4GUXA

Crystal structure of trypsin:mcoti-ii complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structural insights into the role of the cyclic backbone in a squash trypsin inhibitor
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
chains with identical sequence B, C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4guxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4guxA02
2G5VA 1CU1A 4F4OC 1DOJA 1W14U 3SW2B 4JZ1A 1CBWC 2G00A 2CV3A 4YM9A 1AU8A 2OLGA 1EKBB 1P2QA 1BBRE 3FANA 1O3KA 2FMJA 6CHAC 4H4FA 4HGCA 1V2MT 3EA7A 3TGJE 1T8NA 2HNTF 2J38A 1DWBH 1GI1A 1K1MA 3I29A 1YYY1 4NSVA 4CBNA 1AZ8A 4KTCA 1NTPA 3VPKA 1QBVH 2GZ7A 2A5IA 1IQEA 2ZQ2A 3ODFA 2BDYA 5GCHG 2F9BH 2WYGA 4Y7AA 3CS0A 1C5PA 5LPRA 4IMZA 1EATA 1C5NH 1AFQC 1K21H 3CENA 4LZ4B 4CRGA 2BY6X 1O2PA 1TNKA 2OC1A 3RMNH 2ZHWH 1O36A 1HXFH 4BAHB 3O8BA 4IC5A 1FNIA 2R0KA 4NCYA 2WPLS 1LHDH 3SBKA 4AFSA 2Q6FA 2BTCE 2FWWA 1Z8RA 2ZTYA 3ZZ5A 1YPLH 5FCKA 1WBGB 1YPEH 2W3KA 1BMNH 2VINA 3E90B 2ZP0H 2VU8E 3D62A 1TOMH 8KME2 2FOBA 1P0SH 2J95A 3Q76A 1J17T 3NK8A 1QB6A 2BHGA 2BY9X 1KY9A 6GCHF 1MBMA 5A09A 2JH0D 1WV7H 1S0RA 1VR1H 1FIWA 2W3IA 2VNTA 3F68H 1OKXA 3FP8E 2ZHEH 2WPJS 1C5YB 3S9CA 1A5IA 1SGRE 1VGCC 4OS1A 2UWPA 1O30A 2ZHQH 4RN6A 1DWEH 1O3FA 3M37A 2OC7A 2BVSH 3MO9A 4NIYA 2GT7A 3ELAH 4LK4A 2Y7XA 1IQIA 1NO9H 4AN7A 2VVUA 3P8FA 1A0JA 1ZMJA 1AE8H 1FY8E 1ETTH 4TWWA 2OP9A 3SV7A 3GDUA 4OS7A 3M3VA 1P3EA 2ZNKH 3S69A 4AB9A 1TPPA 2VIDA 2OC8A 1E37B 2C8XB 1KXDA 1BBRH 4J1YA 1ZHRA 3P6ZB 1TBZH 3SU2A 1TNHA 2GZ8A 1UTNA 2SNVA 2F9OA 1AB9C 5JPMH 3QUMP 3ZVGA 2VWMA 5A8XA 1ANBA 4B2CA 1E35B 3LGUA 4THNH 1BRAA 3NCLA 2YNBA 1ABJH 4K3JA 2UUKB 4Q7XA 3F6UH 2ZHDA 3RC6A 2BDCA 2BOHB 5AFYH 4IC6A 1Z8GA 1V3XA 1TGNA 2BLWA 2HRVA 2ZU2A 3GICB 5C3NA 1PYTC 4FXGH 1C2KA 4NA8A 3D65E 4LXBH 3PLPA 1TALA 4XOJA 4Z6AH 2ESTE 4IBLH 4NA7A 1K1LA 2QXGA 4FU8A 1DUAA 1KXAA 1Z71A 1T8MA 1GCTB 1AZZA 4JYUH 2A4RA 2Z94A 4MDSA 1C5RA 3SHCH 3A8DA 1YPJH 2JETC 5EU8A 3SHAH 5FPYA 3E0PB 5JBCS 1DVAH 1FV9A 1GPZA 3HGNA 4ABIA 1IHTH 3MOCA 1O5EH 4Z0KA 1QRZA 3IITA 1GHBG 1THPB 3BF6H 3MO6A 2F91A 4CRBA 2G8TA 3ZV9A 4YTAA 5L2ZH 1LKBA 1RGQA 1S5SA 5EGMA 2Q6GA 4E05H 3TH3H 1HXEH 3TLOA 1GVKB 3EDXB 3KQBA 2AMQA 1KLJH 3M5NA 2NU0E 1FQ3A 3M5OA 5I25A 5EODA 1TGCA 2YOLA 1TWXB 1XXFA 2HOBA 4FUGA 4IMQA 2AERH 2FZZA 2GDDA 4B2AA 3O8RA 1TAWA 2ZFRH 4I33A 1G30B 2UWLA 1UCYE 3A8AA 3Q3XA 2ALVA 2BD2A 2CHAC 2NU4E 2BYAX 3M35A 1O5BB 3RXCA 3VB5A 3ATLA 2ZDMA 1A5GH 1UK2A 1VCPA 3PWBA 2FI5E 1YCPM 1GBBA 2FS9A 5DGJA 1C2EA 1RIWC 1ZTLA 2SGFE 1O32A 2STBE 4AORA 3V13A 1IQFA 3K65B 4WMFA 1CGJE 1C2GA 3W95A 1DITH 4ZMAH 2ZTXA 1FMGA 1A46H 3FP6E 4FU7A 3RXGA 1P04A 2F9PA 1EJNA 3MYWA 1UTJA 4JYVH 1LPKB 2I6QA 3S9BA 1NRNH 4O9VA 1O2YA 4A7IB 3GY2A 2GVFA 1O35A 4K2YA 4UFFH 2PTCE 1MKWK 4ZKSU 2F9NA 1TGSZ 2PKSB 1N6XA 2VJ1A 1UVOA 2M5TA 3QN7A 3RXVA 3TK9A 1P02A 1IQNA 2ZCLP 2BXTH 1S6FA 2QGRA 1O3AA 1KDQA 3C27B 1C1WH 3M7UA 1EB2A 4XBBA 1A1RA 1MU8B 3DHKH 2FIRH 2GV7A 2FXRA 4ZHAA 3SNBA 3CS7A 1HNEE 1O34A 1PQ7A 1O5DH 2AMPA 2B0FA 3BEIB 4XBCA 2A4OA 3TGIE 1SGEE 1GJ7B 1O2MA 1C2JA 1O2QA 1SOTA 4NFFA 2ANMH 1O2OA 4X2WA 3ZYEA 3VB3A 1BZXE 3KNXA 4DG4A 3U1JB 4R0IA 1OP0A 2IOTA 1HUTH 1KLTA 2W7SA 2LNCA 3SOSA 3RXHA 1UCYH 1ELDE 1HPGA 1ZPCA 2H9EH 5ESBA 2AIPA 3SJ9A 4I7YH 2IJOB 2A0QB 1DSTA 3G01A 3P92A 3PWCA 1A3EH 3OSYA 3SJ8A 1CT2E 1OWDA 4AGKA 2OQUA 2Q6DA 1LKAA 1GMCF 2GP9B 1YBWA 1GI2A 2VGCC 2XWAA 4MQAA 5LGOA 1GBDA 1O5FH 1DY8A 1SVPA 4BXWA 5J4SA 1BIOA 1Y5BT 1WOFA 3BIUH 2EEKA 1BDAA 1O3HA 5HYOA 5E0GA 4K1EA 3PMJA 3E91A 1TOCB 3SZNA 3BTKE 4DOQA 3ATMA 3BEUA 2PR3A 1E38B 4DCDA 2TRMA 3SNAA 3A86A 1C1QA 2GCHG 3SNCA 2VVCA 4Q2KA 5DKMA 3DA9B 3MU4A 1THRH 5EQSA 1UVUH 2R0LA 1Y3VA 4GHTA 2FOCA 1K1OA 1Z1JA 2ZGCA 4A1VA 1SPJA 3BTGE 1KTTB 3BG8A 3LDXH 1P06A 1OWKA 4AG2A 4NFEA 1XKBC 3U1IB 2ZTZA 1MBQA 1EX3A 2FOFA 2Z3CA 4RSPA 1D3DB 3RXMA 2F83A 3FZZA 1JOUB 1TA6A 3L3TA 3K6YA 5FX5A 4AFZA 1BRUP 3TJVA 5SGAE 4VGCC 1FY3A 1NZQH 1NRQH 2Z9GA 2PLXA 1EJMA 3KCGH 3SNEA 3T27A 2J92A 3A7YA 1GHVH 4NIVA 1UHBB 1O3NA 1ETSH 1THSH 4B73A 3BTEE 5JB9S 2PSXA 3A82A 1FLEE 1Z6JH 2GX4A 3QWCH 1PPGE 2Z9IA 2PUXB 4JCNA 3SU0A 3AAUA 3M5MA 3IG6B 3ATIA 3RC4A 1P12E 2DE8A 4OS4A 3V7TA 3PTNA 1AY6H 2F9VA 1CQQA 2VIWA 3RXRA 3UIRA 4IS5A 1HJAC 4JMYA 4KELA 2GDEH 4R8TB 3SGAE 2ZPRA 4B1TA 3M7TA 4Y8YA 2DUCA 5DPAA 2FOMB 2A4GA 4H42U 3BTDE 3ZVCA 1CA0B 1XVMA 1AO5A 1BB0B 5PTPA 1RFNA 1DY9A 1V2KT 1NU7B 3V12A 5EXNA 3KIDU 1LHFH 2C8WB 3MU8A 3Q3KA 3S0NA 1HJ9A 1P09A 1GJAB 1AMHA 1BTHH 1O0DH 1WQVH 2K1QA 1HBTH 3PTBA 1F0TA 3AASA 1DANH 1XUIA 4FU9A 4ZUHA 4I32A 3T28A 1OYQA 1QR3E 4YOIA 4OS2A 2H5DA 3RLYH 2GMTC 1N8OC 1OP8A 2P8OB 3R3GB 3ZZBA 1HGTH 4Y11E 1A4WH 4NG9H 1D3QB 3T2NA 2WPKS 5EOKA 5DG6A 2PKAA 4FUCA 1HV7A 1O2NA 2V0BA 5F8ZA 3VXFH 1ZPZA 2GCHF 2W26A 1NU9A 4Q80A 3MU1A 4YO9A 3MH5A 1WTGH 2UWOA 2AMDA 5HM2A 1VZQH 2XBXA 1C2MA 3MH4A 4X8VH 3UQVA 3ZV8A 3LIWA 4MLFB 1O33A 1TNIA 2FO9A 1EZSC 1J15A 2TBSA 1FUJA 1SI5H 4ABFA 2R3YA 5L2YH 5A2MH 1Q2WA 1W7GH 3ODDA 1AVWA 1BHXB 1G2LA 1SLXB 3ZVFA 1F0SA 1S83A 1O2UA 1CT4E 2ZI2H 1IQKA 1XMNB 2A45B 3SI3H 3E0NB 1H8IH 3LC3A 2A31A 3E16B 1IAUA 5FHTA 5HXFA 4OS6A 4CR9A 3E1XB 3N7OA 3VB4A 1J16A 1WCZA 4O97A 1HFDA 4ZHLU 3VB6A 1UTOA 3TJNA 4BAOB 3GY3A 3RC5A 4U2WA 1AWFH 3NPSA 1SOZA 3QDZB 2ZECA 4JZDH 3U98H 1DSUA 1GHAG 1AFQB 2QIQA 3LT3A 4JZEH 3D23A 5IDKA 3GOVB 4X0WU 3FZDA 2JKHA 2R2WU 4O03A 3SQEE 3OY6U 1Z6EA 3EA9A 4I31A 1O2WA 1C4V2 2BD9A 1ZRBA 4FUBA 4X8SH 2PGBB 2OCVB 3TK5A 1GDQA 2ZU4A 4Y0YE 2H9HA 1LQDB 1MQ5A 3T25A 1W11U 3A81A 3LU9B 3MNBA 5JB8S 1VJ9U 4DVAU 2B8OH 1OPHB 2HNTC 4X1SU 1GMDG 4F49A 4Y8XA 2B5TB 1KXFA 1AGJA 2J2UA 1ORFA 1UVSH 2DE9A 1F0UA 1SLUB 4ABGA 1OS8A 1F2SE 1ZSKA 1SHHB 3KGPA 1TPOA 2BMGB 1AUTC 3RM0H 1VITH 1VGCB 1XUGA 1A0LA 1HLTH 1G3EA 1SBWA 2AIQA 2Z9JA 1AHTH 3K2UA 5CMXH 2BDIA 3TNTA 1YC0A 3A7ZA 5A0AE 5L30H 3SU6A 2FDAA 2ZU3A 2PGQB 1C5TA 2GTBA 1Y5UT 1AUJA 1CHOG 4HZHA 1QY6A 1G32B 1ELBA 2AFQB 1QA7A 2V3OH 1C4Y2 2ZO3H 3M7QA 1NRSH 4WF8A 2AH4X 1OXGA 1XUHA 1TMTH 1L1GA 3LH3A 3ZVDA 2G81E 4CRAA 1FIZA 4HFPB 1O38A 1UMAH 3ZZ7A 2R2MB 3ZVEA 1FAXA 5EPNA 3M61U 1SGNE 2AGGX 1BMMH 1AB9B 1EXFA 3SV8A 1TMUH 1QL7A 4UEHH 2Y82A 3QGNB 2OBQA 1GDNA 1V2VT 4YESB 4UFGH 1GBCA 1Y8TA 5ABWA 3SV9A 1S81A 1SGFG 5DP4A 2AEIH 2ZFPH 1O3MA 1QQUA 1O2RA 1KTSB 1V2TT 5DP7A 2D2DA 1KXEA 2ZPSA 1AKSA 1YLDA 1MTNB 1OSSA 2WPHS 1SR5C 5AHGH 2R9PA 1FXYA 5GJ4B 4K8BA 1HAVA 1EAWA 1MZDA 5DP5A 1GHAF 3B9FH 3HGPA 1YCPK 3LGWA 4ABAA 1ZYOA 1EZXC 2HNTE 5K0HA 2P3FH 1FPCH 1K1PA 2XC0A 1L1JA 1Z1IA 3HKJB 1BOQA 1ARCA 1EASA 4ABHA 3PO1C 5FPTA 1C1PA 3UWIA 1SGPE 1KXBA 1QBOA 3UNRA 4XFQA 2TGDA 2A32A 3MU5A 1P9SA 1NFYA 2AYWA 3PLKA 1OWEA 2FTLE 7GCHG 1QGFA 2F3CE 2A5KA 1GGDB 1SGQE 5HGGA 4HI3A 1X7AC 2SGEE 4GVUA 4CHAB 4GLYA 1CA8B 3ESTA 5CE1A 1LO6A 4MTBA 1GHWH 1TRYA 2XC4A 3ENSB 1ESTA 4K1SA 2FS8A 2BDBA 1MCVA 5GCHF 1TLDA 1OWIA 1RTLA 2CMYA 3MWIU 4XDEA 1Z7KA 3GCHC 2FOEA 5A0BA 2D1JA 4E7RG 1EAUA 4BAKB 1GMHG 1LTOA 1K1JA 1CHOF 2BY5X 3SUFA 1QRXA 1SLVB 2CHAB 1T8OA 1MQ6A 1QFKH 2NU1E 1H4WA 3VGCC 2CF9H 4I8JA 3Q3YA 2FEQH 3GISB 1V2OT 1HDTH 1V2JT 1MU6B 1P2IA 3QGJA 1TBRH 1C1UH 1SFQB 1S84A 1TGBA 1RIWB 3RXBA 4D8NA 3V3MA 1C5LH 3MFJA 3KQDA 2HGTH 1B0FA 1GJ9B 1BTUA 4BTTB 2Y7ZA 2VH0A 1M9UA 1YF4A 1D9IA 1D6RA 1SGYE 3RXPA 3V0XA 1JRSA 2BD7A 1JRTA 5BRRE 3A80A 3A8CA 1BCUH 1GBKA 1SGIB 3LGYA 4D76A 2ZCKP 2PTNA 3SI4H 2BDAA 1ID5H 3SUGA 2BD5A 1C5SA 4INHA 5EXMA 3M36A 1T4UH 4NZQA 1P01A 5F03A 3HK6B 2SGAA 3B23B 3T62A 2Q1JA 3RU4D 3STIA 3MNCA 5EW1H 4GAWA 1MKXH 3SQHE 3QTVH 2TGAA 3TJOA 1IHSH 3FVFB 2ZDAH 2OQ5A 4K8YA 1TMBH 4K1TA 1UTPA 4D7FA 3TPIZ 1HAGE 2BQWB 3TH4H 1MAXA 4DURA 4AG1A 1OP2A 2CJIA 3E3TA 2VWLA 1XUFA 1SGCA 1GCTC 2V3HH 1AWHB 3UOUA 2I6SA 1ZOMA 7KMEH 1DS2E 4ZH8A 5EG4A 2F9UA 4ISNA 3JZ2B 1VCQA 3QX5H 5DP3A 3ATKA 4MNXA 1BBRK 1EB1H 4X1QU 1MD7A 1BRBE 3AAVA 4RKJB 2QCYA 4UDWH 2W5EA 2OINA 1WAYB 1NFXA 3U8OH 1WQSA 1C5WB 1H9LB 1ZJKA 3A7WA 4U30A 2J9NA 2QXHA 2RA3A 3E8LA 3L6PA 2OBOA 1JBUH 1TRNA 1Y3XA 1DXPA 2VIVA 1GI9B 4QT8C 4Y10E 2BOKA 1NN6A 5FPSA 2BD8A 2QN5T 3LJJA 2FOAA 1V2RT 2ZDKA 1H9HE 1P03A 3PMBB 5A0CA 1SQOA 3GCOA 5E0JA 1MTVA 4UE7H 1YLCA 1KLIH 4WXIA 2IN2A 4CBOA 1SB1H 2Y6TA 2SFAA 4YLQH 2KAIA 4A1XA 4K5ZA 1XM1A 2HPQH 2VGCB 2WUBA 4BOHA 1EZUC 4BNRA 2P94A 1V2LT 4Y0ZE 1F0RA 1GHBF 3RXKA 3TH2H 5GIBA 2QXIA 1A5HA 5DO4H 1DX5M 3TVJB 4X6NA 1W8BH 1FY4A 1GG6B 2OUAA 4DT7B 5F8XA 2ZQ1A 1ARBA 5A8ZA 1A3BH 3TJUA 3PM3A 2GCTB 5H4IB 1WUNH 4WVPE 3AW1A 5AFZH 1O2SA 2WYJA 2BLVA 4MPVA 4IN1A 2HALA 4X1NU 4K60A 2ODQA 4X1PU 3MH7A 1BMAA 1UVTH 1GBEA 2EA3A 5HM9A 2ZWLH 2PKSC 1BTWA 2XYAA 1ZR0A 1LVOA 1ELGA 1GL1A 1HAZB 2EI7A 1QBNA 3LPRA 3FP7E 1F5RA 3RXDA 1O3PB 3MHWU 1CVWH 2QF0A 1O3JA 3QZRA 3VFEA 4VGCB 2BDGA 4DIHH 5GWZA 1YGCH 1SG8B 3ZVBA 4UFDH 3GYMA 2V35A 2TGPZ 2Z3EA 5JBBS 4BTIB 1ZTKA 4UONA 5JBAS 1YPKH 2PV9B 2O8MA 5FX6A 1Y59T 2ASUB 1YM0A 3HK3B 4XE4A 2D26C 3DUXH 1CT0E 1LCYA 4YLUA 1GBTA 4ZXYH 1A2CH 5LPEA 3PV4A 1GBHA 1SQAA 1HJAB 5IYTA 1PPHE 2GV6A 5J4QA 3T5FH 1TPAE 1EOJA 3GYLB 1O3IA 5GDSH 1K28D 4BAQB 1HRTH 3LJOA 2BQ7B 4GSOA 3F1SB 1H8DH 2ZPQA 2C8YB 5T6FA 1MTUA 2BD3A 4U01A 1ELAA 2BD4A 4YOJA 4XBDA 2WINI 5EQQA 2CGAA 5CHAB 1W2KH 1ZJDA 2WPIS 4ABBA 5C1UA 1EPTA 1TQ7B 2H2ZA 1EPTC 4CREA 1PPBH 1GHYH 1AIXH 1LHCH 1LPGB 1QCPA 1T7CA 1G36A 1LQEA 1PQ8A 2FYQA 2XCFA 4IN2A 1H9IE 1O2GH 2NU3E 1U6QA 3TGKE 5GPIB 3TIUA 1K9OE 2ZC9H 4DIIH 2BLQA 2GMTB 1N8OB 4DW2U 1P2OA 2A2XH 2BX3A 4X2YA 1NESE 1O2ZA 4INLA 2LPRA 3BEFB 4ISLA 1UTMA 2QAAA 1GBJA 1GJ6A 3UR9A 2C4FH 1C1NA 3K6ZA 2Y80A 3W94A 1MMJN 1TONA 2PKAB 8LPRA 2CN0H 2ZGBH 4INKA 1SQTA 1BTPA 1TYNA 4BXSA 4LOYH 1PQ5A 2FYRA 1UK3A 1O5GH 4ZKNU 5GXPA 3BV9B 1DPOA 1O5CB 3UOPA 1QJ1B 1O5AB 1O3OA 1UCYK 1PYTD 3A89A 3RP2A 1HAPH 1TGTA 2XBWA 1EAXA 3I78A 4X8TH 2ZU1A 2FM2A 3UWJH 2FPZA 1L1NA 3H7TA 1O2JA 1D3TB 1C5XB 1E36B 3RXSA 1Z8IB 2C90B 3ZZCA 3MI4A 1ZPBA 4MNVA 3LC5A 4MPUA 3S7HB 4WY3A 1C2HA 1EAIA 3GY6A 1CSOE 3LOXA 4TPYA 3AVZA 1UK4A 3LGTA 5BPEA 1DWDH 3O8CA 2G5NA 3NKKA 4D7GA 5EPYA 1P05A 3EYDA 1G2MA 1GJ8B 3RXEA 3P70B 1V2WT 1G37A 2G4UA 5FBEA 1OWHA 4BAMB 2ZDVH 3KQCA 1QTFA 1L4DA 4AOQA 4KGAA 4CH8B 1TX7A 2H9TH 1BITA 3RXOA 3AW0A 2PHBA 2XWBI 1PPCE 4TY6A 5DJ7A 4AB8A 3URDA 3GY4A 2PW8H 3GY5A 1FY1A 1GJ5H 1CBWB 3KQEA 2P16A 1YPMH 1SMFE 3QZQA 1CA0C 3F9HA 3MMGA 4ZKOU 4I8HA 6CHAB 4ISIH 4TWYA 3NUMA 1P2KA 3NXPA 4AFUA 2H5CA 1W0YH 4PROA 2ZIQH 3UR6A 5HMAA 1F7ZA 2XNIA 5LPFA 5A8YA 4MNWA 5AVDA 1ZTJA 1Y3UA 2WPMS 5E8EH 3BTWE 1W0ZU 1DDJA 3U69H 2FLRH 1LPZB 2H1UA 1TABE 4FUIA 4JYTA 2P8OC 1N1LA 2XTTB 1TFXA 2Z7FE 3JZ1B 4Q7ZA 4SGBE 1GHZA 3Q00A 2O8WA 1OYTH 1YCPH 1YPHC 1INCA 3UREA 2ZCHP 5ESTE 2FESH 2ZGJA 2VWOA 3SGBE 2BZ6H 1GVLA 2CF8H 2UUYA 1HIAA 1PQAA 1V2NT 1AN1E 2QC2A 1HB0B 1BA8B 3K9XB 5TCCA 4X6MA 1O2TA 5DP8A 1MTWA 2ULLA 4MPWA 4WMEA 1P10A 4FVDA 3BSQA 4WWYA 2VIQA 4GCHG 1TBQH 2CXVA 4B75A 1C1OA 2C8ZB 3EGKH 3ITIA 5E2PA 1Y5AT 4MNYA 1J14A 2TIOA 3RU4E 3BTTE 2R3UA 2GD4B 1SHYA 1GJDB 1UJ1A 3H5CB 1F5KU 4NZLA 3ZVAA 2BZAA 2VH6A 5C2ZA 1TIOA 8ESTE 1ZZZA 4TYDA 3SU1A 2RA0A 1QNJA 1EP6A 3SJOA 1MZAA 1C9TA 2FOHA 1F5LA 1AKSB 1BHXF 2XXLA 2P59A 4H6TA 1ZRKA 5T6GA 2BY7X 4Y6DA 3SU4A 3HKIB 2UUJB 1C2FA 1KSNA 1ACBE 1QURH 3PLBA 1FI8A 1MD8A 1GVZA 1HAHH 1HAVB 2ZFFH 4K69A 4NA9H 4OGXA 2D8WA 3RXIA 2A1DB 2RDLA 1GBMA 1FONA 1O3BA 2P3UB 2QXJA 3BG4C 3E6PH 1WTHD 3URCA 5E2OA 2RCEA 1PPFE 1HAYB 4A5TS 1QL9A 3PO1B 4I8GA 4OS5A 4WH6A 1O39A 1CGIE 2QY0B 1GI6A 4D9QA 2P3TB 1KYNA 2AS9A 2B9LA 1L0ZA 2NWNA 3F9GA 2PUQH 1AI8H 3BIVH 5LH8A 2J4IA 2YNAA 1ZSJA 4D9RA 4RKOB 1ZMLA 1W13U 2HLCA 1WSSH 4ASHA 4NSYA 3F9EA 5ETXA 3M3SA 1LMWB 1LVYA 2QF3A 1YPHE 1BTZA 1JXPA 3FAOA 3OY5U 4FVBA 1FPHH 3RUOA 3SU5A 3T26A 1AE5A 1G3DA 1K22H 5TCAA 3ZZ8A 1T4VH 3GCHB 3VEQB 3P8GA 1HAXB 1D3PB 4GPGA 3MTYA 1JMOH 1V2QT 1J9CH 4NGAH 2Z9KA 1JIRA 4FUHA 1Q3XA 2EC9H 1TA2A 2JETB 3D49H 3VGCB 4GUXA 3PMAB 1PPEE 3EQ0H 3O8DA 3DFJA 4H6SB 5FXLA 3BTHE 3S7KB 3WY8A 5L6NH 4ISOA 1EUFA 3GDSA 1N6YA 2WUCA 5F8TA 2BM2A 2Z9LA 1ESBA 2SGPE 2BLOA 4Y76A 1UO6A 1GMDF 1GCDA 5TJXA 1ETRH 1O37A 1ESAA 9ESTA 4GCHF 3ZZ4A 1C5QA 5EXLA 3KL6A 2OXSA 2FX4A 1C5MD 3PMHB 1J8AA 4NIWA 2JH6D 3ZZ3A 1MKWH 1P2JA 2SNWA 1NM6A 1P3CA 1HAOH 1C2LA 4AZ2B 1DT2A 2O8LA 2O8TA 2VB0A 1GBAA 1H1BA 4Y79A 1AQ7A 1TX6A 1MTNC 2OD3B 1T31A 1T8LA 3UUZA 7LPRA 3RLWH 1SLWB 1EQ9A 4X6PA 2ALPA 1NPMA 4Y7BA 3SNDA 4YOGA 3MNXA 3KF2A 1Q31A 1XUKA 4X2VA 1K1IA 3MH6A 1SL3A 2WV4A 1SC8U 1SGFA 3BTME 3RMLH 1G3CA 5JYIA 2BXUH 2PFEA 4OGYA 1BTXA 3TITA 4FUFA 4KTUA 5EQRA 4YT6H 1NRPH 2WV5A 2G52A 3PROA 4A1TA 1O2HA 2Y5HA 4CRFA 1DXWA 4ZAEA 3A85A 2OC0A 2XRCA 1CGHA 3NWUA 1YPGH 1RS0A 1W10U 2FI4E 4A6LA 1XXDA 4AYYB 1GGDC 4ZROA 4JK5A 1UTKA 1C1RA 1FZZA 3RXQA 4DJZB 3HPTB 3A88A 1RRKA 4CHAC 1C1MA 3IWMA 1GI8B 2ZZUH 1MH0A 3GY8A 1GL0E 3T29A 1RXPA 1EOLA 1BT7A 3UY9A 1KDQB 3SGQE 3LGVA 3NZIA 4A92A 4WH8A 3RDZA 3GCNA 3QTOH 1C5UA 4O3UA 1NROH 3SU3A 1NS3A 1RTFB 2G4TA 2FP7B 3UTUH 2BB4A 1MUEB 3GY7A 2KAIB 3A7XA 1G3BA 1GMCG 1SGDE 1L2EA 1ZLRA 2G55A 1DWCH 5DK1A 2GT8A 2Y81A 1GBLA 4HTCH 1BJVA 5JBTA 1O2IA 2JH5D 1HCGA 3P95A 7GCHF 2ZU5A 4AX9H 4E06H 1S0QA 5FCRA 1LVMA 3VXEH 1ANEA 4X8UH 5K7RA 1B7XB 3FFGA 3VB7A 1ELCA 3OTJE 3OU0A 3ZZAA 2J94A 5C67A 1ELVA 1NRRH 3EA8A 1GJ4H 1PPZA 2ZEBA 3U8RH 2SGDE 4CR5A 3PB1E 3DD2H 1C9PA 2FODA 1B0EA 1A61H 4WXVA 4B74A 1GMHF 2ZA5A 2EI6A 4NWLA 5EW2H 5C5OA 4MVNA 4CRCA 1BMLA 2RG3A 1C1SA 7ESTE 1O31A 1P2NA 1TNGA 3KN2A 8GCHG 3DFLA 1BUIA 3H7OA 3ZYDA 1ZGIA 2FLBH 5T6DA 1O3CA 1V2ST 2HPPH 1C4U2 1VITG 1NC6A 5F6MA 3LKWA 1CO7E 2VIOA 3F9FA 3RM2H 3C1KA 4B71A 4MG3A 3I77A 1TB6H 4GHQA 1P2MA 2A5AA 1C5VA 2ZG0H 3HATH 4CH2B 1C1TA 2PWXA 3L33A 4FUEA 2ZF0H 2ZFTA 2ZDLA 2ODPA 2Z3DA 4DY7B 1EP5A 2XW9A 3SUEA 1HYLA 1EZQA 1OWJA 1ANDA 2QV1A 3UPEA 1LHGH 3GCTG 1GJBB 1LVBA 5E0HA 3A7TA 3M3TA 2FOGA 4JK6A 1AFEH 1TPSA 2VIPA 2W7UA 4AFQA 2V6NA 1LHEH 4ISHH 1SSXA 1O2XA 1GDUA 1IQJA 1O3LA 2A7CA 1W3CA 2XC5A 3KEEA 3SJKA 5C1YA 3BTFE 5T3HA 2AGIX 1HJ8A 4FUJA 3A7VA 4J2YB 1BQYA 1QRWA 1O3GA 3MU0A 3GDVA 1XKAC 2ANKH 1P57B 2J34A 1EPTB 4YT7H 2IPHA 1MKXK 2HVXA 3LH1A 1GI5A 4TPIZ 2QYIA 1O2VA 1MCTA 1P8VC 1PFXC 1QIXB 3RXAA 2A7JA 3A8BA 4ABJA 1A0HB 2C3SA 4WMDA 2ZGXH 3S9AA 3SV2H 2PSYA 2ZGHA 2BY8X 2HWLB 2AGEX 1RTKA 4AYVB 3SORA 2STAE 4B76A 1VJAU 1TE0A 1FN6A 1QA0A 1O2LA 2P93A 2ZFSA 1MTSA 1MAYA 5I46H 3QK1A 5AF9H 3TNSA 4U32A 1D4PB 4Y8ZA 1GG6C 5B6OA 2G51A 1AD8H 2QA9E 3BTQE 4JZIA 1XUJA 1ZSLA 4DGJA 2GCTC 1TNLA 4ESTE 1AVGH 4CRDA 2TGTA 2BDHA 4NIXA 3UQOA 2A7HA 2GKVE 4ZXXH 3ZZ9A 1S82A 1S85A 1UVPA 1O3DA 3LGIA 3RXUA 1C2IA 2GZ9A 1K1NA 4UFEH 8GCHF 3PYHA 1DLEA 2XBVA 1RJXB 4KP0A 1FDPA 1GBFA 3KHVA 2A4QA 4X2XA 3RU4T 1VITF 3TK6A 4AGJA 1KIGH 1QL8A 2ODYB 2A2QH 1C5OH 3DT0H 2EI8A 2OTVA 1ELTA 1G9IE 2XCNA 3QO6A 4XSKU 3QLPH 1QHRB 3RXFA 1SFIA 1IOEA 3Q77A 1NFWA 3M5LA 3EE0B 2O9QA 1D6WA 1ANCA 3SJIA 3RXTA 1QQ4A 5FBIA 3TU7H 2BVRH 3GCTF 1TNJA 1C1VH 1YP9A 2Z6BD 1NFUA 4FUDA 1DM4B 1JWTA 1UTLM 4SGAE 3UNQA 1NT1A 5DP9A 3P8OA 5JDUB 5DP6A 1T32A 1E34B 5C1XA 1CHGA 4NWKA 4ABEA 3SN8A 1PJPA 3CP7A 1P9UA 2P95A 4O3TA 4LZ1H 4E7NA 1ZGVA 1B5GH 2BQ6B 1JIMA 3U9AH 4YZUA 1IQMA 3RXLA 1E0FD 1VCWA 1SGTA 1GI4A 1XVOA 1HAIH 4ZHMU 5FAHA 1P11E 2BX4A 5CHAC 3ZZDA 1K2I1 2O8UA 1V2PT 1BJUA 1W12U 1O3EA 2UUFB 4MPXA 2NU2E 2H6MA 4BTUB 1AVXA 2C93B 3SUDA 4B2BA 1GJCB 1UTQA 1EJAA 4KTSA 1UHBA 4X1RU 3LONA 5G4BA 1A7SA 1C2DA 1F92A 3OX7U 1GI7B 1WU1A 1ELFA 1IQGA 3R0FA 9LPRA 1Z8JB 1QJ6B 1C5ZB 4ABDA 1BRCE 2FTMA 1ZHMA 3STJA 4Y71A 1TX8A 1QJ7B 1GI3A 4ZKRU 1GWAA 4UD9H 3A84A 1XX9A 1FAKH 2SGQE 4IGDA 1FJSA 3SO3A 2ZKSA 2ANYA 1IQHA 4KKDA 1HIAB 1CE5A 4BANB 1GHXH 2FI3E 3ATWA 1QB1A 2BVXH 2TPIZ 1RD3B 3RXJA 1L4ZA 1FN8A 2B7DH 6GCHG 4WJG2 1OOKB 4JZFH 2ZFQH 1IQLA 2THFB 1DUEA 3A83A 1V2UT 1GBIA 4I8LA 2ILNA 2ZDNA 1W7XH 1ELEE 1ZMNA 3P17H 2FX6A 1LDTT 1DE7H 6LPRA 1Y3YA 2XBYA 4M7GA 3RMMH 4TY7A 3OYPA 1O2KA 1V6DA 1QB9A 2ANWA 3MO3A 4IW4E 3ZZ6A 1FY5A 3MNSA 4Q7YA 3RMOH 1S6HA 2GGVB 1ABIH 1ZHPA 3BN9A 1KXCA 1Y3WA 2VWNA 3P8NA 1OX1A 3U8TH 3UNSA 3UFAA 5C20A 6ESTA 1YKTA 3A87A 1WYKA 4X6OA 1TRMA 2ZHFH 1GI0A 1DFPA 2Y5GA 2VVVA 5C5NA 3B8JA 3BG4B 1TQ0B 1DLKB 2Y5FA 3EAJA 1NY22 1BTYA 4I8KA 3SV6A 1DICA
chains in the Genus database with same CATH superfamily
2G5VA 1CU1A 4F4OC 1DOJA 3DSOA 1W14U 3SW2B 4JZ1A 1CBWC 2J98B 2G00A 2CV3A 4YM9A 1AU8A 2OLGA 1EKBB 1P2QA 1BBRE 3FANA 1O3KA 3AK5A 2FMJA 6CHAC 4H4FA 4HGCA 1V2MT 1WDIA 1W0KD 3EA7A 3TGJE 1T8NA 2HNTF 2J38A 1DWBH 1GI1A 1K1MA 3I29A 1YYY1 4NSVA 4CBNA 2QF4A 1AZ8A 4KTCA 1NTPA 3VPKA 1QBVH 2GZ7A 2A5IA 1IQEA 2ZQ2A 3ODFA 2BDYA 5GCHG 2F9BH 2WYGA 4Y7AA 3CS0A 1C5PA 5LPRA 4IMZA 1EATA 1C5NH 1AFQC 1K21H 3CENA 4LZ4B 4CRGA 2BY6X 2AHME 1O2PA 1TNKA 2OC1A 3RMNH 2ZHWH 1O36A 1HXFH 4BAHB 3O8BA 4IC5A 1FNIA 5CDFE 2R0KA 4NCYA 2WPLS 1LHDH 3OTPA 3SBKA 4AFSA 2Q6FA 2BTCE 2FWWA 1Z8RA 2ZTYA 3ZZ5A 1YPLH 3MQKC 5FCKA 1WBGB 1YPEH 2W3KA 1BMNH 2VINA 3E90B 2ZP0H 2VU8E 3D62A 1TOMH 8KME2 2FOBA 1P0SH 2J95A 3Q76A 1J17T 3NK8A 1QB6A 2BHGA 2BY9X 1KY9A 6GCHF 1MBMA 5A09A 2JH0D 1WV7H 1S0RA 1VR1H 1FIWA 2W3IA 2VNTA 3F68H 1OKXA 3FP8E 2ZHEH 2WPJS 1C5YB 4XRNA 3S9CA 1A5IA 1SGRE 1VGCC 4OS1A 2UWPA 3OE7D 1O30A 2ZHQH 4RN6A 1DWEH 1O3FA 3M37A 2OC7A 2BVSH 3MO9A 4NIYA 2GT7A 3ELAH 4LK4A 2Y7XA 1IQIA 1NO9H 4AN7A 2VVUA 3P8FA 1A0JA 1ZMJA 3DCLA 1AE8H 1FY8E 1ETTH 4TWWA 2OP9A 3SV7A 3GDUA 4OS7A 3M3VA 1P3EA 2ZNKH 3S69A 4AB9A 1TPPA 2VIDA 2OC8A 1E37B 2C8XB 1KXDA 1BBRH 4J1YA 1ZHRA 3P6ZB 1TBZH 3SU2A 1TNHA 2GZ8A 1UTNA 2SNVA 2F9OA 1AB9C 5JPMH 3QUMP 3ZVGA 2VWMA 5A8XA 1ANBA 4B2CA 1E35B 3LGUA 4THNH 1BRAA 3NCLA 2YNBA 1ABJH 4K3JA 2UUKB 4Q7XA 3F6UH 2ZHDA 3RC6A 2BDCA 2BOHB 5AFYH 4IC6A 5GNDA 1Z8GA 1V3XA 1TGNA 2BLWA 2HRVA 2ZU2A 5DSFA 3GICB 5C3NA 1E1RD 1PYTC 3UB0A 4FXGH 1C2KA 4NA8A 3D65E 4LXBH 3PLPA 1TALA 4XOJA 4Z6AH 2ESTE 4IBLH 4NA7A 1K1LA 1YWUA 2QXGA 4FU8A 1DUAA 1KXAA 1Z71A 1T8MA 1GCTB 1AZZA 4JYUH 2A4RA 2Z94A 4MDSA 1C5RA 3SHCH 3A8DA 1YPJH 2JETC 5EU8A 3SHAH 5FPYA 3E0PB 5JBCS 1DVAH 1FV9A 3WW7A 1GPZA 3HGNA 3F2HA 1IHTH 4ABIA 3MOCA 1O5EH 4Z0KA 1QRZA 3IITA 1GHBG 1THPB 3BF6H 3MO6A 2F91A 4CRBA 2G8TA 3ZV9A 4YTAA 5L2ZH 1LKBA 1RGQA 1S5SA 5EGMA 2Q6GA 4E05H 2V7QD 3TH3H 1HXEH 3TLOA 1GVKB 3EDXB 3KQBA 2AMQA 1KLJH 3M5NA 2NU0E 1FQ3A 3M5OA 1BMFD 5I25A 5EODA 1TGCA 2YOLA 1TWXB 1XXFA 2HOBA 4FUGA 4IMQA 2AERH 2FZZA 2GDDA 4B2AA 3O8RA 1TAWA 2ZFRH 4I33A 1G30B 2UWLA 1UCYE 3A8AA 3Q3XA 2ALVA 2BD2A 2CHAC 2NU4E 2BYAX 3M35A 1O5BB 3RXCA 3VB5A 3ATLA 2ZDMA 1A5GH 1UK2A 1VCPA 3PWBA 2FI5E 1YCPM 1GBBA 2FS9A 5DGJA 1C2EA 1RIWC 1ZTLA 2SGFE 1O32A 2STBE 4AORA 3V13A 1IQFA 3K65B 4AC9A 4WMFA 1CGJE 1C2GA 3W95A 1DITH 4ZMAH 2ZTXA 1FMGA 1A46H 3FP6E 4FU7A 3RXGA 3PRBA 1P04A 2F9PA 1EJNA 3MYWA 3W1EA 1UTJA 4JYVH 1LPKB 2I6QA 4TT3D 4FOUC 3S9BA 1NRNH 4O9VA 1O2YA 4A7IB 3GY2A 4B6FA 2GVFA 1O35A 4K2YA 4UFFH 2PTCE 1MKWK 4ZKSU 2F9NA 1TGSZ 2PKSB 1N6XA 2VJ1A 1UVOA 2M5TA 3QN7A 3RXVA 3TK9A 1P02A 1SQRA 1IQNA 2ZCLP 2BXTH 1S6FA 2QGRA 1O3AA 1KDQA 3C27B 1C1WH 3M7UA 1EB2A 4XBBA 1A1RA 1MU8B 3DHKH 4F48B 2FIRH 2GV7A 2FXRA 4ZHAA 3SNBA 3CS7A 1HNEE 1VKYA 1O34A 1PQ7A 4I86A 1O5DH 2AMPA 2B0FA 3BEIB 2YMSB 4XBCA 2A4OA 3TGIE 1SGEE 1GJ7B 1O2MA 1C2JA 1O2QA 1SOTA 4NFFA 2ANMH 1O2OA 4X2WA 3ZYEA 3VB3A 1BZXE 3KNXA 4DG4A 3U1JB 4R0IA 1OP0A 2IOTA 1HUTH 1KLTA 2W7SA 2F43B 2LNCA 3SOSA 3CNRA 3RXHA 1UCYH 1ELDE 1HPGA 1ZPCA 2H9EH 5ESBA 2AIPA 3SJ9A 4I7YH 2IJOB 2A0QB 1DSTA 3G01A 3P92A 3PWCA 1A3EH 3OSYA 3SJ8A 1CT2E 1OWDA 4AGKA 2OQUA 2Q6DA 1LKAA 1GMCF 3OEED 2GP9B 1YBWA 2GJGA 1GI2A 2VGCC 2XWAA 4MQAA 5LGOA 1GBDA 1O5FH 1DY8A 1SVPA 4BXWA 5J4SA 1BIOA 1Y5BT 1WOFA 3BIUH 2EEKA 1BDAA 1O3HA 5HYOA 3EE7A 4RT1A 5E0GA 4K1EA 3PMJA 3E91A 1TOCB 3SZNA 3BTKE 4DOQA 3ATMA 3BEUA 2PR3A 1E38B 4DCDA 2TRMA 3SNAA 3A86A 1C1QA 2GCHG 3SNCA 2VVCA 4Q2KA 5DKMA 3DA9B 3MU4A 1THRH 5EQSA 1UVUH 2R0LA 1Y3VA 4GHTA 2FOCA 1K1OA 1Z1JA 2ZGCA 4A1VA 1SPJA 5KECA 3BTGE 1KTTB 3BG8A 3LDXH 1P06A 1OWKA 4AG2A 4NFEA 1XKBC 3U1IB 2ZTZA 1MBQA 1EX3A 2FOFA 2Z3CA 4RSPA 1D3DB 3RXMA 2F83A 3FZZA 1JOUB 1TA6A 3L3TA 3K6YA 5FX5A 4AFZA 1BRUP 3TJVA 5SGAE 4VGCC 1FY3A 1NZQH 1NRQH 2Z9GA 2PLXA 1EJMA 3KCGH 3SNEA 3F0OA 3T27A 2J92A 3A7YA 1GHVH 4NIVA 1UHBB 1O3NA 1ETSH 1THSH 4B73A 3BTEE 5JB9S 2PSXA 3A82A 1FLEE 1Z6JH 2GX4A 3QWCH 1PPGE 2Z9IA 2PUXB 4JCNA 3SU0A 3AAUA 3M5MA 3IG6B 3ATIA 3RC4A 1P12E 2DE8A 4OS4A 3V7TA 3PTNA 1AY6H 2F9VA 1CQQA 2VIWA 3RXRA 3UIRA 4IS5A 1HJAC 4JMYA 4KELA 2GDEH 4R8TB 3SGAE 2ZPRA 4B1TA 3M7TA 4Y8YA 2DUCA 5DPAA 2FOMB 2A4GA 4H42U 3BTDE 3ZVCA 1CA0B 1XVMA 1AO5A 1BB0B 5PTPA 1RFNA 1DY9A 1YLNA 1V2KT 1NU7B 3V12A 5EXNA 3KIDU 1LHFH 2C8WB 3MU8A 3Q3KA 3S0NA 2HLDD 1HJ9A 1P09A 1GJAB 1AMHA 1BTHH 1O0DH 1WQVH 2K1QA 1HBTH 3PTBA 1F0TA 3AASA 1DANH 1XUIA 4FU9A 4ZUHA 4I32A 3T28A 1OYQA 1QR3E 4YOIA 2EQNA 4OS2A 1E1QD 2H5DA 3RLYH 2GMTC 1N8OC 1OP8A 2P8OB 3KYFA 2KCYA 3R3GB 3ZZBA 1HGTH 4Y11E 1A4WH 4NG9H 1D3QB 3T2NA 2WPKS 5EOKA 5DG6A 2PKAA 3FOAA 1HV7A 1O2NA 2V0BA 4FUCA 5F8ZA 3VXFH 1NBMD 1ZPZA 2GCHF 2W26A 1NU9A 4Q80A 3MU1A 4YO9A 3MH5A 1WTGH 2UWOA 2AMDA 5HM2A 1VZQH 2XBXA 1C2MA 3MH4A 4X8VH 3UQVA 3ZV8A 3LIWA 4MLFB 1O33A 1TNIA 2FO9A 1EZSC 4RT0A 1J15A 2TBSA 1FUJA 1SI5H 4ABFA 2R3YA 5L2YH 5A2MH 1Q2WA 1W7GH 3ODDA 1AVWA 1BHXB 1G2LA 1SLXB 3ZVFA 2W6ID 1F0SA 1S83A 3N99A 1O2UA 1CT4E 2ZI2H 1IQKA 1XMNB 2A45B 3SI3H 3E0NB 1H8IH 3LC3A 2A31A 3E16B 1IAUA 4M9FA 5FHTA 3F0PA 4OS6A 5HXFA 4CR9A 3E1XB 3N7OA 3VB4A 1J16A 1WCZA 2WV9A 3KQ5A 4O97A 1HFDA 4ZHLU 1UW7A 3VB6A 1UTOA 3TJNA 4BAOB 3GY3A 3RC5A 4U2WA 1AWFH 3NPSA 1SOZA 3QDZB 2ZECA 1MABB 4JZDH 3U98H 1DSUA 1GHAG 1AFQB 2QIQA 3LT3A 4JZEH 3D23A 1EFRD 5IDKA 3GOVB 4X0WU 3FZDA 2JKHA 2R2WU 4O03A 3SQEE 3OY6U 1Z6EA 3EA9A 4I31A 1O2WA 1C4V2 2BD9A 1ZRBA 4FUBA 4X8SH 2PGBB 2OCVB 3TK5A 1GDQA 2ZU4A 4Y0YE 2H9HA 1LQDB 1MQ5A 3T25A 1W11U 3A81A 3LU9B 3MNBA 5JB8S 1VJ9U 4DVAU 2B8OH 4P00A 1OPHB 2HNTC 4X1SU 1GMDG 4F49A 4Y8XA 2B5TB 1KXFA 1AGJA 2J2UA 1ORFA 1UVSH 2DE9A 1F0UA 1SLUB 2KR7A 4ABGA 1OS8A 1F2SE 1ZSKA 1SHHB 3KGPA 1TPOA 2BMGB 5FL7D 1AUTC 3NRLA 3RM0H 3ZIAD 1VITH 1VGCB 1XUGA 1A0LA 1HLTH 1G3EA 1SBWA 2AIQA 2Z9JA 1AHTH 3K2UA 5C94A 5CMXH 2BDIA 3TNTA 1YC0A 3A7ZA 5A0AE 5L30H 3SU6A 2FDAA 2ZU3A 2PGQB 1C5TA 2GTBA 1Y5UT 1AUJA 1CHOG 4HZHA 1QY6A 1G32B 1ELBA 2AFQB 1QA7A 2V3OH 1C4Y2 2V3MA 2ZO3H 3M7QA 1NRSH 4WF8A 2AH4X 1OXGA 1XUHA 1TMTH 1L1GA 3LH3A 3FN8A 3ZVDA 3VG8A 2G81E 4CRAA 1FIZA 4HFPB 1O38A 1UMAH 3ZZ7A 2R2MB 3ZVEA 1FAXA 5EPNA 3M61U 1SGNE 2AGGX 1BMMH 1AB9B 1EXFA 3SV8A 1TMUH 1QL7A 4UEHH 2Y82A 3QGNB 2OBQA 1GDNA 5C0TA 2J98A 1V2VT 4YESB 4UFGH 1GBCA 1Y8TA 5ABWA 3SV9A 1S81A 1SGFG 5DP4A 2RDEA 2AEIH 2ZFPH 1O3MA 1QQUA 1O2RA 1KTSB 1V2TT 5DP7A 2D2DA 1KXEA 2ZPSA 1AKSA 1YLDA 1MTNB 1OSSA 2WPHS 1SR5C 5AHGH 2R9PA 4B6EA 1FXYA 2YMSD 5GJ4B 4K8BA 1HAVA 1EAWA 1MZDA 5DP5A 1GHAF 3B9FH 3HGPA 1YCPK 3LGWA 4ABAA 1ZYOA 1EZXC 2HNTE 5K0HA 2P3FH 1FPCH 1K1PA 3PV2A 2XC0A 1L1JA 1Z1IA 3HKJB 1BOQA 1ARCA 1EASA 4ABHA 3PO1C 3FO8D 5FPTA 1C1PA 3UWIA 1SGPE 1KXBA 1QBOA 3UNRA 4XFQA 2TGDA 2A32A 3MU5A 1P9SA 1NFYA 2AYWA 3PLKA 1OWEA 2FTLE 7GCHG 1QGFA 2F3CE 2A5KA 1GGDB 1SGQE 5HGGA 4HI3A 1X7AC 2SGEE 4GVUA 4CHAB 4GLYA 1CA8B 3ESTA 5CE1A 1LO6A 4MTBA 1GHWH 1TRYA 2XC4A 3ENSB 1ESTA 4K1SA 2FS8A 2BDBA 1MCVA 5GCHF 1TLDA 1OWIA 1RTLA 2CMYA 3MWIU 4XDEA 1Z7KA 3GCHC 2FOEA 2IJD1 5A0BA 2D1JA 4E7RG 1EAUA 4BAKB 1GMHG 1LTOA 1K1JA 1CHOF 2BY5X 3SUFA 1QRXA 1SLVB 2CHAB 1T8OA 1MQ6A 1QFKH 2NU1E 1H4WA 3VGCC 2CF9H 4I8JA 3Q3YA 2FEQH 3GISB 1V2OT 1HDTH 1V2JT 1MU6B 1P2IA 3QGJA 1TBRH 1C1UH 2KCOA 1SFQB 1S84A 1TGBA 1RIWB 3RXBA 4D8NA 5EJLA 3V3MA 1C5LH 3MFJA 3KQDA 2HGTH 1B0FA 1GJ9B 1BTUA 4BTTB 2Y7ZA 2VH0A 4ZCNA 1M9UA 1YF4A 1D9IA 1D6RA 1SGYE 3RXPA 3V0XA 1JRSA 2BD7A 1JRTA 5BRRE 3A80A 3A8CA 1BCUH 1GBKA 1SGIB 3LGYA 3PRDA 4D76A 2ZCKP 2PTNA 3SI4H 4F55A 2K0QA 1E79D 2BDAA 1ID5H 3SUGA 2BD5A 2HVYB 1C5SA 4INHA 5EXMA 3PV5A 3M36A 1T4UH 4NZQA 1P01A 5F03A 3HK6B 2SGAA 3B23B 3T62A 2Q1JA 3RU4D 3STIA 3MNCA 5EW1H 4GAWA 1MKXH 3SQHE 2KCPA 3QTVH 2TGAA 3TJOA 1IHSH 3FVFB 2ZDAH 2OQ5A 4K8YA 1TMBH 4K1TA 1UTPA 4D7FA 3TPIZ 1HAGE 5HKKD 2BQWB 3TH4H 1MAXA 4DURA 4AG1A 1OP2A 2CJIA 3E3TA 2VWLA 1XUFA 1SGCA 4ACAA 1GCTC 2V3HH 1AWHB 3UOUA 2I6SA 1ZOMA 7KMEH 1DS2E 4ZH8A 5EG4A 2L74A 2J5UA 2F9UA 4ISNA 3JZ2B 1VCQA 3QX5H 5DP3A 4Z1MD 3ATKA 4MNXA 1BBRK 1EB1H 4X1QU 1MD7A 1BRBE 3AAVA 4RKJB 2QCYA 4UDWH 2W5EA 2OINA 1WAYB 1NFXA 3U8OH 1WQSA 1C5WB 1H9LB 1ZJKA 3A7WA 4U30A 2J9NA 2QXHA 2RA3A 3E8LA 3L6PA 2OBOA 1JBUH 1TRNA 1Y3XA 1DXPA 2VIVA 1GI9B 4QT8C 4Y10E 2BOKA 1NN6A 5FPSA 2BD8A 2QN5T 3LJJA 2FOAA 1V2RT 2ZDKA 1H9HE 1P03A 3PMBB 4ASUD 5A0CA 1SQOA 3GCOA 5E0JA 1MTVA 4UE7H 1YLCA 1KLIH 4WXIA 2IN2A 4CBOA 1SB1H 2Y6TA 2SFAA 4YLQH 2KAIA 4A1XA 4K5ZA 1XM1A 2HPQH 2VGCB 2WUBA 4BOHA 1EZUC 4BNRA 2P94A 1K0HA 1FX0B 1V2LT 5KEDA 4Y0ZE 1F0RA 1GHBF 3RXKA 3TH2H 5GIBA 2QXIA 1A5HA 1NBME 2KCAA 5DO4H 1DX5M 3TVJB 4X6NA 4DT4A 1W8BH 1FY4A 2WZQA 1GG6B 2KM0A 2OUAA 4DT7B 5F8XA 2ZQ1A 1ARBA 5A8ZA 1A3BH 3TJUA 3PM3A 2GCTB 5H4IB 1WUNH 4WVPE 3AW1A 5AFZH 1O2SA 2WYJA 2BLVA 4MPVA 4IN1A 2HALA 4X1NU 4K60A 2ODQA 4X1PU 3MH7A 1BMAA 5T1VA 1UVTH 1GBEA 2EA3A 5HM9A 2ZWLH 2IPQX 2PKSC 1BTWA 2XYAA 1ZR0A 1LVOA 1ELGA 5EJ1A 1GL1A 1HAZB 2EI7A 1QBNA 3LPRA 3FP7E 1F5RA 3RXDA 1O3PB 3MHWU 1CVWH 2QF0A 1O3JA 3QZRA 3VFEA 4VGCB 2BDGA 1KMHB 4DIHH 5GWZA 1YGCH 1SG8B 3ZVBA 4UFDH 3GYMA 2V35A 2TGPZ 2Z3EA 2W6JD 5JBBS 4BTIB 1ZTKA 4UONA 5JBAS 1YPKH 2PV9B 2O8MA 5FX6A 1Y59T 2ASUB 1YM0A 2RFKC 3HK3B 4XE4A 2D26C 3DUXH 1CT0E 1LCYA 4YLUA 1GBTA 4ZXYH 1A2CH 5LPEA 3PV4A 1GBHA 1SQAA 1HJAB 5IYTA 1PPHE 2GV6A 5J4QA 3T5FH 1TPAE 1EOJA 3GYLB 1O3IA 5GDSH 1K28D 4BAQB 1HRTH 3LJOA 2BQ7B 4GSOA 3F1SB 1H8DH 2ZPQA 2C8YB 5T6FA 1MTUA 2BD3A 4U01A 1ELAA 2BD4A 4YOJA 4XBDA 2WINI 5EQQA 2CGAA 5CHAB 1W2KH 1ZJDA 2WPIS 4ABBA 5C1UA 1EPTA 3KYGA 1TQ7B 2H2ZA 3OFND 3UAIC 1EPTC 4CREA 1PPBH 1GHYH 1AIXH 1LHCH 1LPGB 1QCPA 1T7CA 1G36A 1LQEA 1PQ8A 2FYQA 2XCFA 4IN2A 1H9IE 1O2GH 2NU3E 1U6QA 3TGKE 5GPIB 3TIUA 1K9OE 2ZC9H 4DIIH 2BLQA 2GMTB 1N8OB 4DW2U 1P2OA 2A2XH 2BX3A 4X2YA 1NESE 1O2ZA 4INLA 2LPRA 3BEFB 4ISLA 1UTMA 2QAAA 1GBJA 1GJ6A 3UR9A 2C4FH 1C1NA 2KX4A 3K6ZA 2Y80A 5B6LA 3W94A 1MMJN 1TONA 2PKAB 8LPRA 2CN0H 2ZGBH 4INKA 1SQTA 1BTPA 1TYNA 4BXSA 4LOYH 1PQ5A 2FYRA 1UK3A 1O5GH 4ZKNU 5GXPA 3BV9B 1DPOA 1O5CB 3UOPA 1QJ1B 1O5AB 1O3OA 1UCYK 1PYTD 3A89A 3RP2A 1HAPH 1TGTA 2XBWA 1EAXA 3I78A 4X8TH 2ZU1A 2FM2A 3UWJH 2FPZA 1L1NA 3GS9A 3H7TA 1O2JA 1D3TB 1C5XB 1E36B 3RXSA 1Z8IB 2XNDD 2C90B 3ZZCA 3MI4A 1ZPBA 4MNVA 3LC5A 4MPUA 3WWBA 3S7HB 4WY3A 1C2HA 1EAIA 3GY6A 1CSOE 3LOXA 4TPYA 3AVZA 1UK4A 3LGTA 4XD7D 1DWDH 5BPEA 3O8CA 2G5NA 3NKKA 4D7GA 5EPYA 1P05A 5F53A 3EYDA 1G2MA 1GJ8B 3RXEA 3P70B 1V2WT 1G37A 2G4UA 5FBEA 5C0UA 1OWHA 4BAMB 2ZDVH 3KQCA 1QTFA 1L4DA 4AOQA 4KGAA 4CH8B 1TX7A 2H9TH 1BITA 3RXOA 3AW0A 2PHBA 2XWBI 1PPCE 4TY6A 5DJ7A 4AB8A 3URDA 2EY4C 3GY4A 2PW8H 3GY5A 1FY1A 1GJ5H 1CBWB 3KQEA 2P16A 1YPMH 1SMFE 3QZQA 1CA0C 3F9HA 3MMGA 4ZKOU 4I8HA 6CHAB 4ISIH 4TWYA 3NUMA 1P2KA 3NXPA 4AFUA 2H5CA 1W0YH 4PROA 2ZIQH 3UR6A 5HMAA 2M2AA 1F7ZA 2XNIA 5LPFA 5A8YA 4MNWA 5AVDA 1ZTJA 1Y3UA 2WPMS 5E8EH 3BTWE 1W0ZU 3SZEA 5CHBA 1DDJA 3H09A 2FLRH 1LPZB 3U69H 2H1UA 1TABE 4FUIA 4JYTA 2P8OC 1N1LA 2XTTB 1TFXA 2Z7FE 3JZ1B 4Q7ZA 4SGBE 1GHZA 3Q00A 2O8WA 1OYTH 1YCPH 1YPHC 1INCA 3UREA 2ZCHP 5ESTE 2FESH 2ZGJA 4TSFD 2VWOA 3SGBE 2BZ6H 4RI0A 1GVLA 2CF8H 4Q4LA 2UUYA 1HIAA 1PQAA 3FKSD 1V2NT 1AN1E 2QC2A 1HB0B 1BA8B 3K9XB 5TCCA 4X6MA 1O2TA 5DP8A 1MTWA 2ULLA 4MPWA 4WMEA 1P10A 4FVDA 3BSQA 4WWYA 2VIQA 4GCHG 1TBQH 2CXVA 4B75A 1C1OA 2C8ZB 3EGKH 3ITIA 5E2PA 2OK5A 1Y5AT 4MNYA 1J14A 2TIOA 3RU4E 3BTTE 2R3UA 2GD4B 1SHYA 1GJDB 1UJ1A 3H5CB 1F5KU 4NZLA 3ZVAA 2BZAA 2VH6A 5C2ZA 1TIOA 8ESTE 1ZZZA 4TYDA 3SU1A 2RA0A 1QNJA 5DN6D 1EP6A 3SJOA 5HIZA 1MZAA 1C9TA 2FOHA 1F5LA 1AKSB 1BHXF 2XXLA 2P59A 4H6TA 1ZRKA 5T6GA 2BY7X 3DSPA 4Y6DA 3SU4A 3HKIB 2UUJB 1C2FA 1KSNA 1ACBE 1QURH 3PLBA 1FI8A 1MD8A 1GVZA 1HAHH 1HAVB 3N7EA 2ZFFH 4K69A 4NA9H 4OGXA 2D8WA 3RXIA 2A1DB 2RDLA 1GBMA 1FONA 1O3BA 2P3UB 2QXJA 3BG4C 3E6PH 1WTHD 2JJ1D 3URCA 5E2OA 2RCEA 1PPFE 1HAYB 4A5TS 1QL9A 3PO1B 4I8GA 4OS5A 4WH6A 1O39A 1CGIE 2QY0B 1GI6A 4D9QA 2P3TB 1KYNA 2AS9A 2B9LA 1L0ZA 2NWNA 3F9GA 3SYJA 2PUQH 1AI8H 3BIVH 5LH8A 3N7DA 2J4IA 2YNAA 1ZSJA 4ACBA 4D9RA 4RKOB 1ZMLA 1W13U 2HLCA 1WSSH 4ASHA 4NSYA 3F9EA 3U28C 5ETXA 2WHXA 3M3SA 1OHHD 1LMWB 1LVYA 2QF3A 1YPHE 1BTZA 1JXPA 3FAOA 3OY5U 4FVBA 1FPHH 3RUOA 2F4LA 3SU5A 3T26A 1AE5A 1G3DA 1K22H 5TCAA 3ZZ8A 1T4VH 3GCHB 3VEQB 3P8GA 1HAXB 1D3PB 4GPGA 3MTYA 1JMOH 1V2QT 1J9CH 4NGAH 2J97A 2Z9KA 1JIRA 4FUHA 1Q3XA 2EC9H 5HIYA 1TA2A 2JETB 3D49H 3VGCB 4GUXA 3PMAB 1PPEE 3EQ0H 3O8DA 3DFJA 4H6SB 5FXLA 3BTHE 3S7KB 3WY8A 5L6NH 4ISOA 1EUFA 3GDSA 1N6YA 2WUCA 5F8TA 2BM2A 2Z9LA 1ESBA 2KZ4A 2SGPE 1WXRA 2BLOA 4Y76A 1UO6A 1GMDF 1GCDA 5TJXA 1ETRH 1O37A 1ESAA 9ESTA 4GCHF 3ZZ4A 1C5QA 5EXLA 3KL6A 2OXSA 2FX4A 1C5MD 3PMHB 1J8AA 4NIWA 2JH6D 3ZZ3A 1MKWH 1P2JA 2SNWA 1NM6A 1P3CA 1HAOH 1C2LA 5C17A 4AZ2B 1DT2A 2O8LA 2O8TA 2VB0A 1GBAA 1H1BA 3WWFA 3OEHD 4Y79A 1AQ7A 1TX6A 1MTNC 1QZ8A 2OD3B 1T31A 1T8LA 3UUZA 7LPRA 3RLWH 1SLWB 1EQ9A 2WPDD 4X6PA 2ALPA 1NPMA 4Y7BA 3SNDA 4YOGA 3MNXA 3KF2A 1Q31A 1XUKA 4X2VA 1K1IA 3MH6A 2JIZD 1SL3A 2WV4A 1SC8U 1SGFA 3BTME 3RMLH 1G3CA 5JYIA 2BXUH 2PFEA 4OGYA 1BTXA 3TITA 4FUFA 4KTUA 5EQRA 4YT6H 1NRPH 2WV5A 2G52A 3PROA 4A1TA 1O2HA 2Y5HA 4CRFA 1DXWA 4ZAEA 3A85A 2OC0A 2XRCA 1CGHA 3NWUA 1YPGH 5EJZA 1RS0A 1W10U 2FI4E 4A6LA 1XXDA 4AYYB 1GGDC 4ZROA 4JK5A 1UTKA 1C1RA 1FZZA 3RXQA 4DJZB 3HPTB 3A88A 1RRKA 4CHAC 1C1MA 2LP6A 3IWMA 1GI8B 2ZZUH 1MH0A 3GY8A 1GL0E 3T29A 1RXPA 1EOLA 1BT7A 3UY9A 1KDQB 3SGQE 3LGVA 4HG6A 3NZIA 4A92A 4WH8A 3F2FA 3RDZA 3GCNA 3QTOH 1C5UA 4O3UA 1NROH 3SU3A 1NS3A 1RTFB 2G4TA 2FP7B 3UTUH 2BB4A 1MUEB 3GY7A 2KAIB 3A7XA 1G3BA 1GMCG 1SGDE 1L2EA 1ZLRA 2G55A 1DWCH 5DK1A 2GT8A 2Y81A 1GBLA 4HTCH 1BJVA 5JBTA 1O2IA 2JH5D 1HCGA 3P95A 7GCHF 2ZU5A 4AX9H 4E06H 1S0QA 5FCRA 1LVMA 3VXEH 1COWD 1ANEA 4X8UH 5K7RA 1B7XB 3FFGA 3VB7A 1ELCA 3OTJE 2JJ2D 3OU0A 3ZZAA 2J94A 5C67A 1ELVA 1NRRH 3EA8A 1GJ4H 1PPZA 2ZEBA 3U8RH 2SGDE 4CR5A 3PB1E 3DD2H 1C9PA 2FODA 1B0EA 1A61H 4WXVA 4B74A 1GMHF 2ZA5A 2EI6A 4NWLA 5EW2H 5C5OA 4MVNA 4CRCA 1BMLA 2RG3A 1C1SA 7ESTE 1O31A 1P2NA 1TNGA 3KN2A 8GCHG 3DFLA 1BUIA 5EIYA 3H7OA 3ZYDA 1ZGIA 2FLBH 5T6DA 1O3CA 1V2ST 2HPPH 1C4U2 1VITG 2XOKD 1NC6A 5F6MA 3LKWA 1CO7E 2VIOA 3F9FA 3RM2H 3C1KA 4B71A 4MG3A 3I77A 1TB6H 4GHQA 1P2MA 2A5AA 1C5VA 2ZG0H 3HATH 4CH2B 1C1TA 2PWXA 3L33A 4FUEA 1YY3A 2ZF0H 2ZFTA 2ZDLA 2ODPA 2Z3DA 4P02A 4DY7B 1EP5A 2XW9A 3F3BA 3SUEA 1HYLA 1EZQA 1OWJA 1ANDA 2QV1A 3UPEA 1LHGH 3GCTG 1GJBB 1LVBA 5E0HA 3A7TA 3M3TA 2FOGA 4JK6A 2L6OA 1AFEH 1TPSA 2VIPA 2W7UA 3DSGA 4AFQA 2V6NA 1LHEH 4ISHH 1SSXA 1O2XA 1GDUA 1IQJA 1O3LA 2A7CA 1W3CA 2XC5A 3KEEA 3SJKA 5C1YA 2JDID 3BTFE 5T3HA 2AGIX 1HJ8A 4FUJA 3A7VA 4J2YB 1BQYA 1QRWA 1O3GA 3MU0A 3GDVA 1XKAC 2ANKH 1P57B 2J34A 1EPTB 4YT7H 2IPHA 1MKXK 2HVXA 3LH1A 1GI5A 4TPIZ 2QYIA 1O2VA 1MCTA 1P8VC 1PFXC 1QIXB 3RXAA 2A7JA 3A8BA 3OAAD 4ABJA 1A0HB 2C3SA 4WMDA 2ZGXH 3S9AA 3SV2H 2PSYA 2ZGHA 2BY8X 2HWLB 2AGEX 1RTKA 4AYVB 3SORA 2STAE 2YMSC 1VJAU 4B76A 1TE0A 1FN6A 1QA0A 1O2LA 2P93A 2ZFSA 1MTSA 1MAYA 2VBCA 5I46H 3QK1A 5AF9H 3TNSA 4U32A 2WSSD 1D4PB 4Y8ZA 1GG6C 5B6OA 2G51A 1AD8H 2QA9E 3BTQE 1S6LA 4JZIA 1XUJA 1ZSLA 4DGJA 2GCTC 1TNLA 4ESTE 1AVGH 4CRDA 1H8ED 2TGTA 2BDHA 4NIXA 3UQOA 2A7HA 2GKVE 4ZXXH 3ZZ9A 1S82A 1S85A 1UVPA 4FETA 1O3DA 3LGIA 3RXUA 5KGOA 1C2IA 2GZ9A 1K1NA 4UFEH 8GCHF 3PYHA 1DLEA 2XBVA 1RJXB 4KP0A 1FDPA 1GBFA 3KHVA 2A4QA 4X2XA 3RU4T 1VITF 3TK6A 4AGJA 1KIGH 1QL8A 2ODYB 2A2QH 1C5OH 3DT0H 2EI8A 2KFWA 1ELTA 2OTVA 1G9IE 2XCNA 3QO6A 2LELA 4XSKU 3QLPH 1QHRB 3RXFA 1SFIA 1IOEA 3Q77A 1NFWA 3M5LA 3EE0B 2O9QA 1D6WA 1ANCA 3SJIA 3RXTA 1QQ4A 5FBIA 3TU7H 2BVRH 3GCTF 1TNJA 1C1VH 1YP9A 2Z6BD 1NFUA 4FUDA 1DM4B 1JWTA 1UTLM 4SGAE 3UNQA 1NT1A 5DP9A 3P8OA 5JDUB 5DP6A 1T32A 1E34B 5C1XA 1SKYE 1CHGA 4NWKA 4ABEA 3SN8A 1PJPA 3CP7A 1P9UA 2P95A 4O3TA 3F2GA 4LZ1H 4E7NA 1ZGVA 1B5GH 2BQ6B 1JIMA 5IK2D 3U9AH 4YZUA 1IQMA 3RXLA 1E0FD 1VCWA 1SGTA 4OM9A 1GI4A 1XVOA 1HAIH 4ZHMU 5FAHA 1P11E 2BX4A 5CHAC 3ZZDA 1K2I1 2O8UA 1V2PT 1BJUA 1W12U 1O3EA 2UUFB 4MPXA 2NU2E 2H6MA 4BTUB 1AVXA 2C93B 3SUDA 4B2BA 1GJCB 1UTQA 1EJAA 4KTSA 1UHBA 4X1RU 3LONA 5G4BA 1A7SA 1C2DA 1F92A 3OX7U 1W0JD 1GI7B 1WU1A 1ELFA 1IQGA 3R0FA 9LPRA 1Z8JB 1QJ6B 1C5ZB 4ABDA 1BRCE 2CK3D 2FTMA 1ZHMA 3STJA 4Y71A 1TX8A 1QJ7B 1GI3A 4ZKRU 1GWAA 4UD9H 3A84A 1XX9A 1FAKH 2SGQE 4IGDA 1FJSA 3SO3A 2ZKSA 2ANYA 1IQHA 4KKDA 1HIAB 1CE5A 2QF5A 4BANB 1GHXH 2FI3E 3ATWA 1QB1A 2BVXH 2TPIZ 1RD3B 3RXJA 1L4ZA 1FN8A 2B7DH 6GCHG 4WJG2 1OOKB 4JZFH 2ZFQH 1IQLA 2THFB 1DUEA 3A83A 1V2UT 1GBIA 4I8LA 2ILNA 2ZDNA 1H8HD 1W7XH 1ELEE 1ZMNA 3P17H 2PP6A 2FX6A 1LDTT 1DE7H 2K8IA 6LPRA 1Y3YA 2XBYA 4M7GA 2QE7D 3RMMH 4TY7A 3OYPA 1O2KA 1V6DA 1QB9A 2ANWA 3MO3A 4IW4E 3ZZ6A 1FY5A 3MNSA 4Q7YA 3RMOH 1S6HA 2GGVB 1ABIH 1ZHPA 3BN9A 1KXCA 1Y3WA 2VWNA 3P8NA 1OX1A 3U8TH 3UNSA 3UFAA 5C20A 6ESTA 1YKTA 3A87A 1WYKA 4X6OA 4YXWD 1TRMA 2ZHFH 1GI0A 1DFPA 2Y5GA 2VVVA 5C5NA 3B8JA 3BG4B 1TQ0B 1DLKB 2Y5FA 3EAJA 1NY22 1BTYA 4I8KA 4Q63A 3SV6A 1DICA
chains in the Genus database with same CATH topology
2G5VA 1CU1A 4F4OC 1DOJA 1W14U 3SW2B 4JZ1A 1CBWC 2G00A 2CV3A 4YM9A 1AU8A 2OLGA 1EKBB 1P2QA 1BBRE 3FANA 1O3KA 2FMJA 6CHAC 4H4FA 4HGCA 1V2MT 3EA7A 3TGJE 1T8NA 2HNTF 2J38A 1DWBH 1GI1A 1K1MA 3I29A 1YYY1 4NSVA 4CBNA 1AZ8A 4KTCA 1NTPA 3VPKA 1QBVH 2GZ7A 2A5IA 1IQEA 2ZQ2A 3ODFA 2BDYA 5GCHG 2F9BH 2WYGA 4Y7AA 3CS0A 1C5PA 5LPRA 4IMZA 1EATA 1C5NH 1AFQC 1K21H 3CENA 4LZ4B 4CRGA 2BY6X 1O2PA 1TNKA 2OC1A 3RMNH 2ZHWH 1O36A 1HXFH 4BAHB 3O8BA 4IC5A 1FNIA 2R0KA 4NCYA 2WPLS 1LHDH 3SBKA 4AFSA 2Q6FA 2BTCE 2FWWA 1Z8RA 2ZTYA 3ZZ5A 1YPLH 5FCKA 1WBGB 1YPEH 2W3KA 1BMNH 2VINA 3E90B 2ZP0H 2VU8E 3D62A 1TOMH 8KME2 2FOBA 1P0SH 2J95A 3Q76A 1J17T 3NK8A 1QB6A 2BHGA 2BY9X 1KY9A 6GCHF 1MBMA 5A09A 2JH0D 1WV7H 1S0RA 1VR1H 1FIWA 2W3IA 2VNTA 3F68H 1OKXA 3FP8E 2ZHEH 2WPJS 1C5YB 3S9CA 1A5IA 1SGRE 1VGCC 4OS1A 2UWPA 1O30A 2ZHQH 4RN6A 1DWEH 1O3FA 3M37A 2OC7A 2BVSH 3MO9A 4NIYA 2GT7A 3ELAH 4LK4A 2Y7XA 1IQIA 1NO9H 4AN7A 2VVUA 3P8FA 1A0JA 1ZMJA 1AE8H 1FY8E 1ETTH 4TWWA 2OP9A 3SV7A 3GDUA 4OS7A 3M3VA 1P3EA 2ZNKH 3S69A 4AB9A 1TPPA 2VIDA 2OC8A 1E37B 2C8XB 1KXDA 1BBRH 4J1YA 1ZHRA 3P6ZB 1TBZH 3SU2A 1TNHA 2GZ8A 1UTNA 2SNVA 2F9OA 1AB9C 5JPMH 3QUMP 3ZVGA 2VWMA 5A8XA 1ANBA 4B2CA 1E35B 3LGUA 4THNH 1BRAA 3NCLA 2YNBA 1ABJH 4K3JA 2UUKB 4Q7XA 3F6UH 2ZHDA 3RC6A 2BDCA 2BOHB 5AFYH 4IC6A 1Z8GA 1V3XA 1TGNA 2BLWA 2HRVA 2ZU2A 3GICB 5C3NA 1PYTC 4FXGH 1C2KA 4NA8A 3D65E 4LXBH 3PLPA 1TALA 4XOJA 4Z6AH 2ESTE 4IBLH 4NA7A 1K1LA 2QXGA 4FU8A 1DUAA 1KXAA 1Z71A 1T8MA 1GCTB 1AZZA 4JYUH 2A4RA 2Z94A 4MDSA 1C5RA 3SHCH 3A8DA 1YPJH 2JETC 5EU8A 3SHAH 5FPYA 3E0PB 5JBCS 1DVAH 1FV9A 1GPZA 3HGNA 4ABIA 1IHTH 3MOCA 1O5EH 4Z0KA 1QRZA 3IITA 1GHBG 1THPB 3BF6H 3MO6A 2F91A 4CRBA 2G8TA 3ZV9A 4YTAA 5L2ZH 1LKBA 1RGQA 1S5SA 5EGMA 2Q6GA 4E05H 3TH3H 1HXEH 3TLOA 1GVKB 3EDXB 3KQBA 2AMQA 1KLJH 3M5NA 2NU0E 1FQ3A 3M5OA 5I25A 5EODA 1TGCA 2YOLA 1TWXB 1XXFA 2HOBA 4FUGA 4IMQA 2AERH 2FZZA 2GDDA 4B2AA 3O8RA 1TAWA 2ZFRH 4I33A 1G30B 2UWLA 1UCYE 3A8AA 3Q3XA 2ALVA 2BD2A 2CHAC 2NU4E 2BYAX 3M35A 1O5BB 3RXCA 3VB5A 3ATLA 2ZDMA 1A5GH 1UK2A 1VCPA 3PWBA 2FI5E 1YCPM 1GBBA 2FS9A 5DGJA 1C2EA 1RIWC 1ZTLA 2SGFE 1O32A 2STBE 4AORA 3V13A 1IQFA 3K65B 4WMFA 1CGJE 1C2GA 3W95A 1DITH 4ZMAH 2ZTXA 1FMGA 1A46H 3FP6E 4FU7A 3RXGA 1P04A 2F9PA 1EJNA 3MYWA 1UTJA 4JYVH 1LPKB 2I6QA 3S9BA 1NRNH 4O9VA 1O2YA 4A7IB 3GY2A 2GVFA 1O35A 4K2YA 4UFFH 2PTCE 1MKWK 4ZKSU 2F9NA 1TGSZ 2PKSB 1N6XA 2VJ1A 1UVOA 2M5TA 3QN7A 3RXVA 3TK9A 1P02A 1IQNA 2ZCLP 2BXTH 1S6FA 2QGRA 1O3AA 1KDQA 3C27B 1C1WH 3M7UA 1EB2A 4XBBA 1A1RA 1MU8B 3DHKH 2FIRH 2GV7A 2FXRA 4ZHAA 3SNBA 3CS7A 1HNEE 1O34A 1PQ7A 1O5DH 2AMPA 2B0FA 3BEIB 4XBCA 2A4OA 3TGIE 1SGEE 1GJ7B 1O2MA 1C2JA 1O2QA 1SOTA 4NFFA 2ANMH 1O2OA 4X2WA 3ZYEA 3VB3A 1BZXE 3KNXA 4DG4A 3U1JB 4R0IA 1OP0A 2IOTA 1HUTH 1KLTA 2W7SA 2LNCA 3SOSA 3RXHA 1UCYH 1ELDE 1HPGA 1ZPCA 2H9EH 5ESBA 2AIPA 3SJ9A 4I7YH 2IJOB 2A0QB 1DSTA 3G01A 3P92A 3PWCA 1A3EH 3OSYA 3SJ8A 1CT2E 1OWDA 4AGKA 2OQUA 2Q6DA 1LKAA 1GMCF 2GP9B 1YBWA 1GI2A 2VGCC 2XWAA 4MQAA 5LGOA 1GBDA 1O5FH 1DY8A 1SVPA 4BXWA 5J4SA 1BIOA 1Y5BT 1WOFA 3BIUH 2EEKA 1BDAA 1O3HA 5HYOA 5E0GA 4K1EA 3PMJA 3E91A 1TOCB 3SZNA 3BTKE 4DOQA 3ATMA 3BEUA 2PR3A 1E38B 4DCDA 2TRMA 3SNAA 3A86A 1C1QA 2GCHG 3SNCA 2VVCA 4Q2KA 5DKMA 3DA9B 3MU4A 1THRH 5EQSA 1UVUH 2R0LA 1Y3VA 4GHTA 2FOCA 1K1OA 1Z1JA 2ZGCA 4A1VA 1SPJA 3BTGE 1KTTB 3BG8A 3LDXH 1P06A 1OWKA 4AG2A 4NFEA 1XKBC 3U1IB 2ZTZA 1MBQA 1EX3A 2FOFA 2Z3CA 4RSPA 1D3DB 3RXMA 2F83A 3FZZA 1JOUB 1TA6A 3L3TA 3K6YA 5FX5A 4AFZA 1BRUP 3TJVA 5SGAE 4VGCC 1FY3A 1NZQH 1NRQH 2Z9GA 2PLXA 1EJMA 3KCGH 3SNEA 3T27A 2J92A 3A7YA 1GHVH 4NIVA 1UHBB 1O3NA 1ETSH 1THSH 4B73A 3BTEE 5JB9S 2PSXA 3A82A 1FLEE 1Z6JH 2GX4A 3QWCH 1PPGE 2Z9IA 2PUXB 4JCNA 3SU0A 3AAUA 3M5MA 3IG6B 3ATIA 3RC4A 1P12E 2DE8A 4OS4A 3V7TA 3PTNA 1AY6H 2F9VA 1CQQA 2VIWA 3RXRA 3UIRA 4IS5A 1HJAC 4JMYA 4KELA 2GDEH 4R8TB 3SGAE 2ZPRA 4B1TA 3M7TA 4Y8YA 2DUCA 5DPAA 2FOMB 2A4GA 4H42U 3BTDE 3ZVCA 1CA0B 1XVMA 1AO5A 1BB0B 5PTPA 1RFNA 1DY9A 1V2KT 1NU7B 3V12A 5EXNA 3KIDU 1LHFH 2C8WB 3MU8A 3Q3KA 3S0NA 1HJ9A 1P09A 1GJAB 1AMHA 1BTHH 1O0DH 1WQVH 2K1QA 1HBTH 3PTBA 1F0TA 3AASA 1DANH 1XUIA 4FU9A 4ZUHA 4I32A 3T28A 1OYQA 1QR3E 4YOIA 4OS2A 2H5DA 3RLYH 2GMTC 1N8OC 1OP8A 2P8OB 3R3GB 3ZZBA 1HGTH 4Y11E 1A4WH 4NG9H 1D3QB 3T2NA 2WPKS 5EOKA 5DG6A 2PKAA 4FUCA 1HV7A 1O2NA 2V0BA 5F8ZA 3VXFH 1ZPZA 2GCHF 2W26A 1NU9A 4Q80A 3MU1A 4YO9A 3MH5A 1WTGH 2UWOA 2AMDA 5HM2A 1VZQH 2XBXA 1C2MA 3MH4A 4X8VH 3UQVA 3ZV8A 3LIWA 4MLFB 1O33A 1TNIA 2FO9A 1EZSC 1J15A 2TBSA 1FUJA 1SI5H 4ABFA 2R3YA 5L2YH 5A2MH 1Q2WA 1W7GH 3ODDA 1AVWA 1BHXB 1G2LA 1SLXB 3ZVFA 1F0SA 1S83A 1O2UA 1CT4E 2ZI2H 1IQKA 1XMNB 2A45B 3SI3H 3E0NB 1H8IH 3LC3A 2A31A 3E16B 1IAUA 5FHTA 5HXFA 4OS6A 4CR9A 3E1XB 3N7OA 3VB4A 1J16A 1WCZA 4O97A 1HFDA 4ZHLU 3VB6A 1UTOA 3TJNA 4BAOB 3GY3A 3RC5A 4U2WA 1AWFH 3NPSA 1SOZA 3QDZB 2ZECA 4JZDH 3U98H 1DSUA 1GHAG 1AFQB 2QIQA 3LT3A 4JZEH 3D23A 5IDKA 3GOVB 4X0WU 3FZDA 2JKHA 2R2WU 4O03A 3SQEE 3OY6U 1Z6EA 3EA9A 4I31A 1O2WA 1C4V2 2BD9A 1ZRBA 4FUBA 4X8SH 2PGBB 2OCVB 3TK5A 1GDQA 2ZU4A 4Y0YE 2H9HA 1LQDB 1MQ5A 3T25A 1W11U 3A81A 3LU9B 3MNBA 5JB8S 1VJ9U 4DVAU 2B8OH 1OPHB 2HNTC 4X1SU 1GMDG 4F49A 4Y8XA 2B5TB 1KXFA 1AGJA 2J2UA 1ORFA 1UVSH 2DE9A 1F0UA 1SLUB 4ABGA 1OS8A 1F2SE 1ZSKA 1SHHB 3KGPA 1TPOA 2BMGB 1AUTC 3RM0H 1VITH 1VGCB 1XUGA 1A0LA 1HLTH 1G3EA 1SBWA 2AIQA 2Z9JA 1AHTH 3K2UA 5CMXH 2BDIA 3TNTA 1YC0A 3A7ZA 5A0AE 5L30H 3SU6A 2FDAA 2ZU3A 2PGQB 1C5TA 2GTBA 1Y5UT 1AUJA 1CHOG 4HZHA 1QY6A 1G32B 1ELBA 2AFQB 1QA7A 2V3OH 1C4Y2 2ZO3H 3M7QA 1NRSH 4WF8A 2AH4X 1OXGA 1XUHA 1TMTH 1L1GA 3LH3A 3ZVDA 2G81E 4CRAA 1FIZA 4HFPB 1O38A 1UMAH 3ZZ7A 2R2MB 3ZVEA 1FAXA 5EPNA 3M61U 1SGNE 2AGGX 1BMMH 1AB9B 1EXFA 3SV8A 1TMUH 1QL7A 4UEHH 2Y82A 3QGNB 2OBQA 1GDNA 1V2VT 4YESB 4UFGH 1GBCA 1Y8TA 5ABWA 3SV9A 1S81A 1SGFG 5DP4A 2AEIH 2ZFPH 1O3MA 1QQUA 1O2RA 1KTSB 1V2TT 5DP7A 2D2DA 1KXEA 2ZPSA 1AKSA 1YLDA 1MTNB 1OSSA 2WPHS 1SR5C 5AHGH 2R9PA 1FXYA 5GJ4B 4K8BA 1HAVA 1EAWA 1MZDA 5DP5A 1GHAF 3B9FH 3HGPA 1YCPK 3LGWA 4ABAA 1ZYOA 1EZXC 2HNTE 5K0HA 2P3FH 1FPCH 1K1PA 2XC0A 1L1JA 1Z1IA 3HKJB 1BOQA 1ARCA 1EASA 4ABHA 3PO1C 5FPTA 1C1PA 3UWIA 1SGPE 1KXBA 1QBOA 3UNRA 4XFQA 2TGDA 2A32A 3MU5A 1P9SA 1NFYA 2AYWA 3PLKA 1OWEA 2FTLE 7GCHG 1QGFA 2F3CE 2A5KA 1GGDB 1SGQE 5HGGA 4HI3A 1X7AC 2SGEE 4GVUA 4CHAB 4GLYA 1CA8B 3ESTA 5CE1A 1LO6A 4MTBA 1GHWH 1TRYA 2XC4A 3ENSB 1ESTA 4K1SA 2FS8A 2BDBA 1MCVA 5GCHF 1TLDA 1OWIA 1RTLA 2CMYA 3MWIU 4XDEA 1Z7KA 3GCHC 2FOEA 5A0BA 2D1JA 4E7RG 1EAUA 4BAKB 1GMHG 1LTOA 1K1JA 1CHOF 2BY5X 3SUFA 1QRXA 1SLVB 2CHAB 1T8OA 1MQ6A 1QFKH 2NU1E 1H4WA 3VGCC 2CF9H 4I8JA 3Q3YA 2FEQH 3GISB 1V2OT 1HDTH 1V2JT 1MU6B 1P2IA 3QGJA 1TBRH 1C1UH 1SFQB 1S84A 1TGBA 1RIWB 3RXBA 4D8NA 3V3MA 1C5LH 3MFJA 3KQDA 2HGTH 1B0FA 1GJ9B 1BTUA 4BTTB 2Y7ZA 2VH0A 1M9UA 1YF4A 1D9IA 1D6RA 1SGYE 3RXPA 3V0XA 1JRSA 2BD7A 1JRTA 5BRRE 3A80A 3A8CA 1BCUH 1GBKA 1SGIB 3LGYA 4D76A 2ZCKP 2PTNA 3SI4H 2BDAA 1ID5H 3SUGA 2BD5A 1C5SA 4INHA 5EXMA 3M36A 1T4UH 4NZQA 1P01A 5F03A 3HK6B 2SGAA 3B23B 3T62A 2Q1JA 3RU4D 3STIA 3MNCA 5EW1H 4GAWA 1MKXH 3SQHE 3QTVH 2TGAA 3TJOA 1IHSH 3FVFB 2ZDAH 2OQ5A 4K8YA 1TMBH 4K1TA 1UTPA 4D7FA 3TPIZ 1HAGE 2BQWB 3TH4H 1MAXA 4DURA 4AG1A 1OP2A 2CJIA 3E3TA 2VWLA 1XUFA 1SGCA 1GCTC 2V3HH 1AWHB 3UOUA 2I6SA 1ZOMA 7KMEH 1DS2E 4ZH8A 5EG4A 2F9UA 4ISNA 3JZ2B 1VCQA 3QX5H 5DP3A 3ATKA 4MNXA 1BBRK 1EB1H 4X1QU 1MD7A 1BRBE 3AAVA 4RKJB 2QCYA 4UDWH 2W5EA 2OINA 1WAYB 1NFXA 3U8OH 1WQSA 1C5WB 1H9LB 1ZJKA 3A7WA 4U30A 2J9NA 2QXHA 2RA3A 3E8LA 3L6PA 2OBOA 1JBUH 1TRNA 1Y3XA 1DXPA 2VIVA 1GI9B 4QT8C 4Y10E 2BOKA 1NN6A 5FPSA 2BD8A 2QN5T 3LJJA 2FOAA 1V2RT 2ZDKA 1H9HE 1P03A 3PMBB 5A0CA 1SQOA 3GCOA 5E0JA 1MTVA 4UE7H 1YLCA 1KLIH 4WXIA 2IN2A 4CBOA 1SB1H 2Y6TA 2SFAA 4YLQH 2KAIA 4A1XA 4K5ZA 1XM1A 2HPQH 2VGCB 2WUBA 4BOHA 1EZUC 4BNRA 2P94A 1V2LT 4Y0ZE 1F0RA 1GHBF 3RXKA 3TH2H 5GIBA 2QXIA 1A5HA 5DO4H 1DX5M 3TVJB 4X6NA 1W8BH 1FY4A 1GG6B 2OUAA 4DT7B 5F8XA 2ZQ1A 1ARBA 5A8ZA 1A3BH 3TJUA