2IPQX

Crystal structure of c-terminal domain of salmonella enterica protein sty4665, pfam duf1528
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
121
Chain Sequence
b'LSSTELGDLFWSWLRDGLREGDIPVNTADACVHLTCGFVFISVPGVFFLFLKSHGRKEQVQAAFEKMRKHRVSDSRRFWQCCLYEEPGGRGRYKKLTGYLIKMSEIYNGNFPDDSLFLKVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein STY4665
publication title Structure of C-terminal domain of Hypothetical protein STY4665
rcsb
source organism Salmonella typhi
molecule tags Structural genomics, unknown function
total genus 29
structure length 121
sequence length 133
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ipqX01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 2ipqX02
1BIAA 2QM3A 3CTAA 2CFXA 3MZHA 4RB1A 2DPUA 1WI9A 1DP7P 3I71A 5AIPA 3P9IA 5LHGA 3WTWC 4HF1A 3WE3A 1SD6A 2L02A 5ERIA 4G7HF 1R22A 3SZTA 4M72A 5FB2A 2DBBA 4M73A 2STWA 2IP2A 4KIFA 2ZCWA 5F1RA 1ODDA 4BHBA 4G94A 4FX0A 5ICCA 1IAWA 4U88A 5H20A 3VOEA 2WC2A 2V6CA 2FNAA 1ON1A 3I58A 1SFXA 1AWCA 3F8MA 3IL2A 2FU4A 3AAFA 3CJNA 2EJRA 3RYPA 2TDXA 1Y0UA 4ZZDA 1D8JA 4HZFA 2GA1A 5LRSA 2Z5UA 1QNTA 1RZ4A 1WKMA 4L9NA 3I5UA 3DQVC 3QOPA 4YIFA 5ILVA 3I59B 4IRGA 3N4MA 3U2RA 4ENMA 1H9GA 3V8KA 5K5RA 3WU1B 2F5DA 3BROA 1L3LA 4QWQA 2DQRA 1J7KA 2X4HA 1ON2A 4N9HA 3RYRA 4CDGA 3IRRA 5D6EA 1MGTA 2FXAA 3WODF 2G9WA 2JSCA 3EYIA 2PFBA 1T39A 1HXDA 1FP2A 2FNPA 3N97A 3F8FA 5E1WA 2R7DA 1P4WA 3J80K 1QQIA 2UWMA 1J59A 1MZBA 1R5HA 2RVCA 3GZ6A 3ZMUA 2VONA 1J9IA 4OMYA 3F8CA 5ICFA 1ZYRF 1CGPA 4LFUA 5BMZA 1QPMA 1XMKA 1SD7A 2ISYA 2FQ3A 1LB2A 4IVNA 3IHUA 1JE8A 4HF2A 2P5KA 4WCGA 3Q9SA 1FBUA 5FD6A 1S8NA 1ONVA 4LMYA 1SMYF 3FXQA 1JHFA 1SMTA 3KP2A 1XB4A 1CF7A 2EFNA 2HOEA 1RI7A 2RGVA 4PDKA 3HUGA 1FBQA 2P6SA 2P7CB 1O57A 3FMSA 4P5OA 4AWXB 4Q4ZF 5HDNA 4I01A 1PDNC 1U2WA 2V79A 3B73A 1S3JA 4L0YB 3LAPA 1P92A 5D8LB 2O0YA 4HX4A 4ZZLA 2WWYA 2KRFA 2YSRA 1U5TA 4P96A 4KT5C 4XLNF 4ENJA 1IXRC 4LG0A 1BI1A 5HVQC 5H6RA 3REOA 3HSFA 4HQMA 4DQ2A 2XV4S 2PMHA 3SZPA 4HV6A 3IRQA 3JTGA 5K5QA 3WGHA 1HW2A 1F1ZA 2CYYA 4D0PA 4HLXA 5D5UB 3EQLF 2ZKZA 4LJZF 3ECOA 2QBYA 1D8KA 4HDUA 2OZ6A 3ELKA 3CUQA 3KP6A 1GHCA 3E97A 3ZMSA 1OYIA 3FF5A 1YQAA 3KP4A 2AS5F 4LLGF 1D3YA 1FC3A 3LQQA 2DW4A 5J6XA 2YU3A 2BYVE 2BGCA 3K1PA 2QQBA 3GF2A 4IHSA 3HRSA 1ZH5A 3HRMA 1O3QA 2G7HA 2VOPA 4HAMA 3F21A 4CZZA 5AIQA 2MLGA 2XHKA 1XSVA 3M7GA 1FYLA 4EM2A 1G4DA 3WE2A 4IRIA 5ED4A 2XKOA 1IRGA 2V1DA 2M45A 2CG4A 3T1BA 3GLXA 1UHWA 5TRDA 1BIBA 2OBPA 1YLFA 3DV8A 3GUDA 4WXDA 2VN2A 1TNSA 4UXNA 1EH7A 1R23A 1JGSA 2E1CA 1XCBA 1Z6RA 5CVJA 2XVCA 3RTRA 3T8RA 1USSA 3GZ5A 4AVPA 1HKQA 4KMFA 4Q5SF 3RJPA 3O6BB 1W4MA 5BPDA 5LEKA 4A6EA 3GEZA 1I1SA 2OZUA 3TO7A 5HOOA 3TO9A 4PGGA 5ILSA 1V4RA 4DNCA 1T2KA 1BC7C 1MDMA 3MFKA 3ERED 1D5VA 1K78A 2XRNA 1FWZA 1MKMA 5E8IA 4ENKA 3Q9VA 1KA8A 4Q47A 4RGUA 4GCVA 2HYGD 4BHCA 1R1VA 4A0YA 1KYWA 3QRFF 4XLPF 4OINF 4I7HA 3KETA 1R00A 2Z3YA 2MC3A 4M6YA 2PEXA 4IRHA 1STZA 3LWFA 1BN5A 2Q2EA 3V8LA 1XSXA 4U7DA 1EH8A 2PI0A 2PJPA 3V7CA 4EJVA 2K4BA 4GXOA 1W5SA 3OOPA 2LF7A 5CVVA 4UV8A 4ESBA 1YIOA 4NQWA 2EV6A 4G7OF 3VFZA 4ON0A 3K1NA 1IN4A 4EJWA 5HLHA 4KFCA 3ISPA 3E6BA 3KEQA 4HDVA 1QGPA 3GW2A 1KQ8A 1VTNC 1Z05A 2VBXA 3Q5FA 3FMQA 1QBJA 4YG2F 2KKOA 3GFJA 2DQLA 2CO5A 4PCQA 4RGXA 2HYFA 5HDKA 3DP7A 4S05A 4P55A 5DV5A 3WGIA 4U0WA 1P4XA 4I02A 3VEPA 3IWZA 1TQIA 4RB3C 5DD4A 5LGTA 5IT9Z 3DF8A 4RS8A 1H0MA 1FOKA 2VE9A 3I0TA 3IKVA 1B6AA 2IJLA 3D0SA 2RN7A 3W6JB 4P9FA 1BC8C 3VB2A 2PMUA 4Z2YA 3WTZA 3IKTA 1IN5A 1T6SA 2FBHA 3HTUA 4JQFA 4M71A 4MEYF 2FMYA 2ZNYA 4RGRA 1G3TA 2GIVA 5ICEA 2DO7A 1A04A 4U0VA 4UVAA 2Y0MA 4R1HA 2EFOA 1R5GA 4L9TA 4WK8F 3JW4A 2M8EA 4CYDA 5CVUA 1YYVA 1TQPA 2QQ9A 4KUMA 4N9IA 2XAJA 5FLXZ 1HW5A 4MEXF 4EGZA 4KNYA 2BE5F 2YR2A 2EB7A 1O7LA 3NRVA 3LA2A 2MA3A 1WSUA 3GYHX 2GA2A 4FT8A 4OIOF 4L0ZB 5DUIA 2Q8KA 2QVOA 2LNBA 3BP8A 1U3EM 5KVRA 5D5XB 3RKXA 1K79A 1F4KA 2HZTA 1W5TA 5LRRA 2E1NA 1YW9A 3E6MA 2FF4A 1S7AA 3O3KA 4A12A 1K7AA 4XRFA 2H94A 4I2OA 1B4AA 3J81Z 1UCRA 2E7WA 2KIMA 5A2QZ 3KZYA 4UHTA 2XGXA 3GFIA 2JPBA 1MJAA 2VE8A 2FMLA 5HLGA 2D1VA 2K4JA 1PP8F 5HLIA 2A6HF 2KJBA 5K5OA 2NS0A 4EVIA 3WG9A 3MEXA 4P9UA 2DPDA 1CF7B 3O2PE 2E7XA 5BOXA 3P7NA 2EA4A 1O3TA 2HEOA 2XAFA 3NEUA 2M87A 2ZO4A 3K0LA 1G3WA 2CSOA 2XIGA 2A69F 3ZMTA 3NQOA 1U8RA 1YW8A 4M74A 3LFKA 3HOSA 3HIFA 1U5TB 3JSOA 3HSEA 1KQ9A 1LDKB 4L18B 2FBKA 4LG0B 5LEJA 4KDPA 3BJ6A 1DPUA 1K6OA 2J5OA 3L00A 5DD8A 3F8BA 3I54A 2BBYA 2IRFG 2PLYA 2O3FA 1ZGJA 1XSDA 2F5FA 2FBIA 2IW5A 4FX4A 4Q48A 4BXUA 1IF1A 2DK8A 4LD5A 3H3UA 3R60A 1ZG1A 3F22A 2XUBA 3E5XA 1LJ9A 2QBYB 3KP7A 5TJJA 3RPUA 1I1GA 3COAC 4R8HA 3BZ6A 3R0AA 4KICA 2ACJA 3CUQB 4L9JA 2VT2A 2LDUA 2IVMA 5FFZA 3I64A 2DT5A 5E1XA 3BOQA 3FM5A 5DDGA 3U9GA 2L3DA 1XD7A 2HTJA 4UV9A 1G3SA 2RV8A 3GFLA 4N0BA 5FLXK 4KYWA 2L4AA 5FGMA 4GYGA 1ZRDA 4KN4X 1Z91A 4CICA 2W84A 2NNYA 4M6XA 3RPQA 3R61A 4ESJA 2K27A 2PN6A 3JAMZ 1BM9A 5J8FA 1I27A 3ZPLA 4ZH4F 4KA4A 3ABTA 4HOBA 4KMUX 2ESNA 4OU0A 2JZYA 2OAZA 1ZRCA 5LHIA 2M1BA 4F7ZA 5K1YA 3ML6A 4HV5A 3WGGA 5BPIA 1XGNA 1XDSA 2QUFA 3BPVA 5ICGA 3J81K 2GAUA 4BH9A 4EV0A 3WTSC 1SFEA 2HFHA 2H09A 5A2QK 2H6BA 3PQJA 2EFWA 1QO0D 3IWFA 2ESHA 3QP6A 2HS5A 2W25A 1MJBA 3TOAA 1T38A 2W85A 1P6RA 3U1DA 1BI2A 2KIUA 2Z33A 2P6TA 3DPLC 4WX9A 3VODA 1LEBA 1PP7U 1MDMB 4WWCA 4WXHA 3TOBA 2JRTA 1K78B 2NRAC 5CJ9A 1HSTA 4PGHA 4LLLA 2ZNZA 3FMRA 4G6DA 3MAJA 3TDZC 4LLNA 5F64A 2EV0A 2DLLA 1LNWA 5JR3A 3TQNA 5E20A 2Q0OA 2EK5A 1KU9A 4Y15A 2D45A 1FSHA 5HS7A 2GWRA 3QU6A 5FD5A 3QPHA 3CUOA 1ZARA 3K69A 1S7OA 4IJAA 3I53A 3EUHA 1FPQA 1I5ZA 4MHGA 1E2XA 4Y17A 5DCMA 3RKWA 2NAZA 2V1UA 1ZN2A 1FYKA 1IN7A 3ZQ7A 4M9SA 4WF2A 1YTYA 4O6JA 2IA2A 2UZKA 4HA8A 5DUKA 5D5WB 4G9YA 1J2XA 3CLOA 2MH2A 3H92A 5L3FA 1OYYA 4NHJA 4QLCU 2L4MA 2VC1A 4LB6B 1TW2A 4ETSA 3OV8A 3C1DA 1HW1A 2OU2A 1OR7A 2R7FA 1FNNA 5E18F 5E17F 4G7ZF 1H9TA 3RKYA 2XROA 1R58A 1OMIA 2W57A 4RAYA 3CO6C 2PG4A 3E6DA 3K2ZA 4K2EA 3QPTA 3C7JA 2DFIA 4I98B 5DEQA 2O8XA 5L3DA 5F6FA 2ZBKA 1UB9A 5CVRA 2QWWA 2K7LA 1B59A 2PQ8A 1Z6TA 4B8XA 3FXRA 1O3RA 3P9CA 2FEZA 4EQQA 3H3ZA 4ZYHA 4YFXF 3HHGA 4UVCA 5HDGA 4AD9A 1WWXA 2Z99A 3WTTC 2HDCA 4HQEA 1B9NA 1LEAA 1XGMA 3JTHA 4O5VA 4LGWA 4YIIA 3TO6A 2ZXJA 2F2EA 1BI3A 1KYZA 1HQCA 1XN7A 1RIOH 2P7VB 4I0BA 2RKHA 3ZMZA 4EM0B 1DDNA 2EV5A 3RI4A 3D5LA 4U0YA 1ULYA 4MGRA 1S29A 4Y13A 3KZZA 2XAHA 1LQ1A 1PUEE 3FZVA 4AIHA 1O3SA 4M9ZA 5EEHA 2QYOA 4ESFA 5KK1A 3K1MA 1L0OC 5DCFA 4A0XA 3KCCA 2GQQA 4L9VA 1ZLKA 3HSRA 3F6OA 1J0RA 1YFHA 3GWZA 2CWEA 4RAZA 4MQ9F 1FZPB 2FRHA 2IPQX 4BYYA 4ZYDA 1FP1D 1KU7A 1TNTA 3R4KA 2WTEA 4CO8A 5E1ZB 1IW7F 2CQKA 5BS6A 2STTA 4ENNA 4EGYA 3HYIA 1F5TA 1U78A 4A0ZA 4KIBA 3ROUA 2HKXA 3QAHA 2F5CA 3JSPA 3LAJA 3GVAA 3LQRA 3EETA 1J75A 1TLHB 3FM3A 1KU3A 2MD5A 1V3FA 1FYMA 2V1XA 3MQ0A 2A6EF 4H0EA 2CW0F 3F3XA 1HKTA 1SD5A 3RDIA 1W7PA 4LK1F 1JXSA 5D8KB 2HGCA 4GGGA 3HTSB 3QP5A 3BJAA 2AXLA 2DK5A 3C3WA 1QZYA 2D2WA 1AOYA 5J8CA 2RNJA 3V4GA 2BEOA 2QLZA 4ZYGA 1BBYA 1RNLA 4EM1A 1BI0A 1IN6A 5LBQA 1BJAA 5JVTA 1XMAA 3KLOA 4AIKA 3WU0A 3MZYA 3ZN1A 3E5UA 4MTEA 3RIRA 2RQPA 2ZMEA 1T0FA 3KFWX 5L3CA 3ZMDA 3ECHA 4TV7A 1LDJA 1P4AA 1IRFA 4BQAA 5H6QA 3ZMVA 3CO7C 3S2WA 2HWVA 4YFNF 6PAXA 2KJCA 2ZJ2A 3R6SA 1YS7A 5FFXA 2VT3A 3HRUA 2HKOA 3KP3A 4CGZA 1OPCA 4EJUA 5D4RA 3GFMA 3DFGA 4OIQF 1SAXA 2EWNA 2VC0A 1MD0A 3TDUC 4RB0A 4EJTA 2VODA 3WTVC 5JFRA 3L2CA 1DPRA 5LGNA 1WQ2A 2A3SA 5IT9K 2RDPA 4EJOA 1O7FA 3V8JA 4CHUA 2FE3A 5ILUA 2MH9A 5E8GA 2JT1A 4R79A 2HTSA 3FWEA 4OMZA 4M9XA 2A68F 3ULQB 2X0LA 2LSOA 3DEUA 1IN8A 3GO5A 5IT3A 3WTYC 1HSJA 1R7JA 2FSWA 2GZWA 2O03A 3DXJF 4HX8A 1Z7UA 5FO5A 2A07F 2P8TA 4RGSA 4OOIA 3V7RA 2A61A 1FX7A 1KGSA 1REPC 1WRJA 1DUXC 1GVJA 4GO1A 5LGUA 1JHHA 1SD4A 4HX7A 3KQ5A 3LA3A 5BQTA 1OYWA 3M1EA 1TTYA 4A2UA 1LDDA 2DU9A 2Y75A 2MLKA 3CDHA 5CLSA 3DKWA 3G73A 3I59A 3QU3A 2QENA 3LA7A 2V9VA 2XKPA 1I6XA 1NHAA 2J5PA 3TKYA 4HYEA 3KP5A 4XSXF 2M30A 4BHPA 4O3MA 4HF0A 3T5XA 2L01A 2L54A 4FHTA 2VBYA 3MWMA 4U7BA 3ZP5A 5DCMB 4G6QA 2VBWA 2NYXA 1KQ0A 2FOKA 1HBXG 4PZJA 1ZG5A 3M8EA 1F9NA 4BNCA 1U6GA 3F6VA 2DI3A 5HS9A 1GXPA 4L5IA 1R36A 2GXGA 2XAQA 1IXCA 1ZHFA 2QZ8A 2O6GE 2EFQA 4HW0A 5L3BA 3R0JA 1Z9CA 3BJOA 1E17A 3SHFA 2F5EA 4JK1X 3TGNA 3BPXA 2DTRA 2G7UA 1USTA 1SFUA 4HLYA 1ZG3A 4LK0F 2GXBA 1J5YA 1MJ9A 3F8NA 2IA0A 2IA1A 2FA5A 2VOOA 4MTDA 3P9KA 1BOAA 2HQRA 4XBFA 4ASNA 3J7AO 1FSEA 3BDDA 3WTUC 4UNOA 1IZ1A 1XGOA 4ZYEA 4UVBA 3C18A 2UXXA 3B02A 2K02A 2ELHA 1YS6A 1FLIA 3SXYA 1UFMA 2QQAA 2CGPA 3IC7A 2EFPA 4A6DA 1IUYA 5D6FA 4BAYA 4LB5A 1XDUA 3PQKA 1R1UA 1X3UA 3FHZA 1KU2A 5D5VB 3M8FA 1UHMA 3WTXC 1U5TC 2H27A 2K86A 1FY7A 1ZRFA 1Z1DA 1G3YA 3L09A 4JBAA 2WV0A 2YX4A 4I0AA 3HOTA 2EA2A 3DPTA 4IPAA 1XCVA 2R3SA 3HRTA 1W7PD 2Y48A 1QZZA 2JTVA 2UXNA 1B9MA 4MNUA 2W24A 3M9AA 1GXQA 3ABUA 2D1HA 3EYYA 2HR3A 3LSTA 4S04A 1S6LA 2IT0A 3CUQC 5JHUA 2VBZA 2COMA 2M5WA 3KE2A 3BY6A 4YFKF 4WXCA 1ZLJA 4KIGA 1YW7A 1EH6A 4HBLA 3SQNA 3ZN0A 4NB5A 3EDPA 3JAMK 3G3ZA 3KEOA 1P2FA 2YX7A 5EEGA 1B1BA 3MCZA 2VXZA 1YG2A 3BWGA 4UUVA 2LF8A 4A5MA 3T0YA 5L3EA 4OIRF 3K9TA 1ZGAA 1YO5C 3E3VA 3SFZA 2DAOA 3W6KB 1TW3A 2PBIA 2ETHA 5HS8A 4G8XA 2P4WA 4AIJA 1RUOA 4OIPF 2OD5A 1C0WA 1ZREA 3E5QA 5D4SA 2OQRA 2YPRA 5LHHA 4IHTA 5CYVA 2Z9OA 2C6YA 4E70A 1T98A 3GXOA 3L7WA 1R1TA 4KN7X 1HKSA 2RC4A 2A5YB 2P5LC 4XSZF 2MBFA 2P5VA 3FXUA 1IXSB 3GX4X 1ZAOA 1FBSA 1W7PB 4B09A 2NNNA 1FT9A 3V7SA 2ZFWA 1EV7A 3PFIA 3T8TA 2B0LA 2O61A 4CXFA 4IF4A 1Q1HA 1LVAA 5LLQA 2OQGA 3FX3A 5JI6A 2ADUA 4IXAA 5L3GA 5DYMA 2LKPA 5CVIA 2OA4A 3F72A 1G6NA 2ISZA 3L9FA 1OKRA 2XASA 4EMSA 1TQMA 2KIFA 4MQVA 2ZMEB 3F23A 3J80Z 2HQNA 1XGSA 4RB2C 2H6CA 4A5NA 4GYIA 2BV6A 2XAGA 3I4PA 1RUNA 1TBXA 3KLNA 2JPCA 3HHHA 4L5JA 3E6CC 5AONA 4I09A
chains in the Genus database with same CATH superfamily
3S1NJ 1DPOA 3JRBA 1SHHB 3MZHA 1DP7P 1C5VA 3P9IA 1KTTB 3BEFB 1EQ9A 4MNYA 4X6PA 3GLLA 2DOAA 4NA7A 4UFFH 4XQFA 4MPWA 4P1WA 2STWA 4BKXA 3LOXA 5C5NA 1Y1VJ 4A6LA 3GY7A 1C2LA 3MFJA 1LVMA 1ODDA 4FX0A 5ICCA 1IAWA 3PROA 4U88A 3GDUA 2O8MA 2ZDKA 1O36A 1F0RA 1ON1A 2ZA5A 3RXGA 2F3CE 3KGPA 3EAJA 4XL9A 1C1WH 1F92A 2VIOA 2EJRA 1MNDA 2TDXA 3RXQA 1RETA 2F4OB 3S9BA 4ZZDA 4DYRA 2Q1ZB 5LRSA 4ASUD 1QNTA 4ZKOU 3I5UA 3SV8A 1VQ4I 1J9CH 2ZTZA 3MNXA 3TPIZ 3DU6A 3GCTF 1DY8A 4ENMA 1H9GA 4BTIB 1F2SE 3ZZ6A 2OK5A 2G8TA 1HIAA 1W12U 1VKYA 2KM0A 2K85A 4CH8B 1AA7A 3LJOA 2HDWA 4BQOA 3OL3A 3BV9B 4CH2B 1MTVA 5C3NA 2W7SA 3RXTA 4NZQA 3F0PA 2DQRA 3I29A 1WXRA 2JN6A 8GCHG 4U32A 3H9QA 2EZLA 2UUZA 2WPJS 3SNEA 3O8GA 3K70D 2JJ7A 1V2PT 2HGTH 1T39A 2H9EH 3BG9A 2X1DA 5HIYA 2PR3A 2R7DA 2FLBH 3LSMA 4HNTA 1UMQA 1J59A 2VGCB 2ZC2A 3VB6A 3CCEI 3ZQHA 1SQOA 2FDAA 3ZMUA 4OMYA 2O8UA 3MYWA 2L6OA 3DSOA 3QZRA 2OCEA 1CGPA 4GLYA 4LFUA 3A7ZA 3TJOA 5BMZA 3TEDA 1THRH 1QPMA 3ODDA 2BY2A 1G9IE 4C3IJ 2K3PA 1ESTA 1WTHD 4FVBA 1UJ8A 3IHUA 1TFXA 2A4OA 2JUCA 4XLHA 1X1BA 1XMNB 1FBUA 1OWKA 1L4ZA 3ZYEA 2GBYA 1SMYF 4MTBA 1C2JA 1MTNC 1CF7A 1EPTC 2EFNA 2HOEA 1QIXB 2OINA 3KF2A 3FMSA 1E1RD 1S9HA 4I01A 5IP6A 2F4IA 3OYEA 1U2WA 3CP7A 1JIRA 4XN3A 2JH6D 5G4BA 3T62A 1MBHA 4RT0A 2IJD1 4HX4A 4TWWA 3ZV9A 2ANKH 4C2TA 2OC8A 2NVXJ 5HXFA 2JJ2D 5T6FA 3RXVA 4VGCC 2PMHA 3SZPA 4H6TA 5A8YA 1GJAB 1H9IE 2DA2A 2IEKA 3F9KA 1ORFA 4BJ6C 3CCMI 1ETXA 3EQLF 3ONQA 1MBMA 1LVOA 2QBYA 1OWEA 2DMNA 1G32B 3FP8E 3CUQA 3FDYA 3BG7A 3U9AH 3E97A 3ZMSA 3PO2J 1VQ9I 3KP4A 2RNGA 3OYKA 3UOUA 4WH8A 5J6XA 1HXFH 2YU3A 1Z8IB 3K1PA 4IHSA 2W7UA 4UY8I 2HI3A 1SQRA 1UHBA 1ZH5A 3HZJA 1GBBA 1GHZA 2OC7A 2VOPA 4HAMA 3DHKH 4CZZA 3JRAA 1HV7A 1O5DH 1QQ4A 3EUAA 2WPIS 1XSVA 3M7GA 4IRIA 1G4DA 3J7YJ 3K9XB 1TMTH 2CG4A 1EZQA 1SKYE 1GDQA 1SAUA 1AUJA 3RKQA 3ZQGA 3RXPA 4PJJA 1W11U 5CVJA 2VH0A 1YRNA 1USSA 2MC4A 1HKQA 3J7ZI 1IDZA 3RJPA 4K8YA 1W4MA 1ZPZA 3I4MJ 5LEKA 1DGRM 1GHWH 4A6EA 2ME6A 4PSWA 1EAUA 2ZFTA 2OZUA 3SJOA 4PGGA 1HYLA 1HOMA 1AZZA 1TA6A 2VQCA 1EKEA 1VFCA 1NESE 1U6QA 1IOEA 2R7WA 3MFKA 1LKXA 1MDMA 3HG9A 2WV1A 1D5VA 2R0QC 1K78A 5E8IA 4TWYA 4GCVA 1MCTA 2ZECA 1R1VA 1K1JA 3BIVH 3VDXA 2Z16A 1TMBH 4DGWB 1YHQI 2PFEA 1P01A 4XLPF 1O2RA 1UTOA 2FOFA 1VQ7I 1YJWI 3LGVA 1O2LA 5GIBA 5GAEJ 6CHAC 1MMNA 3OYBA 5C94A 2ZGXH 3FFGA 2PEXA 3FXMA 1STZA 3LWFA 2F9UA 2OBQA 3B8JA 1BOBA 1K1NA 1EH8A 4KP0A 1C5TA 3BR3A 2A7HA 4G12A 1WV7H 1G2MA 1QQUA 4Z0KA 5CVVA 4UV8A 2HRVA 1SLWB 3K70C 4NQWA 2EV6A 2Q1JA 4KITB 2E2JJ 1Y3VA 1OR7C 4DBRA 1QFKH 3E6BA 3OMYA 1YP9A 4HDVA 1QGPA 2BY9X 7KMEH 1TPSA 3VPKA 1HAZB 3FBIB 1KQ8A 2HQAA 2Z3CA 3ZZ5A 3GFJA 3GDSA 2CO5A 3BR2A 1DUAA 3UPEA 1ELGA 1M1EB 5HDKA 3DP7A 5DV5A 5HODA 3D62A 4X1SU 5HM2A 1Z3XA 3LSHA 4JK6A 1LHDH 1BTYA 3CJQB 1D3PB 5M5YJ 4RB3C 4MVNA 5IT9Z 3DF8A 1N78A 4C3HJ 2VE9A 1K9OE 3D0SA 4P9FA 1BC8C 2PMUA 3WTZA 4W97A 3MU1A 2PMZN 4FUGA 1GBIA 4MEYF 2HNTE 2ZNYA 1G3TA 1SI5H 2QC2A 1EP5A 4U0VA 4UVAA 3H1CA 1D6WA 1D1AA 3U8TH 3EPZA 5B1BH 5FAHA 1BDAA 1XPXA 2ZSIB 1TQPA 2QQ9A 4KUMA 2XAJA 5FLXZ 2PGQB 1HW5A 4EGZA 2Y0SN 1GL0E 5J1YA 2J9NA 2AXTC 1GJ8B 1O7LA 3EE7A 4XORA 3LA2A 1VQ5I 2R5ZA 3T5FH 4OIOF 4L0ZB 5FKMA 1AO5A 2LNBA 5GP9A 3W94A 2Y80A 1BL0A 3JZ2B 2JK3A 1ETOA 2AS9A 4I7YH 1HAPH 2E1NA 5PTPA 1KTSB 2LH9A 4I32A 1OJLA 3J81Z 2CUFA 1O38A 2FPZA 2KIMA 2XBYA 3KZYA 5C44J 3PMAB 2ZXIA 3GFIA 1MJAA 2VE8A 3OYJA 5FKLA 3QN7A 4DCDA 2EZHA 3MN2A 3OYCA 2D2DA 2K4JA 1PP8F 2BY5X 2KJBA 5K5OA 1UG0A 3MEXA 1UK4A 3K2UA 5BOXA 2JSPA 1MBGA 5AVDA 3HUGB 1UVUH 5EGMA 1AVGH 2M87A 1A1RA 1CSOE 5FLVA 4GCHF 1TWGJ 4RLFA 1KXFA 3SBKA 5EODA 2OTVA 4CRDA 3ATMA 4GAWA 4FOUC 2TBSA 5KCMA 2L7KA 3ODFA 3JSOA 1O5EH 4NZLA 1KQ9A 1GJBB 2FBKA 3PRBA 4Y79A 3VB7A 1ZMLA 3F8BA 2BY3A 2QGRA 1GDUA 3GTMJ 3HK6B 1OLTA 4IX7A 4Q48A 4X2YA 1GHYH 2R93J 1IF1A 4JMYA 3H3UA 2FX0A 3M3YJ 1GVKB 1X19A 5EQSA 1O3JA 1EAXA 4BBRJ 3NWUA 5TJJA 2ZMEC 3CJRB 3N7OA 3GCNA 4XM3A 1VQKI 3S2DJ 2LDUA 2IVMA 4XOPA 3VFEA 5GTIC 3I64A 4FU8A 1FMWA 3U9GA 4NSYA 1XD7A 4ZTFA 4UV9A 1FIPA 1LHFH 5HIZA 1SLXB 2EA3A 3M3VA 2C90B 2TCTA 2ANYA 4DIHH 4ZKRU 1YPMH 2V7FA 1HB0B 4KN4X 3TNSA 3K65B 2ELKA 3GBGA 2OXSA 3RPQA 5DK1A 1VGCB 2GZ9A 2K27A 1ETSH 2QF4A 1BM9A 1D1BA 3HDDA 3B23B 3TJNA 3ZPLA 4KA4A 2Z7FE 3JRHA 3CMAI 2TGTA 2JZYA 1TOMH 3BG6A 1AB9B 5JB9S 2ESTE 1O4XA 1DLEA 3BLYA 4HV5A 4RKJB 3ABLH 1G8XA 1XDSA 1CA0B 5GDSH 4BH9A 4ISHH 3WTSC 1GV2A 5A2QK 3BR5A 1WU1A 2LP6A 3BCAA 3TOAA 1T38A 1JUPA 2W48A 3H5RA 1S5SA 4K1TA 1A35A 2F6CA 3S8PA 2Z33A 1FOYA 2BHZA 3DPLC 4WX9A 1S0RA 3TGKE 1LHGH 1O5CB 1BQYA 2IS4A 2DFHA 2HWLB 4ABGA 1EAWA 2KAIB 7ESTE 2GOXB 1TPPA 4QT8C 4RI0A 3VB3A 4M3EA 3M5OA 3MHWU 1W0YH 3K4NA 3LDXH 2ZNZA 3B9FH 3MAJA 2CQNA 1Q2WA 2XYAA 1ZELA 1GGDC 1LNWA 4QSHA 5E20A 1KU9A 2UUKB 1FSHA 2EIJH 4FUJA 2SGEE 1C2EA 1E3OC 3QPHA 1O3NA 1ZARA 3K69A 2BY6X 1APLC 1O2HA 1MMGA 1S7OA 2KRHA 5DP3A 1FPQA 4JYKA 2ZZUH 4MHGA 4AB8A 3GTKJ 1E2XA 3NARA 1EA3A 5DCMA 3A84A 5E2PA 3MH7A 4LITA 2V1UA 1MD8A 4CRFA 2DA6A 1R9TJ 4WF2A 4FUEA 5GCHF 1F5LA 2QGUA 3BSQA 4J00A 5EXLA 2VINA 2UZKA 1Z8JB 4XE4A 2QCOA 1B0FA 4LOYH 1A5JA 3I78A 4E7JA 1DLKB 1GJ7B 3OV8A 2XGEA 1HW1A 4WF8A 2R7FA 5LPFA 3DCFA 5E17F 2AYWA 4G7ZF 1H9TA 2VB0A 4SGAE 4X2WA 4NSVA 3RSNA 2O7OA 2YOLA 1NTCA 1ZGWA 4RAYA 3DBRB 1ZHPA 4ZC3A 2PG4A 3LSRA 3C7JA 2OCCH 2C3SA 3I56I 4CUGA 2O8XA 5JVGF 2V6NA 4GRIA 2ZBKA 5CVRA 1TNIA 8LPRA 2XF6A 9LPRA 3ZOBA 4XLCA 4LZ4B 1O3KA 3D5RC 4YXWD 1QJ6B 4B8XA 3JR9A 1ANDA 3FXRA 3K4MA 3MNBA 2FEZA 1FQ3A 4BACA 2W4SA 2E1OA 1JIMA 1ETWA 5F0CA 3A86A 5AF9H 4DW6A 3MVPA 3WTTC 1MBEA 4B2CA 4O5VA 1PQ5A 2X6XA 4LGWA 4CCMA 4YIIA 2ZXJA 1Y59T 1HAVB 1RIWB 1XKBC 2JWTA 2K9MA 1O34A 2D1JA 2ODPA 3FVFB 3ZVDA 3DT0H 3SZEA 3ITIA 2J4IA 3SU0A 5C17A 2OQ5A 1J8AA 1QRWA 2BVSH 1DDNA 2EV5A 1TMUH 3RPUD 1NBME 4MGRA 4YO9A 2HOTA 4AIHA 4ESFA 3QQAA 2O8LA 5JHFA 1Z1JA 2H5CA 1MSEC 3K1MA 2GCTC 5DCFA 3KCCA 2F4MB 1QY6A 3M4OJ 3BTTE 2A5AA 5I25A 3GWZA 3AG4H 3ZGKA 1POGA 4MQ9F 4DZJA 1T8MA 2O5RA 3RU4D 1TNTA 5CDFE 2MG4A 2KDOA 1P2NA 1AE5A 2JH0D 1IW7F 5AFZH 3A7TA 1DGWY 4X6NA 3G1OA 1RR8C 3H5AA 1C1MA 3HYIA 2PHBA 1O5FH 1F5TA 1GMDG 4I76A 1U78A 1AKSA 1SFQB 3ZZCA 1E38B 1LKAA 1Y8TA 3LH1A 3LAJA 2NU4E 1K1PA 3K7AJ 4X1PU 3OR2C 1J75A 1M9UA 2CU7A 3VB5A 1V3FA 3RXCA 2OC6A 2CW0F 3F3XA 1SD5A 3RDIA 1K28D 2Z94A 1NT1A 3GCOA 3T25A 2HGCA 1BR4A 2K9SA 3QP5A 1TNJA 1QVUA 2AXLA 4HNUA 3SU1A 4A3LJ 1GBDA 2DK5A 3C3WA 5GPCA 4XRNA 2GIZA 5A0AE 4P00A 1V2NT 1ID5H 3A4CA 2QLZA 1BBYA 4EM1A 5LBQA 5JVTA 4VGCB 2VKVA 3SJMA 1HNEE 1TPAE 2GTBA 4AFZA 2ZG0H 2B9SA 4BS9A 2Y6TA 4CYCA 4MTEA 3RIRA 2E5NA 2RQPA 1KXDA 2FD5A 2I8DA 3I77A 3SJIA 1PQ8A 3KFWX 4DGJA 3ECHA 4U87A 3ESTA 2MGQA 3LKWA 2XBWA 3KCGH 5DP9A 1YPHE 2ZGBH 1P4AA 5JPMH 1F0UA 1WH7A 1HA8A 4YFNF 2KJCA 1ZPCA 4LZ1H 2ZU3A 2YNBA 3WWBA 2VT3A 3KP3A 4QPQA 1OPCA 5D4RA 1ELAA 1UK3A 2QY0B 1HJ8A 1WUNH 1DPRA 5FKKA 5LGNA 5BPEA 1WQ2A 1ANEA 1E37B 2OPTA 3E0PB 5L30H 1ACIA 4EJOA 1O5BB 1NG7A 4CHUA 3D65E 2MH9A 2ZTYA 4R79A 2HTSA 3FWEA 2A68F 3GMEA 2X0LA 2ZU1A 2AIQA 1O3MA 2QF7A 1PPGE 3E0NB 1IN8A 1BZXE 1HSJA 1R7JA 5IY5H 2ALPA 5FO5A 2AMQA 2E1MC 2Y9ZA 4RGSA 2BVRH 1HJAC 1AFQC 2A61A 1HAHH 1QA6A 2LOOA 1O3AA 1GVJA 2CV1A 1X2MA 2OJED 1SD4A 2FTMA 3LA3A 4UD9H 3GDVA 1TTYA 2BXUH 4A2UA 3K4CA 4IMQA 3ZV8A 1O3FA 1JTXA 2Z1DA 3CDHA 5CLSA 1P2IA 2DA7A 1MCVA 3I59A 1GMCF 3A7XA 1GV5A 3ATIA 3U69H 2QENA 3QDZB 2V9VA 2G5VA 3P95A 1WDIA 3ZVEA 2AHQA 2WYJA 3MNSA 1FTTA 1FIZA 2EPFA 5K0HA 4BHPA 4NFFA 4HF0A 1Y3UA 3F2GA 3BTCA 2E2IJ 4FHTA 2K8IA 3ZP5A 3TVJB 2XWAA 2STAE 2VBWA 1HBXG 4PZJA 1EATA 1ZG5A 3EQ0H 5LD2C 4A93J 4NBQA 4M6VA 2R5YB 2CV3A 1BHXF 2DI3A 1B72A 2L7FP 1CQQA 1XC5A 2XAQA 1GI9B 2O9LA 2XRCA 3RXJA 2BLOA 1S5LC 4JK1X 1GI2A 4OS1A 2W00A 2FXRA 4I33A 1BRAA 3F8NA 3QWCH 4B3AA 2IA1A 2AMDA 1HBTH 2GT7A 3P5JA 5DP4A 1XVMA 3DLAA 3WTUC 4UNOA 1HGTH 4UVBA 2PKAA 2UXXA 1AIXH 1VITG 4B6EA 1ELVA 2BHYA 5JBTA 3SXYA 2QQAA 2CGPA 2LLKA 3IC7A 4A6DA 1QCPA 3K6YA 4LB5A 1XDUA 3PQKA 1N75A 2M8GX 2AGGX 1BIOA 3L2UA 4CREA 1UHMA 1A0JA 2E60A 3LSGA 1U5TC 3S93A 3NWSA 2PJRA 2FOMB 4ZCNA 5LFAA 2BZ6H 2A5KA 4GHTA 4ZTJA 4I0AA 3HOTA 3DLLF 4IPAA 2BD8A 4K2YA 2R3SA 3ELAH 2ZU4A 4M3FA 1IQKA 4RM2A 1BOQA 1YBWA 1UTQA 2UXNA 1D0XA 3KEEA 4X1QU 1B9MA 2W24A 3M9AA 3EYYA 1O31A 2XSDC 1S6LA 6GCHF 5A0BA 1C5QA 5JHUA 2BOKA 2VBZA 3U21A 2IBDA 3KE2A 4Y11E 1SB1H 2G00A 1O2IA 2MABA 1EH6A 2VIWA 4ZHAA 3SQNA 3F0CA 2LVSA 4NB5A 4TT3D 2YX7A 2L9SA 2M7BA 1JKPC 1C5NH 2DODA 1B1BA 4ISIH 2XB0X 3LGUA 3CC4I 1YG2A 4I8GA 3BWGA 1SGRE 2VWNA 5L3EA 5IOZA 2WPMS 2ZXWH 5EG0B 3RXMA 1ELEE 2ZFRH 1TW3A 3A02A 2CHAB 2BY1A 1C2FA 4AGKA 1A5IA 1RUOA 1OQYA 2DMTA 3HOUJ 1C0WA 2BVMA 1C5SA 3E5QA 1W1WE 5EW2H 3QO6A 4RA2A 2Z9OA 2C6YA 1UTJA 3GXOA 1NO9H 4WH6A 4NG9H 1R1TA 3TBIA 2ZXHA 2KISA 1C1OA 3PTBA 4PK4A 1FMGA 2TGAA 2P5VA 2CH0A 1FBSA 2R7XA 2ZFWA 1CBWC 5FLMJ 2W6ID 2NVUB 5LLQA 5JI6A 5TISC 4IXAA 3U1KA 4E7SA 5L3GA 2LKPA 3UB0A 5J1UA 4CHAC 3TK9A 5CVIA 4Q7YA 5JLWA 1AVWA 1NZQH 2XW9A 4E7NA 1G6NA 1N8OC 2JVHA 2KIFA 2CQQA 1K22H 3SDBA 3V3MA 5LH8A 2ZMEB 3VG8A 5DP6A 2FX4A 2BD5A 1W8BH 2JA8J 1D3TB 4A5NA 1WYKA 4XKCA 1SQAA 3ZQLA 1SGYE 1FZZA 5FBEA 1Z7KA 2JPCA 1BTPA 4L5JA 1YY3A 1VNDA 3BN9A 1IJWC 3SGQE 1BIAA 1HLVA 2NU2E 2Y31A 5EIYA 2F83A 4HGCA 2DPUA 1WI9A 3I71A 4HF1A 4AZ2B 5ERIA 2UV1A 1FN8A 4G7HF 3QYEA 2XRLA 3LFUA 1H4WA 4B6FA 3MD2A 3BTIA 2DN0A 5L2YH 2IP2A 1KLJH 4TSFD 2COBA 2ZCWA 1YLNA 1MQ5A 1G2LA 1CO7E 2EZKA 5A8ZA 5H20A 4BDZA 2DJNA 1K0HA 2M34A 2FNAA 4Y7NJ 3I58A 1PFXC 4SGBE 3A8BA 3VYSB 1HAIH 3P92A 3IL2A 1QRYA 1I50J 4A1XA 2WA0A 2FU4A 1P2OA 5DTDA 1D8JA 1FV9A 1EP6A 3KPHA 4CR5A 2Y30A 7GCHG 1RZ4A 4L9NA 2VKHA 3QOPA 2Q6GA 2V3HH 2OD3B 4PROA 4IRGA 3BQZA 2VVVA 3NWTA 3V8KA 1BTHH 3PIOF 1LMWB 2DUCA 3QX5H 2AHME 3SJKA 2M0MA 3SUFA 2H9HA 3ZCOA 1HLTH 3LU9B 1GGDB 2CF8H 3GYMA 4MLFB 1GJ4H 2X4HA 1ON2A 1KIGH 4X0WU 2FOHA 4N9HA 3RYRA 4CDGA 2FXAA 2GLOA 3Q3XA 5AFYH 1LCYA 1A61H 3EYIA 2XPUA 1KLTA 1FP2A 2WZQA 2EI6A 1P4WA 2H1UA 3J80K 1X1AA 2IS2A 2UUYA 2UWMA 1MKXH 1MZBA 1R5HA 1YX3A 3GTLJ 1E34B 1BMAA 3GZ6A 1FMVA 3NUMA 1QBOA 1J9IA 5ICFA 4ZHMU 5H4IB 4IW4E 5HLTA 1ZTKA 1O3EA 2LELA 2IS1A 2ZB9A 2J95A 4BBSJ 3C2GA 1P05A 2H5DA 1LO6A 1W13U 3OSYA 1YE9A 1K4SA 3FAOA 1LB2A 4ABIA 2ZHQH 4HF2A 1QBNA 3Q9SA 2Y7ZA 1UCYH 3QPSA 4LMYA 3KP2A 1SBWA 2DMQA 2ZU5A 5FPTA 3S32A 2HNTC 4PJNA 5E8EH 1TBZH 2RGVA 2P7CB 1O57A 4P5OA 4UUSA 4PJMA 4AWXB 4RT1A 1OSSA 3WWFA 1PDNC 3B73A 4B3XA 1S3JA 3HOYJ 5EDNA 4L0YB 3LAPA 3S7HB 4IHYA 3RXEA 4UUTA 3GTPJ 1BMFD 1YCPM 2O0YA 3CCSI 1EAIA 2HNTF 2WWYA 4P96A 1N1LA 4XLNF 4ENJA 1IXRC 4V2FA 2WY7Q 4LG0A 3RMOH 2GT8A 1GMHG 2OBOA 2STBE 1WBGB 1HAYB 3DEEA 3UR9A 3CD6I 3IRQA 1ZRBA 5K5QA 2JA7J 2EY4C 4NIYA 1HW2A 1F1ZA 2CYYA 4ZAEA 3L1PA 4HLXA 2XNIA 5D5UB 2EQNA 2ZKZA 2HVQA 1MTWA 3SN8A 2OZ6A 2CRGA 3ELKA 1ITYA 3UR6A 3KP6A 3L2QA 1P8VC 2JH5D 1OYIA 3FF5A 1YQAA 3H35A 5JLXA 1FTZA 4LLGF 2HVYB 3ZVGA 4BQNA 1BR2A 4A3BJ 4B2BA 4D9QA 4IHVA 1MKWK 1ZZZA 4YIRX 2KCAA 2VIDA 4LOCA 4YT7H 2FMJA 1TP4A 1TGNA 5J3LA 4QPOA 5E0JA 3HRSA 2LD5A 4JZIA 2DE8A 1DY9A 4GVUA 2KLOA 1C2MA 1D9IA 1Z1IA 1GJ5H 4XNFA 2L9VA 1AKHB 2RA0A 1OWJA 1H8DH 2W7NA 1YWUA 1IQIA 1T08B 1WJEA 1IRGA 4ISOA 2V1DA 2M45A 1MMJN 1Y3XA 3RXRA 3CESA 1YPKH 1YLFA 1X1DA 4DJAA 3HATH 1YPGH 3R0FA 2Z9LA 4UXNA 1EH7A 2SGQE 2E1CA 1XCBA 2F9NA 4DJZB 1NG6A 4FXGH 2VQHA 2VJIA 1XTAA 4KMFA 5B6LA 4Q5SF 1H9LB 3H5CB 3ZQCA 1UTPA 1NBMD 5J4QA 2PP6A 3LSPA 3PWCA 2MW8A 1P3EA 1I1SA 3TO7A 3E6PH 3TO9A 3LGIA 3FXKA 3LONA 3MH4A 2CW7A 1T2KA 3S3NA 1BC7C 3T27A 3ERED 2K5CA 4YLQH 3Q9VA 4Q47A 2HOSA 5EJ1A 2ZKSA 2Z2SB 4A0YA 1AHTH 4AG2A 3UR3C 1DXPA 1W2KH 4OINF 4I7HA 3EUHC 1Y5AT 1RJXB 5JBCS 3UNQA 1C5OH 5DJ7A 3QPLA 1A36A 1Y3WA 1OCTC 2MC3A 4M6YA 1OCPA 2X48A 4IRHA 1NN6A 3U1IB 2Q2EA 1XSXA 1LFUP 4XSKU 3SDGA 3S15J 3HOZJ 4X0GA 2VIVA 4B75A 4GXOA 1W5SA 3RZDJ 2VWLA 4HTCH 4Q2KA 1NRQH 1YIOA 3VFZA 4ACAA 3MQKC 5HLHA 1XXFA 3VGCB 4B4CA 3K10A 1FLEE 1QU3A 3VYRB 1O2UA 1WJDA 3UQVA 2VBXA 2EQRA 3Q5FA 1QBJA 1VJ9U 3CLQA 3TP3A 1FY3A 2F9BH 3O8DA 3A01A 1WGXA 1V2VT 2IN2A 3TJVA 3IWZA 1BBRH 5DD4A 3QWLA 4RS8A 3GICB 1H0MA 1SGPE 1FOKA 3IKVA 2QF5A 3W6JB 2E1MB 1HJAB 3OYFA 4B47A 1AFQB 1W7GH 1GHAF 1T6SA 3QYFA 3ZZBA 3OE7D 4GUXA 4JQFA 4M71A 4RGRA 3M3TA 3GCMA 2H8WA 3G6EI 2DO7A 1Y8RB 4INKA 1ANCA 2Y0MA 4FUHA 2FESH 3RXAA 4WK8F 1R5GA 1QL7A 2ZSHB 1GI7B 3GCHC 5FCKA 4ZMAH 4CYDA 5CVUA 2WY8Q 1LPQA 2CJIA 1X58A 1QB9A 4K8BA 4N9IA 1V55H 1O37A 2SNVA 3NAUA 1BHXB 3CCQI 2LY1A 4MEXF 2XCFA 3WG7H 3GYHX 1F36A 3HGYA 4FT8A 3HOXJ 3OY9A 5DUIA 4AU7A 3MKYB 1P0SH 2FOCA 1Z71A 2QVOA 3BP8A 1U3EM 5D5XB 1ETKA 3RKXA 1C5ZB 2HZTA 1L1JA 6LPRA 3LGTA 2CFOA 2CMPA 3QODA 3O3KA 1JMOH 5ABWA 3SU5A 1K7AA 2H94A 1TRMA 1UCRA 1Z8GA 2E7WA 4E7IA 1IGNA 2QKLB 4Q7XA 8GCHF 3BIUH 4Y8YA 2JPBA 3ZVCA 1P09A 4BAKB 1FPHH 1O2MA 2OLGA 1C1PA 1GJDB 5LGOA 1SFIA 4Y4RA 4AYBN 1W10U 2R3UA 3OAAD 1X3ZB 2HVSA 2QN5T 3IG6B 1NFWA 3NQOA 3FK6A 2VIPA 4H4KC 1R6RA 2NVTJ 1QHRB 3BG3A 2F48A 1MKXK 1ZYOA 4R0IA 3LFKA 3HIFA 1U5TB 3OIPA 1VQMI 3HSEA 1A5GH 3LSIA 1GBKA 3MU4A 2ZDNA 4LK4A 2WUBA 2OV7A 3L00A 2GCHG 5CHBA 1ABJH 3L2WA 4C2MJ 3G1LA 1XSDA 1YCPH 2F5FA 4FX4A 2V26A 1P57B 2FTLE 2J98A 4ABHA 3GTOJ 1S72I 3FHNA 4YOIA 2V3OH 4I8KA 3LGYA 1OWHA 3E5XA 4ABDA 1UVTH 3RPUA 1T0FC 3COAC 2BB4A 3VPRA 2HOAA 2ACJA 4L9JA 4OS5A 1VCWA 5EQRA 4C9YA 4DYQA 1EJAA 2L3DA 2KIQA 1G3SA 3GFLA 4YOGA 1V6DA 2VNTA 4N0BA 2UWOA 5FLXK 2TGDA 2LY9A 4NIXA 1J14A 1WJ5A 3OYIA 3D5SC 5B6OA 4ZXYH 2W84A 4A92A 3AVZA 3OS1A 4UFGH 2LR8A 2P8OC 2R7SA 3OIOA 2QXGA 1EKBB 1UK2A 1I27A 1W0JD 1VF9A 4HOBA 2ZFQH 4NFEA 3CF2A 1FJSA 1SSXA 4F7ZA 5K1YA 3JREA 1IQHA 2WB1A 1XGNA 3DFLA 2IGOA 4YESB 1HCRA 3J81K 1T32A 1UTNA 1R71A 3H09A 2HFHA 3UWIA 2H09A 1QO0D 4ZYAA 2ESHA 4YTAA 1C5MD 1C2KA 1FIWA 2W85A 1PUFA 1UVOA 3IITA 3K4LA 1P9SA 1BI2A 3P17H 2P3TB 1Y5UT 2AO9A 1ANBA 1CBWB 4AFSA 4WXHA 3SFIA 3TOBA 2FM2A 4B71A 2NRAC 2B7EA 4D7GA 5I46H 1A4WH 2ZCHP 4PGHA 4CHAB 2ULLA 3EUKL 1Y56A 1AY6H 3TDZC 1YPHC 1O2GH 3HK3B 4LLNA 2DLLA 1XUIA 3VYUB 5JR3A 3TQNA 3RMMH 4Y15A 2PUXB 3QU6A 1RS0A 2QE7D 1Y0NA 2JDID 5C0UA 3RKWA 1O5AB 4HRIA 3OY6U 3SHCH 2H2ZA 1ZN2A 1FYKA 1Y1WJ 4M9SA 3KZIC 4B44A 1AQ7A 5E79C 2L74A 4EEFG 3J7AY 2ZI2H 4QTRA 4O6JA 2IA2A 2CUJA 1ELTA 3RXIA 4HA8A 4FISA 4D8NA 1J2XA 1D0ZA 2MH2A 2W1OA 3ATWA 1OYYA 5B66C 2VXDA 1HDDC 3F9HA 1TW2A 4W1UA 2ZJRF 3TU7H 2LREA 4I6ZA 3AFHA 3DU5A 1BA5A 1LQEA 3K6GA 1QTFA 2XROA 3SV6A 1OMIA 2W57A 4IN2A 1EJ9A 4J2YB 1PVEA 3FIWA 4XN0A 2THFB 1ZJKA 4K2EA 3QPTA 5B1AH 5DEQA 5L3DA 1G3DA 3UTUH 4E05H 3WY8A 4E7KA 2FOBA 4ISNA 4DW2U 1TWHJ 2QWWA 1N77A 2BW3B 4ABJA 2ALVA 2PQ8A 1IQEA 1JKQC 1BJVA 2DE9A 2BXZA 2E2HJ 1BRBE 4XD7D 2PX9A 3H3ZA 1EZXC 2ZP0H 1TWFJ 4BXXJ 2L2OA 5GPAA 3I3LA 1B8IB 5F0HA 2HDCA 5FPYA 1XGMA 5IP7J 4NNJA 5EGOA 3EE0B 1XN7A 4IS5A 1W0UA 2RKHA 3ZMZA 1UZCA 3OYAA 4FE4A 1SGTA 3M37A 1I3QJ 3BTFE 1ULYA 4XDEA 1SANA 3CMYA 4X1EA 3FZVA 2NVYJ 4RAGA 1O3SA 2XGCA 3C2HA 2R7QA 3GY4A 3TK6A 1UHSA 1LKBA 2HPMA 2HYJA 1THSH 1TB6H 2Y7XA 5F08A 1NTPA 3RQ4A 2CWEA 2W26A 5E3MA 2NOGA 1MBJA 3UFAA 3ZQIA 1FY1A 2EI7A 4CCJA 3AKZA 4UB6C 2LNCA 3GYLB 2STTA 5FRNA 1YYY1 1ZMNA 4ENNA 4EGYA 2GDDA 4V19K 3PYHA 2A7CA 1ELDE 2ILNA 2HKXA 3CQZJ 2DMPA 1TONA 3QAHA 4XIDA 3S0NA 2PKSC 3JSPA 3A81A 2SGAA 4ESTE 1MW7A 5T6GA 3G4SI 5GAGJ 3D1NI 4AIDA 2MD5A 3HXLA 2V1XA 4A3MJ 1DSTA 2CF9H 1HKTA 4LK1F 5KGOA 3V42A 4GGGA 1XX9A 1Y8QB 2K9LA 4BQQA 3ATKA 3A1YA 3F2HA 1F43A 1RTKA 2D2WA 2KR7A 1WJCA 3V4GA 4DOZA 1NRRH 2AMPA 4FQGA 3QUMP 4ZYGA 3ZRGA 1IN6A 3ZVAA 3OIQA 2JA6J 2DDAA 4ZHLU 4A1VA 3SU2A 4XOJA 4ISLA 2P16A 2C8WB 2NS7A 1E3PA 1QNJA 5L3CA 1BRUP 4TV7A 4ZUHA 1TNGA 1E35B 1LDJA 1MMSA 1YX5A 1BITA 2V35A 5H6QA 3DTKA 3B6AA 1OP8A 1WJFA 2KP6A 2L9NA 3PM3A 4BNRA 2DDBA 2C8YB 5C4XJ 2BDAA 3U8OH 4GHQA 1YS7A 1PJPA 5FFXA 4MPUA 1RIWC 3GFMA 3A8AA 4OIQF 1YCPK 4Y7AA 1K21H 3WHCA 2GM4A 1KXEA 2VC0A 1MD0A 3L33A 1QBVH 1I3AA 4H6SB 4EJTA 4AOQA 3WTVC 3L2CA 3S3OA 1KDQB 1ZKGA 5ETXA 1N25A 3M61U 2A3SA 1FJLA 2RDPA 1NK3P 4NCYA 4DG4A 2GVFA 4IZZA 2ZNKH 4OMZA 4M9XA 2LSOA 1A3EH 4D7FA 1BRCE 3WTYC 1BUIA 2FSWA 2GZWA 3GS9A 5GWZA 4J19A 3DXJF 4HX8A 5M5WJ 1Z7UA 2A07F 1SLVB 4WY3A 3V7RA 1WFXA 2DA3A 3F6UH 2LBFB 1DUXC 4HX7A 4ZDPA 2JVGA 4HSTA 1W0TA 3M1EA 4BAQB 4X8TH 2VJJA 1LDDA 3FN8A 3W6VA 3KHVA 3QU3A 2XDVA 1YLDA 1I6XA 3CP2A 4E4HA 5KHDA 2EILH 3VXFH 4M7GA 1PPZA 1VR1H 3KP5A 1UTLM 1C5RA 4X6AJ 4O3MA 3T5XA 2TGPZ 1MTUA 1IHSH 1MH4A 3PNTA 2VBYA 3MWMA 4BXFA 3U8RH 4BOHA 4U7BA 3A85A 1JKOC 1TL8A 1KQ0A 2FOKA 1ERDA 2VIXA 3OOUA 3JCUC 3E1XB 1U6GA 1BW6A 1OP0A 1GJ9B 1PPFE 2EEKA 3LOCA 3KYFA 3S16J 5J4YA 3P8NA 2EFQA 3CP8A 5L3BA 3R0JA 1TYNA 1Z9CA 3BPXA 2DTRA 2G7UA 1YF4A 2OP9A 2Y82A 4HLYA 1JOUB 5FL7D 1ZG3A 5C4JJ 1E79D 4LK0F 3BTDE 5J40A 4CCLA 2JIZD 1MJ9A 2BYAX 5GTHC 2IA0A 4MTDA 1VCQA 3HL2A 4XBFA 3OY5U 1ORKA 4ASNA 8KME2 3J7AO 1W0ZU 3BDDA 4NUBA 5EXNA 2LY2A 1MBFA 3KL6A 3VB4A 2K02A 1SHYA 2WPDD 4CCNA 1Z0XA 1IQFA 4AGJA 1TBRH 1BMMH 1VCPA 4IHWA 2EFPA 3QTOH 3OS2A 3MKLA 1R1UA 1TLDA 2R7ZJ 3HPGA 4FUFA 3LSJA 4X2VA 1XUKA 3M8FA 1XUJA 2PUQH 1C1TA 4WMDA 2PSXA 3FK7A 1T4VH 2P3FH 3WTXC 3A8CA 2XB5A 1ZRFA 4INHA 5EYRA 1ABIH 1T4UH 1E0FD 2YX4A 2WAQN 3DPTA 3QK1A 3M7UA 3HOVJ 1XCVA 5BNGA 3UIRA 2Y48A 3GCHB 1QZZA 3R3GB 5A2MH 3CJTB 4MNUA 2HR3A 5FCRA 3PUBA 3CUQC 3PFYA 1O2NA 3SNAA 1C2DA 2COMA 2M5WA 1FUJA 4YFKF 4WXCA 3S2HJ 1XXDA 2WBMA 4Y0YE 5JDUB 2HPPH 1P06A 1HAOH 3EDPA 2CJJA 1GHBF 3MMYB 1O5GH 1BMNH 2GMTC 3MCZA 2BQWB 2VXZA 2BM2A 2M4KA 4AG1A 4UUVA 2VLAA 2NU3E 1O2ZA 1QVTA 4UEHH 3SFZA 1H8AC 3W6KB 2F4LA 3O8BA 2SGDE 4JYUH 4G8XA 4I8JA 1DWCH 2WPLS 4OIPF 3I9V2 2Y5FA 1OCCH 1PQ7A 5LHHA 4IHTA 5CYVA 4YZUA 1XX5A 1NY22 1TGSZ 3L7WA 5GJ4B 1Z3YA 1HKSA 1U9NA 3DBHB 2CQXA 2EZIA 1KXCA 3ERMA 3RDZA 3SV2H 2P93A 4DBQA 3GX4X 1GG6C 2VUMJ 2RG3A 1G37A 1W7PB 3HGGA 3VXEH 4B09A 1GI3A 5EPYA 3PFIA 2O61A 5J47A 4CXFA 3E91A 1LVAA 2Y5GA 4L5EA 2W5EA 4YEJA 2ADUA 4C30A 2AEIH 1DE7H 1VZ0A 1O2YA 3MU8A 2KPMA 1WTGH 1TX8A 1GMDF 4D7MA 2OA4A 1QGFA 4Y0ZE 3BG5A 2ISZA 3PNYA 1L1GA 1OKRA 1CA8B 4BE0A 4LG3A 4IC5A 2FODA 1XGSA 1OOKB 1K1LA 4I99C 1WJAA 2BV6A 5DG6A 5HMAA 1PPEE 1RUNA 3ABMH 4Y33A 2E71A 2HPQH 3NK8A 3HHHA 1TBQH 1C2GA 4ANJA 5AONA 2QF3A 3RC5A 5C0TA 1ESBA 2J34A 1CVWH 4NA9H 4OAZA 4RB1A 1TOCB 3NRLA 5LHGA 3RQIA 3WTWC 1SD6A 1Y5BT 2DYSH 1PJRA 4BEHA 4J01A 2P8OB 4M72A 2DA1A 1RXPA 1NC6A 4KIFA 2Y69H 1TT0A 1C9TA 4BHBA 4G94A 3M3SA 1YPJH 3H9GA 2Z9GA 4HI3A 2V6CA 3SORA 1BMLA 2BOHB 2BDHA 1SFXA 1Y6IA 5C3EJ 1AWCA 1MMAA 1JRTA 2CK3D 2J97A 3AAFA 4AB9A 4O03A 3RYPA 2G4UA 1K4TA 1Y0UA 1K61A 4HZFA 2FLRH 1QL9A 3DBLB 2CHAC 5F8ZA 5ILVA 2L9RA 2YMSB 1GBMA 3U2RA 3ZZ8A 1DOJA 1IQMA 5K5RA 3U98H 1CT4E 3WU1B 2OF7A 1JI8A 1GHVH 1L3LA 2A2XH 3F3BA 3E7LA 3T28A 2A1DB 3Q77A 1CHOG 4CRGA 2G0EA 1L1NA 5IYDJ 1ETYA 3PSFA 2D26C 5CQEA 4B48A 5M3MJ 3MO3A 2IAIA 3IRRA 2PGBB 3WODF 5M5XJ 1TALA 1EFRD 4IMZA 2ZC9H 3AW0A 2FNPA 3DFJA 2ZWLH 2HVXA 2K1QA 3F8FA 5E1WA 3FBNB 1JUMA 1V2MT 1QR3E 2TIOA 1B5GH 2LMDA 3V7TA 1ZR0A 2AGEX 1A0LA 2VONA 2QF0A 1ZYRF 1C4V2 1C9PA 2FO9A 1XMKA 3KQEA 3CCUI 2RDLA 2FQ3A 2VKEA 1C4Y2 4IVNA 1P04A 1JE8A 4WCGA 3GY8A 5IYCJ 3RXLA 5FD6A 1P02A 1ONVA 1WHUA 1SGDE 2TRTA 2ZGJA 1S82A 1VJAU 3CCLI 4PDKA 3HUGA 2P6SA 1FX0B 3LNQA 3RLWH 5HDNA 3A03A 2V4JC 3IH2A 2YUSA 2WINI 2V79A 1S83A 4MIMA 1WQSA 1P92A 1NRSH 5D8LB 3QYBA 4ZZLA 3PO1C 4IO9F 2DYRH 2KRFA 1O2PA 1RRKA 1S6HA 3TNTA 1S0QA 3Q0VA 1VITF 1BB0B 2ZDVH 1FXYA 1BI1A 3H3VK 4K3JA 5H6RA 1OWIA 4DQ2A 4BDYA 4FUIA 4HV6A 3WGHA 4OS2A 3FKIJ 4Y71A 3BTWE 4D1QA 3ECOA 1D8KA 1GBHA 2ZF0H 1FAXA 1J15A 1T8NA 3KIDU 2A45B 5EW1H 1A31A 1BCUH 4JCNA 1GHCA 2AQFA 3LL7A 2MSYA 1MAXA 7LPRA 1D3YA 3P8GA 4ABFA 3U28C 2BXYA 2XPVA 1NFXA 3FZZA 1GLNA 2BYVE 1GBFA 2QQBA 3ASNH 3M36A 3K4KA 4DURA 1S84A 1J09A 3HRMA 2QIQA 1A46H 3EA8A 1S81A 3S9AA 2ZJPF 3RMLH 3F21A 2MLGA 3VWBA 2G51A 2XHKA 1YLCA 4EM2A 1XM1A 3MH6A 5ED4A 2XKOA 3T1BA 3GLXA 1PYTD 3LIWA 2Z6BD 1BIBA 2OBPA 2FZZA 3HKZA 5FJ8J 3DV8A 3GUDA 3BTEE 1A2CH 3K4JA 4TPYA 1DT2A 1O3BA 3VSKA 3RM0H 1R23A 1JGSA 2QSFX 1GBEA 1UO6A 2D8WA 3Q00A 4X8UH 2XVCA 3RTRA 1YGCH 2PKSB 2Q6DA 1TNLA 4BAMB 1QURH 3GZ5A 4NC8A 4AVPA 1X4OA 2PW8H 3GY5A 1ZHMA 3IP4B 3O6BB 1KSNA 4OS6A 2DXIA 1SQTA 1IAUA 4ACBA 3L2RA 2WHXA 3BTHE 2WV4A 4ABBA 3JRIA 3GEZA 1QRXA 3FXJA 5ILSA 4DNCA 2CGAA 2JUGA 1ARBA 3GTQJ 4II2A 2OCVB 1ETQA 1LE8B 2KAIA 4KTCA 2RFKC 3A87A 2XRNA 1MKMA 4ENKA 2I6SA 3OYGA 2KCOA 4RGUA 1AE8H 4NDLA 5FROA 2A32A 3KYGA 2FYQA 3MO6A 1KYWA 4IEJA 1OPHB 1RKTA 2ZDLA 1A6QA 2M7AA 2ODQA 2C4FH 1L2EA 5E3NA 3UY9A 3SGAE 4K69A 1LVKA 1R00A 4G6TB 2ZHWH 3HC7A 1DFPA 4B2AA 1C5WB 1BN5A 1F5RA 1ZQ3P 4U7DA 2PI0A 4EJVA 3MO9A 1O2JA 2K4BA 1O2VA 3LC3A 1GBTA 3AG3H 1TPOA 1SL3A 4G7OF 4E7RG 4ON0A 3K1NA 1IN4A 4EJWA 4KFCA 3ISPA 3GY2A 2V6EA 2PTNA 1YOVB 1VTNC 1Z05A 3FMQA 2XBVA 3T2NA 1RESA 4NWLA 3GISB 3P8FA 4S05A 3AG1H 4P55A 5DP8A 4U0WA 1SC8U 4HFPB 3VEPA 4UDWH 1TQIA 5LGTA 4ABAA 4KISA 1JXPA 3UQOA 3I0TA 1B6AA 2IJLA 2RN7A 4CA0A 4DYCA 1K2I1 1GVLA 2IGNA 5C1UA 1IN5A 4RLQA 3TW6A 2X85A 1LPGB 2XNDD 4Y8ZA 3HTUA 2FMYA 2KT0A 3QOEA 1I6HJ 1HIAB 3FISA 4IHXA 3G2BA 2TRMA 1TT5B 4R1HA 3A88A 2EFOA 4XK4A 4F49A 4MPVA 3RXSA 5BRRE 3JW4A 1ZSLA 1ZSKA 2AIPA 5TCAA 3ZZ3A 2IPHA 4RN6A 1TX6A 4KNYA 1HAVA 5A8XA 2JETC 1ZGIA 1GHAG 3W95A 4D9RA 2EH3A 3NRVA 3A7VA 2F43B 3VYTB 4X1RU 4B1TA 2HDDA 7GCHF 2Q8KA 4CCOA 1BJZA 5C5OA 5ESTE 1K79A 4XOTA 2BMGB 3ZQQA 2G5NA 1MBKA 1ZR2A 5LRRA 1FY8E 2FOGA 2ZDAH 3E6MA 4A12A 2Y9YA 1SGEE 5CHAB 2ID3A 4AFUA 1B4AA 1T56A 2YU9J 3SEQA 5K7ZA 2MFZA 3HKJB 2X51A 3RU4E 1SGFA 4AVZA 2WYGA 2DT6A 1J17T 2ZJQF 2RREA 1C1QA 5HLGA 1JKRC 2HXOA 3OYLA 3I55I 3UNGC 4EVIA 2FP7B 3WG9A 5EEAA 4P9UA 2DPDA 1CF7B 2E7XA 3P7NA 2EA4A 1MBQA 1O3TA 2XAFA 4DT7B 2ZO4A 4B73A 3K0LA 2F9VA 4E6KG 1WSSH 3BQYA 4Z1MD 2JRMA 2XIGA 1MD7A 2A69F 2DMUA 3A0BC 1PYTC 1GT0C 2GGVB 3IWMA 1U8RA 3CS7A 2KMUA 1YW8A 1EPTA 3VGCC 1OX1A 1HC8A 1P03A 3KYCB 3NZIA 1HUTH 1LDKB 4L18B 5FKNA 3JZ1B 5LEJA 5F1JA 1H89C 4KDPA 4WXVA 2J5OA 1OKXA 4D5FA 5DD8A 4HZHA 3MU0A 2PLYA 2O3FA 2UUFB 3F9EA 2DOFA 2FBIA 2IW5A 1KLIH 1PPHE 2DK8A 1SFKA 4F93B 1O3DA 1GCTB 3R60A 1ZG1A 1CQTA 2WB1N 4XLEA 1LJ9A 2QBYB 1I1GA 1OCOH 5EJZA 4R8HA 3BZ6A 1ZMJA 3V13A 2RDEA 2EBIA 3CUQB 4JZFH 4Q63A 5FX6A 1DVAH 1TWCJ 5FFZA 4O3UA 3PNVA 5HM9A 1YI2I 2XF7A 4XRMA 5E1XA 3FM5A 1SOTA 4CSWA 1BTZA 4XBDA 1MIJA 1UCYE 4GYGA 1HDTH 3RXUA 3KQDA 1GMHF 2GMTB 1Z91A 1UHBB 3A2KA 4CICA 1E1QD 2XBXA 4ESJA 1O2WA 4BTUB 1HXEH 1DUEA 2PN6A 1MUEB 5KAFC 2V1NA 2LRDA 1VZQH 2XTTB 3AAUA 1C1VH 5F04A 3ABTA 2QXIA 4KMUX 1RRJA 5LHIA 4UFDH 1CGJE 2G52A 3ML6A 3WGGA 5C1YA 3QGNB 1O35A 3KQBA 5ICGA 1TGBA 2GAUA 1V5GA 1GWAA 4EV0A 1VQNI 5HGGA 1YRNB 1EJNA 3PQJA 5IK2D 2EFWA 1V2UT 2HS5A 1MJBA 5T1VA 3U1DA 3SW2B 2KIUA 2P6TA 5EG4A 1TABE 2XCNA 1GG6B 1FEXA 3F68H 4AN7A 1A0HB 2OTLI 3QTVH 1EXFA 1LEBA 1PP7U 1G3EA 1MDMB 4NIVA 4XICA 4WWCA 1HFDA 4J1YA 2JRTA 3UAIC 4NIWA 1D3DB 2LTPA 1K78B 1Z6JH 4MNVA 1YJ9I 2FI3E 3ZXSA 5CJ9A 2M0CA 1X3WB 3HM5A 3PSIA 3DPUA 3FMRA 5F64A 2Q6FA 4KELA 2I6QA 2FIRH 4JK5A 2OTJI 1GBCA 4Y3OA 4U30A 1CHGA 2HPIA 3I53A 1IRZA 2OQUA 4I86A 1CT2E 2DA4A 1JJ6C 4Y17A 4B1RA 3SJ8A 1MKWH 2XC0A 3BG8A 2R9PA 3ZQ7A 3STJA 4DIQA 3FKSD 4NQWB 1ACBE 1F0SA 2R5YA 3E3TA 4ZKNU 5FPSA 3FO8D 5DUKA 4G9YA 5EZGA 2MD0A 3H92A 1QZEA 3URDA 3UOPA 5L3FA 4IOCF 3PL8A 1FDPA 2VC1A 4A1TA 2CXVA 4NC7A 2OU2A 1OR7A 1AWFH 3A8DA 3DSGA 1R58A 2BVXH 3ESWB 1E3HA 3V12A 3CDLA 3E90B 2QXHA 2XSJC 2F91A 3CO6C 1V5FA 2J94A 2KDZA 4AC9A 3BF6H 2DFIA 4AUXA 1IC8A 2L7MP 3PMHB 3PB1E 2GKVE 3M5MA 2K7LA 1Z6TA 3IH4A 1O32A 3AAVA 5FXLA 2AH4X 1O3RA 3PLKA 2CUEA 3CCVI 4EQQA 2VU8E 4UVCA 5HDGA 1RR7A 3IAM2 1EB1H 2FOAA 1WQVH 1WWXA 4BEHB 1Y3YA 4HQEA 3RXDA 3S17J 3TO6A 3M5LA 1O3LA 3S7KB 4TY6A 3PRDA 1AGJA 3KYLA 1HQCA 4FU9A 1SVLA 1GBLA 1SFOJ 5FKOA 2R5ZB 4DT4A 1FPCH 4I0BA 4EM0B 2FYRA 2J92A 2BVLA 4YLUA 3A89A 3HGPA 2BD3A 4Y13A 3KZZA 3OS0A 2XAHA 1HAXB 4X2XA 1LQ1A 1TWXB 1QA0A 5EEHA 4HNVA 4LXBH 3OSFA 4LIVA 5KK1A 1LVYA 2ZPRA 1L0OC 3DTEA 1VQ6I 3N99A 3LPRA 2EI8A 3HSRA 1CU1A 3F6OA 2C93B 1BBRE 2Z9KA 1MQ6A 2IPQX 5F8TA 1LPKB 1Q3XA 4CO8A 5E1ZB 2CQKA 5EG0A 2FQ4A 3KNXA 3JRDA 3K2AA 3PV5A 3PV2A 2J2UA 2P81A 4E7HA 1BW5A 4M3DA 2NS8A 3PJRA 2VJ1A 4KIBA 3ROUA 3QZQA 4U2WA 1IQNA 2CMYA 3EETA 4PJ0C 1T7CA 1DXWA 1TLHB 3BTLA 4OAYA 2I10A 2VWOA 1LTOA 4X8SH 1YPLH 5K7RA 1FYMA 3ATLA 3MQ0A 4X6OA 3CF5F 2A6EF 4H0EA 2QCYA 1OISA 4YOJA 4A5TS 2FOWA 5D8KB 3RXOA 3PO1B 2H1LA 3HTSB 3BJAA 4XMYA 1GBAA 1AOYA 2BEOA 4AFQA 3PTNA 4UB8C 1RNLA 1BI0A 1BJAA 3WHBA 2ZFFH 5DN6D 4HG2A 1D4PB 1XMAA 3KLOA 4AIKA 2ZU2A 2VQGA 3MZYA 5GAHJ 2SNWA 3E5UA 2IXSA 2QSHX 4RSPA 3P70B 2ZMEA 1WZ2A 3ZMDA 2FS9A 4XLFA 1EZUC 3BTGE 3SUDA 1IRFA 4BQAA 2GCHF 3ZMVA 3S2WA 6PAXA 3RC6A 3MKWB 1N6YA 3K6ZA 4EATA 1U0JA 3R6SA 3O8CA 4V2GA 1GDTA 2HKOA 4MDSA 4EJUA 3I4NJ 3BTKE 4M9FA 1GBJA 2EWNA 4F92B 4RB0A 2VODA 1L4DA 2UWLA 3ENSB 2G55A 3OX7U 4CBNA 3V8JA 3GCTG 2FE3A 5ILUA 3Q76A 1RKWA 3PO3J 3CMEI 2WPHS 2A31A 4E7ZA 2XC5A 1SVPA 3GO5A 5IT3A 1V2JT 3A80A 4XLAA 1OFCX 5F0FA 3T26A 4KTUA 2RCEA 2A05A 4AYBA 1FOWA 4B43A 1FX7A 1KGSA 2ME0A 1P11E 1WRJA 3ZIAD 1ESAA 2KZGA 2ZGHA 1P3CA 5KECA 2Z9JA 2QA9E 2ZEBA 5BQTA 1OYWA 2O8WA 2DU9A 2Y75A 1VQ8I 2IGMA 3DKWA 3G01A 3G73A 1CT0E 4WMFA 3LA7A 1FOXA 4BGDA 3G71I 3SZNA 3F9GA 3TKYA 4A7IB 4HYEA 3FXOA 5F53A 1Q1VA 2KRCA 5DCMB 4G6QA 2KHMA 2A5IA 2NYXA 3O8RA 3MU5A 1HPGA 3M8EA 1NFYA 1F9NA 3WW7A 2ZHEH 4PFPA 1SGFG 4F4OC 1FI8A 2ASUB 2CW8A 1SEUA 4CCKA 3H7TA 4L5IA 1R36A 1C2IA 1IO2A 1IXCA 2QZ8A 4HW0A 3BJOA 5K7FA 3SHFA 2F5EA 3HPTB 2XOKD 3ZZ9A 4KJZA 3AL0B 1D6RA 1X1PA 1J5YA 3BT9A 1UJ1A 2MYSA 1Z67A 1TQ0B 3VSLA 3L3TA 3SU3A 1Z6EA 1TE0A 5KEDA 3S1MJ 3H0DA 1IZ1A 1XGOA 5CKTA 1OYQA 4Y6DA 2QKMB 1UW7A 2ELHA 1YS6A 5DP7A 1C1SA 1UFMA 5D6FA 2B9LA 2VKDA 4XKWA 1V2LT 2HQ5A 3MH5A 1KU2A 5D5VB 4ABEA 3H9JA 2ZIQH 4F48B 1ZPBA 4JYTA 3MI4A 3G1MA 2K86A 1DP3A 1W14U 5SGAE 1FY7A 1JJ8C 4NGAH 4K60A 3DKXA 2WV0A 1MU8B 4F52A 3OR1C 3HRTA 1W7PD 4JYVH 1CGIE 1A7SA 4RAFA 3A83A 1H9HE 4GDFA 4AYYB 1GXQA 3ABUA 2D1HA 4S04A 2LPRA 4IN1A 2FWWA 4BY7J 2VVCA 2ELJA 3ZVFA 1GI8B 2JETB 2HLDD 1HRTH 5C1XA 1ZLJA 2AERH 1O2KA 4KIGA 4HBLA 3DUXH 3LSKA 1DDJA 1O3HA 3ZN0A 2WV5A 2LKXA 3JAMK 3G3ZA 5EEGA 2DOEA 1C1RA 5LPRA 3DD2H 3OYHA 2V3MA 3IH3A 2LF8A 1EASA 3BEIB 5IYBJ 4A5MA 1R4MB 3T0YA 4I8HA 2FJ1A 1QA7A 1JBUH 2IS6A 3K9TA 3E16B 3FANA 1YO5C 3E3VA 4ZDLA 2F9OA 1AI8H 2DAOA 1UVPA 3CENA 2HLCA 2ETHA 2N8GA 4OS7A 1AKHA 1V2TT 4A3GJ 1GHBG 3RXHA 2ZTXA 1IRXA 4MPXA 4HG6A 1AKSB 3PLBA 4D7NA 1H1BA 2OQRA 2YPRA 1T8OA 4BE1A 3OYMA 4E70A 2E34A 3M7QA 2BXTH 1RGQA 4E06H 2A5YB 5EQQA 3OL4A 1VI0A 2ZHDA 2MBFA 3FXUA 1HDPA 2FEQH 1IXSB 1AWHB 1ZAOA 3F1SB 2R7VA 3OYDA 2GDEH 1EV7A 2B0LA 1Q1HA 1O3PB 3FX3A 2NXNB 1TNKA 5ESBA 5DYMA 3F72A 1HF0A 5EJCA 3S3MA 1MSFC 3CMMA 4RM3A 1J16A 3DEWA 2Z3DA 3AASA 5HKKD 2A4RA 4ZDOA 1HJ9A 2BD9A 1VQLI 3KQCA 2YMSD 1DWDH 4CYCB 1TQMA 4MQVA 2B5TB 4RBOA 1OXGA 4A3DJ 3F23A 2HQNA 3EA7A 4WXIA 4BANB 2F5VA 4GYIA 2XAGA 2UWPA 4OWRB 3I4PA 4MNXA 3RU4T 2AFQB 1PQAA 2BZAA 1JTYA 1YPEH 3E6CC 2GP9B 3U1JB 1FONA 2VH6A 3SOSA 2FOEA 1MTNB 2QM3A 3CTAA 3GY3A 2CFXA 2V7QD 1EPTB 2XC4A 5JBBS 8ESTE 5AIPA 1V5EA 2R7TA 3WE3A 1VQOI 1O39A 5FX5A 4CBOA 2L02A 3S1RJ 4XBCA 1R22A 1WJBA 3SZTA 5FB2A 2DBBA 4M73A 1DANH 2E19A 4O9VA 1D3QB 4C2UA 5F1RA 3H5NA 2ZCLP 2K9QA 1AN1E 4OGYA 1XUHA 2L7ZA 4WJG2 2V0BA 3VOEA 1OHHD 2XWBI 1K1MA 1PPCE 4WVPE 2WC2A 1LHCH 3M35A 2G81E 1G30B 1ETRH 2JMWA 2LK2A 2FX6A 2JA5J 3F8MA 3RXFA 1W7XH 5DGJA 1D1CA 2WAEA 3CJNA 4NC6A 1OS8A 4Q80A 2GA1A 3SNDA 4X1NU 2Z5UA 1WKMA 3DQVC 2XC7A 3GY6A 4YIFA 4IC6A 3W2AA 2GD4B 2NWNA 3I59B 4B74A 3PMBB 1ETVA 3SU4A 1FN6A 2OUMA 3N4MA 1JRSA 1Z21A 3LT3A 2QAAA 1DITH 3FP7E 2AQEA 2IGKA 1RFNA 3Q3KA 4FE7A 4TPIZ 2UUJB 2F5DA 4UONA 5IPAA 1CGHA 3BROA 1Z77A 2P59A 4QWQA 3LMMA 3E8LA 1QB1A 1J7KA 3GTJJ 3C2BA 2R7UA 2ANWA 1MAYA 2VWMA 2VIQA 3B6CA 2W3KA 2H1KA 1DU6A 3TGIE 1O3GA 5D6EA 3D49H 1MGTA 2G9WA 2JSCA 2V9PA 1B72B 1C1UH 2PFBA 3UUZA 1HXDA 3A0HC 3CC2I 3N97A 4IBLH 3HBLA 4ITVA 1QQIA 5DS9A 4GCHG 3SU6A 2RVCA 3F8CA 4BY1J 2B0FA 4CZCA 1QJ7B 3MTYA 5M3FJ 2PKAB 1D0YA 1SD7A 1SGCA 4PFOA 3BC8A 2ISYA 1JGGA 3X2QH 1YKTA 2P5KA 5T3HA 2JJ1D 5L6NH 1S8NA 1YC0A 2A6TA 3FXQA 1JHFA 1SMTA 4D5CA 4AORA 1O3CA 2M2EA 5T6DA 1XB4A 3OEED 1P7IA 1RI7A 1WVRA 1EX3A 1K83J 4Y76A 1FBQA 4Q4ZF 3AK5A 5TGTA 2BQ6B 1DS2E 1DWEH 3SZGA 2PJRB 2DFFA 4H42U 2R7RA 3S69A 2VJ5A 1TX7A 6CHAB 1K1OA 1OCZH 1BT7A 2A4QA 2GX4A 2IOTA 3TP0A 1P7JA 3NXPA 5DO4H 3E1SA 2YSRA 5DM6F 4M3GA 1U5TA 2X1EA 1T8LA 1LDTT 2KX4A 1W0KD 5HYOA 4KT5C 5B5EC 5FBIA 2X9DA 5HVQC 3JRFA 3REOA 2BZTA 3HSFA 4II3A 4HQMA 2XV4S 3W2WA 3JTGA 1KXAA 4D0PA 4JOMA 3HKZN 3LH3A 1UG2A 1O3OA 4LJZF 2ZQ1A 2IJOB 4HDUA 2FS8A 1C5YB 2J38A 5HNHA 4Y52J 3UWJH 3CS0A 1C5PA 2BLVA 2YMSC 1TIOA 2WUCA 2AS5F 1NS3A 1SOZA 1FC3A 4MFEA 1F5KU 3SUEA 3PM1A 3LQQA 3BG4C 3NPSA 4FETA 4K5ZA 4WWYA 2DW4A 2E36A 5IP9J 2BGCA 1QHGA 3M5NA 3GF2A 4GSOA 2KFWA 5GNDA 4F91B 3A82A 4MQAA 1O3QA 2G7HA 3STIA 5AIQA 1GVZA 4U01A 1UELB 1FYLA 1TZLA 3WE2A 2LYCA 4ZH8A 2PWXA 1UHWA 1BTUA 1IQJA 4DZPA 4IGDA 5TRDA 1BA8B 4Y7BA 2XGDA 4WXDA 2VN2A 4BE2A 1TNSA 2WV9A 1LUJB 1EOJA 4MG3A 2KFDA 5J4SA 5DM7F 2GJGA 5J4VA 1Z6RA 1EF4A 5KAIC 3RCOA 4DOQA 4XBBA 3T8RA 3KX2A 2JKHA 2BLQA 1F7ZA 3ZZDA 1C5UA 4TYDA 3BR6A 3SI3H 5BPDA 1C1NA 5HOOA 3FKJA 3TITA 2YS9A 1V4RA 5A09A 1IUFA 2R0LA 3F9FA 1NH3A 2BDGA 2EIKH 4IL6C 4I31A 3UNSA 4WMEA 5GCHG 3TLOA 1FWZA 4OGXA 1IV6A 1KA8A 1OWDA 2HYGD 4BHCA 2WAQA 3UKGA 2VI6A 2V9KA 1GI4A 3QRFF 1N6XA 3SHAH 1TRYA 2F9PA 1U9OA 3KETA 3KN2A 5A0CA 4ABZA 3DWLE 2L0KA 4IQ4A 2QXJA 2Z3YA 1EB2A 1OP2A 2L5QA 3N7EA 1ZTLA 3V8LA 1ZJDA 2PJPA 4AM3A 3V7CA 2WAFA 3M8JA 3L2VA 1AHDP 3LC5A 1SG8B 3OOPA 2A2QH 2LF7A 4Z6AH 4ESBA 2VB6A 3BZCA 3P8OA 4HEA2 5HNFA 4I8LA 1ELCA 1BTXA 3KEQA 4KT6A 2I5UA 3ZQFA 2E35A 4M3BA 3GW2A 3TW7A 1YJNI 2B7DH 4RMNA 1LQDB 1ZRKA 1ELFA 4YG2F 2KKOA 2DQLA 5EOKA 1I39A 1F0TA 4PCQA 4RGXA 2HYFA 2K3FA 2BLWA 4ZXXH 3WGIA 4XR6A 3S1QJ 1IDYA 1P4XA 4I02A 2BX4A 3LGWA 2C8ZB 1KY9A 2KL4A 2ZFUA 1V2OT 4BJTA 1X4PA 2XXLA 2QQ8A 1MMDA 1SGIB 3VB2A 4Z2YA 1R4NB 3H36A 3IKTA 2DT7B 5J1RA 4DY7B 4BJ5C 2FBHA 1Z8RA 3BCBA 2BW3A 1KONA 1V2ST 2GIVA 3CCRI 2Z3EA 3TGJE 5ICEA 1MABB 1A04A 1T95A 4JZEH 5B3SH 1DWBH 1QL8A 4L9TA 3KYDB 4JZ1A 2M8EA 1B8IA 3TH2H 1YYVA 1IQLA 1XS9A 1V2WT 3RC4A 1TNHA 2A0QB 2BE5F 1HAGE 2YR2A 2H8RA 2EB7A 2BQ7B 5IOYA 1FIAA 2HU9A 4PUSA 1Q31A 2MA3A 1WSUA 2WSSD 2GA2A 2VPRA 1QRZA 4AC0A 1D5YA 1AD8H 5KVRA 1JWTA 1NU7B 1F4KA 2Y5HA 4OM9A 1CE5A 1BJUA 1RPWA 3SNCA 1W5TA 3TL4X 4DVAU 1RTFB 1YW9A 1EJMA 3SJ9A 2FF4A 1S7AA 4BXWA 1XVOA 2PMZA 3S9CA 1L0ZA 4CRCA 4XRFA 4I2OA 2RA3A 1P2MA 4BAHB 5EF6A 2BD7A 2AGIX 3CNRA 5A2QZ 1T31A 5C20A 4UHTA 1CHOF 2XGXA 1O3IA 1AZ8A 2FMLA 1KMHB 3CCYA 3SO3A 1MNMC 1ELBA 2D1VA 4O3TA 5HLIA 2A6HF 1XUFA 3RM2H 2NS0A 2R3YA 1DU0A 1DX5M 4BXSA 2Y0SA 1O2QA 3O2PE 4BU2A 4E7LA 2E5ZA 3SYJA 2HEOA 1S85A 3NEUA 1EZSC 4UUSB 2O8TA 1FY5A 2CV0A 3SGBE 1G3WA 2CSOA 4A3IJ 3FOAA 3ZMTA 4FUBA 2Y2ZA 1G59A 2ZPSA 3URCA 4JX6A 2DCEA 2KZVA 1SR5C 4M74A 3ZR8X 3HOSA 2VPLA 4AYVB 4KKDA 1AVXA 1FNIA 3BTME 4LG0B 3BJ6A 4PJLA 1DPUA 1K6OA 3I54A 4BL0B 2R2WU 4X6MA 2BBYA 2IRFG 1UTKA 1ZGJA 2ODYB 1FAKH 3IAS2 3SUGA 4BXUA 4LD5A 2R92J 3F22A 2M9HA 2XUBA 1O30A 1TGTA 3N7DA 3KP7A 3R0AA 4KICA 3OTJE 2VT2A 2LC2A 4YM9A 3SEZA 1WH5A 2A5WA 2SFAA 2DT5A 3BOQA 5DDGA 1O2SA 3T29A 2CQ7A 1ENHA 4YRVA 4K1SA 2HTJA 2TPIZ 1XUGA 1NFUA 2RV8A 2KZ4A 1G36A 2LP0A 1R49A 4KYWA 3RMNH 4RDUA 2L4AA 1SVOA 5FGMA 1ZRDA 1GL1A 5DSFA 1V54H 2DTZA 4CR9A 2NNYA 4M6XA 4XRSA 3KEYA 3IV5A 3R61A 4GPGA 3PV4A 3GTGJ 2JQ7A 3P6ZB 3JAMZ 2PLXA 5J8FA 2B63J 4ZH4F 1B0EA 3OYNA 2ESNA 4OU0A 2OAZA 1ZRCA 1RTLA 3MKZA 2M1BA 2OC1A 5BPIA 1KDQA 2QUFA 2R0KA 4OS4A 5GPIB 3BPVA 1S6FA 4F55A 3LJJA 1GMCG 2W3IA 2SGPE 4JP0A 1SFEA 2H6BA 2ZHFH 2QEXI 4BTTB 5TJXA 3IWFA 3QP6A 2W25A 4H4FA 4F3QA 2DFEA 3ZZ7A 5CPRB 1P6RA 2FI5E 4Y8XA 3EDXB 5CHAC 2ANMH 2DA5A 2YNAA 1G3CA 1GJ6A 4ASHA 3VODA 4UFEH 2P94A 1O2TA 5DKMA 1TC3C 4KTSA 1YIJI