4I8HA

Bovine trypsin at 0.75 resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title On the reproducibility of protein crystal structures: five atomic resolution structures of trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8hA02
3TGIE 1ZPCA 1VCQA 1UVPA 3RMLH 3RXLA 1V6DA 4OGXA 2ZECA 2ZWLH 4D7GA 2Z9KA 3NCLA 1UCYH 1RFNA 2FOGA 1GHXH 3MMGA 1FY1A 5CHAB 3MNXA 2NU2E 1F5LA 4MPUA 3U8OH 1GI1A 1C1RA 3R0FA 4MNXA 1GI9B 3M36A 2WUCA 3Q3XA 2YNAA 4FUJA 4Q7ZA 1C1WH 1GMHG 4I8LA 2HLCA 4WH6A 2Y5HA 2Q6FA 2AGGX 1S85A 1JOUB 1W8BH 4FUFA 3RXHA 3KEEA 4INHA 5ESTE 3LJJA 4D8NA 3TGJE 5AFYH 1C2HA 2VJ1A 2XBVA 2FMJA 3E1XB 5FBIA 1Q31A 3LKWA 1DITH 1K21H 1V2NT 3HGNA 3M35A 1ZPZA 4I32A 1G36A 3SV8A 1KY9A 1GI6A 4CRBA 2P8OB 1W0ZU 2GDEH 3E16B 3DA9B 1FY3A 1RRKA 3SUFA 4CHAC 3BTME 2IN2A 5GPIB 1ETTH 3FZZA 1GCDA 2SGFE 4ZXXH 1K1IA 5L2YH 2HNTC 2WPLS 2GCTC 2C8XB 4BXWA 1O0DH 3A88A 1NFUA 3D62A 2ZEBA 2G4TA 4Q7YA 1SGQE 3TK9A 1HAHH 1E34B 2CHAC 1P3EA 3PYHA 2AIPA 5EW2H 1DT2A 4YT6H 3ZVDA 3MTYA 1FPCH 5FPTA 1BIOA 4ZKRU 1SMFE 3E3TA 3LGVA 3ZVBA 1C9TA 1ELDE 2FOEA 3GOVB 2BY5X 1UO6A 4AFQA 4X8SH 3ATWA 5AFZH 5BRRE 4Q80A 3ZYDA 1BTYA 1GI3A 1CU1A 1AKSB 4Y7AA 4ABIA 3LPRA 2ZU5A 3V12A 3K6YA 1BJUA 3ATKA 3SU4A 4AX9H 1TNHA 3KL6A 1GL0E 1TNIA 4B73A 2G81E 2BOHB 2ZFSA 5FBEA 1WQSA 1EAUA 1GBAA 3M5LA 3FP7E 3AASA 4LXBH 1QL7A 1HJ9A 3GY4A 1C5VA 2GZ8A 1QRWA 1UHBB 1A46H 1ZSLA 2H5CA 2P59A 1KXAA 1O2WA 4CH8B 1WUNH 1AE8H 1NFXA 3C1KA 3RU4E 1GI0A 4GSOA 3A7WA 3T62A 2P3TB 1O3OA 3SGBE 1A5HA 1SG8B 1TLDA 1TPPA 1YPHE 2FP7B 1IQEA 1CE5A 3KN2A 3P92A 2PKAA 4K1TA 3RXIA 3CS0A 2WPMS 2TGTA 2ZHFH 5EQRA 2OBOA 3STIA 2AS9A 3ZZ9A 1ABJH 1NRNH 2H9EH 2FLRH 1P3CA 1FZZA 3RXMA 2QXHA 2ZCHP 3PM3A 3BG4B 2Q6DA 2SFAA 4K8BA 1GBCA 1F92A 3WY8A 4AG2A 2GD4B 1MBMA 1K28D 1ZJKA 1BMNH 3K9XB 3PWBA 1CHOF 4ABFA 2ASUB 2BDYA 3SORA 3E0NB 2WYGA 5E0GA 1G30B 1O3FA 1BDAA 1G3DA 2B8OH 1C2FA 1DWDH 3UNQA 1QQUA 1NM6A 2BDAA 1HJAC 2XWAA 5EG4A 2CGAA 3Q77A 2HOBA 2H9TH 1UK2A 2SGPE 1V2MT 3D65E 2C8ZB 3RUOA 2GMTC 2C8YB 1C5ZB 2FEQH 2BB4A 1ELTA 2GP9B 2BDHA 4D9QA 1GHBG 3SJKA 1DY9A 4DGJA 4M7GA 3S0NA 1HAZB 1IQFA 1MTNC 2PKSB 2F9PA 2P3UB 1O2MA 1SB1H 1THRH 2TGAA 2UUFB 4FU9A 4Q7XA 1LVYA 4THNH 1D6WA 5IYTA 2A7HA 3A8BA 1UVTH 4B2BA 3A84A 1TGBA 8ESTE 4FUCA 4AYYB 1P02A 2QAAA 2EI6A 2BZ6H 4IW4E 1MQ6A 2OLGA 4DIIH 1W13U 1C5WB 1C2JA 2FOBA 2W3KA 4NZLA 1K22H 2A4GA 2ZTYA 3RC5A 3PLBA 4U32A 2WINI 1TPAE 4ISNA 2CF8H 1QA7A 2R3UA 1HLTH 2F3CE 3NKKA 3TPIZ 4K69A 2ZDKA 5FXLA 1MUEB 3E91A 3UFAA 3KGPA 2OC7A 4WMEA 2Z9LA 1TPSA 1JRTA 5HGGA 4I8KA 2O8LA 1P2IA 2CV3A 1TA6A 1O5BB 1ZRKA 1OYQA 2WYJA 1GDQA 3BIUH 1C1PA 2ZHEH 4X1QU 1F7ZA 1BTPA 1C5UA 1AO5A 1O2LA 1GHAG 3QGJA 2QGRA 1JIMA 4J1YA 1LQDB 5TJXA 4CH2B 5ABWA 4JK5A 1O2JA 1Q3XA 1MKWH 4JCNA 5T6DA 2PGQB 4AFSA 4X8UH 4BANB 2J2UA 1ESTA 5EXMA 3GYMA 1HFDA 1GMCF 2VVCA 5CHAC 1GPZA 1BRCE 2BY9X 1HIAB 1MKXH 2PSXA 3A86A 2FIRH 1BBRE 1C1NA 1GBKA 1QJ1B 2VVVA 2W7UA 3LDXH 3U1JB 1P01A 1CGHA 2ZTXA 4TYDA 4WXVA 2XBWA 4GCHF 1VITF 1W7XH 3GCTF 4ISOA 1NT1A 1OOKB 1UVSH 1RXPA 1GJ9B 1CA8B 1UVUH 1ANDA 1IQJA 3GY5A 3KCGH 3QZRA 1FY5A 1ESBA 1TGTA 3F1SB 3IWMA 1O2PA 1KTTB 2GCHG 1C4V2 2Z94A 2P3FH 1GHVH 1O3CA 3LT3A 2J4IA 2B9LA 1Y3YA 4B2CA 3T29A 1SPJA 1YP9A 1TFXA 3DT0H 1FAXA 2BYAX 1FPHH 4IS5A 4NCYA 5LPRA 3STJA 1GMDF 1YGCH 4GAWA 1YC0A 1OS8A 2VWMA 4XOJA 3URCA 1YPMH 1PPFE 1GBJA 4GHQA 1A4WH 3RU4T 4K5ZA 4KTUA 2G00A 1BBRH 2EC9H 1ELVA 1NRPH 1W14U 1CHGA 1SGNE 3RXOA 1GVZA 2BDCA 1BHXB 4NIXA 1SL3A 3EAJA 4ZROA 2XCNA 5A8ZA 5LGOA 1PQ7A 1XKBC 1FIZA 1UTOA 3L6PA 1HXFH 3SU1A 3TGKE 3OYPA 1TMUH 5I46H 2O8WA 4ESTE 5EXLA 3RC4A 1PYTC 2ZI2H 2XC0A 1BUIA 4I7YH 5TCCA 3GDUA 4MNVA 1HXEH 2ZF0H 2BMGB 4R0IA 3LH1A 3VPKA 1Q2WA 2A2XH 4CBOA 2TIOA 5AVDA 2BDBA 4NSYA 1KYNA 1PPCE 3UUZA 1T4UH 1HUTH 5CMXH 4R8TB 1Y8TA 3SV7A 4JZ1A 1RTLA 3AAVA 2BD2A 1BMLA 4H42U 1YCPH 4XFQA 2ALPA 3SV2H 2FXRA 1DDJA 1VITH 3PMAB 5F6MA 1A0JA 3SU6A 4DG4A 1EB2A 1ZMLA 2FOFA 1TGNA 4UEHH 4O03A 1A0HB 3MWIU 1O3LA 2ZGXH 4X1PU 1GJ5H 4WH8A 3MO3A 1P2QA 3M3VA 3E0PB 3ATMA 4WF8A 1YPJH 1AWHB 1WSSH 4MPXA 2OUAA 3A8CA 2WPJS 1Y5AT 5JYIA 1KLIH 3VB3A 2BLVA 3VB7A 2QA9E 4JK6A 4Y71A 4NA8A 1P2OA 3BTKE 1GWAA 3RDZA 3V3MA 1P05A 2OD3B 2HALA 1C5MD 1GJ8B 1GJDB 4B74A 3T27A 3P6ZB 3BTGE 1PQ8A 2XBXA 2F9OA 1DS2E 4K2YA 1FNIA 4NA9H 2ZC9H 3BG4C 5ETXA 3RXBA 1NROH 1GHYH 1TX6A 3UNRA 1GJAB 1XMNB 4A7IB 2PV9B 3TJVA 3SJIA 2V3OH 1V2LT 1UK4A 1CGIE 1J14A 2AEIH 8GCHF 1LVBA 3AW0A 5IDKA 2BOKA 2FOHA 1GMCG 3UREA 2BD5A 1TNLA 3IG6B 2TGPZ 3ENSB 3MHWU 2XC5A 2A31A 4ABBA 4IC5A 3MH7A 2V35A 1S81A 1ZGVA 2GTBA 2KAIA 1FN6A 3BN9A 1T8NA 5E0HA 1QB1A 1TWXB 3BEIB 1QBNA 1CO7E 1ZYOA 1S0RA 1UCYK 5LPEA 2SGAA 1OYTH 1WCZA 1O3HA 1FONA 2R3YA 1U6QA 4Y6DA 1NS3A 3TH4H 2ANMH 1D9IA 3UIRA 2XWBI 3GYLB 1F0TA 5JB9S 2VIVA 3MU8A 1O5EH 3M61U 3Q3KA 2PKSC 2QF0A 1DSTA 4UFDH 5DK1A 2GMTB 2NU0E 1EPTA 2Y82A 5JBCS 3RXAA 3L3TA 3GDVA 3DFLA 2ANKH 4OS6A 1AFEH 1FI8A 1AVWA 1F2SE 1MTNB 3ZVFA 1HBTH 1MCVA 1PPGE 2FI4E 2Z3CA 2THFB 4NFFA 3EGKH 4K1SA 2F9BH 4K8YA 1GBHA 5DKMA 4GUXA 2HNTE 1LPKB 4DY7B 1THPB 2H2ZA 3S9AA 1W12U 1TMTH 1EJAA 2EA3A 3UR6A 4H6SB 3SI3H 3KQBA 4WVPE 2HGTH 2XBYA 2I6QA 5J4SA 3TH3H 4XBCA 1Y59T 1EAWA 2BQWB 4ABAA 4JZEH 3A81A 3AAUA 4AN7A 2FM2A 3SNAA 1SLUB 4A92A 1L0ZA 1GJ7B 1DX5M 1FY8E 3MU5A 4NWKA 3M5NA 4U2WA 4UFGH 2SGQE 1O2XA 1F5KU 2J34A 1AMHA 1YPGH 3LC3A 4KTCA 1P9UA 4X2XA 1S82A 2ZFPH 4X8TH 2V0BA 4RKJB 5F03A 1N6YA 4Y8XA 1NN6A 1O3AA 1EZXC 1OWDA 3V7TA 5EPNA 2PFEA 1CBWB 2BD9A 3TJNA 1Y3XA 4DIHH 4NSVA 3V0XA 1SGIB 5T6GA 3RLWH 1QL8A 4B71A 5L30H 1BT7A 1F0SA 3HKJB 1O5CB 3ATIA 2D2DA 4HTCH 1DE7H 1HYLA 5DP6A 1OP2A 1C2GA 3FVFB 5EODA 5FHTA 1CA0B 1SGDE 4ZXYH 1M9UA 2AERH 3KNXA 4AG1A 5DPAA 1H9LB 1V2OT 3MO9A 2QY0B 1BRUP 1JBUH 4YTAA 2NWNA 1GBLA 1PPHE 1SGFA 2GV7A 1SGCA 2PWXA 3P70B 4IN2A 5C67A 3GDSA 1QGFA 1D6RA 1VCPA 1O2GH 2BD3A 2NU1E 2UWOA 1QBOA 1HB0B 5C5NA 4UFFH 2P95A 1TGSZ 3FANA 3H7OA 3SHCH 1Y3WA 5F8ZA 2Y80A 3GCOA 3FP6E 4AYVB 4E06H 1SQAA 1QBVH 3ODFA 1ZTLA 1E35B 2NU4E 1LHGH 3E90B 8GCHG 1O5AB 1YPLH 4BAMB 1NU7B 2ZIQH 3P8FA 3S7KB 3PB1E 5A2MH 1BZXE 1V3XA 1WU1A 2A4RA 4LZ4B 3UNSA 4RN6A 2O8MA 2G4UA 5JBAS 1TGCA 3ZZCA 1TBQH 3AVZA 1Z6EA 1YKTA 2BX3A 2R9PA 1XUGA 1SGPE 3P8OA 4FUBA 2H9HA 1MQ5A 1TQ7B 1LQEA 1ZPBA 4X2WA 1C5OH 3FFGA 3HATH 2UUYA 2ZU1A 4FUHA 3I77A 1XUIA 1OPHB 1HAGE 1TNJA 1FQ3A 3SUGA 1PJPA 1ELCA 3BTTE 1NRQH 1ZMJA 2ZDMA 3ZZ8A 1SQOA 4A1XA 1G37A 1GI2A 2B0FA 2QN5T 2F9NA 1J15A 3MU0A 2NU3E 5LH8A 4JYTA 3QO6A 1GG6C 2HVXA 4X8VH 3TJUA 1NRRH 3DFJA 1DVAH 2OCVB 3F6UH 3I78A 3HK6B 1O30A 1OWKA 3MU1A 5DP7A 1P12E 1FJSA 5GCHF 4NZQA 3TH2H 4XBBA 1N1LA 2R0LA 4YESB 1DY8A 1TYNA 3M7TA 1DANH 1ZSJA 2PTNA 3UWIA 1A3EH 1G3CA 5GXPA 2VH0A 2Y7ZA 4B75A 1XX9A 2BM2A 2BD4A 3M3SA 3U8RH 1V2KT 1AZ8A 3VGCB 5FAHA 4BOHA 1Y5UT 1HRTH 4AZ2B 8LPRA 3O8CA 3PWCA 1J9CH 2BLQA 3SUDA 1AUTC 1AVGH 3RXDA 2G51A 2Q1JA 2F91A 4WMFA 3SU0A 1IQIA 2VIPA 2BQ6B 1OWEA 1TX8A 4CRCA 1QA0A 1KIGH 4K3JA 2SGEE 3ZZBA 1LHEH 2SNVA 1FIWA 2FWWA 5C2ZA 1O2UA 9ESTA 1QNJA 2ZTZA 3RLYH 2ZGBH 1PFXC 2UUKB 3TVJB 3TLOA 1KXEA 1BMAA 1HDTH 1ETSH 1MKWK 1LMWB 1HAVB 5LPFA 1O3EA 1BJVA 1T4VH 4IN1A 2R2MB 1GBEA 2BY8X 2A32A 4K60A 1ZJDA 3QWCH 1F0RA 4ZMAH 3NPSA 4MDSA 1Z71A 2J95A 2WPHS 1WOFA 1C5RA 5A09A 1MKXK 1MAXA 4RKOB 1LVMA 3M5OA 3A8DA 1Z1JA 5EU8A 1SGEE 2AFQB 1MTSA 2XXLA 4NGAH 1PPZA 1GJ4H 5EXNA 1WAYB 2Y6TA 2FI5E 1A7SA 3E6PH 5E2OA 6CHAC 4A1VA 1TRYA 4O97A 1FXYA 1DM4B 1GVKB 2ZQ1A 3UTUH 5G4BA 2Y81A 2VWNA 3D49H 1QHRB 3QDZB 1QJ7B 1L2EA 1P8VC 2H1UA 4MG3A 3P8GA 2QCYA 1UTNA 4X6NA 2OC8A 2ZHDA 1XVMA 2GGVB 4HI3A 3MNSA 4AFZA 5HYOA 1C5PA 1A61H 2JKHA 4XE4A 2FTLE 2ZDVH 4YLQH 4LOYH 1KLTA 2JH0D 1EUFA 2ZO3H 1GJ6A 5A0CA 3F9FA 1J16A 4ZHAA 3BEFB 2RA0A 1O3PB 3RXEA 2ZFRH 2FS8A 2F9UA 1HGTH 1TPOA 3F68H 2UWLA 3TJOA 2R0KA 1ELBA 1PPBH 1V2WT 1IOEA 1Z8RA 2ZGJA 3NZIA 1Y5BT 1D4PB 1TNKA 4NIWA 1AQ7A 1HIAA 1ZGIA 3SHAH 2RCEA 1KSNA 1CBWC 2BDIA 2AMPA 4FU7A 5HM2A 1TBRH 2VIDA 2ZFQH 2ZNKH 3RXTA 5K0HA 2ZGCA 4KTSA 1IQGA 3QUMP 1XUHA 2HRVA 3SJOA 1UTQA 2R2WU 3KF2A 2AH4X 1ANCA 1CA0C 1EATA 1SC8U 1EAXA 4I8HA 1T8LA 2CMYA 3PO1C 1O2NA 3LGUA 1GDNA 1YLCA 5A0AE 1B7XB 3BG8A 3GY8A 1YCPK 4WJG2 3PMJA 2LPRA 4ABEA 1LCYA 5C3NA 3OY5U 4CRFA 4DJZB 4FXGH 1EP5A 1L1GA 4GPGA 2FYQA 1AWFH 1C2EA 3LGIA 1H8DH 1TA2A 1O2SA 3LC5A 1RS0A 1SGTA 2TBSA 4WY3A 1TRMA 3SQEE 2CJIA 4MPWA 3URDA 1HV7A 5GDSH 1HAIH 3ZV8A 1GDUA 4KP0A 3TNTA 2ODPA 1ZHRA 3LOXA 4TWYA 1C5YB 5B6OA 1K1NA 3SOSA 4DCDA 3PTNA 2C3SA 4E7RG 4I8GA 4XDEA 1SGFG 4BNRA 3TU7H 3A7XA 5GWZA 4IMZA 1C1OA 4ZHMU 4BTTB 1TONA 4ZAEA 2YNBA 2PLXA 1NTPA 3LIWA 3GY6A 3SU5A 2XRCA 1YLDA 2ZU3A 2Y5FA 1CHOG 1OP0A 1KDQA 1ZZZA 1GBIA 1TABE 5FCRA 1LTOA 2GDDA 1ACBE 3SU2A 1EZUC 1GBFA 1G3EA 1QIXB 3EE0B 2PTCE 3MH6A 4Z6AH 3TNSA 1GGDB 3ZZ3A 4Y10E 2BVXH 1ELGA 5C1XA 1GI8B 3MO6A 4AB8A 1KTSB 1WBGB 1OWJA 2FX6A 3SW2B 2ZU2A 3A83A 2BY6X 4J2YB 2OTVA 3EA8A 2ZQ2A 2A45B 5EGMA 1ZR0A 1C5TA 1JRSA 4OS1A 2ESTE 2OBQA 1O2IA 1AI8H 1SSXA 2ZG0H 1W3CA 2G52A 1CGJE 2Y7XA 2W3IA 3BTWE 3SNBA 3H5CB 4JYUH 1VZQH 2DE9A 3ZVGA 1HAXB 7ESTE 1N8OB 5GJ4B 4U30A 2G8TA 4BAKB 3PMHB 1KXBA 1L1NA 3O8BA 2XYAA 5C5OA 1LKBA 1H9IE 1XUFA 4BXSA 1GG6B 1G3BA 4XBDA 4DVAU 2P94A 5DP8A 3T26A 2BD8A 1AE5A 1GCTC 2SNWA 1VGCC 3HKIB 3T2NA 2HPPH 2UWPA 2TPIZ 3MNCA 4NWLA 2VWOA 1SOTA 1TOCB 2WV4A 3VFEA 1IAUA 5C20A 2DUCA 3VGCC 3GCNA 1SFQB 3RP2A 4D7FA 2SGDE 1AN1E 3QTVH 1T8OA 1HJ8A 2ZPSA 4FVBA 1QB6A 3B9FH 3BIVH 2AMQA 2H6MA 4OS4A 3SUEA 3DD2H 2B7DH 4BTIB 4Y7BA 1HAOH 5T3HA 2VNTA 3KIDU 3U8TH 4FUEA 1BTXA 1Z1IA 1LPGB 3NK8A 1S5SA 3RXFA 3CENA 2OC1A 4ABGA 4U01A 1AD8H 2BLWA 1K2I1 2Z6BD 1QR3E 4YM9A 3MH4A 3ITIA 3RU4D 3C27B 2ANWA 2QF3A 1QTFA 1SFIA 2ZFTA 3L33A 3HK3B 1MU6B 5JPMH 4BAQB 2HNTF 4X2VA 4X6MA 1D3TB 1JWTA 1AU8A 2XC4A 4B1TA 1C2KA 1O2HA 3EA7A 3MOCA 1OXGA 4GCHG 1VITG 3GCTG 3UQVA 1O3DA 2D26C 1CSOE 2GZ9A 1QRXA 3TK5A 2J92A 1BRBE 1HNEE 3MFJA 1O2OA 2A4OA 4IGDA 3CS7A 2OC0A 4CRGA 1GL1A 1ETRH 2W5EA 4SGBE 1MH0A 2F83A 1E0FD 3SGQE 4Y76A 1TAWA 1XM1A 1GMDG 6CHAB 2ANYA 1WYKA 1P11E 4NA7A 4INKA 4SGAE 4K1EA 3SV9A 2A5AA 2PW8H 2OXSA 1DWEH 5BPEA 1WTHD 1DLKB 2STAE 3A80A 4JMYA 3ZZ4A 5FX5A 1A5IA 1V2VT 1HAPH 2KAIB 2A5IA 3VXEH 1GVLA 1EJMA 2ZCKP 1G32B 3BTDE 5GIBA 2ZKSA 1MTWA 1C5XB 2QXGA 3RM2H 5C1UA 7LPRA 2VH6A 2AMDA 1F5RA 1H9HE 1L4ZA 1NESE 2GZ7A 1SBWA 1V2RT 1O2TA 4UD9H 2IPHA 4KGAA 4YOIA 4AGJA 3PROA 4A6LA 1EJNA 3W94A 1MU8B 2BHGA 3ZVCA 2I6SA 1BCUH 1EPTB 1BA8B 2WV5A 4TPYA 2VINA 1K1JA 3VB6A 4UONA 2FI3E 3K6ZA 3F9EA 1UCYE 1MZAA 1P9SA 5HMAA 1EAIA 1AGJA 2Q6GA 3MYWA 1NPMA 1O35A 1WV7H 2WPIS 1E38B 3NXPA 1ZRBA 2BY7X 2YOLA 7KMEH 3GCHC 1TIOA 1ZTJA 1PYTD 3ESTA 3ZVEA 4VGCB 1F0UA 1BQYA 2PSYA 1TQ0B 4ABDA 1O34A 3A7VA 1VJAU 2G55A 2ZDAH 5DP5A 3QK1A 1EZQA 5SGAE 2IJOB 3RXUA 2OINA 1Y3VA 2STBE 1MD8A 3RXSA 1JMOH 5EQQA 3PO1B 2ZPQA 4KKDA 1NRSH 1O3JA 5FCKA 1VR1H 2RA3A 1DSUA 1INCA 1YPKH 3ODDA 1K9OE 4X0WU 1C1SA 3BTHE 1EP6A 5DG6A 2JETB 3KHVA 2D1JA 1GI7B 2PR3A 1C2IA 1ANEA 1FLEE 4E7NA 4B76A 1N6XA 2JH6D 3QX5H 1OWIA 1EQ9A 1VCWA 1LVOA 1TNGA 4GHTA 4GVUA 4Y79A 1H4WA 1ID5H 1GBTA 3BTQE 3MNBA 3TITA 1EXFA 1GI4A 1A0LA 1NC6A 1Z7KA 2ZCLP 3PLKA 2WUBA 2JH5D 3P17H 1O2KA 1XUJA 1E37B 4MLFB 5E2PA 4I31A 2AGEX 1UTLM 1GHBF 4YOGA 1IQLA 1FN8A 2FO9A 3MU4A 3DHKH 1ZHMA 1DWBH 1NO9H 1TRNA 2QXIA 5JDUB 1HCGA 1EASA 1X7AC 3UPEA 1NFWA 3P95A 1QRZA 1K1PA 4ZH8A 5T6FA 2BXTH 3BV9B 1EZSC 4X6OA 1BRAA 3PTBA 1GGDC 1AKSA 1AZZA 4DT7B 4AOQA 1ARBA 1C4Y2 4UFEH 1ZMNA 5F8TA 5JB8S 1S6FA 1YBWA 4Y8ZA 1O2ZA 2UUJB 1O36A 3QN7A 2OQUA 4YT7H 1DOJA 1V2ST 4ABJA 4DW2U 4QT8C 1G2LA 2A7JA 2BDGA 3SZNA 1Z8JB 1N8OC 1C2LA 4AFUA 1BTUA 1O5DH 4DOQA 5A0BA 3SBKA 3LU9B 1O3GA 1UHBA 1S0QA 1LDTT 4BAHB 1UJ1A 2BVRH 1P2NA 4BAOB 4LZ1H 3VEQB 1THSH 3EYDA 4YO9A 3RXJA 1GHAF 1BTWA 1O33A 3RMMH 2H5DA 1RTFB 1NY22 1GHZA 3DUXH 2BVSH 2ILNA 6GCHF 4E05H 3Q3YA 3ZZ5A 2VWLA 1HPGA 4Y0ZE 1GCTB 1VGCB 1IQNA 1CT4E 4Y11E 1T32A 2A7CA 1IQKA 4ZUHA 2Z9GA 3Q76A 3A7ZA 2P16A 3A89A 3EQ0H 1ZHPA 3BF6H 5CE1A 6ESTA 2EI7A 1C5LH 4NIYA 1MTUA 5JBTA 2TRMA 2QC2A 4CRAA 1TMBH 8KME2 1HAVA 1P0SH 1SI5H 5TCAA 3QGNB 1O5GH 5K7RA 1P10A 1SR5C 1YCPM 3RXPA 2GCHF 5J4QA 1LHFH 3LH3A 3ZZ7A 4MQAA 5E0JA 1UTJA 1GBBA 1OP8A 1AY6H 3G01A 3SGAE 4GLYA 2QIQA 4NFEA 1YYY1 1C4U2 4OS5A 1ANBA 1LHCH 2HPQH 3SJ8A 1IHTH 4LK4A 2FOCA 3V13A 2GVFA 4MVNA 3T28A 3QLPH 4KELA 1A1RA 1P2MA 3JZ2B 3R3GB 1UTPA 1RGQA 3H7TA 4CREA 2PKAB 2BLOA 2J94A 3JZ1B 1DXPA 4ISHH 2O9QA 1W10U 2VIWA 2QV1A 5I25A 1Z8IB 1NZQH 7GCHF 4FU8A 3W95A 1CQQA 4ZKOU 1QURH 1O3KA 1RIWB 4YLUA 3U1IB 1GHWH 1GI5A 4JZDH 3UR9A 2XTTB 5DP4A 2FYRA 2ODYB 2VIOA 2K1QA 3UY9A 2PGBB 1CT0E 3SI4H 1G2MA 1AB9B 2ZPRA 2ALVA 5F8XA 5E8EH 2PHBA 1O3MA 1XKAC 1Z6JH 3F9GA 4X6PA 2OQ5A 5A8YA 1QQ4A 2GKVE 1A2CH 2V3HH 4YOJA 1SQTA 2ZGHA 3OTJE 1BBRK 2Z3DA 2O8UA 2ZA5A 5DJ7A 1BTHH 1ZSKA 3SU3A 2XW9A 1AFQC 4BTUB 2VGCB 2GT8A 2G5VA 2VB0A 3RXQA 1ESAA 3M37A 3RXCA 1H8IH 1LPZB 1C1TA 2Y5GA 1B0FA 1EPTC 3SQHE 2C4FH 3RMOH 1O2VA 3GISB 2RDLA 2TGDA 2ZZUH 2HWLB 3S7HB 1GBDA 3B8JA 1YM0A 3A7YA 1UMAH 1C9PA 3K65B 4CBNA 1FV9A 1C1QA 2V6NA 1DFPA 3QZQA 4VGCC 1L4DA 1C2DA 3RXVA 1YPHC 3BEUA 3M7UA 1C1VH 1TX7A 1UVOA 1AHTH 1K1MA 2VIQA 2FX4A 5PTPA 1D3PB 1A5GH 4MTBA 1TOMH 1O2YA 3A82A 4A1TA 1LKAA 3GCHB 1RD3B 1QJ6B 2FLBH 3ZVAA 3OSYA 1FY4A 1MMJN 1DUEA 1S6HA 4HFPB 4UE7H 5GCHG 2J9NA 1V2PT 4AORA 6GCHG 2F9VA 1DXWA 1PQAA 3TIUA 1G9IE 1OKXA 1P03A 4FUDA 1B5GH 1LO6A 1EKBB 3LGTA 2Z9JA 3OX7U 5DP3A 1V2UT 2JETC 1O31A 1EOLA 3RXGA 4ABHA 2Z3EA 4TWWA 3SN8A 4PROA 1PQ5A 3M7QA 4NG9H 3LGWA 3TK6A 1O2RA 3T25A 4F4OC 1MZDA 1O38A 3BTEE 2VVUA 1DICA 3U69H 3ATLA 2C93B 3ZZAA 2FOAA 3UWJH 2ZHWH 1ELEE 1Y3UA 2M5TA 1KLJH 1SLXB 2EEKA 3EDXB 4I8JA 1T8MA 1SGYE 1WTGH 3MH5A 5H4IB 2W26A 2A2QH 2GV6A 4Y8YA 5EPYA 3NWUA 3A8AA 1P2JA 1ORFA 3AW1A 4F49A 3GY7A 2ZDNA 4NIVA 3U98H 4XSKU 4RSPA 5C1YA 4JZFH 1FDPA 3A85A 3F9HA 2BZAA 3GY3A 3ZZ6A 2FS9A 2P8OC 1SOZA 3SNDA 4JYVH 4UDWH 1VJ9U 1K1OA 4CR9A 1LHDH 3GICB 1DLEA 1MTVA 2QXJA 1XVOA 1DPOA 1MCTA 3HGPA 1CT2E 3MI4A 3UOUA 2C8WB 3A87A 5HXFA 4D9RA 1MAYA 5DO4H 1D3QB 1XXFA 4TY7A 3B23B 4I33A 1SGRE 3BTFE 4CHAB 4MNYA 1EX3A 4H4FA 3KQCA 3VB4A 1IQHA 2FESH 1KXDA 2DE8A 4CRDA 1W2KH 4OS7A 4X1SU 1FMGA 3M5MA 3VB5A 1ZTKA 4AGKA 1SLVB 1Z8GA 2CF9H 4ISLA 2W7SA 4WXIA 7GCHG 1A3BH 1AVXA 2GCTB 3RM0H 2ODQA 4HZHA 1O39A 4Y0YE 2ZP0H 1QY6A 3D23A 2FDAA 4IC6A 5AF9H 4ASHA 3ZYEA 1J8AA 4IMQA 2CHAB 3OU0A 4X2YA 1ABIH 2ZU4A 4Q2KA 1D3DB 1FAKH 1L1JA 4O3UA 4YZUA 1C5NH 3M3TA 3CP7A 1ARCA 2J38A 4OS2A 1QB9A 1KDQB 5EW1H 2Z9IA 2D8WA 1IHSH 4ZKNU 1P2KA 3HPTB 3FP8E 4FVDA 2GT7A 1T7CA 1EOJA 4ISIH 3RC6A 1AUJA 1MBQA 2AGIX 4DURA 1O32A 4H6TA 1BOQA 2AYWA 5ESBA 1H1BA 3S69A 3OY6U 1TBZH 4TPIZ 1NU9A 3BSQA 2BXUH 4HGCA 3U9AH 1ELAA 1C1MA 5L6NH 1QL9A 1GMHF 4A5TS 4ZKSU 1WQVH 3PV4A 5HM9A 1ZOMA 1O37A 4WWYA 1YF4A 2XNIA 1UTKA 2BX4A 2FTMA 3PMBB 2BTCE 1NFYA 4O9VA 4AB9A 3LJOA 4Z0KA 5FX6A 1W11U 1O3BA 1SHYA 2PUXB 4OGYA 4WMDA 3EA9A 1BHXF 3RMNH 1C2MA 1IQMA 5JBBS 3NUMA 4CR5A 1YPEH 1JIRA 3FAOA 1P04A 1TALA 2A1DB 4INLA 5AHGH 3S9BA 1K1LA 2A0QB 3ZV9A 1P06A 2C90B 2B5TB 3E8LA 4MPVA 1TE0A 3PLPA 4FUGA 1OWHA 1J17T 3RXKA 1S84A 5DGJA 1E36B 2PUQH 2ZFFH 3LGYA 1HAYB 4X1RU 1RIWC 2ZHQH 3T5FH 4JZIA 9LPRA 1ZLRA 2IOTA 1GJBB 2Z7FE 1ELFA 1V2JT 2P93A 2FZZA 2FODA 1W7GH 1TB6H 3LONA 1BB0B 2ULLA 1PPEE 3ZZDA 1RJXB 3SO3A 1AB9C 1DUAA 1V2TT 1GBMA 1JXPA 4TY6A 2AIQA 1HJAB 3P8NA 1V2QT 4X1NU 3A7TA 3FZDA 3N7OA 1KXFA 4ZHLU 3ELAH 4FUIA 4MNWA 4D76A 1T31A 2VGCC 2O8TA 2OP9A 1P57B 3VXFH 6LPRA 2FOMB 1QFKH 2G5NA 5EQSA 1O3IA 1XXDA 3KQEA 1UTMA 3GY2A 4IBLH 3Q00A 1O3NA 3SNCA 1KXCA 1AIXH 1AFQB 1C1UH 2XCFA 3RXRA 2CXVA 1MD7A 1BITA 1BTZA 2A5KA 3O8RA 2EI8A 4B2AA 1SVPA 1XUKA 1OSSA 3UQOA 5DP9A 3SJ9A 1W0YH 2LNCA 2CN0H 1B0EA 3IITA 3O8DA 3UOPA 5A8XA 1SHHB 3KQDA 2A4QA 3QTOH 2ZDLA 3S9CA 2RG3A 1S83A 1OX1A 1GJCB 5FPSA 3K2UA 1UK3A 3SV6A 1FUJA 1C5SA 2FPZA 3SNEA 1DWCH 1BMMH 2VU8E 1EB1H 1O5FH 2BD7A 5L2ZH 2GX4A 2WPKS 1O2QA 1CVWH 5EOKA 2QYIA 1C5QA 5FPYA 1SLWB 2BQ7B 3I29A 1RTKA 4O3TA 1P09A 1QCPA
chains in the Genus database with same CATH superfamily
3TGIE 1ZPCA 1VCQA 1UVPA 3RMLH 3RXLA 1V6DA 4OGXA 2ZECA 2ZWLH 4D7GA 2Z9KA 3NCLA 1UCYH 1RFNA 2FOGA 1GHXH 3MMGA 1FY1A 5CHAB 3MNXA 2NU2E 1F5LA 4MPUA 3U8OH 1GI1A 1C1RA 3R0FA 4MNXA 1GI9B 3M36A 2WUCA 3Q3XA 2YNAA 4FUJA 4Q7ZA 1C1WH 1GMHG 3SZEA 4I8LA 2HLCA 4WH6A 2Y5HA 2Q6FA 2AGGX 1S85A 3N7EA 1JOUB 1W8BH 4FUFA 3RXHA 3KEEA 4INHA 5ESTE 3LJJA 4D8NA 3TGJE 5AFYH 1C2HA 2VJ1A 2XBVA 2FMJA 3E1XB 5FBIA 1Q31A 3LKWA 1DITH 1K21H 1V2NT 2KM0A 3HGNA 3M35A 1ZPZA 4I32A 1G36A 3SV8A 1KY9A 1GI6A 1OHHD 4CRBA 2P8OB 1W0ZU 2GDEH 3E16B 3DA9B 1FY3A 1RRKA 3SUFA 4CHAC 3BTME 2IN2A 5GPIB 1ETTH 3FZZA 3VG8A 1GCDA 3KYGA 2SGFE 4ZXXH 1K1IA 5L2YH 2HNTC 2WPLS 2GCTC 2C8XB 4BXWA 1O0DH 3A88A 1NFUA 3D62A 5GNDA 2RFKC 2ZEBA 2G4TA 4Q7YA 1SGQE 3TK9A 1HAHH 1E34B 2CHAC 1P3EA 3PYHA 2AIPA 5EW2H 1DT2A 4YT6H 3ZVDA 3MTYA 1FPCH 5FPTA 1BIOA 4ZKRU 1SMFE 2QF4A 3E3TA 3LGVA 3ZVBA 1C9TA 1ELDE 2FOEA 3GOVB 2BY5X 1UO6A 4AFQA 4X8SH 3ATWA 5AFZH 5BRRE 4Q80A 3ZYDA 1BTYA 1GI3A 1CU1A 1AKSB 4Y7AA 4ABIA 3LPRA 2ZU5A 3V12A 3K6YA 1BJUA 3ATKA 3SU4A 4AX9H 1TNHA 3KL6A 1GL0E 1TNIA 4B73A 2G81E 3DCLA 2BOHB 2ZFSA 5FBEA 1WQSA 3OEED 1EAUA 1GBAA 3M5LA 3FP7E 2EQNA 3AASA 4LXBH 1QL7A 1HJ9A 3GY4A 1C5VA 2GZ8A 1QRWA 1UHBB 1A46H 1ZSLA 2H5CA 2P59A 1KXAA 1O2WA 4CH8B 1WUNH 1AE8H 1NFXA 3C1KA 3RU4E 1GI0A 4GSOA 3A7WA 3T62A 2P3TB 1O3OA 3SGBE 1A5HA 1SG8B 1TLDA 1TPPA 1YPHE 2FP7B 1IQEA 1CE5A 3KN2A 3P92A 2PKAA 4K1TA 3RXIA 3CS0A 2WPMS 2TGTA 2ZHFH 5EQRA 2OBOA 2OK5A 2AS9A 3STIA 3ZZ9A 1ABJH 1NRNH 2H9EH 2FLRH 1MABB 1P3CA 1FZZA 3RXMA 2QXHA 2ZCHP 3PM3A 3BG4B 2F4LA 2Q6DA 2SFAA 4K8BA 1GBCA 1F92A 3WY8A 4AG2A 2GD4B 1MBMA 1K28D 3FKSD 1ZJKA 1BMNH 3K9XB 3PWBA 1CHOF 4ABFA 2ASUB 2BDYA 3SORA 3E0NB 2WYGA 5E0GA 1G30B 1O3FA 1BDAA 1G3DA 2B8OH 1C2FA 1DWDH 3UNQA 1QQUA 1NM6A 2BDAA 1HJAC 2XWAA 5EG4A 2CGAA 3Q77A 2HOBA 2H9TH 1UK2A 2SGPE 1V2MT 3D65E 2C8ZB 3RUOA 2GMTC 2C8YB 1C5ZB 2FEQH 2BB4A 1ELTA 2GP9B 2BDHA 4D9QA 1GHBG 3SJKA 1DY9A 4DGJA 4M7GA 3S0NA 1HAZB 1IQFA 1MTNC 2PKSB 2F9PA 2P3UB 1O2MA 1SB1H 1THRH 2TGAA 2UUFB 4FU9A 4Q7XA 1LVYA 4THNH 1D6WA 5IYTA 2A7HA 3A8BA 1UVTH 4RT0A 4B2BA 3A84A 1TGBA 8ESTE 4FUCA 4AYYB 3EE7A 1P02A 2QAAA 2EI6A 2BZ6H 4IW4E 1MQ6A 2OLGA 4DIIH 1W13U 1C5WB 1C2JA 2FOBA 2W3KA 2KX4A 4NZLA 4DT4A 1K22H 2A4GA 2ZTYA 3RC5A 3PLBA 4U32A 2WINI 1TPAE 4ISNA 2CF8H 1QA7A 2R3UA 1HLTH 2F3CE 3NKKA 3TPIZ 4K69A 2ZDKA 5FXLA 1MUEB 3E91A 3UFAA 3KGPA 2OC7A 4WMEA 2Z9LA 1TPSA 1JRTA 5HGGA 4I8KA 2O8LA 1P2IA 2CV3A 1TA6A 1H8HD 1O5BB 1ZRKA 1OYQA 2WYJA 1GDQA 3BIUH 1C1PA 2ZHEH 4X1QU 1F7ZA 1BTPA 1C5UA 1AO5A 1O2LA 1GHAG 3QGJA 2QGRA 1JIMA 4J1YA 1LQDB 5TJXA 4CH2B 5ABWA 4JK5A 1O2JA 1Q3XA 1MKWH 4JCNA 5T6DA 2PGQB 4AFSA 4X8UH 4BANB 2J2UA 1ESTA 5EXMA 3GYMA 1HFDA 1GMCF 2VVCA 5CHAC 1GPZA 1BRCE 2YMSD 2BY9X 1HIAB 1MKXH 2PSXA 3A86A 2FIRH 1BBRE 1C1NA 1GBKA 1QJ1B 2VVVA 2W7UA 3LDXH 3U1JB 1P01A 1CGHA 2ZTXA 4TYDA 4WXVA 5EJLA 2XBWA 4GCHF 1VITF 1W7XH 3GCTF 4ISOA 1NT1A 1OOKB 1UVSH 1RXPA 3PV2A 1GJ9B 1CA8B 1UVUH 1ANDA 1IQJA 3GY5A 3KCGH 3QZRA 1FY5A 1ESBA 1TGTA 3F1SB 3IWMA 1O2PA 1KTTB 2GCHG 1C4V2 2Z94A 2P3FH 1GHVH 1O3CA 3LT3A 2J4IA 2B9LA 1Y3YA 3MQKC 4B2CA 3T29A 1SPJA 1YP9A 1TFXA 3DT0H 1FAXA 2BYAX 1FPHH 4IS5A 4NCYA 5LPRA 2J97A 2QF5A 3STJA 1GMDF 1YGCH 4GAWA 1YC0A 1OS8A 2VWMA 4XOJA 3URCA 1YPMH 1PPFE 1GBJA 4GHQA 1A4WH 3RU4T 4K5ZA 4KTUA 2G00A 1BBRH 2EC9H 2CK3D 1ELVA 1NRPH 1W14U 1CHGA 1SGNE 3RXOA 1GVZA 2BDCA 1BHXB 4NIXA 1SL3A 3EAJA 4ZROA 5C94A 3UAIC 2XCNA 5A8ZA 2XNDD 5LGOA 1PQ7A 1XKBC 1FIZA 1UTOA 3L6PA 1HXFH 3SU1A 3TGKE 3OYPA 1TMUH 5I46H 2O8WA 4ESTE 5EXLA 3RC4A 1PYTC 2ZI2H 2XC0A 1BUIA 4I7YH 5TCCA 3GDUA 4MNVA 1HXEH 2ZF0H 2BMGB 4R0IA 3LH1A 3VPKA 1Q2WA 2A2XH 4CBOA 2TIOA 1YWUA 5AVDA 2BDBA 3F2FA 4NSYA 1KYNA 1PPCE 3UUZA 1T4UH 1HUTH 5CMXH 4R8TB 1Y8TA 3SV7A 4JZ1A 1RTLA 3AAVA 2BD2A 1BMLA 4H42U 1YCPH 4XFQA 2ALPA 3SV2H 2FXRA 1DDJA 1VITH 3PMAB 5F6MA 1A0JA 3SU6A 4DG4A 1EB2A 1ZMLA 2FOFA 1TGNA 4UEHH 4O03A 1A0HB 3OTPA 3MWIU 1O3LA 2ZGXH 4X1PU 1GJ5H 4WH8A 3MO3A 1P2QA 3M3VA 3E0PB 3ATMA 3F2GA 5T1VA 4WF8A 1YPJH 1AWHB 1WSSH 4MPXA 2OUAA 3A8CA 2WPJS 1Y5AT 5KGOA 5JYIA 1KLIH 3VB3A 2BLVA 3VB7A 2QA9E 4JK6A 4Y71A 4NA8A 1P2OA 3BTKE 1GWAA 3RDZA 3V3MA 1P05A 1WDIA 2OD3B 2HALA 1C5MD 1GJ8B 1GJDB 4B74A 3T27A 3P6ZB 3BTGE 1PQ8A 2XBXA 2F9OA 1DS2E 4K2YA 1FNIA 4NA9H 2ZC9H 3BG4C 5ETXA 3RXBA 1NROH 1GHYH 1TX6A 3FOAA 4OM9A 3UNRA 1GJAB 1XMNB 4A7IB 2PV9B 3TJVA 4AC9A 4ASUD 3SJIA 2V3OH 1V2LT 1UK4A 1CGIE 1J14A 2AEIH 8GCHF 1LVBA 3AW0A 5IDKA 2BOKA 2FOHA 1GMCG 3UREA 2BD5A 1TNLA 3IG6B 2TGPZ 3ENSB 3MHWU 2XC5A 2A31A 4ABBA 2KCOA 4IC5A 3MH7A 2V35A 1S81A 1ZGVA 2GTBA 2HVYB 2KAIA 1FN6A 1S6LA 3BN9A 1T8NA 4M9FA 5E0HA 1QB1A 1TWXB 3BEIB 1QBNA 1CO7E 1ZYOA 5EIYA 1S0RA 1UCYK 5LPEA 2SGAA 1OYTH 1W0KD 1WCZA 1O3HA 1FONA 2R3YA 1U6QA 4Y6DA 1NS3A 3TH4H 2ANMH 1D9IA 3UIRA 2XWBI 3GYLB 1F0TA 5JB9S 2VIVA 3MU8A 1O5EH 3M61U 3Q3KA 2PKSC 2QF0A 1DSTA 4UFDH 5DK1A 2GMTB 2NU0E 1EPTA 2WPDD 2Y82A 5JBCS 3RXAA 3L3TA 3GDVA 3ZIAD 2IJD1 3DFLA 2ANKH 4OS6A 1AFEH 1FI8A 1AVWA 1F2SE 1MTNB 3ZVFA 1HBTH 1MCVA 1PPGE 2FI4E 2Z3CA 2THFB 4NFFA 3EGKH 4K1SA 2F9BH 4K8YA 1GBHA 5DKMA 4GUXA 2HNTE 1LPKB 4DY7B 1THPB 2H2ZA 3S9AA 1W12U 1TMTH 2WSSD 1FX0B 3W1EA 1EJAA 2EA3A 3UR6A 4H6SB 3SI3H 3KQBA 4WVPE 2HGTH 2XBYA 2I6QA 5J4SA 4P00A 3TH3H 4XBCA 1Y59T 1EAWA 2BQWB 4ABAA 4JZEH 3A81A 3AAUA 4AN7A 2FM2A 3SNAA 1SLUB 4A92A 1L0ZA 1GJ7B 1DX5M 1FY8E 3MU5A 4NWKA 3M5NA 4U2WA 4UFGH 2SGQE 1O2XA 5C0TA 1F5KU 2J34A 1AMHA 1YPGH 3LC3A 4KTCA 1P9UA 4X2XA 1S82A 2ZFPH 4X8TH 2V0BA 4RKJB 5F03A 5KEDA 1N6YA 4Y8XA 1NN6A 1O3AA 1EZXC 1OWDA 3V7TA 5EPNA 2PFEA 1CBWB 2BD9A 3TJNA 1Y3XA 4DIHH 4NSVA 3V0XA 1SGIB 5T6GA 3RLWH 1QL8A 5EJZA 4B71A 5L30H 1BT7A 1F0SA 3HKJB 1NBMD 1O5CB 3ATIA 5HIYA 2D2DA 4HTCH 1DE7H 1HYLA 5DP6A 1OP2A 2KCPA 1C2GA 3FVFB 5EODA 5FHTA 1CA0B 1SGDE 4ZXYH 1M9UA 2AERH 3KNXA 4AG1A 5DPAA 1H9LB 1V2OT 3MO9A 2QY0B 1BRUP 1JBUH 4YTAA 5C0UA 2NWNA 1GBLA 1PPHE 1SGFA 2GV7A 1SGCA 2PWXA 3P70B 4IN2A 5C67A 3GDSA 1QGFA 1D6RA 1VCPA 1O2GH 2BD3A 2NU1E 2UWOA 1QBOA 1HB0B 5C5NA 4UFFH 2P95A 1TGSZ 3DSOA 3FANA 3H7OA 3SHCH 1Y3WA 5F8ZA 2M2AA 2Y80A 3GCOA 3FP6E 4AYVB 4E06H 1SQAA 1QBVH 3ODFA 1ZTLA 1E35B 1LHGH 2NU4E 3E90B 8GCHG 1YPLH 1O5AB 3WW7A 4BAMB 1NU7B 2ZIQH 4XRNA 3P8FA 3S7KB 3PB1E 5A2MH 1BZXE 1V3XA 1WU1A 2A4RA 4LZ4B 3UNSA 4RN6A 2O8MA 2G4UA 5JBAS 1TGCA 3ZZCA 1TBQH 3AVZA 1Z6EA 1YKTA 2BX3A 2R9PA 1XUGA 1SGPE 3P8OA 4FUBA 2H9HA 1MQ5A 1TQ7B 1LQEA 1ZPBA 4X2WA 1C5OH 3FFGA 3HATH 2UUYA 2ZU1A 4FUHA 3I77A 1XUIA 1OPHB 1HAGE 1TNJA 1FQ3A 3SUGA 1PJPA 1ELCA 3BTTE 3FO8D 1NRQH 2LELA 1ZMJA 2ZDMA 3ZZ8A 1SQOA 4A1XA 1G37A 1GI2A 2B0FA 2QN5T 2F9NA 1J15A 3MU0A 2NU3E 5LH8A 4JYTA 3QO6A 1GG6C 2HVXA 2JIZD 4X8VH 3TJUA 1NRRH 3DFJA 1DVAH 2OCVB 3F6UH 3I78A 3HK6B 1O30A 1OWKA 3MU1A 5DP7A 1P12E 1FJSA 5GCHF 4NZQA 3TH2H 4XBBA 1N1LA 2R0LA 4YESB 1DY8A 1TYNA 3M7TA 1DANH 1ZSJA 2PTNA 3UWIA 1A3EH 1G3CA 4F48B 5GXPA 2VH0A 2Y7ZA 4B75A 1XX9A 2BM2A 2BD4A 3M3SA 3U8RH 1V2KT 1AZ8A 3VGCB 5FAHA 4BOHA 1Y5UT 1HRTH 4AZ2B 8LPRA 3O8CA 3PWCA 1J9CH 2BLQA 3SUDA 1AUTC 1AVGH 3RXDA 2G51A 2Q1JA 2F91A 4WMFA 3SU0A 1IQIA 2VIPA 2BQ6B 1OWEA 1TX8A 4CRCA 1QA0A 1KIGH 4K3JA 2SGEE 3ZZBA 3NRLA 1LHEH 2SNVA 1FIWA 2FWWA 5C2ZA 3FN8A 1O2UA 9ESTA 1QNJA 2ZTZA 5IK2D 3RLYH 2ZGBH 1PFXC 2UUKB 3TVJB 3TLOA 1KXEA 1BMAA 1HDTH 1ETSH 1MKWK 1LMWB 1HAVB 5LPFA 1O3EA 1BJVA 1T4VH 4IN1A 2R2MB 1GBEA 2BY8X 2A32A 4K60A 1ZJDA 3QWCH 1F0RA 4ZMAH 3NPSA 4MDSA 1Z71A 2J95A 2WPHS 1WOFA 1C5RA 5A09A 1MKXK 1MAXA 4RKOB 1LVMA 3M5OA 2J98A 3A8DA 1Z1JA 5EU8A 1SGEE 2AFQB 1MTSA 2XXLA 4NGAH 1PPZA 1GJ4H 2QE7D 5EXNA 1WAYB 2Y6TA 2FI5E 1A7SA 3E6PH 5E2OA 6CHAC 4A1VA 1TRYA 4O97A 1FXYA 1DM4B 1GVKB 2ZQ1A 3UTUH 5G4BA 2Y81A 2VWNA 3D49H 1QHRB 3QDZB 1QJ7B 1L2EA 1P8VC 2L6OA 2H1UA 1QZ8A 4MG3A 3P8GA 2QCYA 5CDFE 1UTNA 4X6NA 2OC8A 2ZHDA 1XVMA 2GGVB 4HI3A 3MNSA 4AFZA 5HYOA 1C5PA 1A61H 2JKHA 4TT3D 4XE4A 2FTLE 2ZDVH 4YLQH 4LOYH 1KLTA 2JH0D 1EUFA 2ZO3H 1GJ6A 5A0CA 3F9FA 1J16A 4ZHAA 3BEFB 2RA0A 1O3PB 3RXEA 2ZFRH 2FS8A 2F9UA 1KMHB 1HGTH 1TPOA 3F68H 2UWLA 5F53A 2R0KA 1ELBA 3TJOA 1PPBH 1V2WT 1IOEA 1SQRA 1Z8RA 2ZGJA 3NZIA 1Y5BT 1D4PB 1TNKA 4NIWA 1AQ7A 1HIAA 3UB0A 1ZGIA 3SHAH 2RCEA 1KSNA 1CBWC 2BDIA 2AMPA 4FU7A 5HM2A 1TBRH 2VIDA 2ZFQH 3OEHD 2ZNKH 3RXTA 5K0HA 2ZGCA 4KTSA 1IQGA 3QUMP 1XUHA 2HRVA 3SJOA 1UTQA 2R2WU 3KF2A 2AH4X 1ANCA 1CA0C 1EATA 1SC8U 1EAXA 4I8HA 4XD7D 1VKYA 1T8LA 2CMYA 3PO1C 1O2NA 3LGUA 1GDNA 1YLCA 4B6EA 5A0AE 1B7XB 3BG8A 3GY8A 1YCPK 4WJG2 3PMJA 2LPRA 4ABEA 1LCYA 5C3NA 3OY5U 4CRFA 4DJZB 4FXGH 3F2HA 1EP5A 1L1GA 4GPGA 2FYQA 1AWFH 1C2EA 3LGIA 1H8DH 1TA2A 1O2SA 5CHBA 3LC5A 1RS0A 1SGTA 2TBSA 4WY3A 1TRMA 3SQEE 2CJIA 4MPWA 3URDA 1HV7A 5GDSH 1HAIH 3ZV8A 4Z1MD 1GDUA 4KP0A 3TNTA 2ODPA 1ZHRA 3LOXA 4TWYA 1C5YB 5B6OA 1K1NA 2JJ1D 3SOSA 4DCDA 3PTNA 2C3SA 4E7RG 4I8GA 4XDEA 1SGFG 4BNRA 3TU7H 3A7XA 5GWZA 4IMZA 1C1OA 4ZHMU 4BTTB 1TONA 4ZAEA 2YNBA 2PLXA 1NTPA 3LIWA 3GY6A 3SU5A 2XRCA 1YLDA 2ZU3A 2Y5FA 1CHOG 1OP0A 1KDQA 1ZZZA 2KCYA 1GBIA 1TABE 5FCRA 1LTOA 2GDDA 1ACBE 3SU2A 1EZUC 1GBFA 1G3EA 1QIXB 3EE0B 2PTCE 3MH6A 4Z6AH 3TNSA 1GGDB 3ZZ3A 4Y10E 2BVXH 1ELGA 5C1XA 1GI8B 2F43B 3MO6A 4AB8A 1KTSB 1WBGB 1OWJA 2FX6A 3SW2B 2ZU2A 3A83A 2BY6X 4J2YB 2OTVA 3EA8A 2ZQ2A 2A45B 5EGMA 1ZR0A 1C5TA 1JRSA 4OS1A 2ESTE 2OBQA 1O2IA 1AI8H 1SSXA 2ZG0H 1W3CA 2G52A 1CGJE 2Y7XA 2W3IA 3BTWE 3SNBA 3H5CB 4JYUH 1VZQH 5C17A 2DE9A 3ZVGA 1HAXB 7ESTE 1N8OB 5GJ4B 4U30A 2YMSB 2G8TA 4BAKB 3PMHB 1KXBA 1L1NA 3O8BA 2XYAA 5C5OA 1LKBA 1H9IE 1XUFA 4BXSA 1GG6B 1G3BA 4XBDA 4DVAU 2P94A 5DP8A 3T26A 2BD8A 1AE5A 1GCTC 2SNWA 1VGCC 3HKIB 3T2NA 2HPPH 2UWPA 2TPIZ 3MNCA 4NWLA 2VWOA 1SOTA 1TOCB 2WV4A 3VFEA 1IAUA 5C20A 2DUCA 3VGCC 3GCNA 1SFQB 3RP2A 4D7FA 2SGDE 1AN1E 3QTVH 1T8OA 1HJ8A 2ZPSA 4FVBA 1QB6A 3B9FH 3BIVH 2AMQA 2H6MA 4OS4A 3SUEA 3DD2H 2B7DH 4BTIB 4Y7BA 1HAOH 4ACBA 5T3HA 2VNTA 3KIDU 3U8TH 4FUEA 1BTXA 1Z1IA 1LPGB 3NK8A 4FETA 1S5SA 3RXFA 3CENA 2OC1A 4ABGA 4U01A 1AD8H 2BLWA 1K2I1 2J5UA 2Z6BD 1QR3E 4YM9A 3MH4A 3ITIA 3RU4D 2EY4C 3C27B 2ANWA 2QF3A 1QTFA 1SFIA 2ZFTA 3L33A 3HK3B 1MU6B 5JPMH 4BAQB 2HNTF 4X2VA 4X6MA 1D3TB 1JWTA 1AU8A 2XC4A 4B1TA 1C2KA 1O2HA 3EA7A 3MOCA 1OXGA 4GCHG 1VITG 3GCTG 3UQVA 1O3DA 2D26C 1CSOE 2GZ9A 1QRXA 3TK5A 2J92A 1BRBE 1HNEE 3MFJA 1O2OA 2A4OA 4IGDA 3CS7A 2OC0A 1EFRD 4CRGA 1GL1A 1E1RD 1ETRH 2JDID 2W5EA 4SGBE 1MH0A 2F83A 1E0FD 3SGQE 4Y76A 1TAWA 1E79D 1XM1A 1GMDG 6CHAB 2ANYA 1WYKA 1P11E 4NA7A 4INKA 4SGAE 4K1EA 5B6LA 3DSGA 3SV9A 2A5AA 2PW8H 2OXSA 1DWEH 5BPEA 1WTHD 1DLKB 2STAE 3A80A 4JMYA 4RT1A 3ZZ4A 5FX5A 1A5IA 1V2VT 1HAPH 2KAIB 2A5IA 3VXEH 1GVLA 1EJMA 2ZCKP 1G32B 3BTDE 5GIBA 5EJ1A 2ZKSA 1MTWA 1C5XB 2QXGA 3RM2H 5C1UA 7LPRA 2VH6A 2AMDA 1F5RA 1H9HE 1L4ZA 1NESE 2GZ7A 1SBWA 1V2RT 1O2TA 1COWD 4UD9H 2IPHA 4P02A 4KGAA 4YOIA 4AGJA 3PROA 4A6LA 1EJNA 3W94A 1MU8B 2BHGA 3ZVCA 2I6SA 1BCUH 1EPTB 1BA8B 2WV5A 4TPYA 2VINA 1K1JA 2RDEA 3VB6A 4UONA 2FI3E 3K6ZA 3F9EA 1UCYE 1MZAA 1P9SA 5HMAA 1EAIA 1AGJA 2Q6GA 3MYWA 1NPMA 1O35A 1WV7H 2WPIS 1E38B 3NXPA 1ZRBA 2BY7X 2YOLA 2KR7A 7KMEH 3GCHC 1TIOA 1ZTJA 1PYTD 3ESTA 3ZVEA 4VGCB 1F0UA 1BQYA 2XOKD 2PSYA 1TQ0B 3DSPA 4ABDA 1O34A 3A7VA 1VJAU 2G55A 2ZDAH 5DP5A 3QK1A 1EZQA 5SGAE 2IJOB 3RXUA 2OINA 1Y3VA 2STBE 1MD8A 3RXSA 1JMOH 5EQQA 3PO1B 2ZPQA 3WWBA 4KKDA 1NRSH 1O3JA 5FCKA 1VR1H 2RA3A 3N7DA 4Q4LA 1DSUA 1INCA 1YPKH 3ODDA 2KZ4A 1K9OE 4X0WU 1C1SA 3BTHE 1EP6A 5DG6A 2JETB 3KHVA 2D1JA 1GI7B 2PR3A 1C2IA 1ANEA 1FLEE 4E7NA 4B76A 1N6XA 2JH6D 3QX5H 1OWIA 1EQ9A 1VCWA 1LVOA 1TNGA 4GHTA 4GVUA 4Y79A 1H4WA 1ID5H 1GBTA 2AHME 3BTQE 3MNBA 3TITA 1EXFA 1GI4A 1A0LA 3KQ5A 1NC6A 1Z7KA 2ZCLP 3PLKA 2WUBA 2JH5D 3P17H 2L74A 1O2KA 1XUJA 3CNRA 1E37B 4MLFB 2WV9A 5E2PA 4I31A 2AGEX 1UTLM 1GHBF 4YOGA 1IQLA 1FN8A 2FO9A 3MU4A 3DHKH 1ZHMA 1DWBH 1NO9H 1TRNA 2KFWA 2QXIA 5JDUB 1HCGA 1EASA 1X7AC 3UPEA 1NFWA 2GJGA 3P95A 1QRZA 1K1PA 4ZH8A 5T6FA 2BXTH 3BV9B 1EZSC 4X6OA 1BRAA 3PTBA 1GGDC 1AKSA 4F55A 1AZZA 4DT7B 4AOQA 1ARBA 5KECA 1C4Y2 4UFEH 1ZMNA 5F8TA 5JB8S 1S6FA 1YBWA 4Y8ZA 5DSFA 1O2ZA 2UUJB 1O36A 3QN7A 2OQUA 4YT7H 1DOJA 1V2ST 4ABJA 4DW2U 4QT8C 3OE7D 1G2LA 2A7JA 2BDGA 3SZNA 1Z8JB 2VBCA 1N8OC 1C2LA 4AFUA 1BTUA 1O5DH 4DOQA 2YMSC 3SBKA 5A0BA 3LU9B 1O3GA 1UHBA 1S0QA 1LDTT 3F0PA 4BAHB 1UJ1A 2BVRH 1P2NA 3F3BA 4BAOB 4LZ1H 3VEQB 1THSH 3EYDA 4YO9A 3RXJA 1GHAF 1BTWA 1O33A 3RMMH 2LP6A 2H5DA 1RTFB 1NY22 1GHZA 3DUXH 2BVSH 2ILNA 6GCHF 4E05H 3Q3YA 3ZZ5A 2VWLA 1HPGA 4I86A 4Y0ZE 1GCTB 1VGCB 1IQNA 1CT4E 3F0OA 1T32A 4Y11E 2A7CA 1IQKA 4ZUHA 2Z9GA 3Q76A 3A7ZA 2P16A 3A89A 3EQ0H 1ZHPA 3BF6H 5CE1A 6ESTA 2EI7A 1C5LH 4NIYA 1MTUA 5JBTA 2TRMA 2QC2A 4CRAA 1TMBH 8KME2 1HAVA 1P0SH 1SI5H 5TCAA 3QGNB 1O5GH 4ACAA 5K7RA 1P10A 1SR5C 1YCPM 3RXPA 2GCHF 5J4QA 1LHFH 3LH3A 3ZZ7A 4MQAA 5E0JA 1UTJA 1GBBA 1OP8A 1AY6H 1K0HA 3G01A 3SGAE 4GLYA 2QIQA 4NFEA 1YYY1 1C4U2 4OS5A 1ANBA 1LHCH 2HPQH 3SJ8A 1IHTH 4LK4A 2FOCA 3V13A 2GVFA 4MVNA 3T28A 3QLPH 4KELA 1A1RA 1P2MA 2W6ID 3JZ2B 3R3GB 1UTPA 1RGQA 3H7TA 4CREA 2PKAB 2WHXA 2BLOA 2J94A 3JZ1B 1DXPA 4ISHH 2O9QA 1W10U 2VIWA 2QV1A 5I25A 1Z8IB 1NZQH 7GCHF 4FU8A 3W95A 1CQQA 4ZKOU 2V3MA 1QURH 1O3KA 2IPQX 1RIWB 3PRDA 4YLUA 3U1IB 1GHWH 1GI5A 4JZDH 3UR9A 2XTTB 5DP4A 2FYRA 5HKKD 2ODYB 2VIOA 2K1QA 3UY9A 2PGBB 1CT0E 3SI4H 1G2MA 1AB9B 2ZPRA 2ALVA 5F8XA 5E8EH 2PHBA 1O3MA 1XKAC 1Z6JH 4FOUC 2JJ2D 3F9GA 4X6PA 2OQ5A 5A8YA 1QQ4A 2GKVE 1A2CH 2V3HH 4YOJA 1SQTA 2ZGHA 3OTJE 1BBRK 2Z3DA 2O8UA 3KYFA 2ZA5A 5DJ7A 1BTHH 1ZSKA 3SU3A 2XW9A 1AFQC 4BTUB 2VGCB 2GT8A 2G5VA 2J98B 2VB0A 3RXQA 1ESAA 3M37A 3RXCA 1H8IH 1LPZB 1C1TA 2Y5GA 1B0FA 1EPTC 3SQHE 2C4FH 3RMOH 1O2VA 3GISB 2RDLA 2TGDA 2ZZUH 2HWLB 3S7HB 1GBDA 3B8JA 1YM0A 3A7YA 1UMAH 1C9PA 3K65B 4CBNA 1FV9A 1C1QA 2V6NA 1DFPA 3QZQA 3N99A 4VGCC 1L4DA 1C2DA 3RXVA 5DN6D 1NBME 1YPHC 3BEUA 3M7UA 1C1VH 1TX7A 1UVOA 1AHTH 1K1MA 2VIQA 2FX4A 5PTPA 1D3PB 1A5GH 4MTBA 1E1QD 1TOMH 1O2YA 3A82A 4A1TA 1LKAA 3GCHB 1RD3B 1QJ6B 2FLBH 3ZVAA 4B6FA 3OSYA 1FY4A 1MMJN 4Q63A 1DUEA 1S6HA 4HFPB 4UE7H 5GCHG 2J9NA 1WXRA 5FL7D 1V2PT 4AORA 6GCHG 2F9VA 1DXWA 1PQAA 3TIUA 1G9IE 1OKXA 1P03A 4FUDA 1B5GH 1LO6A 1EKBB 3LGTA 2Z9JA 3OX7U 5DP3A 1V2UT 2JETC 1O31A 1EOLA 3RXGA 4ABHA 2Z3EA 2W6JD 4TWWA 3SN8A 4PROA 1PQ5A 3M7QA 4NG9H 3LGWA 3TK6A 1O2RA 3T25A 4F4OC 1MZDA 1O38A 3BTEE 2VVUA 1DICA 3U69H 1YLNA 3ATLA 2C93B 3ZZAA 2FOAA 3UWJH 2ZHWH 1ELEE 3OFND 1Y3UA 2M5TA 1KLJH 1SLXB 2EEKA 3EDXB 4I8JA 1T8MA 1SGYE 1SKYE 1WTGH 3MH5A 5H4IB 2W26A 2A2QH 2GV6A 4Y8YA 5EPYA 3NWUA 3A8AA 1P2JA 1ORFA 3AW1A 4TSFD 4F49A 3GY7A 2ZDNA 4NIVA 3U98H 4XSKU 4RSPA 5C1YA 4JZFH 1FDPA 3A85A 3F9HA 2BZAA 3GY3A 3ZZ6A 2FS9A 2P8OC 1SOZA 3SNDA 4JYVH 4UDWH 1VJ9U 1K1OA 4CR9A 3OAAD 1LHDH 3GICB 1DLEA 1MTVA 2QXJA 1XVOA 1DPOA 1MCTA 3HGPA 1CT2E 3MI4A 3UOUA 2C8WB 3A87A 5HXFA 4D9RA 1MAYA 5DO4H 1D3QB 1XXFA 4TY7A 3B23B 4I33A 1SGRE 3BTFE 4CHAB 4MNYA 1EX3A 4H4FA 3KQCA 3VB4A 1IQHA 2FESH 1KXDA 2DE8A 4CRDA 1W2KH 4OS7A 4X1SU 1FMGA 3M5MA 3VB5A 1ZTKA 4AGKA 1SLVB 1Z8GA 2CF9H 4ISLA 2W7SA 4WXIA 7GCHG 1A3BH 1AVXA 2GCTB 3RM0H 2ODQA 4HZHA 1O39A 4Y0YE 2ZP0H 1QY6A 3D23A 2FDAA 4IC6A 5AF9H 4ASHA 3ZYEA 1J8AA 4IMQA 2CHAB 3OU0A 4X2YA 1ABIH 2ZU4A 4Q2KA 1D3DB 1FAKH 1BMFD 1L1JA 4O3UA 1C5NH 4YZUA 3M3TA 3CP7A 1ARCA 2J38A 4OS2A 1QB9A 1KDQB 5EW1H 2Z9IA 2D8WA 1IHSH 3GS9A 4ZKNU 1P2KA 3HPTB 3FP8E 4FVDA 2GT7A 3H09A 1T7CA 1EOJA 4ISIH 3RC6A 1AUJA 1MBQA 2AGIX 4DURA 1O32A 4H6TA 1BOQA 2AYWA 5ESBA 1H1BA 2K0QA 3S69A 3OY6U 1TBZH 4TPIZ 1NU9A 3BSQA 3WWFA 2BXUH 4HGCA 3U9AH 1ELAA 1C1MA 5L6NH 2V7QD 5HIZA 1QL9A 1GMHF 4A5TS 4ZKSU 1WQVH 3PV4A 5HM9A 1ZOMA 1O37A 4WWYA 1YF4A 2XNIA 1UTKA 2BX4A 2FTMA 3PMBB 2BTCE 1NFYA 4O9VA 4AB9A 3LJOA 4Z0KA 5FX6A 4HG6A 1W11U 1O3BA 1SHYA 2PUXB 4OGYA 4WMDA 1YY3A 2WZQA 3EA9A 1BHXF 3RMNH 1C2MA 1IQMA 5JBBS 3NUMA 3PRBA 4CR5A 1YPEH 1JIRA 3FAOA 1P04A 1TALA 2A1DB 4INLA 5AHGH 3S9BA 1K1LA 2A0QB 3ZV9A 1P06A 2C90B 2B5TB 3E8LA 4MPVA 1TE0A 3PLPA 4FUGA 1OWHA 1J17T 3RXKA 1S84A 5DGJA 1E36B 2K8IA 2PUQH 2ZFFH 3LGYA 1HAYB 1W0JD 1RIWC 2ZHQH 4X1RU 4JZIA 3T5FH 1ZLRA 9LPRA 2IOTA 1GJBB 2Z7FE 1ELFA 1V2JT 2FZZA 2P93A 2FODA 1W7GH 1TB6H 3LONA 1BB0B 2ULLA 1PPEE 3ZZDA 1RJXB 3SO3A 1AB9C 1DUAA 1V2TT 1GBMA 1JXPA 4TY6A 2AIQA 1HJAB 3P8NA 1V2QT 4X1NU 3A7TA 3FZDA 3N7OA 1KXFA 4ZHLU 3AK5A 3ELAH 3U28C 4FUIA 4MNWA 2PP6A 4D76A 1T31A 1UW7A 2VGCC 2O8TA 2OP9A 1P57B 3VXFH 6LPRA 2FOMB 1QFKH 2G5NA 5EQSA 1O3IA 1XXDA 3KQEA 1UTMA 2KCAA 3GY2A 4IBLH 3Q00A 1O3NA 3SNCA 1KXCA 1AIXH 1AFQB 1C1UH 2XCFA 3RXRA 2CXVA 1MD7A 2HLDD 1BITA 1BTZA 2A5KA 3O8RA 2EI8A 4B2AA 1SVPA 1XUKA 1OSSA 3UQOA 5DP9A 3SJ9A 1W0YH 2LNCA 2CN0H 1B0EA 3IITA 3O8DA 3UOPA 5A8XA 1SHHB 3KQDA 2A4QA 4ZCNA 3QTOH 2ZDLA 3S9CA 2RG3A 1H8ED 1S83A 1OX1A 1GJCB 5FPSA 3K2UA 1UK3A 3SV6A 1FUJA 1C5SA 2FPZA 3SNEA 1DWCH 1BMMH 2VU8E 1EB1H 1O5FH 2BD7A 5L2ZH 2GX4A 2WPKS 4RI0A 1O2QA 1CVWH 5EOKA 2QYIA 1C5QA 5FPYA 3SYJA 3PV5A 1SLWB 2BQ7B 3I29A 1RTKA 4O3TA 4YXWD 1P09A 1QCPA
chains in the Genus database with same CATH topology
3TGIE 1ZPCA 1VCQA 1UVPA 3RMLH 3RXLA 1V6DA 4OGXA 2ZECA 2ZWLH 4D7GA 2Z9KA 3NCLA 1UCYH 1RFNA 2FOGA 1GHXH 3MMGA 1FY1A 5CHAB 3MNXA 2NU2E 1F5LA 4MPUA 3U8OH 1GI1A 1C1RA 3R0FA 4MNXA 1GI9B 3M36A 2WUCA 3Q3XA 2YNAA 4FUJA 4Q7ZA 1C1WH 1GMHG 4I8LA 2HLCA 4WH6A 2Y5HA 2Q6FA 2AGGX 1S85A 1JOUB 1W8BH 4FUFA 3RXHA 3KEEA 4INHA 5ESTE 3LJJA 4D8NA 3TGJE 5AFYH 1C2HA 2VJ1A 2XBVA 2FMJA 3E1XB 5FBIA 1Q31A 3LKWA 1DITH 1K21H 1V2NT 3HGNA 3M35A 1ZPZA 4I32A 1G36A 3SV8A 1KY9A 1GI6A 4CRBA 2P8OB 1W0ZU 2GDEH 3E16B 3DA9B 1FY3A 1RRKA 3SUFA 4CHAC 3BTME 2IN2A 5GPIB 1ETTH 3FZZA 1GCDA 2SGFE 4ZXXH 1K1IA 5L2YH 2HNTC 2WPLS 2GCTC 2C8XB 4BXWA 1O0DH 3A88A 1NFUA 3D62A 2ZEBA 2G4TA 4Q7YA 1SGQE 3TK9A 1HAHH 1E34B 2CHAC 1P3EA 3PYHA 2AIPA 5EW2H 1DT2A 4YT6H 3ZVDA 3MTYA 1FPCH 5FPTA 1BIOA 4ZKRU 1SMFE 3E3TA 3LGVA 3ZVBA 1C9TA 1ELDE 2FOEA 3GOVB 2BY5X 1UO6A 4AFQA 4X8SH 3ATWA 5AFZH 5BRRE 4Q80A 3ZYDA 1BTYA 1GI3A 1CU1A 1AKSB 4Y7AA 4ABIA 3LPRA 2ZU5A 3V12A 3K6YA 1BJUA 3ATKA 3SU4A 4AX9H 1TNHA 3KL6A 1GL0E 1TNIA 4B73A 2G81E 2BOHB 2ZFSA 5FBEA 1WQSA 1EAUA 1GBAA 3M5LA 3FP7E 3AASA 4LXBH 1QL7A 1HJ9A 3GY4A 1C5VA 2GZ8A 1QRWA 1UHBB 1A46H 1ZSLA 2H5CA 2P59A 1KXAA 1O2WA 4CH8B 1WUNH 1AE8H 1NFXA 3C1KA 3RU4E 1GI0A 4GSOA 3A7WA 3T62A 2P3TB 1O3OA 3SGBE 1A5HA 1SG8B 1TLDA 1TPPA 1YPHE 2FP7B 1IQEA 1CE5A 3KN2A 3P92A 2PKAA 4K1TA 3RXIA 3CS0A 2WPMS 2TGTA 2ZHFH 5EQRA 2OBOA 3STIA 2AS9A 3ZZ9A 1ABJH 1NRNH 2H9EH 2FLRH 1P3CA 1FZZA 3RXMA 2QXHA 2ZCHP 3PM3A 3BG4B 2Q6DA 2SFAA 4K8BA 1GBCA 1F92A 3WY8A 4AG2A 2GD4B 1MBMA 1K28D 1ZJKA 1BMNH 3K9XB 3PWBA 1CHOF 4ABFA 2ASUB 2BDYA 3SORA 3E0NB 2WYGA 5E0GA 1G30B 1O3FA 1BDAA 1G3DA 2B8OH 1C2FA 1DWDH 3UNQA 1QQUA 1NM6A 2BDAA 1HJAC 2XWAA 5EG4A 2CGAA 3Q77A 2HOBA 2H9TH 1UK2A 2SGPE 1V2MT 3D65E 2C8ZB 3RUOA 2GMTC 2C8YB 1C5ZB 2FEQH 2BB4A 1ELTA 2GP9B 2BDHA 4D9QA 1GHBG 3SJKA 1DY9A 4DGJA 4M7GA 3S0NA 1HAZB 1IQFA 1MTNC 2PKSB 2F9PA 2P3UB 1O2MA 1SB1H 1THRH 2TGAA 2UUFB 4FU9A 4Q7XA 1LVYA 4THNH 1D6WA 5IYTA 2A7HA 3A8BA 1UVTH 4B2BA 3A84A 1TGBA 8ESTE 4FUCA 4AYYB 1P02A 2QAAA 2EI6A 2BZ6H 4IW4E 1MQ6A 2OLGA 4DIIH 1W13U 1C5WB 1C2JA 2FOBA 2W3KA 4NZLA 1K22H 2A4GA 2ZTYA 3RC5A 3PLBA 4U32A 2WINI 1TPAE 4ISNA 2CF8H 1QA7A 2R3UA 1HLTH 2F3CE 3NKKA 3TPIZ 4K69A 2ZDKA 5FXLA 1MUEB 3E91A 3UFAA 3KGPA 2OC7A 4WMEA 2Z9LA 1TPSA 1JRTA 5HGGA 4I8KA 2O8LA 1P2IA 2CV3A 1TA6A 1O5BB 1ZRKA 1OYQA 2WYJA 1GDQA 3BIUH 1C1PA 2ZHEH 4X1QU 1F7ZA 1BTPA 1C5UA 1AO5A 1O2LA 1GHAG 3QGJA 2QGRA 1JIMA 4J1YA 1LQDB 5TJXA 4CH2B 5ABWA 4JK5A 1O2JA 1Q3XA 1MKWH 4JCNA 5T6DA 2PGQB 4AFSA 4X8UH 4BANB 2J2UA 1ESTA 5EXMA 3GYMA 1HFDA 1GMCF 2VVCA 5CHAC 1GPZA 1BRCE 2BY9X 1HIAB 1MKXH 2PSXA 3A86A 2FIRH 1BBRE 1C1NA 1GBKA 1QJ1B 2VVVA 2W7UA 3LDXH 3U1JB 1P01A 1CGHA 2ZTXA 4TYDA 4WXVA 2XBWA 4GCHF 1VITF 1W7XH 3GCTF 4ISOA 1NT1A 1OOKB 1UVSH 1RXPA 1GJ9B 1CA8B 1UVUH 1ANDA 1IQJA 3GY5A 3KCGH 3QZRA 1FY5A 1ESBA 1TGTA 3F1SB 3IWMA 1O2PA 1KTTB 2GCHG 1C4V2 2Z94A 2P3FH 1GHVH 1O3CA 3LT3A 2J4IA 2B9LA 1Y3YA 4B2CA 3T29A 1SPJA 1YP9A 1TFXA 3DT0H 1FAXA 2BYAX 1FPHH 4IS5A 4NCYA 5LPRA 3STJA 1GMDF 1YGCH 4GAWA 1YC0A 1OS8A 2VWMA 4XOJA 3URCA 1YPMH 1PPFE 1GBJA 4GHQA 1A4WH 3RU4T 4K5ZA 4KTUA 2G00A 1BBRH 2EC9H 1ELVA 1NRPH 1W14U 1CHGA 1SGNE 3RXOA 1GVZA 2BDCA 1BHXB 4NIXA 1SL3A 3EAJA 4ZROA 2XCNA 5A8ZA 5LGOA 1PQ7A 1XKBC 1FIZA 1UTOA 3L6PA 1HXFH 3SU1A 3TGKE 3OYPA 1TMUH 5I46H 2O8WA 4ESTE 5EXLA 3RC4A 1PYTC 2ZI2H 2XC0A 1BUIA 4I7YH 5TCCA 3GDUA 4MNVA 1HXEH 2ZF0H 2BMGB 4R0IA 3LH1A 3VPKA 1Q2WA 2A2XH 4CBOA 2TIOA 5AVDA 2BDBA 4NSYA 1KYNA 1PPCE 3UUZA 1T4UH 1HUTH 5CMXH 4R8TB 1Y8TA 3SV7A 4JZ1A 1RTLA 3AAVA 2BD2A 1BMLA 4H42U 1YCPH 4XFQA 2ALPA 3SV2H 2FXRA 1DDJA 1VITH 3PMAB 5F6MA 1A0JA 3SU6A 4DG4A 1EB2A 1ZMLA 2FOFA 1TGNA 4UEHH 4O03A 1A0HB 3MWIU 1O3LA 2ZGXH 4X1PU 1GJ5H 4WH8A 3MO3A 1P2QA 3M3VA 3E0PB 3ATMA 4WF8A 1YPJH 1AWHB 1WSSH 4MPXA 2OUAA 3A8CA 2WPJS 1Y5AT 5JYIA 1KLIH 3VB3A 2BLVA 3VB7A 2QA9E 4JK6A 4Y71A 4NA8A 1P2OA 3BTKE 1GWAA 3RDZA 3V3MA 1P05A 2OD3B 2HALA 1C5MD 1GJ8B 1GJDB 4B74A 3T27A 3P6ZB 3BTGE 1PQ8A 2XBXA 2F9OA 1DS2E 4K2YA 1FNIA 4NA9H 2ZC9H 3BG4C 5ETXA 3RXBA 1NROH 1GHYH 1TX6A 3UNRA 1GJAB 1XMNB 4A7IB 2PV9B 3TJVA 3SJIA 2V3OH 1V2LT 1UK4A 1CGIE 1J14A 2AEIH 8GCHF 1LVBA 3AW0A 5IDKA 2BOKA 2FOHA 1GMCG 3UREA 2BD5A 1TNLA 3IG6B 2TGPZ 3ENSB 3MHWU 2XC5A 2A31A 4ABBA 4IC5A 3MH7A 2V35A 1S81A 1ZGVA 2GTBA 2KAIA 1FN6A 3BN9A 1T8NA 5E0HA 1QB1A 1TWXB 3BEIB 1QBNA 1CO7E 1ZYOA 1S0RA 1UCYK 5LPEA 2SGAA 1OYTH 1WCZA 1O3HA 1FONA 2R3YA 1U6QA 4Y6DA 1NS3A 3TH4H 2ANMH 1D9IA 3UIRA 2XWBI 3GYLB 1F0TA 5JB9S 2VIVA 3MU8A 1O5EH 3M61U 3Q3KA 2PKSC 2QF0A 1DSTA 4UFDH 5DK1A 2GMTB 2NU0E 1EPTA 2Y82A 5JBCS 3RXAA 3L3TA 3GDVA 3DFLA 2ANKH 4OS6A 1AFEH 1FI8A 1AVWA 1F2SE 1MTNB 3ZVFA 1HBTH 1MCVA 1PPGE 2FI4E 2Z3CA 2THFB 4NFFA 3EGKH 4K1SA 2F9BH 4K8YA 1GBHA 5DKMA 4GUXA 2HNTE 1LPKB 4DY7B 1THPB 2H2ZA 3S9AA 1W12U 1TMTH 1EJAA 2EA3A 3UR6A 4H6SB 3SI3H 3KQBA 4WVPE 2HGTH 2XBYA 2I6QA 5J4SA 3TH3H 4XBCA 1Y59T 1EAWA 2BQWB 4ABAA 4JZEH 3A81A 3AAUA 4AN7A 2FM2A 3SNAA 1SLUB 4A92A 1L0ZA 1GJ7B 1DX5M 1FY8E 3MU5A 4NWKA 3M5NA 4U2WA 4UFGH 2SGQE 1O2XA 1F5KU 2J34A 1AMHA 1YPGH 3LC3A 4KTCA 1P9UA 4X2XA 1S82A 2ZFPH 4X8TH 2V0BA 4RKJB 5F03A 1N6YA 4Y8XA 1NN6A 1O3AA 1EZXC 1OWDA 3V7TA 5EPNA 2PFEA 1CBWB 2BD9A 3TJNA 1Y3XA 4DIHH 4NSVA 3V0XA 1SGIB 5T6GA 3RLWH 1QL8A 4B71A 5L30H 1BT7A 1F0SA 3HKJB 1O5CB 3ATIA 2D2DA 4HTCH 1DE7H 1HYLA 5DP6A 1OP2A 1C2GA 3FVFB 5EODA 5FHTA 1CA0B 1SGDE 4ZXYH 1M9UA 2AERH 3KNXA 4AG1A 5DPAA 1H9LB 1V2OT 3MO9A 2QY0B 1BRUP 1JBUH 4YTAA 2NWNA 1GBLA 1PPHE 1SGFA 2GV7A 1SGCA 2PWXA 3P70B 4IN2A 5C67A 3GDSA 1QGFA 1D6RA 1VCPA 1O2GH 2BD3A 2NU1E 2UWOA 1QBOA 1HB0B 5C5NA 4UFFH 2P95A 1TGSZ 3FANA 3H7OA 3SHCH 1Y3WA 5F8ZA 2Y80A 3GCOA 3FP6E 4AYVB 4E06H 1SQAA 1QBVH 3ODFA 1ZTLA 1E35B 2NU4E 1LHGH 3E90B 8GCHG 1O5AB 1YPLH 4BAMB 1NU7B 2ZIQH 3P8FA 3S7KB 3PB1E 5A2MH 1BZXE 1V3XA 1WU1A 2A4RA 4LZ4B 3UNSA 4RN6A 2O8MA 2G4UA 5JBAS 1TGCA 3ZZCA 1TBQH 3AVZA 1Z6EA 1YKTA 2BX3A 2R9PA 1XUGA 1SGPE 3P8OA 4FUBA 2H9HA 1MQ5A 1TQ7B 1LQEA 1ZPBA 4X2WA 1C5OH 3FFGA 3HATH 2UUYA 2ZU1A 4FUHA 3I77A 1XUIA 1OPHB 1HAGE 1TNJA 1FQ3A 3SUGA 1PJPA 1ELCA 3BTTE 1NRQH 1ZMJA 2ZDMA 3ZZ8A 1SQOA 4A1XA 1G37A 1GI2A 2B0FA 2QN5T 2F9NA 1J15A 3MU0A 2NU3E 5LH8A 4JYTA 3QO6A 1GG6C 2HVXA 4X8VH 3TJUA 1NRRH 3DFJA 1DVAH 2OCVB 3F6UH 3I78A 3HK6B 1O30A 1OWKA 3MU1A 5DP7A 1P12E 1FJSA 5GCHF 4NZQA 3TH2H 4XBBA 1N1LA 2R0LA 4YESB 1DY8A 1TYNA 3M7TA 1DANH 1ZSJA 2PTNA 3UWIA 1A3EH 1G3CA 5GXPA 2VH0A 2Y7ZA 4B75A 1XX9A 2BM2A 2BD4A 3M3SA 3U8RH 1V2KT 1AZ8A 3VGCB 5FAHA 4BOHA 1Y5UT 1HRTH 4AZ2B 8LPRA 3O8CA 3PWCA 1J9CH 2BLQA 3SUDA 1AUTC 1AVGH 3RXDA 2G51A 2Q1JA 2F91A 4WMFA 3SU0A 1IQIA 2VIPA 2BQ6B 1OWEA 1TX8A 4CRCA 1QA0A 1KIGH 4K3JA 2SGEE 3ZZBA 1LHEH 2SNVA 1FIWA 2FWWA 5C2ZA 1O2UA 9ESTA 1QNJA 2ZTZA 3RLYH 2ZGBH 1PFXC 2UUKB 3TVJB 3TLOA 1KXEA 1BMAA 1HDTH 1ETSH 1MKWK 1LMWB 1HAVB 5LPFA 1O3EA 1BJVA 1T4VH 4IN1A 2R2MB 1GBEA 2BY8X 2A32A 4K60A 1ZJDA 3QWCH 1F0RA 4ZMAH 3NPSA 4MDSA 1Z71A 2J95A 2WPHS 1WOFA 1C5RA 5A09A 1MKXK 1MAXA 4RKOB 1LVMA 3M5OA 3A8DA 1Z1JA 5EU8A 1SGEE 2AFQB 1MTSA 2XXLA 4NGAH 1PPZA 1GJ4H 5EXNA 1WAYB 2Y6TA 2FI5E 1A7SA 3E6PH 5E2OA 6CHAC 4A1VA 1TRYA 4O97A 1FXYA 1DM4B 1GVKB 2ZQ1A 3UTUH 5G4BA 2Y81A 2VWNA 3D49H 1QHRB 3QDZB 1QJ7B 1L2EA 1P8VC 2H1UA 4MG3A 3P8GA 2QCYA 1UTNA 4X6NA 2OC8A 2ZHDA 1XVMA 2GGVB 4HI3A 3MNSA 4AFZA 5HYOA 1C5PA 1A61H 2JKHA 4XE4A 2FTLE 2ZDVH 4YLQH 4LOYH 1KLTA 2JH0D 1EUFA 2ZO3H 1GJ6A 5A0CA 3F9FA 1J16A 4ZHAA 3BEFB 2RA0A 1O3PB 3RXEA 2ZFRH 2FS8A 2F9UA 1HGTH 1TPOA 3F68H 2UWLA 3TJOA 2R0KA 1ELBA 1PPBH 1V2WT 1IOEA 1Z8RA 2ZGJA 3NZIA 1Y5BT 1D4PB 1TNKA 4NIWA 1AQ7A 1HIAA 1ZGIA 3SHAH 2RCEA 1KSNA 1CBWC 2BDIA 2AMPA 4FU7A 5HM2A 1TBRH 2VIDA 2ZFQH 2ZNKH 3RXTA 5K0HA 2ZGCA 4KTSA 1IQGA 3QUMP 1XUHA 2HRVA 3SJOA 1UTQA 2R2WU 3KF2A 2AH4X 1ANCA 1CA0C 1EATA 1SC8U 1EAXA 4I8HA 1T8LA 2CMYA 3PO1C 1O2NA 3LGUA 1GDNA 1YLCA 5A0AE 1B7XB 3BG8A 3GY8A 1YCPK 4WJG2 3PMJA 2LPRA 4ABEA 1LCYA 5C3NA 3OY5U 4CRFA 4DJZB 4FXGH 1EP5A 1L1GA 4GPGA 2FYQA 1AWFH 1C2EA 3LGIA 1H8DH 1TA2A 1O2SA 3LC5A 1RS0A