2IPQX

Crystal structure of c-terminal domain of salmonella enterica protein sty4665, pfam duf1528
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
121
Chain Sequence
LSSTELGDLFWSWLRDGLREGDIPVNTADACVHLTCGFVFISVPGVFFLFLKSHGRKEQVQAAFEKMRKHRVSDSRRFWQCCLYEEPGGRGRYKKLTGYLIKMSEIYNGNFPDDSLFLKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein STY4665
publication title Structure of C-terminal domain of Hypothetical protein STY4665
rcsb
source organism Salmonella typhi
total genus 29
structure length 121
sequence length 133
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ipqX01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 2ipqX02
4UNOA 4LLNA 2ELHA 5EEHA 1L0OC 3F8BA 1KU7A 4OU0A 5E8IA 3GZ5A 2DQLA 1LEAA 1R58A 3I53A 1G6NA 3CUQB 1LQ1A 4FT8A 2HDCA 4KICA 4BH9A 1IRFA 4HQEA 2EFWA 1J59A 3VOEA 4DNCA 4EJWA 2DW4A 2O6GE 2ZFWA 4D0PA 3WTSC 4NQWA 3J81Z 1F1ZA 4KN4X 2NRAC 2ESHA 1R00A 2NNYA 2RN7A 3F3XA 1H0MA 1FBSA 4G6QA 2W57A 1DPRA 1O7FA 2VC1A 2CSOA 2ACJA 2CG4A 2WWYA 4RB0A 3T0YA 3E5UA 5H20A 4Q47A 3K1MA 2EFQA 2EWNA 2HFHA 5E1ZB 5DD4A 2M45A 5LGNA 2BBYA 1XGNA 4EJOA 5F6FA 1OYIA 3O3KA 2K7LA 3ABTA 3VEPA 1K79A 2IA0A 1ULYA 4IJAA 2FU4A 2KJCA 3VODA 3LAPA 5D5WB 4EVIA 5F1RA 2DQRA 1KU3A 3ZMTA 1XN7A 5FLXK 4U7DA 1U2WA 3HRSA 1WWXA 3I59A 5DUIA 2L4AA 1IN6A 4KNYA 5IT9Z 3R0JA 4HX7A 1IN5A 3BROA 3K0LA 3F8CA 4RGSA 2XUBA 4K2EA 4L9TA 5CYVA 5D6FA 1ZARA 4A0ZA 2XRNA 4WXDA 4XLNF 5AIQA 2XIGA 2DT5A 1FWZA 5K5OA 1RI7A 3CJNA 2RQPA 4AVPA 3JAMK 4B8XA 3RPUA 1FYKA 1ONVA 2RGVA 4KIBA 5BPDA 3M9AA 4PCQA 2ZMEA 1XB4A 2HYFA 2QLZA 1O57A 1Z91A 3E97A 1MJAA 5E8GA 1P4AA 5HDKA 2BEOA 1EH7A 4L9JA 2QBYA 2ZO4A 1Z6TA 1SD5A 3T8RA 2O61A 3QPTA 2HOEA 2WV0A 2XV4S 3IC7A 5D8LB 2DAOA 1J9IA 4B09A 3HSRA 2E1NA 2HR3A 3NEUA 2FQ3A 5FO5A 4Q5SF 2YX4A 3IHUA 2H6CA 3I4PA 1E17A 3E6CC 4LJZF 2JPBA 4AIJA 2A61A 4FX4A 1GXPA 3TOAA 1YS6A 5L3EA 4ESFA 4I2OA 4ZZLA 1OYYA 1TNSA 3LQQA 3KFWX 3R61A 2D1VA 3BDDA 1SD7A 2KIMA 4JBAA 3VB2A 1R7JA 1OR7A 2VODA 2KRFA 1FYLA 4R1HA 4A6DA 5L3GA 2Y48A 2Q8KA 3V7CA 3ZPLA 2EB7A 4EJVA 1YW8A 2DLLA 1P6RA 2L01A 4LG0A 4U0WA 2PJPA 1G3WA 4BHCA 4A5NA 5AONA 1XMAA 1U5TA 2L02A 3S2WA 1FY7A 3ECOA 2LF7A 1YTYA 2XAFA 1ZYRF 2QENA 1SD4A 5LLQA 1KYZA 2EV0A 4GYGA 4M73A 3GEZA 1ZGAA 1XSVA 1W7PB 3BWGA 4EQQA 4RB1A 2QQBA 4WXCA 5BPIA 5DCMA 4IPAA 3HRMA 1WQ2A 4ZH4F 2G9WA 1ZREA 1UFMA 4KMUX 2IA1A 1J7KA 2IP2A 1DDNA 4CHUA 2VBXA 2GA2A 5D4SA 1A04A 4L9VA 3GFIA 3HIFA 4XSXF 3G73A 3T1BA 4G7ZF 5ICEA 2FOKA 1KGSA 1ZG1A 3BY6A 2ETHA 2RC4A 2PI0A 4NHJA 5J6XA 3I54A 1KYWA 4R8HA 3KCCA 1REPC 2EA4A 3TO9A 3ELKA 2L54A 4G94A 3ZMSA 5HLHA 1B9MA 3FMSA 1F5TA 3J80K 4ZYDA 4XRFA 4OOIA 3MWMA 3HTUA 4JQFA 3QP6A 4NB5A 2XROA 1O3RA 2YX7A 6PAXA 4RB2C 3DV8A 2PLYA 2KIFA 2MBFA 1ZG3A 1H9TA 2YR2A 4U0VA 5DD8A 4UXNA 4EV0A 4I98B 1KA8A 2KKOA 1IN8A 3EQLF 3FMQA 2H6BA 2VOPA 1KQ0A 2COMA 1T0FA 2V79A 3DQVC 2HKXA 2IPQX 5KVRA 5DDGA 2M87A 5LBQA 3PFIA 2LNBA 5HOOA 1UHMA 3REOA 4XLPF 3GO5A 2O3FA 2FA5A 2VE9A 4AIKA 3RI4A 2ESNA 4I02A 3TO7A 2H27A 4JK1X 2VONA 3HRTA 1F9NA 1BI0A 3RKYA 2XAJA 3HYIA 3WGHA 2HYGD 5BOXA 3LWFA 4CDGA 5ILUA 4DQ2A 2J5PA 4HF1A 1T98A 3DKWA 4O3MA 1FC3A 2A07F 1LVAA 2UXNA 2A6HF 4I7HA 3TKYA 2P7VB 4M74A 3WTVC 5A2QK 1ZHFA 4M6YA 5KK1A 3V8LA 3QU3A 4IRIA 3JTHA 3J7AO 2DBBA 4U7BA 3LA2A 3M1EA 3MEXA 5D5UB 3U1DA 1CF7A 3E5XA 4KUMA 2EFOA 4RGXA 1MJ9A 1HXDA 3WTTC 1HW1A 4ETSA 3I59B 3DXJF 5FFXA 1T39A 1OYWA 1ZLKA 4IXAA 4HBLA 3E6DA 3MQ0A 2EFPA 1O3TA 1T6SA 2E1CA 2KJBA 1XCVA 1J2XA 3B73A 1Z05A 3I0TA 3HSFA 2YU3A 1TTYA 4I09A 2DI3A 4A6EA 1ZLJA 1R36A 3D5LA 2Z99A 1GHCA 4IRHA 5D5XB 4ENMA 2UWMA 3DPLC 5HLIA 2Y0MA 4I0BA 2ZMEB 4CXFA 2A6EF 2ISYA 5HLGA 3JSPA 4RGUA 3KP7A 2PFBA 2PMHA 1X3UA 3KZZA 2MLGA 1K78A 1ZRDA 2EFNA 4CO8A 2UXXA 3HRUA 2FBHA 1PDNC 4G7OF 2HZTA 2OZUA 4MNUA 2RNJA 5J8CA 2QBYB 5ICCA 2W25A 5E20A 1BJAA 3ZMVA 4HLYA 1I5ZA 1YYVA 3PQKA 2FMYA 1HBXG 2B0LA 3PQJA 1B6AA 3F6OA 2CGPA 2K4BA 4P96A 3QPHA 1ZN2A 3CDHA 1JXSA 3G3ZA 3LQRA 1F4KA 1ON2A 4PDKA 1IZ1A 4ZYEA 2ZNYA 3TGNA 1LJ9A 4GCVA 2K02A 4HQMA 1YQAA 1HW5A 3SHFA 2PQ8A 2VC0A 4WF2A 1B4AA 2V1XA 4WX9A 2JT1A 2DK5A 2Q2EA 3F22A 2J5OA 5H6QA 3JW4A 4BQAA 5FLXZ 1LEBA 4KYWA 4BYYA 1FYMA 4A2UA 3RKWA 3FM5A 3ZMDA 4LB6B 4A12A 1AWCA 4PGHA 4G9YA 2BE5F 2FMLA 2GQQA 2M5WA 3M7GA 2VBZA 4EJUA 4IVNA 3KETA 1QBJA 1UB9A 1MZBA 5AIPA 1H9GA 2JSCA 2LKPA 4LG0B 4AIHA 5LHHA 2XASA 1U5TB 1WKMA 2HKOA 3GX4X 3JSOA 4FHTA 1TW3A 3WE2A 1D8JA 5DCFA 5LRRA 4Z2YA 4Y15A 3O2PE 2P5VA 1FSEA 5H6RA 5CVUA 4M9XA 3K9TA 3JAMZ 3AAFA 5LHGA 1UHWA 2ZJ2A 4ZYHA 1S7AA 5LEKA 2FE3A 3GFLA 3FF5A 3I5UA 2E7XA 5JVTA 2FEZA 1W7PD 1DPUA 5DCMB 2BGCA 3E6MA 5E1WA 2MD5A 4Q48A 5HVQC 5HS8A 2QVOA 3QAHA 1JE8A 4LLLA 1I1GA 3FXUA 4HZFA 1FP2A 3R4KA 3BP8A 4CICA 5JR3A 2OZ6A 4HDUA 2GZWA 3KLNA 5L3CA 1B59A 2IVMA 1IXSB 1T2KA 1MKMA 1SFXA 2EV6A 1JGSA 2JTVA 1IW7F 1UCRA 3RYRA 1YG2A 2XVCA 1ZAOA 4YFXF 3IRRA 5FB2A 5CVJA 1I27A 3SFZA 1LB2A 1JHFA 2LF8A 4LB5A 3HUGA 3L7WA 1FOKA 4L0ZB 2V1UA 2OQGA 1QPMA 1LDDA 4XSZF 2IW5A 1BM9A 1BIBA 3ZN0A 3NQOA 1U6GA 3TQNA 3WTZA 4HAMA 2GWRA 2O03A 3F8FA 4MEYF 4KMFA 1FBQA 4OIQF 1O7LA 1BC8C 5ERIA 5ILVA 5FD5A 2EJRA 4A0XA 1RUNA 3FMRA 4UVAA 1EV7A 4G7HF 5K1YA 3QU6A 1D8KA 5HDNA 1BC7C 3W6KB 4KIFA 3VFZA 3FWEA 2MLKA 1CGPA 2Z5UA 3P9CA 2DU9A 4UHTA 4QLCU 3ZQ7A 3GYHX 2EA2A 2K86A 2OD5A 4LK1F 3ABUA 4YFNF 3V4GA 2DPUA 1XMKA 4EGZA 4HLXA 3WGIA 3GLXA 4UVBA 3V7RA 2R7DA 3KP2A 3ERED 2FBIA 1FLIA 3T5XA 2XHKA 3KE2A 1P4XA 4YFKF 1LDKB 3IWZA 4UV8A 1SAXA 4S04A 3DFGA 4CZZA 2UZKA 3RKXA 1YW9A 4FX0A 4KDPA 4UVCA 4I0AA 3L9FA 4O5VA 2XAQA 2D45A 2CFXA 2BV6A 1GVJA 3H3ZA 2F2EA 3WG9A 4F7ZA 1CF7B 1STZA 2ZXJA 1S8NA 3HSEA 2JRTA 4HA8A 1S7OA 2RKHA 4HV5A 2VXZA 2KIUA 4E70A 4ESBA 2F5FA 3TDZC 1LNWA 1ZG5A 3GF2A 1IF1A 1K7AA 3J80Z 4GGGA 4RS8A 3BPXA 3KEQA 5EEGA 1PP7U 1PUEE 1AOYA 3R6SA 2CQKA 4KIGA 4LGWA 3CO7C 4OIOF 2HS5A 4I01A 1Q1HA 4Q4ZF 1FNNA 1YIOA 1W4MA 3KP6A 2EV5A 5L3DA 1OKRA 1K78B 2A3SA 4EJTA 2O8XA 5ICFA 2GXGA 2CW0F 3HOTA 3F72A 5K5RA 1SMTA 4WCGA 3C3WA 3RDIA 3ECHA 4GYIA 3WE3A 3B02A 2NS0A 4N9HA 1IN4A 1O3QA 5K5QA 4MQVA 1TQPA 4MEXF 1FZPB 3H92A 2L4MA 2XAGA 2HGCA 3MFKA 4LK0F 5CVIA 3K2ZA 2HWVA 1W5SA 2P8TA 1B9NA 2RDPA 3N97A 2C6YA 4KA4A 2PEXA 1V3FA 5A2QZ 3SZTA 1U78A 2JPCA 3P9KA 1BI2A 4OMZA 5E1XA 3K1NA 3KEOA 1XGSA 1TQMA 3C18A 2V9VA 2ZBKA 1R23A 1J75A 2VN2A 5LHIA 4EMSA 1DUXC 2QM3A 3GVAA 1Y0UA 3CUOA 3RJPA 4HF2A 2W85A 4RGRA 2P5KA 1QZYA 1XCBA 2K4JA 2LSOA 1E2XA 2A69F 5HS9A 1C0WA 2QQAA 4ENNA 3LFKA 3I64A 3I71A 3P9IA 1RIOH 2HQNA 4ZYGA 3L09A 3O6BB 1TQIA 4RAZA 3N4MA 4O6JA 1BOAA 4OIRF 1Z7UA 3CTAA 1TNTA 1USSA 2YPRA 5HS7A 3GFMA 1XSXA 3ISPA 4HYEA 3WTXC 3GFJA 3FM3A 1HW2A 1RNLA 3HOSA 1BI3A 2QWWA 3DP7A 3WTWC 2P6SA 2H09A 3LSTA 3IL2A 2GIVA 3V8KA 4M72A 2VE8A 4AD9A 3Q9VA 1W5TA 1FX7A 1KU2A 1U3EM 1R1UA 1R22A 5LRSA 5IT3A 3TDUC 3GZ6A 1QNTA 1IAWA 3EYIA 4EM1A 5LEJA 2BYVE 4GO1A 1YFHA 1YLFA 4YIFA 4CGZA 2FNAA 2GA1A 1MDMA 2QZ8A 1MD0A 5LGTA 2FRHA 1L3LA 3ZP5A 2FXAA 4L0YB 2QYOA 2IRFG 2VT3A 2ISZA 4KT5C 1IRGA 3KLOA 4ESJA 3E3VA 1BBYA 1FT9A 3FX3A 3MCZA 4UV9A 3OV8A 3CUQC 1ON1A 4EM2A 3C1DA 4LFUA 1HSJA 2HQRA 4MTEA 5FFZA 5BQTA 3GXOA 3KP5A 5TRDA 1B1BA 1XDUA 3JTGA 1XGOA 1USTA 4IHSA 2M8EA 3H3UA 1BIAA 3ZN1A 5CJ9A 1FP1D 3J81K 2MA3A 3BJ6A 1O3SA 1QO0D 2FF4A 3L00A 4TV7A 4N0BA 1NHAA 3GWZA 3L2CA 1XD7A 3LA7A 2PMUA 5CVVA 2GXBA 2F5EA 2HTJA 2E7WA 1EH6A 3NRVA 1MJBA 2ZKZA 1HQCA 4ZZDA 3SQNA 1T38A 5CVRA 1S3JA 1I1SA 2QUFA 2W84A 2P6TA 4GXOA 4IRGA 2CYYA 2JZYA 3R0AA 3W6JB 1ZRFA 3D0SA 5L3BA 3DF8A 3GW2A 1QQIA 2PBIA 2OU2A 2RVCA 2K27A 4BXUA 3ROUA 4OIPF 3MZYA 3I58A 5ICGA 4XBFA 3EETA 4YG2F 3C7JA 3F8NA 2Z3YA 3RIRA 2VT2A 1ZH5A 3BZ6A 2EK5A 2P7CB 2P5LC 3K69A 1FBUA 2V6CA 3COAC 4A5MA 4ENKA 4HW0A 4U88A 1SFEA 2Y75A 3IWFA 2VBWA 1U5TC 3ZMUA 2STWA 5ILSA 4BHBA 1WI9A 4H0EA 5IT9K 2WC2A 1IUYA 1G3YA 4P55A 3FXRA 2XKOA 1IXRC 2A68F 4OINF 3OOPA 5F64A 1RZ4A 4HX8A 1SD6A 2PG4A 4S05A 1U8RA 3CUQA 2XAHA 3ULQB 3DEUA 1XSDA 3WTYC 2HTSA 4LMYA 2M30A 2HEOA 5DEQA 2R7FA 2A5YB 2OQRA 5D4RA 1IXCA 2D2WA 4PGGA 3IKVA 3KZYA 2MH2A 4QWQA 4EM0B 1Z6RA 4KN7X 5JFRA 4IF4A 3ZMZA 5DYMA 2ZCWA 1G4DA 2CO5A 1J5YA 2XGXA 3QOPA 1D3YA 1GXQA 3SZPA 4AWXB 3F23A 2XKPA 4ASNA 4HF0A 3IKTA 1TLHB 5ED4A 2VBYA 2PN6A 3WU1B 1R1VA 3MZHA 4RAYA 4R79A 3KP4A 3R60A 4EGYA 1KQ8A 3K1PA 1HSTA 1ZRCA 1G3TA 4ON0A 2ADUA 2GAUA 2AS5F 4M71A 5L3FA 5LGUA 4M9SA 2G7UA 1HKSA 3V7SA 2OA4A 1R1TA 1I6XA 3U2RA 5TJJA 3KQ5A 5FGMA 1MGTA 3F8MA 2STTA 4HDVA 1K6OA 5D5VB 4G8XA 1WRJA 4N9IA 1D5VA 3E6BA 5FD6A 3HHGA 2LDUA 1ZGJA 2IA2A 1BI1A 1YO5C 3BJAA 4IHTA 1RUOA 1BN5A 3TOBA 4WK8F 1HKTA 4L18B 1XDSA 4M9ZA 4BHPA 3P7NA 3LA3A 3WGGA 2DFIA 2WTEA 5JI6A 3F21A 4RB3C 2IJLA 2FNPA 4CYDA 3BJOA 2OAZA 2CWEA 4P5OA 1S6LA 4UUVA 4U0YA 2O0YA 5D8KB 3HTSB 5BMZA 1HKQA 1G3SA 3SXYA 4L9NA 2V1DA 4LD5A 4PZJA 2VOOA 2TDXA 3QP5A 3CLOA 1MDMB 4YIIA 2X4HA 3IRQA 4LLGF 3ML6A 4L5IA 3FXQA 2Z33A 3V8JA 5DV5A 3DPTA 3Q5FA 3U9GA 4MQ9F 3LAJA 4OMYA 4HV6A 2QQ9A 1DP7P 2X0LA 1KQ9A 1PP8F 3BOQA 1QGPA 3RPQA 3RYPA 5BS6A 1SFUA 4MGRA 3FZVA 2G7HA 2L3DA 4L5JA 5D6EA 4BAYA 2IT0A 1P2FA 4P9UA 1TBXA 3MAJA 2NYXA 1FPQA 3QRFF 1R5HA 3EDPA 3Q9SA 5JHUA 1V4RA 2RV8A 4WXHA 2D1HA 1OMIA 2MC3A 1S29A 2DK8A 4BNCA 1FSHA 3F6VA 1YS7A 2NNNA 5CLSA 1IN7A 5DUKA 3KP3A 2MH9A 1Z9CA 2DTRA 4HX4A 4A0YA 4HOBA 3EUHA 3TO6A 2H94A 1P4WA 4G6DA 4P9FA 3M8FA 4WWCA 4KFCA 2FSWA 1VTNC 2M1BA 1JHHA 4MTDA 2YSRA 1KU9A 1SMYF 3WU0A 1P92A 2P4WA 3RTRA 3FHZA 3M8EA 5E17F 1YW7A 3HHHA 1ODDA 2DPDA 2DO7A 2NAZA 2OBPA 4M6XA 3WTUC 2F5CA 3WODF 2R3SA 4ENJA 1W7PA 2Q0OA 2F5DA 5E18F 1Z1DA 1LDJA 2AXLA 1J0RA 4Y13A 1TW2A 1EH8A 5HDGA 2FBKA 3T8TA 2Z9OA 3EYYA 2W24A 3GUDA 3BPVA 1QZZA 1R5GA 1XGMA 2ZNZA 3E5QA 4MHGA 1OPCA 4Y17A 5J8FA 3CO6C 1WSUA
chains in the Genus database with same CATH superfamily
3RXUA 1MZAA 4UNOA 1TONA 4FXGH 1IV8A 2TIOA 2ZO3H 4LLNA 5EEHA 1L0OC 4OS4A 2BTCE 2GDEH 2UV1A 4OU0A 3HB9A 3MNBA 4BEHA 2WAQN 3LSIA 5EQQA 1TFXA 1LEAA 3KQEA 3H5AA 4UDWH 3S69A 1C5MD 2OTVA 3SEZA 1UG2A 1LQ1A 2HPIA 5EEAA 3TP3A 1J8AA 1J59A 4DNCA 1QZ8A 1PPZA 4ABFA 3S16J 2DDAA 1HIAA 4Q80A 2H8RA 3AKZA 1F92A 2PSXA 3OYEA 3J81Z 1F1ZA 4A3KJ 1XXDA 4IN2A 1P3EA 4KN4X 4NDLA 3A82A 1TNLA 5HODA 1R00A 2ZCLP 3F3XA 1JJ8C 5SGAE 1FBSA 2FOHA 5KECA 1F5RA 1O7FA 3TPIZ 2VC1A 1JRSA 2WWYA 1TALA 4RB0A 5HKKD 2F4LA 5H20A 4Q47A 2HFHA 2I8DA 2M45A 5LGNA 2BBYA 1XGNA 2JA5J 1H4WA 3L2QA 1A5IA 3ZZ9A 1KTTB 3O3KA 2K7LA 1N77A 3VEPA 3KYFA 1FY8E 4JYUH 3A7VA 2DOAA 4V19K 3LGVA 5JLWA 3ZCOA 1D0ZA 1O2UA 3PRBA 1K1LA 2KJCA 2DMQA 2NS7A 1P2MA 3CDLA 1LVOA 3F0CA 4BBRJ 1KU3A 1GJ5H 5J47A 1POGA 2VB0A 3PRDA 1U2WA 3ZYDA 2BDIA 4KTCA 4I7YH 3I59A 2CHAB 2L4AA 4KNYA 1JKOC 4ZHLU 1S9HA 1VQNI 3RUOA 1GI7B 3S9BA 3IP4B 2QA9E 1WJBA 4B6FA 4HX7A 1IN5A 4DYQA 1CBWC 4RGSA 2XUBA 5A8YA 2Z9LA 1D9IA 4HG2A 2V9KA 5D6FA 4X8SH 4CA0A 1CQQA 5DS9A 2E35A 4WXDA 2C3SA 1AA7A 1JTXA 2DT5A 3RZOJ 4ZC3A 4THNH 4AVPA 3UKGA 2A5WA 2RGVA 1NTCA 1UCYH 3M9AA 4PCQA 2HYFA 3BG7A 3HOUJ 2IGOA 1MABB 2OINA 3E97A 3SZNA 5K7ZA 1ACIA 2BZAA 3DWLE 5E8GA 2TPIZ 1P4AA 5HDKA 2BEOA 1EP5A 3BG9A 4IC5A 1EH7A 2W1OA 4L9JA 1LCYA 1TX8A 3T8RA 3JRAA 1AHTH 1SGQE 2ECCA 1ABJH 3RXFA 1E3PA 4DBQA 1TBQH 5B6LA 2WV0A 2E19A 5D8LB 2R5YA 1Z67A 4BJ5C 2BDCA 2SGDE 5DM6F 1AU7A 2KFWA 3HSRA 4AUXA 1O0DH 2WUCA 2SGFE 3P6ZB 2XPWA 1X4OA 3E6CC 5C67A 4AIJA 3HOXJ 1BIOA 4CH8B 3ZIAD 4ESTE 1GXPA 5L3EA 4ESFA 4AFQA 3SV9A 1L1NA 1OYYA 2Y69H 2ZF0H 2BDHA 1UK4A 1F0SA 2B5TB 2ZGJA 1LHDH 1ZTJA 4DYRA 2A2XH 2D1VA 1R5ID 3BDDA 4JBAA 2A7CA 2VXDA 5HIZA 1LMWB 3AG1H 3FZZA 7GCHF 4R1HA 4A6DA 1BMNH 1UTOA 3A8DA 4NA7A 3K4JA 2X48A 4IGDA 4EJVA 2A5AA 7GCHG 3DSPA 3M3SA 1NBMD 1G3WA 1NU9A 5AONA 1A0HB 2DUCA 2Z9JA 3Q77A 5A8XA 2V3OH 2HYJA 1DSUA 1HNEE 1AVGH 1K1MA 5K0HA 1RIWC 1Y0NA 2F4IA 3O8GA 1SD4A 2LD5A 1KYZA 4X8VH 2EV0A 4DYCA 5EYRA 2LREA 1ZGAA 1ZSLA 1EUFA 3E0PB 3G1OA 3RMLH 3OU0A 1W7PB 3BWGA 3G01A 1AWFH 3OFND 5BPIA 3H5NA 2MFZA 1AB9B 1FZZA 5I25A 1GJ8B 1A1RA 1ZPCA 1DWBH 2JJ2D 1A04A 4YESB 5GP9A 2HNTF 3HIFA 1QB9A 3OS0A 5JPMH 2W7NA 1N1LA 1EJMA 2SGAA 4AG2A 2ZFRH 2HVXA 1ZG1A 3UR6A 2WV5A 3V3MA 3N7OA 3ZZ7A 4KTSA 2FS9A 3TO9A 2VH6A 1JT0A 5HLHA 4K8YA 1F5TA 3J80K 3IWMA 3SUGA 1Z77A 4OOIA 2WAFA 4JQFA 3QP6A 1JKRC 1G3BA 2Q6DA 1IQNA 1W0JD 1MBGA 1O3RA 1COWD 2QN5T 6PAXA 4S0HB 3ZQIA 2A4OA 4U32A 3BQZA 5A0CA 5DD8A 2BD8A 4D7FA 4NQWB 2LBFA 1GGDC 2VOPA 3FP7E 1X7AC 1LE8A 1IQKA 1CT4E 2HKXA 1FN8A 3FHNA 3NWSA 2XBWA 1C5XB 2GLOA 3TO7A 4JK1X 1LKAA 5K7FA 1D0XA 1L2EA 2YS9A 4B43A 1BMLA 2Y7ZA 2MD0A 1RR8C 1F5LA 2A45B 2QY0B 4BJ6C 4MDSA 2OCCH 4DQ2A 4M6VA 4BE2A 3U1JB 5DPAA 3FXOA 2UXNA 3S9AA 2A6HF 4WWYA 4Q2KA 1Y8QB 5JYIA 2G00A 2OQUA 3WTVC 1ZHFA 1V6DA 3S1QJ 3V8LA 2LKXA 4IRIA 2M9HA 5LFAA 1Y5BT 5D5UB 1MCTA 1BTYA 3E5XA 1O3HA 3SU5A 1HXDA 3WTTC 2DE9A 4X8UH 1T39A 1FY4A 2AMPA 1OYWA 1ZLKA 2VJIA 1V2JT 3P8FA 2ANMH 3MQ0A 1XUIA 1DQUA 2WPJS 5E3NA 2R7VA 5EF6A 1O3TA 2E1CA 1XCVA 4D1QA 1RTKA 1IG7A 2O8KA 4B73A 3HSFA 4X2VA 1GBAA 3BF6H 3VB3A 1IOEA 1R36A 1W11U 3W94A 1GHCA 3DPLC 1NT1A 4IQ4A 3PLKA 4J2YB 2A6EF 2ISYA 4FUJA 2DA1A 2PMHA 4MVNA 2MLGA 2I10A 3TH3H 2WADA 1O2GH 5B66C 2QXIA 1ZR2A 4OGYA 3RSNA 2FBHA 3VB6A 2HZTA 2RNJA 2QBYB 5ICCA 1UG0A 3MU1A 3ABMH 3ZZ4A 1YYVA 1O3BA 2FMYA 4ZXXH 1B6AA 3S7KB 1BMMH 4FUBA 1SGCA 1ON2A 3EAJA 3HKJB 2M7BA 4PDKA 4XRNA 4M3BA 3HK6B 1FQ3A 1JJ6C 1QGFA 4ZYEA 1D3PB 2K02A 1C2GA 2YNAA 1YQAA 5F8XA 1QIXB 3SHFA 4UUSB 1GHAF 1A4WH 4WF2A 4C3HJ 4ZHAA 2ZFUA 4B4CA 3Q0VA 1MKXH 1SGYE 3FM5A 2BVLA 3ZMDA 1AWCA 3MU8A 2BE5F 3I55I 1XXFA 4IVNA 2JETC 2P8OC 3T26A 1MZBA 5AIPA 1CBWB 4LG0B 2BXYA 1UVPA 3ZQGA 2P3TB 2ZHWH 1QBOA 1TW3A 1O2NA 3HM5A 1TA2A 2DA6A 4Z2YA 1AY6H 4Y15A 3C27B 5CVUA 4OWRB 5A2MH 2ZHQH 5LEKA 2TGAA 3N99A 5JVTA 1Z71A 1S6HA 1W7PD 2R7QA 1GL1A 3DBRB 3M3VA 2BGCA 3CP8A 1VQ7I 1GBTA 3HGYA 5HVQC 5HS8A 2QVOA 3QAHA 3VB5A 5AFZH 2L74A 4LLLA 1VR1H 3FXUA 3LSGA 1B8IA 3H9JA 4HZFA 3R4KA 3H9QA 4CICA 1BHXB 2DOFA 1FPCH 1C1UH 3KLNA 1IXSB 1MKMA 1SFXA 3M3YJ 1K4TA 3W95A 2ZU3A 1JGSA 2ELKA 1FUJA 1KXCA 3RKQA 3BEIB 1VQ9I 4BANB 1YG2A 3DD2H 1ZAOA 1TRMA 3IRRA 3MH5A 3DPUA 2K40A 4HSRA 1WQVH 5CVJA 4LB5A 2OC7A 4LK4A 1EQ9A 1FOKA 3BEUA 4NWKA 3SJ9A 2JN6A 1YP9A 3ZN0A 3NQOA 1YLNA 1PQ8A 2RREA 1HV7A 3GY7A 4RI0A 5A0AE 3BR5A 5GAEJ 1MTVA 1BC8C 1ETRH 3GTJJ 1UJ8A 3MNXA 1KMHB 1O3GA 4Q7ZA 3CS7A 3K7AJ 3QU6A 2AFQB 1SLVB 3FVFB 3W6KB 2GM4A 3ZRGA 1JGGA 3FWEA 2MLKA 2Z6BD 3M5OA 2QCOA 3P9CA 4FE7A 1RIWB 3ZQ7A 1D5YA 1TPAE 2OD5A 1XKAC 3D1NI 3ABUA 1TE0A 4JOMA 1P12E 2ZCKP 4XN0A 1UTNA 3BG3A 3ZVFA 3V7RA 3ERED 3CNRA 4Y8YA 2FD5A 2V6NA 1FLIA 3T5XA 2XHKA 3KE2A 1O3DA 2VL8A 1NTPA 1RC9A 1BTPA 3I4NJ 3Q3KA 1UK2A 4DT7B 4UVCA 4YZUA 3H9GA 4O5VA 2XAQA 1TBRH 2D45A 4RLQA 3K6GA 4XNFA 2Y9YA 2F2EA 1B7XB 1NFYA 1KLIH 3HSEA 2JRTA 1ELGA 3F0PA 2DDBA 2LY9A 3W3CA 4ISHH 3OYBA 2E1MB 2KIUA 1BQYA 4ABEA 3LPRA 2KCYA 3TDZC 2D8WA 2Y5FA 3TJOA 4GHQA 3RXLA 4X2WA 1K7AA 3D65E 3KEQA 2M0CA 2XW9A 1MH0A 2ALPA 2Z9KA 4W1UA 1P10A 4LGWA 3CO7C 2XSDC 3QODA 4I8KA 4O97A 3N7EA 1P03A 2L2OA 4K1TA 3S8PA 1CGHA 2A1DB 3RXBA 1FNNA 2G0EA 5G4BA 1GGDB 2H9HA 3BTME 3CP7A 3H0GJ 3ZZCA 4XLEA 1IQFA 1MNDA 4EJTA 1ELEE 3F72A 3SU4A 1HB0B 3PMHB 1RKWA 3B02A 2CJIA 1VQ4I 4ZDLA 1DWDH 1HJAC 3PLPA 3I29A 5EJLA 3MFKA 3AVZA 5HNFA 5CVIA 5GIBA 1U6QA 4JYKA 2P8TA 2K0QA 1YCPH 3SQEE 2BLQA 1Y5AT 2TCTA 4KA4A 5A2QZ 3SZTA 3G2BA 4LZ1H 2JPCA 1BI2A 3UNQA 3C18A 2BZ6H 3KGPA 1BMFD 1XPXA 2BD2A 2GX4A 4X8TH 1V2UT 3QTOH 2BW3B 3L2VA 1JKPC 1P57B 1FONA 2KCPA 1GBJA 2LSOA 2A69F 1DU0A 1WPKA 4CREA 3E1SA 3OYIA 5JB8S 2QQAA 2YUSA 1MBEA 1LFBA 2HQNA 4ZYGA 2WPDD 4I8LA 2HPPH 5FAHA 1AKHA 3MTYA 3BIVH 1BOAA 4D5CA 4OIRF 3P95A 4YM9A 2QGUA 4BGDA 1Z7UA 2XC0A 1GCDA 3CCVI 2ZU4A 1CGJE 2YPRA 3GFMA 2ZB9A 3ISPA 3IG6B 3GFJA 1T8IA 2L5QA 1HW2A 1QL7A 1RNLA 3OYKA 1YOVB 2QXHA 3MH7A 2H09A 2FYQA 3QOEA 2H6MA 5KAIC 1W5TA 1AKSB 1U3EM 1GHYH 1OCCH 2PMZN 3M4OJ 4XQFA 4E7HA 1UVTH 1QHRB 1GHBF 3EYIA 1MUEB 2BYVE 1C5WB 4YIFA 1A3BH 3RP2A 3M7TA 1YLCA 2ZCHP 2QZ8A 1MD0A 5LGTA 1DANH 2FRHA 3VWBA 2F6CA 3SEQA 5EGOB 1GVDA 2QYOA 1D1CA 1XS9A 1DXWA 1Y8RB 2IRFG 4JP0A 2E5ZA 1MKWK 4A3GJ 3URCA 2ISZA 4ZTJA 1Z1IA 3MZ8A 3ATLA 3E3VA 4ESJA 2TRMA 1K21H 2FOBA 1NRNH 2VVUA 1E37B 4UV9A 3CUQC 2JETB 1HSJA 2P8OB 1HLTH 2BHYA 5FFZA 1TBZH 3RXPA 3HOYJ 1OQYA 1V2TT 1A0JA 1B1BA 1HAGE 1XGOA 2BMGB 3LDXH 3TITA 1O2LA 2IGKA 3RMMH 4U30A 4ZYAA 4GFBA 3BC8A 1O3SA 5AFYH 1QO0D 5FJ8J 5M3FJ 2FX4A 5CVVA 2GZ8A 1X3ZB 2ZKZA 1ZR0A 3SQNA 1GBCA 1S3JA 1W14U 2QUFA 5DGJA 4GXOA 4IRGA 1WDIA 3H7OA 2JZYA 1C4U2 1FMGA 1C5SA 3LC3A 3QPLA 1HAOH 2E60A 4ZAEA 2THFB 1Z1JA 3DF8A 2BD4A 4D9QA 2LNCA 4XIDA 2DN0A 4B2AA 4Y52J 1O2TA 4BTUB 1QRWA 3E0JB 2ELJA 4XBFA 4MO7A 4YG2F 1RGQA 4Y7NJ 4BTTB 4NC6A 2Z3YA 3RIRA 1GHWH 1HUTH 1DFPA 1XVMA 3BZ6A 5JDUB 2IGMA 1GDUA 3K69A 1FBUA 2FLBH 3GTPJ 1ZKGA 1IHSH 2QYIA 3STJA 2Y75A 1TGNA 2FI3E 3RXIA 1U5TC 2STWA 3TGIE 4BHBA 5FX5A 1G2MA 1UK3A 1WI9A 4BOHA 2Y31A 3UREA 1BBRE 2OTJI 2FO9A 2F9NA 5FPSA 2AGGX 1IXRC 2A68F 5F64A 4ABZA 3VXFH 2CQQA 3OSYA 2SGQE 4Y4RA 4S05A 1U8RA 4SGBE 1X3WB 1O2RA 5E3OA 3A85A 3GOVB 1XSDA 3K10A 2M30A 3MQKC 2CF9H 5DEQA 4A69C 1Y5UT 4WY3A 2R2MB 2P94A 1SB1H 4XBBA 4M3FA 4Q4LA 4IOAF 1IXCA 3IKVA 4WMEA 3F9GA 4NIXA 2MH2A 2M34A 3SU2A 1GLNA 1P2KA 5C17A 4LOCA 2FQ4A 4KN7X 3F9EA 4JZDH 1MMSA 1BTXA 2PR3A 2JA8J 4AGKA 1J5YA 3OIQA 2GV7A 2KCAA 2VKDA 4AWXB 3TK5A 1X1PA 1AU8A 1DXPA 4ASNA 4FU9A 1A6QA 1MU8B 2C93B 4WXVA 3CDIA 4RAYA 4R79A 1G30B 3R60A 5LGOA 1KQ8A 1N8OC 3K1PA 3BTWE 1RTFB 1HSTA 3U69H 4CRGA 1H88C 1QB1A 5L3FA 1B5GH 2FOGA 2Y2ZA 5FKOA 1HKSA 1ORFA 3P8NA 1IDYA 4RM3A 2PFEA 2OC8A 2F4OB 2BXZA 3GTMJ 4C2TA 3Q3XA 2PWXA 4BL0B 4JZEH 1ANDA 1MGTA 3O8HA 2CUZA 2GMTC 1R71A 4HDVA 1ZTKA 5EW2H 2EBIA 2O5RA 1WRJA 1HDPA 2G81E 4X6AJ 1D5VA 3E6BA 4O3TA 5FD6A 2LDUA 2FYRA 3S17J 1O38A 2R7SA 1QJ6B 4B75A 4II2A 2Z9IA 3OMYA 3TOBA 2VIWA 3E3TA 1Z3XA 1W7GH 2ULLA 1EOJA 3FFGA 1GT0C 5BPEA 2WPKS 4JZIA 3F21A 1W1WE 2NWNA 2BY7X 4CYDA 4OS1A 3BJOA 1ZELA 3BG5A 4G12A 1SGEE 1S6LA 4UUVA 5J3LA 2O0YA 3SJOA 1TRNA 4M7GA 5BMZA 3OY6U 1G3SA 3SXYA 1CA0C 4K3JA 2HALA 4PZJA 1V2KT 1MCVA 2FM2A 4D7MA 1ZZZA 2X4HA 3IRQA 3FXQA 3V8JA 1FEXA 1QFKH 4X6NA 1FAXA 3LAJA 4OMYA 1LKXA 2LTPA 4CRFA 4AOQA 2HOTA 3ATKA 1KXAA 4JYTA 3CC7I 3RPQA 3KN2A 2PP6A 2KPMA 4JX6A 3OYPA 4MGRA 2A32A 3FZVA 1GHXH 5EJCA 4Z6AH 1QBVH 2IT0A 4B71A 4P9UA 1SGIB 4SGAE 4F48B 2CK3D 2DA5A 1UELB 2WBMA 4CCLA 3ZYEA 2RV8A 4NZQA 3HGGA 3UNRA 4WXHA 3JR9A 1AVXA 1IQIA 5IY5H 2DK8A 3AW1A 5DUKA 3KP3A 1SOTA 3CJTB 4A0YA 1A7SA 5H4IB 3GCTF 3ZOBA 4PJ0C 1P4WA 3KIOA 2DT7B 2FOAA 2FS8A 4NC8A 2M1BA 1YCPM 4MTDA 1P92A 3GCTG 2P4WA 3RTRA 1OCZH 3M8EA 3FHZA 4P1WA 1MTUA 5F53A 3S3NA 2GP9B 1YW7A 3HHHA 1L1JA 1O5FH 2DPDA 1P06A 2DO7A 1H9LB 5M5WJ 2BY1A 1JMOH 3BEFB 2F5CA 1WI3A 4YO9A 4K5ZA 3H35A 3UPEA 4JMYA 1UTPA 3BR3A 3A89A 5DO4H 1LDJA 2AXLA 1GI2A 1J0RA 2FBKA 1C1TA 4DG4A 5C20A 2WINI 3EYYA 3GUDA 1TA6A 4ISNA 4WH6A 4CRCA 1R5GA 5IYBJ 5GJ4B 3SHAH 3E1XB 1FY3A 2Z1DA 1ZGIA 1OPCA 3S2DJ 3GCOA 2ZSHB 1Z8IB 1QQUA 2R92J 2J92A 2ELHA 1MNMC 2QEXI 3F8BA 4CCKA 1PPGE 1SG8B 3GZ5A 2GT8A 4KITB 4AFSA 3KEYA 2KAIA 4XORA 3I53A 1G6NA 3CUQB 2G4TA 2ZEBA 3CF5F 1G3EA 2HDCA 3H7TA 4XR6A 4KICA 3A01B 4IN1A 1IRFA 1FY5A 2XPUA 4MNXA 2VIDA 3VOEA 1H89C 1VZ0A 3G1LA 2ZFTA 1C1QA 3MWIU 3F2GA 1D3QB 2BDGA 4MPXA 4IMZA 2A4QA 1TT0A 3ONQA 1LO6A 2NRAC 1C1MA 1DITH 1H0MA 1VJ9U 2HI3A 4D8NA 1C2DA 3U21A 1DPRA 2ZGXH 1IHTH 4C30A 3IITA 1G8XA 2ACJA 1WYKA 2GGVB 4GCHG 3A1YA 2ZXWH 1AUJA 3BR2A 4ABIA 5DD4A 1TNJA 3I4MJ 4EJOA 1O2OA 5F6FA 3A7YA 1K79A 3GY2A 1Y1VJ 4IJAA 1RJXB 4NIVA 3VODA 2FOEA 5D5WB 1C5VA 2Y0SA 4EEFG 1XN7A 3NUMA 1MSEC 1W10U 4U7DA 1CHOF 4HI3A 3VG8A 5DUIA 1O4XA 1NO9H 1OKXA 3QUMP 4NA9H 4PROA 1CHOG 1E38B 4AX9H 4MLOA 1ZMNA 3BROA 3F8CA 5EJ1A 3EE0B 4K2EA 4L9TA 1KXDA 2JVGA 3IAM2 3BTJA 5AIQA 3DTIA 1FWZA 2CV2A 4X6MA 3OOUA 2OP9A 1V54H 2UWLA 3JAMK 3PTBA 3RPUA 1FYKA 4K1SA 4CCOA 5BPDA 3VYTB 2ZMEA 1E1QD 1O57A 1P2NA 1UVSH 1VGCC 5EXMA 3Q0UA 3SO3A 4F93B 3H3VK 1Z6TA 4B74A 2O61A 2AH4X 3QPTA 2HOEA 2Z9GA 2Z16A 3NXPA 2VQHA 4II3A 4Y7BA 2DAOA 1J9IA 1O5DH 1C2MA 5A09A 4Q5SF 5FO5A 5DP4A 2ZTXA 3ZZAA 2KIQA 2GDDA 1HAPH 3JCUC 3IHUA 2H6CA 4LJZF 3CMYA 2DXIA 1MIJA 3PM1A 1B72A 2A61A 2ME0A 2EI7A 1YS6A 3IH3A 3BR6A 3BSQA 3A2KA 1V2RT 3U98H 1TMTH 1S5SA 1LPZB 2ANKH 4AGJA 3PIOF 5E2OA 2DMUA 3R61A 1GBMA 1SD7A 2KIMA 3VB2A 1J15A 1EF4A 4IHWA 2IS6A 3QN7A 2GMTB 2ZSIB 3S2HJ 1FYLA 2QKMB 3F3BA 1UCYK 4X6PA 3ZVGA 2Q8KA 4A3LJ 3V7CA 2PSYA 2EB7A 3DEEA 3PO1C 1RKTA 1QHHD 1P6RA 2L01A 1HGTH 4RSPA 4BHCA 2HOBA 1GJBB 4E7JA 3BCAA 5KNLA 1V2PT 3A87A 2BLOA 2FTLE 3HOZJ 2PKAB 3DFJA 5F03A 1FY7A 2DOEA 2LF7A 4FVDA 4QTRA 4FUFA 1YTYA 2XAFA 1C5UA 1WJAA 1P2OA 2EZKA 3KZIC 2ZP0H 1CO7E 1BT7A 4EQQA 2ID6A 1RESA 1AE5A 3QX5H 1NU7B 4IPAA 3HRMA 2HVQA 4Q7XA 5AF9H 1O2VA 2G9WA 1HAIH 4CRAA 1CA0B 2M3AA 2IA1A 1J7KA 2IP2A 1YRNA 1WTGH 5D4SA 4L9VA 3GFIA 4XSXF 4BNRA 1ERDA 4AFUA 4G7ZF 3UQVA 4PK4A 3OAAD 2ZKSA 1KGSA 3BY6A 3S0NA 4FOUC 5J6XA 1KYWA 3GZNB 4R8HA 4XL9A 1OWKA 1REPC 4ZMAH 3IUOA 4I31A 3OY5U 3ELKA 2L54A 4BE0A 2TBSA 4GUXA 2FJ1A 1E0FD 4HNUA 4BEHB 1W5CC 4MTBA 3BN9A 4ASUD 5HYOA 4GLYA 3MWMA 3HTUA 2K3PA 2X6XA 1IO2A 4NB5A 3PNTA 1MBHA 3VGCC 5HM9A 3VYUB 4RB2C 2XCFA 3LSPA 3E6PH 3KPHA 2MBFA 4N4NB 3QZRA 2QQ8A 1BZXE 1KA8A 1HIAB 1IN8A 3EQLF 3FMQA 1KQ0A 2N8GA 5J1RA 3GYLB 2ZNKH 3T62A 2IPQX 5KVRA 3PFIA 2FESH 2KR7A 5HOOA 1X2NA 1A5HA 2BOHB 1O2ZA 1ORKA 1EAIA 2VE9A 3RI4A 3OR2C 3HRTA 3MO3A 1F9NA 4FCYA 1ZR4A 1BI0A 5FBEA 2BQ6B 2HYGD 5BOXA 3LWFA 4IZZA 2NU2E 2GTBA 4PSWA 1T98A 2ZDMA 1SI5H 1LVAA 2F9PA 3TKYA 2OBOA 3MFJA 1GI8B 2P7VB 2E71A 1P04A 1TYNA 3JZ2B 5L2YH 2WY8Q 1OP0A 2V7QD 4NG9H 1WJEA 1S0RA 3JTHA 3RC4A 2M2AA 3J7AO 5CQEA 4U7BA 4A3DJ 1A2CH 1UHBA 1XTAA 2XC7A 1QRYA 3U1DA 1CF7A 4MPVA 1AWHB 1O31A 4RGXA 1ABIH 4ETSA 3QDZB 3I59B 8GCHF 2AYWA 3ZQHA 5LPRA 1C9PA 1WHUA 2F4MB 1V2LT 5IP9J 1TQ7B 3TK6A 4XN3A 8GCHG 1V2NT 3HDDA 1WSSH 3RXGA 2KJBA 4DIHH 1GVKB 1J2XA 3HKIB 4CH7A 2ODQA 2AGEX 1Z05A 2ZQ2A 1EZXC 1ELFA 1LVYA 4I09A 5F0HA 3R3GB 4GAWA 2DI3A 1GVLA 3CS0A 1O39A 4NC7A 1ZLJA 1Y39A 1XKBC 3D5LA 2Z99A 2JQ7A 2UWMA 3SNAA 4I0BA 5AHGH 4RGUA 1YHQI 1JKQC 3KP7A 2BLWA 2HNTC 3GISB 3SW2B 1ELBA 1VQLI 4B3XA 1ZRDA 3E91A 5F27A 3LFUA 4CO8A 2NVTJ 2XWAA 4MFDA 2BDAA 3W6VA 4G7OF 5FKKA 5J8CA 5E20A 2CUJA 3PQKA 1HBXG 3LJOA 3LMMA 4NZLA 1OJLA 1Z7KA 2R5YB 2ZJRF 1JXSA 1TT5B 3LQRA 1SEUA 2FXRA 2R7ZJ 2BY3A 1QTFA 4B44A 1O3JA 3UR9A 1LJ9A 1RD3B 4XRSG 4HQMA 1CSOE 4MNWA 2VC0A 4NCYA 1B4AA 3OIPA 4A7IB 1NFXA 1HJ9A 1T8LA 4FU7A 2AMDA 2JT1A 2DK5A 1IC8A 3RXMA 1GV2A 5H6QA 1IRXA 3JW4A 3MKWB 5FLXZ 1LEBA 4BYYA 1FYMA 3Q0WA 2A05A 4LB6B 2XBXA 2FMLA 3MYWA 3FXLA 3GCMA 3JZ1B 9ANTA 1H9GA 2OJED 3CMEI 2E1OA 1HAXB 2P95A 1U9OA 5LHHA 3U8OH 1FIAA 3X2QH 3JSOA 3D62A 3WWBA 4E7SA 1DWEH 1VQ5I 1TWHJ 2QXJA 1SHYA 2P5VA 1FSEA 3M5MA 3BTCA 2R93J 2K8IA 1K2I1 2HVRA 2ZJ2A 2VBCA 2D1JA 1PQ7A 1D3DB 3ODDA 3MKYB 1KXBA 2FE3A 4XICA 3I5UA 2E7XA 1S82A 3VYRB 2FEZA 1VGCB 1GBHA 3GDSA 5E1WA 3AL0C 4I76A 3BG6A 4Q48A 3WWFA 1JE8A 4XBCA 3NAUA 2QAAA 1HCGA 3RMNH 1FP2A 1U9NA 3BP8A 1SLXB 3IH2A 3A0BC 1B59A 2IVMA 1A31A 2VGCC 2EV6A 2M4KA 1IW7F 1SLWB 4AORA 4RKJB 1D3TB 5J4YA 4UB8C 2XVCA 2W48A 1MW7A 4BBSJ 4KISA 1Y8TA 1P9QC 5FB2A 2VASA 4FQGA 3SFZA 3PJRA 1C1RA 1OX1A 2LF8A 4A5TS 1TLDA 3FK7A 1TWFJ 3PLBA 1BIBA 3WTZA 4HAMA 1O37A 3HPTB 4BQOA 1NBME 3UWJH 1R6RA 5ABWA 3PO1B 2LBFB 3KQDA 2EJRA 4IS5A 1AUTC 4G7HF 1YYY1 1LE8B 5FPYA 2Z94A 4AYVB 3HGNA 5LPEA 2XB0X 2OUAA 1CT0E 3CC2I 3DT0H 4ABJA 4UHTA 1GJCB 2EA2A 1SQAA 1V5EA 4YFNF 1XUJA 1XMKA 2Z3CA 3QZQA 3TH2H 1JUSA 4HLXA 4UVBA 1UMAH 4L5EA 2ZZUH 2FBIA 3A7XA 1RPWA 2AO9A 1LDKB 2RCEA 1VQPI 1B0FA 4S04A 3DFGA 4CZZA 5F8TA 1Y3YA 2UZKA 3RKXA 4XLHA 1ANBA 4I86A 1VQ8I 3ENSB 4HFPB 4FX0A 4KDPA 2L7MP 1N75A 3L9FA 2R2WU 1WGXA 2C8XB 1S72I 2K9QA 2BV6A 4WMFA 3LGUA 2KDZA 2ZJQF 2JJ1D 2JH5D 2ZXJA 1O3FA 2VKEA 4IHVA 3ZV9A 5KGOA 2H9TH 1W0ZU 1UO6A 4E70A 5T3HA 3AFHA 2KM0A 2O8WA 1ZG5A 3SGQE 2VWMA 3OY9A 2V6EA 2Y6TA 4GGGA 4RS8A 1NRPH 4DIIH 1PP7U 2VIOA 2VPLA 2CQKA 4B76A 4KIGA 3S3MA 3VGCB 1QQ4A 3SUEA 5DSFA 2VQLA 1Q1HA 2ZGHA 3DKYA 2E2HJ 1E36B 1YIOA 1W4MA 2BY2A 3KP6A 1YPEH 5HGGA 3VSLA 1HA8A 3MKLA 2AIQA 4BAMB 2B63J 2A3SA 1OISA 1CE5A 4XRSA 3GY6A 2GXGA 2CW0F 1SGTA 1SMTA 3RDIA 3ECHA 2IN2A 1GI0A 2ZJPF 3WE3A 2BHZA 1QRZA 2GOXB 5K5QA 4MQVA 1RETA 1GPZA 1TQPA 4RAFA 4MEXF 1FZPB 4BQNA 4LK0F 2OD3B 3AG3H 2SFAA 1B9NA 1NG7A 2FI4E 2RDPA 2C6YA 2PEXA 4MG3A 2W26A 3QWCH 3K1NA 1YF4A 4K69A 1TQMA 2NVXJ 4EMSA 1DUXC 3GVAA 2ZXHA 3RJPA 4HF2A 1G37A 3U8TH 1KSNA 4JZFH 4YELA 3RXEA 3ASOH 1BTUA 3DTEA 2PLXA 4MPWA 2XCNA 1C0WA 3C2BA 1YKTA 4AVZA 2DA3A 3GY3A 3L09A 3UQOA 1TQIA 4RN6A 4OS2A 4O6JA 2BD7A 1AI8H 3FOAA 1R49A 2HOSA 3BTFE 1OWJA 3JRCA 3I56I 1XSXA 3HOWJ 2A7HA 3WTXC 4ISLA 2LFBA 3EQ0H 3TJVA 2J2UA 1T31A 2ZDKA 3LSTA 3IL2A 2GIVA 3BZKA 1SPJA 1HFDA 3K4NA 3GMEA 1AE8H 1YITI 1CT2E 3FXKA 4IX7A 2GZ7A 1ZQ3P 3TDUC 3GZ6A 1QNTA 1B8IB 5LEJA 2CV1A 5EQRA 2W3KA 4GO1A 1YLFA 4ZTFA 1S83A 1MDMA 3CD6I 1ACBE 4OS5A 1L3LA 1WZ2A 1U8BA 3HL2A 3ELAH 2FXAA 4R8TB 4WJG2 1NS3A 3SJ8A 5F08A 4FASD 1MBKA 2H5DA 4F91B 4F55A 2EZHA 3URDA 2PX9A 3SFIA 1BBYA 4XD7D 1FJSA 4WMDA 2CQ7A 1CU1A 1BRBE 1ON1A 3OYMA 4EM2A 2ZC2A 2PUQH 1GI6A 4MTEA 2KDOA 3F2FA 3OYAA 3GXOA 4CH2B 3KP5A 1G2LA 4W97A 3JTGA 1JIRA 1USTA 4ZDOA 2EQNA 1WFXA 3H3UA 1BIAA 1EPTA 2KISA 1OXGA 4UE7H 2Q6GA 1FP1D 3J81K 1BBRK 1MBQA 3BJ6A 4IEJA 2FF4A 4DT4A 1XMNB 1NHAA 3L2CA 3GBGA 1G36A 1XD7A 3KQBA 1OSSA 2F5EA 1EXFA 1HQCA 4ZZDA 1FPHH 5CVRA 4BU2A 2P6TA 3SDBA 3NPSA 4DIQA 3LSRA 2GXAA 2F9BH 1L4DA 1DOJA 1C2LA 3D0SA 1QNJA 3M8JA 3G1MA 3AL0B 1WJ5A 4UD9H 4FISA 1AZ8A 2AQFA 5T6GA 3ABKH 5H2FC 4Y8XA 2RVCA 3RU4T 3ZV8A 1OR7C 4BXUA 3ROUA 4OIPF 5ICGA 3EETA 1C2EA 1O30A 3MI4A 3M5NA 1YPHC 2VT2A 1MTWA 2I6QA 3SNBA 2L7ZA 3A7TA 2VGCB 4C9YA 2FX0A 5GNDA 3NARA 1C5RA 3V12A 3OL4A 1YJWI 3ZMUA 4Y3OA 1FOXA 3TNTA 2J38A 1UTLM 1VQ6I 4N4OB 4CRBA 4A3CJ 4LITA 3CESA 2EILH 3UUZA 5JBCS 2JA2A 2ZQ1A 4OINF 5GADJ 2NXNB 3SDGA 4HX8A 4EATA 4UFDH 1P05A 3RM2H 3MU5A 4AC0A 5J4VA 2HTSA 1IDZA 3PV2A 4I8JA 1S5LC 2R7FA 1PUFA 3RXHA 1UTJA 3SORA 4PGGA 2FDAA 3KZYA 4QWQA 1W12U 1Z6RA 1GI3A 1SGPE 4YRVA 3L3TA 3NKKA 4IF4A 3OYHA 1ZSJA 2ZCWA 2CO5A 1EFRD 1GXQA 3SZPA 1ESBA 5C5OA 1KIGH 3F23A 2J98A 1HRTH 3BCBA 3DLAA 4HF0A 3PYHA 1TLHB 2VBYA 1SFOJ 3GCNA 1TOMH 1OYTH 2CN0H 1ZJKA 5EQSA 4FUGA 3PV4A 1VQMI 1O2JA 1G3TA 1O3KA 1SL3A 2B9LA 1X1DA 3UOPA 2VJ4A 3DBLB 1C2IA 2Y5GA 1TP4A 3E0NB 1I6XA 4H6SB 3RU4D 5CHBA 2X1DA 4QT8C 2A31A 5FGMA 2VIXA 1KDQA 1OCRH 3WHCA 1E35B 5C5NA 4A6LA 1K6OA 5D5VB 1NH3A 2KLOA 4HPQA 5B1AH 4N9IA 3QGNB 5GTIC 2BOKA 1ZGJA 1YX3A 4E06H 1AKHB 1YO5C 1MTNC 1BB0B 3BJAA 2FMJA 2MC4A 1RUOA 1V2MT 1BN5A 1BDAA 4LXBH 3S9CA 4WK8F 2AMQA 1HKTA 4L18B 1QJ1B 5F0CA 1GV5A 5KEDA 2DFIA 3D23A 1TWGJ 2WTEA 3P8OA 2LOOA 2EEKA 1WQSA 3SV6A 2A0QB 3G6EI 1K1PA 1YGCH 3MO6A 1UCYE 2OAZA 1JIMA 2NU0E 1HAHH 4P5OA 1FX0B 5D8KB 1R9TJ 1IQMA 1HKQA 1ZRKA 2E1MC 2V1DA 3ZVAA 4IMQA 4ABGA 4ZH8A 3PWCA 2STBE 1EAXA 3ML6A 2HGTH 2BY8X 2ZU2A 4I8HA 1UHSA 1PPEE 1SQRA 2YU9J 2GOMA 1YY3A 1DP7P 2IJD1 1HPGA 1KQ9A 3FKSD 1WH5A 2PGQB 1BR2A 3BOQA 1KXEA 5JB9S 1ETQA 2ALVA 1O3MA 5DK1A 3CCJI 3GS9A 1OOKB 3VPKA 4E4HA 4QPOA 3QYBA 1SFUA 3M37A 1ESTA 5D6EA 2ZHDA 2F48A 1HF0A 1YPHE 4P02A 2PW8H 1GBIA 2NYXA 2FODA 1FPQA 1TGSZ 3ZZ3A 2VJJA 3I9V2 3Q9SA 5JHUA 5IYTA 2OUMA 2D1HA 2QF3A 2EA3A 4BNCA 2L0KA 1RXPA 3F6VA 1YS7A 5EG4A 2MH9A 3EUHA 2NVQJ 2ZDNA 3M8FA 4ISOA 2R7RA 2E34A 2YSRA 2GZ9A 1UVUH 3B9FH 2Y82A 2XGCA 3ESWB 2QSGX 1ANEA 1MKWH 2DFEA 3B23B 4ABDA 2STAE 4ZXYH 2OBPA 3TW6A 3W2VA 2CS3A 4M6XA 5ESBA 1BA8B 3WODF 2JRMA 2R3SA 4ENJA 2GT7A 4OM9A 4Y33A 1LPKB 1UW7A 3UIRA 2BXUH 3TW7A 1SGFG 2K85A 2NU3E 5CHAC 3BPVA 1HJ8A 1O3IA 2JWTA 1LHGH 4HGCA 5DN6D 1JTYA 2L9RA 3FP6E 2XOKD 2WPIS 4GSOA 3CO6C 3DSOA 4JCNA 1WSUA 1NN6A 3G4SI 2DMTA 3N05A 1H8IH 4TPYA 1KU7A 3SV2H 5EG0A 1TGBA 3K65B 5GWZA 2WV4A 5E8IA 3BIUH 3T27A 3EE7A 3TEDA 1R58A 1EZQA 3MH4A 1KZHA 5TCAA 1O2IA 3KYDB 3K4MA 1D6RA 1GVZA 2F9UA 3FP8E 1DY9A 3UNSA 1GMHF 3A8AA 1GHVH 2J95A 2XNDD 4A3IJ 4LIVA 1LKBA 2FOWA 2G55A 2O6GE 2HU9A 2ZFWA 3WTSC 1GBBA 2ZMEC 1GMHG 2DYRH 4KGAA 5GPIB 1JUPA 4DZPA 1QA7A 2RN7A 2BHGA 1TWCJ 2UUJB 3SHCH 3PM3A 2HQAA 3GYMA 2W57A 3SJKA 4HRIA 5T1VA 5TJXA 3HATH 2JH6D 3T0YA 4WXIA 5LD2C 1R4MB 3K1MA 4PFPA 5E1ZB 1IQJA 1SGDE 1OYIA 3ABTA 1VITF 2B9SA 3HXLA 1GBKA 1ENHA 1J9CH 4X0GA 3JRIA 2FU4A 7ESTE 1VITG 1N25A 4EVIA 2WV1A 3GDUA 3O8BA 1K1NA 1SC8U 2XPVA 3HRSA 3VDXA 4I6ZA 1WWXA 1PQ5A 1O2KA 5IT9Z 4ZDPA 3R0JA 1RRKA 1THRH 1ZGVA 2Y80A 1LPGB 2DMPA 4CCJA 1GL0E 4A0ZA 2FX6A 4ABBA 1BJZA 1FOWA 5BNGA 4QIWN 2XIGA 3NRLA 5K5OA 1RI7A 4B8XA 1IQGA 1EZSC 3CJRB 2LY1A 5F1JA 1MBJA 3LKWA 2ZTZA 5EOKA 1Z91A 4RT0A 1ETTH 1U0JA 3S14J 2ZO4A 2E2IJ 1MAYA 1SD5A 3HBLA 1ESAA 2ZHEH 1NFUA 4PSXA 1X1CA 3JRBA 1C5QA 3IC7A 3HGPA 1DPOA 3RQ4A 2CRGA 2LVSA 3CENA 4B09A 2E1NA 2HR3A 4DCDA 4B48A 2YX4A 2IS2A 1MMNA 4D76A 1K83J 3HOVJ 1E17A 3SOSA 3GTLJ 4NSYA 2JPBA 3K70C 4UFGH 2LYCA 3AK5A 3SZGA 4NFFA 4AN7A 4H4KC 4I2OA 2EINH 3WU2C 1NRRH 1TRYA 2BX3A 4XBDA 4GHTA 3LQQA 3KFWX 2AGIX 3EPZA 3BG8A 2R5ZA 1Y56A 1DLKB 2QCYA 2VODA 5PTPA 4FUHA 5DP5A 1DU6A 2NOJB 3B6CA 3HKZA 5L3GA 4RM2A 2WAQA 4CSWA 3M07A 3ZPLA 1SLUB 4RMNA 2GD4B 1YW8A 2DLLA 5IDKA 5J1UA 4U0WA 3F0OA 1MTNB 1SGFA 2ZHFH 2PJPA 1AMHA 4ZHMU 1VQKI 1U5TA 1OWDA 2L02A 2W4SA 4F49A 1EOLA 1T7CA 1LFUP 1ETVA 3S2WA 1R4NB 3ESTA 3ECOA 3ZQLA 1VJAU 4DGWB 1TAWA 5HMAA 1ZYRF 5EZGA 1THSH 1KONA 3E16B 4M73A 2PHBA 1TIOA 4GVUA 4XKCA 1XSVA 1YE9A 1DWCH 4RB1A 4WXCA 5DCMA 3DLLF 4ZH4F 3J7ZI 4HSTA 5DTDA 4WVPE 3EGKH 1UFMA 2KHMA 4KMUX 5DKMA 4DOZA 2E5NA 2EIKH 3LL7A 1DDNA 2GA2A 4HZHA 4CYCA 1J17T 1HCRA 3RXRA 1X19A 3G73A 1ID5H 3T1BA 2ME6A 4BS9A 5ICEA 4K60A 2VNTA 3GTQJ 1P8VC 3CLQA 2ETHA 1TPPA 3I54A 5E8EH 3KCCA 3BTKE 3S3OA 1QRXA 1A36A 1B9MA 3ZQQA 2CUEA 2D5VA 1O3LA 2KAIB 1DP3A 3TBIA 3BTGE 2O8LA 4XRFA 3UB0A 3CF2A 4J00A 3Q3SA 2VQGA 4HNVA 1P01A 1ZMLA 1PFXC 3SU3A 3I78A 2YX7A 4J1YA 3DV8A 4AB9A 1O2WA 2KIFA 2VWOA 1AVWA 5E3LA 3P5JA 3CC4I 3NK8A 2NOGA 3PV5A 2KKOA 1RS0A 4XONA 2H6BA 1IV6A 3LIWA 4FUCA 3RXCA 4B2BA 2HLDD 1T0FA 2Q6FA 3DQVC 2W7SA 4QSHA 5DDGA 3SZEA 5LBQA 2LNBA 1SBWA 2PUXB 1UHMA 3REOA 4XLPF 2O3FA 3F9KA 2ESNA 4I02A 2H27A 1ELAA 3RKYA 2XAJA 3HYIA 3GY5A 4HNTA 1DGRM 1GDNA 4CDGA 2P3UB 5ILUA 2J5PA 2OF7A 3DKWA 4DY7B 1FC3A 1P7JA 2P81A 2FIRH 1AFEH 4FU8A 3K4LA 2A4RA 4KKDA 2YMSC 1D4PB 5A2QK 2WV9A 5CHAB 3ABLH 4IKFA 5KK1A 2KRCA 3M1EA 3P92A 3JREA 3S15J 4OS7A 2AQEA 1A5GH 3MEXA 3ZGKA 3M36A 2J5UA 4LIUA 3L6PA 1HW1A 1GG6B 2XF6A 4R0IA 5FKMA 3S32A 4IXAA 3OR1C 1VCWA 3RLYH 3E6DA 1SC7A 2O8MA 1W7XH 1EB2A 4DVAU 2EFPA 4D9JA 2R0LA 5DP9A 2NU1E 4MPUA 3B73A 4ZJZA 3K6ZA 1DS2E 3I0TA 3BG4C 3H36A 2YU3A 2C4FH 3MN2A 3U1IB 3AASA 1ZLRA 5D5XB 1B0EA 3HKZN 2DYSH 2QKLB 5GPCA 2ZMEB 4CXFA 5HLGA 3JSPA 7KMEH 1X3UA 5J1YA 1K78A 3S1RJ 1SOZA 2VB6A 4AFZA 2BY9X 2UXXA 4TY6A 2ANWA 1PDNC 2OZUA 2W25A 3FBNB 4RA2A 1Z7LA 3ZMVA 4HLYA 5ETXA 3PQJA 3S7HB 3F6OA 2SGPE 4P96A 1BA5A 3QPHA 5EU8A 3QWLA 1ZN2A 3CDHA 1QL9A 3G3ZA 4C3IJ 2OC0A 2VVCA 2XF7A 1ELTA 1IZ1A 2HOAA 1SSXA 1ZRBA 3U9AH 1EJNA 1ZHRA 1FOYA 4GCVA 1O3EA 4B47A 1B72B 5IYCJ 1HW5A 3BZCA 2R7XA 1TB6H 2V1XA 4WX9A 3KF2A 2IS1A 3A8CA 2Q2EA 3F22A 2J5OA 1PYTC 3TLOA 4A2UA 5IK2D 1G3CA 1MD8A 3SYTA 3RKWA 3LC5A 3RM0H 4A12A 4PGHA 4G9YA 1QPIA 2OV7A 2GQQA 3M7GA 2VBZA 1AO5A 1O32A 1WH7A 2SNVA 4TWWA 2JSCA 4E7IA 2LKPA 2BD9A 1SANA 2HRVA 1MQ6A 2B7DH 3OEHD 4YLUA 2A4GA 3GX4X 4FHTA 1GBLA 3WE2A 5LRRA 1MTSA 2EI8A 3H5CB 3IV5A 1C2KA 5H6RA 3AAFA 3PWBA 3BTEE 4NUBA 1W0KD 1RRJA 1C1WH 1EA3A 3DSGA 2JMWA 6CHAC 4Y10E 5EXLA 1XUHA 3FF5A 2P3FH 1ZTLA 1N6XA 4K8BA 3E6MA 4DOQA 2PJRA 2MD5A 1WXRA 4PFOA 3DCFA 2R7OA 4NA8A 1VFCA 2CV0A 1I1GA 1YRNB 1WBGB 2ZFPH 3L33A 3L1PA 1NZQH 1A46H 2HNHA 5JR3A 4HDUA 3FAOA 2VJ1A 3DFLA 3SU6A 5L3CA 1LHEH 2B8OH 5K7RA 1X1AA 4YOJA 4GPGA 4BXXJ 1O35A 1JOUB 1OCTC 4O03A 2EQRA 2JTVA 3A83A 1C5ZB 1UCRA 4A3FJ 3RYRA 2B0FA 4BKXA 4IW4E 4DBRA 2GBYA 1SFKA 1K1OA 4YFXF 1V2WT 1UVOA 1T56A 1BTHH 4BJTA 3ZVBA 1JWTA 1I27A 3OYFA 4XSKU 1JHFA 3HUGA 3L7WA 4L0ZB 3LU9B 2VWNA 2FLRH 2V1UA 2OQGA 1JUMA 1BM9A 1U6GA 3TQNA 2J9NA 5CQGA 2O03A 2LG4A 1LVKA 5E3MA 4OIQF 1K28D 3SJIA 5ILVA 5FD5A 4P00A 4A0XA 3FMRA 3PB1E 4UVAA 2EH3A 5K1YA 2MABA 1D8KA 5HDNA 1BC7C 4WH8A 1AN1E 4BDYA 1WAYB 3RXDA 1MAXA 2WSSD 1CGPA 2Z5UA 4M3EA 3F9FA 1OWHA 1SFQB 3GYHX 2K86A 3BV9B 1I50J 2XBYA 2DPUA 4Z0KA 4B2CA 4EGZA 3MKZA 3VXEH 3GLXA 1OS8A 4CCNA 2MG4A 5DG6A 3OTPA 1DX5M 4YFKF 1TX6A 1C2JA 4RBOA 3IWZA 1CGIE 4UV8A 2P16A 3P70B 2C90B 4Y8ZA 2CMPA 2Y5HA 3VB4A 3IH4A 4I0AA 3WG7H 4FTHA 2R7TA 2JVHA 2CFXA 4A3JJ 1GDQA 1GVJA 1UHBB 3H3ZA 1QBNA 1K0HA 1HYLA 4F7ZA 1CF7B 1STZA 4HA8A 4FE4A 2RKHA 1KTSB 3J7YJ 2HDDA 1C5OH 2W6ID 1WJCA 4ESBA 2BY0A 2F5FA 3EUAA 5JHFA 1UAAA 3J80Z 3M35A 3BPXA 3TK9A 1TNIA 1D1AA 2ZU5A 3T28A 1BMAA 2Y30A 4OIOF 1OFCX 4RLFA 1XUKA 1K22H 4YEJA 4C3JJ 1NC6A 4NBQA 1ETYA 5CKTA 3RPUD 3AAVA 2EV5A 3DU6A 1OKRA 3T25A 2GCHF 5C1UA 4MNVA 1GBDA 2O8XA 3HOTA 1DGWY 5K5RA 4WCGA 1VF9A 1PPBH 3E90B 4GYIA 1GDTA 2GCHG 1ITYA 4BAKB 4YOGA 3TGJE 3MO9A 1WJDA 2TGDA 1O3QA 3ZZ8A 3SNDA 1H8AC 3S93A 2Z3DA 5L30H 4E7LA 3H92A 2XAGA 4CBOA 2DMNA 2OLGA 5LPFA 4BXFA 2M8GX 2EC9H 3N97A 2YMSB 1MNEA 5FRNA 3P9KA 2Y9ZA 4ACBA 2XRLA 4UY8I 2ZBKA 2QXGA 2XAUA 1QCPA 4X1PU 4TY7A 1Y0UA 3CUOA 1GWAA 1NRSH 1YPMH 3LH1A 1AZZA 2P5KA 3L2UA 3RZDJ 1SMFE 1XM1A 1XCBA 6ESTA 2K4JA 4BY7J 2QF0A 4ENNA 4FUIA 1WOFA 2QF7A 3LFKA 1IQLA 2DE8A 4RAZA 2LR8A 2RDLA 3B8JA 1LUJB 1EPTC 3BG4B 4NWLA 1G3DA 3CTAA 1USSA 2IEKA 2G52A 1JT6A 2CJJA 2RAEA 1P11E 3UAIC 3TP0A 2G5NA 3NCLA 5EPYA 1IQEA 3A7ZA 1BI3A 2V3MA 1DICA 4XLCA 2QWWA 3DP7A 1AGJA 1HXEH 4ABAA 1T95A 3PSFA 2LELA 4G6TB 2R0KA 3WTWC 5JBAS 2P6SA 2IBDA 2BZTA 3LGYA 3OYJA 4RDUA 2VE8A 1ARBA 3Q9VA 1BR1A 1R22A 5LRSA 2FUG2 1IAWA 1OWIA 3FO8D 2ZU1A 3CCEI 1M9UA 3PUBA 1XG1A 2CQNA 4CGZA 4TT3D 3HPHA 2EZIA 2RA3A 3SV8A 1IAUA 1IRZA 2BM2A 4F3QA 4Y11E 3ZVDA 1YJNI 3SU1A 2HVSA 3DCLA 1KY9A 4YT7H 4L0YB 2KP6A 2V0BA 4KP0A 3K70D 1TNHA 2ZGCA 2KL4A 9LPRA 2VT3A 2XGEA 3M7QA 1UMQA 2FOFA 2QIQA 4XKBA 3CCRI 3P17H 1P09A 1EB1H 1F43A 1FT9A 3VSKA 4JK6A 1QL8A 3FX3A 1K1JA 5HIYA 5B1BH 2XYAA 3OV8A 1TGCA 3C1DA 1EASA 3V13A 4TYDA 5CE1A 4GCHF 3D5SC 4MQAA 5EXNA 2XWBI 2HDWA 1O5CB 3KQCA 2BQWB 1XDUA 4IHSA 5FX6A 1GHAG 2VH0A 3ZN1A 1SVMA 1P9SA 2ODPA 5CJ9A 1HAVA 3S1MJ 5EJZA 8KME2 2ZECA 3GLLA 4N0BA 1ETKA 3PO2J 5FRMA 5DP3A 3LA7A 2PMUA 5FXLA 2G4UA 2H8WA 4IHXA 2E7WA 2V4JC 3NRVA 3U1KA 2OPTA 1MQ5A 1I1SA 2VU8E 5FCRA 1FNIA 6CHAB 1K9OE 1LTOA 2CYYA 1ETXA 1W36D 3R0AA 3PNVA 1LVBA 3F68H 3SI3H 5L3BA 2F43B 2LKSA 1SQTA 3V42A 3K4CA 2VUMJ 2ZTYA 4XOJA 1O2XA 2DFHA 2OU2A 3SU0A 2R3YA 2K27A 3LOCA 3MZYA 2W6JD 4X2YA 2J4IA 1FIPA 1OP8A 1WU1A 2F5VA 3F8NA 1ZH5A 5CMXH 2YOLA 2P7CB 8LPRA 3LGTA 2V6CA 1C5NH 2BVMA 4A5MA 3MMGA 4ENKA 2XSJC 2JUCA 4U88A 3OYCA 1YPKH 2ZPSA 3L2WA 2VBWA 5AVDA 1S81A 4OAYA 4X2XA 4HEA2 1O3NA 3L2RA 3PMJA 4H0EA 1A6IA 1I39A 3LGIA 3FXRA 3BR0A 2WHXA 1C1NA 2XKOA 3CCYA 3OOPA 3A86A 2TRTA 1RZ4A 2UUZA 1RTLA 3M1CA 2LP0A 4E7KA 3TL4X 4NGAH 1FIWA 4PJJA 2FZZA 1O2HA 1QURH 4BAHB 2HEOA 4O9VA 2MGQA 4IO9F 1TOCB 3KHVA 5E0JA 3AG4H 2A5YB 5D4RA 2D2WA 3OWTA 2X1EA 3PTNA 3DKXA 3BTLA 4EM0B 4WF8A 4XOTA 1FTZA 3A80A 2ZGBH 3ZMZA 3PROA 5DYMA 2AERH 1C2HA 1EATA 1C5LH 4CHAC 4DJZB 4UFFH 3QOPA 1SR5C 2V1NA 3FXMA 2ESTE 3FK6A 2K1QA 4OAZA 4UONA 4LZ4B 2QSHX 1S7EA 3MNCA 2IAIA 1L4ZA 1R1VA 2PMZA 3MZHA 2F9VA 3WY8A 2MYSA 2V9PA 4FUEA 5FROA 2YMSD 1ZSKA 1ZRCA 1N6YA 2ADUA 2ECBA 2AS5F 2R9PA 4M71A 3TVJB 5IOZA 5LGUA 3KNXA 4M9SA 1DVAH 4JK5A 1NK2P 2G7UA 5IP7J 5JBTA 3OX7U 1C4V2 1OYQA 2FPZA 1W0YH 3V7SA 1T4VH 1R1TA 3U2RA 3OTJE 1P9UA 3LOXA 5M5XJ 3RMOH 4K2YA 2STTA 1C1PA 2QF4A 4CR5A 3MH6A 4BTIB 3QQAA 4G8XA 5DJ7A 1UJ1A 4B6EA 2K9LA 5C94A 4X1EA 1BI1A 1HLVA 3ATWA 4GDFA 4XDEA 2BQ7B 4Z6YA 2HLCA 3EUHC 2IXSA 3ZZ5A 2A2QH 2COBA 4IHTA 2P0WA 4RAGA 5HXFA 1AD8H 2F3CE 1A35A 5E0HA 4DGJA 1G2HA 1XDSA 3C2GA 1LHCH 2FOCA 3LA3A 3WGGA 2CH0A 1NRQH 1JBUH 5DP6A 1G59A 2BLVA 3LSJA 1T8NA 3M3TA 1GI4A 1QY6A 1UTQA 2K9NA 1E0EA 1QJ7B 1K61A 2QGRA 1X2MA 1WCMJ 4U0YA 5C44J 3HTSB 2I5UA 3CCUI 4L9NA 2F9OA 4LD5A 2VOOA 2TDXA 1IUFA 1K1IA 3M61U 1MDMB 4YIIA 3SYJA 3ZR8X 2KZ4A 5DM7F 3MD2A 3AG2H 2Z33A 3UOUA 3Q5FA 1LQDB 3U9GA 3KX2A 4MQ9F 1Z6EA 2Y0SN 3AW0A 2ZDLA 2SGEE 1PJPA 4Y0ZE 4CR9A 4XOPA 1LHFH 1TPSA 2F83A 2OCEA 2GKVE 3RYPA 2E2JJ 2DA7A 1PYTD 2M7AA 3OIOA 4BXWA 4D5FA 4L5JA 3H09A 4BAYA 1H9IE 3OYNA 3WW7A 3JRFA 3MAJA 5EDNA 1VQOI 2XBVA 3W2AA 5JBBS 4ANJA 3OS1A 4GRIA 1IQHA 3EDPA 1F0UA 1P3CA 3A8BA 5C3NA 3SJMA 1EPTB 1H1BA 2H1LA 1QVUA 2DTRA 4HX4A 1Z6JH 3TO6A 5BRRE 2CGAA 2H94A 2AHME 4G6DA 4WWCA 1SFIA 2FSWA 4MNYA 1VCPA 3ASNH 2PTNA 1KU9A 1SMYF 1GUUA 3ZZDA 5K7HA 1W0TA 1BITA 1J16A 1KLJH 3SQHE 5E17F 4AYYB 4DW6A 5FHTA 4X1NU 2NAZA 2ID3A 2EZLA 3GTGJ 3VPRA 4ABHA 2G5VA 1FMVA 1W7PA 2Q0OA 2F5DA 8ESTE 4JYVH 1Z1DA 4MIMA 4DJAA 1MMJN 2VI6A 1EH8A 1C5YB 1O5BB 2Z9OA 1XX9A 1EKEA 2X6WA 3DHKH 3BT9A 2GCTC 2ZNZA 1GCTC 3PNYA 3E5QA 1H8ED 1Y59T 1BBRH 5LH8A 4Y17A 2A5KA 5J8FA 3TNSA 4A93J 1Z21A 1FLEE 1OPHB 1W3CA 6LPRA 2VPRA 1GHBG 4B1TA 2DQLA 2IPHA 4KELA 1XUGA 3PO3J 1BHXF 3SN8A 9ESTA 3A02A 4FT8A 1A5JA 2OXSA 4BH9A 5FBIA 3K6YA 4HQEA 2EFWA 4EJWA 1PUFB 2DW4A 2XNIA 1PPHE 1C1SA 4BAOB 4D0PA 1MH3A 4NQWA 3LJJA 3DUXH 2PGBB 1ETOA 3A88A 4AIDA 3FXJA 3N7DA 2ESHA 2NNYA 1IGNA 3FIWA 1GBFA 4RT1A 3T5FH 2AS9A 4G6QA 1C5TA 5HNHA 1Q2WA 2CSOA 1BTWA 2CG4A 3HZJA 1F5KU 1M1EB 1F0TA 1Z8RA 2J98B 5KHDA 1BL0A 3E5UA 2CMYA 2EFQA 2EWNA 1ZOMA 1NPMA 5A0BA 1PQAA 4NIYA 2RFKC 3PIPF 2UUKB 5GAGJ 4O3UA 2IA0A 2R4GA 2A5IA 2FEQH 1ULYA 2Q1ZB 3O8DA 4PJMA 3LAPA 1Z0XA 1CQTA 5F1RA 3BTTE 2DQRA 1XC5A 3ZMTA 3CMAI 5FLXK 5FKNA 2VJ5A 1KDQB 1C1OA 5F8ZA 1IN6A 4ISIH 4BE1A 2EIJH 3H0DA 3QGJA 4ZCNA 3K0LA 1QU3A 4H6TA 1Y3VA 1V2VT 1P2QA 3ATIA 5CYVA 2VWLA 4ZKNU 1ZARA 2XRNA 4U2WA 4XLNF 3TGKE 5T6FA 1C9TA 1HDDC 1AIXH 2TGTA 2KQRA 4KTUA 3CJNA 2RQPA 1CA8B 1ONVA 4KIBA 3E7LA 1XB4A 2EI6A 2QLZA 3SGBE 1OLTA 1I6HJ 3VFEA 1MKXK 4YXWD 1V5GA 4XFQA 2OTLI 2ZPQA 1MJAA 1DT2A 4A3MJ 3P8GA 3MHWU 4TPIZ 4CHAB 2QBYA 5C0TA 1WVRA 4IOCF 2O9LA 2VKHA 3FBIB 5FLMJ 1O3OA 1EAUA 4XKWA 2XB5A 2XV4S 4JX5A 1C2FA 4QPQA 2HPMA 1YJ9I 3CJQB 2OK5A 3NEUA 2FQ3A 4BAQB 1J14A 1L1GA 2AHQA 1FV9A 4CRDA 3I4PA 1JRTA 1O36A 1X1BA 3CCLI 2HZDA 4ACAA 3D49H 4FX4A 1WJFA 3TOAA 4UUSA 3RU4E 2JIZD 3H1CA 2VVVA 4ZZLA 4U87A 3GICB 1BRCE 1V3XA 1TNSA 1P0SH 1MMDA 3OSGA 1ZHPA 1G32B 2LY2A 1R7JA 1OR7A 3T2NA 2W7UA 2SNWA 3LH3A 3RXQA 2KRFA 1V2OT 3U28C 1GMCF 2Y48A 4V2FA 3ZZ6A 1JXPA 1Q3XA 3AAUA 4J19A 1VKYA 1D6WA 4LG0A 1GMCG 1T0FC 1GI1A 5F0FA 4A5NA 2ANYA 2O9QA 1MZDA 1XMAA 3JRHA 1O5GH 1V55H 3QYEA 3RXVA 3MMYB 2HNTE 3DEWA 1BOQA 4YIRX 3EYDA 3QYFA 3QTVH 2V7FA 3STIA 2CW8A 3UNGC 4M3GA 2I6SA 2QENA 5LLQA 2JH0D 1I3QJ 2EIMH 4GYGA 2ZC9H 3GEZA 2OC1A 1DSTA 5IPAA 1YI2I 4F4OC 1ELCA 1V2ST 1MMGA 2QQBA 1O5EH 4E6KG 1GJ4H 4E05H 3BTIA 2L6OA 2K3FA 2Z3EA 1WQ2A 1F36A 1ZREA 2J97A 6GCHF 4Z1MD 3A0HC 4F52A 2LC2A 1HAYB 2B7EA 3C2HA 4CHUA 2VBXA 3GY4A 1RR7A 2FWWA 6GCHG 2X6OA 5J4SA 3QLPH 4BDZA 2FOKA 1GJDB 2AEIH 1ZPBA 4I32A 2RC4A 2H1KA 1HJAB 4MFEA 4AYBA 2PI0A 4NHJA 1EKBB 5HLTA 3PUFA 2EA4A 2QA4I 4G94A 3ZMSA 5EG0B 3FMSA 2ODYB 3SNEA 1OWEA 4XM3A 4ZYDA 1A61H 3O8RA 3A7WA 1VITH 1NG6A 1UTMA 2KX4A 2PLYA 1ZHMA 1TQ0B 1ZG3A 1H9TA 5FPTA 2WPHS 2YR2A 3EA9A 4U0VA 3TU7H 3FN8A 2H1UA 4UXNA 4EV0A 4I98B 2C8WB 5GCHF 1SVLA 3IAS2 2COMA 2XRCA 4D7GA 2DA4A 2BDBA 2V79A 3MVPA 2M87A 2F91A 1DUAA 5GCHG 2UWPA 3GO5A 5CPRB 5FLVA 5FCKA 1MBMA 2FA5A 1BOBA 4AIKA 1ELDE 1W0UA 2VONA 3V0XA 5J4QA 4MLFB 1Q1VA 3WGHA 2BDYA 1L0ZA 2HXOA 4INHA 4CBNA 3KL6A 1OHHD 4HF1A 1F2SE 4O3MA 3U8RH 1TNKA 3CCMI 2A07F 3FISA 3TJUA 2P93A 4I7HA 3TMOA 1ETWA 4Y0YE 1EX3A 3CCQI 3CMMA 5C1XA 4M74A 4Y76A 5GXPA 1O5AB 4M6YA 3QU3A 2JK3A 1BTZA 2GCTB 4YLQH 1FY1A 2DBBA 3C1KA 2OQ5A 3LA2A 1GCTB 2BX4A 2CU7A 2K9MA 4AZ2B 5IP6A 3O8CA 4KUMA 2EFOA 1MJ9A 2BVRH 3DXJF 5FFXA 2A6TA 1XVOA 1KLTA 2V26A 3M7UA 1FN6A 2GV6A 4HBLA 4NIWA 1NESE 1Y3WA 2WPLS 4X6OA 3LSMA 4NNJA 1T6SA 3KYCB 1T4UH 1TZLA 1YCPK 1LPQA 5HM2A 2VIVA 1TTYA 5EPNA 1NFWA 3UWIA 4A6EA 3F2HA 3GCHC 4IRHA 5E79C 4ENMA 1MMAA 5HLIA 2Y0MA 2UUYA 2ASUB 1LFPA 4Q63A 1DUEA 2PFBA 4XLFA 3KZZA 4YOIA 2RG3A 2RNGA 3EA8A 2W5EA 1SKYE 2EFNA 1H8HD 5A8ZA 1FTTA 4VGCC 4Y79A 3HRUA 2VKVA 4MNUA 2V35A 2M2EA 3A84A 2MW8A 1AFQC 1BJAA 1FXYA 1CHGA 1I5ZA 2B0LA 2JA7J 1NM6A 1AHDP 2CGPA 2K4BA 4Q7YA 2WUBA 2R7WA 1E3OC 2RDEA 2W82A 1F4KA 2D2DA 4A1XA 5L2ZH 1FAKH 3RC6A 2BVXH 2LLKA 2BY5X 4CZCA 5B5EC 3UY9A 4ZUHA 1D1BA 1APLC 2ZNYA 1UZCA 3TGNA 1LVMA 1HXFH 5EGMA 1Y6IA 4IC6A 2PQ8A 1TL8A 1ELVA 2M5TA 1E3HA 3CCSI 2EPFA 4KJZA 2L9NA 2H9EH 2X51A 4BQAA 4KYWA 3FKJA 2R5ZB 1THPB 2ZFSA 2BW3A 2M5WA 4AYBN 4EJUA 3F6UH 2X9DA 3KETA 1Y1WJ 1QBJA 1UB9A 1SGRE 3ERMA 1A0LA 2XC4A 1QR3E 4X1RU 4IL6C 4IQJA 4AIHA 1SQOA 2XASA 3CP2A 1U5TB 1WKMA 2HKOA 1BUIA 1D8JA 1INCA 5DCFA 3ATMA 2WPMS 3O2PE 1T33A 1WTHD 4M9XA 3K9TA 3JAMZ 1P2IA 2ZI2H 4ZKOU 5LHGA 2BVSH 1UHWA 2XTTB 4ZYHA 3OS2A 1Z8GA 1S7AA 2Z2SB 2WYGA 4Y7AA 3GFLA 2LPRA 1QA0A 3VB7A 1YM0A 3SUDA 3OE7D 1LDTT 2QE7D 2GJGA 1DPUA 5DCMB 1OP2A 1YX5A 3PL8A 1ETSH 1AKSA 3HEFA 1O33A 3GTOJ 3GTKJ 4DW2U 1C4Y2 5CDFE 2R7UA 1YLDA 4CUGA 1YPJH 4CYCB 2AIPA 2WB1A 3SNCA 2OZ6A 2GZWA 2ZDVH 4V2GA 3M5LA 2BXTH 1DM4B 5FL7D 1T2KA 5FKLA 1EAWA 4LOYH 5EGOA 1UTKA 3OSFA 3OYGA 1GJAB 2Y7XA 5IOYA 1YPGH 1NK3P 4XK4A 2ZA5A 1BW6A 1LB2A 1N8OB 4XE4A 2HXIA 2KZVA 3FZDA 1QPMA 1LDDA 4XSZF 2IW5A 2DA2A 1S84A 3KIDU 1YWUA 3FDYA 2GWRA 3F8FA 4MEYF 4KMFA 2QSFX 1FBQA 4ZROA 3HK3B 1O7LA 4A3EJ 5ERIA 1HDTH 1RUNA 3TIUA 2Q1JA 1EV7A 3K9XB 4YT6H 2O8TA 2K9SA 4KIFA 3RQIA 1ZYOA 5GPAA 3VFZA 3OYLA 2DFFA 3E8LA 1O3AA 3KYLA 2ZG0H 1F0RA 3PFYA 2DU9A 2XGDA 4QLCU 1MBFA 4LK1F 3EUKL 2HVYB