2IPQX

Crystal structure of c-terminal domain of salmonella enterica protein sty4665, pfam duf1528
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
121
Chain Sequence
LSSTELGDLFWSWLRDGLREGDIPVNTADACVHLTCGFVFISVPGVFFLFLKSHGRKEQVQAAFEKMRKHRVSDSRRFWQCCLYEEPGGRGRYKKLTGYLIKMSEIYNGNFPDDSLFLKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of C-terminal domain of Hypothetical protein STY4665
rcsb
source organism Salmonella typhi
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein STY4665
total genus 29
structure length 121
sequence length 133
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07515 TraI_2_C Putative conjugal transfer nickase/helicase TraI C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ipqX01
2.40.10.200 Mainly Beta Beta Barrel Thrombin, subunit H STY4665 C-terminal domain-like 2ipqX02
3GO5A 1QPMA 1DUXC 5H6RA 4CO8A 3LA2A 2FRHA 1ZYRF 5LRSA 2IT0A 2D1VA 3MWMA 1QQIA 4G6DA 1K79A 3F3XA 2F5DA 4RB0A 4ZZLA 5D8KB 5LLQA 1TNSA 4DNCA 1U78A 4KFCA 1NHAA 2MH9A 1Y0UA 3E5XA 1KU7A 5J8CA 4L9NA 2UXNA 1ON1A 3K1NA 4QWQA 4WF2A 1USSA 4IRIA 1S3JA 3V7SA 2ISZA 1U2WA 2NRAC 1I5ZA 1KA8A 2FSWA 4LLNA 2NNYA 1LJ9A 1Z6TA 2EJRA 4M74A 2MD5A 4AIHA 1AWCA 1XCBA 2XAHA 4HQMA 4P55A 3P9CA 5LGUA 4EM2A 1ZGJA 2D45A 1HQCA 1B9NA 3SZPA 1R22A 3JAMK 2Z9OA 2GA2A 5J8FA 5FO5A 4WXHA 3NQOA 1J9IA 2JRTA 1W5SA 1ZRDA 5E8GA 4HF0A 5L3EA 4D0PA 3ZMDA 5L3DA 4E70A 1R1TA 1IN5A 2FMYA 2HZTA 2YX4A 4MQVA 1SAXA 4WX9A 1U5TB 4P96A 1XCVA 4G7ZF 2PN6A 1IN7A 1YLFA 5DV5A 3WTWC 2QENA 1JE8A 5D8LB 2H94A 3EETA 5DD8A 2LF8A 1SFXA 2L02A 1GXQA 4XSZF 4DQ2A 2VODA 1LQ1A 3T5XA 5FLXK 1W7PA 1D8KA 4YIIA 1YS7A 2XIGA 2XAGA 3C3WA 2EV5A 5AIPA 1SMTA 4CICA 1O7FA 5JHUA 4L0YB 1BC8C 2P5LC 1O3QA 2YX7A 3NEUA 1KU2A 1IN4A 1EH6A 3SQNA 2F5EA 1L3LA 1ZLJA 2QUFA 2YPRA 2HOEA 2IP2A 2A6HF 2HTSA 4HLXA 5LEKA 1I1SA 1HKTA 1B1BA 1FBSA 3BPVA 2NS0A 2G7UA 5KVRA 2L54A 5HDGA 3E3VA 3HYIA 2DK5A 4EJUA 2IA1A 2Y48A 2AXLA 3ELKA 2EFWA 4XLNF 1R5HA 4JBAA 4L9TA 2ZMEA 1UCRA 5HVQC 4EMSA 5F1RA 2DAOA 2L4AA 1MDMA 2BYVE 2HKOA 1ZAOA 3J7AO 3WU1B 3FX3A 3HUGA 4G7HF 1CF7A 3IHUA 3COAC 2WTEA 3P7NA 3VODA 4HX4A 3K1MA 4KMUX 1FYLA 4PDKA 5FFXA 1MZBA 1G3WA 4I7HA 1KQ9A 2ZJ2A 4KT5C 3T1BA 1G3TA 3WTXC 2ZKZA 3ZP5A 1FBQA 3FHZA 1KQ0A 3WU0A 2MC3A 1H9GA 4UUVA 5DCFA 2A61A 3CJNA 3L9FA 3VB2A 3FMRA 3GX4X 2ZBKA 4HAMA 5A2QK 4CXFA 5D5VB 4EJWA 4EGZA 5LHIA 4L0ZB 1IXCA 3HRSA 3TO6A 3V8LA 1STZA 3LAJA 1LVAA 2JSCA 3IRRA 2E7WA 3L2CA 3WGIA 5HDKA 3F8BA 2UZKA 2FE3A 4HF2A 3R6SA 2EB7A 1ZREA 1MJ9A 3FXUA 1EV7A 3SFZA 2UWMA 2H27A 1HSJA 2P7CB 1WI9A 1XMAA 1HSTA 4YFNF 2KJBA 1IZ1A 4L9JA 1B59A 2O3FA 5A2QZ 1V4RA 2VBYA 2Z33A 1CGPA 3BWGA 5CVIA 3QPHA 5LGTA 3DFGA 1YFHA 3QU3A 1XSVA 1MDMB 4UXNA 3DPTA 3KP4A 3D5LA 5ICGA 4S04A 1BI2A 2K27A 1MGTA 2IW5A 4HQEA 3BJAA 4NB5A 3WTZA 2FNAA 2OA4A 3LA7A 1OPCA 3FWEA 1UHWA 3CUQA 1QNTA 1IW7F 1R00A 4KN4X 4BHPA 1ZRCA 3PQKA 2MA3A 3P9KA 2GQQA 5HDNA 2BE5F 1SD6A 5D5XB 4U0VA 2JZYA 3KE2A 2J5OA 5L3CA 1FP1D 4M6YA 1AOYA 2L4MA 1PP7U 5BMZA 1B9MA 3QPTA 3KEOA 4I09A 1OKRA 4LGWA 1ODDA 1RUOA 1XMKA 1OYIA 3J81Z 3LSTA 1BIAA 2O03A 4R8HA 5ICEA 2DPUA 1WRJA 5HLGA 6PAXA 1S7AA 2C6YA 1XDUA 2ZNYA 1WWXA 2L01A 3ECOA 1W7PD 3WE3A 4LLLA 4B09A 5JR3A 1IAWA 1WQ2A 4OIRF 2F2EA 2LNBA 3JSPA 5CJ9A 3F72A 4LG0A 1KGSA 1G4DA 3WTSC 2F5FA 3F21A 4GXOA 2CO5A 3V4GA 1D5VA 3WODF 2PMHA 2V79A 3WTVC 1YG2A 4LG0B 1OMIA 3E5UA 2ISYA 1BI0A 1IRFA 4PGGA 2F5CA 4GYIA 3R61A 3QP6A 1R7JA 4MEYF 1XGOA 1J7KA 4M71A 4GCVA 2X4HA 3KCCA 4HDUA 3QRFF 5LBQA 1MD0A 4GO1A 2OQGA 4IF4A 2CQKA 1BI1A 5HS7A 3RKXA 4YIFA 2BEOA 2PFBA 1XN7A 1TLHB 1S8NA 4EQQA 1ZLKA 3BDDA 5AONA 1O3RA 3JAMZ 3VOEA 2H09A 2OBPA 4ZYHA 4XBFA 4HYEA 2FOKA 3ZN0A 2QWWA 2EFPA 5HLIA 1XB4A 2EK5A 2FF4A 5EEGA 3BROA 3C7JA 5LGNA 1ON2A 2RN7A 1ZG5A 5EEHA 2DBBA 4B8XA 3M9AA 3VFZA 4ENMA 3KP3A 2VC0A 1T39A 4M9XA 3WE2A 5CVRA 3R60A 1PP8F 1IRGA 1USTA 1LNWA 4LB6B 3R0AA 4BHCA 1P2FA 5K1YA 1GXPA 5ILVA 1SD5A 1EH7A 3FM5A 1XGSA 3FZVA 5HS9A 1R1VA 2FEZA 1O57A 4UVAA 4P9UA 3E5QA 1ZGAA 2HWVA 4LFUA 1FNNA 4R1HA 3RYRA 4AVPA 3I54A 2V6CA 3V7RA 1LEBA 4EV0A 2QQ9A 3HRMA 1IF1A 1Z6RA 2HEOA 3P9IA 3RTRA 1LB2A 4A6DA 1REPC 3FF5A 3HSEA 3AAFA 2VOOA 2WV0A 4KUMA 2BV6A 1BOAA 3FMSA 1KYWA 2DTRA 4ZH4F 1G3SA 5K5QA 4IHSA 3K2ZA 1KU3A 2V1DA 1HW1A 4LD5A 3REOA 1RZ4A 3E6DA 2P4WA 3TDUC 5E1ZB 4IRGA 2CW0F 1MKMA 5HLHA 4UNOA 2XASA 3QAHA 4U7BA 5KK1A 2ZO4A 1A04A 2K02A 1RIOH 3QOPA 3I5UA 1I6XA 3V8KA 4U0WA 2E1CA 2OU2A 3HSFA 1GHCA 1QZYA 2KRFA 4HBLA 1K7AA 3TDZC 3PFIA 3L00A 2Q0OA 4IXAA 2OZ6A 2K7LA 4CYDA 2LF7A 4A6EA 1P4AA 3K9TA 1D3YA 2GAUA 5ED4A 5CVVA 3TO9A 4HW0A 2JT1A 3E97A 3LQQA 5CVUA 3VEPA 4CHUA 3S2WA 3TGNA 2XV4S 4RB1A 4UVBA 2W25A 1B6AA 3TKYA 3F8MA 5BOXA 2HR3A 1UB9A 4AIJA 2DI3A 3KP7A 2IVMA 1DPUA 3RPQA 3V8JA 1OR7A 1EH8A 5TJJA 5K5OA 1ZG1A 2EV6A 4HX7A 2R3SA 3H3ZA 3BY6A 1R36A 2LDUA 3WTUC 2WC2A 4KMFA 1E2XA 5IT3A 2K4BA 4A2UA 2GA1A 2V1XA 1GVJA 3GWZA 1G6NA 4EVIA 3J80Z 4LK1F 4P5OA 2RV8A 3HHHA 4MGRA 2PEXA 2DQLA 2DQRA 4HF1A 5FLXZ 4ESJA 3ZMTA 2XKPA 3ZPLA 2PI0A 2P8TA 3PQJA 4OIQF 4MEXF 4RB2C 1RNLA 3M1EA 4UHTA 2D1HA 1Z7UA 5H20A 2KIUA 5FD6A 1BIBA 4Q4ZF 3RI4A 2ETHA 3FM3A 2J5PA 4L9VA 1ZARA 3ZN1A 2EFQA 1PUEE 1Z05A 3WTYC 3BP8A 3N4MA 4HV6A 4IVNA 2W24A 3DPLC 2PMUA 1JXSA 1BJAA 1IXSB 1HXDA 3K1PA 4ESBA 1T98A 2M1BA 3G73A 3JTHA 3RJPA 4Z2YA 4BNCA 3MQ0A 2Z99A 1FBUA 2VOPA 2ZNZA 2MLGA 3KZZA 3DQVC 2HKXA 2Q2EA 4CZZA 4FHTA 4RAZA 1D8JA 4RB3C 3I59A 5JFRA 5FGMA 1E17A 1J5YA 4Y13A 3M8EA 5DEQA 3F6OA 1BI3A 2CSOA 4BAYA 2CG4A 2XKOA 4L18B 3MZHA 2NYXA 1QO0D 2OD5A 5D5WB 2RQPA 4I0AA 1K78A 1F5TA 2KKOA 1FX7A 4Q5SF 5BPDA 4KYWA 5DCMA 1FY7A 1YS6A 4ZYEA 3J80K 1FYKA 2EV0A 3IKVA 2JPCA 2PQ8A 4YFKF 2VBXA 1RI7A 3MEXA 5FB2A 3WGHA 1KU9A 2XVCA 1F9NA 4O6JA 3QU6A 4I02A 3TQNA 3L09A 2XAFA 4LJZF 4U7DA 1S29A 3T8TA 5HS8A 2XGXA 3N97A 1R5GA 4BXUA 3GFMA 2WWYA 4BHBA 2O61A 3OOPA 2PJPA 4A12A 1FC3A 3V7CA 3HSRA 3KP6A 3M8FA 2LSOA 4L5JA 2D2WA 2ACJA 5BS6A 4IPAA 2B0LA 4RGUA 2A69F 2QLZA 2R7FA 2X0LA 3GEZA 2QZ8A 2FA5A 2VT2A 2M30A 4N9HA 4JK1X 1YW7A 3O6BB 3SXYA 1MJAA 1IN8A 3G3ZA 2O6GE 3ECHA 4MQ9F 4PGHA 3GVAA 5DUKA 2P5KA 1TBXA 3JSOA 4M9SA 5CYVA 3GZ6A 1XGNA 5JVTA 2HTJA 4CDGA 1SMYF 3RKYA 2A68F 4NHJA 4UV8A 2IJLA 3ZMZA 4GYGA 5DCMB 2RVCA 4UV9A 4OIOF 1XGMA 3IWFA 2MLKA 4P9FA 1ZN2A 3E6MA 2M87A 2A07F 1IUYA 2EA2A 1Z9CA 1J0RA 1XD7A 3RIRA 1S6LA 1IXRC 4PZJA 5D5UB 3RPUA 5LRRA 1I27A 1U6GA 1H9TA 1RUNA 3EYIA 4AD9A 2L3DA 1FP2A 3BOQA 3F8CA 1V3FA 4I0BA 3DF8A 4A5MA 1FYMA 5D4SA 3I71A 1P92A 3F8FA 3GXOA 4I2OA 3BZ6A 3RKWA 3LA3A 2G9WA 1ZHFA 3H3UA 3GZ5A 2CWEA 5E8IA 2ZFWA 4N9IA 4OOIA 1F1ZA 3ISPA 3FXQA 3DXJF 3ERED 1O3SA 2AS5F 2HFHA 4PCQA 1TNTA 2IRFG 4BQAA 2H6CA 1XSXA 5DUIA 2P6SA 3F23A 2YR2A 3FMQA 4KIBA 5BPIA 2KIFA 4RGSA 2DW4A 2FBIA 4WXDA 4RGXA 2IA0A 3WG9A 2ZXJA 1IN6A 3HOTA 1ULYA 3CLOA 3LQRA 4WK8F 1DDNA 2VN2A 1TQMA 1YO5C 3BJOA 2NAZA 2PLYA 5ICCA 4ESFA 1U5TC 2NNNA 3KZYA 4L5IA 3KQ5A 4WXCA 2STTA 2OAZA 4G94A 3JTGA 1R1UA 3R4KA 3HOSA 4XRFA 1YW8A 2FU4A 1ZH5A 1YYVA 1SD4A 3ZQ7A 1HBXG 3TOAA 3KP2A 3TOBA 4Y15A 5AIQA 4I01A 3SZTA 4ZZDA 3K0LA 5J6XA 4UVCA 2Q8KA 2GIVA 2K4JA 4OU0A 2XROA 1Z91A 3MZYA 1SFUA 1FWZA 4A0ZA 3WGGA 5BQTA 2Y75A 2O0YA 5D6EA 4OMYA 1MJBA 3LFKA 2DU9A 1YQAA 1W4MA 4AWXB 1LDJA 1BC7C 3DEUA 3KP5A 2VC1A 5DYMA 3F6VA 1UFMA 4TV7A 4M73A 4R79A 3I0TA 3ZMUA 1BBYA 3DKWA 3EUHA 4XSXF 3EYYA 1OYYA 3SHFA 2E7XA 1J75A 2FNPA 4FT8A 2G7HA 1LDKB 3CUOA 2V1UA 3HHGA 3IWZA 4N0BA 2XRNA 4LB5A 2JPBA 5D6FA 4A0YA 1LEAA 3Q9VA 5HOOA 3B73A 4G7OF 3KETA 5L3BA 4AIKA 4ENKA 4G6QA 3C18A 5K5RA 3GW2A 4JQFA 3ULQB 2CGPA 4OMZA 3IL2A 2GXBA 4BYYA 2MBFA 2EWNA 1Z1DA 5JI6A 2BGCA 3E6BA 2VE9A 5ILUA 2DLLA 3U2RA 5ICFA 1PDNC 5FFZA 4EM1A 1HKQA 1TW2A 1LDDA 5LHGA 2P5VA 3GFLA 2Z3YA 4YG2F 5DD4A 4FX4A 2DFIA 1BN5A 1H0MA 3I4PA 4KIFA 3C1DA 4QLCU 3W6KB 1O3TA 4U0YA 3ZMSA 2VXZA 3DV8A 5L3GA 1UHMA 2HGCA 4M9ZA 5F64A 4RGRA 1L0OC 2ESHA 4RAYA 2RGVA 1R23A 3EQLF 2W57A 3ABUA 2P6TA 3HTUA 3CUQC 2EA4A 2ADUA 4ZYDA 1DP7P 1P4WA 2IPQX 1S7OA 1U8RA 1U5TA 2EFNA 2VBWA 3MAJA 3K69A 1X3UA 2KJCA 1T6SA 3R0JA 3HIFA 3RYPA 2W84A 1YW9A 4RS8A 3JW4A 3F22A 3ZMVA 3IC7A 3T8RA 2E1NA 1U3EM 3J81K 4BH9A 2RNJA 5IT9K 1HW5A 3ABTA 2FXAA 1W7PB 1I1GA 1FPQA 3HRUA 4F7ZA 4NQWA 1FSHA 5L3FA 4IRHA 2W85A 2DPDA 4HA8A 4OINF 2UXXA 3IRQA 1J2XA 2M5WA 4A0XA 2HS5A 5LEJA 1J59A 4KNYA 5DDGA 5F6FA 5FD5A 5E1XA 2FMLA 4O5VA 4HDVA 4G8XA 2STWA 4MTEA 4LMYA 4IJAA 5CLSA 3BJ6A 2GZWA 1TQPA 1FZPB 4IHTA 3HTSB 1DPRA 2V9VA 2QM3A 2FBHA 3GYHX 2XUBA 3MFKA 1R58A 3I53A 5LHHA 2HYGD 1JHFA 4GGGA 4KICA 2OQRA 1OYWA 1ZG3A 1W5TA 1YTYA 2PG4A 4EGYA 1YIOA 3GFIA 2QBYA 2HQNA 2KIMA 4HLYA 2H6BA 1CF7B 2FQ3A 3TO7A 1FT9A 3T0YA 4FX0A 4MHGA 3WTTC 2QBYB 4EM0B 2YU3A 2FBKA 2COMA 2VE8A 3LAPA 1P6RA 4HZFA 4ZYGA 4YFXF 5E20A 4OIPF 2O8XA 2A3SA 2XAJA 2QYOA 3L7WA 3OV8A 4HX8A 1FLIA 3H92A 1F4KA 3M7GA 5CVJA 3I59B 2CYYA 2DT5A 4O3MA 2ESNA 3KLNA 3KFWX 1WSUA 1WKMA 4Y17A 1B4AA 1FOKA 1TTYA 1VTNC 4ON0A 2Y0MA 2GWRA 2R7DA 2QQAA 4M72A 4ENJA 4WCGA 1QBJA 4ETSA 5E1WA 2M45A 1HW2A 3B02A 3D0SA 3ML6A 1JHHA 4A5NA 2OZUA 3KLOA 4KDPA 1T2KA 1G3YA 3CTAA 3I64A 4G9YA 2DK8A 1P4XA 2VT3A 4CGZA 2TDXA 3DP7A 5H6QA 3RDIA 4KA4A 1T38A 1FSEA 4Q47A 4EJTA 4MNUA 2DO7A 3GLXA 5IT9Z 3O3KA 2A6EF 3I58A 1K6OA 3GUDA 2EFOA 2MH2A 4ENNA 3QP5A 2CFXA 4Q48A 2QVOA 1XSDA 2Z5UA 3MCZA 2ZCWA 3GFJA 1KQ8A 2LKPA 3ROUA 3IKTA 3CO7C 1C0WA 4S05A 2IA2A 3FXRA 2XAQA 2RC4A 2ELHA 2HYFA 1BM9A 1Q1HA 3Q9SA 5E17F 1ONVA 2A5YB 1ZRFA 2BBYA 3CDHA 4ASNA 3U1DA 3CO6C 4HOBA 3HRTA 3CUQB 4M6XA 2P7VB 2VBZA 4XLPF 1TW3A 3EDPA 4HV5A 2QQBA 2RDPA 1O7LA 1HKSA 1T0FA 3Q5FA 4WWCA 2HQRA 5D4RA 3BPXA 4I98B 4EJVA 1JGSA 4EJOA 3GF2A 5TRDA 4H0EA 5E18F 5ERIA 5ILSA 3NRVA 1QZZA 4U88A 1QGPA 1XDSA 3E6CC 1SD7A 3O2PE 4K2EA 4KIGA 2PBIA 2K86A 2HDCA 3U9GA 1TQIA 2XHKA 1SFEA 4MTDA 2GXGA 1K78B 4LK0F 2RKHA 3KEQA 2VONA 2YSRA 1KYZA 2JTVA 3LWFA 2M8EA 4LLGF 4KN7X 3W6JB 3F8NA 2ZMEB
chains in the Genus database with same CATH superfamily
2MW8A 2NU3E 4NA9H 2G81E 2RDEA 1HAVA 3LDXH 1U8BA 2HOTA 1RRKA 2FOWA 3LC5A 2DFHA 4B4CA 3BQZA 2F5DA 4RB0A 2HU9A 4JZEH 1TNSA 4ANJA 4DNCA 1U78A 4XLEA 3L33A 3SNAA 1Y0UA 1RRJA 3BTKE 4CH2B 5FKMA 1ACBE 5EPNA 1Y8QB 1AU7A 3STJA 1T7CA 4WF2A 1WH7A 4IRIA 5CQGA 3CMAI 1S3JA 3V7SA 1D1AA 3RXBA 2V1NA 2BVXH 4E6KG 3BCBA 1TX6A 1V2TT 1LJ9A 1W36D 1Z6TA 3CJTB 4O9VA 4Y10E 2MD5A 3L2UA 3P92A 2Y81A 1BRBE 1ZGIA 5LGUA 1OYQA 4EM2A 1HGTH 2BHYA 2UWPA 1IQMA 3P6ZB 4ISIH 3H35A 2STAE 1TT0A 2GA2A 3C1KA 2B9SA 4WXHA 1QCPA 3NQOA 1OKXA 1Q31A 1K4SA 2DA4A 1A46H 4RDUA 1TWAJ 5L3EA 4D0PA 2IBDA 4E70A 3MMGA 3RXUA 1NRPH 4U2WA 3A80A 3SV6A 3HOXJ 1R1TA 4ABGA 3BTHE 1N75A 4IHYA 2Q6GA 1SAXA 4B6FA 1TMBH 5FKNA 3A82A 4FQGA 1S84A 5EGMA 1IN7A 1YLFA 2NVYJ 3QOEA 3WTWC 2QENA 1JE8A 5D8LB 4YELA 3EETA 5B1AH 1OP0A 2GBYA 5DD8A 2LF8A 2GOXB 2VNTA 2VJJA 2VKVA 1O2NA 1D8KA 3BV9B 2XIGA 2XAGA 5J4SA 4DYCA 5AIPA 1GHAF 1SMTA 3IAM2 5JHUA 4L0YB 1NFUA 1BC8C 3B6CA 1KU2A 1IN4A 1C2LA 2ZDAH 2QUFA 3S3OA 3OU0A 2W3IA 4GCHF 2HTSA 4HLXA 5LEKA 4TPIZ 1YYY1 1FBSA 1TNLA 3BPVA 2TGAA 1GHZA 3B9FH 1TX7A 4D1QA 1FMGA 1C5PA 5KVRA 2L54A 5HDGA 1AE5A 3E3VA 3BG5A 1P2KA 4J1YA 1ETSH 2Y48A 4MO7A 2IN2A 4XLNF 3ZZ4A 1C1TA 4X1NU 2LC2A 2OCEA 1SQOA 1TBRH 2CS3A 2ZA5A 3J7AO 2Z9KA 3HUGA 1NS3A 2GDDA 1ZPZA 1BTXA 3SDGA 1KMHB 3CP7A 3COAC 3P7NA 5C0UA 2A5IA 4FUFA 4HRIA 1WJEA 1HIAB 1S6FA 1Y8RB 1MZBA 4C30A 4I7HA 5JHFA 1KQ9A 1B72A 1G2LA 1G3TA 1CGHA 2ZKZA 1S0QA 1F2SE 1E34B 3FHZA 2AFQB 2L74A 3V0XA 5J40A 4ACBA 2MC3A 3SJIA 3MNCA 1H9GA 1O2OA 2ODYB 2HNTE 3L9FA 3QZQA 1ARBA 2ZBKA 3PROA 2AMQA 4I99C 3ZQQA 1NRSH 1EQ9A 2BDGA 1S7EA 1UVTH 3SOSA 3UNQA 3VPRA 2FM2A 3L2VA 3SZGA 3L2CA 4ZTJA 1AHDP 1YOVB 1ESBA 3T27A 3F8BA 1P57B 3DBHB 2MGQA 1MKXK 1P7JA 1I39A 1JKRC 2ZJQF 3Q0WA 1PUFB 2DMTA 3WY8A 1HSJA 3RC5A 1XMAA 1YCPH 1YRNB 1H8DH 1QL9A 2UUKB 2X6WA 2X6YA 3A01A 4IMQA 1HLVA 1MBFA 3BG4B 1V4RA 2Z33A 1CGPA 5GP9A 1HAOH 1X1BA 3QPHA 5LGTA 5C20A 1MDMB 4UXNA 3D5LA 1FIWA 2AGGX 5ICGA 3VEQB 3FOAA 3ABLH 1PUFA 4BOHA 2ZGHA 3BJAA 1LE8A 1K1LA 2OA4A 1QURH 1OPCA 1UHWA 2Y5GA 1SC8U 1NTCA 2MA3A 5HDNA 1BQYA 2JETC 4YOGA 4BAKB 4VGCC 2F4LA 3EA7A 2QC2A 1YWUA 5C4XJ 2GTBA 4R0IA 2FX6A 1YPJH 1AOYA 1N8OB 1XX9A 1FX0B 3WU2C 1PP7U 1Z8GA 5JPMH 1D0ZA 3SORA 3DD2H 3QPTA 3KEOA 4XOTA 1INCA 1AVWA 1XMKA 1RUOA 1IOEA 2AIPA 2I6SA 1BIAA 2LR8A 2O03A 2FS9A 2HVYB 2SNVA 3QYBA 5HLGA 1S7AA 1O2WA 4LLLA 1PPFE 2ODQA 3H9GA 4OIRF 2LREA 3BR2A 3JSPA 3NCLA 4B1RA 1G4DA 2GT8A 2XBVA 1OCRH 1IC8A 1SKYE 4AZ2B 2Y0SN 2BLVA 3Q3YA 3NKKA 4H4KC 3SNDA 3WTVC 1MH0A 4LG0B 3BTLA 1OMIA 3JRGA 3DLLF 4CHAB 2R5YB 2C4FH 1SFIA 3PWCA 1BI0A 1IRFA 2QSHX 2ZU3A 3R61A 4AG2A 3GCHC 1ELAA 4M71A 5TGTA 2X4HA 3TH3H 1MABB 4TSFD 3HB9A 1EZQA 1LVKA 4THNH 1O2MA 4H6TA 5LBQA 1TNHA 4GO1A 4ZKOU 2BM2A 4IF4A 2BZTA 1LPGB 1QY6A 4C2TA 4RA2A 1XN7A 2J4IA 1TLHB 1FAXA 1L4ZA 2ZP0H 1P05A 4U87A 5B1BH 4JX4A 1R4MB 1VITF 1P06A 3DLAA 5E2PA 3VOEA 2ZPRA 3RXIA 5T6DA 4ZYHA 1ELTA 2NU0E 4ABBA 1XM1A 5EXNA 2FF4A 1C9PA 3PUFA 1POGA 3M36A 4B8XA 1MTSA 2YUSA 1MAYA 1USTA 4BAMB 1GHYH 1Y3VA 2P59A 2XBWA 1Z71A 3VXFH 3QQAA 4XLHA 4OS5A 1WHUA 4I8GA 1TC3C 4GAWA 1R1VA 3G2BA 5JBAS 3RPUD 1FNNA 1TZLA 4E06H 3RYRA 4A6LA 4MNYA 4YEJA 2OXSA 4F55A 3V7RA 1OP2A 1LMWB 1W10U 2HOBA 2HEOA 1FMVA 2A7HA 3U9AH 1QB1A 1OFCX 3FF5A 4B3XA 3RXPA 2XC7A 3PWBA 2WV0A 2CJIA 1X1PA 2C8XB 2BD8A 4ABIA 5K5QA 3ODFA 1JOUB 1KU3A 2DA6A 3FXOA 4BEHA 3MKYB 1VQ6I 1OPHB 1GT0C 1PPCE 2P4WA 3S7HB 1GVZA 1FQ3A 5DP4A 2CU7A 5E1ZB 4UNOA 3QAHA 4U7BA 4XN0A 1CT4E 5KK1A 4NFFA 1Y3WA 2M8GX 2E2JJ 2P94A 3I5UA 4B1TA 2H9TH 2JA2A 1JWTA 2OU2A 2IJD1 1DX5M 4E7JA 4HBLA 2OUAA 1A5HA 3HL2A 2Q0OA 2VIXA 4IXAA 3OY6U 1YI2I 2VIPA 2Q6FA 2W7NA 4LZ4B 2OTJI 1AQ7A 2DODA 2L7ZA 1H8AC 2CV0A 1D3YA 4YRVA 1JIMA 4X2YA 1NFWA 1UMAH 1O34A 4BAQB 1AA7A 1TGNA 5EQQA 2CMYA 3MU5A 2JT1A 2CFOA 3LQQA 5CVUA 1YJ9I 3LOCA 4CHUA 5C2ZA 3H5NA 3TGNA 3TW7A 2XV4S 4RB1A 4YM9A 1B6AA 2ZQ1A 5BOXA 2HR3A 3VYUB 2BMGB 4DW2U 5BRRE 3LJOA 4FU8A 1DPUA 2QA9E 3V8JA 3RXSA 1EH8A 5TJJA 3HZJA 5K5OA 3ITIA 1TYNA 3KZIC 2E35A 5F04A 1YPHE 3RZOJ 3G4SI 2F9NA 1E79D 1BMMH 3PIOF 2F9UA 3KN2A 1ABIH 3WTUC 2KX4A 2B8OH 2CW8A 1E2XA 1J15A 4NUBA 3EE7A 1O3IA 5FROA 2ZCLP 4LK1F 2H8WA 2RV8A 3ESWB 3PMJA 2DQRA 1RR7A 5B3SH 3SV8A 4ESJA 3ZMTA 1AWHB 2QCOA 3RXLA 3GTPJ 1WJDA 2VVUA 4LITA 1F7ZA 3SNBA 1Z8RA 3TITA 2IS2A 3SHCH 1E3OC 4WH8A 1CVWH 1JRSA 3GICB 1TB6H 2OF7A 3ZZ9A 1Z7UA 3V13A 1GBIA 1GWAA 9ANTA 1KLTA 3GY4A 1ZPCA 4NDLA 1IAUA 2J5PA 1ZARA 1W2KH 3ZQFA 2QE7D 3JZ2B 1PUEE 1Z05A 2Z9GA 3WTYC 3BP8A 3URCA 4M3GA 3DPLC 4XRSG 1JXSA 4AYYB 2H9EH 1BJAA 3I56I 1W8BH 4ESBA 1TPAE 4C3IJ 1UTOA 2NU1E 2JA8J 3JTHA 4Z2YA 1MMJN 2MLGA 1OWHA 5GCHG 3V7TA 3N7DA 2M7AA 1BBRK 2QXHA 4DBRA 1TA2A 5EG4A 1ELEE 1J5YA 5DEQA 3F6OA 1LKBA 4AM3A 4FOUC 4Q7YA 3SUDA 2PV9B 1C2KA 4AGKA 2RQPA 2KKOA 2D1JA 3AL0B 1SG8B 1FX7A 5GAEJ 5BPDA 2JH6D 1DLEA 1FY7A 2TCTA 1U9OA 2EV0A 4YESB 2PMZA 2MD0A 2A0QB 1ZZZA 4ZTFA 1BR1A 3NPSA 5FB2A 3WGHA 3F9GA 1O37A 2XPUA 1F9NA 1JKOC 4O3UA 4K3JA 2LP6A 4HSRA 3S1QJ 3OTJE 3L09A 2XSJC 3W2AA 4U7DA 1S29A 2LVSA 2RCEA 4DT4A 2HOAA 3BR3A 1AKSA 2WWYA 1EP6A 3HOVJ 1P12E 1GHXH 2PJPA 1EFRD 1K0HA 4XRNA 2HXOA 3OSGA 2Y2ZA 2ULLA 2JIZD 3WWBA 4CZCA 1A35A 1K4TA 3ATLA 3CP2A 2D2WA 3TH4H 4IZZA 2H5CA 5K7RA 1X3ZB 2JA5J 3K9XB 3T28A 2WSSD 2X0LA 2XSDC 4S0HB 4D7GA 4LZ1H 3SXYA 1P9SA 2FS8A 3UFAA 3DFJA 3RM0H 3ECHA 5EXMA 4BTTB 3GVAA 3RXEA 5DUKA 2F6CA 2P5KA 2EIKH 2V3OH 3JSOA 5CYVA 4CR9A 1O3NA 3S9CA 3QK1A 2A1DB 4KISA 2Y0SA 4UD9H 4XBDA 5KAFC 3N99A 4NHJA 1G2MA 3GCTG 2IJLA 4GYGA 5J4QA 5DCMB 2OQ5A 1C5LH 2RVCA 3EUAA 2IS6A 4UV9A 1P9UA 3E3TA 3E0JB 1XGMA 1TONA 3STIA 1QB6A 1QA0A 3A4CA 2BVLA 2MLKA 4P9FA 1MH3A 1GMCF 5E3OA 1IUYA 4DW6A 1Z9CA 1XD7A 1S6LA 1XXDA 2OTVA 4QPOA 1C1PA 4AOQA 2W7SA 4MVNA 3SN8A 4NZLA 1H9TA 3A8CA 1FP2A 6CHAC 4A5MA 1FYMA 1AGJA 3S0NA 4II3A 2A4RA 3GXOA 1SQAA 1PJPA 3H3UA 4FVBA 3OS1A 5DN6D 3SI3H 5E8IA 2ZFWA 1E1RD 4OOIA 1EXFA 3GISB 4A3GJ 2H9HA 2ZIQH 3ERED 2LP0A 4CCOA 2EC9H 1EAUA 4TT3D 1O3OA 4JYUH 3PMBB 2HFHA 2M5TA 1TNTA 3D23A 4PSWA 2WUCA 5L2ZH 3E0NB 1HRTH 4PJJA 3FP7E 2K9MA 2ZXJA 3FKJA 1SGDE 5B6OA 2BXUH 1BOQA 2ALPA 1TL8A 2LELA 4L5IA 3KQ5A 1HJAB 5FKLA 1X2MA 3LH3A 3HOSA 2FU4A 1ZH5A 1XUFA 1FOYA 1G32B 2Y9YA 4JYKA 4Y15A 4BXFA 3QZRA 4Y52J 1BMNH 3ABMH 3K0LA 3SBKA 2E2HJ 3GTGJ 3MZYA 1YJWI 3SO3A 3RDZA 1UCYH 3WGGA 1P3CA 5J4YA 1YQAA 1GJ8B 2ZSIB 2WPJS 1A3EH 4PJLA 1LQDB 2PR3A 3OYFA 6ESTA 1UFMA 1EP5A 5F03A 4RM3A 4R79A 3TP0A 2L2OA 1FY8E 1T56A 4YIRX 3NWUA 3DKWA 3BCAA 4XSXF 5AF9H 2WPHS 1BA8B 2BD5A 4YO9A 2MSYA 1QZEA 1C4Y2 2E7XA 2HQAA 1J75A 2QF3A 1BTUA 1RGQA 3AAVA 3CCLI 2XC4A 1VI0A 3U1IB 3IWZA 1Z0XA 3PM3A 5GADJ 4LB5A 2ME6A 1LEAA 3Q9VA 5HOOA 4AIKA 4G6QA 1TWCJ 3C18A 1LFUP 4JQFA 4XN3A 2FI5E 1O35A 1HFDA 1UZCA 4NA7A 1LFBA 1O2XA 3TL4X 4OS1A 2DA5A 2L5QA 1LHEH 1OCCH 1VNDA 4A3EJ 1SEUA 1A5JA 3SJOA 3ZQHA 3RMNH 4NC6A 2E1MB 4FUCA 4ABAA 3Q77A 3BTME 2RQQA 2BOKA 3CDLA 3GY5A 1BOBA 1AIXH 3OYPA 3FAOA 1I3QJ 4YG2F 1GBMA 5DD4A 2EZKA 3VYSB 4GDFA 4AFZA 2MC4A 1K1NA 1KXFA 3DPUA 1H0MA 3I4PA 3QO6A 5DJ7A 3M07A 3D1NI 1UK4A 1FIZA 4K1TA 2HGCA 4M9ZA 4RGRA 2QSFX 5ABWA 1OCTC 4BY1J 4RAYA 1DWDH 3ABUA 4FUJA 2J9NA 4ZYDA 2VWLA 1S7OA 2Z1DA 3G71I 3S3MA 1CA0C 1U5TA 3OSFA 3UQOA 2CF9H 5B66C 2D8WA 1JIRA 1A6QA 2WAEA 4M3FA 2V9PA 2XPWA 3SV7A 3ZVAA 3JW4A 2Z16A 4CSWA 3IC7A 4RKOB 1C2MA 3RQIA 1U3EM 1NC6A 3FXJA 5FKKA 3ZCOA 1A36A 4BH9A 1B7XB 2KISA 2ZXWH 3ABTA 1W7PB 2RDLA 1I1GA 1FPQA 2M0MA 1XMXA 1SGFA 5BPEA 4NCYA 5L3FA 2M9HA 4WJG2 2WAQN 3EA8A 4HA8A 4OINF 2BW3A 5A09A 3LNQA 2ZI2H 1OQYA 1HJ9A 3P70B 3GBGA 4HZHA 5F6FA 4CCJA 1WJCA 2G51A 5DP5A 2FMLA 4HDVA 4G8XA 2G55A 2VIWA 2QKLB 4ZKNU 4IJAA 1QBNA 2FOGA 2GX4A 5CLSA 1C2FA 1WZ2A 1QJ6B 3BJ6A 3JRAA 1FZPB 2K0QA 3GYHX 3CESA 2KZVA 3GTLJ 2A4OA 2HYGD 3D65E 1G3CA 1HDPA 1DS2E 2HNTF 3ZQCA 1YIOA 4YLUA 2QBYA 1TBZH 2HOSA 4NWKA 2GDEH 5EF6A 3ASOH 1MBEA 3T0YA 4MHGA 4XORA 2QBYB 2XGEA 1SGPE 3VB3A 3A85A 1OS8A 2SGPE 1JJ8C 1QA6A 3FXLA 1PPHE 3RZDJ 4OIPF 2O8XA 2QSGX 4K5ZA 3NK8A 1FY4A 1QR3E 1GVDA 1RIWC 4AN7A 1FJSA 5JBTA 3M7GA 2M3AA 1CGJE 1DSTA 1QL8A 2R7UA 2Q1JA 3KLNA 3KFWX 1WKMA 1EJAA 1SLVB 4JX5A 1LHCH 4FVDA 4ON0A 3LOXA 2X6OA 5JB8S 2BZ6H 1VZQH 4WCGA 5DP6A 3ATKA 2V3HH 4BE1A 1RETA 3D0SA 2L7KA 5GIBA 2IXSA 4A5NA 5FBIA 4DZPA 2KR7A 1UK2A 2A5AA 2RA0A 3S32A 2V6NA 4AGJA 4CUGA 1BB0B 2VT3A 2XTTB 4CGZA 3DP7A 5GPIB 1MAXA 3P17H 2R7XA 4DJAA 1AD8H 4X6AJ 5IT9Z 2ZDKA 1XKBC 1D1CA 2A6EF 3KYCB 1O36A 3QDZB 5IPAA 2J34A 1OWEA 1O3AA 3ZVCA 3F1SB 3UOUA 2A05A 3GFJA 1KQ8A 1AZ8A 3RXGA 3UQVA 4QTRA 4KELA 3IKTA 5IYTA 1TABE 2K8IA 4Y8ZA 3FXRA 5KEDA 4SGAE 2ZFFH 2G4TA 5C0TA 2HYFA 2AMDA 1BM9A 4K1EA 3OEHD 5IOZA 2AQEA 1ZRFA 1MMDA 2BBYA 3ZVEA 1G30B 4MG3A 5G4BA 3PV5A 3VFEA 4NSYA 3AKZA 3FXMA 1W0KD 2PKSB 5LPFA 4XLPF 4HV5A 1G3BA 2QQBA 1O7LA 1AE8H 1GJ7B 3TJOA 5A0AE 3DHKH 1VQ5I 2F5VA 5FAHA 3DTIA 1IQEA 4TPYA 2R5ZB 1YPLH 1S0RA 3W3CA 5IYCJ 3MO3A 5GDSH 3EUHC 4V2FA 3MKWB 1E0EA 3S2HJ 5ERIA 1QZZA 1ZSJA 1ZTRA 3O2PE 2EI6A 3M35A 2K86A 5TCAA 5C3NA 2COBA 2ZHEH 2XHKA 1QL7A 2ELJA 1YCPK 1K78B 3BTGE 4LXBH 2JH0D 1Y5BT 2ZDMA 1D1BA 2ZHDA 3W6JB 1VFCA 2ESTE 3ONQA 5FLMJ 3GO5A 1DUXC 3I78A 4ASUD 5H6RA 1IO2A 2GV7A 3ZVDA 2WPLS 2FRHA 1GMDG 5LRSA 2DDAA 1NZQH 1S6HA 1GBDA 4G6DA 1WJBA 1TBQH 3F3XA 2WADA 1ZTLA 4X2WA 4KFCA 4AFQA 2KMUA 5JLXA 4YTAA 1UHSA 3KYGA 3PRBA 4XQFA 2JN6A 3DTKA 1KU7A 1ZTJA 1EPTB 5FXLA 4IHWA 2WPKS 4INLA 3TLOA 3JRCA 3PNVA 2UXNA 2FXRA 3CS0A 3K1NA 4QWQA 1USSA 1GI5A 1MQ6A 4B48A 1U2WA 3ZR8X 1D3PB 4O03A 1IHTH 2WAQA 1BTYA 2AHME 3K70C 1V2RT 1UAAA 1TIOA 3F9HA 3T5FH 2XAHA 3FFGA 4H4FA 4P55A 4RT0A 2O5RA 7GCHG 1IQHA 3OYJA 1ZGJA 2D45A 4OGYA 1HQCA 3C2GA 1B9NA 2AMPA 3CS7A 5CKTA 3SV9A 1O5AB 2Z9OA 1NK2P 1GBCA 3F2FA 2C93B 2YMSD 3GMEA 5L3DA 3BIVH 2BY3A 5EJCA 1F0SA 1WBGB 4FU9A 1RIWB 1ORKA 4HFPB 4C3HJ 3KQDA 2ZEBA 2K1QA 4CCNA 2BZAA 2K40A 1DANH 1ETTH 3TPIZ 1XCVA 2LKXA 3H5CB 5E79C 4I8KA 4ITVA 3LMMA 1RC9A 3ZZDA 3GTKJ 3TVJB 4NQWB 4Y4RA 2L02A 4XSZF 3BTWE 4DQ2A 1LQ1A 2DOEA 1G59A 2LG4A 1YS7A 2UUYA 3C3WA 1VQ8I 1OOKB 1O7FA 5GJ4B 1PPGE 4MPWA 2PLXA 1OWKA 2CHAC 4X0WU 5E3LA 1HUTH 2F5EA 5KGOA 4AC9A 1AVGH 3D5RC 5HIZA 1G3DA 5HGGA 2A6HF 2PJRB 3PMHB 1W12U 3OYIA 4UB8C 3PIPF 4EJUA 2IA1A 2AXLA 3ELKA 1PPZA 2ZNKH 1UCRA 1AMHA 5HVQC 2PGBB 1MDMA 1P9QC 5AHGH 2BYVE 3KF2A 5HNHA 2HKOA 1S83A 1ZAOA 4PJ0C 3H1CA 4G7HF 1TGSZ 3T2NA 1CF7A 5H4IB 3OYBA 5EJLA 1DWEH 1RKTA 3RU4T 2WTEA 1OJLA 1QFKH 4A3MJ 2SGDE 4HX4A 1GJ9B 2DXIA 1LHFH 4KTUA 3O8HA 2W4SA 4J01A 5FFXA 2O8LA 1G3WA 2G5VA 1GI6A 1XUJA 1IV8A 1F0RA 1EZSC 5F27A 3ZP5A 3D49H 2M4KA 2CXVA 3CQZJ 4A92A 3WU0A 1WXRA 1UJ1A 3Q3XA 4TY6A 2B63J 5DCFA 3OYAA 1U6QA 3GX4X 4R8TB 1OCPA 1MNEA 4EGZA 4L0ZB 3LGTA 3TO6A 3V8LA 3JRIA 1A31A 1TP4A 1ID5H 1EAIA 5E0JA 2E7WA 1OX1A 4PJMA 1QGFA 5HDKA 1LQEA 1RS0A 1O3FA 1O2KA 2JVGA 4HF2A 2EB7A 1HAXB 3A81A 4XOJA 4RAGA 2UWMA 3M5OA 2CGAA 3OAAD 4K69A 1WI9A 1HSTA 1QRWA 1SQRA 3KIDU 3LGYA 1IZ1A 4SGBE 3DUXH 3UWJH 4JZFH 3OYNA 3RQ4A 1C2IA 1O5FH 2VBYA 5GNDA 4GCHG 2TPIZ 2EPFA 2CRGA 3KP4A 3OYDA 3J7YJ 4JZDH 1CO7E 1A7SA 5KECA 3OFND 1MGTA 2IW5A 4HQEA 1COWD 3SQEE 2YMSB 1GGDC 1O3LA 2FNAA 4GSOA 3RSNA 4AC0A 3CUQA 3QYFA 1R00A 1C1VH 1ZRCA 3PQKA 3FKIJ 1Q1VA 3SFIA 4JZIA 4ZH8A 2BE5F 3EA9A 1SD6A 3RXJA 2J5OA 2ZU2A 5FRMA 1BR4A 1ITYA 2R2WU 1NBME 3GTJJ 5F8TA 3LSMA 2L4MA 3PRDA 2PUQH 1GUUA 1C1OA 2QQ8A 2KFWA 4MNXA 2BHZA 1G2HA 4Z1MD 4I09A 1EJ9A 4RKJB 4LGWA 3RXRA 1ODDA 3OYKA 1BW6A 3QWLA 1ZR4A 4CR5A 4R8HA 1MBKA 2DPUA 1SGCA 1WRJA 3BTQE 4LK4A 3S9BA 1W7PD 4B09A 5HNFA 1FPCH 2DUCA 3KQEA 3BC8A 5JR3A 1IAWA 1MZDA 3MVPA 5C67A 1WQ2A 2F2EA 1HA8A 1MZAA 2P3UB 1YF4A 3TH2H 1P03A 3WTSC 2F5FA 3BEUA 1HCGA 1NTPA 3ZZ7A 3K10A 2RAEA 1VJAU 3V4GA 4A3KJ 2PMHA 4Y8XA 5FHTA 3A7WA 3HC7A 2L9VA 3IH4A 4D9JA 3E5UA 2ISYA 5TCCA 4HI3A 1CSOE 4GYIA 3QP6A 3BT9A 1EPTA 4MEYF 2BD9A 1ETVA 3P95A 4GCVA 2NWNA 2ZWLH 2ANWA 2NS7A 1OLTA 1ANEA 1MSFC 1D0XA 1BBRE 2R7OA 2KT0A 4U30A 5HS7A 4YIFA 1WH5A 3H9JA 2L7FP 2MABA 1EATA 4EQQA 1ZLKA 3K65B 1O3RA 1TPPA 5C5NA 1Y1VJ 2UUZA 1QB9A 1NFXA 1O3PB 3LC3A 5I25A 3RXVA 3BF6H 1D0YA 1FI8A 3G1LA 1G9IE 3ZN0A 1N25A 2EFPA 2QWWA 3SU6A 4A1TA 4I86A 3BG8A 5EEGA 3BROA 1SFOJ 2OLGA 2P0WA 5LGNA 3E1SA 4I31A 1XMNB 1ON2A 2RN7A 5EEHA 1FY3A 3CF5F 2GVFA 2PMZN 1TA6A 3MH6A 1Z6JH 3FZZA 4XLFA 2FQ4A 2OQUA 3BTCA 4YT7H 1T39A 2QV1A 3VSKA 3R60A 2HVXA 1PP8F 1IRGA 2O8UA 1AWFH 3ZZAA 1NRNH 4AB8A 4WWYA 2XB5A 1JT6A 3R0AA 1KXCA 1GXPA 3FVFB 2GCTB 1S82A 1SD5A 1EH7A 3DSPA 3PUBA 2ICWG 3FM5A 4VGCB 3DKYA 2G52A 1AI8H 3PO2J 5HS9A 3GY8A 5GXPA 1UTKA 2FEZA 4UVAA 4P9UA 1ZGAA 2ANMH 1C5SA 4AB9A 9LPRA 4R1HA 4H42U 1XS9A 2ELKA 1LEBA 2BY5X 4BXSA 2QQ9A 3HRMA 4HPQA 2VGCB 3BG7A 1H4WA 3P9IA 1LB2A 2OP9A 1REPC 3H0GJ 3UR9A 3HSEA 2SGAA 4KUMA 2CQNA 3BTFE 2BV6A 2DFEA 1SC7A 4ZH4F 2FJ1A 5CHAB 3MH7A 4X6OA 4IHSA 3WHCA 3ENSB 3AG4H 5DS9A 4XIDA 2KFDA 4G6TB 3TDUC 2CMPA 4IBLH 1MKMA 2KHMA 2HPMA 2LRDA 4K8BA 2K02A 2EI7A 4ZAEA 1I6XA 2X1DA 5FRNA 4CH8B 3JRDA 1GL1A 1QQ4A 3GCHB 2KRFA 1K7AA 1J16A 2R92J 1GJCB 1CQTA 4FCYA 1APLC 1HAHH 3SNEA 3K9TA 2CQ7A 1UELB 2GGVB 3HXLA 5CVVA 1KZHA 3GY6A 1O4XA 2O7OA 2FOMB 1OR7C 2DFFA 2ZKSA 2M2EA 1BTWA 4NSVA 4UVBA 4CBNA 4X1QU 1VZ0A 2DI3A 1ZTKA 2FZZA 3KP7A 3IH3A 3UNRA 3B6AA 2IGNA 4KTSA 3JR9A 4WMDA 2PSXA 1NRRH 2EV6A 5DK1A 1V5GA 2Z3CA 1MBHA 4DYQA 2LNCA 4EATA 3PL8A 3MFJA 1DGRM 3UKGA 4KMFA 4QT8C 2K4BA 1B5GH 4TY7A 3K4NA 5DP8A 2GA1A 3UAIC 5DTDA 4EVIA 1WJFA 4E7IA 6LPRA 3M61U 4MGRA 1VQ7I 4HF1A 3IP4B 2EA3A 1P2IA 3H7OA 1MSEC 3VGCC 2HRVA 1DSUA 5C17A 2CQQA 2PI0A 3PQJA 3TIUA 2Z3DA 5C1YA 5HXFA 4RB2C 1RNLA 4WXVA 2E2IJ 3A84A 4M3BA 4MFDA 4DIQA 1Z3YA 4ISNA 1DLKB 1K1OA 4ZHLU 5FD6A 3RI4A 1G37A 3A7ZA 2ETHA 2XRLA 3FM3A 2ZFQH 4HTCH 2X48A 1LVBA 2YU9J 4HG6A 2EFQA 4YOIA 1IQFA 1KTTB 3N4MA 4IVNA 4OS2A 1TWHJ 1HXDA 1SANA 1F43A 3K1PA 1T98A 4XRSA 1NY22 3KNXA 3G73A 3MQ0A 2VOPA 1YITI 3A02A 3KZZA 1FN8A 1RTKA 2OK5A 1V2NT 4RAZA 5EZGA 5FGMA 3M8EA 1NESE 1O5GH 1BI3A 2Q1ZB 2DA3A 4FUGA 1EJMA 3AW1A 5F6MA 4X2XA 2CG4A 2XKOA 3Q3KA 4L18B 5J3LA 2NYXA 1QO0D 2OD5A 1Q3XA 4I0AA 3M5MA 2EZIA 1F5TA 1FTTA 4ABEA 1JKQC 3SU0A 3M3SA 4U01A 4Q5SF 3PM1A 3PB1E 1FXYA 4V2GA 2BOHB 1TRYA 2ASUB 2QGRA 4CRFA 3LGUA 4Y79A 4OAYA 3OX7U 4TWWA 3RXFA 2PQ8A 2CUZA 5DG6A 2VBXA 4IX7A 3UNGC 4JYTA 5GWZA 1V2LT 2KCYA 3KQBA 1NG6A 1Y5UT 2BD3A 3K6ZA 4I02A 4AYVB 2R5ZA 2XAFA 1FDPA 2XGXA 3MKLA 1AKHB 2BQ7B 2GP9B 3N97A 4I8HA 5GAHJ 2VINA 2O61A 4NC7A 2CUEA 1NROH 1JUMA 2QN5T 4XNFA 3M8FA 1WOFA 1TT5B 2DTZA 3P8GA 2P8OB 2LSOA 4BEHB 4L5JA 1MKXH 2CN0H 1A6IA 4BACA 2ZU5A 1IQGA 3EE0B 3CCRI 1GBEA 1MMAA 2M30A 2JH5D 4GFBA 4OWRB 4N9HA 2R0LA 4BQOA 3ESTA 1IN8A 1V2KT 4B43A 4MQ9F 3F9EA 2F9BH 2KRHA 1GLNA 2YS9A 2TGDA 4M9SA 2D26C 1V6DA 1MD7A 3HGNA 4B44A 4CDGA 2F9PA 1BIOA 4JK6A 3RKYA 2XW9A 2A68F 3O8DA 4BQNA 1MBGA 2DMNA 3ZMZA 1O38A 2J94A 2ZDNA 4OIOF 1X1DA 4IL6C 3VWBA 5KCMA 3X2QH 4KTCA 1DGWY 1GJ6A 1TGCA 1Z6EA 4A3BJ 4IQJA 4X1PU 1KXEA 3A03A 3S15J 3G1OA 1PJRA 2JJ2D 2XNIA 1N8OC 3TJVA 1U6GA 3C2BA 1Z1JA 3RLWH 4IOCF 1V3FA 2X6XA 2BY7X 3DF8A 4JZ1A 5AVDA 2QA4I 5D4SA 3F8FA 1DM4B 3BZCA 3BZ6A 1JKPC 2VU8E 3LA3A 3MNSA 5JVGF 2G9WA 4E05H 5FLVA 1ZOMA 2NS8A 1O5BB 1QBVH 4N9IA 2FOHA 1F1ZA 3F9FA 4D8NA 3ISPA 4X8TH 3FXQA 1EB1H 3F3BA 1S72I 1JXPA 3SZNA 3RCOA 2AS5F 3KX2A 2KLOA 3GZNB 4PCQA 3TJNA 4BQAA 2H6CA 3UREA 2BDBA 3ZGKA 1Y6IA 3Q3SA 3CENA 2BXYA 5K7FA 5BPIA 4RGSA 3RLYH 2FBIA 4WXDA 1R71A 3WG9A 4FUDA 4I76A 4CRCA 1DDNA 1FIAA 1OSSA 1YO5C 2Y7XA 3SZEA 4B47A 4F92B 1EB2A 3PO1C 2NAZA 2ZTYA 2ZGCA 2V3MA 5ICCA 4ESFA 1U5TC 3OL3A 4KJZA 2C3SA 4X8VH 2ANKH 4G94A 3JTGA 1R1UA 4C3JJ 1JBUH 3CDIA 3L2QA 1P02A 1YW8A 1GI1A 1SD4A 1UG0A 4BJ6C 3TOAA 1K83J 1LTOA 5L2YH 1NK3P 1HPGA 4I01A 5J6XA 2BW3B 2GIVA 2K4JA 4BTIB 2XROA 2A4GA 2LBFA 1Z91A 1BHXB 5M3MJ 4A0ZA 2F3CE 5BQTA 4WMEA 1FTZA 1MJBA 2A2XH 3LFKA 1O3GA 1AUJA 3A1YA 4B2CA 1LDJA 4NIXA 3KP5A 2G0EA 4D76A 3F6VA 3S3NA 1KTSB 4KKDA 1DOJA 1O2SA 2GKVE 3ZMUA 3SYTA 3OIPA 3MNXA 2OPTA 3M5NA 1O3CA 3CCMI 3SHFA 2JUCA 2OD3B 2B0FA 1H9HE 2GM4A 1MTNB 1NBMD 3NWSA 3CCVI 5JLWA 5HIYA 3CUOA 2V1UA 4X6NA 2JPBA 5D6FA 2PFEA 3OYLA 1W7GH 3A7TA 3KETA 1M9UA 4ENKA 1Z21A 5K5RA 2ZMEC 1C5WB 2FLRH 3ULQB 4OMZA 3IL2A 1FPHH 2WA0A 5E3MA 3HOWJ 5JI6A 1LPQA 2VE9A 3U2RA 1QHHD 3OWTA 3SUEA 2AHQA 1DP3A 4NZQA 4IGDA 2ZFSA 4BAHB 3ERMA 2CK3D 3FO8D 2R7TA 3SNCA 2GXAA 2V4JC 5LHGA 4XKWA 3GFLA 1HOMA 1LKXA 5DP3A 1UCYK 1FEXA 2JJ1D 1BN5A 1C4U2 5DO4H 2XRCA 2LMDA 2ID3A 2LPRA 3DSOA 4KIFA 1SL3A 4DURA 4K60A 1IJWC 4QLCU 4YLQH 4U0YA 1ELFA 1Y3XA 3JRHA 2V26A 2VXZA 3DV8A 4A3DJ 3ELAH 4J19A 4BGDA 1WAYB 1L0OC 2ESHA 1R23A 2Q2EB 1XUHA 1U0JA 3V12A 1HAIH 2P6TA 2X1CA 2PSYA 3HTUA 1THSH 5IK2D 2ADUA 2IPQX 1U8RA 2VQCA 3UUZA 1PQ8A 2VBWA 3SHAH 1T6SA 3HKIB 3OYMA 2W84A 1YW9A 3ZMVA 1L1NA 3SGBE 1Y5AT 1V2UT 3J81K 2K9QA 4QSHA 5DM7F 5FPTA 4HG2A 4JX6A 3HRUA 4NQWA 1FSHA 1YPHC 4IRHA 2DPDA 3A7VA 4ASHA 2UXXA 1J2XA 3DWLE 5LEJA 1K21H 4IO9F 1J59A 1WCZA 4X1RU 4KNYA 5FD5A 1K2I1 1G36A 3FDYA 1AZZA 2W26A 4LMYA 1GI2A 3KIOA 3VSLA 1L2EA 2VJ4A 2BX4A 1YLCA 4OM9A 4IHTA 3HTSB 2QM3A 5DP7A 2R4GA 2FBHA 2WY8Q 2ZTXA 4M6VA 3I53A 2ALVA 4IC5A 4KICA 2STBE 3AK5A 2GOMA 3I77A 1OYWA 4A5TS 1TNJA 2PG4A 3PMAB 1MKWK 2VIVA 5EXLA 2K9LA 1OHHD 3KYFA 3WTTC 1CHGA 2PUXB 3VYTB 2ZCKP 3MTYA 3PV4A 2FESH 3ATIA 1WUNH 2COMA 3K6GA 1C5MD 4HZFA 4ZYGA 1AHTH 3AAUA 3OV8A 4DYRA 2NOJB 3H92A 2K3PA 3RKQA 1TQ7B 1F4KA 3OR2C 3LSRA 4ZKSU 3I59B 2R7WA 2DT5A 2NU2E 1C2GA 1WSUA 2AIQA 1B4AA 1TTYA 1DY9A 3ZRGA 3OYEA 2R7DA 3BTDE 3E90B 5E1WA 1Z77A 3IAS2 2QXJA 2M45A 3B02A 4PK4A 4AYBA 4HNUA 3ML6A 2ZQ2A 1X1CA 1ESAA 3A86A 3HPTB 1UVPA 1JHHA 2LLKA 2OZUA 1O2UA 4II2A 1UVSH 1CT0E 5FX6A 4XLAA 1T2KA 1ZPBA 4DJZB 3I64A 3HBLA 1Y39A 1X2NA 3PSIA 4FTHA 2W5EA 3QGJA 1IQIA 4CYCB 1T38A 5F1JA 2ZPSA 4PROA 4I6ZA 3CLQA 1FSEA 1O3MA 1O30A 1GBFA 1R4NB 3RU4D 3O3KA 3I58A 3CCEI 2FOCA 4FE4A 1K6OA 3GUDA 2EFOA 2MH2A 4ENNA 3QP5A 1ZMJA 4UFDH 3VPKA 1TRMA 2Z5UA 2LKPA 5FBEA 1C0WA 2RC4A 4LOCA 2ELHA 1RKWA 1V2QT 2H1UA 2SGFE 5E17F 1Z1IA 1ONVA 4OGXA 4CBOA 1OWIA 3U1DA 2KAIA 4HOBA 2PW8H 3HRTA 3CUQB 2GV6A 4M6XA 4ZDPA 1TW3A 3EDPA 1SOZA 2WPDD 3Q5FA 4ZHMU 2UWLA 4DOQA 3E6PH 2BY8X 3LGWA 4DT7B 3BPXA 4I98B 5F53A 1V54H 4EJVA 3B23B 4EJOA 3GF2A 3MH5A 2NVUB 4H0EA 3DBLB 4I8LA 3CP8A 3NRVA 5T3HA 3GCMA 4U88A 3E6CC 4K2EA 1BW5A 3GY2A 2WV4A 2K5CA 3QX5H 4MTDA 3LSGA 1C5VA 3OMYA 2RKHA 2QAAA 3KEQA 1UVOA 2YSRA 2C8WB 2M8EA 4LLGF 3BTJA 3A83A 3U8RH 1QPMA 4D5CA 1O2PA 1LVOA 3KEYA 4CO8A 3LA2A 3MHWU 1LO6A 4NBQA 2A32A 3MWMA 4Y71A 2WBMA 3FP8E 1K79A 2B7EA 3CJRB 3V3MA 3C2HA 2ME0A 6GCHG 3CNRA 1GJ5H 1AKSB 1NG7A 4BDZA 2MH9A 1PYTD 2ZB9A 2DE8A 3E5XA 1C2JA 4L9NA 2ZU1A 5E0GA 1ON1A 1NU7B 3HKZN 1NM6A 2ISZA 2ANYA 3WWFA 2Z9JA 5EIYA 2NRAC 1KA8A 4AIDA 4LLNA 5FKOA 1W1WE 4OAZA 2EJRA 1ANDA 3EUKL 2R9PA 4M74A 1AWCA 1XCBA 3M4OJ 4HQMA 1TWFJ 1ZHPA 3TNTA 2EIMH 1TQ0B 1P11E 3SJMA 2SFAA 1A4WH 2Z2SB 3SZPA 1TOMH 1R22A 2WPMS 3CMMA 5FO5A 4BBSJ 5F0CA 4D9QA 1J9IA 2JRTA 5E8GA 1V55H 4HF0A 1GMHG 1A3BH 3U98H 2FMYA 2V7QD 1K61A 5J4VA 2YX4A 3E0PB 4MQVA 4WX9A 1B72B 2V6EA 1KXAA 3Q0UA 1W0YH 2XDVA 5IY5H 3BR1A 2NVXJ 2PN6A 2WV1A 1YPMH 3OEED 4M3EA 5DV5A 3J7ZI 3BTEE 5J1RA 3A89A 1SFXA 1GXQA 2HNTC 2Y7ZA 2VODA 3AFHA 1ZGWA 3GTMJ 1SVLA 4YIIA 2JJ7A 4CICA 4OS6A 2P5LC 2JSPA 1O3QA 1ESTA 2BXTH 3NEUA 3S2DJ 3SQNA 2VKHA 2R7RA 2BQ6B 1L3LA 2BX3A 4NIYA 2YPRA 4CCLA 3VXEH 2W48A 2IP2A 1EAXA 2VIDA 1I1SA 2R7SA 1D3QB 3MU8A 1JMOH 3JREA 1GG6B 3P8FA 1QHRB 3HJEA 4F3QA 1TFXA 2R3UA 1ENHA 2ZHFH 2DK5A 4ISOA 8GCHF 1SGNE 1R5HA 4GHQA 4RBOA 3QYEA 5C1XA 4EMSA 5F1RA 4XICA 3HGGA 2DAOA 2IGOA 1ELGA 4X8SH 1NFYA 1VCPA 1QZ8A 3CMYA 2VJ1A 3FX3A 3BN9A 5A8XA 4BNRA 3IHUA 1QU3A 1HC8A 2PKAA 1SFQB 1ZJDA 1P2NA 3KQCA 3W94A 3LH1A 3VODA 3K1MA 1T32A 3CF2A 3ZZ3A 1WJ5A 1KIGH 1BHXF 1C5RA 1O2YA 1JI8A 3T1BA 3ZZ8A 3WTXC 1XPXA 1OYTH 4AVZA 3AASA 1JTXA 3CJQB 3OY5U 1QNJA 1HJ8A 2XC5A 3GCNA 1TE0A 3K4BA 4UUVA 3O8CA 1BJVA 3CJNA 5EW1H 2LKSA 2QY0B 5A2QK 1SLXB 4CXFA 1SMFE 1DU6A 1K1MA 3CZ6A 4DVAU 3D5SC 3E7LA 3LAJA 4DOZA 5F8ZA 3KGPA 1BL0A 1LVAA 1YKTA 2JSCA 5FJ8J 3ZQIA 2CV1A 1GVLA 4F48B 4A3CJ 3OIQA 2FE3A 2BDCA 4P1WA 2BDIA 3R6SA 2HI3A 2GMTB 1EV7A 1FNIA 3SFZA 2H27A 3H5AA 4YZUA 4YFNF 1MTNC 2VWNA 4L9JA 5DSFA 1B59A 2O3FA 5FL7D 2Y82A 3DFGA 3QU3A 1XSVA 3DPTA 2SNWA 1YX5A 1GBHA 2VB6A 4CCMA 2FLBH 4ZKRU 3GCTF 2XAUA 3WTZA 3LA7A 2CW7A 2X85A 3SUFA 3E91A 1IW7F 5FCRA 3P9KA 1LVMA 2GQQA 2V0BA 5D5XB 3W95A 5HM9A 2JZYA 2P3TB 1NT1A 3A8BA 5L3CA 1GMCG 1H8HD 1LPKB 2DYSH 3F2HA 2O8KA 1B9MA 5EZHA 1TGBA 2HXIA 1IHSH 4NNJA 1MH4A 3LSTA 1SGEE 2R2MB 2EINH 1GMHF 2ZSHB 2J98B 1XDUA 2Z94A 1T8LA 1BJZA 2JK3A 1LHDH 2O9LA 2AS9A 1WSSH 5CJ9A 3F72A 4KITB 1UTPA 1KGSA 4Y0YE 2XBYA 2KP6A 3F21A 4Y76A 1F0TA 4GXOA 1D5VA 3WODF 2V79A 3H0DA 3BEIB 3PNTA 5LH8A 1B0EA 2ZC9H 5DGJA 3BLYA 1UCYE 3BG6A 2LY9A 3LSJA 2F5CA 3SJ8A 2FP7B 1R7JA 5CMXH 3E16B 1RTFB 4JP0A 3EGKH 2ECCA 3QRFF 1R9TJ 2HZDA 3N7EA 2KZGA 5KNLA 2JDID 1C1MA 2IGKA 2VB0A 2A4QA 3S1MJ 3RKXA 2BEOA 1O31A 2PFBA 3LL7A 1S8NA 3EDXB 3M3TA 2ZJPF 3ZVBA 3C27B 1MIJA 2A2QH 8GCHG 3GCOA 3JAMZ 4TYDA 1YPEH 5CPRB 1TNKA 3BSQA 2H09A 2VBCA 1DFPA 4E7NA 2EH3A 3O8BA 3NAUA 1AFQC 4XBFA 5C44J 4HYEA 3IV5A 2DA1A 2SGEE 5HLIA 1XB4A 2EK5A 2HLDD 1BTHH 3C7JA 1ELCA 1W3CA 3OYHA 4XKBA 5A8YA 2DBBA 4E7KA 1GV2A 3M9AA 3VFZA 3H36A 4BU2A 5F0HA 2DDBA 4Z6AH 2BD2A 2F4OB 3WE2A 2VVVA 5EJZA 1T8OA 2LK2A 3RXDA 5ETXA 3OS0A 2RNGA 1LNWA 1WU1A 4JYVH 4BHCA 4OS4A 2BLWA 3E1XB 5ILVA 1N77A 2OCVB 1C4V2 1XGSA 3RXAA 3RXQA 2VI6A 3JRBA 1CQQA 3FZVA 1Y3YA 1FAKH 1GJAB 1O57A 2VXDA 2HWVA 4CRBA 1WGXA 2OC7A 3FANA 2XBXA 1TMUH 4AVPA 2V6CA 3A2KA 2IS4A 4Y7BA 4EV0A 3HG9A 1YIJI 1IF1A 2HDWA 2E19A 4BE0A 1XX5A 1GDTA 4A6DA 1L1GA 3AAFA 3ZZCA 1GPZA 2TRTA 1XUKA 1BOAA 3FMSA 1KYWA 5TISC 1RXPA 1MBMA 4PUSA 1DUAA 3MU4A 5A0BA 1I50J 2ZXHA 1HW1A 4LD5A 2XC0A 1BDAA 4O97A 1S85A 3E6DA 1FY1A 1D4PB 4UB6C 3K4JA 2LH9A 2CW0F 1PQ7A 1SVPA 4XOPA 2ZO4A 1O5EH 5IYDJ 3QOPA 1IRZA 3FIWA 4BTUB 1LFPA 3V8KA 1DQUA 2E1CA 3CC7I 2DT6A 2L6OA 1BCUH 3UIRA 4ZJZA 1YE9A 3MN2A 1C1UH 2GAUA 5ED4A 2XWBI 3U69H 3EPZA 3E97A 4MPUA 3VEPA 3S2WA 1HBTH 4BQQA 3CMEI 2W25A 3RC6A 1BT7A 3ATMA 5GPCA 4AIJA 1FZZA 3PO1B 2IVMA 4XE4A 2A7JA 2GCHF 3RPQA 4BXXJ 1BA5A 2GCTC 5JDUB 5E0HA 3DA9B 5EGOB 5H2FC 2R3SA 2PHBA 2PGQB 2AYWA 3RU4E 3BY6A 2HYJA 1WTGH 1TRNA 2LDUA 2ZFRH 5IT3A 1P04A 3I4NJ 3SI4H 3ZYEA 1GVJA 3IG6B 1G6NA 4P5OA 3HHHA 2PEXA 2DQLA 2VGCC 1XVOA 3RXCA 2HVSA 4Z6YA 4K2YA 2P8TA 5AFZH 4ZDLA 2BY0A 3W6VA 1A2CH 5EDNA 4MEXF 4UHTA 4IKFA 3T26A 1KY9A 1P0SH 3LFUA 3LSPA 4Q4LA 5H20A 2JWTA 2KIUA 3DU6A 3P5JA 2H1KA 2ZU4A 5E3NA 1DY8A 4L9VA 4HV6A 2W24A 2JA7J 1IXSB 3V42A 3AL0C 3M8JA 2M1BA 1BBRH 3ATWA 3RJPA 1FV9A 2Z99A 1FBUA 4BNCA 1GI7B 1D6WA 2HKXA 3PV2A 2Y6TA 3MOCA 1T4UH 4FHTA 1O2IA 5HKKD 1RD3B 3OY9A 1MD8A 3AG3H 1R5ID 2VH0A 4HNVA 5C5OA 1X3WB 2CSOA 2X1EA 1UHBA 4J00A 2L9RA 1TPSA 1Z3XA 1GHVH 1LVYA 1EA3A 1GJBB 3HOUJ 1KSNA 1D6RA 1JUPA 1K78A 4KYWA 1N1LA 4XM3A 3HGYA 1YS6A 4ZYEA 3J80K 5HMAA 1FYKA 1V2ST 1XTAA 4YFKF 5M3FJ 1RI7A 4BJ5C 3BR0A 5LPRA 1SGRE 5FPSA 1T8IA 4O6JA 3QU6A 3TQNA 1SPJA 2I8DA 2ID6A 4Y3OA 2VQHA 3CD6I 1HAVB 4BL0B 5CE1A 5HS8A 3T8TA 1VF9A 1R5GA 2CH0A 2XYAA 1FUJA 1C1NA 1MMGA 2GD4B 4BHBA 3TK6A 4HSTA 3OOPA 3BG3A 1LKAA 1ZMLA 3SU4A 1GBAA 3V7CA 4X1EA 2FX0A 2JETB 2XCFA 4ABZA 3QODA 2CQXA 5BS6A 4IPAA 2B0LA 4MLFB 2A69F 4UUSA 2EQRA 2LYCA 2R7FA 3GEZA 3HOZJ 1WJAA 3O6BB 2VUMJ 3GLLA 1MJAA 3G3ZA 4FU7A 2IOTA 2FIRH 3BTTE 2O6GE 4MNWA 2ZGBH 2Z6BD 1GBTA 1CHOG 2OV7A 4YXWD 1TBXA 3W1EA 1GDNA 3IUOA 3ZZ6A 3RUOA 2FI3E 4ISHH 3U28C 4NA8A 3Q0VA 3E8LA 3M7QA 1XGNA 5JVTA 2WUBA 1V2WT 1SMYF 4I8JA 3WW7A 2OBQA 4ZXXH 1MTWA 3MNBA 1YLNA 1ETYA 2BY1A 1V3XA 3PLKA 1SAUA 4CREA 3PLPA 3IWFA 4CYCA 1C5TA 3N05A 4FUEA 2O9QA 1AN1E 1ZN2A 1HXFH 2GT7A 7LPRA 1V2JT 4KT6A 1J0RA 1O3DA 5I46H 2ZPQA 1IXRC 1W0ZU 4PZJA 1FONA 3RPUA 1I27A 2IPHA 3RMOH 3EYIA 1QJ7B 2L3DA 1AU8A 3H5RA 3F8CA 4I0BA 3Q76A 2EEKA 2X51A 1GMDF 4MQAA 1W11U 1H88C 1K1PA 1CT2E 1UVUH 4I2OA 1MMSA 2W6JD 3PFYA 1PPEE 2KCOA 2CJJA 2FPZA 4D9RA 2O8WA 2CWEA 4GLYA 3HEFA 1LUJB 1O2QA 3KEEA 4Y11E 3ZXSA 2EBIA 1XKAC 1GBJA 1HF0A 2P6SA 4I32A 3F23A 4ISLA 5LPEA 3FMQA 4KIBA 2KIFA 2OJED 2V7FA 3SEQA 1MW7A 3UR3C 4RGXA 1V2OT 1IN6A 1T4VH 2R7ZJ 3HOTA 1Y3UA 4WK8F 3SUGA 2XGDA 5B5EC 2FOEA 2ZXIA 5J1YA 4NGAH 3RP2A 2PLYA 1A1RA 3B8JA 2NNNA 2QF7A 1A5IA 1YJNI 3KZYA 2OINA 1MQ5A 4WXCA 3HGPA 4E7ZA 2STTA 3H9QA 1GJDB 2WYGA 4E4HA 1DVAH 1PYTC 3LJJA 3ZQ7A 3KP2A 3TOBA 1GDQA 1IG7A 4Q63A 2G8TA 4M7GA 2Q8KA 4C2UA 4FISA 4XRMA 1J17T 2L7MP 2FTLE 8LPRA 1FWZA 3SQHE 4A3JJ 5M5XJ 1HJAC 2PKSC 2Y75A 4NFEA 4OMYA 5D6EA 2DU9A 1N6XA 4AWXB 3GOVB 3SU1A 1RFNA 1T33A 1BC7C 3RC4A 1YX3A 2Z9LA 4CRDA 3DKXA 4TV7A 2VKEA 5EG0B 3I0TA 4W97A 3EUHA 4XLCA 3EYYA 1OYYA 2FNPA 4K1SA 3QTOH 4IS5A 1YC0A 3F6UH 2R0KA 1FOWA 3A01B 3HHGA 4N0BA 1V2PT 1PFXC 2XRNA 5GTIC 4A0YA 1BUIA 3D62A 2WB1A 3B73A 4G7OF 5L3BA 1V2MT 3I3LA 2Y80A 2CGPA 3SGQE 1X4PA 4DBQA 4BYYA 4XFQA 3K4CA 2EWNA 1L4DA 4U32A 1Z1DA 2BGCA 3E6BA 4BBRJ 1O5CB 2HQ5A 5GPAA 2FMJA 4O3TA 1PDNC 2LY1A 2F43B 3F9KA 2NU4E 4ZDOA 5FFZA 4FE7A 4EM1A 4JOMA 1HKQA 1IQKA 1TW2A 1D3TB 2VL8A 1SQTA 2P5VA 2WZQA 1EAWA 4FUIA 2Z3YA 1WCMJ 1T95A 1JRTA 4FX4A 3DTEA 2BVRH 2C8YB 2F4MB 3DCFA 1C9TA 2BDHA 1ELDE 3PJRA 2XWAA 5FPYA 2DOFA 1RJXB 3W6KB 1O3TA 1O33A 2CF8H 5DKMA 2GLOA 1EX3A 3ZQGA 2RGVA 3EQLF 1O2HA 1K28D 2MG4A 3OL4A 2DA2A 3CUQC 1P4WA 1Q2WA 5SGAE 1HDDC 2JQ7A 1SFKA 2EFNA 2WY7Q 1ZELA 2KJCA 1MMNA 2IGMA 2F9VA 1NH3A 3BG4C 3R0JA 3HIFA 3RYPA 2QXIA 4RS8A 1QRZA 2CUJA 2LFBA 3T8RA 5DM6F 3L1PA 5IP9J 4ZHAA 1ZRKA 2RNJA 1TOCB 3SU3A 3P8OA 1O0DH 1XUGA 1I6HJ 1HB0B 1QJ1B 5C3EJ 3QWCH 1C5UA 2YOLA 3R3GB 2B7DH 3ZOBA 1EUFA 2W85A 1SB1H 3M5LA 4IN1A 2M5WA 4GPGA 4A1XA 1PPBH 3P8NA 4A0XA 2HS5A 4LOYH 5E1XA 2P95A 3CCYA 4M3DA 1O3EA 4XBCA 2H2ZA 1QIXB 1C5QA 1E3PA 2KDZA 1RESA 2XGCA 2UUJB 1C1WH 1DWBH 1ETXA 2DYRH 3PLBA 1JHFA 3CCJI 2OQRA 1ZG3A 1W5TA 1YTYA 5F0FA 1O2RA 3S93A 3GFIA 3TMOA 2QKMB 2KIMA 2FD5A 4HLYA 2HDDA 1DU0A 3ODDA 4FX0A 2OC6A 2K3FA 2EQNA 1UMQA 3QPSA 2PTCE 2YU3A 1DDJA 1HAGE 1IQNA 5PTPA 1BZXE 2UV1A 2THFB 2OC8A 1S5SA 1SR5C 2ZHWH 4YFXF 1XG1A 5E20A 1SGFG 2V35A 2A3SA 4ABDA 2QYOA 3L7WA 3GYMA 4HX8A 1FLIA 3CCQI 3H09A 3UNSA 1K1JA 2VJIA 1GBLA 3WHBA 2HALA 1SSXA 5CVJA 2E71A 3RXMA 2CYYA 4O3MA 3DEWA 1J09A 2KQRA 2XF6A 1ETQA 4Y17A 1K22H 3TK9A 4RN6A 1FOKA 1VTNC 2D5VA 2GWRA 1B8IB 3FZDA 4B6EA 4BS9A 2QQAA 4M72A 2R5YA 3I4MJ 2I6QA 4ENJA 4ETSA 4ZYAA 1HW2A 1A61H 2JVHA 2RREA 4A3IJ 3MU1A 2AXTC 1KLIH 3LSKA 2L0KA 2ZDVH 5J47A 1BITA 3KLOA 4KDPA 1VQLI 1W0TA 1VCWA 1G3YA 3CTAA 4FASD 5LD2C 1DICA 2DK8A 1T8MA 1P4XA 4UFGH 2ZFUA 2R7VA 1IDZA 3RDIA 2ILNA 2Z3EA 1YGCH 2DJIA 4Q47A 4EJTA 5A8ZA 4MNUA 2DO7A 3GLXA 1OP8A 1ZHMA 3UPEA 3A87A 1FIPA 1G8XA 1XXFA 2QF5A 1EZUC 1VITG 4E7HA 1YRNA 5HLTA 1SLWB 1CBWB 2EZLA 1T31A 3MYWA 1LHGH 2CFXA 4Q48A 1LDTT 3ZV9A 2ZFPH 1HAYB 5KHDA 3ROUA 3CO7C 2AERH 4A3LJ 3GTOJ 2J95A 2XAQA 5HYOA 4DZJA 1JJ6C 1JGGA 1YCPM 2YMSC 3Q9SA 3CDHA 2BVMA 4ASNA 4BJTA 2XNDD 2P7VB 2QF4A 2RDPA 1XUIA 1SVMA 1T8NA 1Y59T 1P2QA 3SJ9A 4UEHH 1FY5A 4RAFA 2HQRA 5D4RA 1WTHD 3OSYA 3TK5A 1GL0E 1T08B 5JBCS 5M5WJ 3FK6A 1JGSA 5TRDA 5E18F 1OXGA 2OCCH 1BJUA 5ILSA 4ACAA 1XDSA 3KCGH 1SD7A 7KMEH 2IEKA 4FUHA 4IN2A 2GXGA 2P3FH 1EOLA 1HCRA 3UB0A 2VONA 2JTVA 1O3HA 4KN7X 1I3AA 4AX9H 2GCHG 5IP6A 3PO3J 2NOGA 3G6EI 3FISA 1C1RA 1ZYRF 2IT0A 5T6FA 2BD4A 2D1VA 3T29A 3RM2H 1QQIA 2F48A 2M0CA 1E36B 2J38A 1ELVA 5K7ZA 2P16A 4P02A 5JBBS 2BB4A 4ZZLA 5D8KB 5LLQA 1P7IA 1O3BA 2BLOA 1ETWA 2ZFTA 3SU2A 3ZV8A 1NHAA 1E1QD 1ZK8A 1VQPI 2FI4E 2FX4A 5J8CA 2W3KA 3RXTA 2W00A 3LGIA 4ZUHA 1YM0A 4B74A 1WYKA 2DMUA 4TWYA 1A0HB 3OYGA 4BUPA 1I5ZA 2FSWA 1VGCB 2JKHA 2NNYA 3CCUI 1GBBA 2CV2A 1FOXA 2O8TA 3GDUA 1GI9B 2OUMA 4AIHA 2JUGA 1DXPA 2DT7B 3P9CA 1P8VC 2M7BA 1JTYA 4NIWA 2HVRA 4C2MJ 3JAMK 3F0PA 2XPVA 1GCTC 5J8FA 1V2VT 4RSPA 3F68H 1TALA 1ETOA 2XB0X 1W5SA 1ZRDA 1MCTA 3RMLH 3ZMDA 1BRUP 1LPZB 4Y8YA 4ZMAH 2RA3A 1IN5A 2HZTA 1YBWA 3K2AA 3QPLA 4DG4A 5IOYA 1U5TB 3RMMH 4P96A 2HPIA 1ETRH 2AH4X 4G7ZF 1S5LC 1IQJA 3S16J 1OWDA 2H94A 1NN6A 2BXZA 3OS2A 4N4OB 4X1SU 1O2JA 2PX9A 2VKDA 3VYRB 4BKXA 3H7TA 3T5XA 5FLXK 1W7PA 1F92A 3A8DA 3A0BC 2EV5A 1HAZB 1RPWA 1SI5H 3FK7A 4B2AA 2YX7A 2L9SA 2GJGA 1LCYA 4Q7XA 1EH6A 2E1OA 1C5XB 1YLDA 1ZLJA 3OR1C 2HOEA 1ORFA 2XF5A 1HLTH 1X4OA 2ZC2A 1QA7A 1HKTA 4NG9H 1B1BA 3URDA 2NS0A 2XOKD 1MUEB 1UW7A 2G7UA 5GCHF 3OTPA 4EEFG 4B3AA 2ZECA 3HYIA 3F0CA 2EFWA 4MTBA 4JBAA 4L9TA 2ZMEA 4WMFA 2L4AA 4BE2A 4XL9A 2W1OA 4IOAF 2Y9ZA 3WU1B 3NRLA 2BY2A 3S17J 5EQSA 4D5FA 1P01A 1TPOA 4CA0A 4KMUX 1FYLA 1TLDA 3KL6A 4PDKA 4UUSB 1GCDA 5FCKA 3A8AA 4KT5C 2ZJ2A 4XKCA 4QIWN 1TNGA 3W2VA 2J2UA 5ESTE 1FBQA 3HK6B 3ZVFA 2BYAX 1KQ0A 1O39A 3HUGB 3DT0H 4Y0ZE 2H1LA 4B76A 3IH2A 2A61A 1GJ4H 3VB2A 1AY6H 3FMRA 3JCUC 1THPB 1C1SA 4HAMA 4Q80A 3TW6A 5C94A 5IDKA 5D5VB 4KP0A 3QTVH 4EJWA 3LIWA 5LHIA 1Z67A 5EU8A 1IXCA 3HRSA 3F2GA 1STZA 4E7LA 5LFAA 5IP7J 2EI8A 1DXWA 1EKBB 1ZLRA 3A7XA 1XVMA 3S1NJ 1AVXA 3IRRA 2HNHA 5F8XA 3AW0A 1AFEH 3GDVA 3WGIA 3OYCA 2MFZA 2F83A 2KPMA 2UZKA 1VGCC 1ZREA 1MJ9A 3FXUA 2P81A 3K4LA 3MWIU 4J2YB 2P7CB 2KJBA 2E34A 1S81A 2Z7FE 4Y7AA 1ZHRA 5M5YJ 4WF8A 2KIQA 5A2QZ 3BWGA 5CVIA 4PFOA 2ZGJA 1LE8B 4AORA 1YFHA 2B9LA 3AG1H 1OCZH 1DT2A 2BD7A 1O5DH 4CCKA 2OTLI 4S04A 5A0CA 1BI2A 2K27A 3RXOA 1AB9B 4NB5A 1MBJA 3IITA 1VKYA 2UUFB 5FX5A 3HATH 4NIVA 1NO9H 3FWEA 1NRQH 4RI0A 1QNTA 4KN4X 4BHPA 2XF7A 4XMYA 2A6TA 3I55I 3RXKA 4QPQA 4I33A 3GYLB 4F52A 2P8OC 2QYIA 4PJNA 8ESTE 3W2WA 1IUFA 1HNEE 5GAGJ 4U0VA 4XK4A 3MZ8A 1GV5A 3KE2A 1GI0A 4MLOA 1BTPA 1FP1D 4XKVA 4M6YA 2QEXI 1C2EA 3I29A 1O3KA 4AUXA 5BMZA 3PSFA 1OKRA 3H3VK 1OYIA 1U9NA 3J81Z 1H9IE 5EODA 2LTPA 5ICEA 1BMLA 6PAXA 2C6YA 2ZNYA 1WWXA 2L01A 3ECOA 3WE3A 2G00A 4L5EA 2FYQA 2LNBA 3GY3A 1SVOA 4F91B 2BLQA 3MD2A 1YP9A 5ESBA 1Z7LA 4LG0A 1UTNA 1K6YA 3TEDA 1AKHA 2CV3A 4DIHH 4XR6A 2CO5A 1WV7H 4B2BA 1YG2A 4PSXA 5EG0A 3HM5A 4Z0KA 4PGGA 2FODA 3J7AY 1TNIA 1XGOA 4IEJA 1J7KA 1Z8IB 5B6LA 3KCCA 2PWXA 2TGTA 4HDUA 4BAOB 2M34A 4KGAA 1MD0A 4XBBA 2OQGA 1Z8JB 4D7NA 3TNSA 2CQKA 1BI1A 3S8PA 3BDDA 5AONA 4FXGH 4BXWA 4ZC3A 3IWMA 2RG3A 2DA7A 1MU6B 2E1MC 4INHA 2OBPA 1W0UA 2HPQH 3LSHA 3JRFA 2FOKA 1D3DB 4F93B 2QF0A 5C1UA 5GTHC 2DCEA 1ZG5A 2E5ZA 4UDWH 2R3YA 4CRAA 2Y69H 3QLPH 4ENMA 3KP3A 2VC0A 4A1VA 4M9XA 3NXPA 5CVRA 3LPRA 2K85A 4D7MA 4LB6B 1EKEA 3K2UA 4DIIH 1SLUB 5K1YA 1P2FA 1BR2A 1GDUA 2I5UA 3VB4A 5CHAC 3FN8A 1UG2A 2FOFA 1T0FC 2NXNB 3BQYA 1H1BA 2PTNA 3E5QA 3HPHA 2M2AA 4LFUA 1QVUA 1F0UA 3I54A 4CRGA 2ECBA 2DJNA 1Z6RA 3RTRA 5TJXA 1SGQE 1ZGVA 1C5OH 4GHTA 3F0OA 5JYIA 2Y5HA 2VOOA 1N78A 3GTQJ 2DTRA 3HPGA 2ZCHP 3TGIE 4LIVA 1IQLA 3CC2I 2O8MA 1GI4A 1G3SA 1Y56A 4B71A 3K2ZA 4WH6A 1TMTH 2VQGA 1ZSKA 1MKWH 3K70D 4UFFH 2V1DA 4RLFA 1H8ED 3REOA 3MKZA 2ZJRF 1K9OE 1QVTA 4X6PA 1RZ4A 1DE7H 1Y1WJ 1FN6A 2JRMA 4E7SA 7ESTE 1KXDA 4IRGA 5T6GA 2N8GA 5HLHA 2XASA 1BRCE 1A04A 3FXKA 3UOPA 1RIOH 2BHGA 2FTMA 4GUXA 3TU7H 4U0WA 4DY7B 2FYRA 3HSFA 3BZKA 1GHCA 1QZYA 3TDZC 3PFIA 3L00A 1AFQB 1UTQA 1O2GH 1ZYOA 2OZ6A 2VPRA 1L0ZA 2K7LA 4CYDA 2OC1A 3FP6E 1THRH 2E5NA 2LF7A 1ELBA 1ABJH 4A6EA 1AO5A 2VIQA 1P4AA 2EILH 2WAFA 3LGVA 2W82A 2B5TB 7GCHF 3TO9A 2LY2A 4HW0A 2R0QC 2A5WA 5LGOA 4ESTE 2J98A 2Y5FA 1NPMA 3TKYA 3L2WA 3F8MA 1UB9A 4DGWB 1OR7A 1ZG1A 4UONA 3SEZA 1PYVA 3QUMP 4HX7A 2WV9A 3H3ZA 1JT0A 1ANCA 5T1VA 3BTIA 1R36A 2ZF0H 2WC2A 3M1CA 4CHAC 4CH7A 5J1UA 3TBIA 2A31A 1UTMA 4A2UA 1VR1H 4Q7ZA 4FETA 2V1XA 2J92A 3GWZA 1CU1A 3J80Z 2E36A 3LKWA 2DMPA 5FLXZ 3AVZA 4IW4E 2XKPA 2QIQA 5E8EH 4YOJA 3ZPLA 2BY6X 1C2DA 1Y0NA 1H9LB 2X9DA 4OIQF 3M1EA 2OBOA 1DITH 2D1HA 2GIZA 3SDBA 1V5FA 4DCDA 2AGIX 1FLEE 1BIBA 2MYSA 4Q4ZF 4ZROA 2G4UA 2WPIS 3QN7A 1A0JA 3ZN1A 2VJ5A 1JUSA 4MNVA 1GCTB 1WVRA 2PMUA 3KPHA 1QRYA 2GZ8A 4AG1A 3O8RA 1P2OA 1TGTA 1M1EB 3PTNA 4MPVA 1DUEA 4FUBA 2ZNZA 1ACIA 2Y30A 1MU8B 3DQVC 3VB7A 2Q2EA 4CZZA 1FJLA 4LG3A