GCTB 5EGOB 5AIPA 2Y82A 3KZYA 1IV8A 1O2PA 3TJNA 4ESJA 6PAXA 2H2ZA 1IN4A 3SBKA 3OYCA 2P93A 3HRUA 2WSSD 1WGXA 3BG4B 4HX7A 5D8LB 1H8HD 1D1BA 4W1UA 1TNGA 1FLIA 1MKXH 2VASA 1O39A 4CZZA 1YLDA 2FM2A 1T0FA 2HVQA 1ETWA 1P2JA 3M61U 2LBFA 3IP4B 4M73A 2FTMA 1QL7A 1AHDP 1TT0A 3OYMA 2W26A 3A1YA 3CCLI 4ZDOA 1SQAA 1FX0B 1P4AA 1ZARA 1W0YH 2R7SA 2GZ8A 3S2HJ 3DV8A 1GHBF 2JJ1D 2BVMA 1FTTA 1VQOI 2EI6A 2NWNA 4DYRA 4KTSA 5E1XA 1EB2A 2DJIA 1BMNH 2XAFA 4M9XA 1DT2A 2EIMH 1IRFA 3MKZA 4NSVA 3O3KA 3D5RC 4HLYA 2DDAA 1WV7H 2CJJA 2UUFB 2ZHWH 3OL3A 5F53A 1D5YA 3F9FA 4E7SA 1LCYA 1OWDA 2QXIA 2KT0A 5EPNA 1T98A 1OWEA 2WADA 1ORKA 2CS3A 2HPPH 5FLMJ 4H4KC 2ESTE 1LFPA 3D0SA 4LB6B 1QJ1B 3LSTA 1D8JA 1QZEA 1ETYA 2Q1JA 2ETHA 4A6LA 1IQIA 1FOYA 2ZC9H 2PFEA 1S6HA 1C5RA 3FN8A 3FM3A 1OP8A 2CMPA 4MGRA 2XWBI 1C0WA 3E0NB 1IV6A 2SGEE 2ZGJA 3KYLA 5F6FA 5F0FA 3ZMZA 1LHEH 6CHAC 1TE0A 1D3QB 4ZCNA 2ELHA 2OAZA 3HUGA 2R3YA 5ICGA 4Q80A 1PPEE 1BITA 3BF6H 1HKTA 4Y76A 1OXGA 2D26C 3NKKA 1SLXB 1IZ1A 5A2MH 1NK3P 3WU1B 4TY7A 3U1KA 2XNDD 1V2KT 4X2YA 1ETVA 3OR2C 2W82A 4P5OA 2PJPA 1UCYH 2KZ4A 1VFCA 1HXDA 3DT0H 1AU7A 2MFZA 2F3CE 5H6RA 3ZIAD 2JRMA 2XDVA 1KQ8A 4K2YA 3U1DA 2BDBA 3DFGA 2BVLA 4U7BA 3RI4A 5LEJA 4D7GA 2Z5UA 4G7OF 1GI6A 5GP9A 1ZZZA 3S7HB 3ZVEA 2FOGA 3BG8A 5C44J 4JZIA 3RU4E 3H0GJ 3OOUA 3MU8A 2QQBA 3H0DA 2ESHA 3LC5A 3CD6I 3QOPA 4PUSA 1VQLI 1NC6A 4FUJA 3ZZBA 3CCRI 2VH6A 2PMZN 4WMDA 4RB1A 2K9LA 5J3LA 3CS0A 2A4OA 1H9HE 3A86A 2QXHA 2Y5GA 1ACBE 3IH2A 2XB0X 1JWTA 5LRSA 3A02A 1FQ3A 1OJLA 1VZ0A 1YIJI 1S3JA 1B5GH 2XCNA 3RU4D 3RZOJ 2P3FH 1X2NA 5CYVA 3DWLE 4PFPA 2PUQH 2DTRA 2R92J 2HQNA 4BAKB 2QKMB 2HVSA 3DBHB 3K4NA 1FDPA 1T4UH 1KQ0A 3KFWX 1C9TA 1GL1A 3M5MA 2ZI2H 2Q8KA 3ZCOA 2XPUA 5F08A 2GXBA 1NBME 3QLPH 3ZVCA 2AS9A 5JBCS 4YFKF 4M3EA 1HJ8A 3MQ0A 1DLEA 1Z0XA 5EJZA 1S29A 4JMYA 3HGGA 4C3IJ 3KZIC 3KE2A 1L0OC 3JTHA 3ZMUA 2WBMA 1SG8B 2P7VB 5EGOA 2ZU3A 3GMEA 3M8JA 4R79A 1OYTH 2L9VA 4K69A 2WAFA 4YIFA 2UUJB 1WI3A 2NVUB 1QY6A 3PQKA 1U5TA 2QYIA 2YR2A 3BQYA 2DA5A 1PUFA 4EM2A 2VGCC 1I3QJ 2YPRA 4HSRA 1Z3YA 1OWJA 3H35A 5F64A 1RS0A 2NVQJ 2XAGA 2IJOB 2K9MA 5C2ZA 4O97A 3OV8A 3GY4A 1U8BA 3T27A 5IOYA 3W94A 1BMAA 4BXXJ 1OWHA 1GBCA 3HXLA 1UTJA 4AD9A 3V7TA 2A6TA 3TP0A 4B2CA 2STWA 3HL2A 4ASHA 1LPKB 3LAJA 4KMUX 1O37A 1H4WA 5E3LA 3ZMSA 5CE1A 1PQ7A 3OYKA 3C27B 3Q3YA 3VEQB 3DLLF 3B23B 3QOEA 1I3AA 4EM0B 2FPZA 4BEHB 4HF0A 3KIDU 3I53A 5ICCA 4ABIA 4IQ4A 3O8HA 1VQMI 2R3UA 4A5MA 1GI2A 1QQIA 3E0PB 1SB1H 4PSWA 4UXNA 2KCAA 1FIAA 4EM1A 1BT7A 1Z67A 2XPWA 2FYRA 4ZH8A 3TJOA 2UUYA 4II2A 1AWFH 1GBMA 2PLXA 2RGVA 3ABTA 3RDZA 2VUMJ 1B7XB 3FKIJ 1LVYA 1R6RA 5FL7D 3I5UA 1YPJH 2JDID 5FKOA 3GCHC 4J1YA 3RYPA 3H9JA 4BKXA 4AN7A 4HPQA 2IN2A 2CUJA 1LJ9A 4V19K 4FASD 1QQ4A 3SQNA 4ETSA 3OYIA 1XM1A 2QF0A 1G3SA 2L9NA 2CQXA 3E90B 3FXRA 3JRHA 2BW3A 1GCTC 3SJ9A 4ABFA 2ZKSA 4ZKNU 3BTJA 1IO2A 3PB1E 3KEYA 1NK2P 2I6SA 5GPCA 2X9DA 4N4NB 4NWKA 4AZ2B 5ILUA 4NNJA 2BD2A 1GBLA 3C3WA 1QGPA 1AKSA 2WAEA 1AY6H 2KIQA 4NZLA 2EWNA 3F23A 1YOVB 2ZJQF 1C1TA 2CUFA 2ZHQH 7GCHF 5CHAB 1T8IA 2ECBA 1HW1A 2Z99A 1TB6H 2ID6A 2HLCA 4DJAA 4FU8A 2BY8X 1BTZA 1THSH 3V12A 5FHTA 1WQSA 3SDGA 3WTSC 2A05A 3LMMA 3UWJH 5DUKA 3C7JA 5DP8A 3TO7A 3GZ6A 3MNSA 4Y8XA 1D0YA 2IA2A 3JSPA 5EDNA 1BTWA 1TFXA 2DFIA 2TCTA 3UPEA 2FS9A 1P02A 2BLOA 3OU0A 4HA8A 2JA2A 5TISC 2ADUA 1ZH5A 2HALA 4D1QA 1QRXA 1YQAA 1K1JA 3CP2A 2PSYA 2BM2A 2BXTH 2JZYA 1P9SA 3MCZA 2FOFA 3RLWH 1XB4A 3RXTA 4HTCH 4I7HA 3O8BA 1ZR2A 4FCYA 2GKVE 4KNYA 3TKYA 2ZFFH 2QGRA 1IQFA 2BX3A 1SD7A 4BHPA 1IQKA 2H6BA 2ZCKP 3AG4H 1YC0A 3U8TH 3A2KA 1U9OA 1SD4A 5IYDJ 1AZZA 1TQ7B 1NRPH 3HIFA 4D9RA 2O8MA 3HSRA 2WV4A 1F0SA 1YG2A 3G1LA 2F91A 2QXJA 3E91A 1CQTA 1ARCA 1PQ5A 3KPHA 2ZGCA 2M7BA 2KM0A 1O3HA 3NZIA 4PGGA 1T0FC 4AWXB 1SL3A 3T0YA 2MGQA 5HNHA 1SC8U 2M4GA 4P02A 3FXLA 4UD9H 3QPHA 3SFZA 1R71A 1OYWA 1CU1A 4AIHA 1LNWA 4BE1A 5C3EJ 1C5SA 1CT2E 2DMPA 1Q31A 3L2QA 5DG6A 3U21A 3G2BA 4X2WA 2K27A 4Q5SF 1AB9C 2J95A 4RAFA 3SXYA 3E6DA 2PKAA 1AKSB 1O3CA 5F27A 4IRIA 2FU4A 2KLOA 3TDUC 3SNDA 2Y7ZA 4X6MA 2L3DA 3SJMA 3ZN0A 1N1LA 1FBSA 4X6NA 1OKRA 2XKPA 1FZPB 2OXSA 2E19A 2SNWA 2VBXA 5FCKA 4TYDA 4WMFA 3CDIA 3J80Z 4V2FA 1HW5A 2QQAA 4JQFA 4ZDPA 1W0UA 1O2WA 5F6MA 1YF4A 3CDLA 1T38A 2W25A 2KPMA 2L2OA 4CR9A 3D5LA 2A5YB 3BN9A 1O2IA 5BPDA 2OQGA 5K7HA 1ZPBA 2VC1A 2C3SA 1BTXA 5B66C 2FLRH 3RMOH 3J7ZI 3H3ZA 1STZA 4KA4A 3SORA 2Y30A 2HI3A 4HX4A 4JZEH 3H36A 1ESTA 3K70D 2CQ7A 4Y8ZA 2JETC 2DOFA 2QY0B 5FAHA 1C2GA 4IRGA 1SBWA 1NRQH 3L2UA 1TWCJ 2B9LA 1UCYK 1U2WA 4EJUA 1D3PB 2M45A 1QA6A 4IHYA 3TOBA 4MPUA 1ZPZA 4ENNA 5A0BA 5C0TA 5IOZA 3RXEA 3TIUA 4A5NA 2AIPA 3NRLA 3UQVA 1GBEA 2AXLA 4JX5A 1UCYE 2G4TA 2WYGA 2ZU2A 1NZQH 4ZAEA 3AL0B 4WF8A 1P12E 3SNEA 1BR4A 1BI1A 1YRNB 1SGQE 2PTCE 1BRAA 1MBJA 3TL4X 3VB7A 5DP3A 2OU2A 2EC9H 2H1UA 2JWTA 1LHGH 1L1NA 3OYHA 1B8IB 2YU9J 1K6YA 3K2ZA 1MBFA 2FOMB 1DPOA 4XLAA 3FZVA 3EA9A 3K1MA 4LFUA 4KYWA 4YTAA 1YIOA 2SGFE 3BTEE 1YX5A 2YOLA 4I0AA 2VKVA 2Q2EA 4UUSB 1O4XA 3Q3XA 2LPRA 2C8YB 4QT8C 1I39A 1QU3A 2UUKB 1J5YA 5GIBA 2X85A 1LHDH 1GMCG 3L1PA 3M8EA 1W13U 4NA9H 1GWAA 1E3PA 3W6KB 3ZZAA 1FYKA 3H5CB 1F2SE 4DIIH 2OD5A 1MU8B 2KCOA 3F8NA 5D4SA 3PNVA 1GBAA 5IP9J 1YJWI 1HDTH 1RKTA 4LK0F 2HQAA 2GMTC 1UB9A 5CQGA 3A01A 1VQ8I 1V55H 2XF5A 3FBIB 1ZSKA 2W3KA 4FUBA 5E3NA 2HKXA 1R36A 2CHAC 2BOLA 2ZC2A 4KMFA 2FX6A 1MKWK 2NS7A 4WXCA 4Z2YA 1JRTA 4E7RG 1VITG 1POGA 1HB0B 4HQEA 1ZTRA 5TRDA 2HU9A 1LB2A 2R7OA 2A5KA 2UZKA 4MNYA 1JJ8C 1G8XA 5GPAA 1U9NA 1AFQB 3N05A 5BS6A 3ESWB 2CK3D 5EEAA 1S6LA 3QZRA 4AIKA 5FPSA 1KLJH 3MQKC 2QSHX 4X8TH 5GJ4B 1CQQA 5HGGA 1HNEE 3HEFA 2A1DB 3PRDA 2PFBA 3QU3A 4GCHG 4A0XA 1HJ9A 1N25A 3OAAD 1Z05A 3U9AH 4AC0A 4UUSA 1UW7A 2L6OA 2VJ4A 2P7CB 3HK6B 3H09A 1DWEH 2LG4A 4BDYA 3BWGA 1MBMA 1O3MA 3I78A 4A0ZA 5E79C 1PYTC 1JT6A 2XAUA 3PMHB 4CHAB 3GDUA 1O0DH 1DUXC 3S8PA 2YSRA 1MNEA 5HVQC 3BR1A 1N6XA 4FE4A 2WWYA 4YIIA 2EY4C 4X6PA 4AC9A 5JFRA 3WTUC 4YG2F 4UVAA 2HYGD 3RKQA 2NVTJ 3CMEI 2R5YB 4DURA 3ZZ5A 5EEHA 1T4VH 2F48A 2N8GA 4XL9A 3SZPA 3ISPA 2FJ1A 2EA3A 1W5TA 1KMHB 3SNAA 4DT4A 3KP3A 4XRSG 3MH5A 1T32A 5D6EA 2NNYA 1MMAA 2PTNA 1TBZH 3R60A 1YCPK 3QRFF 4XIDA 5TGTA 3L3TA 1Z71A 4AGJA 1S7EA 3KQDA 3TMOA 2FNAA 2JA7J 1JRSA 1BBRK 1V2UT 1TP4A 4XMYA 1SOTA 1FMVA 3SGQE 5GTIC 1P3EA 4CCNA 4PJLA 1C1RA 2FD5A 1J9CH 2GVFA 3HM5A 2F9BH 1P7IA 5A0AE 5L2ZH 1WJBA 1XGMA 1YO5C 3K4CA 5DCMA 1DFPA 2JSPA 3JW4A 3NAUA 4NUBA 1ZOMA 4MVNA 5F1RA 2J98B 3JSOA 4JX6A 4XOPA 3C2BA 3GXOA 2P8TA 2EFOA 4XOTA 4B43A 4Y79A 2HTSA 1IRXA 3JRGA 1V5GA 2VPLA 6ESTA 1V2OT 2G51A 4TT3D 2L5QA 4A3LJ 3QYBA 3GTLJ 2IPQX 1HAOH 1KU3A 2BGCA 2KDZA 3QN7A 1SGFG 4AIDA 3GY7A 1BL0A 3C2GA 2K9NA 4EGYA 5M5YJ 4PSXA 1FN8A 3BG9A 1P2NA 4JP0A 3BPVA 4Y71A 5JBTA 1LO6A 5IYTA 2CGAA 4HGCA 3LA7A 5HODA 3I58A 1D3YA 5FPTA 4RAGA 4Y0YE 2FNPA 5EYRA 1XMAA 1VQ5I 1AHTH 4G9YA 3PTNA 1THRH 3FXMA 1QVTA 2R7DA 3KCGH 2A45B 2ZA5A 1HA8A 1FXYA 4IGDA 2TPIZ 3QO6A 1NFUA 1HGTH 2QZ8A 1EA3A 5E8IA 3FP7E 1S85A 2HOEA 2HNTE 3I59A 2MD5A 3RU4T 1K2I1 3A7TA 4TWYA 4K3JA 3DU5A 1GG6C 4UV8A 2VJJA 1BC8C 1MMSA 2HVXA 2R0QC 3G6EI 1OPHB 1B9NA 2J38A 3CQZJ 3F68H 2XPVA 1EPTA 1NBMD 1Z8IB 4BXUA 2IGNA 1WSUA 2C93B 2A0QB 3ZMVA 2PKSB 2LBFB 4C3HJ 1BB0B 2Z3DA 3LONA 5AF9H 2K4BA 1E38B 3A01B 2DA6A 2PHBA 1QHRB 1MMDA 1OCRH 1DUAA 1XVOA 1OYYA 4B74A 5E17F 4AFZA 1J9IA 3K9TA 1YJ9I 3RXQA 4GSOA 4ISIH 1WUNH 4MTBA 5H20A 2A6EF 5B6OA 3MD2A 2F9VA 2ULLA 4UVBA 4BTIB 1V2QT 2BVXH 3LOXA 3P7NA 3BTTE 1NHAA 4MHGA 3MO6A 2P81A 1HDPA 1TNHA 1GHYH 2J94A 1R5HA 3V4GA 3KYDB 2FI3E 4HRIA 4UV9A 3TVJB 3SZNA 3GOVB 1FZZA 3FXJA 4O9VA 2LELA 1TBRH 4MNXA 5M3MJ 1X3WB 3HRSA 1L2EA 4YEJA 2P95A 2VWMA 1HBTH 2K4JA 4OGXA 1J2XA 1UAAA 3OS1A 1RGQA 2KIMA 3VYRB 1C4Y2 1DY9A 4RGRA 4CCOA 2D5VA 3RYRA 5JDUB 4ZHLU 1O38A 3RCOA 1JKOC 1L4DA 1SVOA 2X4HA 2STAE 1QURH 3SO3A 1PPFE 4IHXA 1GMDG 4DJZB 2M8GX 4XQFA 1TABE 2QIQA 2FQ4A 4IMZA 4U2WA 1H8AC 1KU9A 1PPZA 1JKRC 2O8WA 1QB1A 1C5QA 4IOCF 5AVDA 4AORA 1UVOA 2VXZA 1ZTLA 3PO1B 2Y81A 2WV1A 2BDYA 3L09A 2A2QH 2F5EA 3D62A 2WB1N 4ZTJA 4FUFA 2W5EA 4BOHA 2SGAA 2XBWA 1BMMH 3BG4C 2DI3A 3HOTA 1FPQA 2ODYB 3MMGA 3LH3A 1S84A 2WA0A 4KIFA 2QVOA 2XCFA 3ZVGA 1BW6A 2OQ5A 1EZQA 1A46H 3GCTF 3ZQ7A 2IS1A 5CPRB 1GMCF 3K4LA 3SN8A 2VQCA 2I6QA 4XRMA 2RDPA 2X1EA 1BBYA 2FUG2 4I6ZA 1ARBA 2LD5A 2FS8A 4A1TA 3F21A 1Y3VA 3BT9A 1TGTA 1ZTKA 1JHHA 2D45A 3RXFA 3L2VA 4WWCA 3TITA 3CJTB 4Q63A 4I01A 3OYNA 3LSKA 2EFNA 3VG8A 4AOQA 2ZNZA 1E1QD 5CMXH 3T29A 3RKWA 2DPDA 4BAHB 3BP8A 1FI8A 3GW2A 4IN2A 2O8KA 3BCBA 4DGWB 3M1CA 3E16B 3LSRA 1YYY1 3EE0B 3P9CA 4AFUA 2BXUH 1DU6A 2E1MB 3BTFE 1QBOA 3ABUA 4LJZF 1ETOA 1ZR0A 1AIXH 3S3NA 2E7WA 1O5GH 2KIUA 5EJCA 5E0HA 1F0RA 2ZKZA 3OYFA 2VT2A 1BJAA 2HPQH 2Y48A 1BIOA 1ZYOA 1FEXA 1B0FA 1K1OA 1UHSA 3VYUB 2P5KA 2YMSB 2FWWA 2QAAA 3V7RA 4IJAA 4IBLH 1IG7A 1MKXK 4DBRA 3EDXB 1TA2A 2BE5F 4D9JA 2TRTA 3GTJJ 2G7HA 4BAYA 5EJLA 1NTPA 1K28D 1XTAA 1T33A 4B44A 3ZPLA 2MH9A 3DHKH 2L7FP 2VVVA 2B63J 1FIWA 5A2QZ 1VQKI 3B6AA 2XGEA 4FTHA 5KCMA 1D9IA 3RXIA 5D6FA 4X6OA 3A03A 3EA8A 1G2MA 2UXXA 3GY2A 1SFEA 3J7YJ 1AFEH 3MH7A 3HUGB 3BZKA 3BR0A 3PM1A 4PFOA 1BIAA 2ZHDA 4JZFH 2PV9B 1KSNA 4XN3A 1PPHE 5K0HA 5GAHJ 3SU0A 2MC4A 2V79A 3QODA 3L2WA 1ZHMA 5IT3A 2H6CA 5HS9A 3I77A 3UNSA 1O3BA 2VU8E 4RLQA 1PFXC 2FI5E 2EI8A 4O03A 4BE2A 4X1NU 4S0HB 2PLYA 1TOCB 2M4KA 2VL8A 2WY7Q 3EUKL 2SGPE 3WG7H 1WJ5A 1ZK8A 3R0AA 3TGNA 2ZGXH 2TGAA 1JIMA 3OYPA 1SEUA 1MDMA 4B1RA 3KNXA 1PJRA 1YCPH 3LC3A 4XRSA 5LHGA 2FOHA 3IL2A 3KYFA 2OC7A 4O5VA 3HTSB 5DM6F 4PJNA 4Y3OA 1TPPA 1AVXA 1BN5A 2F4IA 3V42A 3MU0A 1HJAB 3BR2A 2K0QA 4KP0A 1OCTC 4OMZA 2LOOA 2ODPA 1X3ZB 3CCQI 1QBVH 1YY3A 3TEDA 3K1NA 3P70B 2JPBA 1UK2A 3ABLH 3ZQQA 3F3XA 5F0CA 3PV5A 3BV9B 3OY6U 2CSOA 1P8VC 1J14A 2GQQA 1KXEA 2X1DA 3ERED 4I76A 1BUIA 1S9HA 3R0FA 4MPVA 5EJ1A 4CCJA 2WPLS 1SGEE 2EFWA 5ABWA 1IN8A 1F9NA 5K5OA 3Q76A 2M2AA 1DS2E 2E34A 2ZFUA 1HV7A 1SGPE 5LHHA 1CGJE 2CFXA 2OC8A 2M1BA 1MBEA 4N9HA 4BQQA 2MD0A 1UVTH 4ZTFA 3KETA 4BS9A 1WOFA 1C5TA 2IXSA 2QSFX 3GCOA 2YUSA 3MKLA 1ZMNA 2KMUA 4DIHH 3RM0H 2F5FA 4JK5A 2OJED 2HR3A 4PDKA 1ANCA 1EV7A 4BXFA 4O3UA 4B71A 4EMSA 5HLHA 3UB0A 4I02A 1FMGA 1XC5A 3KZZA 4NWLA 4ISNA 2ZGHA 4U0VA 4CYCB 1WQVH 4FU7A 5EW1H 2FQ3A 1O31A 2Z9OA 2EPFA 3WTTC 4XRNA 1LMWB 2NS8A 3SU4A 4B8XA 4NFFA 4K1SA 1ANBA 4F55A 1BC7C 3NWUA 1PVEA 3CCVI 5LPFA 4AGKA 4HX8A 3FMRA 3SV7A 2Y2ZA 3SV9A 5FBEA 5HLIA 1RRKA 1WRJA 2WINI 2YMSC 2L7ZA 1MTWA 2M34A 2JH0D 4U01A 3BY6A 3BQZA 1A5HA 1A36A 1YPEH 5ICEA 2UWLA 1B4AA 3MTYA 1O3PB 1SQRA 3Q0WA 1X58A 4XBCA 3CENA 4JCNA 4WCGA 1GXQA 2OINA 3W2AA 3GTQJ 2JSCA 1O57A 5J1RA 2B7EA 3N99A 3K70C 1RESA 2VKDA 3TOAA 3VFZA 5A0CA 3DA9B 1G3BA 2L4MA 2W48A 2Q6DA 2LR8A 3FBNB 3HZJA 2BDCA 4ZMAH 3C1KA 3K6YA 3OEHD 1PPCE 4RSPA 3LOCA 2MABA 1FP2A 1OLTA 1NESE 2QCYA 4B48A 4MEYF 4BNCA 1FX7A 1ZGAA 2EJRA 1TQIA 3BPXA 4AVZA 1LPGB 3STJA 5B6LA 3H5RA 5IYBJ 2KQRA 4AG1A 1HIAB 2C4FH 3F9KA 2KFWA 2R5ZA 1OOKB 1OP2A 4TSFD 5GPIB 5AIQA 3BEFB 2PN6A 2XWAA 1J15A 2HDDA 3ATMA 3M7GA 5GNDA 2ZU4A 3D23A 4Q47A 2ISYA 5LGTA 2ICWG 3CTAA 3B8JA 4Y11E 2ZU1A 4D7NA 5E2OA 5D5XB 2RNGA 2TDXA 4ABEA 3S1QJ 1W7PA 2O9QA 3P8OA 1W5CC 1WQ2A 1LVKA 2BD7A 3FHZA 1GJBB 2BEOA 1G59A 4CICA 4Q4ZF 1YBWA 4BAMB 4DNCA 4RB2C 1S0RA 5EZHA 2RDEA 5E1WA 2PMZA 1GI1A 2QBYA 3LSMA 2PI0A 3D1NI 1S81A 3RXAA 3QWCH 5DM7F 2H1LA 1O2MA 1HAZB 2DMTA 1C9PA 3HGPA 1O2OA 4EQQA 4PCQA 2M3AA 3V8LA 4EEFG 1K0HA 1GI4A 3FKJA 4HBLA 2ZFPH 1OQYA 3RUOA 4PJJA 5EXNA 2WV0A 2WV9A 4EVIA 1GVDA 2RC4A 4DZPA 2RA0A 2XF7A 1VGCC 1MD0A 2C8ZB 1DLKB 1Z6RA 2KP6A 1BJVA 3W2VA 3ZZDA 1G4DA 3FO8D 1EB1H 3O8CA 3RC6A 1ETXA 1VI0A 4P9FA 4OM9A 4N4OB 1K61A 2ISZA 2ZIQH 2PJRA 2QLZA 2UUZA 3M3SA 1HCGA 4A3JJ 3RXBA 3RJPA 4YT7H 4I8HA 4E7NA 3I64A 4ENKA 1KGSA 2K8IA 3CMMA 5TCCA 1D0XA 2GCHG 1KXDA 5L3EA 4MFEA 4A3DJ 3OS2A 2ZFTA 2G8TA 3ZYEA 1EKEA 2FXRA 3M3VA 2JETB 1QPMA 1X19A 3FFGA 1TMUH 2ZGBH 2NOJB 1TGBA 1F5TA 3Q9SA 2ZDMA 1OWKA 5E3OA 5EW2H 1H8IH 4WXVA 2VC0A 3QK1A 4QPQA 4ZC3A 3S1RJ 2GZWA 3CNRA 3LWFA 1KYWA 2CJIA 5DP7A 3H9GA 5IY5H 2QE7D 1XGNA 1ELAA 2K5CA 1RIWB 2GZ7A 5HDGA 2AQFA 2ZFWA 1P01A 1MDMB 2PBIA 1X1BA 1SD6A 2IAIA 2ANKH 1AI8H 4NHJA 1ZLJA 4BNRA 3RP2A 1B0EA 5K5RA 3HOSA 2MH2A 4I32A 1C4U2 1QBNA 4XSKU 4I8KA 3S7KB 2VVUA 2ZNYA 4Y52J 3OX7U 1H0MA 1GI8B 1P2KA 1BA8B 4I86A 3SHAH 2AYWA 2DA3A 1XX9A 1XUKA 1O3OA 2SGQE 2RCEA 4ASUD 5HS8A 2ZU5A 4YELA 1AE8H 5CQEA 4Y15A 2K9SA 1GMDF 3SYJA 5GAEJ 1TYNA 3HK3B 2R4GA 4IC5A 1ON1A 2VBYA 2HRVA 2ECCA 3ODDA 1NFXA 2GP9B 3GUDA 3T62A 4MNUA 1HOMA 2MA3A 2FOEA 2LF7A 2ALVA 4B09A 2H9EH 2K3FA 4WY3A 5L6NH 1CSOE 3MKYB 4K1TA 2YMSD 4UUVA 5FBIA 1XSXA 5DP6A 3GY3A 9LPRA 5JLWA 3KCCA 5JBBS 4MEXF 2VT3A 2YU3A 1BZXE 4UHTA 1GDUA 4PK4A 6GCHF 2BY0A 4BTUB 2R5ZB 4U32A 1S0QA 3G73A 3F6VA 3SQHE 2XYAA 5E8EH 3HC7A 2ZHFH 3ZMTA 1C2JA 2P16A 3PJRA 1Y1WJ 1W10U 1UJ1A 3SFIA 1MH4A 5HNFA 1YLNA 1W0ZU 1FSEA 5GADJ 1HW2A 3T28A 3BTWE 4RA2A 5J1YA 1ZMLA 2EINH 4ZKSU 3MU4A 2EZKA 1AVGH 2JMWA 1O2LA 3BTDE 2W7NA 1W7PB 6CHAB 2E71A 1BMFD 5EG0A 2GXGA 3IKTA 2GX4A 1ZG5A 2FODA 1CBWB 5KECA 3A87A 1AUTC 1HSJA 3OSGA 4Q4LA 1EAIA 4K5ZA 4HF1A 2NS0A 4X1RU 2OQUA 1O2XA 2XNIA 3JRFA 4UVCA 5EF6A 4ZROA 3K7AJ 1O7FA 1WH5A 2VONA 2ZSHB 3S1MJ 4FX4A 4F92B 1EH8A 4NB5A 4X0GA 3LU9B 1TWHJ 4LMYA 4KT5C 1ZHFA 1F36A 3DTIA 4ANJA 2BDGA 4CHAC 3P9KA 5HMAA 2LMDA 3AFHA 5J8FA 2FOCA 1G9IE 1INCA 1RR7A 1TL8A 4A3BJ 1TA6A 3PROA 5GCHG 3HPTB 4LOCA 5CHBA 4A0YA 3TGJE 3P8GA 2V9PA 1HRTH 2WC2A 2RV8A 1H9IE 4GPGA 4D76A 3D5SC 5EG0B 1VITH 4N9IA 2JH6D 4BXWA 1W0TA 1L3LA 1Q2WA 1H8DH 2XHKA 4C2UA 2XROA 3TP3A 1X7AC 4E70A 3GCHB 3PMAB 1WTGH 4OIOF 1QTFA 1YITI 4ESBA 3VSKA 2Y31A 3L2RA 3DTEA 2BYVE 2XSJC 2GA2A 3CJQB 1LKAA 3S17J 4LZ1H 2P6SA 1YPKH 3LPRA 4GFBA 1FY5A 1ZRBA 2JIZD 2WHXA 2ZJPF 1K4TA 2BVSH 4CYCA 3RDIA 2X6XA 1ZR4A 3UAIC 4L5JA 6GCHG 2EFQA 1YRNA 1JHFA 5JR3A 4D5CA 3CCUI 1K1IA 1SGYE 1QA0A 1GMHG 5A8YA 1K1PA 3IV5A 1V6DA 3ZZ7A 4L9JA 1S5LC 1A04A 5DD8A 3IRQA 3OIQA 4BACA 1BRBE 1TBQH 4A6EA 1MJAA 1ZLKA 2RAEA 1GHAF 4UEHH 1TQ0B 4ESFA 3AG3H 1Z1JA 3T2NA 3TW7A 1ZGIA 1E1RD 2BHZA 4UFEH 4ZKRU 1X1CA 1PUFB 4XD7D 4QWQA 4B3XA 1IC8A 2KZGA 4ZZDA 1K78B 2R2MB 3PLKA 3OS0A 3RC5A 3L6PA 4ZXXH 5FD6A 3HKZA 1BMLA 1DWCH 4ITVA 1P11E 2CUEA 3H1CA 4A3GJ 3KIOA 1IDYA 1Y5UT 4DQ2A 5E18F 4OS7A 3AAFA 4CZCA 4E06H 3IH3A 3WGGA 3F9GA 4XFQA 2VWOA 2O6GE 4TPIZ 2HOAA 1JTYA 1X1DA 2CN0H 2BYAX 1G6NA 1HC8A 2LKPA 5LGUA 5A2QK 4D7FA 3U8OH 4Z6YA 1XGOA 3RC4A 2PWXA 2I5UA 2BBYA 1H89C 5D5WB 3RXRA 2PGBB 1C5VA 1WDIA 2CGPA 1MBQA 1WTHD 1X4PA 1YYVA 1ELDE 2OZ6A 2C6YA 1GDTA 2ZQ2A 3HTUA 4TWWA 1V3FA 3LL7A 1CA0C 2O61A 3FMSA 3W2WA 3LSGA 1SGIB 2ZHEH 2W4SA 4UB8C 3G1OA 2WPKS 3L9FA 1QZYA 2DQLA 4XRFA 7LPRA 3ABKH 1GVKB 2Z1DA 2CF9H 1TW2A 2XBYA 4NA8A 4Y7AA 2HYJA 1SGTA 4Q7YA 4GUXA 4F91B 1G2LA 3SUEA 5LEKA 2TRMA 1ZJDA 1Z7LA 3NPSA 5EPYA 2QA4I 2V1XA 2KISA 4OS6A 4FISA 3LSPA 5C3NA 1TQMA 1FV9A 1RTFB 4GHTA 1LFBA 2Q6FA 3HSFA 1R5GA 4RLFA 2DK8A 1IQHA 1EAXA 3K4MA 4MO7A 2AXTC 1Y0UA 2GD4B 2WUCA 3H3VK 1IAUA 4UFDH 2AHQA 2G0EA 4A3CJ 2XIGA 1NM6A 1NN6A 1NTCA 4F93B 2BD3A 1TRYA 1AKHA 3LT3A 5BQTA 4KKDA 1GL0E 2LKSA 1LDDA 2Z33A 3MEXA 3S93A 1D6WA 1ZHRA 2QM3A 1JTXA 2V1DA 2R0LA 1DVAH 4FUEA 1RUNA 4CHUA 1A31A 3ZMDA 1PP8F 1TT5B 1ODDA 1Y8RB 4A3FJ 2GMTB 5L3BA 2V3MA 3ZZ9A 2TGPZ 4BHCA 2ALPA 2Q0OA 2A7HA 4AUXA 2CV3A 2LY2A 3BZCA 2XW9A 5KK1A 1FNIA 1A0HB 3HATH 3ZVAA 5IK2D 4U7DA 2SGDE 2CQKA 4Z0KA 1C1PA 2JUGA 3PM3A 2EZLA 1W8BH 1JUMA 4ZYEA 3KQBA 3HB9A 3H5AA 3LAPA 5C5OA 1MMJN 2F5DA 3DBRB 1EZUC 1ANDA 2ZXHA 4A3MJ 3CF2A 1O3TA 5LH8A 1JJ6C 2F83A 2DO7A 1R5ID 5T3HA 2PQ8A 1TGCA 2OBQA 2GLOA 4J19A 3BR5A 1VCQA 2QUFA 5C1YA 2HDWA 1P2FA 2XC7A 1CF7B 3DUXH 2UXNA 1XKAC 1F0TA 2BQ6B 3Q3SA 4Z6AH 5GCHF 4THNH 1U6GA 1HCRA 3O8DA 1O5EH 3MZYA 1D0ZA 3TH2H 5C4JJ 2E2IJ 2IJLA 1V2RT 5J4SA 1RPWA 3VEPA 1O3EA 2ZMEC 1LQDB 2XC5A 1W1WE 2V9KA 2HKOA 4JBAA 1Y1VJ 4XKWA 3A8CA 4K8YA 3PQJA 4D0PA 3HJEA 3BG7A 3LNQA 4O3MA 2PKSC 4RT1A 2FOWA 1HXFH 1Q3XA 3TDZC 1FYLA 4GVUA 4E7HA 1QO0D 1Y6IA 2CQQA 2BHYA 1Y3XA 3FXKA 1IUFA 2O5RA 1MQ5A 5HM2A 3HKZN 1AU8A 3GLLA 2OV7A 2D2DA 3HBLA 3ESTA 1ABJH 1C1OA 3URCA 3V13A 4XM3A 1FLEE 2WPJS 4HQMA 3FVFB 5F1JA 2E1MC 3OYEA 2J5PA 4HYEA 4XICA 3Q9VA 1IN7A 1R49A 3DEUA 1R00A 4J01A 3REOA 2LP0A 1GMHF 3PMJA 1WJEA 5GAGJ 3A7ZA 4FUHA 2KRCA 1WWXA 4MTDA 2D1VA 3JAMZ 1Y5AT 4LD5A 1CT0E 2BB4A 4FETA 2M30A 5DK1A 1AB9B 2P8OC 1Z6TA 4A1VA 1I27A 3MKWB 3CF5F 3OSYA 3GO5A 4HNVA 2Z3YA 2GV7A 2HOSA 4ZH4F 4HG2A 3JCUC 2WPIS 1ON2A 2VQLA 3SW2B 4U0WA 3VSLA 1P0SH 2G55A 2LLKA 2WUBA 1ID5H 5TJJA 2OPTA 1RXPA 4LG0A 2DUCA 1LE8B 4I33A 1N75A 3K69A 2V1UA 2Q6GA 2HGCA 2GCTC 1ZPCA 2E1OA 3M3YJ 4MPXA 5EG4A 2K02A 3QU6A 3DQVC 2J5OA 1FBUA 2P3TB 4ENMA 2ZDAH 3FP6E 3SHCH 1UFMA 4DYCA 4M7GA 3GY5A 4FT8A 1GDQA 2M0MA 3QDZB 3ECHA 1FPHH 2EIJH 2LDUA 1E35B 1KLIH 1W11U 2WPHS 1A4WH 1LEBA 1CO7E 5ICFA 4IHTA 4PROA 4ZJZA 1FAKH 2FOAA 1P9UA 4Q7ZA 2X0LA 2IEKA 4ZYGA 3J7AO 2ZFRH 1DU0A 3LKWA 3BTLA 1AO5A 5J8CA 2XB5A 3CCEI 2CWEA 1U78A 1O2RA 1IQJA 5C17A 2BV6A 4X1EA 5B1BH 1NFYA 5M5XJ 1GGDC 1K1MA 1MZAA 4J2YB 1GI3A 2RQQA 1O34A 4WF2A 4GHQA 4BGDA 4G7ZF 1IHSH 3GF2A 1JE8A 4AIJA 1D6RA 1XXFA 2QQ8A 2A5WA 3UKGA 1BI3A 3MO9A 2HXIA 4A12A 3PL8A 4IO9F 3U28C 2BY1A 1P4WA 3A85A 2V35A 3WE2A 3LSHA 3JZ2B 2QV1A 5FLVA 2IVMA 4PZJA 3DSOA 3VWBA 4ASNA 1G3TA 1VQPI 4A3EJ 4L5EA 1BI2A 1V2TT 2V0BA 1VQ7I 1QRYA 4L5IA 2AERH 2ZDKA 3HOWJ 3TU7H 2QEXI 1VJ9U 1Z6JH 2KCYA 5FB2A 3DD2H 1YLFA 3F0OA 3TO6A 2H6MA 4BDZA 1Q1HA 2L7KA 1KDQA 2H5CA 4L9VA 4HLXA 4P9UA 5BOXA 5JHFA 2GM4A 4IQJA 5FROA 3Q0UA 3VXEH 1BTUA 1ZRCA 1Z8RA 2A07F 1QPIA 4H0EA 1JUPA 1FPCH 3ZQGA 5BNGA 3NWTA 2NVXJ 4UFGH 1OYIA 1GJ5H 2MLGA 1CHOG 4CRBA 2K85A 3RQ4A 1AQ7A 4ISHH 3R3GB 4LLLA 5FD5A 1T8NA 1LHCH 4LOYH 1L4ZA 1FTZA 2JQ7A 4E7KA 2NOGA 1QQUA 3E6MA 2OUMA 5CDFE 1A3BH 3U69H 3LGVA 1GBHA 4ACAA 5KHDA 4C2MJ 2BY3A 1UHWA 2DYRH 2H5DA 1TAWA 4H4FA 1XUHA 5K5QA 2VWLA 2R7TA 3ZR8X 1O3FA 2GV6A 1XN7A 3K4BA 3W3CA 1O3JA 2Y69H 1GBDA 1N8OB 2XXLA 2FEZA 2P6TA 5E8GA 3AW0A 3HKIB 4B2AA 5L3CA 1KTTB 2R7XA 1E37B 4XSXF 1GI5A 5CVVA 1FC3A 2OCEA 1EATA 1GJ9B 1P03A 1ZQ3P 2EV6A 1QL8A 3F8MA 3OYJA 2PP6A 2VIDA 1E17A 4RBOA 1A1RA 2ZXIA 3RXOA 4PJ0C 2LNBA 3BTQE 4RB3C 3OR1C 2A7JA 3KYGA 1YKTA 3ELAH 5H2FC 1R1VA 1P2OA 1FUJA 1VQNI 2GDEH 1WAYB 4WXIA 3OEED 3DKXA 4DYQA 1OS8A 4GLYA 2GT7A 4IF4A 5IYCJ 4GGGA 3M7TA 4ZYDA 1SFXA 3PFYA 4QLCU 2IGOA 1DPUA 3OFND 4BHBA 2RVCA 1XXDA 1IXCA 1K79A 2BD9A 1C2KA 2V6EA 5T6FA 1MTNC 5FLXZ 2BQWB 1RC9A 1ZYRF 3TK5A 2VQHA 3JRAA 5HKKD 3VODA 1VGCB 3ZQHA 1YPHC 3GYLB 3KEQA 2DYSH 4AG2A 1GJDB 2BZ6H 4M9FA 2FESH 4M74A 2KCPA 1P6RA 3VFEA 2HNTC 3DP7A 4ZHMU 4Y10E 3GVAA 1L1JA 3BG5A 5CVIA 1C5XB 4OS1A 1P92A 3KQCA 2EQNA 1YWUA 1C2EA 3C2HA 3OIPA 3KX2A 5CVUA 4XBDA 2FBKA 2ZFSA 4HDVA 4FE7A 5LFAA 1KXCA 3E5XA 3DXJF 2AQEA 3I4MJ 1NRSH 1QB9A 2AMDA 2BVRH 1I50J 4A69C 1TGNA 1EF4A 1CHOF 1GUUA 1TPAE 5ESBA 3PIPF 5FFXA 3B02A 4FUDA 1SANA 3QAHA 4BY1J 1SLUB 3JREA 1SPJA 4CCLA 1Q1VA 2M8EA 1YTYA 4OIQF 3J7AY 4KN7X 3DKWA 1ZJKA 2RKHA 2O9LA 4I98B 1THPB 1OCCH 4OAYA 3FIWA 2LY9A 4LG3A 2FRHA 4RAYA 2GTBA 5LBQA 2IBDA 5FKMA 3R6SA 2DJNA 1Y8QB 1B72B 3SU2A 2EB7A 2Y0MA 2ACJA 4TV7A 2IOTA 2WTEA 2CQNA 2DT6A 4YOJA 4YLUA 1XDSA 1HSTA 1X4OA 1V2JT 1BHXB 1TWGJ 5EEGA 1BOQA 3G1MA 4IOAF 3EQ0H 1YS6A 3OYBA 1P2MA 1LTOA 1A0LA 1RJXB 3ONQA 1R1UA 2FSWA 4JK6A 1TX7A 3I4PA 2X51A 2A6HF 3SUFA 2VKEA 2COMA 4M3FA 5DGJA 1MSFC 1GXPA 3PO2J 3PWCA 4MQVA 1AUJA 4R8TB 3BJOA 1Y39A 3ZV8A 2W00A 4RMNA 4XORA 4E7ZA 3NCLA 3V7SA 4MG3A 1HPGA 2ID3A 1DICA 1JOUB 1UTKA 3ZP5A 5AONA 4BJTA 3FWEA 5HIYA 3RTRA 5C4XJ 2EK5A 4U87A 2EBIA 4N0BA 2GOXB 2DMQA 3U2RA 1F1ZA 3S9BA 3HRTA 2Z6BD 1W0KD 5T1VA 1MD7A 3MNBA 3V8KA 2KAIA 2KKOA 3IWZA 4XLFA 1KLTA 3ODFA 5L3DA 2THFB 3IKVA 2O03A 4NC6A 3I3LA 1O3AA 1HQCA 2AIQA 4INLA 2IP2A 3NXPA 3QTVH 3M1EA 3HHHA 1XPXA 3L7WA 2NU4E 3L2CA 5DS9A 1T6SA 5HYOA 1J0RA 1Y3WA 1DDNA 1C5NH 2V7FA 4I8GA 1OR7C 4Y33A 1D8KA 4NG9H 3KP5A 1VR1H 1W7XH 3R0JA 3CCJI 1TNLA 3OWTA 1ELBA 1C2IA 1MCTA 2Z9IA 3GWZA 4LB5A 4DY7B 2AMPA 2DLLA 1O2SA 1MMGA 3P5JA 2M5TA 4JX4A 3TPIZ 3RMNH 1ZG3A 3BR3A 3OY9A 3EDPA 1T56A 1JIRA 2DT5A 7GCHG 3HGNA 3VYSB 4BJ6C 1Y59T 3V0XA 2DOEA 3VPRA 2FOBA 3RMLH 4L18B 3AG2H 2G00A 2C8XB 4XLNF 2GXAA 1O33A 3PUFA 3SUDA 4ZHAA 2E2JJ 4F49A 1YE9A 1YCPM 2DAOA 4KJZA 5ESTE 4AU7A 1C5LH 3ROUA 1V54H 1BRUP 4AYYB 3MI4A 3CO7C 4U30A 1TX8A 3H92A 1LVAA 1TW3A 3I0TA 2KDOA 4M3DA 4HZHA 5T6GA 1IDZA 1HAYB 1EJ9A 4CXFA 3G71I 1O2UA 3HG9A 1G30B 2C8WB 1KXFA 4YO9A 5PTPA 4YRVA 1G32B 3E7LA 1EAWA 2M9HA 5D4RA 5DP5A 2ME6A 4KITB 3CC2I 3H7OA 2LC2A 3WG9A 5HXFA 2GCHF 1ZG1A 1G36A 2VBWA 2A32A 1O3NA 4UB6C 3GCMA 4IN1A 1DUEA 1R22A 2Z9LA 4B73A 3S9AA 1UTLM 1VCWA 2MG4A 1WJCA 3P6ZB 5JVGF 4OU0A 1VF9A 2VODA 1K4SA 2ELKA 4ENJA 2DQRA 1G3YA 1T8OA 3TH3H 3GFMA 3RSNA 1MH0A 2FEQH 1GJ8B 2R7UA 3GEZA 4MFDA 5J4QA 1GDNA 1RUOA 3E5UA 3VYTB 1RNLA 2DODA 2VIQA 5FRMA 3BG3A 3TK6A 3M5NA 5E0JA 3W6JB 5K1YA 2VOOA 1L1GA 2LRDA 4Z1MD 1K21H 1D1AA 2VBCA 1MW7A 4R0IA 3NRVA 2DW4A 1WU1A 3ATLA 5K7FA 2ELJA 2FBIA 1O3IA 1ZSLA 2DBBA 1W4MA 1A5GH 1HAXB 3T1BA 3F2FA 3UQOA 2HVYB 4WJG2 3E3VA 2A4RA