4GUXA

Crystal structure of trypsin:mcoti-ii complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Structural insights into the role of the cyclic backbone in a squash trypsin inhibitor
pubmed doi rcsb
total genus 57
structure length 223
sequence length 223
chains with identical sequence B, C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4guxA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4guxA02
1V2OT 3A80A 5DP8A 1Q2WA 1W3CA 1V2VT 3UOUA 1AE8H 5A0CA 3QZRA 2OC7A 2FOBA 2QGRA 3SUFA 1A5HA 4FVDA 1TGCA 1N8OC 1EQ9A 1GJAB 3LGIA 2P16A 3MU8A 5HGGA 3TU7H 2G4UA 1UO6A 2Z7FE 1C5NH 3PLBA 1CHOF 1O3CA 3VB3A 1AVWA 4INLA 1FIZA 1SQAA 1RTFB 4NWKA 4X8VH 4RKJB 3T25A 1C2JA 3E3TA 3SU1A 4IN1A 2PUQH 2C8YB 3SJIA 2ZO3H 1A0JA 2Y5HA 4HGCA 3TGIE 3BIVH 1ETTH 3SU0A 4Y6DA 2PKAA 3SUGA 3PYHA 2ZU4A 3L3TA 4NIYA 3SI4H 3LGUA 1L4ZA 1O2RA 5I46H 1DOJA 4UEHH 2XBWA 1CT4E 1UTJA 1B5GH 2V3OH 4X2VA 1C5QA 1TMTH 2ZC9H 1O3KA 1E35B 2XXLA 1FNIA 4MNXA 1BOQA 1IAUA 4MPVA 4TY7A 5E0HA 2YOLA 1RIWB 3EAJA 1L1GA 2FLRH 4J1YA 1TBZH 4O97A 1TX8A 1YBWA 2BD9A 5EXMA 1ZYOA 2ZCKP 5GDSH 2BDIA 3LT3A 1SQOA 2R0LA 1OPHB 4XDEA 3V13A 3S69A 4Y0YE 3A8AA 1HFDA 1GI4A 3AAVA 2BOKA 1HPGA 4XBCA 1INCA 3BTHE 1DPOA 3HPTB 4TPIZ 1XUFA 3D62A 2CV3A 1NESE 5E0JA 1EPTB 1O2HA 1QR3E 1RGQA 1E34B 1EAXA 4ZXXH 3SNDA 5E2OA 1O5EH 1BBRE 1S0RA 4OS4A 3GDUA 1ZMNA 1GDUA 1LVBA 2WUBA 1UCYH 4NSYA 1B0FA 2I6QA 3ZVFA 4K1SA 2PV9B 2BX3A 1CSOE 1P3CA 3ENSB 1DY9A 3A8BA 5ETXA 4IMQA 1NTPA 4O9VA 3SQEE 3NCLA 2Y7ZA 4Y76A 3VB5A 3O8CA 1OP2A 4B2CA 1KIGH 2FI4E 1EATA 2FP7B 5CHAC 3MU0A 3EQ0H 1S6FA 4JZIA 3E6PH 4AFSA 1EAIA 4E7NA 1O3OA 1O2UA 1MU8B 1TMUH 1OWDA 2AYWA 3HGNA 3P95A 3RC4A 1F92A 2AMDA 3SO3A 3G01A 1GMHG 3GYMA 3E16B 1FN6A 1WYKA 2FX4A 1IQEA 2C4FH 1UMAH 2GCHG 1GBAA 3KHVA 2ZFTA 1TGBA 1VJ9U 3RXCA 3SJ8A 4NFFA 4RKOB 4B1TA 1HDTH 2UWLA 2ODYB 3TPIZ 3BSQA 3MO9A 3S9AA 1G2LA 2VIPA 1GJBB 1ZMJA 4NZLA 1QA0A 1HUTH 3UREA 5TJXA 1LHGH 2FOAA 1YC0A 3SJOA 1G3EA 1S82A 4F49A 2ZPQA 2J34A 2ZU5A 2F9BH 5DG6A 3Q00A 3ZZ3A 4WXIA 1C5UA 3GY3A 3FP8E 5FCRA 1AUJA 3RXSA 1BRCE 3RU4E 1ZRBA 2ESTE 1O3BA 1C9PA 5FX5A 4ABDA 1D3PB 3PV4A 1G9IE 1EB1H 2ZI2H 4DJZB 9LPRA 1TRMA 2HNTC 3MNCA 5LGOA 3A7ZA 1UK2A 3AVZA 2C93B 5F8XA 1CT2E 1K1LA 1SI5H 1YPHC 8GCHF 1O2JA 3JZ1B 3E0PB 1C5OH 1MBQA 1U6QA 2TRMA 4KTSA 4I31A 3E0NB 4ZXYH 1MTWA 2SGDE 2NWNA 3IWMA 2HWLB 2FLBH 3LJJA 3KF2A 4BAMB 1FJSA 1GBKA 1NC6A 1O2YA 2ZGBH 4JYUH 1S6HA 3I29A 4CR9A 3V12A 3C27B 2XBXA 3LONA 3O8BA 2BTCE 3FZZA 3RXQA 4J2YB 4AGKA 3PO1B 2BD7A 1BRAA 2QCYA 2TBSA 2ZFFH 3TK9A 3RM0H 1GHZA 3KL6A 1GMCF 3H7OA 3MWIU 4HFPB 5L2ZH 4JCNA 1G32B 1RRKA 1PQAA 1LPGB 3F6UH 1ANEA 4WH8A 3RM2H 4KGAA 1MD8A 1C1WH 1SGPE 2OLGA 1TQ7B 1YPEH 4FUGA 3URDA 4I8KA 1NN6A 5L6NH 2G52A 1FZZA 4ZUHA 2LNCA 1V2QT 1OWJA 5B6OA 2ZGHA 3LKWA 1BHXF 1Y59T 1Z8GA 3MH7A 1HJAB 1C2KA 5EW1H 3P8GA 3QUMP 1HXFH 2OUAA 4GCHF 1BMLA 2ANMH 4UFFH 1UTKA 4X1PU 1C5VA 2ZDVH 5ESTE 1GHXH 3AASA 2Z9LA 3GCTG 1AWHB 1L1JA 2WV5A 2ZGCA 3RXAA 1P2IA 3BTTE 2P8OB 6CHAC 5DP6A 1ZTJA 2H2ZA 5A8ZA 4ZKSU 1FY3A 1GVKB 3EE0B 2BM2A 3SOSA 1TPPA 4H6TA 4X6OA 1SL3A 4MPUA 3M5OA 3GDSA 1PJPA 3QO6A 5AF9H 1K2I1 1UTMA 3ATLA 1GBBA 5DP9A 1OP0A 3CS0A 5T6DA 1O3LA 1BUIA 1LQDB 1UHBA 5F03A 2JH5D 5LPRA 3E8LA 1P04A 4NA7A 3A8DA 2UWOA 1GJ7B 4UD9H 4INKA 1G3BA 2GT7A 3SU4A 3KEEA 1GMDG 4FU8A 4BXSA 2A4OA 2A4GA 2NU3E 5L2YH 3TH2H 4E06H 1VCPA 1A1RA 1SGDE 1UK3A 3ODDA 2AIPA 1AFQC 1EZSC 3S7KB 1XM1A 1D3TB 4K5ZA 3BG4C 4FUIA 2BHGA 1DLEA 3P92A 1YLCA 2FI5E 1P11E 1GBDA 1FY1A 2BLWA 5FHTA 3DD2H 5F6MA 4FUFA 2VVUA 3A82A 1PPHE 1ZGIA 4GPGA 1BTWA 3E1XB 1CBWC 4Q7ZA 4JZFH 4BXWA 3TITA 3TIUA 1TOCB 3K9XB 3UTUH 3P8OA 3KCGH 4YT7H 4ESTE 2D1JA 5DJ7A 1XXDA 3GDVA 3BTKE 3OTJE 1ABIH 4BAOB 4Y7BA 3P70B 4YLQH 3P8NA 4IN2A 4X6PA 1UJ1A 3NKKA 3TJVA 3U69H 5DO4H 1JBUH 3GICB 4HZHA 4MTBA 2FOHA 1QJ7B 1VITG 1PQ7A 2DE9A 2GCTB 1MU6B 2HRVA 3LGYA 4LXBH 1XVMA 1SHYA 4DY7B 1EX3A 2FOGA 2Z9JA 1K1PA 1O33A 3HK3B 3RXLA 1V3XA 2PTNA 2ZG0H 3RLWH 1C1UH 3TJOA 1ZSJA 2G51A 3TJNA 1GCTC 1RS0A 1O3HA 1Y3WA 2BXTH 3TLOA 1GI9B 1GBJA 5JPMH 2PTCE 1G37A 1QGFA 3MU4A 3U1JB 3SU5A 4ZKOU 1H4WA 2ZF0H 4HTCH 3V3MA 1EJMA 3NK8A 3TK6A 1ZSKA 1QQ4A 1ZR0A 3GY4A 1HAXB 5A0AE 2FWWA 4H6SB 1XUGA 1YPLH 1UTPA 2QN5T 3H5CB 2A5AA 2XC4A 2XWBI 2FOEA 1JIMA 4X1NU 2BDBA 4IS5A 1C2HA 3ZVEA 1T8MA 3DT0H 1YCPK 1XXFA 1AHTH 2P59A 1ZHMA 1LKAA 3VB7A 3S7HB 4DIHH 3VGCB 1O2QA 1O3AA 1TNKA 1AZZA 4IMZA 1BBRH 1F5RA 2Z9IA 1YPGH 4BAKB 3S9BA 1MCTA 5C2ZA 2SGPE 1F2SE 5AVDA 4B76A 1F0SA 1BTPA 2VNTA 5IYTA 1C2GA 4FUCA 3RU4T 4AGJA 3F68H 4AYVB 1QJ1B 1K28D 2IN2A 1WAYB 1K21H 1MZAA 1UTLM 2A4QA 3L33A 1JRTA 3MMGA 1TX7A 4CRAA 1H9LB 2Z3DA 1CHOG 4BNRA 3SN8A 1O38A 2G5NA 4MG3A 2JKHA 1ELBA 1SFQB 3A83A 5FPYA 1HCGA 1NFWA 1QBVH 1THPB 3A86A 3RXEA 5SGAE 4CRCA 1C5MD 1MKWH 6ESTA 1ELGA 1MAXA 4BTUB 2AS9A 2ZFPH 5LPEA 3PTNA 4YLUA 1IQJA 1Y5AT 1GBMA 1RFNA 2A31A 4DOQA 3A84A 4I32A 1OYTH 1HAGE 1QL9A 4GAWA 2VH0A 3RMNH 2V3HH 4BTIB 2YNBA 4UDWH 4ISNA 1GBCA 1O5AB 1DWEH 1MQ5A 3M7UA 1SGYE 1PYTD 3B8JA 4TWWA 1WU1A 2QA9E 1C2DA 2XW9A 3U9AH 3UIRA 2R0KA 2P3FH 1ELCA 3RUOA 5K0HA 2SNVA 2CHAC 2DUCA 2QF3A 2WINI 5HM2A 5JBBS 1HAIH 1XUIA 4X2YA 1N8OB 1L1NA 1GHBF 2A32A 2FXRA 2NU0E 3U1IB 2ZGXH 2XYAA 1K22H 2GTBA 2ZU1A 1KLJH 1JRSA 4XFQA 1F5KU 1SGQE 1SLVB 1MTNC 1GVLA 2W7UA 1XKBC 2TGTA 4AG1A 1W8BH 1HAZB 4BAQB 2XNIA 2BOHB 1QTFA 4LZ4B 1C5ZB 3BEUA 1O35A 4X1SU 1C2EA 1AWFH 4TPYA 1TNJA 1FAKH 2LPRA 4H42U 1J17T 1YGCH 1GWAA 1AFEH 3QTVH 2HALA 4AX9H 2XCFA 3F1SB 4UFEH 1KLTA 1GJCB 1F5LA 3NZIA 1C5YB 2STBE 1UTQA 3OX7U 2RDLA 1RD3B 4Y0ZE 5HM9A 1K1JA 1O2ZA 3ZZ7A 1GL1A 4Q7YA 3RXJA 2ANKH 5L30H 1K1NA 2GD4B 2NU4E 1DWBH 1HAVA 3GISB 1BCUH 1V2MT 1C5TA 1EP6A 3RC5A 3RXDA 3EA9A 1HBTH 3BEFB 1O2IA 1AKSB 2A7JA 3ZZ9A 1AU8A 7GCHF 1JXPA 3ELAH 2M5TA 1OSSA 1FMGA 5GXPA 4CREA 4U01A 1FONA 4CH8B 1AUTC 1QA7A 1BA8B 1E0FD 4E7RG 1YPMH 2PKSC 5LPFA 1V2JT 1T4UH 1EZQA 3S0NA 2PHBA 1UVUH 4JYVH 1H9IE 2ZFSA 4B73A 3TH4H 1QL7A 1SGNE 1E36B 1O2MA 4Y7AA 1O32A 2BDYA 2C90B 4X6MA 5EG4A 4YM9A 2O8LA 2VVCA 4JK6A 4XOJA 5FX6A 3H7TA 3PTBA 1D9IA 3IITA 1IQMA 3ITIA 1S85A 3A81A 7KMEH 1TA6A 2A5KA 3M5MA 3ATIA 3M36A 2ZDMA 2Y5FA 1BTUA 3T2NA 1CGIE 1O3FA 1FDPA 2Q6FA 1H8DH 1QRWA 3BTEE 4INHA 2H9EH 4ISLA 1C2IA 1EB2A 2F9VA 5I25A 2Z9KA 2FX6A 3SHAH 1T8OA 2OQ5A 5T6GA 2GZ7A 3RXHA 2Y80A 5CHAB 1FV9A 5EQRA 2BXUH 4MNWA 2C8WB 1SMFE 4LK4A 1AVXA 4BANB 1W10U 3KQBA 2WUCA 2BB4A 1IHTH 1P2KA 1MTVA 2BDCA 1DS2E 2ZDKA 3ZVDA 1WSSH 1Q3XA 4B2AA 1O3IA 2ANWA 4BAHB 5JBCS 1P9UA 1LCYA 1SGTA 2F9UA 1NRRH 3PWCA 1WQSA 1PPCE 2J92A 2PKAB 1P03A 4NGAH 4A1VA 4RSPA 1GDQA 1ZTKA 2B0FA 3RMOH 1WQVH 2BQ6B 2F83A 3KIDU 2B9LA 4NWLA 1NRPH 2A5IA 2ZFQH 3T27A 1A7SA 5CMXH 1QRXA 2FZZA 4FVBA 3PROA 1XUJA 3DA9B 1FPCH 1CT0E 2PW8H 4X6NA 1WCZA 3SNCA 1PQ5A 2J94A 1V2UT 1GJ5H 3RXPA 1SPJA 1PQ8A 2VIQA 2ZGJA 1TX6A 1QCPA 1WUNH 4CRBA 3LGTA 3SUDA 2R3UA 2QV1A 4GCHG 1OOKB 4AORA 1VGCC 1ZJDA 5BRRE 1PYTC 3GY8A 1ZGVA 1SHHB 3SU3A 5A0BA 3K6YA 2JETC 3K65B 3U8OH 3HK6B 3ZV9A 1W14U 3BG8A 3W95A 5DGJA 1V2PT 4AFZA 3SU6A 2FYRA 3VXEH 1ELAA 1C5LH 8LPRA 2O8UA 4YESB 1ANBA 2P94A 2CF8H 1LO6A 4TYDA 4GVUA 1UVTH 1DY8A 2KAIA 5DP3A 4AOQA 1DSUA 5TCCA 3KQEA 3SI3H 3ZVAA 3RC6A 4B71A 2ODPA 4JYTA 2ALPA 4D8NA 1ACBE 1ELEE 4U30A 4FXGH 2DE8A 1HYLA 1MKXK 4TWYA 1BITA 4MNYA 1IQHA 2BY6X 2PSXA 3FP7E 2BDHA 2C8XB 2FS8A 4YOGA 4K8BA 1SBWA 1Y8TA 3SV7A 1ZJKA 4CR5A 1FY5A 2VIOA 3ZZAA 3RP2A 3ESTA 1EOJA 1AD8H 3M61U 5C1YA 1G36A 4MPWA 3LDXH 1LHDH 1KDQB 1NS3A 3PLKA 1S83A 2FOFA 5FXLA 3M7TA 4NZQA 1TPAE 3RXVA 3PMJA 1IOEA 5EXLA 6CHAB 3D23A 4MPXA 2TGPZ 5C5OA 2PGBB 1NROH 1GBIA 1WOFA 2A7HA 3HATH 1S0QA 3VB6A 1O2XA 3M35A 1NM6A 4A6LA 3KQCA 4ASHA 1N1LA 1BMMH 2ZHDA 1MBMA 7LPRA 2PGQB 4XBDA 1S84A 1AQ7A 2H1UA 2K1QA 2TGDA 5GCHF 1EJNA 1ABJH 1IQKA 1T32A 5HYOA 2Z94A 3A7WA 2GZ9A 1V2RT 2A45B 1O3PB 1TLDA 1GPZA 3GY5A 3MU5A 1YF4A 1GG6C 3VB4A 1BZXE 1Q31A 2EI6A 1RJXB 2UUYA 1CGHA 1KTTB 1OP8A 1YYY1 2GV7A 3URCA 4Z6AH 3HGPA 1PFXC 1O2VA 4MVNA 4Y8XA 1G3DA 3PLPA 2W5EA 1Z71A 1OS8A 2ZFRH 3QLPH 4JZEH 1C5XB 3A7VA 5IDKA 4CBNA 1FIWA 1AFQB 1FN8A 2J2UA 4CH2B 3RXKA 1FUJA 2BLQA 2Q1JA 2VU8E 3BG4B 1W13U 3ZZ4A 1EASA 2CXVA 2EC9H 4AYYB 2STAE 4AZ2B 1ESAA 4X2XA 5GJ4B 4UFDH 3W94A 3RMMH 1LHEH 1QNJA 3HKIB 1OKXA 4XE4A 1DE7H 3SJKA 1C5RA 1ESBA 1GI1A 3ATWA 2NU2E 3D49H 3MNBA 2W3KA 3F9FA 9ESTA 2D26C 1ELVA 4YOJA 4ABEA 1CBWB 2R3YA 1RTKA 1P06A 2OXSA 1HXEH 4NFEA 5ESBA 1V6DA 4WMFA 1HIAA 3BTWE 3KGPA 1OWEA 1OWHA 1Z7KA 2G4TA 2D2DA 1P8VC 2VINA 2AMQA 3BEIB 3DFJA 4DT7B 4BOHA 1LQEA 4ZHAA 1ANDA 1DT2A 1YM0A 3TJUA 4ISOA 5C5NA 2Y6TA 4LOYH 3M37A 3SV2H 3A88A 2XC0A 2J38A 1ANCA 4GHTA 1NRQH 4K1TA 2BMGB 5EPYA 2EA3A 3GY6A 4FUJA 3RU4D 4AB9A 2BQ7B 3OY5U 2FOMB 1JOUB 1C2FA 1SOTA 2Y5GA 1GCTB 3UQVA 3T28A 2OINA 2ZHWH 5DPAA 1YCPM 1GGDC 1QRZA 1RXPA 3UNRA 2A2XH 1LVOA 3M5NA 3FFGA 3SV9A 1HAYB 4KTCA 3SW2B 1NRSH 1LPZB 1BTYA 1NU9A 2GMTC 4MLFB 2GX4A 3LU9B 3QN7A 1UHBB 3BTQE 4ABFA 4CRGA 3CS7A 2FODA 5A09A 1P05A 1AIXH 1BDAA 1L0ZA 1ARCA 4I7YH 1C2LA 1W0ZU 2ZIQH 1GDNA 5T6FA 2VWNA 1O3GA 1NFUA 2UUFB 3ZZCA 4O3UA 1Z1IA 4DCDA 4AB8A 5EOKA 3EYDA 3MNXA 1XKAC 2FI3E 3BTFE 4DW2U 1C1TA 4VGCC 4ZHMU 2SGFE 1EJAA 1SGCA 1O3JA 6GCHF 3D65E 3MOCA 1P09A 1TRYA 4ZKRU 2CGAA 1BMNH 4OS2A 4YTAA 2SGAA 2ZWLH 4DURA 1E38B 3QTOH 2QYIA 2F91A 1A3BH 1ETSH 2AGIX 3SUEA 1QHRB 3DUXH 3VEQB 2HNTE 5CE1A 1FXYA 2CJIA 1CA0C 1GHBG 4K2YA 1EAUA 2D8WA 1YPHE 1O5GH 1XUHA 1GL0E 2OQUA 4WVPE 1C1PA 2J4IA 2OBOA 4NG9H 5FBEA 3CP7A 3DHKH 1GBTA 1SGIB 4UONA 4YO9A 1DICA 1DVAH 1O31A 2VWLA 1TGNA 2H9HA 2ZNKH 3I77A 4OS6A 1GJ4H 1PPBH 1HV7A 3UWIA 1T8LA 1XUKA 1SGRE 3P8FA 3A7TA 4FUBA 2HVXA 2IOTA 2P3UB 1SLWB 3WY8A 4ABGA 4D9RA 1DSTA 4WF8A 4AG2A 4CRFA 3JZ2B 2V35A 1Y3XA 3SV8A 4JZDH 2A1DB 3BN9A 1DM4B 2XTTB 2P3TB 3K2UA 1W2KH 5JYIA 3P17H 1JMOH 4ABHA 3ZVBA 3SGBE 4MNVA 1N6XA 2OC8A 2SNWA 2CHAB 3GCHC 2P95A 3MO6A 3LGVA 1Z1JA 4OS7A 4CHAC 1C4Y2 7GCHG 1NZQH 3SZNA 3M3TA 1C1QA 1D6RA 5H4IB 2BX4A 4HI3A 1SB1H 1V2TT 2IJOB 1CHGA 3ZZBA 3U8TH 1GI5A 2BVRH 2WPHS 1PPGE 1TNIA 1ELDE 2FMJA 1HAOH 1G3CA 1ZOMA 2YNAA 1TGSZ 2ZKSA 3ZZ8A 2FDAA 2ZPRA 1UCYK 3RXGA 1O2LA 2ZECA 1GI6A 2BZAA 5G4BA 1M9UA 2FS9A 1C1OA 3SQHE 3FAOA 1TBQH 3TNTA 1Z6JH 4Y79A 1NT1A 1SVPA 3BV9B 3BIUH 3TK5A 1F0RA 1WBGB 3MFJA 3A7XA 2PR3A 1SGFA 2G55A 2BLOA 2Y81A 4B75A 1EZXC 2VGCC 1O37A 1Y5UT 1Y5BT 5JDUB 3FZDA 1SG8B 3PMAB 2BD8A 2WYGA 5JBAS 1GJ8B 2CN0H 1O2GH 2TIOA 1SLXB 2B7DH 1ETRH 2Y82A 2ZP0H 3I78A 1FY4A 4ZMAH 5EGMA 3MHWU 2IPHA 2NU1E 4O3TA 4UFGH 1J15A 1TALA 1TABE 1BIOA 7ESTE 1CVWH 3U98H 1C1NA 3Q3YA 4X1QU 4DVAU 2Z6BD 1GHAF 4A92A 3RXFA 1ORFA 2PKSB 2ZHQH 2GV6A 1BRBE 1EKBB 1THSH 4X2WA 4ISHH 1ZTLA 1VZQH 1S5SA 2ZTYA 1KSNA 2FOCA 1O3MA 3RMLH 3L6PA 3E90B 4B74A 4WH6A 2A4RA 8ESTE 1BHXB 4SGBE 1FAXA 1TA2A 3GY7A 2SGEE 1AB9C 5AHGH 1O2SA 2BY5X 1P02A 1O3EA 2F3CE 4KP0A 5JB8S 1UVSH 4FUDA 1GVZA 1ZHRA 3A87A 1AGJA 1EZUC 1HAHH 3QDZB 3SHCH 1G2MA 3UNSA 2G5VA 1A5GH 1T31A 1TOMH 2ZDLA 1P12E 2RA3A 3UOPA 1NY22 2ASUB 2VB0A 4D7GA 1GJ9B 4Y71A 3PMHB 1LTOA 1TNHA 3FP6E 3ATKA 1A5IA 1DWDH 2GDDA 3E91A 3M5LA 5J4QA 4DIIH 1KXAA 5J4SA 2PUXB 1SGEE 4THNH 3MH6A 1P2JA 2FIRH 1FY8E 1A2CH 1O2TA 1P10A 2FPZA 1O34A 1EPTA 3PMBB 3M7QA 5EQSA 1THRH 1ZMLA 1TE0A 2ILNA 4K8YA 5A8YA 2JH6D 1GBEA 3KN2A 1HB0B 3PWBA 2BQWB 1GBLA 2WPMS 1AI8H 4OS1A 3QGJA 3U8RH 4U32A 3R3GB 1AE5A 4K3JA 1A4WH 1QB1A 1YCPH 5JB9S 1OWIA 2C3SA 1P01A 4DGJA 4AFUA 4ISIH 2ZTXA 1YP9A 3B23B 1HLTH 4JMYA 1HAVB 2H9TH 1EXFA 1W0YH 3GYLB 1BJVA 3M3VA 8GCHG 1BRUP 3QX5H 5AFZH 1KXBA 3STIA 1QY6A 4FU9A 5FPSA 1Y3YA 2G8TA 1P2MA 1VGCB 2BZ6H 4LZ1H 1UK4A 1DXPA 3N7OA 2JETB 1VR1H 2AH4X 1MH0A 1O2OA 1TRNA 2FM2A 3UY9A 2XCNA 5HXFA 3C1KA 3MNSA 5GIBA 1YPJH 1ZLRA 1KXCA 1MD7A 1VCQA 5BPEA 4NIVA 3AAUA 1GMCG 2ZDAH 1SQTA 1TPSA 1K9OE 2W26A 4Q80A 2ZTZA 1TPOA 1KY9A 2UWPA 3AW0A 4MQAA 1W11U 1O5BB 2XBVA 5GCHG 1TYNA 2GGVB 3TGKE 2A7CA 1ZRKA 3RXRA 2QXIA 3SBKA 3VPKA 1B0EA 1HJ9A 3RXUA 1UTOA 1RIWC 1TMBH 2Q6GA 1W7GH 4R8TB 1C1VH 1EAWA 5A2MH 1BTHH 3RXIA 4WJG2 1L2EA 2UUJB 1YLDA 2Z3CA 3NUMA 3T62A 5EXNA 1T8NA 2ZQ1A 1SGFG 3TH3H 2FYQA 1GI2A 2EEKA 1CGJE 1SFIA 4A1TA 1GBFA 4CBOA 1GJ6A 5DP5A 2F9PA 1GCDA 2O9QA 1KDQA 3MTYA 1EPTC 1NU7B 2AEIH 3RXTA 3TNSA 1CA8B 4H4FA 2VIDA 2I6SA 4A1XA 3LH1A 2SFAA 1XMNB 1W12U 1MUEB 4A7IB 3UR6A 3V7TA 1BT7A 1OYQA 1QB9A 2J95A 3P6ZB 1HJ8A 4M7GA 1V2ST 1DLKB 1ARBA 5JBTA 2TPIZ 4XSKU 2AFQB 3LH3A 2ZDNA 4GUXA 4NIWA 2ULLA 4JZ1A 2ZEBA 5C3NA 1P0SH 2OC1A 2BY9X 1AZ8A 1JIRA 2ZQ2A 4FU7A 2WPLS 3ZVGA 1W7XH 1BJUA 4YT6H 1GG6B 3LOXA 3SGQE 1HNEE 1DUAA 1IQFA 2EI8A 2XC5A 1ZHPA 1A0LA 1BTXA 5GWZA 1ZPCA 4YOIA 1GBHA 4F4OC 1ELTA 4D7FA 1YPKH 1IQLA 3A89A 1F0TA 5FCKA 1JWTA 4NA9H 3RXMA 2FO9A 2BD3A 2ZHEH 4OS5A 1BMAA 3ZVCA 5F8TA 1UVPA 2R2MB 1D3DB 2QIQA 3GY2A 3EA7A 1BTZA 1FPHH 2VVVA 2B5TB 2BD5A 2AGEX 2H6MA 1A3EH 3RXBA 3STJA 2KAIB 5DP4A 3DFLA 1KXFA 1J14A 3T26A 3LIWA 1AY6H 3O8DA 4ZH8A 2ZHFH 1QQUA 4D76A 3IG6B 1B7XB 1C1RA 4NIXA 1G30B 3Q76A 5EU8A 1P2OA 2V0BA 1LKBA 5T3HA 4BTTB 2AIQA 1O2NA 2PWXA 2HPPH 1Z8JB 1SOZA 3VFEA 1Z8IB 5AFYH 2OP9A 2R2WU 3Q3KA 2G00A 5C67A 4YZUA 3EA8A 4AFQA 4ZKNU 3SGAE 3AW1A 1BBRK 1QURH 4GHQA 4ZAEA 2QC2A 4RN6A 1O5CB 4IC6A 1Z6EA 1O5DH 1MZDA 3SORA 2F9NA 1GI7B 1T7CA 4I8GA 4KELA 1TWXB 4ZROA 6GCHG 1DANH 5FBIA 1K1IA 1ZSLA 2A2QH 3NPSA 3LPRA 4PROA 5DP7A 3UUZA 1X7AC 3MI4A 1GMHF 2QF0A 2R9PA 4GLYA 1C4U2 5E0GA 3OYPA 1XX9A 2GCHF 3FANA 2AGGX 4WMEA 1KXEA 3UFAA 2BD4A 1GGDB 2G81E 3PO1C 1VITH 2PLXA 2XWAA 2BY8X 1CE5A 1MCVA 2AMPA 3R0FA 1GHWH 2ZPSA 3A7YA 4ABJA 1IQGA 1MMJN 2PSYA 1AN1E 1O39A 1ZZZA 3MU1A 2GMTB 1A61H 1MKWK 2VIVA 4OGXA 4XBBA 2Z3EA 1V2WT 1P9SA 3UQOA 1GHYH 1IQIA 2ZU3A 2OD3B 1C5SA 4TY6A 4WY3A 1VJAU 1PPFE 4UE7H 3UWJH 1AO5A 1DWCH 1O5FH 2WPKS 4IBLH 4Y10E 1A46H 3NWUA 3A8CA 4Q7XA 1HJAC 5C20A 2V6NA 4VGCB 2WV4A 4R0IA 2Z9GA 3FVFB 5C1XA 4K60A 4AN7A 1GI0A 5EQQA 1TIOA 2VJ1A 4D9QA 1UCYE 2BVXH 1CU1A 2Q6DA 2HGTH 5A8XA 1MAYA 2P8OC 1F0UA 1IQNA 4NA8A 2J9NA 3ZV8A 3ODFA 2WPJS 4KKDA 4X0WU 3UNQA 1LVMA 4FUHA 2XBYA 1LHFH 4K1EA 1P3EA 2FTMA 2ZCHP 1D6WA 2F9OA 5TCAA 1CA0B 1P2QA 1L4DA 2AERH 1OX1A 1Z8RA 1ZPBA 2BYAX 1HIAB 2SGQE 2VWMA 2UUKB 4IC5A 1OWKA 4A5TS 1LMWB 4I33A 5ABWA 2QXGA 3S9CA 3MYWA 1PPZA 1V2NT 2QAAA 5LH8A 3RDZA 1GHVH 2HPQH 3MH5A 1MTSA 1O30A 2RCEA 4X8TH 1WTHD 1TNGA 1XVOA 4NCYA 2CMYA 2O8TA 1MKXH 1ID5H 1VCWA 2WPIS 2GT8A 1C9TA 2QY0B 2O8MA 4Y8YA 1TONA 1C5PA 3EDXB 4WMDA 3LC5A 1DITH 3OU0A 3HKJB 4ZHLU 4WWYA 3GCTF 3B9FH 4Y11E 1BB0B 1QL8A 2ALVA 1QJ6B 2FEQH 1SSXA 2QXJA 4JK5A 1TB6H 4ABIA 3ZZDA 3OY6U 1RTLA 1EOLA 1DX5M 2HNTF 5FPTA 3GCHB 1LHCH 4KTUA 4CHAB 2VWOA 1N6YA 3LJOA 5EW2H 4FUEA 3VXFH 2GP9B 2JH0D 1P2NA 1GHAG 5EODA 1KXDA 5HMAA 1ESTA 1LPKB 2FTLE 1E37B 1NRNH 1QIXB 3T29A 4MDSA 4IGDA 3RXOA 2OCVB 2ZA5A 2BY7X 3NXPA 4ABBA 1AVGH 2XRCA 4ABAA 1WTGH 3PM3A 2ODQA 3M3SA 1J9CH 3SNEA 8KME2 1C1SA 4X8SH 1MQ6A 2ZCLP 2VIWA 1D4PB 3SNAA 1GMDF 3GOVB 6LPRA 1TGTA 2A0QB 1O2PA 4DG4A 1HRTH 1PPEE 2GVFA 2BVSH 1A0HB 4K69A 2H5DA 4CRDA 1TAWA 1FQ3A 3TGJE 2GCTC 2VGCB 1C2MA 2O8WA 5DK1A 1DUEA 1C1MA 3MH4A 3BTGE 1KTSB 3KNXA 1C4V2 1AMHA 1H1BA 2W3IA 3LGWA 3LC3A 2BLVA 1NO9H 1T4VH 1BQYA 1TBRH 1QBNA 2OBQA 3ZYEA 3F9GA 1D3QB 1EP5A 1UVOA 1YKTA 1DFPA 1SR5C 4SGAE 2HLCA 1MTNB 4U2WA 3F9HA 4E05H 1K1MA 3QZQA 3BTME 3BTDE 3CENA 3ZZ6A 3GCNA 2RA0A 3QK1A 2CF9H 2FESH 1EUFA 5GPIB 2RG3A 4I8HA 3BF6H 4QT8C 4OGYA 3Q3XA 3F9EA 3QGNB 3ATMA 3SU2A 1FLEE 1NFXA 5F8ZA 1WV7H 2EI7A 2ZU2A 4X8UH 3VGCC 1OXGA 3KQDA 1AB9B 1CQQA 1TQ0B 5PTPA 3T5FH 1VITF 3QWCH 3MO3A 3EGKH 3ZZ5A 1HGTH 2B8OH 1LDTT 2GDEH 1QBOA 3V0XA 1HAPH 3SV6A 2BDGA 3Q77A 4I8LA 3RLYH 2GZ8A 5C1UA 1F7ZA 1CO7E 1DDJA 1ZPZA 1DXWA 2TGAA 1V2KT 5FAHA 4WXVA 1O0DH 1K1OA 2ANYA 2OC0A 1TFXA 2WYJA 3A85A 4O03A 3UR9A 2C8ZB 1NPMA 1O3DA 5E2PA 1AKSA 4IW4E 1H9HE 1O2KA 1H8IH 3GCOA 3PB1E 4X1RU 3SNBA 2THFB 2HOBA 1S81A 1O3NA 1J16A 1GI8B 1NFYA 2QXHA 3TVJB 1QFKH 4NSVA 1V2LT 1C5WB 1IHSH 2VH6A 3SJ9A 2GKVE 4I8JA 4Z0KA 1Y3UA 3ZYDA 1J8AA 3UPEA 2P93A 2PFEA 1LVYA 1UTNA 2BDAA 4B2BA 5EPNA 1GI3A 3K6ZA 1O2WA 1P57B 3OSYA 4GSOA 1FI8A 1KLIH 1ELFA 1KYNA 1QB6A 2BD2A 1SLUB 5E8EH 5DKMA 1SC8U 4Q2KA 3O8RA 1Y3VA 1GJDB 2W7SA 1TNLA 2Y7XA 1MTUA 4Y8ZA 2ZZUH 5K7RA 1O36A 2H5CA 2OTVA
chains in the Genus database with same CATH superfamily
1V2OT 3A80A 5DP8A 1Q2WA 1W3CA 1V2VT 3UOUA 1AE8H 5A0CA 3QZRA 2OC7A 2FOBA 2QGRA 3SUFA 1A5HA 4FVDA 1TGCA 1N8OC 1EQ9A 1GJAB 3LGIA 2P16A 3MU8A 5HGGA 3TU7H 2G4UA 1UO6A 2Z7FE 1C5NH 3PLBA 1CHOF 1O3CA 3VB3A 1AVWA 4INLA 1FIZA 1SQAA 1RTFB 3GS9A 4NWKA 4RKJB 4X8VH 3T25A 1C2JA 3E3TA 3SU1A 4IN1A 2PUQH 2C8YB 3SJIA 2ZO3H 1A0JA 2Y5HA 4HGCA 3TGIE 3BIVH 1ETTH 3SU0A 4Y6DA 2PKAA 3SUGA 3PYHA 2ZU4A 3L3TA 4NIYA 3SI4H 3LGUA 1L4ZA 1O2RA 5I46H 1DOJA 4UEHH 2XBWA 1CT4E 1UTJA 1B5GH 5FL7D 2V3OH 4X2VA 1C5QA 1TMTH 2ZC9H 1O3KA 1E35B 2XXLA 1FNIA 4MNXA 1BOQA 1IAUA 3PV2A 4MPVA 4TY7A 5E0HA 2YOLA 1RIWB 2YMSB 1L1GA 2FLRH 3EAJA 1TBZH 4J1YA 1TX8A 4O97A 1YBWA 2BD9A 5EXMA 1ZYOA 2ZCKP 5GDSH 2BDIA 3LT3A 1SQOA 2R0LA 1OPHB 4XDEA 3V13A 3S69A 4Y0YE 3A8AA 1HFDA 4B6EA 1GI4A 3AAVA 2BOKA 1HPGA 4XBCA 1INCA 3BTHE 1DPOA 3HPTB 4TPIZ 1XUFA 3D62A 2CV3A 3N7DA 1NESE 5E0JA 1EPTB 1O2HA 1QR3E 1RGQA 1E34B 1EAXA 4ZXXH 3SNDA 5E2OA 1O5EH 1BBRE 1S0RA 4OS4A 3GDUA 1ZMNA 1GDUA 1E1QD 1LVBA 2WUBA 1UCYH 4NSYA 1B0FA 2I6QA 3ZVFA 4K1SA 4RI0A 2PV9B 2BX3A 1CSOE 1P3CA 3ENSB 1DY9A 3A8BA 5ETXA 4IMQA 2KFWA 1NTPA 4O9VA 3SQEE 3NCLA 2Y7ZA 4Y76A 3VB5A 3O8CA 1OP2A 4B2CA 1KIGH 2FI4E 3W1EA 1EATA 2FP7B 5CHAC 3MU0A 3EQ0H 1S6FA 4JZIA 3E6PH 4AFSA 1EAIA 4E7NA 1O3OA 1O2UA 1MU8B 1TMUH 1OWDA 2AYWA 3HGNA 3P95A 3RC4A 1F92A 4ACAA 2AMDA 3SO3A 3G01A 1GMHG 3GYMA 3E16B 1FN6A 1WYKA 2FX4A 1IQEA 2C4FH 1UMAH 2GCHG 1GBAA 3KHVA 2ZFTA 1TGBA 1VJ9U 3RXCA 3SJ8A 4NFFA 4RKOB 4B1TA 1HDTH 2UWLA 2ODYB 3TPIZ 3BSQA 3MO9A 3S9AA 1G2LA 2VIPA 1GJBB 1ZMJA 4NZLA 1QA0A 1HUTH 3UREA 5TJXA 1LHGH 2FOAA 1YC0A 3SJOA 1G3EA 1S82A 4F49A 2ZPQA 2J34A 2ZU5A 2F9BH 5DG6A 3Q00A 3ZZ3A 4WXIA 1C5UA 3GY3A 3FP8E 5FCRA 1AUJA 3RXSA 1BRCE 3RU4E 1ZRBA 2ESTE 1O3BA 1C9PA 5FX5A 4ABDA 1D3PB 3PV4A 1G9IE 1EB1H 2ZI2H 4DJZB 9LPRA 1TRMA 2HNTC 3MNCA 5LGOA 3A7ZA 1UK2A 3AVZA 2C93B 4HG6A 5F8XA 1CT2E 1K1LA 1SI5H 1YPHC 8GCHF 1O2JA 3JZ1B 3E0PB 1C5OH 1MBQA 1U6QA 2TRMA 2AHME 4KTSA 4I31A 3E0NB 4ZXYH 1MTWA 2SGDE 2NWNA 3IWMA 2HWLB 2FLBH 3LJJA 3KF2A 5EJZA 4BAMB 1FJSA 1GBKA 1NC6A 1O2YA 2ZGBH 4JYUH 1S6HA 3I29A 4CR9A 3V12A 2JJ1D 4RT1A 3C27B 2XBXA 3LONA 3O8BA 2BTCE 3FZZA 2V3MA 4J2YB 3RXQA 4AGKA 3PO1B 1W0JD 2BD7A 1BRAA 2QCYA 2TBSA 2W6JD 2ZFFH 3TK9A 3RM0H 1GHZA 2V7QD 5T1VA 3KL6A 1GMCF 3H7OA 3MWIU 4HFPB 5L2ZH 4JCNA 1G32B 1KMHB 1RRKA 1PQAA 1LPGB 3F6UH 1ANEA 4WH8A 3PRBA 3RM2H 4KGAA 1MD8A 1C1WH 1SGPE 2OLGA 1TQ7B 1YPEH 4FUGA 3URDA 4I8KA 1NN6A 5L6NH 2G52A 1FZZA 4ZUHA 3FKSD 4I86A 2LNCA 1V2QT 1OWJA 5B6OA 2ZGHA 3LKWA 1BHXF 1Y59T 1Z8GA 3MH7A 1HJAB 1C2KA 5EW1H 3P8GA 3QUMP 1HXFH 2OUAA 4GCHF 1BMLA 2ANMH 4UFFH 1UTKA 4X1PU 4P02A 1C5VA 2ZDVH 5ESTE 1GHXH 3AASA 2Z9LA 3GCTG 1AWHB 1L1JA 2WV5A 3OEHD 2ZGCA 3RXAA 1P2IA 3BTTE 2P8OB 6CHAC 5DP6A 1ZTJA 2H2ZA 5A8ZA 4ZKSU 1FY3A 1GVKB 2IJD1 3EE0B 2BM2A 3SOSA 1TPPA 4H6TA 4X6OA 1SL3A 4MPUA 3M5OA 3GDSA 1PJPA 3QO6A 5AF9H 1K2I1 1UTMA 2GJGA 3ATLA 1GBBA 5DP9A 1OP0A 3CS0A 5T6DA 1O3LA 1BUIA 1LQDB 1UHBA 5F03A 2JH5D 5LPRA 3E8LA 1P04A 4NA7A 3A8DA 5EJLA 2UWOA 1GJ7B 4UD9H 4INKA 1G3BA 2GT7A 3SU4A 3KEEA 1GMDG 4FU8A 4BXSA 2A4OA 2A4GA 2NU3E 5L2YH 3TH2H 4E06H 1VCPA 1A1RA 1SGDE 1UK3A 3ODDA 2AIPA 1AFQC 1EZSC 3S7KB 1XM1A 1D3TB 4K5ZA 3BG4C 4FUIA 2BHGA 1DLEA 3P92A 1YLCA 2FI5E 1P11E 1GBDA 1FY1A 2BLWA 5FHTA 3DD2H 5F6MA 4FUFA 2VVUA 3A82A 1PPHE 1ZGIA 4GPGA 1BTWA 3E1XB 1CBWC 4Q7ZA 4JZFH 4BXWA 3TITA 3TIUA 1H8HD 2KCYA 1TOCB 3K9XB 3UTUH 3P8OA 3KCGH 4YT7H 4ESTE 2D1JA 3U28C 5DJ7A 1XXDA 3GDVA 3BTKE 3OTJE 1ABIH 4BAOB 4Y7BA 3P70B 4YLQH 3P8NA 4IN2A 4X6PA 1UJ1A 3NKKA 3TJVA 3U69H 5DO4H 1JBUH 3GICB 3OFND 4HZHA 1NBMD 4MTBA 2FOHA 1QJ7B 3OE7D 1VITG 1PQ7A 3F0PA 2DE9A 2GCTB 1MU6B 2HRVA 3LGYA 4LXBH 1XVMA 1SHYA 4DY7B 1EX3A 2FOGA 2Z9JA 1K1PA 1O33A 3HK3B 3RXLA 1V3XA 2PTNA 2ZG0H 3RLWH 1C1UH 3TJOA 1ZSJA 2G51A 3TJNA 1GCTC 1RS0A 1O3HA 1Y3WA 2BXTH 3TLOA 1GI9B 1GBJA 5JPMH 2PTCE 1G37A 1QGFA 3MU4A 3U1JB 3SU5A 4ZKOU 1H4WA 2ZF0H 4HTCH 3V3MA 1EJMA 3NK8A 3TK6A 1ZSKA 1QQ4A 1ZR0A 3GY4A 1HAXB 5A0AE 2FWWA 4H6SB 1XUGA 1YPLH 3SZEA 1UTPA 2QN5T 3H5CB 4FETA 2A5AA 2XC4A 2XWBI 3KYFA 4Z1MD 2FOEA 1COWD 1JIMA 4X1NU 2BDBA 4IS5A 1C2HA 3ZVEA 1T8MA 3DT0H 1YCPK 1XXFA 1AHTH 2P59A 1ZHMA 1LKAA 3VB7A 3S7HB 4DIHH 3VGCB 1O2QA 1O3AA 1TNKA 1AZZA 4IMZA 1BBRH 1F5RA 2Z9IA 1YPGH 4BAKB 4Q63A 3S9BA 3H09A 1MCTA 5C2ZA 2SGPE 1F2SE 5AVDA 4B76A 3DSGA 1F0SA 1BTPA 2VNTA 5IYTA 1C2GA 4FUCA 3RU4T 4AGJA 3F68H 4AYVB 1QJ1B 1K28D 2IN2A 1WAYB 1K21H 1MZAA 1UTLM 2A4QA 3L33A 1JRTA 3MMGA 1TX7A 4CRAA 1H9LB 2Z3DA 1CHOG 4BNRA 3SN8A 1O38A 2G5NA 4MG3A 2JKHA 1ELBA 1SFQB 3A83A 5FPYA 1HCGA 1NFWA 1QBVH 1THPB 3A86A 3RXEA 3FOAA 5SGAE 4CRCA 1C5MD 1MKWH 6ESTA 1ELGA 1MAXA 3VG8A 4BTUB 2AS9A 2ZFPH 5LPEA 3PTNA 4YLUA 1IQJA 1Y5AT 1GBMA 1RFNA 3F0OA 2A31A 4DOQA 3A84A 4I32A 1OYTH 1HAGE 1QL9A 4GAWA 2VH0A 3RMNH 2V3HH 4BTIB 2YNBA 4UDWH 4ISNA 2W6ID 4F48B 1GBCA 1O5AB 1DWEH 1MQ5A 3M7UA 1SGYE 1PYTD 3B8JA 1S6LA 1E79D 4TWWA 1WU1A 2QA9E 1C2DA 2XW9A 3U9AH 3UIRA 2R0KA 2P3FH 1ELCA 3RUOA 5K0HA 2SNVA 2CHAC 2DUCA 2QF3A 2WINI 5HM2A 5JBBS 1HAIH 1XUIA 4X2YA 1N8OB 1L1NA 1GHBF 2A32A 2JJ2D 2FXRA 2NU0E 3U1IB 2ZGXH 2XYAA 1K22H 2GTBA 2ZU1A 1KLJH 1JRSA 4XFQA 1F5KU 1SGQE 1SLVB 1MTNC 1GVLA 2W7UA 1XKBC 2TGTA 4AG1A 1W8BH 1HAZB 4BAQB 2XNIA 2BOHB 1QTFA 4LZ4B 4OM9A 1C5ZB 3BEUA 1O35A 4X1SU 1C2EA 4TT3D 1AWFH 4TPYA 1TNJA 1FAKH 1YY3A 2LPRA 4H42U 1J17T 1YGCH 1GWAA 1AFEH 3QTVH 2HALA 4AX9H 2XCFA 3F1SB 4UFEH 1KLTA 1GJCB 1F5LA 3DSPA 3NZIA 1C5YB 2STBE 1UTQA 3OX7U 2RDLA 1RD3B 4Y0ZE 5HM9A 1K1JA 1O2ZA 3ZZ7A 1GL1A 2RDEA 4Q7YA 3RXJA 2ANKH 5L30H 2RFKC 1K1NA 2GD4B 2NU4E 1DWBH 1HAVA 3GISB 1BCUH 1V2MT 1C5TA 1EP6A 3RC5A 3RXDA 3EA9A 1HBTH 3BEFB 1O2IA 1AKSB 2A7JA 3ZZ9A 1AU8A 7GCHF 1JXPA 3ELAH 2M5TA 1OSSA 1FMGA 5GXPA 4CREA 4U01A 1FONA 4CH8B 1AUTC 1QA7A 3NRLA 1BA8B 1E0FD 4E7RG 1YPMH 2PKSC 5LPFA 1V2JT 1T4UH 1EZQA 3S0NA 2PHBA 1UVUH 4JYVH 1H9IE 2ZFSA 5HIYA 4B73A 3TH4H 1QL7A 1SGNE 1E36B 1O2MA 4Y7AA 1O32A 2BDYA 2C90B 4X6MA 5EG4A 4YM9A 2O8LA 2VVCA 4JK6A 4XOJA 5FX6A 3H7TA 3PTBA 1D9IA 3IITA 1IQMA 3ITIA 1S85A 3A81A 7KMEH 1TA6A 2A5KA 3M5MA 3ATIA 3M36A 2ZDMA 2Y5FA 1BTUA 3T2NA 1CGIE 1O3FA 1FDPA 2Q6FA 1H8DH 1QRWA 3BTEE 4INHA 2H9EH 4ISLA 1C2IA 1EB2A 2F9VA 5I25A 2Z9KA 2FX6A 3SHAH 1T8OA 2OQ5A 5T6GA 2GZ7A 3RXHA 5C17A 2Y80A 5CHAB 1FV9A 5EQRA 2BXUH 4MNWA 3KYGA 2C8WB 1SMFE 4LK4A 1AVXA 4BANB 3FN8A 1W10U 3KQBA 2WUCA 2BB4A 2CK3D 1IHTH 1P2KA 1MTVA 2BDCA 1DS2E 2ZDKA 3ZVDA 1WSSH 1Q3XA 4B2AA 1O3IA 2ANWA 4BAHB 5JBCS 1P9UA 1LCYA 1SGTA 2F9UA 1NRRH 3PWCA 1WQSA 1PPCE 2J92A 2PKAB 1P03A 4NGAH 4A1VA 4RSPA 4M9FA 1GDQA 1ZTKA 2B0FA 3RMOH 1WQVH 2BQ6B 2F83A 3KIDU 2B9LA 4NWLA 1NRPH 2A5IA 2ZFQH 3T27A 1A7SA 5CMXH 1QRXA 2FZZA 4FVBA 3PROA 1WXRA 1XUJA 3DA9B 1FPCH 1CT0E 2PW8H 4X6NA 1WCZA 3SNCA 1PQ5A 2LELA 2J94A 1V2UT 1GJ5H 1VKYA 3RXPA 1SPJA 1PQ8A 2VIQA 2ZGJA 1TX6A 1QCPA 1WUNH 4CRBA 3LGTA 3SUDA 2R3UA 2QV1A 4GCHG 1OOKB 4AORA 1VGCC 1ZJDA 5BRRE 1PYTC 3GY8A 1ZGVA 1SHHB 3SU3A 5A0BA 3K6YA 2JETC 3K65B 3U8OH 3HK6B 3ZV9A 2KM0A 1W14U 3BG8A 3W95A 5DGJA 1V2PT 4AFZA 3SU6A 2FYRA 2LP6A 1ELAA 3VXEH 1C5LH 8LPRA 2O8UA 4YESB 1ANBA 2P94A 2CF8H 1LO6A 4TYDA 4GVUA 1UVTH 1DY8A 2KAIA 5DP3A 4AOQA 1DSUA 5TCCA 3KQEA 3SI3H 1WDIA 3ZVAA 3RC6A 4B71A 2ODPA 4JYTA 2ALPA 4D8NA 1ACBE 1ELEE 4U30A 4FXGH 2KZ4A 2DE8A 1HYLA 1MKXK 4TWYA 5KGOA 1BITA 2M2AA 4MNYA 1IQHA 2BY6X 2PSXA 3FP7E 2BDHA 2C8XB 2FS8A 4YOGA 4K8BA 1SBWA 1Y8TA 3SV7A 2J97A 1ZJKA 4CR5A 1FY5A 2VIOA 3ZZAA 3RP2A 3ESTA 1EOJA 1AD8H 3M61U 5C1YA 1G36A 4MPWA 3LDXH 1LHDH 2K8IA 1KDQB 1NS3A 3PLKA 1S83A 2FOFA 5FXLA 3M7TA 4NZQA 5C0TA 1TPAE 3RXVA 3PMJA 1IOEA 5EXLA 6CHAB 1UW7A 3D23A 4MPXA 2TGPZ 5C5OA 1NROH 2PGBB 1GBIA 1WOFA 2A7HA 3HATH 1S0QA 3VB6A 1O2XA 3M35A 1NM6A 4A6LA 3KQCA 4ASHA 1N1LA 1BMMH 2ZHDA 1MBMA 7LPRA 2PGQB 4XBDA 1S84A 1AQ7A 2H1UA 2K1QA 2TGDA 5GCHF 1EJNA 1ABJH 3KQ5A 2VBCA 1IQKA 1T32A 5HYOA 2Z94A 1NBME 3A7WA 2GZ9A 1V2RT 2A45B 1O3PB 1TLDA 1GPZA 3GY5A 3MU5A 1YF4A 1GG6C 3VB4A 2KCAA 1BZXE 1Q31A 2EI6A 1RJXB 2UUYA 1CGHA 1KTTB 1OP8A 1YYY1 2GV7A 3URCA 4Z6AH 3HGPA 1PFXC 1O2VA 4MVNA 4Y8XA 1G3DA 3PLPA 2W5EA 1Z71A 1OS8A 2ZFRH 3QLPH 4JZEH 1C5XB 3A7VA 5IDKA 4CBNA 1FIWA 1AFQB 1FN8A 3CNRA 1YWUA 2J2UA 4CH2B 5DN6D 3RXKA 1K0HA 1FUJA 2BLQA 2JDID 2Q1JA 2VU8E 3BG4B 1W13U 3ZZ4A 1EASA 2CXVA 2EC9H 4AYYB 2STAE 4AZ2B 1ESAA 4X2XA 5GJ4B 4UFDH 1QZ8A 3W94A 3RMMH 1LHEH 1QNJA 3HKIB 1OKXA 4XE4A 1DE7H 3SJKA 1C5RA 1ESBA 1GI1A 3ATWA 2NU2E 3D49H 3MNBA 5KEDA 2W3KA 3UAIC 3F9FA 9ESTA 2D26C 1ELVA 4YOJA 4ABEA 1CBWB 2R3YA 1RTKA 1P06A 1HXEH 2OXSA 4NFEA 5ESBA 1V6DA 4WMFA 1HIAA 3BTWE 3KGPA 1OWEA 1OWHA 1Z7KA 2G4TA 2D2DA 1P8VC 2VINA 2J98A 2AMQA 2KR7A 3BEIB 3DFJA 4DT7B 4BOHA 1LQEA 4ZHAA 1ANDA 1DT2A 3UB0A 1YM0A 3TJUA 4ISOA 5C5NA 2Y6TA 4LOYH 3M37A 3SV2H 3A88A 2XC0A 2J38A 1ANCA 4GHTA 1NRQH 4K1TA 2BMGB 5EPYA 2EA3A 3GY6A 4FUJA 3RU4D 4ASUD 4AB9A 2BQ7B 3OY5U 2FOMB 1JOUB 1C2FA 1SOTA 2Y5GA 1GCTB 3UQVA 3T28A 2OINA 2ZHWH 5DPAA 1YCPM 1GGDC 1QRZA 1RXPA 3UNRA 2A2XH 1LVOA 3M5NA 3FFGA 3SV9A 1HAYB 4KTCA 3SW2B 1NRSH 1LPZB 1BTYA 1NU9A 3N99A 2GMTC 4MLFB 2GX4A 3LU9B 3QN7A 1UHBB 3BTQE 4ABFA 4CRGA 3CS7A 2FODA 5A09A 1P05A 1AIXH 1BDAA 1L0ZA 1ARCA 4I7YH 1C2LA 1W0ZU 2ZIQH 1GDNA 5T6FA 2VWNA 1O3GA 1NFUA 2UUFB 3ZZCA 4O3UA 1Z1IA 4DCDA 4AB8A 5EOKA 4YXWD 3EYDA 3MNXA 1XKAC 2FI3E 3BTFE 4DW2U 1C1TA 4VGCC 4ZHMU 2SGFE 1EJAA 1SGCA 1O3JA 6GCHF 3D65E 3MOCA 1P09A 1TRYA 4ZKRU 4XD7D 2CGAA 2L6OA 4B6FA 1BMNH 4OS2A 4YTAA 2SGAA 2ZWLH 4DURA 1SKYE 1E38B 3QTOH 2QYIA 2F91A 1A3BH 1ETSH 2AGIX 3SUEA 1QHRB 3DUXH 3VEQB 2HNTE 5CE1A 1FXYA 2CJIA 1CA0C 1GHBG 4K2YA 1EAUA 2D8WA 1YPHE 1O5GH 1XUHA 1GL0E 2OQUA 4WVPE 1C1PA 2J4IA 2OBOA 4NG9H 5FBEA 3CP7A 3DHKH 1GBTA 1SGIB 4UONA 4YO9A 1DICA 1DVAH 1O31A 2VWLA 1TGNA 2H9HA 2ZNKH 3I77A 4OS6A 1GJ4H 1PPBH 2QE7D 1HV7A 3UWIA 1T8LA 1XUKA 1SGRE 3P8FA 3A7TA 4FUBA 2HVXA 2IOTA 2P3UB 1SLWB 3WY8A 4ABGA 4D9RA 1DSTA 4WF8A 4AG2A 4CRFA 3JZ2B 2V35A 3FO8D 1Y3XA 3SV8A 4JZDH 2A1DB 3BN9A 1DM4B 2XTTB 5DSFA 2P3TB 3K2UA 1W2KH 5JYIA 3P17H 1JMOH 4ABHA 3ZVBA 3SGBE 4MNVA 1N6XA 2OC8A 2SNWA 2CHAB 3GCHC 2P95A 3MO6A 3LGVA 1Z1JA 4OS7A 4CHAC 1C4Y2 7GCHG 1NZQH 1BMFD 3SZNA 3M3TA 1C1QA 1D6RA 5H4IB 2BX4A 4HI3A 1SB1H 1V2TT 2IJOB 2QF5A 1CHGA 3ZZBA 3U8TH 1GI5A 2BVRH 2WPHS 1PPGE 1TNIA 1ELDE 2FMJA 1HAOH 1G3CA 1ZOMA 2YNAA 1TGSZ 2ZKSA 3ZZ8A 2FDAA 2ZPRA 1UCYK 3RXGA 1O2LA 2ZECA 1GI6A 2BZAA 5G4BA 1M9UA 2FS9A 1C1OA 3SQHE 3FAOA 1TBQH 3TNTA 1Z6JH 4Y79A 5C94A 1NT1A 1SVPA 3BV9B 3BIUH 3TK5A 1F0RA 1WBGB 3MFJA 3A7XA 2WZQA 2PR3A 1SGFA 2G55A 2BLOA 2Y81A 4B75A 1EZXC 2VGCC 1O37A 1Y5UT 1Y5BT 5JDUB 3FZDA 1SG8B 3PMAB 2BD8A 2WYGA 5JBAS 1GJ8B 2CN0H 1O2GH 2TIOA 1SLXB 4ACBA 2B7DH 1ETRH 2Y82A 2ZP0H 3I78A 1E1RD 1FY4A 4ZMAH 5EGMA 3MHWU 2IPHA 2NU1E 4O3TA 4UFGH 1J15A 1TALA 1TABE 1BIOA 7ESTE 1CVWH 3U98H 1C1NA 3Q3YA 4X1QU 4DVAU 5HKKD 2Z6BD 1GHAF 4A92A 3RXFA 1ORFA 2PKSB 2ZHQH 2GV6A 1BRBE 1EKBB 1THSH 2K0QA 4X2WA 4ISHH 1ZTLA 1VZQH 1S5SA 2ZTYA 4RT0A 1KSNA 2FOCA 3F2GA 1O3MA 3RMLH 3L6PA 3E90B 5GNDA 4B74A 4WH6A 2A4RA 8ESTE 1BHXB 4SGBE 1FAXA 1TA2A 3GY7A 2SGEE 1AB9C 5AHGH 1O2SA 2BY5X 1P02A 1O3EA 2F3CE 4KP0A 5JB8S 1UVSH 4FUDA 1GVZA 1ZHRA 3A87A 1AGJA 1EZUC 1HAHH 3QDZB 2KCPA 2XOKD 3SHCH 1G2MA 3UNSA 2G5VA 1A5GH 1T31A 1TOMH 2ZDLA 1P12E 2RA3A 3UOPA 1NY22 2ASUB 2VB0A 4D7GA 1MABB 5CHBA 1GJ9B 4Y71A 3PMHB 1LTOA 1TNHA 3FP6E 3ATKA 1A5IA 1DWDH 2GDDA 3E91A 3M5LA 4ZCNA 5J4QA 4DIIH 2WSSD 1KXAA 5J4SA 2PUXB 1SGEE 4THNH 3MH6A 1P2JA 2FIRH 1FY8E 1A2CH 1O2TA 1P10A 2FPZA 1O34A 1EPTA 3PMBB 3M7QA 5EQSA 1THRH 1ZMLA 1TE0A 2ILNA 4K8YA 5A8YA 2JH6D 1GBEA 3KN2A 1HB0B 3PWBA 2J5UA 2BQWB 1GBLA 2WPMS 1AI8H 4OS1A 3QGJA 3U8RH 4U32A 3R3GB 5KECA 1AE5A 4K3JA 1A4WH 1QB1A 1YCPH 5JB9S 1OWIA 2C3SA 1P01A 4DGJA 4AFUA 4ISIH 2ZTXA 2QF4A 1YP9A 3B23B 1HLTH 4JMYA 1HAVB 2H9TH 1EXFA 1W0YH 3GYLB 1BJVA 3M3VA 8GCHG 1BRUP 3QX5H 5AFZH 1KXBA 3STIA 1QY6A 4FU9A 5FPSA 4DT4A 1Y3YA 2G8TA 1P2MA 1VGCB 2BZ6H 4LZ1H 1UK4A 1DXPA 3N7OA 2JETB 1VR1H 2AH4X 1MH0A 1O2OA 1TRNA 2FM2A 3UY9A 2XCNA 5HXFA 3C1KA 3MNSA 5GIBA 1YPJH 1ZLRA 1KXCA 1MD7A 1VCQA 5BPEA 4NIVA 3AAUA 1GMCG 5EJ1A 2ZDAH 1SQTA 1TPSA 1K9OE 2W26A 4Q80A 2ZTZA 1TPOA 1KY9A 2UWPA 3AW0A 4MQAA 1W11U 1O5BB 2XBVA 5GCHG 1TYNA 3MQKC 2GGVB 3TGKE 2A7CA 1ZRKA 3RXRA 2QXIA 3EE7A 3SBKA 3VPKA 2HVYB 1B0EA 1HJ9A 3RXUA 1UTOA 1RIWC 1TMBH 2YMSC 2Q6GA 1OHHD 1W7GH 4R8TB 1C1VH 1EAWA 5A2MH 1BTHH 3RXIA 4WJG2 1L2EA 2UUJB 1YLDA 2Z3CA 3NUMA 3T62A 5EXNA 1T8NA 2ZQ1A 1SGFG 2HLDD 3TH3H 2FYQA 1GI2A 2EEKA 1CGJE 1SFIA 4A1TA 1GBFA 4CBOA 1GJ6A 5DP5A 2F9PA 5B6LA 1GCDA 2O9QA 1KDQA 3MTYA 1EPTC 1NU7B 2AEIH 3RXTA 3TNSA 1CA8B 4H4FA 2VIDA 2I6SA 4A1XA 4P00A 3LH1A 2SFAA 1XMNB 1W12U 1MUEB 3OEED 4A7IB 3UR6A 3V7TA 1BT7A 1EFRD 1OYQA 1QB9A 2J95A 3P6ZB 1HJ8A 4M7GA 1V2ST 1DLKB 1ARBA 5JBTA 2TPIZ 4XSKU 2AFQB 3LH3A 2ZDNA 4GUXA 4NIWA 2ULLA 4JZ1A 2ZEBA 5C3NA 1P0SH 2OC1A 2BY9X 4FOUC 1AZ8A 1JIRA 2ZQ2A 4FU7A 2WPLS 3ZVGA 1W7XH 1BJUA 4YT6H 1GG6B 3LOXA 3SGQE 1HNEE 1DUAA 1IQFA 2EI8A 2XC5A 1ZHPA 1A0LA 1BTXA 5CDFE 5GWZA 1ZPCA 4YOIA 1GBHA 4F4OC 1ELTA 4D7FA 1YPKH 1IQLA 3A89A 1F0TA 2WPDD 1YLNA 4AC9A 5FCKA 1JWTA 4NA9H 3RXMA 2FO9A 2BD3A 2ZHEH 4OS5A 1BMAA 3ZVCA 5F8TA 1UVPA 2R2MB 1D3DB 2QIQA 3GY2A 3EA7A 1BTZA 1FPHH 2VVVA 1W0KD 2EY4C 2B5TB 2BD5A 2AGEX 2H6MA 1A3EH 3RXBA 3STJA 2KAIB 5DP4A 3DFLA 1KXFA 3F2HA 1J14A 3T26A 3AK5A 3LIWA 1AY6H 3O8DA 4ZH8A 2ZHFH 1QQUA 4D76A 3IG6B 1B7XB 1C1RA 4NIXA 1G30B 3Q76A 5EU8A 1P2OA 2V0BA 1LKBA 5T3HA 4BTTB 2AIQA 1O2NA 2PWXA 2HPPH 1Z8JB 1SOZA 3VFEA 1Z8IB 5AFYH 2OP9A 3WWFA 2R2WU 3Q3KA 2G00A 5C67A 4YZUA 3EA8A 4AFQA 4ZKNU 3SGAE 3AW1A 1BBRK 1QURH 4GHQA 4ZAEA 2QC2A 4RN6A 1O5CB 4IC6A 1Z6EA 1O5DH 1MZDA 3SORA 2F9NA 1GI7B 1T7CA 4I8GA 4KELA 1TWXB 4ZROA 6GCHG 3WWBA 1DANH 5FBIA 1K1IA 1ZSLA 2A2QH 3NPSA 3LPRA 3DCLA 4PROA 5DP7A 3UUZA 1X7AC 3MI4A 1GMHF 2QF0A 2R9PA 4GLYA 1C4U2 5E0GA 3OYPA 1XX9A 2GCHF 3FANA 2AGGX 4WMEA 1KXEA 3UFAA 2BD4A 1GGDB 2G81E 3PO1C 1VITH 2PLXA 2XWAA 2BY8X 1CE5A 1MCVA 2AMPA 3R0FA 1GHWH 3PRDA 2ZPSA 3A7YA 4ABJA 1IQGA 1MMJN 2PSYA 1AN1E 1O39A 1ZZZA 3MU1A 2GMTB 1A61H 1MKWK 2VIVA 4OGXA 2WHXA 4XBBA 2Z3EA 1V2WT 1P9SA 3UQOA 1GHYH 1IQIA 2ZU3A 2OD3B 1C5SA 4TY6A 4WY3A 1VJAU 1PPFE 4UE7H 3UWJH 1AO5A 1DWCH 1O5FH 2WPKS 4IBLH 4Y10E 1A46H 3NWUA 3A8CA 4Q7XA 1HJAC 4XRNA 5C20A 1FX0B 2V6NA 4VGCB 2WV4A 4R0IA 2EQNA 2OK5A 2Z9GA 3FVFB 1H8ED 2JIZD 5C1XA 4K60A 4AN7A 1GI0A 5EQQA 1TIOA 2VJ1A 4D9QA 1UCYE 2BVXH 1CU1A 2Q6DA 2HGTH 5A8XA 1MAYA 2P8OC 1F0UA 1IQNA 4NA8A 2J9NA 3ZV8A 3N7EA 3ODFA 2WPJS 4KKDA 4X0WU 3UNQA 1LVMA 4FUHA 2XBYA 1LHFH 4K1EA 1P3EA 2FTMA 2ZCHP 1D6WA 2F9OA 5TCAA 1CA0B 1P2QA 1L4DA 2AERH 1OX1A 1Z8RA 1ZPBA 2BYAX 1HIAB 2SGQE 2VWMA 2UUKB 4IC5A 1OWKA 4A5TS 1LMWB 4I33A 5ABWA 2QXGA 3S9CA 3MYWA 1PPZA 1V2NT 2J98B 2QAAA 5LH8A 3RDZA 1GHVH 2HPQH 3MH5A 1MTSA 1O30A 2RCEA 4X8TH 1WTHD 1TNGA 1XVOA 4NCYA 2CMYA 2O8TA 1MKXH 1ID5H 1VCWA 2WPIS 2GT8A 1C9TA 2QY0B 2O8MA 4Y8YA 1TONA 1C5PA 3EDXB 4WMDA 3LC5A 3DSOA 1DITH 2IPQX 3HKJB 3OU0A 4ZHLU 4WWYA 3GCTF 3B9FH 4Y11E 1BB0B 1QL8A 2ALVA 3SYJA 1QJ6B 5HIZA 2FEQH 1SSXA 2QXJA 3F2FA 4JK5A 1TB6H 4ABIA 3ZZDA 3OY6U 1RTLA 1EOLA 1DX5M 5F53A 2HNTF 5FPTA 3GCHB 1LHCH 4KTUA 4CHAB 2VWOA 1N6YA 3LJOA 5EW2H 4FUEA 3VXFH 2GP9B 2JH0D 1P2NA 5C0UA 1GHAG 5EODA 1KXDA 5HMAA 1ESTA 1LPKB 2FTLE 1E37B 1NRNH 1QIXB 3T29A 4MDSA 4IGDA 3RXOA 2OCVB 2ZA5A 2BY7X 3NXPA 4ABBA 1AVGH 2XRCA 4ABAA 1WTGH 3PM3A 2ODQA 3M3SA 1J9CH 3WW7A 3SNEA 8KME2 1C1SA 4X8SH 1MQ6A 2ZCLP 2VIWA 1D4PB 3SNAA 1GMDF 3GOVB 6LPRA 1TGTA 2A0QB 1O2PA 4DG4A 1HRTH 1PPEE 2GVFA 2BVSH 1SQRA 1A0HB 4K69A 2H5DA 4CRDA 1TAWA 1FQ3A 3TGJE 2GCTC 2VGCB 3F3BA 1C2MA 2KCOA 2O8WA 5DK1A 1DUEA 1C1MA 3MH4A 2XNDD 3BTGE 1KTSB 3KNXA 5IK2D 1C4V2 1AMHA 1H1BA 2W3IA 3LGWA 3LC3A 2BLVA 1NO9H 1T4VH 1BQYA 1TBRH 1QBNA 2OBQA 3ZYEA 3F9GA 1D3QB 1EP5A 1UVOA 1YKTA 1DFPA 3OTPA 1SR5C 4SGAE 2HLCA 1MTNB 4U2WA 3F9HA 4E05H 1K1MA 3QZQA 3BTME 3BTDE 3CENA 3ZZ6A 3PV5A 2YMSD 3GCNA 2RA0A 3QK1A 2CF9H 2FESH 1EUFA 5EIYA 5GPIB 2RG3A 4I8HA 3BF6H 4QT8C 4OGYA 3Q3XA 3F9EA 3QGNB 3ATMA 3SU2A 1FLEE 1NFXA 5F8ZA 2PP6A 1WV7H 4F55A 2EI7A 2ZU2A 4X8UH 3VGCC 3OAAD 1OXGA 2F43B 3KQDA 1AB9B 1CQQA 1TQ0B 5PTPA 3T5FH 1VITF 3QWCH 3MO3A 4TSFD 3EGKH 3ZZ5A 1HGTH 2B8OH 1LDTT 2GDEH 1QBOA 3V0XA 1HAPH 3SV6A 2BDGA 3Q77A 4I8LA 3RLYH 2GZ8A 5C1UA 1F7ZA 1CO7E 1DDJA 1ZPZA 1DXWA 2TGAA 1V2KT 5FAHA 4WXVA 1O0DH 1K1OA 2ANYA 2OC0A 2KX4A 1TFXA 2WYJA 3A85A 4O03A 3UR9A 2C8ZB 1NPMA 1O3DA 5E2PA 1AKSA 4IW4E 1H9HE 1O2KA 1H8IH 3GCOA 3PB1E 4X1RU 3SNBA 2THFB 2HOBA 1S81A 1O3NA 1J16A 1GI8B 1NFYA 2QXHA 3TVJB 1QFKH 4NSVA 1V2LT 1C5WB 1IHSH 2VH6A 3SJ9A 2GKVE 4I8JA 4Z0KA 1Y3UA 3ZYDA 1J8AA 3UPEA 2P93A 2WV9A 2PFEA 1LVYA 1UTNA 2BDAA 4B2BA 5EPNA 1GI3A 3ZIAD 2L74A 3K6ZA 1O2WA 1P57B 3OSYA 4GSOA 1FI8A 1KLIH 2F4LA 1ELFA 1KYNA 1QB6A 2BD2A 1SLUB 5E8EH 5DKMA 1SC8U 4Q4LA 4Q2KA 3O8RA 1Y3VA 1GJDB 2W7SA 1TNLA 2Y7XA 1MTUA 4Y8ZA 2ZZUH 5K7RA 1O36A 2H5CA 2OTVA
chains in the Genus database with same CATH topology
1V2OT 3A80A 5DP8A 1Q2WA 1W3CA 1V2VT 3UOUA 1AE8H 5A0CA 3QZRA 2OC7A 2FOBA 2QGRA 3SUFA 1A5HA 4FVDA 1TGCA 1N8OC 1EQ9A 1GJAB 3LGIA 2P16A 3MU8A 5HGGA 3TU7H 2G4UA 1UO6A 2Z7FE 1C5NH 3PLBA 1CHOF 1O3CA 3VB3A 1AVWA 4INLA 1FIZA 1SQAA 1RTFB 4NWKA 4X8VH 4RKJB 3T25A 1C2JA 3E3TA 3SU1A 4IN1A 2PUQH 2C8YB 3SJIA 2ZO3H 1A0JA 2Y5HA 4HGCA 3TGIE 3BIVH 1ETTH 3SU0A 4Y6DA 2PKAA 3SUGA 3PYHA 2ZU4A 3L3TA 4NIYA 3SI4H 3LGUA 1L4ZA 1O2RA 5I46H 1DOJA 4UEHH 2XBWA 1CT4E 1UTJA 1B5GH 2V3OH 4X2VA 1C5QA 1TMTH 2ZC9H 1O3KA 1E35B 2XXLA 1FNIA 4MNXA 1BOQA 1IAUA 4MPVA 4TY7A 5E0HA 2YOLA 1RIWB 3EAJA 1L1GA 2FLRH 4J1YA 1TBZH 4O97A 1TX8A 1YBWA 2BD9A 5EXMA 1ZYOA 2ZCKP 5GDSH 2BDIA 3LT3A 1SQOA 2R0LA 1OPHB 4XDEA 3V13A 3S69A 4Y0YE 3A8AA 1HFDA 1GI4A 3AAVA 2BOKA 1HPGA 4XBCA 1INCA 3BTHE 1DPOA 3HPTB 4TPIZ 1XUFA 3D62A 2CV3A 1NESE 5E0JA 1EPTB 1O2HA 1QR3E 1RGQA 1E34B 1EAXA 4ZXXH 3SNDA 5E2OA 1O5EH 1BBRE 1S0RA 4OS4A 3GDUA 1ZMNA 1GDUA 1LVBA 2WUBA 1UCYH 4NSYA 1B0FA 2I6QA 3ZVFA 4K1SA 2PV9B 2BX3A 1CSOE 1P3CA 3ENSB 1DY9A 3A8BA 5ETXA 4IMQA 1NTPA 4O9VA 3SQEE 3NCLA 2Y7ZA 4Y76A 3VB5A 3O8CA 1OP2A 4B2CA 1KIGH 2FI4E 1EATA 2FP7B 5CHAC 3MU0A 3EQ0H 1S6FA 4JZIA 3E6PH 4AFSA 1EAIA 4E7NA 1O3OA 1O2UA 1MU8B 1TMUH 1OWDA 2AYWA 3HGNA 3P95A 3RC4A 1F92A 2AMDA 3SO3A 3G01A 1GMHG 3GYMA 3E16B 1FN6A 1WYKA 2FX4A 1IQEA 2C4FH 1UMAH 2GCHG 1GBAA 3KHVA 2ZFTA 1TGBA 1VJ9U 3RXCA 3SJ8A 4NFFA 4RKOB 4B1TA 1HDTH 2UWLA 2ODYB 3TPIZ 3BSQA 3MO9A 3S9AA 1G2LA 2VIPA 1GJBB 1ZMJA 4NZLA 1QA0A 1HUTH 3UREA 5TJXA 1LHGH 2FOAA 1YC0A 3SJOA 1G3EA 1S82A 4F49A 2ZPQA 2J34A 2ZU5A 2F9BH 5DG6A 3Q00A 3ZZ3A 4WXIA 1C5UA 3GY3A 3FP8E 5FCRA 1AUJA 3RXSA 1BRCE 3RU4E 1ZRBA 2ESTE 1O3BA 1C9PA 5FX5A 4ABDA 1D3PB 3PV4A 1G9IE 1EB1H 2ZI2H 4DJZB 9LPRA 1TRMA 2HNTC 3MNCA 5LGOA 3A7ZA 1UK2A 3AVZA 2C93B 5F8XA 1CT2E 1K1LA 1SI5H 1YPHC 8GCHF 1O2JA 3JZ1B 3E0PB 1C5OH 1MBQA 1U6QA 2TRMA 4KTSA 4I31A 3E0NB 4ZXYH 1MTWA 2SGDE 2NWNA 3IWMA 2HWLB 2FLBH 3LJJA 3KF2A 4BAMB 1FJSA 1GBKA 1NC6A 1O2YA 2ZGBH 4JYUH 1S6HA 3I29A 4CR9A 3V12A 3C27B 2XBXA 3LONA 3O8BA 2BTCE 3FZZA 3RXQA 4J2YB 4AGKA 3PO1B 2BD7A 1BRAA 2QCYA 2TBSA 2ZFFH 3TK9A 3RM0H 1GHZA 3KL6A 1GMCF 3H7OA 3MWIU 4HFPB 5L2ZH 4JCNA 1G32B 1RRKA 1PQAA 1LPGB 3F6UH 1ANEA 4WH8A 3RM2H 4KGAA 1MD8A 1C1WH 1SGPE 2OLGA 1TQ7B 1YPEH 4FUGA 3URDA 4I8KA 1NN6A 5L6NH 2G52A 1FZZA 4ZUHA 2LNCA 1V2QT 1OWJA 5B6OA 2ZGHA 3LKWA 1BHXF 1Y59T 1Z8GA 3MH7A 1HJAB 1C2KA 5EW1H 3P8GA 3QUMP 1HXFH 2OUAA 4GCHF 1BMLA 2ANMH 4UFFH 1UTKA 4X1PU 1C5VA 2ZDVH 5ESTE 1GHXH 3AASA 2Z9LA 3GCTG 1AWHB 1L1JA 2WV5A 2ZGCA 3RXAA 1P2IA 3BTTE 2P8OB 6CHAC 5DP6A 1ZTJA 2H2ZA 5A8ZA 4ZKSU 1FY3A 1GVKB 3EE0B 2BM2A 3SOSA 1TPPA 4H6TA 4X6OA 1SL3A 4MPUA 3M5OA 3GDSA 1PJPA 3QO6A 5AF9H 1K2I1 1UTMA 3ATLA 1GBBA 5DP9A 1OP0A 3CS0A 5T6DA 1O3LA 1BUIA 1LQDB 1UHBA 5F03A 2JH5D 5LPRA 3E8LA 1P04A 4NA7A 3A8DA 2UWOA 1GJ7B 4UD9H 4INKA 1G3BA 2GT7A 3SU4A 3KEEA 1GMDG 4FU8A 4BXSA 2A4OA 2A4GA 2NU3E 5L2YH 3TH2H 4E06H 1VCPA 1A1RA 1SGDE 1UK3A 3ODDA 2AIPA 1AFQC 1EZSC 3S7KB 1XM1A 1D3TB 4K5ZA 3BG4C 4FUIA 2BHGA 1DLEA 3P92A 1YLCA 2FI5E 1P11E 1GBDA 1FY1A 2BLWA 5FHTA 3DD2H 5F6MA 4FUFA 2VVUA 3A82A 1PPHE 1ZGIA 4GPGA 1BTWA 3E1XB 1CBWC 4Q7ZA 4JZFH 4BXWA 3TITA 3TIUA 1TOCB 3K9XB 3UTUH 3P8OA 3KCGH 4YT7H 4ESTE 2D1JA 5DJ7A 1XXDA 3GDVA 3BTKE 3OTJE 1ABIH 4BAOB 4Y7BA 3P70B 4YLQH 3P8NA 4IN2A 4X6PA 1UJ1A 3NKKA 3TJVA 3U69H 5DO4H 1JBUH 3GICB 4HZHA 4MTBA 2FOHA 1QJ7B 1VITG 1PQ7A 2DE9A 2GCTB 1MU6B 2HRVA 3LGYA 4LXBH 1XVMA 1SHYA 4DY7B 1EX3A 2FOGA 2Z9JA 1K1PA 1O33A 3HK3B 3RXLA 1V3XA 2PTNA 2ZG0H 3RLWH 1C1UH 3TJOA 1ZSJA 2G51A 3TJNA 1GCTC 1RS0A 1O3HA 1Y3WA 2BXTH 3TLOA 1GI9B 1GBJA 5JPMH 2PTCE 1G37A 1QGFA 3MU4A 3U1JB 3SU5A 4ZKOU 1H4WA 2ZF0H 4HTCH 3V3MA 1EJMA 3NK8A 3TK6A 1ZSKA 1QQ4A 1ZR0A 3GY4A 1HAXB 5A0AE 2FWWA 4H6SB 1XUGA 1YPLH 1UTPA 2QN5T 3H5CB 2A5AA 2XC4A 2XWBI 2FOEA 1JIMA 4X1NU 2BDBA 4IS5A 1C2HA 3ZVEA 1T8MA 3DT0H 1YCPK 1XXFA 1AHTH 2P59A 1ZHMA 1LKAA 3VB7A 3S7HB 4DIHH 3VGCB 1O2QA 1O3AA 1TNKA 1AZZA 4IMZA 1BBRH 1F5RA 2Z9IA 1YPGH 4BAKB 3S9BA 1MCTA 5C2ZA 2SGPE 1F2SE 5AVDA 4B76A 1F0SA 1BTPA 2VNTA 5IYTA 1C2GA 4FUCA 3RU4T 4AGJA 3F68H 4AYVB 1QJ1B 1K28D 2IN2A 1WAYB 1K21H 1MZAA 1UTLM 2A4QA 3L33A 1JRTA 3MMGA 1TX7A 4CRAA 1H9LB 2Z3DA 1CHOG 4BNRA 3SN8A 1O38A 2G5NA 4MG3A 2JKHA 1ELBA 1SFQB 3A83A 5FPYA 1HCGA 1NFWA 1QBVH 1THPB 3A86A 3RXEA 5SGAE 4CRCA 1C5MD 1MKWH 6ESTA 1ELGA 1MAXA 4BTUB 2AS9A 2ZFPH 5LPEA 3PTNA 4YLUA 1IQJA 1Y5AT 1GBMA 1RFNA 2A31A 4DOQA 3A84A 4I32A 1OYTH 1HAGE 1QL9A 4GAWA 2VH0A 3RMNH 2V3HH 4BTIB 2YNBA 4UDWH 4ISNA 1GBCA 1O5AB 1DWEH 1MQ5A 3M7UA 1SGYE 1PYTD 3B8JA 4TWWA 1WU1A 2QA9E 1C2DA 2XW9A 3U9AH 3UIRA 2R0KA 2P3FH 1ELCA 3RUOA 5K0HA 2SNVA 2CHAC 2DUCA 2QF3A 2WINI 5HM2A 5JBBS 1HAIH 1XUIA 4X2YA 1N8OB 1L1NA 1GHBF 2A32A 2FXRA 2NU0E 3U1IB 2ZGXH 2XYAA 1K22H 2GTBA 2ZU1A 1KLJH 1JRSA 4XFQA 1F5KU 1SGQE 1SLVB 1MTNC 1GVLA 2W7UA 1XKBC 2TGTA 4AG1A 1W8BH 1HAZB 4BAQB 2XNIA 2BOHB 1QTFA 4LZ4B 1C5ZB 3BEUA 1O35A 4X1SU 1C2EA 1AWFH 4TPYA 1TNJA 1FAKH 2LPRA 4H42U 1J17T 1YGCH 1GWAA 1AFEH 3QTVH 2HALA 4AX9H 2XCFA 3F1SB 4UFEH 1KLTA 1GJCB 1F5LA 3NZIA 1C5YB 2STBE 1UTQA 3OX7U 2RDLA 1RD3B 4Y0ZE 5HM9A 1K1JA 1O2ZA 3ZZ7A 1GL1A 4Q7YA 3RXJA 2ANKH 5L30H 1K1NA 2GD4B 2NU4E 1DWBH 1HAVA 3GISB 1BCUH 1V2MT 1C5TA 1EP6A 3RC5A 3RXDA 3EA9A 1HBTH 3BEFB 1O2IA 1AKSB 2A7JA 3ZZ9A 1AU8A 7GCHF 1JXPA 3ELAH 2M5TA 1OSSA 1FMGA 5GXPA 4CREA 4U01A 1FONA 4CH8B 1AUTC 1QA7A 1BA8B 1E0FD 4E7RG 1YPMH 2PKSC 5LPFA 1V2JT 1T4UH 1EZQA 3S0NA 2PHBA 1UVUH 4JYVH 1H9IE 2ZFSA 4B73A 3TH4H 1QL7A 1SGNE 1E36B 1O2MA 4Y7AA 1O32A 2BDYA 2C90B 4X6MA 5EG4A 4YM9A 2O8LA 2VVCA 4JK6A 4XOJA 5FX6A 3H7TA 3PTBA 1D9IA 3IITA 1IQMA 3ITIA 1S85A 3A81A 7KMEH 1TA6A 2A5KA 3M5MA 3ATIA 3M36A 2ZDMA 2Y5FA 1BTUA 3T2NA 1CGIE 1O3FA 1FDPA 2Q6FA 1H8DH 1QRWA 3BTEE 4INHA 2H9EH 4ISLA 1C2IA 1EB2A 2F9VA 5I25A 2Z9KA 2FX6A 3SHAH 1T8OA 2OQ5A 5T6GA 2GZ7A 3RXHA 2Y80A 5CHAB 1FV9A 5EQRA 2BXUH 4MNWA 2C8WB 1SMFE 4LK4A 1AVXA 4BANB 1W10U 3KQBA 2WUCA 2BB4A 1IHTH 1P2KA 1MTVA 2BDCA 1DS2E 2ZDKA 3ZVDA 1WSSH 1Q3XA 4B2AA 1O3IA 2ANWA 4BAHB 5JBCS 1P9UA 1LCYA 1SGTA 2F9UA 1NRRH 3PWCA 1WQSA 1PPCE 2J92A 2PKAB 1P03A 4NGAH 4A1VA 4RSPA 1GDQA 1ZTKA 2B0FA 3RMOH 1WQVH 2BQ6B 2F83A 3KIDU 2B9LA 4NWLA 1NRPH 2A5IA 2ZFQH 3T27A 1A7SA 5CMXH 1QRXA 2FZZA 4FVBA 3PROA 1XUJA 3DA9B 1FPCH 1CT0E 2PW8H 4X6NA 1WCZA 3SNCA 1PQ5A 2J94A 1V2UT 1GJ5H 3RXPA 1SPJA 1PQ8A 2VIQA 2ZGJA 1TX6A 1QCPA 1WUNH 4CRBA 3LGTA 3SUDA 2R3UA 2QV1A 4GCHG 1OOKB 4AORA 1VGCC 1ZJDA 5BRRE 1PYTC 3GY8A 1ZGVA 1SHHB 3SU3A 5A0BA 3K6YA 2JETC 3K65B 3U8OH 3HK6B 3ZV9A 1W14U 3BG8A 3W95A 5DGJA 1V2PT 4AFZA 3SU6A 2FYRA 3VXEH 1ELAA 1C5LH 8LPRA 2O8UA 4YESB 1ANBA 2P94A 2CF8H 1LO6A 4TYDA 4GVUA 1UVTH 1DY8A 2KAIA 5DP3A 4AOQA 1DSUA 5TCCA 3KQEA 3SI3H 3ZVAA 3RC6A 4B71A 2ODPA 4JYTA 2ALPA 4D8NA 1ACBE 1ELEE 4U30A 4FXGH 2DE8A 1HYLA 1MKXK 4TWYA 1BITA 4MNYA 1IQHA 2BY6X 2PSXA 3FP7E 2BDHA 2C8XB 2FS8A 4YOGA 4K8BA 1SBWA 1Y8TA 3SV7A 1ZJKA 4CR5A 1FY5A 2VIOA 3ZZAA 3RP2A 3ESTA 1EOJA 1AD8H 3M61U 5C1YA 1G36A 4MPWA 3LDXH 1LHDH 1KDQB 1NS3A 3PLKA 1S83A 2FOFA 5FXLA 3M7TA 4NZQA 1TPAE 3RXVA 3PMJA 1IOEA 5EXLA 6CHAB 3D23A 4MPXA 2TGPZ 5C5OA 2PGBB 1NROH 1GBIA 1WOFA 2A7HA 3HATH 1S0QA 3VB6A 1O2XA 3M35A 1NM6A 4A6LA 3KQCA 4ASHA 1N1LA 1BMMH 2ZHDA 1MBMA 7LPRA 2PGQB 4XBDA 1S84A 1AQ7A 2H1UA 2K1QA 2TGDA 5GCHF 1EJNA 1ABJH 1IQKA 1T32A 5HYOA 2Z94A 3A7WA 2GZ9A 1V2RT 2A45B 1O3PB 1TLDA 1GPZA 3GY5A 3MU5A 1YF4A 1GG6C 3VB4A 1BZXE 1Q31A 2EI6A 1RJXB 2UUYA 1CGHA 1KTTB 1OP8A 1YYY1 2GV7A 3URCA 4Z6AH 3HGPA 1PFXC 1O2VA 4MVNA 4Y8XA 1G3DA 3PLPA 2W5EA 1Z71A 1OS8A 2ZFRH 3QLPH 4JZEH 1C5XB 3A7VA 5IDKA 4CBNA 1FIWA 1AFQB 1FN8A 2J2UA 4CH2B 3RXKA 1FUJA 2BLQA 2Q1JA 2VU8E 3BG4B 1W13U 3ZZ4A 1EASA 2CXVA 2EC9H 4AYYB 2STAE 4AZ2B 1ESAA 4X2XA 5GJ4B 4UFDH 3W94A 3RMMH 1LHEH 1QNJA 3HKIB 1OKXA 4XE4A 1DE7H 3SJKA 1C5RA 1ESBA 1GI1A 3ATWA 2NU2E 3D49H 3MNBA 2W3KA 3F9FA 9ESTA 2D26C 1ELVA 4YOJA 4ABEA 1CBWB 2R3YA 1RTKA 1P06A 2OXSA 1HXEH 4NFEA 5ESBA 1V6DA 4WMFA 1HIAA 3BTWE 3KGPA 1OWEA 1OWHA 1Z7KA