2IPQX

Crystal structure of c-terminal domain of salmonella enterica protein sty4665, pfam duf1528
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
121
Chain Sequence
LSSTELGDLFWSWLRDGLREGDIPVNTADACVHLTCGFVFISVPGVFFLFLKSHGRKEQVQAAFEKMRKHRVSDSRRFWQCCLYEEPGGRGRYKKLTGYLIKMSEIYNGNFPDDSLFLKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein STY4665
publication title Structure of C-terminal domain of Hypothetical protein STY4665
rcsb
source organism Salmonella typhi
molecule tags Structural genomics, unknown function
total genus 29
structure length 121
sequence length 133
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ipqX01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 2ipqX02
5LHHA 5DUKA 1O3QA 2FA5A 2ZKZA 3HUGA 3JTHA 2VN2A 1LDKB 3KLNA 1CGPA 1G3YA 1Y0UA 5J8FA 3GO5A 2OQGA 2IT0A 1F1ZA 1EH6A 1ZYRF 4EJUA 3IWFA 4EV0A 2XVCA 2KJCA 4EJOA 3HYIA 4MTDA 2D2WA 1KU7A 2Q0OA 1YFHA 1ZH5A 4AIHA 1S29A 3G73A 1TW2A 2EFNA 2EK5A 3KZYA 3WE3A 5L3EA 1OYWA 4PGHA 2PI0A 6PAXA 2O3FA 3J81K 1WI9A 2AS5F 3WTWC 2BEOA 2FU4A 2OZ6A 4LK0F 1O3TA 4YFKF 4IHTA 2MLGA 4L9VA 2C6YA 4EQQA 2VT2A 3KEQA 5CVVA 2J5PA 3ZMTA 5E18F 5CVUA 2GQQA 3IHUA 1G3SA 4UUVA 3R0AA 2CG4A 4LG0A 2ETHA 1FYMA 2W57A 5DV5A 3U9GA 1P4AA 4B09A 1UFMA 5FO5A 2YX7A 1FZPB 4P96A 2XAGA 4I02A 3KP3A 2LKPA 1HSJA 2V79A 3LQQA 3WG9A 4XLPF 1Z6RA 3TGNA 1LQ1A 3F3XA 4L9NA 3L7WA 1G3TA 2CW0F 4WXDA 1FBQA 1TQIA 2CWEA 1MJBA 1XSVA 1LDDA 2DU9A 4UHTA 1IW7F 2YR2A 3OOPA 1P92A 4A0ZA 2IPQX 2COMA 3GYHX 3L00A 3P7NA 1T0FA 2YU3A 4PZJA 5A2QZ 2IP2A 1W7PD 4PGGA 4M73A 5F1RA 2VBZA 3IKTA 1I27A 1TQPA 2J5OA 4A0YA 1GHCA 1IF1A 3E6DA 3S2WA 2VBWA 2QZ8A 2QQBA 4BHCA 3MZHA 1R5GA 1XSDA 5FLXZ 2Z99A 4G7HF 1KU9A 3HRMA 4EGZA 3QOPA 3GXOA 4Z2YA 5K1YA 1S8NA 4L18B 1LDJA 4R79A 1MZBA 5DD4A 3WTSC 1IAWA 4CO8A 3HIFA 2DFIA 1GVJA 4KT5C 2G7UA 2XIGA 2HZTA 3KP7A 5IT9K 1ZRCA 3KCCA 4I01A 2F5DA 1U5TB 1YQAA 1AWCA 4ESBA 1MDMA 2AXLA 1GXQA 2D1HA 2RDPA 1FX7A 2GA2A 1FPQA 4QWQA 2XUBA 4HAMA 4ENKA 5HDKA 2P4WA 3LA2A 3DEUA 3HRUA 1FLIA 2XAJA 2Q2EA 5E1ZB 5ILVA 4UVAA 3WGIA 1I6XA 4OINF 2GAUA 3KETA 2ZO4A 1CF7B 3WTYC 2BBYA 3L2CA 2FBHA 2QQAA 2PG4A 4O5VA 2HOEA 5F6FA 3WGHA 4LMYA 3KZZA 2ESNA 3REOA 2RNJA 2ZBKA 1XDSA 2R7DA 1U5TA 3MWMA 3I59B 3PFIA 1MJ9A 3WTUC 4IRIA 2MD5A 2HEOA 1KQ8A 1HSTA 4CDGA 1Z1DA 2E1NA 2PFBA 1XCBA 3EYIA 4EGYA 5ICGA 2P7CB 3BOQA 1W7PB 4CGZA 1LVAA 5AONA 3CUQC 1IXSB 1MGTA 3SFZA 2ZJ2A 2Z5UA 4Q4ZF 1V4RA 1D8JA 3LAJA 1GXPA 3F21A 1U2WA 2A3SA 2HWVA 4KMUX 4HX4A 1B1BA 2A07F 2NRAC 3F72A 5L3DA 1YW7A 4HF0A 4OIQF 4KDPA 2Z33A 4RS8A 2OD5A 1TBXA 3QU3A 5HDGA 3DFGA 5TJJA 4ENMA 3BJ6A 3ZP5A 2F5FA 5L3CA 3GZ5A 1LJ9A 4BXUA 2W85A 4WXCA 1H9GA 4JK1X 4A5MA 1ZLJA 3SHFA 3V7RA 2EV6A 2JT1A 2QBYA 1KU2A 3U1DA 3V8JA 1T38A 4KA4A 3L9FA 3K69A 3QP5A 5LRRA 1Z9CA 2EFQA 2P6SA 4PDKA 2GZWA 2NNYA 4CZZA 4UNOA 4A12A 1IZ1A 3F8NA 3LAPA 5JVTA 1Q1HA 1OYYA 2CYYA 4L5JA 1T2KA 2VOPA 3CTAA 5HS9A 3P9CA 2P8TA 3ULQB 5BQTA 4L9TA 3T8TA 2JZYA 4XSZF 4I98B 5K5OA 4JQFA 2YPRA 3N97A 1RUOA 3IL2A 4KYWA 2LF8A 2JTVA 5D4RA 2WC2A 3T8RA 1BI1A 4BH9A 3KP6A 1FYKA 4HQEA 2V9VA 2G9WA 4FHTA 5D5UB 1KQ0A 3GVAA 5E20A 3KLOA 3HSEA 3ABUA 1WQ2A 4LB5A 1U78A 2OBPA 4BQAA 4ESFA 3F8CA 3R6SA 3HTSB 3I4PA 4YFNF 2XKPA 1DPRA 3FMRA 1XGNA 1U3EM 3QU6A 2LF7A 3RYPA 4WXHA 1K6OA 2CQKA 3V8LA 1J9IA 3I58A 2FBKA 1S6LA 5FD6A 1QGPA 1HQCA 3CJNA 3JAMZ 4A6EA 1ZG3A 3GEZA 3O3KA 1W5TA 1VTNC 4HBLA 1XGSA 5D6EA 4M6YA 2ZNZA 1UHMA 2DW4A 1FYLA 4M9SA 2E1CA 2IA0A 4U0VA 2XAFA 3QAHA 2LSOA 2QENA 3F8MA 2CSOA 3B02A 1XMKA 2IVMA 4G7OF 4M74A 4MNUA 1BN5A 2M87A 3RTRA 1PP7U 3K1NA 3CUQA 3J80K 4ZYGA 2JPBA 2FNAA 1WKMA 5BPIA 2VC0A 4RAZA 2ISYA 4NHJA 1K7AA 4ZZLA 2FQ3A 3F6VA 2DLLA 3BY6A 3TDUC 2Z3YA 4U0YA 3QPTA 4BYYA 5KK1A 4IJAA 4UXNA 1R00A 4ENNA 2OAZA 3T0YA 1OPCA 2ESHA 2DTRA 1R7JA 3WTXC 4K2EA 2NAZA 3NEUA 2NYXA 2YSRA 3M9AA 1I5ZA 2KIFA 4ENJA 2A5YB 3TO6A 4FX4A 3M7GA 2XHKA 4ZZDA 1RZ4A 2PN6A 5J8CA 2BE5F 3QRFF 2HR3A 3O2PE 5JI6A 1B59A 1FP2A 4G9YA 3TQNA 2GXBA 3CUOA 2ZFWA 2HTJA 2VE9A 1B9NA 2QLZA 2EJRA 5DCFA 3O6BB 4LLLA 1SFXA 2WWYA 3E6CC 3EDPA 2UXXA 1KA8A 5BOXA 5E1WA 4YFXF 2HYFA 4KUMA 3WODF 5CYVA 3ELKA 3GF2A 2PJPA 1LEBA 2G7HA 2V6CA 2MBFA 4WWCA 3WTTC 3RIRA 1IUYA 1Z05A 2F2EA 1R1TA 1JGSA 2VC1A 5D8LB 5FGMA 4OMYA 1U5TC 3VOEA 1RUNA 1EH7A 1ZGJA 3C3WA 2IJLA 4ETSA 2PBIA 1PP8F 3VODA 4R1HA 4IF4A 4P9UA 5LGNA 2MH9A 4HX8A 2VBXA 1W5SA 3JSOA 3RPQA 5CJ9A 4HX7A 2EV0A 2IRFG 2Y75A 1QPMA 3K9TA 3KFWX 3IKVA 5L3BA 2DK5A 2CGPA 2KRFA 2K4JA 5ED4A 5KVRA 4JBAA 2HFHA 2TDXA 2RC4A 4LD5A 3RYRA 2O6GE 3RPUA 3KE2A 5JR3A 3QPHA 3GWZA 2W24A 4IHSA 2RV8A 2BYVE 4I0AA 2QQ9A 2H09A 5E8IA 4BNCA 1TLHB 1T98A 2VONA 4IXAA 4UV9A 5ICCA 2PEXA 3RKXA 1F5TA 3MFKA 3DPTA 2DQRA 2R7FA 2M5WA 3JW4A 1XD7A 3FM5A 4KIFA 2KJBA 3AAFA 1KGSA 1D8KA 4P55A 3LA3A 1IN5A 1C0WA 4UVCA 3BJAA 4YIIA 4FX0A 1BM9A 3M8EA 3HOTA 1PUEE 3ERED 1BOAA 4HA8A 5AIQA 1Z6TA 2UXNA 1HKQA 5LEKA 2GWRA 1YW9A 5HS8A 1L3LA 4O3MA 3WGGA 2O03A 3H3UA 1FOKA 2K4BA 3LQRA 1OMIA 4MQ9F 1IN4A 3DP7A 4RAYA 4HLYA 4AIJA 2L02A 1R5HA 2MLKA 4Y13A 4ZYEA 3ZMDA 2A6EF 5D6FA 1SD5A 4LJZF 4LFUA 4OU0A 3D0SA 4RGUA 5H6QA 1O7FA 2WV0A 1OYIA 4M71A 4A0XA 4XBFA 1I1SA 1BI2A 4HV6A 3R61A 1P2FA 1H0MA 3ZPLA 5K5RA 3E5UA 2HDCA 2YX4A 1YG2A 2EB7A 1O3SA 2FSWA 1FBUA 1TTYA 2XAQA 2STWA 4RB2C 2HQNA 2VT3A 5IT9Z 2FRHA 2QUFA 5LRSA 2EV5A 1R58A 1P6RA 3ZMZA 5LEJA 2FNPA 3HOSA 2P6TA 2H94A 1ON1A 4RGXA 1K78B 4G6QA 1J75A 5HLIA 1SMYF 3HHGA 4CXFA 2DAOA 2ZMEB 4IRHA 2DO7A 2M45A 5DYMA 3RKYA 2CO5A 4KMFA 2K27A 3TO9A 1O57A 2A68F 2DPDA 2VXZA 1CF7A 1KYZA 1HW2A 1ZAOA 4RGRA 5ICFA 1IN7A 3GZ6A 3I53A 1SD4A 1BBYA 2FE3A 2OA4A 1LB2A 2L01A 4KFCA 5DDGA 2XRNA 1FNNA 3VEPA 2O61A 3H92A 4A6DA 2L3DA 3I59A 2QYOA 4U0WA 1KU3A 1ULYA 1STZA 5DD8A 1S7AA 2ZMEA 1XMAA 2P5LC 3TOAA 2VOOA 3WTVC 1W7PA 4A2UA 4GCVA 1JHFA 1R22A 1DPUA 1R1UA 1A04A 4IRGA 2EWNA 2IA1A 1D5VA 4P9FA 3WTZA 4IVNA 2ACJA 3MEXA 4EMSA 3R0JA 1BIAA 5LBQA 4EJWA 1QZYA 2WTEA 5LHIA 3D5LA 3GFMA 4AWXB 2LDUA 3I5UA 3E5QA 1UHWA 3EQLF 2NNNA 2FXAA 2W25A 4GYGA 3BZ6A 1EH8A 2V1XA 1XDUA 3E3VA 3LFKA 2ZXJA 3KP4A 2FBIA 3TKYA 3WE2A 3RI4A 1T6SA 2HS5A 3I64A 1YTYA 4WF2A 1JXSA 4CHUA 4MHGA 1W4MA 3ZQ7A 3ZMUA 5EEGA 1BI3A 5L3GA 3ROUA 2ELHA 3ISPA 3ECHA 4WK8F 2EA4A 1FSEA 1KQ9A 3K1MA 3HRTA 1HW5A 3JAMK 1UCRA 1S3JA 3GUDA 4Q5SF 1QQIA 4YIFA 4KIGA 3FZVA 1SD6A 2M30A 3C18A 1PDNC 3BP8A 3KP2A 3F23A 1J2XA 4G7ZF 3V8KA 2D45A 2HQRA 4Y17A 2ADUA 2Z9OA 2QM3A 1ZLKA 4XRFA 2HYGD 4A5NA 5HDNA 1TQMA 3MCZA 2EFPA 4GXOA 2HKXA 2M8EA 1QZZA 2EA2A 3FXRA 3V7CA 4QLCU 4HYEA 5BS6A 3RKWA 4N9IA 4N9HA 3FM3A 2BGCA 3BJOA 2K7LA 3LA7A 4XSXF 4Y15A 3RJPA 4LK1F 4S04A 3E5XA 3GLXA 4WCGA 1IN8A 3I71A 1P4WA 4LLNA 1V3FA 1ZHFA 1YS6A 3H3ZA 1REPC 1IRFA 5IT3A 2RKHA 3F22A 2CFXA 3WU0A 2JPCA 5D5WB 1F9NA 4IPAA 1FY7A 1FP1D 2O8XA 1FC3A 1IN6A 3DQVC 2HGCA 3CO7C 2A61A 4B8XA 1DP7P 4RB0A 2PMHA 3EETA 1DDNA 3J80Z 2B0LA 2RN7A 2MC3A 1J0RA 2OU2A 5LGTA 1USTA 4EM1A 5H20A 1J7KA 2IW5A 4OIRF 1YLFA 1RNLA 5DEQA 4I7HA 3RDIA 4S05A 1UB9A 3R60A 1F4KA 4KN4X 1YW8A 4LG0B 3VB2A 1ZRDA 2EFOA 5BPDA 4MQVA 1ZN2A 4PCQA 5H6RA 3Q9VA 4HW0A 4L5IA 4H0EA 1LNWA 2GXGA 1P4XA 3SQNA 1TNSA 3V4GA 4XLNF 3I54A 1E17A 3EUHA 4ZYDA 4GO1A 3ABTA 3HTUA 3MQ0A 4HF1A 1OKRA 3PQKA 3U2RA 1RI7A 1ON2A 4UVBA 2XASA 1T39A 1YO5C 2UWMA 4MTEA 1ONVA 5HOOA 4M9XA 3J81Z 2ZCWA 3C1DA 4ON0A 5BMZA 3FXQA 3MAJA 2PQ8A 4I0BA 4Q48A 1XGMA 2VODA 3GFIA 2P5KA 2P5VA 2X0LA 5HS7A 5A2QK 4YG2F 1I1GA 1R36A 1R23A 5DCMB 1D3YA 5CVRA 2DT5A 1IXRC 5K5QA 1U8RA 4RB3C 2DBBA 1MKMA 5LLQA 2JSCA 4NB5A 4CICA 3ZMSA 5FLXK 2F5EA 2QVOA 2Q8KA 3DXJF 3DF8A 3KEOA 4G94A 4GYIA 4G6DA 2E7XA 3K0LA 1G3WA 4AVPA 4OIOF 3ZMVA 2XGXA 1B9MA 2FMYA 4HDVA 1QNTA 1MDMB 2Y0MA 3BWGA 4EM2A 4HZFA 5FFXA 5DCMA 5DUIA 2FOKA 4G8XA 3W6JB 3JTGA 3ML6A 2MA3A 1JHHA 3GFLA 3QP6A 2L54A 3J7AO 4P5OA 4I2OA 2A6HF 2IA2A 3DPLC 3TDZC 3B73A 4KIBA 3P9IA 4LB6B 5E1XA 5FFZA 1HXDA 1KYWA 3DKWA 2KIUA 2MH2A 4U7DA 3HRSA 3WU1B 1XB4A 1XSXA 2O0YA 2OZUA 3M8FA 3SZTA 2KKOA 1XGOA 2BV6A 3PQJA 1B6AA 2K02A 1G4DA 5AIPA 3LWFA 2GIVA 4KICA 1IXCA 4LGWA 2M1BA 5CVJA 3KP5A 3N4MA 1FSHA 3F8BA 3MZYA 3BDDA 2UZKA 1Z91A 3K2ZA 3IWZA 3M1EA 2D1VA 2FMLA 3ZN1A 1SAXA 4MGRA 4BAYA 5TRDA 4HOBA 4ASNA 1L0OC 5FD5A 3KQ5A 1USSA 3OV8A 5LGUA 4BHBA 1NHAA 2KIMA 5E17F 3CO6C 1AOYA 1FBSA 4KNYA 1X3UA 4L9JA 2ZNYA 3FX3A 3BPXA 1ZG1A 2RQPA 5CVIA 1EV7A 1ZGAA 5ILSA 4EJTA 5ICEA 4NQWA 2R3SA 4TV7A 1WSUA 4OIPF 3ZN0A 2PMUA 1JE8A 5ERIA 3FWEA 3R4KA 1QO0D 2HKOA 3P9KA 5HLHA 3K1PA 4DNCA 2QBYB 4EVIA 4OMZA 2DQLA 4D0PA 1BJAA 3CDHA 2V1DA 1FT9A 1K78A 3BPVA 2P7VB 3T1BA 4EM0B 2DPUA 5CLSA 1O3RA 1MJAA 2DI3A 4LLGF 1SFEA 4AIKA 1RIOH 3GW2A 3IRQA 1DUXC 4UV8A 1K79A 3IRRA 3I0TA 5J6XA 2H27A 5HVQC 4HDUA 2VE8A 3CLOA 1IRGA 1MD0A 2XAHA 2VBYA 5EEHA 5D4SA 3T5XA 2RVCA 2JRTA 2ISZA 3GX4X 4MEXF 4WX9A 4R8HA 4M6XA 3E97A 3GFJA 2XV4S 2X4HA 4Q47A 4U7BA 2W84A 1FWZA 2FEZA 2E7WA 1HW1A 3E6BA 4E70A 1QBJA 1SFUA 2L4MA 4KN7X 2DK8A 2OQRA 1ZREA 3NQOA 1O7LA 3HHHA 5JHUA 3V7SA 1ZARA 1R1VA 1YS7A 3JSPA 4CYDA 5HLGA 4ZYHA 1TNTA 3ECOA 3C7JA 1ZG5A 2L4AA 5D5VB 4L0ZB 3NRVA 4ZH4F 1XCVA 3E6MA 1XN7A 4O6JA 1BC8C 1LEAA 4RGSA 1B4AA 1BIBA 3TO7A 4N0BA 4AD9A 3F6OA 4L0YB 4HLXA 4HQMA 3FMSA 3VFZA 3FMQA 5LHGA 1ZRFA 1OR7A 4GGGA 2F5CA 2EFWA 2FF4A 3SXYA 2A69F 4M9ZA 2RGVA 3Q9SA 1H9TA 2NS0A 1S7OA 3CUQB 1J59A 4DQ2A 1SD7A 1WRJA 1U6GA 5L3FA 5F64A 2H6CA 1E2XA 4MEYF 4EJVA 3FXUA 2GA1A 2PLYA 2XROA 4F7ZA 3L09A 3W6KB 1HKSA 3BROA 5ILUA 3SZPA 1BC7C 4I09A 4ESJA 2V1UA 3FF5A 5JFRA 3TOBA 1Z7UA 3F8FA 3EYYA 3FHZA 3COAC 2STTA 4HF2A 1HKTA 1YIOA 4RB1A 1G6NA 5E8GA 5FB2A 1WWXA 3HSFA 2QWWA 3G3ZA 3IC7A 2Y48A 4U88A 3Q5FA 1ODDA 1J5YA 2HTSA 4OOIA 4M72A 1HBXG 3DV8A 3HSRA 2K86A 1SMTA 4FT8A 4HV5A 5D8KB 1TW3A 3LSTA 2XKOA 5D5XB 4BHPA 2H6BA 2LNBA 1YYVA 1BI0A
chains in the Genus database with same CATH superfamily
4LZ1H 5LHHA 5DUKA 2F9UA 4WH6A 2ZKZA 2DOEA 2X6OA 3JTHA 3GBGA 2KP6A 4JOMA 4MLFB 2HVYB 4UE7H 1SOZA 2EQNA 1SL3A 1F1ZA 1EH6A 3PMBB 3IUOA 4ABIA 3NXPA 4NGAH 2IOTA 3BCBA 2D2WA 3VYUB 1Z6JH 2LTPA 1W13U 4OGYA 2HNHA 2Q0OA 2CQ7A 4E7KA 1S29A 3MU0A 1T4VH 3TGJE 4DZPA 1EAIA 1X2MA 3DCLA 3TW6A 2PI0A 2VXDA 3J81K 2CGAA 2A5IA 2LP6A 3TGKE 2BEOA 2CW8A 2OZ6A 4DIQA 1N77A 1ORFA 1YPEH 3Q0UA 3W2WA 2QV1A 4YFKF 2P0WA 1P05A 2GJGA 3E0NB 5LH8A 4CR5A 1T8LA 4IL6C 4UUVA 3TH4H 2WYGA 4JYVH 5IYDJ 1GBEA 1FYMA 1A1RA 1GGDB 4IN2A 2KMUA 1SGIB 4ABZA 1S0RA 2ZGXH 2JA5J 3HZJA 3LOCA 5JYIA 2VH6A 5FO5A 3VYSB 3RC6A 1FZPB 3BQZA 2R7TA 3QGNB 5CQGA 1GHZA 4PSXA 1F43A 1QR3E 1X4PA 2FOEA 4P1WA 1YPJH 4NC8A 1JT0A 3HOZJ 1P06A 1XX9A 4WMDA 1LQ1A 2SGFE 5EPNA 1C5RA 3VSKA 2H1LA 1YRNA 1JJ8C 2EZHA 3A87A 1ZZZA 4LG3A 2ZPRA 1GJDB 2AS9A 5JBTA 4CZCA 4F93B 3RU4E 2COMA 3E7LA 3OMYA 1FY5A 3MMYB 1MD8A 1FTZA 3P8NA 1LTOA 1T0FA 1LHCH 4DY7B 5C4XJ 4A6LA 5A2QZ 2ZKSA 3LIWA 4BAKB 1JUPA 1UO6A 2J5OA 2DE9A 1C5UA 1QBVH 3SJ9A 5T3HA 3RXHA 3H7OA 4PJJA 1OLTA 2ALPA 3E6DA 1UTPA 4X1NU 4G6TB 4FVDA 2SGEE 3VPRA 2WY8Q 3LFUA 1H88C 1QQUA 3J7AY 3IH4A 1XSDA 5FLXZ 2LVSA 4J2YB 4XE4A 1KU9A 3HRMA 4EGZA 2H1UA 1FIPA 1A0HB 4Z2YA 4DOZA 1KIGH 1D1AA 5PTPA 3S32A 4TPYA 5T6FA 1L2EA 1IAWA 2TRMA 5IT9K 1ZRCA 3BR5A 4MPXA 1TL8A 4I01A 1AWCA 4ESBA 2JK3A 3EYDA 3TLOA 2YOLA 2CUFA 4YT7H 1BJUA 2LC2A 4QIWN 4GFBA 2RDPA 2GA2A 3A88A 3URDA 1FLIA 1C4V2 1O2YA 1AA7A 3WGIA 2GAUA 1IGNA 3RMMH 1OXGA 3FP8E 2QQAA 1BRUP 5FCKA 3OS1A 1ARCA 4Q7ZA 3BC8A 3VYTB 1ELVA 3K4CA 3TBIA 1VZQH 4XK4A 4CH8B 1DT2A 4XIDA 2CF8H 3BTDE 2RNJA 2Y7ZA 2QSFX 2R7DA 1WGXA 3MWMA 2EA3A 2C4FH 1MNEA 3SYTA 1G2LA 2A4QA 3CS7A 4IQ4A 1KQ8A 2RCEA 3GDVA 1HSTA 1V55H 2E1NA 3EYIA 3H5RA 1XM1A 3I78A 1J15A 2P7CB 3BOQA 3JRBA 5AONA 1BOQA 1IXSB 2W5EA 1MGTA 5A2MH 4B71A 2CW7A 4MFEA 4B73A 3VDXA 1GXPA 3A8AA 4KMUX 5M5WJ 1B1BA 2A07F 2NRAC 1A5JA 5DS9A 1YW7A 3SOSA 4KDPA 2X6YA 2THFB 5FPSA 4B74A 4ZAEA 4GCHF 4ENMA 2F9VA 3RXDA 5L3CA 1GDTA 7ESTE 3F2HA 1GBLA 1AUJA 4BXUA 3S0NA 1E79D 4K1EA 2X9DA 3FP6E 2G4TA 2W85A 2D8WA 2DJIA 3SHFA 3PV2A 1AI8H 1TZLA 1LFUP 1MTUA 5F08A 2JT1A 3KYDB 3MOCA 3V8JA 3O8HA 5KAIC 1T38A 1SGFG 4KA4A 2ZF0H 1K1PA 2Z7FE 3ZV8A 1Z9CA 2EFQA 2P6SA 3KPHA 2WINI 4PDKA 2GZWA 3SU6A 3F8NA 1Q1HA 1YPHE 3RM0H 3IV5A 1O30A 3M61U 3CS0A 5A8YA 1NC6A 2AHQA 2QKLB 3QWCH 2FI4E 4YZUA 3P9CA 2R2WU 3H35A 5FKNA 5FHTA 4JQFA 2YPRA 2R5YA 4FE4A 1XUJA 3GCTF 1OWIA 2ECBA 2EPFA 3ZZAA 2WC2A 1BUIA 1WCMJ 4ZC3A 1MTVA 4BH9A 4B2AA 3UWIA 1FYKA 4XKWA 3TK5A 4HQEA 2W3KA 1EASA 3A0HC 4IX7A 3KLOA 1XKBC 3HSEA 3B6AA 2CXVA 1UVPA 1ZLRA 4A3JJ 4ESFA 2L74A 1YIJI 3R6SA 4W97A 8LPRA 1RIWB 2X1EA 3KCGH 1GMCG 1XGNA 1J17T 1ETSH 2ZCHP 3UNQA 4AM3A 4WXHA 2KHMA 1J9IA 1S6LA 5FD6A 1QGPA 3UNSA 3LSMA 1HQCA 1CGIE 1SLXB 3JAMZ 4CR9A 4A6EA 5E0GA 1S0QA 1SC8U 2SFAA 2BD4A 1UHMA 3SU5A 1FYLA 3A7TA 3HG9A 1BTPA 1JKRC 2IA0A 4BXSA 4XDEA 2CSOA 2IVMA 1IQHA 4G7OF 4ZJZA 3LC3A 1YLCA 1ZRBA 4MNUA 1MNDA 2M87A 1WJDA 2VB0A 3K1NA 2LK2A 4ZYGA 2FNAA 1PYVA 4RLQA 1LQDB 4Q80A 4D9JA 1GL1A 1VCPA 3PIPF 3KQEA 1V54H 4E7IA 1IHTH 2K3PA 1GI6A 3BY6A 3O8CA 1MBFA 4U0YA 3QPTA 4XLHA 1MMJN 1D3PB 1SEUA 3BR6A 4IJAA 4UXNA 1RXPA 2GKVE 2OAZA 1C2EA 1EFRD 1MAXA 5LFAA 2NU4E 4K2EA 1N25A 1VQ8I 2A32A 3NEUA 1J09A 5EXMA 3QYBA 1KONA 2KIFA 4ENJA 2FJ1A 5J47A 1C5TA 3LNQA 4FX4A 4E7JA 2XHKA 3OYAA 4ZZDA 1MAYA 3QRFF 3O2PE 2BY5X 5GADJ 2AHME 1EKEA 2FOBA 2W00A 2DMPA 3UPEA 3SNDA 1YJWI 2ZFWA 1EF4A 1GG6B 2VE9A 1RKTA 2LY2A 3PV5A 5EYRA 1LVKA 3T29A 5TCAA 1X1CA 3E6CC 3EDPA 3SGQE 3H5AA 1FMVA 3U8OH 1HF0A 2CV0A 1E36B 3KHVA 2HYFA 1ANEA 1SFQB 4K5ZA 4NIVA 1KDQA 2G7HA 1MH3A 3BV9B 3KEYA 3S9BA 1O33A 1QZ8A 2LR8A 4OMYA 1QIXB 1U5TC 2LMDA 3VOEA 1ZGIA 1EH7A 3T26A 4HPQA 2IJLA 3SJOA 3STJA 7LPRA 4HX8A 1W5SA 2ME6A 3RPQA 3JSOA 1GHAG 2XTTB 1Y1WJ 5TCCA 4ISNA 1TP4A 3BTFE 1QNJA 3ATLA 2K4JA 3V42A 2R5ZB 5ED4A 4X1QU 3KQBA 3MH7A 4BAQB 1ETVA 3OSYA 2NVXJ 3FFGA 3TIUA 2HXIA 2QXGA 3OYBA 2OD3B 3QPHA 4X1RU 3Q0WA 2Y0SN 4F3QA 1GJ9B 1V2QT 1RESA 2YMSC 2DTZA 2EZKA 5E8IA 1TLHB 1T98A 1GMHG 3MD2A 2K0QA 5ICCA 3DBLB 3UTUH 2ZDVH 3S9AA 2R7FA 2M5WA 2CS3A 1XD7A 1DSTA 3LSIA 3CC4I 4KIFA 2KJBA 1O5EH 3AAFA 1KGSA 3R0FA 3Q3XA 4P55A 3IG6B 3LA3A 2JH5D 2NOJB 2ECCA 3BJAA 4Y3OA 4YIIA 3BN9A 3HOTA 1SC7A 3RXLA 3GY3A 1C5VA 2K5CA 2K4BA 4MQ9F 1Y3YA 2ZECA 4FUCA 3SU2A 4AG1A 1R5HA 2XNDD 1IQIA 1TWFJ 4LJZF 2BLVA 1BQYA 3G4SI 5B5EC 2I8DA 1SB1H 4M71A 4O97A 4A0XA 4XBFA 2NS8A 1I1SA 1RTLA 1P2FA 1ITYA 2HDCA 2CMYA 4K8YA 1NBMD 4E6KG 1YG2A 4M3EA 1Y5BT 1O3SA 1K22H 1O31A 1DSUA 1Z6EA 3G2BA 1TNJA 4HEA2 2QUFA 2EV5A 2A31A 5LEJA 2FNPA 2P6TA 1BR2A 1YPMH 5GPIB 4Y71A 3WHCA 3HHGA 1C5YB 1CVWH 2KCPA 2M45A 4NA9H 3BG4C 3TNSA 3BTJA 4KMFA 2ASUB 2Z3CA 2QY0B 3OYPA 3TPIZ 2A68F 4CRDA 2HDDA 1KYZA 5ICFA 2ZGBH 3S69A 2JMWA 4Z6AH 1SLVB 4P00A 1EPTC 4KFCA 5DDGA 2H1KA 5JHFA 1WCZA 3M8JA 3VEPA 1C5QA 3I59A 1MW7A 3OEED 5E79C 1DWDH 5DM7F 1KU3A 1O3CA 4RT0A 4PJNA 3PNTA 2ZMEA 1XMAA 1QPIA 2VOOA 3WW7A 3OEHD 2WPKS 1W7PA 5M5YJ 4XLCA 1JHFA 3FISA 1R1UA 4B6EA 4F92B 1INCA 1C2KA 2Y5GA 3WTZA 1UMAH 1W0UA 3R0JA 3OIPA 1C5ZB 3D49H 4JK6A 1QZYA 1HDTH 1EOJA 2FS8A 3P8OA 4BTUB 3F0CA 1T8NA 1GDUA 2LDUA 3E5QA 1UHWA 3RLYH 1QRXA 5IK2D 1TX6A 1WU1A 5C3NA 2B9LA 1XTAA 3LFKA 3TKYA 4EEFG 1T6SA 3JR9A 1VR1H 4OGXA 2KR7A 4RM2A 4MHGA 3M36A 1O2IA 2IGNA 1BB0B 3RKQA 3QQAA 3NRLA 3T25A 1FSEA 2GTBA 5GDSH 3JAMK 3S8PA 4DBQA 4X6NA 3BF6H 1QQIA 4YIFA 2L6OA 4ISLA 5HIYA 3C18A 5DP8A 1IV8A 2XGDA 1TGTA 2WAFA 4Y0ZE 1MQ5A 2LREA 4NFEA 1J2XA 2MFZA 1HAPH 3UB0A 3DSGA 3I4MJ 3HPTB 3QDZB 2HOTA 1Y5AT 2DFEA 2ZZUH 1W0JD 1RKWA 1JXPA 2OLGA 1ZLKA 4IOCF 1SLUB 4A92A 2HYGD 4CRBA 2FPZA 2H8RA 4FVBA 2RQQA 4GXOA 2CH0A 2Q6FA 3OU0A 2J5UA 2HKXA 2M8EA 1GBMA 2EA2A 1C1MA 5KAFC 3FXRA 3V7CA 4HYEA 3T62A 3CESA 3LL7A 3BIVH 4JK5A 2BW3A 2BGCA 3FM3A 1C5WB 4XSXF 4Y15A 3RJPA 1QJ1B 4GRIA 3SDGA 3IP4B 1GHVH 5C3EJ 2M2AA 3LT3A 4ZTFA 3SV8A 1EPTA 3KEEA 4S0HB 1VCWA 1YS6A 1YYY1 1REPC 4Y79A 3O8DA 1IRFA 3QWLA 2ULLA 3STIA 5JLXA 3F22A 1JWTA 2ME0A 1B0EA 1O2SA 5D5WB 1ZR4A 3MTYA 1GJAB 3SZNA 1FY7A 2P95A 2LYCA 1IN6A 2HQAA 5DP5A 1AWHB 2A61A 4JMYA 3B6CA 4HG2A 2C93B 1E38B 1A46H 1ENHA 2RA3A 4RKOB 4IHVA 2B0LA 2BY2A 3S9CA 5F8XA 2DN0A 2OU2A 3MVPA 1D0XA 2VJJA 3G1LA 3CCVI 3M5MA 3ZYDA 3A80A 1BHXB 1QHRB 1J7KA 2YNAA 4OS6A 4X8TH 5C17A 1OYQA 4OIRF 2EY4C 1HIAB 3GTKJ 3ASOH 1GVDA 4J00A 2KISA 2B7EA 3GTOJ 4BY7J 3MYWA 3R60A 1F4KA 3NCLA 3DTKA 1QB1A 1EUFA 4ASHA 4XSKU 3FN8A 1H9HE 4CRCA 5FAHA 5BPDA 4MQVA 1SOTA 2TGAA 4XRSG 4WMFA 2KAIA 4B3AA 1O5FH 2FQ4A 1O3NA 1P4XA 1VKYA 1TPOA 1EA3A 1IQKA 4DURA 2G81E 1W8BH 4YM9A 1CGHA 1DM4B 2VWOA 3EUHA 4C9YA 4ZYDA 4GO1A 1SGRE 3HTUA 1FN8A 4YEJA 1DS2E 1Z8RA 5EEAA 4VGCB 4HF1A 1J14A 2XCFA 2OQ5A 1YM0A 4UVBA 1TBRH 1JT6A 1YO5C 1ONVA 4Y0YE 5HOOA 1NFXA 3C1DA 1CHGA 1P09A 1GBAA 2CUZA 1IAUA 5K7RA 5BMZA 1C5OH 1O3PB 1O3EA 2PQ8A 4I0BA 1FONA 3RXJA 1XGMA 1O2OA 4BE2A 2VODA 2NVYJ 3M7UA 2ZXHA 3PJRA 1WHUA 2X0LA 4X1PU 2BZTA 3FP7E 1LE8A 3ZCOA 3PMJA 4YG2F 4IMQA 1R36A 1YCPK 2W7SA 1EB1H 4RB3C 2LBFA 4XL9A 2JETB 4B4CA 2B7DH 3KYGA 2BQ7B 1D4PB 2BMGB 4HGCA 4IZZA 2DODA 2VLAA 3K0LA 2YMSD 1ZELA 5BPEA 1G9IE 3GMEA 2XGXA 3MH4A 2WV4A 1HFDA 4EM2A 5FFXA 1KXBA 2FOKA 4G8XA 3W6JB 3VB5A 5AFZH 3GFLA 2B0FA 5JB9S 3FDYA 2DMUA 4MG3A 4LB6B 2UWPA 1KYWA 1C2DA 3FAOA 3ODDA 2MH2A 1V2UT 3HRSA 4A69C 1H9IE 3Q77A 4AN7A 1S72I 4ISHH 3PQJA 1J8AA 1G4DA 1Z77A 1TA6A 2ZC2A 1TNKA 4LGWA 1YHQI 4YIRX 4XNFA 4IC5A 3N4MA 1FSHA 3F8BA 4HFPB 1LMWB 1S84A 1V3XA 3M1EA 2D1VA 2FMLA 3ZN1A 1IQEA 5TRDA 4ASNA 1L0OC 5FD5A 1ELDE 3HOVJ 2R0KA 2G4UA 1USSA 4HNTA 2XNIA 4BHBA 4C2MJ 3GDSA 2O8TA 3CO6C 2Z9IA 4LK4A 1AD8H 1LPKB 4JZFH 4L9JA 1GVKB 2FXRA 1IQJA 2JUCA 3CCJI 3S3MA 5FKKA 2FOCA 1C2LA 1F2SE 5J4YA 5ILSA 5ICEA 2KDZA 1WSUA 1N8OB 3JZ2B 5K0HA 3D5SC 2PMUA 1GMDG 1MBGA 3AW0A 3FWEA 5E0HA 2XGCA 2B5TB 2HKOA 5HLHA 3VB6A 2WSSD 4DNCA 1P11E 4EVIA 1TNGA 2DQLA 4D0PA 1BJAA 2DA2A 2VIWA 1RD3B 3LJJA 1ORKA 1V5FA 3F9FA 2YUSA 3GW2A 1YJ9I 1EX3A 3I0TA 2DYSH 4ASUD 1DP3A 4M3FA 2XPUA 2G00A 1BITA 5ABWA 1MD0A 1YC0A 1O2JA 2R0LA 3PUBA 3CC2I 2CQNA 3LPRA 2H9HA 5D4SA 2RVCA 3QPSA 2JRTA 4WMEA 4MEXF 1C2HA 4QPQA 5FCRA 1BTZA 2BYAX 3E97A 1LFPA 1GI7B 1K1MA 1GUUA 4BJTA 2X4HA 4Q47A 1FY4A 3V3MA 2E7WA 2Z9GA 3E6BA 2OC8A 4OS7A 5CMXH 1P2MA 2QCOA 4C3JJ 3HKZN 1A2CH 3BTCA 3HHHA 2P93A 3E1XB 5JHUA 3SI4H 5B1AH 2KFDA 1YS7A 1D1BA 4ABFA 3PL8A 2WB1N 4I99C 1TNTA 2CJIA 1TPPA 2L4AA 2DXIA 4INLA 1L1NA 2M4KA 4ZH4F 1IQLA 3KQDA 2GCTB 1XN7A 1N6YA 4O6JA 1TNHA 3A86A 1MABB 1BIBA 4N0BA 4AD9A 2GM4A 1DXPA 4HLXA 3OSGA 1V2RT 3MKYB 2JWTA 3FMQA 2F4IA 4I31A 3FK7A 2F5CA 2FF4A 2FX0A 2CUEA 1OOKB 5JBCS 1MSEC 3HL2A 2E35A 2TGPZ 1R4MB 3GYMA 3WWBA 2BD8A 1A6IA 3CUQB 3H36A 2DFFA 3UQOA 1T33A 4DQ2A 1R4NB 3GY4A 4QPOA 4MEYF 5KNLA 2GA1A 2PLYA 2XROA 1F5LA 2IXSA 3BROA 3SZPA 3CCSI 1W10U 4RM3A 2V1UA 1GI8B 1QL9A 4I32A 3EYYA 4XKVA 2PP6A 1K1NA 3SHCH 3FHZA 1Y59T 5E3MA 1P2KA 4DJZB 2JVGA 4HF2A 1RRKA 1SKYE 2CV1A 2BY7X 2R7WA 5FB2A 1Q31A 3Q5FA 1FLEE 1ODDA 1NTCA 1CA0C 1J5YA 1E34B 2HTSA 5EG0A 4OOIA 4OS1A 4M72A 3GTPJ 3NUMA 4YXWD 3TMOA 3EAJA 2GIZA 2A05A 1KXEA 1MBHA 4BHPA 2OXSA 1AHTH 1YYVA 3H7TA 4DYCA 3E0JB 3S93A 2DA3A 1OCPA 1O3QA 1VQ9I 2BY3A 1C1SA 2OCCH 3HUGA 2VN2A 4RA2A 1DX5M 1O2UA 1LDKB 1ACBE 4MFDA 3BZCA 1A0JA 1TLDA 3LGIA 1LKXA 3EDXB 3IWFA 3QOEA 2KJCA 1O38A 1F5RA 2JH6D 2D2DA 4EJOA 2AFQB 3CMEI 2ZCLP 1UG2A 1QQ4A 4BXXJ 1YFHA 2NVQJ 3PNYA 2RREA 4DIIH 4Y33A 4FUEA 1TW2A 4DBRA 1VITG 1HAYB 1LHGH 3WE3A 4MDSA 5E8EH 1HB0B 4MVNA 1OYWA 3BTHE 6PAXA 3WTWC 2XC5A 3HOUJ 2FU4A 3AAUA 3SU0A 5AVDA 4LK0F 3ZZ8A 4IHTA 2CF9H 2X6WA 2MLGA 1LCYA 4BXFA 3HDDA 1YRNB 2J5PA 1B8IB 4ABEA 5CVUA 1Y56A 4OS4A 2ICWG 1WOFA 2FI3E 4LG0A 2ETHA 1WTHD 1O2QA 2W57A 3U9GA 1V2TT 2GDEH 2V26A 3SJIA 4NC6A 1UFMA 4O3UA 4P96A 2R7UA 1NTPA 2XAGA 2NOGA 5JPMH 2F6CA 2VPRA 1NS3A 4O03A 2LKPA 4TYDA 4DW2U 1DDJA 3WG9A 1Z6RA 2L2OA 3F3XA 1V2JT 3OS2A 3OX7U 2GD4B 1W7GH 3N7EA 2OTLI 1MJBA 1G8XA 5IP9J 4UHTA 5J40A 3OOPA 2JA8J 4UFEH 1VJAU 4IN1A 3QLPH 3ZZ7A 3SNAA 2IPHA 4D7NA 3ZVBA 4PGGA 4UUSA 5F1RA 3IKTA 5JBAS 1GHCA 3L1PA 3M3VA 5C67A 2STAE 3QYFA 3S2WA 2F5VA 2CMPA 1IRZA 2QZ8A 1HC8A 1AFEH 3LSHA 5M3MJ 4ISIH 3QOPA 4UB8C 4BGDA 2J98B 2E5ZA 3MKWB 5AF9H 4E05H 1LDJA 3ZVEA 4X6OA 2M5TA 1A5IA 3CLQA 1O3OA 5DD4A 3WTSC 1V2MT 1ESAA 3A8CA 4CO8A 2IS1A 1GVJA 2G7UA 5DP7A 3RMNH 1H9LB 4AX9H 1KZHA 1MDMA 4F49A 4F91B 4RDUA 1VQKI 4II3A 2LKXA 1FPQA 3HC7A 2IAIA 4QWQA 2QEXI 4HAMA 3FXJA 4ENKA 5HDKA 2P4WA 3JZ1B 3DEEA 2GX4A 2XAJA 5E1ZB 5ILVA 1YE9A 2NS7A 2VH0A 1SG8B 3OYNA 4OINF 4Z6YA 3PUFA 4NCYA 2BBYA 3ZZ9A 2PG4A 3ZVCA 1GI3A 1HA8A 3UOPA 1QVUA 2WBMA 5CHAB 2EINH 4ACBA 3CDLA 1IJWC 3HK3B 1K4SA 2ZI2H 1C9PA 3REOA 3TJUA 1XDSA 1HNEE 3A85A 3PFIA 1MJ9A 4CBNA 1E0EA 2MD5A 2HEOA 5EODA 1ARBA 2QF5A 1TONA 1GJ6A 1GJ7B 3A2KA 1C9TA 2PFBA 2RNGA 2NVTJ 4EGYA 1LVAA 3MHWU 4H4KC 2ZJ2A 2EC9H 2Z5UA 3L2RA 4MPVA 1U2WA 1ETOA 1W36D 2KL4A 4HX4A 1BL0A 2ZU5A 2DOFA 4OIQF 2Z33A 1VITH 1L4DA 2ANWA 1F0TA 2M7AA 3T2NA 3BJ6A 5EW2H 3HB9A 1LJ9A 5B6LA 3PSFA 1W1WE 3TGIE 1I50J 1MZDA 1EZXC 1O3IA 1PPGE 1WJEA 2R7RA 1OSSA 4Q4LA 2KZGA 4B76A 1GHYH 4JK1X 4XLEA 1ZLJA 2UUYA 1GI4A 1QHGA 3V7RA 2EIJH 2OC7A 5EJLA 1KU2A 3E6PH 3L33A 2A7CA 3EE0B 3L9FA 2BOKA 1AKHA 2FOHA 5CE1A 3QP5A 1X1BA 1HAGE 4XN3A 1F0RA 4CZZA 4LIUA 1A3BH 4A12A 5JVTA 4CUGA 4L5JA 2V0BA 2OPTA 3SU4A 6CHAB 5CDFE 4X2VA 1W0TA 3CTAA 1DLKB 2QF7A 5HS9A 2KZVA 2ZHEH 4ZHMU 1HJ9A 4L9TA 1K1IA 3SNEA 1CT4E 4XSZF 3AW1A 5K5OA 5GP9A 4FUGA 2Y0SA 3S3NA 3S14J 4KTCA 2ZDMA 5D4RA 1WYKA 1BI1A 2A7JA 1BHXF 1O3BA 2V9VA 1Y8QB 2G9WA 4IKFA 4FHTA 1KQ0A 1AKSB 3ABUA 1XVOA 4KITB 1U78A 2OBPA 4PK4A 3LSGA 3F8CA 1P2OA 3QO6A 4FUBA 3OYKA 3ASNH 1MSFC 2IN2A 4FTHA 3ZIAD 5GJ4B 4B1TA 3GTMJ 3VEQB 1NK3P 1UG0A 3V8LA 2FBKA 2RDEA 2P3TB 4AGKA 4FUIA 1Y0NA 2KM0A 2WV9A 1GWAA 1JMOH 2RDLA 5D6EA 2ZNZA 3B8JA 1E3PA 4SGBE 2ZDLA 1OQYA 1P7IA 4M9SA 2WPHS 2K40A 2ZQ2A 1AB9B 1GGDC 1XX5A 1WJAA 4M74A 1DU6A 1BN5A 3RTRA 2F4MB 1MNMC 2V7FA 2JPBA 1B5GH 2DFHA 3FIWA 3ZQFA 2L7FP 5AFYH 3BTLA 4NA8A 3TJOA 4X8UH 2BVRH 5DTDA 4ZZLA 3OL4A 3F6VA 3FXLA 3TDUC 2N8GA 7GCHG 1VQNI 1GVLA 5LPEA 2L7ZA 1WFXA 2STBE 2GMTC 2H2ZA 4ZH8A 1ZOMA 3HGGA 1BBRE 2Z9JA 1X7AC 3GY6A 3WTXC 1R7JA 1UTLM 2J9NA 1T31A 2NAZA 2NYXA 2YSRA 2L9SA 3M9AA 2VJ5A 2LH9A 1CQTA 1QL8A 1KDQB 3M7GA 1AE5A 2PN6A 5J8CA 2TGDA 5LPRA 1EAWA 3VB4A 3QUMP 2V6NA 1MKXK 2XF6A 4XBCA 1SR5C 5DCFA 2C8XB 1TBZH 2EEKA 2WZQA 4L5EA 3M07A 3Q00A 1OCRH 2CU7A 2UXXA 3A83A 2F4LA 1KLIH 3OFND 1PYTD 1GCTB 4YFXF 4CCOA 3GY2A 3HEFA 4KUMA 3WODF 5CYVA 1EQ9A 2PJPA 1EZSC 1LEBA 2ZEBA 1SGFA 2HNTC 2ZPQA 4AU7A 4CCLA 4TY6A 1JGSA 9ESTA 2VC1A 5EGMA 3UQVA 5FGMA 4RN6A 3W2AA 1ELTA 3G6EI 3VB3A 1RUNA 3VFEA 1AFQB 1TWHJ 1TMBH 2D26C 5F8ZA 3VODA 3LJOA 4R1HA 3WY8A 3OY6U 2QCYA 1FOXA 2KPMA 2VBXA 4HX7A 1L0ZA 1G32B 2XPVA 2VVUA 2EV0A 2IRFG 1ZHRA 1P02A 2Y75A 1QPMA 3AASA 5F8TA 3DCFA 2VWLA 2XBVA 3K9TA 3IKVA 2UV1A 5DP6A 2CGPA 2L9VA 1T95A 1EJNA 2R93J 2BY0A 1EP5A 2HFHA 2TDXA 3RYRA 2V9KA 3BEIB 2M3AA 3RPUA 3RZOJ 2Z3EA 1M1EB 1F5KU 2FWWA 5JR3A 1E1RD 3HOXJ 2GCHF 2W24A 1TWXB 3LSKA 1QFKH 4I0AA 4PFPA 1P3CA 2VONA 1Z8GA 1ZR0A 2LLKA 4UV9A 2BQ6B 2PEXA 1F5TA 3MFKA 4P02A 2ZU1A 4XMYA 1SGQE 4EATA 3FM5A 3A7ZA 3A1YA 1Y1VJ 1Q3XA 2PW8H 1QA0A 3S17J 3ERED 1JKQC 3FXMA 1OWHA 1HV7A 2OC1A 5AIQA 1Z6TA 2UXNA 2O8KA 2GWRA 2HPIA 1YW9A 5HS8A 1L3LA 4O3MA 1SVOA 1HJAB 3H3UA 1ANBA 2COBA 2FOAA 3LQRA 1OMIA 1VQLI 4RAYA 1GI5A 2KRHA 3KIDU 2VIOA 4ZKOU 3CCUI 2MLKA 4MPUA 2KCAA 1XXDA 2A6EF 3CQZJ 4LFUA 2QYIA 1OYIA 3CMMA 1SI5H 3LDXH 1OWKA 1GHBG 5JBBS 2YX4A 4NQWB 3P17H 2LNCA 1UVSH 1Z71A 4UD9H 2STWA 4INHA 5IT9Z 2G5NA 5LRSA 3F6UH 1P6RA 1VF9A 3ZMZA 3BCAA 4OS2A 3HOSA 1V2PT 2P3FH 1K78B 4UEHH 2QA4I 1O2ZA 1SMYF 1EZQA 1WJCA 4CXFA 2ZMEB 4AGJA 1TRYA 4IRHA 2DO7A 1ZJKA 3K4NA 3RKYA 1RIWC 2K27A 2PJRB 1HPGA 5KEDA 1NRRH 2ZXWH 1IN7A 2ID3A 3I53A 2OA4A 4A1VA 2L01A 1AVGH 1TRNA 4BOHA 4NBQA 1TT0A 1DWBH 3H92A 4AB8A 2L3DA 2C8YB 4K69A 4U0WA 1G3EA 1ZPZA 1WXRA 2ZA5A 4XRNA 1STZA 3BG7A 3A01A 3UNRA 3SNCA 4K2YA 1S7AA 2DDBA 2P5LC 3TOAA 1Q1VA 5IY5H 1GPZA 4MTBA 1GI1A 4I86A 1SQRA 3H5NA 1DPUA 3SI3H 4IRGA 4E7RG 2ODYB 2NVUB 1D5VA 1JTYA 4INKA 4KT6A 1Y3XA 4PROA 1J9CH 3OYLA 4EMSA 2F43B 1BIAA 5SGAE 1D0ZA 2ZNKH 2WTEA 2HU9A 2OCEA 1DITH 3GFMA 1BTWA 4AWXB 1Y39A 4M6VA 1NU9A 2ZJRF 4UDWH 5HKKD 4RT1A 1XKAC 3E3VA 4IHYA 4MQAA 3ZR8X 5B6OA 1P12E 3KP4A 3G01A 5T6DA 3I64A 3TH2H 4WF2A 2Y7XA 1JXSA 4XOJA 2A7HA 3EUKL 3RLWH 3PO1B 1W4MA 5EEGA 1O2LA 3CP7A 3JREA 3F2GA 3ISPA 4WK8F 4A3MJ 3PO3J 3MWIU 1THSH 2EA4A 1E37B 1GG6C 1C2MA 2KT0A 3ZRGA 2DA5A 1UCRA 5C4JJ 1S3JA 3GUDA 2G5VA 4JYKA 3FZVA 2R7XA 2M30A 1AO5A 3M5NA 1O5CB 3BP8A 1QGFA 3KP2A 3L2VA 5IP7J 4C3IJ 4ZHLU 3V8KA 2HQRA 2QM3A 2J2UA 5F0FA 3BTIA 5KHDA 1O3HA 5IDKA 1JOUB 3NWSA 3QGJA 3UAIC 5GWZA 2OC6A 3RDZA 4Y8ZA 5BS6A 4ZKNU 4N9IA 4N9HA 1F0UA 3DKYA 2PKSB 5HMAA 2FZZA 2ZXIA 1P4WA 1TQ0B 4DVAU 1O2MA 1O0DH 2GDDA 4LLNA 4E7HA 2QIQA 3H3ZA 1X4OA 3KYLA 1KXAA 5IT3A 2RKHA 4GHTA 3K65B 4E4HA 2JPCA 1QB9A 2FIRH 4IPAA 2VGCB 4FU7A 1QCPA 2DMNA 2ZG0H 2P16A 1DP7P 5TJXA 1BTHH 1WJBA 4DCDA 2RN7A 1J0RA 2E5NA 4A1TA 3T5FH 4W1UA 2MSYA 2EH3A 2IS2A 4I8LA 1VQPI 2A5KA 1X1DA 2IW5A 1GDNA 1A31A 3U98H 3S2HJ 1OP0A 2UUFB 3MO6A 3A82A 3RC4A 3RDIA 3EA7A 3MU8A 3H0DA 4NDLA 4KN4X 4U32A 2XCNA 4BDYA 4M3GA 1ZRDA 1WPKA 1LUJB 2CQXA 5H6RA 4AG2A 3PM1A 1FV9A 4H0EA 3SQNA 4X2YA 1F36A 3AVZA 2CQQA 1RTFB 5FLVA 1R71A 2DMTA 5DG6A 1E17A 1ETQA 1NY22 3ABTA 2V3OH 2Y2ZA 3TJVA 2ANMH 1VGCB 5JDUB 7KMEH 2LD5A 1CHOG 2PWXA 3F0OA 1OKRA 1P9QC 3C2HA 2XASA 3SV9A 4R8TB 4MTEA 3RCOA 1RS0A 5GPAA 4ON0A 3PROA 3N05A 4J19A 2BLWA 1BMFD 1LHFH 1O3JA 2BXZA 2TPIZ 3HKZA 4Q48A 3MU4A 1MIJA 2ZQ1A 1XVMA 1FTTA 4YOIA 2IS4A 2P5VA 3L3TA 5H4IB 5HS7A 2WB1A 4AYYB 3L2QA 1R23A 4I8HA 1D3YA 3OYHA 3NWUA 1FY1A 3C27B 1D6RA 1IXRC 1WH5A 1O36A 2GMTB 3CD6I 1MKMA 1BJZA 2FDAA 3ZZCA 3RXSA 2LELA 3RSNA 4RMNA 2ZJQF 2F5EA 5DGJA 2QVOA 2ZFUA 1WJFA 2Q8KA 3U21A 1SGCA 4G94A 4BQQA 3OYEA 1MKWK 1H8AC 2E7XA 3A8DA 1G3WA 4AVPA 4OIOF 1CO7E 3ZMVA 4ZUHA 3CP2A 1DUEA 1V2LT 3KN2A 1B9MA 2FMYA 4JYTA 3E1SA 2Y0MA 3P8FA 5DCMA 3K4MA 4C2UA 2ZPSA 2K9NA 4YTAA 4QSHA 2L0KA 2Q2EB 3RXVA 1DOJA 2V9PA 3RP2A 1TA2A 3TP3A 2GLOA 2F9BH 3K70D 3TDZC 1XMNB 4IGDA 4KIBA 1MTNB 5EF6A 1HXDA 4U7DA 4IHXA 1XB4A 2O0YA 2OZUA 2KKOA 1XUFA 3HKIB 1SHYA 2VKHA 1DUAA 5DJ7A 2K9MA 5AIPA 5EZHA 3A84A 2HOBA 1E0FD 3N99A 2GIVA 3U1KA 4FQGA 4NIYA 4H42U 4FUHA 2VI6A 1OYTH 2ZB9A 3W2VA 3PTBA 3RXIA 3RMLH 3KP5A 2K9SA 2IS6A 4Q7XA 3IWZA 2R7OA 4HOBA 3NKKA 1NFYA 3BTKE 1FX0B 1FJLA 3D5RC 5E3LA 1S82A 3OV8A 3O8RA 1QBNA 1WI3A 2ZGJA 5CPRB 5E17F 3OTPA 1ZGWA 3U9AH 2DDAA 4PJLA 1LO6A 3H3VK 3FX3A 3PSIA 5EQQA 3MI4A 4D7GA 1K1LA 2MGQA 2RQPA 1NRQH 3SZGA 1EV7A 4XRSA 1SMFE 1ZGAA 5GAGJ 1GHBF 2ELKA 3PO2J 2VKEA 3TL4X 3A7XA 2R3SA 4TV7A 5TGTA 4YT6H 1U9OA 5C94A 1OWJA 2QBYB 4OMZA 1FT9A 3BZKA 3BPVA 2P7VB 3GY7A 3T1BA 4H4FA 3RXCA 2M7BA 1OHHD 5EJZA 4EM0B 2XW9A 3TITA 1YY3A 5CLSA 1MJAA 1CBWB 5IP6A 3IRQA 1DUXC 4UV8A 4AIDA 3IRRA 3SUGA 1MMGA 5HVQC 4HDUA 3D1NI 3CLOA 1HOMA 1TALA 1ZTJA 1TT5B 3VSLA 2SGAA 4CHAB 3RXFA 1ZTLA 4V2GA 3M3TA 4WX9A 4R8HA 2Y31A 5K7HA 2M8GX 3GZNB 2D1JA 1F92A 1GJCB 1B7XB 1HYLA 2WUBA 1HW1A 4KN7X 4AFSA 1C5LH 2DK8A 3AKZA 3ZXSA 1O7LA 3FBNB 3V7SA 2ODQA 1LPGB 1BW5A 1CQQA 1Y3UA 1C2IA 4BBRJ 1UCYH 1YCPM 4JZDH 3RU4D 3W3CA 1ZG5A 3ITIA 5D5VB 1WJ5A 1DY9A 3E6MA 3PMAB 3RXTA 2O8UA 4GDFA 1BC8C 1DGWY 4CRAA 2TCTA 3SZEA 2M34A 1I3AA 5G4BA 3SU3A 5KCMA 3K4JA 3VFZA 2K85A 2ZDAH 5F53A 2EFWA 3CMYA 3RXKA 2PTCE 2A69F 3PRDA 3FHNA 2FLRH 4M9ZA 2NS0A 1S7OA 2JA2A 1Z1JA 3MNXA 3OOUA 1THRH 2O9QA 5LD2C 2H6CA 1MH0A 5EIYA 1Y8TA 3FXUA 1S5LC 4F7ZA 2KFWA 1HKSA 1UCYE 3RXEA 4I09A 4ESJA 4VGCC 1L1JA 4ISOA 3FF5A 4NZQA 3S7HB 1GBDA 4YELA 3LSJA 3VXFH 1MTWA 2LY9A 1MZAA 4B1RA 1BR1A 1G6NA 3HSFA 5IPAA 2QWWA 4I7YH 2PR3A 1LVBA 1QRYA 4A93J 2Y81A 1NU7B 4ZTJA 3ZOBA 2BOHB 5J4SA 1OWDA 3HSRA 2K86A 5DP4A 1EB2A 3CCRI 1J16A 2GZ9A 3GTQJ 2H6BA 2JETC 3DT0H 2LNBA 5A0BA 2OTJI 4U87A 2XRLA 2FA5A 4YLUA 3ATIA 4XM3A 1CSOE 2DT7B 3KLNA 1CGPA 1GHWH 3MNCA 5J8FA 2HOAA 3GO5A 1ZYRF 1UVUH 2JJ1D 3PLBA 4EJUA 2XVCA 4FASD 1LQEA 2XSDC 5EPYA 3VB7A 1KTTB 1KU7A 3VG8A 5IOZA 3ZQGA 1ELGA 3VPKA 1VQMI 1ZH5A 2VWMA 3ZVDA 4NZLA 3FZZA 1XUIA 2EFNA 3SJKA 2EK5A 2WPIS 1HAHH 1W11U 5LPFA 1S6FA 2DYRH 4PGHA 2BY8X 2O3FA 2JRMA 4DYQA 3ABLH 1GBJA 1IQGA 2AS5F 5HNHA 3JRIA 1R49A 1A4WH 4NUBA 2BXTH 1VQ4I 2ZC9H 4H6TA 1TOMH 2FOMB 1O3TA 2AIPA 4L9VA 1NZQH 4EQQA 2VT2A 3ZMTA 2GQQA 1T7CA 1O3DA 3GDUA 2HALA 1LPQA 3CF5F 2PGQB 2CG4A 1RRJA 3JRDA 1IG7A 1GDQA 3HXLA 4NFFA 3OS0A 1BRBE 3S1MJ 4Q63A 3ODFA 1C2FA 1NG7A 3P70B 1JBUH 1OP2A 3AG2H 1LHEH 2Y82A 2KX4A 1TFXA 1GLNA 4HNUA 3QYEA 1ZGVA 3UIRA 1S81A 2XSJC 1HSJA 2V79A 1EJ9A 4IOAF 1YLNA 2HPQH 1SGYE 1BRAA 2VQHA 1XC5A 3TGNA 1TC3C 2E1MB 2EI6A 4XLFA 3B9FH 1G3TA 2CW0F 4X2XA 3RUOA 2CWEA 1XSVA 1LDDA 2DU9A 4CYCB 3FKSD 3GY5A 3A7WA 4ABGA 3GISB 1N8OC 3JRHA 4B2BA 3L00A 4D8NA 2AXTC 2JJ7A 1P03A 1X58A 3ONQA 2C3SA 2G52A 2FI5E 3ZVFA 4OS5A 4HZHA 3ESWB 4M73A 1YJNI 3OR2C 1I27A 2BLQA 1TQPA 3ZQCA 4A0YA 1O2VA 2ZHWH 3NAUA 1O5GH 1COWD 2E2HJ 1IF1A 1B72B 2YNBA 4AOQA 1IRXA 4GUXA 4BAMB 4BHCA 1Z7KA 4NWLA 3H09A 4A7IB 1ACIA 2Z99A 3LOXA 4G7HF 4KKDA 3GXOA 2VQLA 1SAUA 1C2JA 1V5EA 1EAXA 1S8NA 4L18B 4R79A 1MZBA 1IQFA 4ZCNA 3TU7H 4JP0A 1Z1IA 4DGWB 4KT5C 1MTSA 2XIGA 3KP7A 3KCCA 2F5DA 2Q1ZB 2XRCA 2AXLA 2VL8A 1GXQA 1X1PA 2D1HA 3DLAA 1FX7A 3FKJA 1OR7C 2J4IA 4TWWA 1ZQ3P 2DJNA 3IH3A 3LA2A 3DEUA 3TP0A 1MMAA 3HRUA 1HUTH 2A2QH 2EZLA 5GXPA 1OWEA 1I6XA 2IEKA 1CF7B 2W26A 3WTYC 2A5AA 3M3SA 3T27A 2BXUH 2JUGA 1MU8B 3UR6A 1C1RA 2UUZA 4MIMA 1MMNA 3SNBA 3SU1A 3DFJA 2V3HH 4A3LJ 4LMYA 4GCHG 2GCTC 4DIHH 1QURH 1GJBB 2QA9E 3CJTB 1U5TA 2L9RA 3OSFA 4FISA 3L6PA 4BU2A 3WTUC 4IRIA 2QF0A 1WBGB 3M4OJ 3VGCB 3LH1A 5ESTE 1O35A 5F27A 2KLOA 1XCBA 3GY8A 5ICGA 1RR7A 2RAEA 4HTCH 4A1XA 3SJ8A 1MBQA 4LITA 1O3MA 2K9LA 3CUQC 4AYVB 2MABA 1OCOH 2V4JC 1WVRA 3CJQB 4Q4ZF 2BOLA 1V4RA 1DE7H 3F21A 2A3SA 2HWVA 2WPDD 1QZEA 2XC0A 2DA6A 5L3DA 4HF0A 1BMNH 3V0XA 2OD5A 1H8IH 3MZ8A 1TBXA 1PUFA 3QU3A 2P94A 5HDGA 3BQYA 1NROH 2BDCA 1YX5A 1G3DA 3FXOA 1QU3A 2CN0H 3M35A 2XC4A 4JCNA 1ESTA 1WDIA 3ZZ3A 2FYQA 1ID5H 3SV2H 1FI8A 4XFQA 3M7QA 3S1QJ 3LC5A 1AGJA 2XB5A 1H9GA 4RSPA 1WAYB 2HXOA 4A5MA 3LMMA 5ETXA 4Y7BA 4PFOA 2P59A 5HNFA 4FE7A 3U1DA 1JKPC 4BL0B 2HNTE 3K69A 1QVTA 2EI7A 3OYIA 1JIMA 2VJIA 4UNOA 4TWYA 3WWFA 2Z9LA 1IZ1A 2FM2A 3LAPA 4XBBA 3D62A 1OYYA 1U6QA 1SVMA 4MNVA 2VOPA 3M7TA 3DA9B 2CHAB 1LFBA 2P8TA 4HNVA 5EQSA 1ELEE 4MNXA 2JZYA 3I56I 1HAIH 4HRIA 1RUOA 1ZHPA 1ZPBA 3BSQA 2LF8A 3SQHE 1QJ7B 3MQKC 3KP6A 4O3TA 2ANYA 4BJ5C 4DJAA 2HLCA 1WQ2A 2F4OB 1KLTA 3CCLI 4ZKRU 3K6YA 1GBKA 2B63J 3CCMI 3GOVB 2ZFTA 4M3DA 1DPRA 4IMZA 3Q3YA 3S15J 5J3LA 3EPZA 4X0GA 1U3EM 3QU6A 2LF7A 3SEZA 3RYPA 4G12A 4LOYH 2CQKA 2WAEA 4I8KA 1UHBB 5KGOA 5EQRA 3F0PA 1VTNC 4HBLA 3BTME 1BTUA 5DM6F 1C2GA 2AMQA 2E1CA 4U0VA 3RPUD 3QAHA 2WV1A 3B02A 1XMKA 1MU6B 4GVUA 2HWLB 1HDDC 1A7SA 1ZPCA 2E2JJ 2FP7B 1VFCA 1PP7U 3CUQA 1W7XH 1GMCF 3J80K 4IC6A 5JLWA 1ZJDA 1SVLA 1DU0A 4GHQA 4RAZA 3BG3A 4NHJA 3SO3A 1K7AA 5AHGH 2DLLA 3DSPA 1XPXA 1UK2A 2Z3YA 1KMHB 2HVSA 3OYCA 5I46H 1GCDA 3BTGE 1OPCA 2DTRA 3SUFA 3CP8A 4MPWA 5EJ1A 2L5QA 1GT0C 4MNWA 2A5YB 1GBIA 1VQOI 2E34A 2DA7A 5K7ZA 1RZ4A 1YI2I 5H2FC 5JI6A 1B59A 1VQ7I 3ABMH 1FP2A 3HGYA 2K3FA 4G9YA 1AE8H 2GXBA 2Z16A 3CUOA 2ZGCA 2XF5A 3AG1H 2AMPA 3GS9A 1B9NA 2QLZA 2EJRA 2VINA 2WWYA 3W1EA 4ACAA 2K9QA 1EXFA 5E1WA 3LGVA 1O2RA 3ELKA 3PWBA 3SUEA 1ABIH 3DU6A 3KGPA 1FY8E 3WTTC 3RIRA 3KQCA 1IUYA 1Z05A 3A8BA 2AH4X 3UY9A 2BZAA 5D8LB 1CA8B 2ZDKA 2HNTF 2GXAA 3S7KB 4NA7A 1SGDE 4CCNA 1PP8F 4ETSA 3M1CA 2PBIA 1E35B 3ZZBA 1HBTH 2H9EH 2BXYA 4IF4A 4P9UA 2AQFA 1GI2A 3CMAI 1K9OE 3DFLA 3FO8D 1AMHA 3BTEE 1ZTKA 4J1YA 5L3BA 3OY9A 1H8HD 2NU0E 2DK5A 1HAXB 2KRFA 5KVRA 3QTVH 1TWAJ 2WYJA 2PX9A 2HDWA 5CHAC 1EP6A 2GT8A 4JBAA 1P0SH 5EGOB 1BR4A 1AU7A 5C44J 1W2KH 2FTLE 2F3CE 2M2EA 1UTKA 2O6GE 1U0JA 1B8IA 3KE2A 9LPRA 2Y6TA 1TGCA 3UREA 5HGGA 4IHSA 2PKAA 2R3UA 1MUEB 2BYVE 2BVSH 2QQ9A 2H09A 2ZDNA 4BNCA 4RI0A 2E1OA 1GHAF 1TGBA 3GTJJ 1F7ZA 1UMQA 1LDTT 1W12U 1ELFA 3UOUA 1UAAA 4AFUA 1SVPA 2ZHQH 1O4XA 2R7QA 1D8KA 4NSYA 3K4LA 1Z0XA 1BM9A 3M8EA 4F55A 2AYWA 4NWKA 4HA8A 3I55I 2W82A 2R9PA 3G71I 5LEKA 5F04A 2WY7Q 2Z9KA 5C5NA 1GMHF 1FOKA 4X2WA 2IGKA 3UKGA 4ITVA 3CENA 1IN4A 3DP7A 3JRFA 1HAVB 4HLYA 4AIJA 1YPKH 3EQ0H 2L02A 2M0MA 1SD5A 3GCHB 4RGUA 2H8WA 1R9TJ 2E2IJ 5FBEA 3E91A 4A3IJ 1MMSA 3MH5A 3CCEI 2RFKC 6CHAC 4HV6A 1OP8A 3ZVGA 1H0MA 1SQOA 4HG6A 3ZPLA 4U01A 2ZU3A 3E5UA 3PM3A 3AFHA 2GT7A 2J98A 1D3DB 4Y10E 1O34A 1DFPA 4B6FA 2FSWA 2QF4A 5T6GA 1TTYA 1D5YA 2KCYA 4RB2C 1R58A 3SGAE 1O2WA 5HXFA 5EXLA 3BEUA 3Q0VA 4G6QA 2VJ4A 3DPUA 2NU1E 2Q6DA 3A01B 1YITI 2YS9A 4FETA 2DAOA 1V2VT 3JCUC 3RXBA 5DYMA 3I29A 4ABBA 1BTYA 4ZXYH 1AU8A 1C1VH 2WPMS 1WQVH 1FAKH 2VXZA 1DQUA 1HW2A 1ZAOA 1W36C 1T56A 2PMZN 1FN6A 3GZ6A 1EKBB 4X1EA 2FE3A 4XONA 1LB2A 2ZWLH 4HSRA 3MMGA 2XRNA 1P04A 3BG5A 1FNNA 2O61A 4D7MA 2JIZD 3QX5H 5LGOA 4ZXXH 2WV5A 1N1LA 2F83A 1ZR2A 3KX2A 4H6SB 3OYJA 5DD8A 4I76A 1AB9C 4M3BA 3BLYA 3WTVC 1K2I1 1UK4A 2TRTA 3X2QH 4GCVA 2BZ6H 1R22A 1P2JA 4PJ0C 3HOYJ 2VNTA 2EWNA 2IA1A 4P9FA 3Q3KA 4IVNA 2ACJA 3MEXA 1XMXA 5LBQA 4EJWA 3V12A 2XYAA 5EJCA 5LHIA 1RR8C 3D5LA 3FVFB 1MKWH 2ZP0H 1V2ST 3MKLA 4BTTB 2JQ7A 1T8OA 4ZDOA 2FXAA 1ZSKA 2V35A 4GYGA 5F0HA 5T1VA 3BZ6A 3U28C 1LKBA 3U8RH 2V1XA 1TB6H 2ZO3H 3QZQA 2XBWA 9ANTA 1QBOA 1ZMLA 3ZQ7A 3ZMUA 3RXQA 1BI3A 4BJ6C 5L3GA 1QTFA 4JZEH 5JVGF 3ROUA 2ELHA 2P8OB 2XWAA 4BEHB 3K1MA 1DY8A 1HW5A 1DICA 3GYLB 4Q5SF 5FXLA 4Y4RA 5HLTA 5M3FJ 4KIGA 1SD6A 2FODA 1GCTC 3F23A 3BTWE 4AORA 2MG4A 1SSXA 2W3IA 1X3WB 2GBYA 2D45A 5FBIA 4Y17A 2ADUA 1JRTA 4A3EJ 3GICB 4D5CA 4ESTE 2PFEA 1AY6H 3SFIA 2W4SA 1ETYA 1TQMA 5HDNA 1PPCE 4I6ZA 1AKSA 1X2NA 2FX4A 2O9LA 1AFQC 2SNWA 3BG8A 4FOUC 4AB9A 4U30A 4YO9A 3A7VA 1MMDA 3BJOA 3E8LA 1JKOC 3BR2A 2HVXA 3LA7A 2ILNA 8GCHG 3SJMA 3GLXA 4WCGA 4KGAA 1IN8A 2KRCA 3I71A 4NSVA 3OL3A 1V3FA 1UHSA 2DA4A 1ZHFA 2ZGHA 4CH7A 1D9IA 3CNRA 4RAFA 1G59A 4MNYA 2CFXA 1GBTA 3WU0A 3URCA 5A8XA 3TH3H 1F9NA 1FP1D 1V2KT 1FC3A 3HJEA 3DQVC 3A81A 2EZIA 2HGCA 2TBSA 3ENSB 3CO7C 3WU2C 2JDID 2BVLA 5A0AE 4IS5A 3EETA 1DDNA 1NBME 2ESTE 2MC3A 3NWTA 5LGTA 4EM1A 1S5SA 2CFOA 2DT6A 1E1QD 4LIVA 3F68H 1C1TA 1YLFA 3EE7A 1UJ1A 1MBEA 3KF2A 5DEQA 4I7HA 1DXWA 4DGJA 5C2ZA 3MO3A 1PYTC 2LP0A 3AL0B 1UB9A 1HLVA 4O9VA 5EOKA 2O5RA 3K2AA 1IV6A 4XBDA 1EAUA 1N75A 2EFOA 1ZN2A 4PCQA 1UTQA 4II2A 2M0CA 1H89C 4HW0A 4L5IA 4ZDLA 2GXGA 1HJAC 2PTNA 1GJ8B 4AFQA 3V4GA 2LY1A 4XLNF 2Z6BD 3P5JA 4M7GA 1Y3WA 5FKLA 1W14U 1PPHE 2AIQA 1BIOA 1MD7A 1G30B 4BTIB 4A3BJ 4AFZA 1HLTH 1H4WA 3W95A 4M9XA 3FK6A 1N6XA 2GOMA 3V7TA 3WHBA 1GBCA 3MAJA 3IAS2 1DANH 3VYRB 2MD0A 3RXRA 5A8ZA 4B75A 1XXFA 2OINA 4I8GA 4C3HJ 3GFIA 3Q76A 2X6XA 2SGPE 3EUAA 4PSWA 2XOKD 5A2QK 1ESBA 1I1GA 5C5OA 5DCMB 2SGQE 3BTQE 2CV3A 2DT5A 2BD3A 5K5QA 3UR9A 3HBLA 3DHKH 2ZMEC 1S6HA 1HCGA 2DBBA 1YKTA 2DMQA 2JSCA 1HAZB 2OV7A 4NB5A 4A3GJ 4CICA 4ZKSU 1YWUA 5FLXK 1BA5A 3EA8A 1KY9A 1ZMJA 5A09A 1N78A 1NRPH 4BANB 1O39A 4G6DA 2FUG2 3LGUA 4AZ2B 4BDZA 1D3QB 3LSPA 2M9HA 5L6NH 2IBDA 3EA9A 1K0HA 4TPIZ 4HZFA 3GCNA 1EOLA 1C5XB 2ZTYA 1AVWA 3ML6A 2MA3A 3QP6A 3J7AO 3RM2H 4P5OA 2VIDA 4I2OA 2OQUA 2A6HF 2IA2A 1O3LA 3DPLC 3B73A 3UUZA 5FFZA 3DKWA 2KIUA 3SHAH 3MU5A 3WU1B 1XSXA 3SZTA 4N4NB 1ERDA 3SDBA 3VWBA 1B6AA 2K02A 1P9SA 2GVFA 1BBRK 1TE0A 4R0IA 3A02A 4KICA 1IXCA 3C2BA 1MCTA 5CVJA 2ZHDA 1TAWA 4X0WU 3PWCA 2Z3DA 4FU8A 1TGSZ 1WUNH 3U8TH 4BAYA 1A5GH 2BD9A 4UFFH 4WJG2 1UK3A 3PO1C 3KQ5A 3MNBA 5C0UA 3UNGC 4B48A 1X3ZB 1IOEA 2KIMA 4K3JA 1NT1A 2J94A 2OC0A 1DLEA 3RC5A 1RJXB 4A3FJ 4ABDA 3AG3H 3BPXA 1ZG1A 5CVIA 3JRGA 2VPLA 4EJTA 4NQWA 2JA6J 1ELBA 4OIPF 3ZN0A 2BLOA 3MH6A 2F9PA 4CSWA 2R92J 2HGTH 4CREA 3NPSA 3P9KA 1P3EA 3K1PA 1DGRM 5DSFA 1O2GH 1LVMA 2MW8A 2V1DA 3DTIA 1K78A 3FKIJ 2R4GA 1W5CC 1TYNA 4AIKA 2ZU2A 1K79A 2PJRA 3LGYA 3P8GA 5J6XA 1BW6A 4BUPA 2E71A 3F9KA 5HODA 2VE8A 4RAGA 4XR6A 1PQ7A 2PKSC 3HM5A 2ZFRH 1DWEH 2R5YB 2Y30A 3C2GA 1WSSH 3DU5A 1WV7H 3CC7I 1GMDF 1GJ5H 4DOQA 1K6YA 3GX4X 3GFJA 3W6VA 2XV4S 1ABJH 1RFNA 4I33A 3ZZ6A 1FNIA 1QRWA 2VGCC 4E70A 1SFUA 2L4MA 3KYCB 3ZQHA 2VQGA 2JJ2D 2AERH 2FOFA 1SGTA 1O2TA 1ZARA 2VJ1A 3RQ4A 4NG9H 1FMWA 3JSPA 2J95A 4ZYHA 2O7OA 3ECOA 1EJMA 1Y6IA 2V6EA 5EG4A 1OFCX 3EUHC 4XOPA 1TABE 1FXYA 4L0YB 4HQMA 4XRMA 2XC7A 3FMSA 2YU9J 4ZHAA 1SBWA 2KIQA 1A5HA 5LHGA 4BXWA 1ZRFA 3TVJB 3E3TA 4CRFA 4DT4A 3ESTA 1SQAA 2I5UA 2OUMA 2RGVA 1H9TA 3DEWA 4DYRA 2F48A 3BR3A 2I10A 1WRJA 1U6GA 1HGTH 5L3FA 5F64A 1ETWA 1E2XA 3I4NJ 2F9NA 2G8TA 2BVMA 3K9XB 3W6KB 5ILUA 1G2MA 3M37A 1BC7C 3RZDJ 4XKBA 1VGCC 1OX1A 4AYBN 2HYJA 1O2HA 2W6JD 3F8FA 2Y69H 2CK3D 3KYFA 2WAQN 2LKSA 2STTA 1YX3A 1HKTA 1FPCH 4DW6A 3ATWA 4RB1A 3U1IB 3MKZA 1W0YH 3PV4A 3H0GJ 3F9GA 2O8LA 1BTXA 3G3ZA 3IC7A 2Y48A 3H9GA 5CHBA 1TWCJ 2JN6A 2AEIH 3GTLJ 3SUDA 2AMDA 3OIQA 1OPHB 2ZFSA 5GTHC 1HBXG 3BEFB 1ANDA 3DV8A 1SMTA 4FT8A 4HV5A 4N4OB 5D8KB 1RTKA 2BQWB 2HPMA 5FKOA 1RETA 4UONA 8GCHF 1MCVA 4Y7NJ 4Y11E 3MFJA 3PLKA 4V19K 1IUFA 3DTEA 1G3YA 1Y0UA 3LKWA 1ZSJA 5B1BH 2OQGA 2IT0A 5HM9A 4B47A 4BKXA 4EV0A 3HYIA 4MTDA 1IQMA 2ANKH 2ZFFH 5FROA 1UZCA 3G1OA 4AIHA 4UUTA 3M3YJ 2VQCA 3G73A 4A3CJ 2OCVB 3KZYA 5IYTA 2VASA 3PFYA 3I9V2 1UVTH 2Q1JA 6GCHG 1KTSB 5L3EA 2F91A 1EATA 1XS9A 1WI9A 2L7MP 4Q7YA 4FU9A 1MTNC 2CRGA 1I39A 5B66C 2XWBI 2KZ4A 2BTCE 1BT7A 4E7ZA 2C6YA 3UFAA 3KEQA 2JSPA 2L7KA 5CVVA 5E18F 2OTVA 1KLJH 3IHUA 4I8JA 1G3SA 2BDGA 4LXBH 3TK6A 1Z67A 3R0AA 2XBXA 3E90B 4UFGH 1PPBH 3RXAA 2FEQH 5DV5A 1TMUH 1C5MD 3HGNA 1T32A 5GNDA 1P4AA 4B09A 4ZYAA 1VITF 2R7VA 2YX7A 4BAOB 3E16B 4QT8C 5DO4H 4LZ4B 3QODA 4XKCA 3IH2A 4NC7A 4I02A 3KP3A 4XD7D 1TRMA 4OAYA 3LQQA 3K4BA 3MN2A 4XORA 4XLPF 2C8ZB 1ELAA 2WADA 4L9NA 4Y52J 3L7WA 1YBWA 1O2XA 4B2CA 1HJ8A 2KQRA 4WXDA 1FBQA 4Y8YA 1TQIA 2P3UB 4A3KJ 1K1JA 1IW7F 2YR2A 3BTTE 2TIOA 1O37A 1P92A 3BR1A 2B8OH 4A0ZA 3LSRA 2LOOA 2IPQX 3GYHX 2ZFQH 4YOJA 1Z3YA 2HVQA 3P7NA 2QF3A 3HPGA 5CKTA 2YU3A 4PZJA 2IP2A 1W7PD 5GPCA 1Y3VA 2VBZA 4GLYA 1JI8A 5A0CA 5E3OA 1NFUA 1MBJA 5CQEA 5FRNA 4K1TA 1UJ8A 4F52A 2VBWA 5DK1A 2OK5A 4FUDA 1CBWC 2QQBA 2X51A 2MYSA 2A2XH 3H1CA 3K70C 3MZHA 1O5DH 4BACA 1V2NT 1R5GA 1G37A 5GCHG 5BRRE 1BJVA 5FX6A 2A45B 5K1YA 1W0KD 4CHAC 1AZ8A 2IGOA 1TPSA 1AN1E 3HIFA 3OR1C 2LG4A 2DFIA 2VIQA 2HZTA 1ZMNA 1U5TB 1YQAA 4RLFA 1GV5A 2HOSA 4CRGA 3NARA 1P2QA 3Q3SA 1SLWB 3I77A 1EZUC 1PPZA 3K2UA 2XUBA 4XICA 2Y5HA 2G51A 5FJ8J 2Q2EA 4UVAA 3KETA 2ZO4A 1XUKA 5M5XJ 1V5GA 3L2CA 2FBHA 2BHZA 4O5VA 3OY5U 5EU8A 4E7SA 1GV2A 5C1XA 2HOEA 5F6FA 3S2DJ 3WGHA 2ZTXA 4ZMAH 3KZZA 2HVRA 2QGRA 1PUFB 2ESNA 3ERMA 3TNTA 1ETTH 2ZBKA 5C1YA 3O8BA 4Z0KA 3I59B 2CJJA 2OF7A 3FXKA 2VWNA 1P10A 3I3LA 1ANCA 4NIWA 3SORA 2ZSIB 2BHGA 2E19A 4Z1MD 2ODPA 3T28A 2YMSB 4B43A 4CDGA 1Z1DA 2ZCKP 2OP9A 1W7PB 4CGZA 3DUXH 2I6QA 1TNIA 3SFZA 2QKMB 1D8JA 3LAJA 2FX6A 3ZZDA 3BIUH 1XG1A 2XXLA 3F72A 2FOWA 2AQEA 2QSGX 4RS8A 4K8BA 2BVXH 3LU9B 4WY3A 3RXMA 3DFGA 5TJJA 5E0JA 3ZP5A 2F5FA 4BQNA 2FMJA 3GZ5A 1FZZA 1Z3XA 3PNVA 2QAAA 1JRSA 3TK9A 1H8ED 5DP9A 2IJOB 4WXCA 2PV9B 1RGQA 5J1UA 1G3CA 2FO9A 1YCPH 2EV6A 1ZRKA 1C1QA 3BG6A 2QBYA 2V1NA 5E2PA 4BAHB 2GV6A 3UWJH 5LRRA 3RXOA 1UELB 4NIXA 2KCOA 2NNYA 5F1JA 6ESTA 4Y76A 2PHBA 5J4QA 2CYYA 4OM9A 1QHHD 4Y6DA 1OCCH 3H9QA 1T2KA 3A0BC 1M9UA 1C1PA 4JZ1A 3S16J 2BD7A 5J1YA 3ULQB 5BQTA 3T8TA 3QZRA 1K21H 1Z8JB 4I98B 1C5PA 3DBHB 3N97A 1CGJE 2C90B 3IL2A 4KYWA 2JTVA 3P6ZB 2VIPA 2AO9A 1K1OA 2QQ8A 2H6MA 3T8RA 4WWYA 1LHDH 2X85A 2W48A 5EDNA 1FOWA 3S3OA 1TOCB 3S1RJ 5D5UB 2GV7A 2O8WA 4HSTA 1O3FA 1AQ7A 3GVAA 3ZVAA 5E20A 4LB5A 2A5WA 2IGMA 1A6QA 4CCMA 4BQAA 2EQRA 2QSHX 4ZROA 3BG4B 1JJ6C 3HTSB 3I4PA 1WZ2A 1YPGH 1A35A 4YFNF 3D65E 2XKPA 5JB8S 2BW3B 1SQTA 4TSFD 1OS8A 3FMRA 1X19A 2W7UA 1K6OA 1TMTH 3I58A 2VKDA 4QTRA 1NN6A 1EPTB 1G36A 1XUHA 2DUCA 4C2TA 5L2ZH 3CJNA 3ATMA 3F9HA 1ZG3A 3RMOH 3GEZA 1K4TA 3O3KA 3R3GB 1W5TA 1BMMH 4X6AJ 5E2OA 1XGSA 1SGNE 1YP9A 4M6YA 2I6SA 3J7ZI 3RQIA 3KNXA 2DW4A 1NG6A 2XAFA 1IO2A 2LSOA 2QENA 3F8MA 1BDAA 3N7OA 3A4CA 1GI9B 2HLDD 4D9RA 4KJZA 3DD2H 2X1DA 3FZDA 2W7NA 1WKMA 2WUCA 1APLC 4FUFA 5BPIA 1VCQA 2VB6A 2R3YA 4CH2B 2UWOA 2VC0A 2ISYA 3S1NJ 2ZU4A 1D3TB 4ABAA 3U69H 2FQ3A 1UTNA 3OE7D 5L30H 1PJRA 2E1MC 3RXPA 3ZZ4A 3SW2B 4BYYA 5KK1A 4UY8I 1VZ0A 1R00A 4ENNA 3O8GA 3T0YA 4C30A 2ESHA 3BR0A 3L2UA 1P2IA 2H5CA 3SGBE 2W1OA 1I5ZA 4AC0A 3H5CB 1QA7A 3TO6A 4MO7A 2KAIB 2PLXA 1KSNA 2BE5F 2HR3A 3F9EA 3RU4T 1FY3A 2PMZA 3TQNA 1SHHB 1A0LA 2HTJA 1P01A 7GCHF 1O2KA 1O3KA 4XLAA 3O6BB 1TGNA 4LLLA 2PUXB 5DKMA 1SFXA 4DT7B 4GPGA 3V13A 3W94A 1C1UH 2XB0X 1KA8A 4MLOA 1FIWA 5BOXA 1AUTC 1GBBA 2LFBA 2EIMH 3CZ6A 3ELAH 1O2NA 3GF2A 1BA8B 2J92A 2XAUA 4YLQH 2BDAA 5FKMA 2V6CA 2MBFA 4WWCA 1YOVB 2F2EA 1I3QJ 1R1TA 4AVZA 1YPHC 2XF7A 2X48A 1LE8B 2GCHG 1D6WA 1ZGJA 3C3WA 4AUXA 2PKAB 1D1CA 1S85A 4YESB 4A3DJ 5LGNA 2MH9A 2BD2A 2LBFB 5CJ9A 2E36A 4D76A 2HZDA 2BDBA 4OAZA 3KFWX 6GCHF 2CUJA 5B3SH 5L2YH 1ZTRA 3PTNA 1TQ7B 4IBLH 2BDYA 2BY9X 2G55A 3A03A 1IDYA 2RC4A 4LD5A 1UVOA 4J01A 2ZHFH 3GWZA 2RV8A 3SN8A 3VGCC 1FEXA 4ABHA 1E3OC 1UTJA 5EXNA 4IXAA 2EI8A 3RKXA 3SV7A 1L1GA 3DPTA 3GLLA 2HI3A 2DQRA 3A7YA 2O8MA 3M5LA 3JW4A 3UR3C 3SQEE 3ZZ5A 1C4U2 1QA6A 1OCZH 2Q6GA 1A61H 2R5ZA 2GZ7A 1S83A 4LOCA 1NESE 1SGPE 1TX7A 1UCYK 1IN5A 1C0WA 3DKXA 4UVCA 5J4VA 2PGBB 1O3AA 4FX0A 4X8SH 1PUEE 1BOAA 2E60A 4KTUA 2AGIX 3OAAD 2QGUA 1UTOA 4WVPE 1HKQA 4CYCA 1FIZA 1JGGA 2Y5FA 1ETXA 2JA7J 1V6DA 3WGGA 1GVZA 2O03A 1MBKA 2Y9ZA 2FESH 4ZDPA 1DVAH 1OKXA 1O5AB 4Y13A 4ZYEA 3ZMDA 2SNVA 2BY1A 5D6FA 4OU0A 3D0SA 5H6QA 3CCYA 1YF4A 1B72A 1LPZB 4JX4A 1O7FA 5BNGA 2ZJPF 1PFXC 4TY7A 2WV0A 2HRVA 1BI2A 1O5BB 3R61A 2CHAC 3RXUA 1FMGA 5GCHF 5K5RA 2ID6A 1UTMA 1DPOA 1ZHMA 3PLPA 3IITA