4I8HA

Bovine trypsin at 0.75 resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the reproducibility of protein crystal structures: five atomic resolution structures of trypsin.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8hA02
2CJIA 3GCHB 4GPGA 1YKTA 1GI4A 4HFPB 4KTUA 4X8TH 2ANKH 2SGFE 4U01A 1C1RA 1Z6EA 3Q76A 2V3OH 3RXRA 3PM3A 2ZKSA 2A5KA 1TNHA 4AYVB 3D65E 1ZZZA 2VIDA 1YPMH 4Y10E 1O3CA 3SJOA 4E05H 1CHOF 1YP9A 3MNCA 1Y8TA 1HUTH 1FIZA 3VB5A 1F0UA 2EI7A 4YLQH 1EZQA 2D8WA 2CF9H 1QBNA 2BY9X 4MG3A 2FI4E 2OQ5A 2GCHG 2BXUH 1V2QT 3KQBA 2FOMB 3Q3YA 3QLPH 2TGDA 4Q7XA 4J2YB 1DVAH 2Z9JA 1MTWA 1BTWA 4YOGA 4ABDA 1GJ7B 1TNKA 4IBLH 2DE9A 2ANWA 1BIOA 2XCNA 2H5DA 1A7SA 3SNDA 3PMHB 2CF8H 3D49H 1GHWH 1YPEH 1P2KA 1O3HA 3KF2A 1HAXB 1AO5A 3MNXA 1IQGA 4RKOB 1WU1A 3Q3XA 3CENA 1P2IA 1T4VH 4B2BA 1PYTC 1TBZH 3ITIA 3ZZBA 5CE1A 3LH1A 2R0LA 4ABJA 1AZZA 1DSUA 2HNTF 3ZVCA 3RMLH 5FBIA 2EI6A 1KLIH 2A7JA 1IQNA 3UIRA 1TABE 2F9BH 1C1VH 3BTKE 3A8DA 4R8TB 1ZGIA 1VCWA 1O3BA 2AFQB 1O2TA 3BSQA 4WWYA 2J95A 2BD7A 2F3CE 3R3GB 4FVBA 5EPYA 1IQEA 4OGYA 1HLTH 2XC4A 2FIRH 1D3TB 1QBOA 3GISB 1GI5A 2YNAA 1C1PA 1OKXA 1SHYA 1P3EA 3ATMA 4NSYA 1ELAA 1AVGH 1GDNA 2F9NA 1LTOA 1N6XA 2ZHFH 3SUFA 3AW0A 1C5RA 1BT7A 4I31A 1O3AA 1P2QA 4Y0ZE 3F9GA 1AD8H 4D7GA 3K65B 1AWFH 1TALA 3ZYEA 1KY9A 1ELEE 4TPYA 3RP2A 1EOJA 1O3OA 1BUIA 4LOYH 3OX7U 3ZZ5A 3QX5H 2BDGA 5F03A 1FDPA 3T62A 7GCHF 3M61U 3SI4H 1C5VA 2AGEX 1CT0E 1SFIA 1SSXA 3SUEA 1EB2A 1RJXB 3MFJA 4ZKNU 1RFNA 2WYGA 2A5IA 1AKSB 1QRXA 1TPOA 5C5NA 4IMZA 4OS1A 5JB9S 4BXSA 2AIQA 2O8WA 4UFFH 2Q6DA 5EW1H 2BD3A 1WAYB 4X2WA 3SJIA 1V6DA 1TX8A 1SGNE 1Z8RA 3BTTE 1ELDE 1GMCF 2O8TA 4IMQA 3ESTA 2Z9KA 2HPQH 2EA3A 1EPTC 2ZWLH 4DIIH 1GI2A 4ZXYH 1ID5H 1HAVB 1NTPA 3VB7A 4ISNA 3MH7A 1ETTH 2XXLA 1CSOE 3TH4H 1KYNA 1AKSA 4NG9H 4NIWA 3QZQA 1YPHE 3EE0B 3DT0H 3KQCA 2BLOA 1FLEE 1OWEA 4UFGH 1GHZA 4JZEH 1C4Y2 3FZDA 1C5UA 1ABIH 3KN2A 4K1EA 3HGNA 1N6YA 3PYHA 3RXOA 1HXEH 3MI4A 4MPXA 1WQVH 2EC9H 3SU3A 3SV6A 3RM0H 2BDIA 4D9RA 1XUHA 1W0ZU 4AFSA 8ESTE 2WPMS 2GP9B 2G8TA 1C5NH 2ZHQH 1EUFA 1O2OA 4CH2B 1ZMNA 1GBLA 3SUDA 1HAOH 1IAUA 1AI8H 2AMQA 2ZFRH 2ZF0H 1QR3E 3RM2H 3ELAH 2HGTH 3HATH 1KLTA 1W13U 5FX5A 2PV9B 2ZECA 1G37A 4XDEA 3ZYDA 1A2CH 1SGFG 1ZSKA 2GTBA 1B0FA 4NGAH 3B23B 3P95A 1HCGA 4MVNA 5T6FA 3EAJA 6CHAC 1SC8U 3PO1B 1C5XB 3F9EA 4NIXA 3LC5A 2AMDA 5IYTA 2NU1E 2Q6FA 4TWWA 3SU0A 1NROH 1GI8B 3K2UA 4TY7A 2NU4E 4MNYA 2ZG0H 3QZRA 2VWNA 4ABIA 1Y5BT 1SGYE 2XWBI 1P2MA 4WXVA 2STAE 4NCYA 3RXIA 1D3PB 1DUAA 1DUEA 1H9LB 4FUBA 1GMDF 3U9AH 4NFEA 2AS9A 5EXLA 2QXHA 4XE4A 2FYRA 1ZHMA 1EZUC 2LPRA 1HAVA 2Z94A 2ZHWH 5EOKA 3SORA 1MTNC 1FZZA 3Q00A 2BZ6H 1JRSA 1GWAA 1GVLA 1BHXF 1D4PB 5JBCS 5DGJA 1OWHA 1C5OH 1GJ6A 3M7TA 4NWLA 4BAHB 1BMNH 1H8DH 4Y6DA 3ZVDA 2WPJS 5ABWA 1O2KA 2BLWA 3RXQA 2Y5HA 3TNSA 4FUDA 2C8WB 5LPFA 3K6YA 3SHCH 3P8OA 3EGKH 1AMHA 4ISOA 3SBKA 1K1IA 5HMAA 1E36B 1T8OA 1SL3A 3B8JA 2P3FH 1TGNA 5JBAS 5F8TA 3P8GA 1ETSH 1E35B 2J92A 2PKAB 1O3NA 1CA8B 1GCTC 1HPGA 4ZKRU 5FPYA 3S9BA 1QFKH 1DWBH 4XSKU 5E8EH 2FYQA 2P3UB 3JZ1B 5C5OA 2TRMA 1KXAA 1SLUB 1TGSZ 2M5TA 1SQTA 1K9OE 1TAWA 4I8KA 3RXMA 1MBQA 1O5BB 2ZDAH 4TPIZ 2FESH 3LGVA 1C2LA 1QA7A 4H42U 1HV7A 3VB4A 1DXPA 1FN8A 2FOFA 1A0JA 1VITF 1V2ST 3E3TA 2FP7B 3ZZ6A 1V2OT 4GLYA 5EXNA 1GBKA 1H9IE 2ANMH 4GHQA 4UDWH 5F8ZA 1KXBA 1WTHD 1XXDA 2WINI 1MD7A 1GMHG 3HK3B 5JDUB 3KGPA 3UY9A 4TY6A 4FVDA 1UJ1A 4X1SU 3A7VA 4Q7YA 3S9CA 1Z8GA 2Z3EA 1AVXA 3RMMH 2CHAC 3A82A 3SV9A 3SGAE 4A5TS 4CBNA 4X6OA 4NZLA 3Q77A 3UWIA 2AERH 1S0RA 1AB9B 2IN2A 3NKKA 1MMJN 3ZVBA 3F1SB 4O9VA 4U2WA 1O2ZA 4NIVA 1VGCC 3M5NA 1IQLA 3ZZ9A 1LPZB 3E1XB 2VB0A 2TBSA 3V0XA 4UEHH 1O36A 2XW9A 1SGIB 2PUXB 3TK9A 4X8UH 3SJ9A 1VJAU 2Y82A 1SB1H 1W11U 1ELGA 2OINA 2GX4A 1TOMH 1ARBA 5A0BA 1CQQA 4X6MA 2TIOA 1B5GH 1O3EA 1IHTH 2TPIZ 2ZDNA 4GUXA 1DPOA 3FAOA 2XNIA 4BTIB 4E7NA 3PO1C 1S0QA 2A45B 1ACBE 4FUFA 1NM6A 6CHAB 2BD8A 2FOCA 1FV9A 2ZEBA 4ZKOU 1GBMA 1ZOMA 1EX3A 1GBDA 2PSXA 3E0NB 2W5EA 2A7CA 1L4ZA 1TPSA 1XXFA 1HJ9A 1MU8B 1C9PA 3A87A 4UFEH 4Y8ZA 3RXKA 3UOUA 1SGPE 1Y3WA 4DY7B 1MCTA 1W2KH 2Y7XA 3MYWA 2O8LA 3LIWA 4INKA 2ZNKH 4YM9A 2GV6A 4LK4A 4WJG2 2FOEA 4DJZB 4BAKB 1BRCE 2BDAA 3MNSA 2ZPQA 2ZTYA 3M5MA 3BG8A 5EG4A 3ZVAA 2WV4A 2J9NA 2IOTA 4X1RU 5JPMH 1O2WA 1NFWA 1WSSH 2BHGA 2PR3A 2V0BA 3VXFH 1MQ6A 2B9LA 5DP3A 4K60A 3EA8A 1GBCA 1Y3YA 1GBEA 3VEQB 1VCPA 3ATIA 1OS8A 2ALVA 1G3EA 2A4RA 3LC3A 3PB1E 3ZVGA 1KXEA 3BEFB 1CBWC 1TOCB 1O2UA 5HM9A 2H9HA 1BOQA 1ZRBA 2PKAA 1KTSB 1O2NA 1C4V2 1P57B 1EPTB 3S7KB 3LJOA 4U30A 4HI3A 4KELA 2SGPE 3S69A 2RCEA 1ESBA 1QQUA 1MAXA 4Y0YE 2O8UA 3QO6A 3WY8A 1M9UA 1TNIA 2THFB 1LVBA 4Y11E 3E91A 1KSNA 5FPSA 2FTMA 1DY8A 3P8FA 2ESTE 2G51A 4GHTA 3GYLB 4B1TA 2FOAA 3AW1A 1J16A 3GCTG 2ZFTA 3AAVA 1ZLRA 2XC0A 1S6FA 4KTSA 1SQOA 5C3NA 1SGTA 4D8NA 1YPHC 3UWJH 4JCNA 1SBWA 1NO9H 2B5TB 2B8OH 1ZPCA 2W3IA 4H6SB 3RXBA 3UQOA 1O3LA 3LJJA 1T8LA 4OS2A 2FXRA 5HYOA 1SGRE 3SJKA 3GY5A 3S7HB 2QF0A 1F5KU 2XC5A 4MPWA 3KQEA 2ULLA 1GMCG 4CRBA 1G3BA 1H1BA 1O3JA 5A09A 1AUTC 1EAWA 1FPHH 2R9PA 2FLRH 4K3JA 1HAHH 1C1TA 2FZZA 1BBRE 1ZJDA 3G01A 1YCPM 2BX3A 4UE7H 2WYJA 2UWLA 1AE8H 3BG4B 2XYAA 1QJ7B 5K7RA 1UTKA 4HTCH 1C1UH 1LHDH 4AZ2B 4FUCA 1Q31A 1A3EH 1A61H 1PPCE 1WYKA 4CBOA 1A0LA 1ORFA 2B0FA 4MDSA 4X8SH 2CV3A 5GDSH 1MKXH 1RTFB 1WTGH 1G30B 2GDEH 4NWKA 3SO3A 1Z71A 4YT6H 3RXPA 3SV7A 1J14A 3O8RA 3TJVA 1O2PA 1Z6JH 1N1LA 4JYUH 2C8ZB 2FEQH 1BJUA 1C5WB 2OBOA 3SNBA 3HKJB 1Z7KA 3NXPA 1V2KT 2ZGCA 4ZKSU 4AG2A 3GY8A 1BTYA 1BB0B 5DP6A 1XUGA 4AFUA 4X1PU 2PLXA 5GCHF 1W12U 1SFQB 5LH8A 1FXYA 2QC2A 3IWMA 3K6ZA 3P17H 3QWCH 1NC6A 2Z9GA 1TNJA 2VVVA 5JBBS 2PGQB 2QA9E 1C2IA 2XTTB 2FOGA 3QGJA 1Y3VA 3UR9A 4X2XA 1TA6A 3MNBA 1EXFA 3MH5A 4U32A 4F49A 3CS7A 2GVFA 1O5FH 1GJDB 2GCTC 1OOKB 4NSVA 1H8IH 2JH5D 1LHGH 3ZV9A 3BN9A 4K8BA 5T6DA 2BMGB 3DFJA 5C2ZA 1TQ7B 1FQ3A 1MZAA 4IGDA 4O3UA 1KXFA 3KL6A 1TA2A 2UUYA 4O03A 1GDUA 4NFFA 4GAWA 3I78A 2ZC9H 2D1JA 1O37A 3DA9B 5A8ZA 1XUKA 4Z6AH 1ELTA 4WF8A 2KAIA 3GY6A 1G3CA 2ANYA 4BAQB 4VGCC 5A0AE 1YLDA 2OC1A 3RXTA 2GV7A 2ZPRA 3RU4E 1AE5A 2ZQ1A 1QJ6B 1SGEE 1CHOG 5DG6A 2FM2A 7ESTE 4B75A 4A7IB 2ZI2H 1DY9A 1ARCA 3RXAA 4WY3A 1DICA 5TCAA 1MKXK 6LPRA 4INHA 1AU8A 2CGAA 2O9QA 3D23A 1ELVA 2ZPSA 3HK6B 3LONA 1GHBG 2BVSH 1GJ9B 1UCYE 1XMNB 3BEIB 4AGKA 1YF4A 1NU7B 2VVCA 5CHAB 3F9HA 1DANH 1XX9A 1W10U 3UOPA 4BAMB 1GDQA 3NCLA 3URCA 1G32B 1UTPA 2OC0A 1IOEA 2VVUA 3NPSA 5DP7A 2AIPA 3PTNA 2ZGJA 1TRNA 2W26A 4Y7BA 2G5VA 3PMBB 2G55A 1KLJH 1C5TA 3A7ZA 3ZZ3A 1FNIA 3FP7E 3T2NA 1HDTH 2HVXA 3ZZDA 2SFAA 3KNXA 4GCHF 1BRBE 6GCHG 1DWCH 2VIOA 5T6GA 4X8VH 2ZQ2A 2R3YA 1H9HE 1O2LA 3A7WA 4ZROA 4GSOA 1A5GH 3GDUA 2WPIS 1GBAA 1TGTA 1MCVA 3QGNB 4FUIA 1O2YA 3BTFE 2G4UA 3PWCA 4BNRA 2VNTA 1FY3A 4Q80A 2G52A 2ZO3H 2SNVA 2J4IA 3MU4A 1S84A 3BIUH 1QTFA 1BHXB 1ZRKA 3PMJA 1LCYA 2A32A 1HB0B 2OBQA 1SOZA 1FUJA 2OC8A 3R0FA 1DS2E 2A5AA 4DOQA 1LQDB 1OYTH 1CT2E 1QY6A 3MTYA 4XFQA 5AF9H 3QN7A 1FJSA 3M5OA 4YTAA 4UD9H 2Q6GA 3F68H 4SGBE 1SR5C 4B71A 1OWIA 2K1QA 1AWHB 5T3HA 1UTOA 2JETB 4WXIA 4PROA 2A2XH 3NWUA 1TWXB 2C8YB 1HAGE 1L4DA 1AIXH 2VGCB 3STJA 4AB9A 4JZDH 3ODDA 1GI0A 3E16B 3U8TH 1V2WT 2FTLE 1RRKA 4DW2U 3RXVA 2ZCHP 2ZCLP 5GCHG 3VGCC 1GJCB 2QN5T 1X7AC 4YZUA 1C9TA 1BTHH 1YPGH 1EAXA 1W0YH 3PROA 3DD2H 3T27A 1JMOH 1VITH 1V3XA 1GL0E 5DKMA 3TGIE 4TWYA 1BRUP 3L6PA 1C2EA 5EQSA 1A4WH 2GMTC 1EAIA 5HM2A 5EODA 3O8BA 1C1QA 5DJ7A 4Y7AA 3W94A 1TPPA 1W14U 3TNTA 3FZZA 1D3QB 5C1XA 3S0NA 1SLWB 3LDXH 3M36A 2VWMA 2PUQH 1A46H 1EKBB 1K1PA 1TQ0B 5EU8A 3T5FH 3U1IB 4BANB 4WVPE 1TNLA 1Z8JB 2QXGA 2YOLA 1THPB 3OTJE 1LDTT 1A0HB 4CR9A 4A1VA 3RXDA 3U98H 4FUGA 2IPHA 1ZHPA 3UR6A 1GHAG 3FANA 4A92A 1EZSC 1YLCA 3GOVB 1OWJA 1W3CA 1NU9A 1TIOA 1EOLA 2F91A 3A8CA 4AORA 2UWPA 1DOJA 4KKDA 1CT4E 1G36A 5E2PA 1F2SE 2BY5X 2PWXA 3RXSA 1ANBA 1C2KA 2BVRH 4YESB 4I7YH 4DURA 2Z3DA 3V3MA 4WMDA 3ZZ4A 3QUMP 2G5NA 1O32A 2ZU3A 4X2YA 3SQHE 1BTPA 1YM0A 1BMAA 2HWLB 1J9CH 2LNCA 2SGAA 3FP8E 1S5SA 1GBFA 5PTPA 1JOUB 1O5DH 1P3CA 3SGBE 1BMLA 1WUNH 3SU4A 3TU7H 1O3KA 1QJ1B 2CXVA 4INLA 1NY22 3M7QA 2GMTB 1O3PB 1JRTA 2J2UA 3PTBA 3D62A 1MAYA 1QGFA 1QQ4A 2OD3B 5FXLA 1L1JA 1UVOA 1C5SA 3ODFA 2RG3A 3HKIB 1YYY1 2FOBA 1LO6A 1G2LA 3LGTA 3VGCB 1MZDA 2P8OB 1GG6C 4CRDA 3ZZCA 5AFZH 4DGJA 1BCUH 2F83A 2V6NA 2Z9LA 1KDQB 2ZU1A 1IHSH 2XBXA 4B76A 2VGCC 2F9OA 2GCHF 3ATWA 3ZVFA 2JETC 4CRGA 3E6PH 1O2JA 4Y79A 3PWBA 1NT1A 3SV2H 1T32A 4ZH8A 4JK5A 4ISHH 4AN7A 4CHAB 2GD4B 3GICB 1DM4B 5ESBA 1A5IA 1AFEH 1W7GH 4IS5A 1EASA 1S85A 3MWIU 1ESAA 2PKSB 4FU9A 1O3IA 1GHBF 1DFPA 2B7DH 1XM1A 1A5HA 1RTKA 4AYYB 3A8BA 1XUIA 2V3HH 1FPCH 4Y76A 1NS3A 2F9VA 1HJAC 3U8RH 3T26A 4BXWA 3OU0A 3SI3H 1TBQH 2ZTXA 1MTVA 1F0RA 3BF6H 4DG4A 2GGVB 1CGJE 1O34A 1AGJA 3UFAA 1C5PA 4AB8A 1GJ4H 4JK6A 1SQAA 1RXPA 1NESE 5H4IB 1O5AB 2G4TA 1B7XB 2FPZA 3UQVA 5CHAC 1O2SA 4JZIA 3OY6U 1C2DA 3NUMA 1Y3UA 2PW8H 7GCHG 1SGDE 3GCOA 1N8OC 5ETXA 1OSSA 2IJOB 1GBJA 1GVZA 5FPTA 1TGCA 2AH4X 1F5RA 2BQ6B 3M7UA 4I8JA 1SGQE 3MH6A 4OS5A 1PPZA 1T7CA 3UNQA 1OXGA 2R2WU 4CRAA 4ABAA 1GGDC 1NFUA 1UTJA 3KQDA 3P70B 5DP8A 2TGPZ 4NZQA 1LHCH 2ZCKP 2HNTC 2ZFFH 1K2I1 1NRSH 1BZXE 4WH8A 1EJNA 1L1NA 1UHBB 3DUXH 4VGCB 1GBTA 5TJXA 1QA0A 5EQQA 4ABGA 3HPTB 1BRAA 3MO3A 3ENSB 1WQSA 1MH0A 1DWEH 3TIUA 1NN6A 3U1JB 5DP5A 4Q7ZA 7LPRA 3BTHE 2GT7A 1MTSA 2BLQA 1F5LA 1GI6A 2P94A 1GJ8B 4WMEA 3CS0A 2VINA 1Z1IA 4ZHAA 1GHVH 4I8LA 3RLYH 2AYWA 1ANCA 1RTLA 1QL7A 1UHBA 5SGAE 1O3GA 1JBUH 4ABFA 6ESTA 5F6MA 2BX4A 2H2ZA 3ZV8A 1NFXA 1RIWB 3TH2H 4YOJA 4ZUHA 2W3KA 4Q2KA 2GCTB 1Q3XA 1YCPH 2FX4A 2H5CA 1VJ9U 2A4GA 1XUFA 4O97A 5J4SA 1XUJA 1SI5H 3FFGA 1BITA 5EQRA 1UK3A 5A8YA 1LVMA 1UVSH 3QK1A 3SV8A 1G3DA 2Z3CA 1UVPA 4I33A 7KMEH 1OX1A 4IC6A 1C5ZB 3L3TA 4AG1A 1VR1H 1WV7H 3BEUA 5E2OA 2SGQE 5FAHA 1ZGVA 2HNTE 2ODQA 3RXLA 4B74A 2AGGX 3IITA 1HIAB 1OYQA 1XVMA 4Y8YA 1O38A 3M35A 3FP6E 1GI1A 1BDAA 2ODPA 1T4UH 1E38B 1FIWA 2VIVA 4DVAU 5JBTA 2ALPA 1P2NA 1TMBH 2BOKA 1MD8A 4Z0KA 4I32A 1SPJA 4AX9H 2NU3E 1Z1JA 1J15A 1L2EA 3TJOA 1BBRK 1V2VT 2FI5E 3UUZA 1YPJH 4RKJB 2ZDLA 5FBEA 2BLVA 2ZZUH 3MU8A 4D7FA 2H1UA 2OP9A 1PQ5A 3SW2B 1F0TA 2EI8A 4YT7H 1HYLA 5L2YH 1HXFH 3BG4C 1MKWH 8GCHF 1YC0A 2RA0A 4AGJA 3BIVH 1DDJA 3Q3KA 4ABBA 4F4OC 1LMWB 1O33A 1K21H 5C20A 4UFDH 1NPMA 4A6LA 1K22H 1O5CB 2FI3E 5C67A 2HPPH 2BDBA 2P3TB 1AFQC 1ANEA 5J4QA 2F9UA 4OS7A 4CR5A 3SNEA 3QDZB 1Y59T 1O2RA 3VB6A 2BQWB 1K1MA 1C2FA 2Y81A 1IQIA 1O2XA 4BTTB 1K1LA 1KXCA 4OS6A 1DT2A 3GCNA 4KP0A 2ODYB 3F6UH 3TGKE 2AMPA 5DP4A 1LKBA 3RXGA 3LGIA 8GCHG 1CA0B 1YCPK 1QL9A 3N7OA 4K1TA 3RXFA 2Q1JA 2XBWA 1C1SA 2ZP0H 1MKWK 4J1YA 1AUJA 2W7SA 1MUEB 1SLXB 1E0FD 1GHXH 1IQMA 1NRPH 5JYIA 3W95A 3A86A 1V2MT 2P95A 2QXIA 1ZTKA 3P8NA 3A7TA 1FY4A 2ZGBH 2OTVA 3CP7A 3T28A 4B73A 1OP8A 2ILNA 3NZIA 5FCKA 2WV5A 1P02A 3QTVH 1CBWB 3EYDA 3PLPA 2ZDMA 3A84A 2A4OA 2BXTH 1EATA 1OP2A 1UK2A 1O5EH 1P0SH 1CVWH 1B0EA 1BTUA 1HGTH 2P93A 4LXBH 1HAZB 1V2LT 3RXEA 1GJBB 1YPLH 3ZZAA 1FONA 3MO9A 2PTNA 1P03A 1NZQH 2ZFPH 5HXFA 1TX7A 3SZNA 1EP5A 5AFYH 3BTME 1GCDA 3U8OH 4CH8B 2J38A 3MHWU 3GYMA 1EAUA 1ETRH 5FHTA 2ZU2A 2C90B 1O30A 2BD4A 4K2YA 1E34B 4GVUA 1V2JT 1KIGH 5E0JA 3O8DA 2QGRA 1QHRB 4ZAEA 1PQ7A 5JB8S 1KXDA 1J17T 3TJUA 1P9UA 3SU1A 4ZMAH 1G2MA 1C2HA 2PFEA 1QRZA 1D6WA 2VWLA 2QIQA 2XWAA 5IDKA 2NWNA 3IG6B 5E0HA 3RXJA 1F7ZA 3VXEH 4OS4A 1W7XH 3FVFB 3PLKA 2HALA 2FS9A 3AVZA 2BY7X 4NA7A 4MPUA 1BQYA 2DUCA 4A1XA 2C4FH 1CA0C 2BDHA 2QV1A 1ZSLA 1C1NA 1K28D 3DHKH 1VGCB 3SU2A 1PPFE 2QY0B 1P2JA 1PPHE 2RDLA 4AFQA 1ZMJA 1AN1E 1AB9C 1TE0A 1THRH 4ZHLU 3GY3A 1C2GA 1HJ8A 1HAPH 1GI7B 2ZA5A 3LKWA 8LPRA 2CHAB 2R2MB 1AFQB 3KCGH 5FX6A 4X1QU 5AVDA 3DFLA 3K9XB 2G00A 5TCCA 5DP9A 2GDDA 2BQ7B 1LPGB 3BTWE 3ATKA 4I8HA 4KGAA 3RU4T 2OXSA 5K0HA 1PYTD 2ZHEH 2BDCA 1V2RT 2VH6A 2JH6D 1P9SA 1WCZA 4B2CA 2A4QA 4JZFH 1ZTLA 3RXUA 2WUCA 1ZTJA 1DLEA 1UTQA 4I8GA 1A1RA 1ZYOA 3RMNH 1ZR0A 2WUBA 2WPKS 3VPKA 4AFZA 5DO4H 5DPAA 1FN6A 3I29A 1JWTA 3GY4A 4DT7B 2HOBA 1O0DH 3VB3A 3TK6A 2ZDVH 5BRRE 2GKVE 3OYPA 2G81E 1C4U2 5CMXH 4IN2A 1DITH 3OSYA 2PTCE 1QL8A 3L33A 2WPHS 1PPGE 1V2NT 2XBVA 1O2QA 4ABEA 1QNJA 4QT8C 1LVYA 1GBBA 1T31A 3U69H 2KAIB 3M5LA 1O2HA 1J8AA 2AEIH 1QCPA 3NK8A 3HGPA 1GCTB 1GI9B 3EA9A 2QAAA 3A85A 4IN1A 1UCYK 5EGMA 2BY6X 1O5GH 4LZ4B 2BYAX 4BAOB 2FLBH 2SGEE 1RS0A 1TX6A 3RLWH 1ZPZA 2GZ9A 2ZFQH 1BJVA 4CREA 1TBRH 2PSYA 1F0SA 1K1JA 5GWZA 1AVWA 2A0QB 3TPIZ 3MU5A 1V2PT 2FWWA 2VH0A 1RIWC 4Y8XA 3P6ZB 1OPHB 2BZAA 2R0KA 2QCYA 5B6OA 2Y5GA 1LKAA 1NRRH 3ZVEA 3A81A 1FI8A 4ASHA 2H9EH 1QBVH 5EXMA 3E8LA 4K69A 2ZU5A 2GZ7A 3ATLA 1MTNB 2FOHA 1SOTA 4E06H 2R3UA 1V2TT 3A89A 1TRYA 2GZ8A 3SQEE 4IC5A 1HAYB 2UUFB 1LPKB 1P05A 4UONA 3H5CB 4YLUA 1HIAA 2VWOA 2FODA 2O8MA 3I77A 1VZQH 2OUAA 4BTUB 5BPEA 2F9PA 3RMOH 1BTZA 1ZSJA 4FXGH 3PV4A 3RUOA 4NA9H 3EA7A 1JIRA 5C1YA 4ZXXH 1GI3A 4CRFA 1O3MA 1K1NA 2FS8A 4K1SA 2FDAA 4JYVH 4O3TA 2RA3A 1TGBA 4B2AA 5G4BA 3RDZA 5FCRA 1GGDB 1UO6A 3A7XA 1P11E 2UWOA 3A80A 1KDQA 1PPEE 1L0ZA 1FY5A 3S9AA 3E90B 1N8OB 3JZ2B 3EQ0H 4K5ZA 1VCQA 1LHFH 1YBWA 1TPAE 2FMJA 5GXPA 2P16A 2JH0D 3AAUA 2Z9IA 2NU0E 3V12A 3SGQE 3M3TA 1DWDH 3RC6A 1AQ7A 3SU5A 1CE5A 1G9IE 2P59A 3MH4A 1CHGA 1SGFA 1O3FA 1P06A 2J94A 2ZHDA 2HLCA 1OWKA 1MBMA 3LGWA 3BTEE 4SGAE 1BTXA 2C8XB 4D76A 1P12E 1HJAB 1DE7H 2ZTZA 1BBRH 1QB1A 3GY7A 3A83A 3LU9B 4ESTE 1GBIA 9LPRA 1XKAC 3C27B 1ELFA 2QXJA 1BA8B 3LH3A 5A0CA 4X0WU 2PKSC 1XVOA 2A1DB 3GDVA 3LOXA 2VIWA 3EDXB 1S82A 1C2MA 1XKBC 1FMGA 1C5QA 2GT8A 9ESTA 1C1MA 1JIMA 1TFXA 1TMUH 4M7GA 3TH3H 5EW2H 1AY6H 1TLDA 3SNCA 4CHAC 2A31A 1DLKB 1HAIH 1MQ5A 2OQUA 3V7TA 4XBDA 4YO9A 3T25A 1SG8B 2BDYA 2Y7ZA 1DX5M 4MLFB 4MNVA 1UVTH 1T8NA 8KME2 1O31A 1PQAA 3SUGA 2ASUB 2OCVB 1ABJH 2BB4A 2D26C 4HGCA 1O2MA 1GJ5H 1ZMLA 1Y5AT 3KHVA 1GG6B 2P8OC 3ZZ8A 1C2JA 1AHTH 4DIHH 3URDA 4DCDA 1NFYA 4H4FA 4FU8A 2A2QH 1EZXC 4K8YA 3SN8A 3B9FH 4TYDA 2J34A 1EJAA 2C93B 2WPLS 2Z6BD 3TLOA 3TGJE 1GMHF 4JMYA 3SOSA 4X6PA 1D9IA 1EB1H 1FAXA 1D6RA 4MPVA 3MU1A 3SNAA 3GCTF 3LGUA 4JZ1A 3RC4A 5GPIB 3KIDU 1IQHA 1P04A 2BM2A 1ANDA 1VITG 3T29A 1DXWA 1SMFE 3RU4D 2SNWA 1TB6H 4NIYA 2OC7A 4Y71A 2FO9A 3UNRA 4X2VA 1S6HA 2TGAA 1P2OA 3E0PB 4KTCA 1QB9A 3QTOH 3UPEA 5DK1A 1EP6A 1FY1A 5LPRA 2XCFA 1V2UT 1LHEH 1UTLM 4YOIA 1GPZA 3MO6A 4X1NU 5L2ZH 1ESTA 1YPKH 3V13A 3BTDE 1TRMA 1K1OA 1QURH 3GY2A 1O2VA 2BVXH 1GVKB 3F9FA 1WBGB 2STBE 3TK5A 3O8CA 1CGIE 1EQ9A 3LPRA 5I46H 1F92A 2AGIX 3RC5A 3AASA 3STIA 1ZHRA 1GL1A 4FU7A 1ZPBA 1IQKA 4R0IA 2BTCE 1U6QA 1EPTA 2ZU4A 3KEEA 1GBHA 3RXCA 2ZIQH 5LPEA 2EEKA 1HFDA 2H6MA 2I6SA 3H7TA 2BD2A 1W8BH 3PMAB 1AZ8A 1DSTA 2ZGHA 3GDSA 4FUHA 2YNBA 4ISIH 4MNXA 1FY8E 4X6NA 1C5MD 2OLGA 2UUJB 5E0GA 3M37A 2BOHB 2QF3A 1INCA 2Y5FA 1KTTB 1C1WH 2A7HA 2V35A 3UTUH 3A8AA 2FX6A 1C5YB 1QB6A 5C1UA 1O2GH 2BY8X 1NRNH 3C1KA 3ZZ7A 4GCHG 6GCHF 5I25A 1HNEE 5L6NH 4WMFA 1EJMA 4JYTA 1ZJKA 4ISLA 5ESTE 1GMDG 1BMMH 1RD3B 3VFEA 1Y3XA 1ELBA 1LVOA 4RN6A 1OWDA 1PFXC 4FUEA 2Y6TA 5EPNA 1O3DA 2Z7FE 1GJAB 3BTGE 3MMGA 1L1GA 1MU6B 1IQFA 4HZHA 1PPBH 1A3BH 1YGCH 4WH6A 1Y5UT 3SHAH 2UUKB 1OP0A 1P10A 4BOHA 1O35A 4OGXA 4XOJA 3BV9B 4NA8A 4AOQA 2BD9A 3RXHA 1THSH 1GHYH 1UTNA 4THNH 4XBCA 2SGDE 5F8XA 5GJ4B 1CU1A 3M3SA 1PQ8A 2JKHA 1TONA 1SHHB 3GCHC 3UREA 4IW4E 1O39A 4FUJA 4XBBA 2VU8E 5L30H 1CGHA 4RSPA 5A8XA 2NU2E 2ZFSA 1C1OA 1JXPA 3A7YA 2ZDKA 2QYIA 1FAKH 1HRTH 1PJPA 4E7RG 1D3DB 2CMYA 5HGGA 1Q2WA 1GHAF 2PHBA 4MTBA 1TYNA 5AHGH 2I6QA 1O2IA 1TNGA 3P92A 1S83A 1ELCA 1QRWA 1UVUH 1SVPA 1NRQH 2XBYA 5GIBA 2VJ1A 1LQEA 4A1TA 3TJNA 2BD5A 1E37B 2VIQA 4MQAA 2HRVA 3UNSA 1CO7E 4CRCA 1HBTH 1P8VC 3A88A 3H7OA 1SGCA 1C5LH 1QIXB 4LZ1H 4ABHA 3SU6A 1P01A 2CN0H 1TMTH 1T8MA 2DE8A 4ZHMU 2ZGXH 5LGOA 3TVJB 2W7UA 3MOCA 3SJ8A 2C3SA 1UTMA 2XRCA 3LT3A 4D9QA 1UK4A 1Z8IB 3TITA 4H6TA 1UCYH 3BTQE 1RGQA 3PLBA 2PGBB 1UMAH 2H9TH 1WOFA 3M3VA 3MU0A 1IQJA 1H4WA 2VIPA 3OY5U 5A2MH 1P09A 2Y80A 1MTUA 2D2DA 1SLVB 1S81A 4MNWA 2TGTA 3LGYA
chains in the Genus database with same CATH superfamily
2CJIA 3GCHB 2QF5A 4GPGA 1YKTA 1GI4A 4HFPB 2WV9A 4KTUA 4X8TH 2ANKH 5HIYA 2SGFE 4U01A 1C1RA 1EFRD 1Z6EA 3Q76A 2V3OH 3RXRA 3PM3A 2ZKSA 2A5KA 1TNHA 4AYVB 3D65E 1ZZZA 2VIDA 5HIZA 1YPMH 4Y10E 5CDFE 1O3CA 2J98A 3SJOA 4E05H 1CHOF 1YP9A 3MNCA 1Y8TA 1HUTH 1FIZA 3VB5A 1F0UA 2EI7A 4YLQH 3SZEA 1EZQA 2D8WA 2CF9H 1QBNA 2BY9X 4MG3A 2FI4E 2OQ5A 2GCHG 2BXUH 1V2QT 3KQBA 2FOMB 3Q3YA 3QLPH 2TGDA 4Q7XA 4J2YB 1DVAH 2Z9JA 1MTWA 1BTWA 4FOUC 4YOGA 4ABDA 1GJ7B 1TNKA 4IBLH 2DE9A 2ANWA 1BIOA 2XCNA 2H5DA 1A7SA 3SNDA 3PMHB 2CF8H 3D49H 1GHWH 1YPEH 1P2KA 1O3HA 3KF2A 1HAXB 4Q63A 1AO5A 3MNXA 1IQGA 4RKOB 1WU1A 3Q3XA 3CENA 1P2IA 1T4VH 4B2BA 1PYTC 5EJLA 1TBZH 3ITIA 3ZZBA 5CE1A 3LH1A 2R0LA 4ABJA 1AZZA 1DSUA 2HNTF 3ZVCA 3RMLH 5FBIA 2EI6A 1KLIH 2A7JA 1IQNA 3UIRA 1TABE 2F9BH 1C1VH 3BTKE 1YY3A 3A8DA 4R8TB 1ZGIA 1VCWA 1O3BA 2AFQB 1O2TA 3BSQA 4WWYA 2J95A 2BD7A 2F3CE 3R3GB 4FVBA 5EPYA 1IQEA 4OGYA 1HLTH 2XC4A 2FIRH 1D3TB 1QBOA 3GISB 1GI5A 2YNAA 1C1PA 1OKXA 1SHYA 1P3EA 3ATMA 4NSYA 1ELAA 1AVGH 1GDNA 2F9NA 1LTOA 1N6XA 3OFND 2ZHFH 3SUFA 3AW0A 1C5RA 1BT7A 4I31A 1O3AA 1P2QA 4Y0ZE 3F9GA 1AD8H 4D7GA 3K65B 1AWFH 1TALA 3ZYEA 1KY9A 1ELEE 2KCAA 4TPYA 3RP2A 5F53A 1EOJA 1O3OA 1BUIA 4LOYH 3OX7U 3ZZ5A 3QX5H 2BDGA 5F03A 1FDPA 3T62A 7GCHF 3M61U 3SI4H 1C5VA 2AGEX 1CT0E 1SFIA 1SSXA 3SUEA 1EB2A 1RJXB 3MFJA 4ZKNU 1RFNA 2WYGA 2A5IA 1AKSB 1QRXA 1TPOA 5C5NA 4IMZA 4OS1A 5JB9S 4BXSA 2AIQA 2O8WA 4UFFH 2Q6DA 5EW1H 2BD3A 1WAYB 4X2WA 3SJIA 3U28C 1V6DA 1TX8A 1SGNE 4Z1MD 1Z8RA 3BTTE 1ELDE 1GMCF 3F2GA 2O8TA 4IMQA 3ESTA 2Z9KA 2HPQH 2EA3A 1EPTC 2ZWLH 4DIIH 1GI2A 4ZXYH 1ID5H 1HAVB 1NTPA 3VB7A 4ISNA 3MH7A 1ETTH 2XXLA 1CSOE 3TH4H 1KYNA 1AKSA 4NG9H 4NIWA 3QZQA 1YPHE 3EE0B 3DT0H 3KQCA 2BLOA 1FLEE 1OWEA 4UFGH 1GHZA 4JZEH 1C4Y2 3FZDA 1C5UA 1ABIH 3KN2A 4K1EA 3HGNA 1N6YA 3PYHA 3RXOA 3NRLA 1OHHD 1HXEH 3MI4A 4MPXA 1WQVH 2EC9H 3SU3A 3SV6A 3RM0H 2BDIA 4D9RA 1XUHA 4ZCNA 1W0ZU 4AFSA 8ESTE 2WPMS 2GP9B 2G8TA 1C5NH 2ZHQH 1EUFA 1O2OA 4CH2B 1ZMNA 1GBLA 3SUDA 1HAOH 1IAUA 1AI8H 2AMQA 2ZFRH 2ZF0H 1QR3E 3RM2H 3ELAH 2HGTH 3HATH 2EY4C 1KLTA 1W13U 5FX5A 2PV9B 2ZECA 1G37A 4XDEA 3ZYDA 1A2CH 1SGFG 1ZSKA 2GTBA 3F3BA 1B0FA 4NGAH 3B23B 3P95A 1HCGA 4MVNA 5T6FA 3EAJA 6CHAC 1SC8U 3PO1B 1C5XB 3F9EA 4NIXA 3LC5A 2AMDA 5IYTA 2NU1E 2Q6FA 4TWWA 3SU0A 1NROH 1GI8B 3K2UA 4TY7A 2NU4E 4MNYA 2ZG0H 3QZRA 2VWNA 3SYJA 4ABIA 1Y5BT 1SGYE 2XWBI 1P2MA 3F2FA 4WXVA 2STAE 4NCYA 3RXIA 1D3PB 1DUAA 1DUEA 1H9LB 4FUBA 1GMDF 3U9AH 4NFEA 2AS9A 5EXLA 2QXHA 4XE4A 2FYRA 1ZHMA 1EZUC 2LPRA 1HAVA 2Z94A 2ZHWH 5EOKA 3SORA 1MTNC 1FZZA 3Q00A 2BZ6H 1JRSA 1GWAA 2K0QA 1GVLA 1BHXF 1D4PB 5JBCS 5DGJA 1OWHA 2J97A 1C5OH 1GJ6A 3M7TA 4NWLA 4BAHB 1BMNH 1H8DH 2YMSD 4Y6DA 3ZVDA 2WPJS 5ABWA 1O2KA 2BLWA 3RXQA 2Y5HA 3TNSA 1KMHB 4FUDA 2C8WB 5LPFA 3K6YA 3SHCH 3P8OA 3EGKH 1AMHA 4ISOA 3SBKA 1K1IA 5HMAA 1E36B 1T8OA 1SL3A 3B8JA 2P3FH 1TGNA 5JBAS 5F8TA 3P8GA 1ETSH 1E35B 2J92A 2PKAB 1O3NA 1CA8B 1GCTC 1HPGA 4ZKRU 5FPYA 3S9BA 1QFKH 1DWBH 4XSKU 5E8EH 2FYQA 2P3UB 3JZ1B 5C5OA 2TRMA 1KXAA 1SLUB 1TGSZ 2M5TA 1SQTA 1K9OE 1TAWA 4I8KA 3RXMA 1MBQA 1O5BB 2ZDAH 5GNDA 4TPIZ 2FESH 3LGVA 2KX4A 1C2LA 1QA7A 4H42U 1HV7A 3VB4A 1DXPA 1FN8A 2FOFA 1A0JA 1VITF 1V2ST 3E3TA 2FP7B 3ZZ6A 1V2OT 4GLYA 5EXNA 1GBKA 2IPQX 1H9IE 2ANMH 4GHQA 4UDWH 5F8ZA 1KXBA 1WTHD 1XXDA 2WINI 1MD7A 1GMHG 3HK3B 5JDUB 3KGPA 3DCLA 4TY6A 3UY9A 4FVDA 1UJ1A 4X1SU 3A7VA 4Q7YA 3S9CA 1Z8GA 2Z3EA 1AVXA 3RMMH 2CHAC 3A82A 5C0TA 3SV9A 3SGAE 4A5TS 4CBNA 4X6OA 4NZLA 3Q77A 3UWIA 2AERH 1S0RA 1AB9B 2IN2A 3NKKA 1MMJN 3ZVBA 3F1SB 4O9VA 4U2WA 1O2ZA 4NIVA 1VGCC 3M5NA 1IQLA 3ZZ9A 1LPZB 5KEDA 3E1XB 2VB0A 2TBSA 3V0XA 4UEHH 1O36A 2XW9A 1SGIB 2PUXB 3TK9A 4X8UH 3SJ9A 1VJAU 2Y82A 1SB1H 1W11U 1ELGA 2OINA 2GX4A 1TOMH 1ARBA 4ACAA 5A0BA 2GJGA 1CQQA 4X6MA 2TIOA 1B5GH 1O3EA 1IHTH 2TPIZ 2ZDNA 4GUXA 1DPOA 3FAOA 2XNIA 4BTIB 4E7NA 3PO1C 1S0QA 2A45B 1ACBE 4FUFA 1NM6A 6CHAB 2BD8A 2FOCA 1FV9A 2ZEBA 4ZKOU 1GBMA 1ZOMA 1EX3A 1GBDA 2PSXA 3E0NB 2W5EA 2A7CA 1L4ZA 1TPSA 1XXFA 1HJ9A 1MU8B 1C9PA 3A87A 4UFEH 4Y8ZA 3RXKA 3UOUA 1SGPE 1Y3WA 4DY7B 2PP6A 1MCTA 1W2KH 2Y7XA 3MYWA 2O8LA 3LIWA 4INKA 3WW7A 2ZNKH 4YM9A 2GV6A 4LK4A 4WJG2 2FOEA 4DJZB 4BAKB 1BRCE 2BDAA 3MNSA 2ZPQA 2ZTYA 3M5MA 2QF4A 3BG8A 5EG4A 3ZVAA 2WV4A 2J9NA 2IOTA 4X1RU 5JPMH 1O2WA 1NFWA 1WSSH 2BHGA 2PR3A 2V0BA 3VXFH 1MQ6A 2B9LA 5DP3A 4K60A 3EA8A 1GBCA 1Y3YA 1GBEA 3VEQB 1VCPA 3ATIA 5C94A 1OS8A 2ALVA 1G3EA 2A4RA 3LC3A 3PB1E 3ZVGA 1KXEA 3BEFB 1CBWC 1TOCB 1O2UA 3H09A 2H9HA 1BOQA 5HM9A 5EJ1A 1ZRBA 2PKAA 1KTSB 1O2NA 1C4V2 1P57B 1EPTB 3S7KB 3LJOA 4U30A 3VG8A 4HI3A 4KELA 2SGPE 3S69A 3F0OA 5B6LA 2RCEA 1ESBA 1QQUA 1MAXA 4OM9A 2O8UA 3QO6A 4Y0YE 3WY8A 1M9UA 1TNIA 2THFB 1LVBA 4Y11E 3E91A 1KSNA 5FPSA 2FTMA 1DY8A 3P8FA 2ESTE 2G51A 4GHTA 3GYLB 4B1TA 2FOAA 2V3MA 3AW1A 1J16A 3N7DA 3GCTG 2ZFTA 3AAVA 1ZLRA 2XC0A 5FL7D 1QZ8A 1S6FA 4KTSA 1SQOA 5C3NA 1SGTA 4D8NA 4B6FA 5EJZA 1YPHC 3UWJH 4JCNA 1SBWA 1NO9H 2B5TB 2B8OH 1ZPCA 2W3IA 4H6SB 3RXBA 3UQOA 1O3LA 3LJJA 1T8LA 4OS2A 2FXRA 5HYOA 1SGRE 3SJKA 3GY5A 3S7HB 2QF0A 1F5KU 2XC5A 4MPWA 3WWBA 3KQEA 2ULLA 1GMCG 4CRBA 1G3BA 1H1BA 1O3JA 5A09A 1AUTC 1EAWA 1FPHH 2R9PA 2FLRH 4K3JA 1HAHH 1C1TA 2FZZA 1BBRE 1ZJDA 3G01A 1YCPM 2BX3A 4UE7H 2WYJA 2UWLA 1AE8H 3BG4B 2XYAA 1QJ7B 5K7RA 1UTKA 4HTCH 1C1UH 1LHDH 2QE7D 4AZ2B 4FUCA 2CK3D 1Q31A 1A3EH 1A61H 1PPCE 1WYKA 4CBOA 1A0LA 1ORFA 2B0FA 4MDSA 4X8SH 1COWD 2CV3A 5GDSH 1MKXH 1RTFB 1WTGH 1G30B 2GDEH 4NWKA 3SO3A 1Z71A 4YT6H 3RXPA 3SV7A 5DN6D 1J14A 3O8RA 3TJVA 1O2PA 1Z6JH 1N1LA 4JYUH 2C8ZB 2FEQH 1BJUA 1C5WB 2OBOA 3SNBA 3HKJB 1Z7KA 3NXPA 1V2KT 2ZGCA 4ZKSU 4AG2A 3GY8A 1BTYA 1BB0B 5DP6A 1XUGA 4AFUA 4X1PU 2PLXA 5GCHF 1W12U 1SFQB 5LH8A 3W1EA 1FXYA 2QC2A 3IWMA 3K6ZA 3P17H 3QWCH 1NC6A 2Z9GA 1TNJA 2VVVA 5JBBS 2PGQB 2QA9E 1C2IA 2XTTB 2FOGA 3QGJA 1Y3VA 3UR9A 4X2XA 1TA6A 3MNBA 2XOKD 1EXFA 3MH5A 4U32A 4F49A 3CS7A 2GVFA 1O5FH 1GJDB 2GCTC 4RT0A 1OOKB 4NSVA 1H8IH 2JH5D 1LHGH 3ZV9A 3BN9A 4K8BA 5T6DA 2BMGB 3DFJA 5C2ZA 1TQ7B 1FQ3A 1MZAA 4IGDA 4O3UA 1KXFA 4TSFD 5EIYA 3KL6A 1TA2A 2UUYA 4O03A 1GDUA 4NFFA 5C17A 3PV2A 4GAWA 3I78A 2ZC9H 2D1JA 2AHME 1O37A 3DA9B 5A8ZA 1XUKA 1E1RD 4Z6AH 1ELTA 4WF8A 2KAIA 3GY6A 1G3CA 2ANYA 3EE7A 4BAQB 4VGCC 5A0AE 1YLDA 2OC1A 3RXTA 2GV7A 2ZPRA 3RU4E 1AE5A 2ZQ1A 1QJ6B 1SGEE 1CHOG 5DG6A 2FM2A 7ESTE 4B75A 4A7IB 2ZI2H 1DY9A 1ARCA 3RXAA 4WY3A 1DICA 5TCAA 1MKXK 6LPRA 4INHA 1AU8A 2CGAA 2O9QA 3D23A 1ELVA 2ZPSA 3HK6B 2W6JD 3LONA 1GHBG 2BVSH 1GJ9B 1UCYE 3DSGA 1XMNB 3BEIB 4AGKA 2L74A 1YF4A 1NU7B 2VVCA 5CHAB 3F9HA 1DANH 1XX9A 1W10U 3UOPA 4BAMB 1GDQA 3NCLA 3URCA 1G32B 1UTPA 2OC0A 1IOEA 2VVUA 3NPSA 5DP7A 2AIPA 3PTNA 3DSOA 2ZGJA 1TRNA 2W26A 4Y7BA 2G5VA 3PMBB 2G55A 1KLJH 1C5TA 3A7ZA 3ZZ3A 1FNIA 2KFWA 3FP7E 3T2NA 1HDTH 2HVXA 3ZZDA 2SFAA 3KNXA 4GCHF 1BRBE 6GCHG 1DWCH 5IK2D 2VIOA 5T6GA 4YXWD 1FX0B 4X8VH 2ZQ2A 2R3YA 1H9HE 1O2LA 1E79D 3A7WA 4ZROA 4GSOA 1A5GH 3GDUA 2WPIS 4M9FA 1GBAA 1TGTA 1MCVA 3QGNB 4FUIA 1O2YA 3BTFE 2G4UA 3PWCA 4BNRA 2VNTA 4F48B 1FY3A 4Q80A 2G52A 2ZO3H 2SNVA 2J4IA 3MU4A 1S84A 3BIUH 1QTFA 1BHXB 1ZRKA 3PMJA 1LCYA 2A32A 1HB0B 2OBQA 1SOZA 1FUJA 2OC8A 3R0FA 1DS2E 2A5AA 4DOQA 1LQDB 1OYTH 2WHXA 1CT2E 1QY6A 3MTYA 4XFQA 5AF9H 3QN7A 1FJSA 3M5OA 4YTAA 4UD9H 2Q6GA 3F68H 4SGBE 1SR5C 4B71A 1OWIA 2K1QA 1NBME 1AWHB 5T3HA 4ASUD 1UTOA 2JETB 4WXIA 4PROA 2A2XH 3NWUA 1TWXB 2C8YB 1HAGE 1L4DA 1AIXH 2VGCB 3STJA 4AB9A 4JZDH 3ODDA 1GI0A 3E16B 4ACBA 3U8TH 3UB0A 1V2WT 2FTLE 1RRKA 4DW2U 3RXVA 2ZCHP 2ZCLP 5GCHG 3VGCC 1GJCB 2QN5T 1X7AC 4YZUA 1C9TA 1BTHH 1YPGH 1EAXA 1W0YH 3FOAA 3PROA 3DD2H 3T27A 1JMOH 1VITH 1V3XA 1GL0E 5DKMA 3TGIE 4TWYA 1BRUP 3L6PA 2J5UA 1C2EA 5EQSA 1A4WH 2GMTC 1EAIA 5HM2A 5EODA 3O8BA 1C1QA 5DJ7A 4Y7AA 3W94A 1TPPA 1W14U 3TNTA 3FZZA 1D3QB 5C1XA 1E1QD 3S0NA 1SLWB 3LDXH 3M36A 2VWMA 2PUQH 1A46H 1EKBB 1K1PA 1TQ0B 5EU8A 3T5FH 3U1IB 4BANB 4WVPE 1TNLA 1Z8JB 2QXGA 2YOLA 1THPB 3OTJE 1LDTT 1A0HB 4CR9A 4A1VA 3RXDA 3U98H 4FUGA 2IPHA 1ZHPA 3UR6A 1GHAG 3FANA 4A92A 1EZSC 1YLCA 3GOVB 1OWJA 1W3CA 1NU9A 1TIOA 1EOLA 2F4LA 2F91A 3A8CA 3OEHD 4AORA 2UWPA 1DOJA 4KKDA 1CT4E 3N99A 1G36A 5E2PA 1F2SE 2BY5X 2PWXA 3RXSA 1ANBA 1C2KA 2BVRH 4YESB 4I7YH 4DURA 2Z3DA 3V3MA 4WMDA 3ZZ4A 3QUMP 2G5NA 1O32A 2ZU3A 4X2YA 3SQHE 1BTPA 1YM0A 2KCPA 1BMAA 2HWLB 1J9CH 2LNCA 2SGAA 3FP8E 1S5SA 1GBFA 5PTPA 1JOUB 1O5DH 1P3CA 4B6EA 3SGBE 1BMLA 1WUNH 3SU4A 3TU7H 1O3KA 2HVYB 1QJ1B 2CXVA 4INLA 1NY22 4AC9A 3M7QA 2GMTB 1O3PB 1JRTA 2J2UA 3PTBA 3D62A 1MAYA 1QGFA 1QQ4A 2OD3B 5FXLA 1L1JA 1UVOA 1C5SA 3ODFA 2RG3A 3HKIB 1YYY1 2FOBA 1LO6A 1G2LA 3LGTA 3VGCB 1MZDA 2P8OB 1GG6C 4CRDA 3ZZCA 5AFZH 4DGJA 1BCUH 2F83A 2F43B 2V6NA 2Z9LA 1KDQB 2ZU1A 1IHSH 2XBXA 4B76A 2VGCC 2F9OA 2GCHF 3ATWA 3ZVFA 2JETC 4CRGA 3E6PH 1O2JA 2YMSC 4Y79A 3PWBA 1NT1A 3SV2H 1T32A 4ZH8A 4JK5A 4ISHH 4AN7A 4FETA 4CHAB 2GD4B 1H8HD 3GICB 1DM4B 5ESBA 1A5IA 1AFEH 1W7GH 4IS5A 1EASA 1S85A 3MWIU 1ESAA 2PKSB 4FU9A 1O3IA 1GHBF 1DFPA 2B7DH 1XM1A 1A5HA 5KECA 1RTKA 4AYYB 3A8BA 1XUIA 2V3HH 1FPCH 4Y76A 1NS3A 2F9VA 1HJAC 3U8RH 3T26A 4BXWA 3OU0A 3SI3H 1TBQH 3ZIAD 2ZTXA 1MTVA 1F0RA 3BF6H 3OAAD 4DG4A 2GGVB 1CGJE 1O34A 1AGJA 3PV5A 3UFAA 1C5PA 4AB8A 1GJ4H 4JK6A 1SQAA 1RXPA 1NESE 5H4IB 3PRBA 1O5AB 2G4TA 1B7XB 2FPZA 3UQVA 5CHAC 1O2SA 4JZIA 3OY6U 1C2DA 3NUMA 1Y3UA 2PW8H 7GCHG 1SGDE 3GCOA 1N8OC 5ETXA 1OSSA 2IJOB 1GBJA 1GVZA 5FPTA 1TGCA 2AH4X 1F5RA 2BQ6B 3M7UA 4I8JA 1SGQE 3MH6A 4OS5A 1PPZA 1T7CA 3UNQA 1OXGA 2R2WU 4CRAA 4ABAA 1GGDC 1NFUA 1UTJA 3KQDA 3P70B 2WSSD 5DP8A 2TGPZ 4NZQA 1LHCH 2ZCKP 2HNTC 2ZFFH 1K2I1 1NRSH 1BZXE 4WH8A 1EJNA 1L1NA 1UHBB 3DUXH 4VGCB 1GBTA 5TJXA 1QA0A 5EQQA 4ABGA 3HPTB 1BRAA 3MO3A 3ENSB 1W0KD 1MH0A 1DWEH 1WQSA 3TIUA 5DSFA 1NN6A 3U1JB 5DP5A 4Q7ZA 7LPRA 3BTHE 1BMFD 2GT7A 1MTSA 2BLQA 1F5LA 1GI6A 2P94A 1GJ8B 4WMEA 3AK5A 3CS0A 2VINA 1Z1IA 4ZHAA 1GHVH 4I8LA 3RLYH 2AYWA 1ANCA 1RTLA 1QL7A 1UHBA 5SGAE 1O3GA 1JBUH 4ABFA 6ESTA 5F6MA 2BX4A 2H2ZA 3ZV8A 1NFXA 1RIWB 3TH2H 4YOJA 4ZUHA 2W3KA 4Q2KA 1MABB 2GCTB 2V7QD 1Q3XA 1YCPH 2FX4A 2H5CA 1VJ9U 2A4GA 1XUFA 4O97A 5J4SA 1XUJA 1SI5H 3FFGA 1BITA 5EQRA 1UK3A 5A8YA 1LVMA 1UVSH 3QK1A 3SV8A 1G3DA 2Z3CA 5T1VA 3CNRA 1UVPA 4I33A 7KMEH 1OX1A 4IC6A 1C5ZB 3L3TA 4AG1A 1VR1H 2XNDD 1WV7H 3BEUA 5E2OA 2SGQE 5FAHA 1ZGVA 2HNTE 2ODQA 3RXLA 4B74A 2AGGX 3IITA 1HIAB 1OYQA 1XVMA 4Y8YA 1O38A 3M35A 3FP6E 1GI1A 1BDAA 5HKKD 2ODPA 1H8ED 1T4UH 1E38B 1FIWA 2VIVA 4DVAU 5JBTA 2ALPA 1P2NA 1TMBH 2BOKA 1MD8A 4Z0KA 4I32A 1SPJA 4AX9H 2NU3E 1Z1JA 1J15A 1L2EA 3TJOA 1BBRK 1V2VT 2FI5E 4XRNA 3UUZA 1YPJH 4RKJB 2ZDLA 5FBEA 2BLVA 2ZZUH 3MU8A 4D7FA 2H1UA 2OP9A 1PQ5A 3SW2B 1F0TA 2EI8A 4YT7H 1HYLA 5L2YH 1HXFH 3BG4C 1MKWH 8GCHF 1YC0A 2RA0A 4AGJA 3BIVH 1DDJA 3Q3KA 4ABBA 4F4OC 1LMWB 1O33A 1K21H 5C20A 4UFDH 1NPMA 4A6LA 1K22H 1O5CB 2FI3E 2KR7A 5C67A 2HPPH 2BDBA 2P3TB 1AFQC 1ANEA 5J4QA 2F9UA 4OS7A 5KGOA 4CR5A 3SNEA 3QDZB 1Y59T 1O2RA 3VB6A 2BQWB 1K1MA 3N7EA 1C2FA 2Y81A 1IQIA 1O2XA 2JIZD 1K1LA 4BTTB 1KXCA 4OS6A 1DT2A 3GCNA 4KP0A 2ODYB 3F6UH 3TGKE 2AMPA 5DP4A 1LKBA 3RXGA 3LGIA 8GCHG 1CA0B 1YCPK 1QL9A 3N7OA 4K1TA 3RXFA 2Q1JA 1VKYA 2XBWA 1C1SA 2ZP0H 1MKWK 4J1YA 1AUJA 2W7SA 1MUEB 1SLXB 1E0FD 1YLNA 1GHXH 1IQMA 1NRPH 5JYIA 3W95A 3A86A 1V2MT 2P95A 2QXIA 1ZTKA 3P8NA 3A7TA 1FY4A 2ZGBH 2OTVA 3CP7A 3T28A 4B73A 1OP8A 2ILNA 3NZIA 5FCKA 2WV5A 1P02A 3QTVH 1CBWB 3EYDA 3PLPA 2ZDMA 3A84A 2A4OA 2BXTH 1YWUA 1EATA 1OP2A 1UK2A 1O5EH 1P0SH 1CVWH 1B0EA 1BTUA 1HGTH 2RFKC 2P93A 4LXBH 1HAZB 1V2LT 1W0JD 3RXEA 1GJBB 1YPLH 3ZZAA 1FONA 3MO9A 2PTNA 1P03A 1NZQH 2ZFPH 5HXFA 1TX7A 3SZNA 1EP5A 5AFYH 3BTME 1GCDA 3U8OH 4CH8B 2J38A 3MHWU 3GYMA 1EAUA 1ETRH 5FHTA 2ZU2A 2C90B 1O30A 2BD4A 4K2YA 1E34B 4GVUA 1V2JT 1KIGH 5E0JA 3O8DA 2QGRA 1QHRB 4ZAEA 1PQ7A 5JB8S 1KXDA 1J17T 3TJUA 1P9UA 3SU1A 4ZMAH 1G2MA 1C2HA 2PFEA 1QRZA 1D6WA 2VWLA 2QIQA 2XWAA 5IDKA 2NWNA 3IG6B 5E0HA 3RXJA 2JJ1D 1F7ZA 4RT1A 3VXEH 4OS4A 1W7XH 3FVFB 3PLKA 2HALA 2FS9A 3AVZA 2BY7X 4NA7A 1WDIA 4MPUA 1BQYA 2DUCA 4A1XA 2C4FH 1CA0C 2BDHA 2QV1A 1ZSLA 1C1NA 1K28D 3DHKH 1VGCB 4TT3D 3F0PA 3SU2A 1PPFE 2QY0B 1P2JA 1PPHE 2RDLA 3KYGA 4AFQA 1ZMJA 1AN1E 2KM0A 1AB9C 1TE0A 1THRH 4ZHLU 3GY3A 1C2GA 2OK5A 1HJ8A 1HAPH 1GI7B 2ZA5A 3LKWA 8LPRA 2CHAB 2R2MB 1S6LA 3KYFA 1AFQB 3KCGH 5FX6A 4X1QU 5AVDA 3DFLA 3K9XB 2G00A 5TCCA 5DP9A 2GDDA 2BQ7B 1LPGB 3BTWE 3ATKA 4I8HA 4KGAA 3RU4T 2OXSA 5K0HA 1PYTD 2ZHEH 2BDCA 1V2RT 2VH6A 2JH6D 1P9SA 1WCZA 4B2CA 2A4QA 4JZFH 1ZTLA 3RXUA 2WUCA 1ZTJA 1DLEA 1UTQA 4I8GA 1A1RA 1ZYOA 3RMNH 1ZR0A 2WUBA 2WPKS 3VPKA 4AFZA 5DO4H 5DPAA 1FN6A 3I29A 1JWTA 3GY4A 4DT7B 2HOBA 1O0DH 3VB3A 3OEED 3TK6A 2ZDVH 5BRRE 2GKVE 3OYPA 2G81E 1C4U2 5CMXH 4IN2A 1DITH 3OSYA 2PTCE 1QL8A 3L33A 2WPHS 1PPGE 1V2NT 2XBVA 1O2QA 4ABEA 1QNJA 4QT8C 1LVYA 1GBBA 1T31A 3U69H 2KAIB 3M5LA 1O2HA 1J8AA 2AEIH 1QCPA 3NK8A 3HGPA 1GCTB 1GI9B 3EA9A 2QAAA 3A85A 4IN1A 1UCYK 2LP6A 5EGMA 2BY6X 1O5GH 4LZ4B 2BYAX 4BAOB 2FLBH 2SGEE 1RS0A 1TX6A 3RLWH 1ZPZA 2GZ9A 2ZFQH 1BJVA 4CREA 1TBRH 2PSYA 1F0SA 1K1JA 1K0HA 5GWZA 1AVWA 2A0QB 3TPIZ 3MU5A 1V2PT 2FWWA 2VH0A 1RIWC 4Y8XA 3P6ZB 1OPHB 2BZAA 2R0KA 2QCYA 5B6OA 2Y5GA 1LKAA 1NRRH 3ZVEA 3A81A 1FI8A 4ASHA 2H9EH 1QBVH 5EXMA 2HLDD 3E8LA 4K69A 2ZU5A 2GZ7A 3ATLA 4RI0A 1MTNB 2FOHA 1SOTA 4E06H 2R3UA 1V2TT 3FN8A 3A89A 1TRYA 2GZ8A 3SQEE 4IC5A 1HAYB 2UUFB 1LPKB 1P05A 4UONA 3H5CB 2JDID 4YLUA 1HIAA 2VWOA 2FODA 2O8MA 3I77A 2IJD1 1VZQH 2OUAA 4BTUB 5BPEA 4F55A 2F9PA 1UW7A 3RMOH 1BTZA 1ZSJA 4FXGH 3PV4A 3RUOA 4NA9H 3EA7A 2EQNA 1JIRA 5C1YA 4ZXXH 1GI3A 4CRFA 1O3MA 3OTPA 1K1NA 2FS8A 4K1SA 3FO8D 2FDAA 4JYVH 4O3TA 2RA3A 1TGBA 4B2AA 5G4BA 3RDZA 5FCRA 1GGDB 1UO6A 3A7XA 1P11E 2UWOA 3A80A 1KDQA 1PPEE 1L0ZA 1FY5A 3S9AA 3E90B 1N8OB 3JZ2B 3EQ0H 4K5ZA 1VCQA 1LHFH 1YBWA 1TPAE 2FMJA 5GXPA 2LELA 2P16A 2JH0D 3AAUA 2Z9IA 2NU0E 3V12A 3SGQE 3M3TA 3UAIC 1DWDH 2L6OA 3RC6A 1AQ7A 3SU5A 1CE5A 1G9IE 2P59A 3MH4A 1CHGA 1SGFA 1O3FA 1P06A 2J94A 2ZHDA 2HLCA 1OWKA 1MBMA 3LGWA 3BTEE 4SGAE 1NBMD 1BTXA 2C8XB 4D76A 1P12E 1HJAB 1DE7H 2RDEA 2ZTZA 1BBRH 1QB1A 3GY7A 3A83A 3LU9B 4ESTE 1GBIA 9LPRA 1XKAC 3C27B 1ELFA 2QXJA 1BA8B 3LH3A 5A0CA 2KZ4A 4X0WU 2PKSC 1XVOA 2A1DB 3GDVA 3LOXA 2VIWA 3EDXB 1S82A 1C2MA 1XKBC 1FMGA 1C5QA 2GT8A 9ESTA 1C1MA 1JIMA 1TFXA 1TMUH 4I86A 4M7GA 3TH3H 5EW2H 1AY6H 1TLDA 3SNCA 4CHAC 2A31A 1DLKB 1HAIH 1MQ5A 2OQUA 3V7TA 4XBDA 4YO9A 3T25A 1SG8B 2BDYA 2YMSB 1WXRA 2Y7ZA 1DX5M 4MLFB 4MNVA 1UVTH 1T8NA 8KME2 1O31A 1PQAA 3SUGA 2ASUB 2OCVB 3GS9A 1ABJH 2BB4A 2D26C 4HGCA 1O2MA 4XD7D 1GJ5H 1ZMLA 1Y5AT 3KHVA 1GG6B 2P8OC 3ZZ8A 1C2JA 1AHTH 4DT4A 4DIHH 3URDA 4DCDA 1NFYA 2K8IA 4H4FA 2M2AA 4FU8A 2A2QH 1EZXC 4K8YA 3SN8A 3B9FH 4TYDA 2J34A 1EJAA 2C93B 2WPLS 2Z6BD 3TLOA 3TGJE 1GMHF 4JMYA 3SOSA 4X6PA 1D9IA 1EB1H 1FAXA 2W6ID 1D6RA 4MPVA 3MU1A 3SNAA 3GCTF 3LGUA 4JZ1A 3RC4A 5GPIB 3KIDU 1IQHA 1P04A 2BM2A 1ANDA 1VITG 3T29A 1DXWA 1SMFE 3RU4D 2SNWA 1TB6H 4NIYA 2OC7A 3FKSD 4Y71A 2FO9A 3UNRA 4X2VA 1S6HA 2TGAA 1P2OA 3E0PB 4KTCA 1SKYE 1QB9A 3QTOH 3UPEA 5DK1A 1EP6A 1FY1A 5LPRA 2XCFA 1V2UT 1LHEH 1UTLM 4YOIA 1GPZA 3MO6A 4X1NU 5L2ZH 1ESTA 1YPKH 3V13A 3BTDE 1TRMA 1K1OA 1QURH 3GY2A 1O2VA 2BVXH 1GVKB 3F9FA 1WBGB 2STBE 3TK5A 3O8CA 1CGIE 1EQ9A 3LPRA 5I46H 1F92A 2AGIX 3RC5A 3WWFA 3AASA 2WPDD 3STIA 1ZHRA 1GL1A 3OE7D 4FU7A 1ZPBA 1IQKA 4R0IA 2BTCE 1U6QA 1EPTA 2ZU4A 3KEEA 1GBHA 3RXCA 2ZIQH 2KCYA 5LPEA 2EEKA 1HFDA 2H6MA 2I6SA 3H7TA 2BD2A 1W8BH 3PMAB 1AZ8A 1DSTA 2ZGHA 3GDSA 4FUHA 2YNBA 4ISIH 4MNXA 1FY8E 4X6NA 1C5MD 2OLGA 2UUJB 5E0GA 3M37A 2BOHB 2QF3A 1INCA 2Y5FA 1KTTB 1C1WH 2A7HA 2VBCA 2V35A 3UTUH 3A8AA 2FX6A 1C5YB 1QB6A 5C1UA 1O2GH 2BY8X 1NRNH 3C1KA 3ZZ7A 4GCHG 6GCHF 5I25A 1HNEE 5L6NH 1SQRA 4WMFA 1EJMA 4JYTA 1ZJKA 4ISLA 5ESTE 1GMDG 3KQ5A 1BMMH 1RD3B 3VFEA 1Y3XA 3F2HA 3PRDA 1ELBA 1LVOA 4RN6A 1OWDA 1PFXC 4FUEA 2Y6TA 5EPNA 1O3DA 2Z7FE 1GJAB 3BTGE 3MMGA 1L1GA 1MU6B 1IQFA 4HZHA 5C0UA 1PPBH 1A3BH 1YGCH 4WH6A 1Y5UT 3SHAH 2UUKB 1OP0A 1P10A 4BOHA 1O35A 4OGXA 4XOJA 3BV9B 4NA8A 4AOQA 2BD9A 3RXHA 1THSH 1GHYH 1UTNA 4THNH 4XBCA 2SGDE 5F8XA 5GJ4B 1CU1A 3M3SA 1PQ8A 2JKHA 1TONA 1SHHB 3GCHC 3UREA 4IW4E 1O39A 4FUJA 4XBBA 2VU8E 2J98B 5L30H 1CGHA 4RSPA 5A8XA 4HG6A 2NU2E 2ZFSA 3MQKC 1C1OA 1JXPA 3A7YA 2ZDKA 4Q4LA 2QYIA 4P00A 1FAKH 1HRTH 1PJPA 4E7RG 1D3DB 2CMYA 5HGGA 1Q2WA 1GHAF 2PHBA 4MTBA 1TYNA 5AHGH 2I6QA 1O2IA 1TNGA 3P92A 1S83A 1ELCA 1QRWA 1UVUH 1SVPA 1NRQH 2XBYA 5GIBA 2VJ1A 1LQEA 4A1TA 3TJNA 2BD5A 2JJ2D 1E37B 2VIQA 4MQAA 2HRVA 3UNSA 1CO7E 4CRCA 1HBTH 1P8VC 3A88A 3H7OA 1SGCA 1C5LH 1QIXB 4LZ1H 4ABHA 3SU6A 2WZQA 4P02A 1P01A 2CN0H 1TMTH 1T8MA 2DE8A 4ZHMU 2ZGXH 5LGOA 3TVJB 2W7UA 3MOCA 3SJ8A 2C3SA 1UTMA 2XRCA 3LT3A 4D9QA 1UK4A 1Z8IB 3TITA 4H6TA 1UCYH 3BTQE 1RGQA 2KCOA 3PLBA 2PGBB 1UMAH 3DSPA 2H9TH 1WOFA 3M3VA 3MU0A 1IQJA 1H4WA 2VIPA 3OY5U 5A2MH 1P09A 2Y80A 1MTUA 2D2DA 5CHBA 1SLVB 1S81A 4MNWA 2TGTA 3LGYA
chains in the Genus database with same CATH topology
2CJIA 3GCHB 4GPGA 1YKTA 1GI4A 4HFPB 4KTUA 4X8TH 2ANKH 2SGFE 4U01A 1C1RA 1Z6EA 3Q76A 2V3OH 3RXRA 3PM3A 2ZKSA 2A5KA 1TNHA 4AYVB 3D65E 1ZZZA 2VIDA 1YPMH 4Y10E 1O3CA 3SJOA 4E05H 1CHOF 1YP9A 3MNCA 1Y8TA 1HUTH 1FIZA 3VB5A 1F0UA 2EI7A 4YLQH 1EZQA 2D8WA 2CF9H 1QBNA 2BY9X 4MG3A 2FI4E 2OQ5A 2GCHG 2BXUH 1V2QT 3KQBA 2FOMB 3Q3YA 3QLPH 2TGDA 4Q7XA 4J2YB 1DVAH 2Z9JA 1MTWA 1BTWA 4YOGA 4ABDA 1GJ7B 1TNKA 4IBLH 2DE9A 2ANWA 1BIOA 2XCNA 2H5DA 1A7SA 3SNDA 3PMHB 2CF8H 3D49H 1GHWH 1YPEH 1P2KA 1O3HA 3KF2A 1HAXB 1AO5A 3MNXA 1IQGA 4RKOB 1WU1A 3Q3XA 3CENA 1P2IA 1T4VH 4B2BA 1PYTC 1TBZH 3ITIA 3ZZBA 5CE1A 3LH1A 2R0LA 4ABJA 1AZZA 1DSUA 2HNTF 3ZVCA 3RMLH 5FBIA 2EI6A 1KLIH 2A7JA 1IQNA 3UIRA 1TABE 2F9BH 1C1VH 3BTKE 3A8DA 4R8TB 1ZGIA 1VCWA 1O3BA 2AFQB 1O2TA 3BSQA 4WWYA 2J95A 2BD7A 2F3CE 3R3GB 4FVBA 5EPYA 1IQEA 4OGYA 1HLTH 2XC4A 2FIRH 1D3TB 1QBOA 3GISB 1GI5A 2YNAA 1C1PA 1OKXA 1SHYA 1P3EA 3ATMA 4NSYA 1ELAA 1AVGH 1GDNA 2F9NA 1LTOA 1N6XA 2ZHFH 3SUFA 3AW0A 1C5RA 1BT7A 4I31A 1O3AA 1P2QA 4Y0ZE 3F9GA 1AD8H 4D7GA 3K65B 1AWFH 1TALA 3ZYEA 1KY9A 1ELEE 4TPYA 3RP2A 1EOJA 1O3OA 1BUIA 4LOYH 3OX7U 3ZZ5A 3QX5H 2BDGA 5F03A 1FDPA 3T62A 7GCHF 3M61U 3SI4H 1C5VA 2AGEX 1CT0E 1SFIA 1SSXA 3SUEA 1EB2A 1RJXB 3MFJA 4ZKNU 1RFNA 2WYGA 2A5IA 1AKSB 1QRXA 1TPOA 5C5NA 4IMZA 4OS1A 5JB9S 4BXSA 2AIQA 2O8WA 4UFFH 2Q6DA 5EW1H 2BD3A 1WAYB 4X2WA 3SJIA 1V6DA 1TX8A 1SGNE 1Z8RA 3BTTE 1ELDE 1GMCF 2O8TA 4IMQA 3ESTA 2Z9KA 2HPQH 2EA3A 1EPTC 2ZWLH 4DIIH 1GI2A 4ZXYH 1ID5H 1HAVB 1NTPA 3VB7A 4ISNA 3MH7A 1ETTH 2XXLA 1CSOE 3TH4H 1KYNA 1AKSA 4NG9H 4NIWA 3QZQA 1YPHE 3EE0B 3DT0H 3KQCA 2BLOA 1FLEE 1OWEA 4UFGH 1GHZA 4JZEH 1C4Y2 3FZDA 1C5UA 1ABIH 3KN2A 4K1EA 3HGNA 1N6YA 3PYHA 3RXOA 1HXEH 3MI4A 4MPXA 1WQVH 2EC9H 3SU3A 3SV6A 3RM0H 2BDIA 4D9RA 1XUHA 1W0ZU 4AFSA 8ESTE 2WPMS 2GP9B 2G8TA 1C5NH 2ZHQH 1EUFA 1O2OA 4CH2B 1ZMNA 1GBLA 3SUDA 1HAOH 1IAUA 1AI8H 2AMQA 2ZFRH 2ZF0H 1QR3E 3RM2H 3ELAH 2HGTH 3HATH 1KLTA 1W13U 5FX5A 2PV9B 2ZECA 1G37A 4XDEA 3ZYDA 1A2CH 1SGFG 1ZSKA 2GTBA 1B0FA 4NGAH 3B23B 3P95A 1HCGA 4MVNA 5T6FA 3EAJA 6CHAC 1SC8U 3PO1B 1C5XB 3F9EA 4NIXA 3LC5A 2AMDA 5IYTA 2NU1E 2Q6FA 4TWWA 3SU0A 1NROH 1GI8B 3K2UA 4TY7A 2NU4E 4MNYA 2ZG0H 3QZRA 2VWNA 4ABIA 1Y5BT 1SGYE 2XWBI 1P2MA 4WXVA 2STAE 4NCYA 3RXIA 1D3PB 1DUAA 1DUEA 1H9LB 4FUBA 1GMDF 3U9AH 4NFEA 2AS9A 5EXLA 2QXHA 4XE4A 2FYRA 1ZHMA 1EZUC 2LPRA 1HAVA 2Z94A 2ZHWH 5EOKA 3SORA 1MTNC 1FZZA 3Q00A 2BZ6H 1JRSA 1GWAA 1GVLA 1BHXF 1D4PB 5JBCS 5DGJA 1OWHA 1C5OH 1GJ6A 3M7TA 4NWLA 4BAHB 1BMNH 1H8DH 4Y6DA 3ZVDA 2WPJS 5ABWA 1O2KA 2BLWA 3RXQA 2Y5HA 3TNSA 4FUDA 2C8WB 5LPFA 3K6YA 3SHCH 3P8OA 3EGKH 1AMHA 4ISOA 3SBKA 1K1IA 5HMAA 1E36B 1T8OA 1SL3A 3B8JA 2P3FH 1TGNA 5JBAS 5F8TA 3P8GA 1ETSH 1E35B 2J92A 2PKAB 1O3NA 1CA8B 1GCTC 1HPGA 4ZKRU 5FPYA 3S9BA 1QFKH 1DWBH 4XSKU 5E8EH 2FYQA 2P3UB 3JZ1B 5C5OA 2TRMA 1KXAA 1SLUB 1TGSZ 2M5TA 1SQTA 1K9OE 1TAWA 4I8KA 3RXMA 1MBQA 1O5BB 2ZDAH 4TPIZ 2FESH 3LGVA 1C2LA 1QA7A 4H42U 1HV7A 3VB4A 1DXPA 1FN8A 2FOFA 1A0JA 1VITF 1V2ST 3E3TA 2FP7B 3ZZ6A 1V2OT 4GLYA 5EXNA 1GBKA 1H9IE 2ANMH 4GHQA 4UDWH 5F8ZA 1KXBA 1WTHD 1XXDA 2WINI 1MD7A 1GMHG 3HK3B 5JDUB 3KGPA 3UY9A 4TY6A 4FVDA 1UJ1A 4X1SU 3A7VA 4Q7YA 3S9CA 1Z8GA 2Z3EA 1AVXA 3RMMH 2CHAC 3A82A 3SV9A 3SGAE 4A5TS 4CBNA 4X6OA 4NZLA 3Q77A 3UWIA 2AERH 1S0RA 1AB9B 2IN2A 3NKKA 1MMJN 3ZVBA 3F1SB 4O9VA 4U2WA 1O2ZA 4NIVA 1VGCC 3M5NA 1IQLA 3ZZ9A 1LPZB 3E1XB 2VB0A 2TBSA 3V0XA 4UEHH 1O36A 2XW9A 1SGIB 2PUXB 3TK9A 4X8UH 3SJ9A 1VJAU 2Y82A 1SB1H 1W11U 1ELGA 2OINA 2GX4A 1TOMH 1ARBA 5A0BA 1CQQA 4X6MA 2TIOA 1B5GH 1O3EA 1IHTH 2TPIZ 2ZDNA 4GUXA 1DPOA 3FAOA 2XNIA 4BTIB 4E7NA 3PO1C 1S0QA 2A45B 1ACBE 4FUFA 1NM6A 6CHAB 2BD8A 2FOCA 1FV9A 2ZEBA 4ZKOU 1GBMA 1ZOMA 1EX3A 1GBDA 2PSXA 3E0NB 2W5EA 2A7CA 1L4ZA 1TPSA 1XXFA 1HJ9A 1MU8B 1C9PA 3A87A 4UFEH 4Y8ZA 3RXKA 3UOUA 1SGPE 1Y3WA 4DY7B 1MCTA 1W2KH 2Y7XA 3MYWA 2O8LA 3LIWA 4INKA 2ZNKH 4YM9A 2GV6A 4LK4A 4WJG2 2FOEA 4DJZB 4BAKB 1BRCE 2BDAA 3MNSA 2ZPQA 2ZTYA 3M5MA 3BG8A 5EG4A 3ZVAA 2WV4A 2J9NA 2IOTA 4X1RU 5JPMH 1O2WA 1NFWA 1WSSH 2BHGA 2PR3A 2V0BA 3VXFH 1MQ6A 2B9LA 5DP3A 4K60A 3EA8A 1GBCA 1Y3YA 1GBEA 3VEQB 1VCPA 3ATIA 1OS8A 2ALVA 1G3EA 2A4RA 3LC3A 3PB1E 3ZVGA 1KXEA 3BEFB 1CBWC 1TOCB 1O2UA 5HM9A 2H9HA 1BOQA 1ZRBA 2PKAA 1KTSB 1O2NA 1C4V2 1P57B 1EPTB 3S7KB 3LJOA 4U30A 4HI3A 4KELA 2SGPE 3S69A 2RCEA 1ESBA 1QQUA 1MAXA 4Y0YE 2O8UA 3QO6A 3WY8A 1M9UA 1TNIA 2THFB 1LVBA 4Y11E 3E91A 1KSNA 5FPSA 2FTMA 1DY8A 3P8FA 2ESTE 2G51A 4GHTA 3GYLB 4B1TA 2FOAA 3AW1A 1J16A 3GCTG 2ZFTA 3AAVA 1ZLRA 2XC0A 1S6FA 4KTSA 1SQOA 5C3NA 1SGTA 4D8NA 1YPHC 3UWJH 4JCNA 1SBWA 1NO9H 2B5TB 2B8OH 1ZPCA 2W3IA 4H6SB 3RXBA 3UQOA 1O3LA 3LJJA 1T8LA 4OS2A 2FXRA 5HYOA 1SGRE 3SJKA 3GY5A 3S7HB 2QF0A 1F5KU 2XC5A 4MPWA 3KQEA 2ULLA 1GMCG 4CRBA 1G3BA 1H1BA 1O3JA 5A09A 1AUTC 1EAWA 1FPHH 2R9PA 2FLRH 4K3JA 1HAHH 1C1TA 2FZZA 1BBRE 1ZJDA 3G01A 1YCPM 2BX3A 4UE7H 2WYJA 2UWLA 1AE8H 3BG4B 2XYAA 1QJ7B 5K7RA 1UTKA 4HTCH 1C1UH 1LHDH 4AZ2B 4FUCA 1Q31A 1A3EH 1A61H 1PPCE 1WYKA 4CBOA 1A0LA 1ORFA 2B0FA 4MDSA 4X8SH 2CV3A 5GDSH 1MKXH 1RTFB 1WTGH 1G30B 2GDEH 4NWKA 3SO3A 1Z71A 4YT6H 3RXPA 3SV7A 1J14A 3O8RA 3TJVA 1O2PA 1Z6JH 1N1LA 4JYUH 2C8ZB 2FEQH 1BJUA 1C5WB 2OBOA 3SNBA 3HKJB 1Z7KA 3NXPA 1V2KT 2ZGCA 4ZKSU 4AG2A 3GY8A 1BTYA 1BB0B 5DP6A 1XUGA 4AFUA 4X1PU 2PLXA 5GCHF 1W12U 1SFQB 5LH8A 1FXYA 2QC2A 3IWMA 3K6ZA 3P17H 3QWCH 1NC6A 2Z9GA 1TNJA 2VVVA 5JBBS 2PGQB 2QA9E 1C2IA 2XTTB 2FOGA 3QGJA 1Y3VA 3UR9A 4X2XA 1TA6A 3MNBA 1EXFA 3MH5A 4U32A 4F49A 3CS7A 2GVFA 1O5FH 1GJDB 2GCTC 1OOKB 4NSVA 1H8IH 2JH5D 1LHGH 3ZV9A 3BN9A 4K8BA 5T6DA 2BMGB 3DFJA 5C2ZA 1TQ7B 1FQ3A 1MZAA 4IGDA 4O3UA 1KXFA 3KL6A 1TA2A 2UUYA 4O03A 1GDUA 4NFFA 4GAWA 3I78A 2ZC9H 2D1JA 1O37A 3DA9B 5A8ZA 1XUKA 4Z6AH 1ELTA 4WF8A 2KAIA 3GY6A 1G3CA 2ANYA 4BAQB 4VGCC 5A0AE 1YLDA 2OC1A 3RXTA 2GV7A 2ZPRA 3RU4E 1AE5A 2ZQ1A 1QJ6B 1SGEE 1CHOG 5DG6A 2FM2A 7ESTE 4B75A 4A7IB 2ZI2H 1DY9A 1ARCA 3RXAA 4WY3A 1DICA 5TCAA 1MKXK 6LPRA 4INHA 1AU8A 2CGAA 2O9QA 3D23A 1ELVA 2ZPSA 3HK6B 3LONA 1GHBG 2BVSH 1GJ9B 1UCYE 1XMNB 3BEIB 4AGKA 1YF4A 1NU7B 2VVCA 5CHAB 3F9HA 1DANH 1XX9A 1W10U 3UOPA 4BAMB 1GDQA 3NCLA 3URCA 1G32B 1UTPA 2OC0A 1IOEA 2VVUA 3NPSA 5DP7A 2AIPA 3PTNA 2ZGJA 1TRNA 2W26A 4Y7BA 2G5VA 3PMBB 2G55A 1KLJH 1C5TA 3A7ZA 3ZZ3A 1FNIA 3FP7E 3T2NA 1HDTH 2HVXA 3ZZDA 2SFAA 3KNXA 4GCHF 1BRBE 6GCHG 1DWCH 2VIOA 5T6GA 4X8VH 2ZQ2A 2R3YA 1H9HE 1O2LA 3A7WA 4ZROA 4GSOA 1A5GH 3GDUA 2WPIS 1GBAA 1TGTA 1MCVA 3QGNB 4FUIA 1O2YA 3BTFE 2G4UA 3PWCA 4BNRA 2VNTA 1FY3A 4Q80A 2G52A 2ZO3H 2SNVA 2J4IA 3MU4A 1S84A 3BIUH 1QTFA 1BHXB 1ZRKA 3PMJA 1LCYA 2A32A 1HB0B 2OBQA 1SOZA 1FUJA 2OC8A 3R0FA 1DS2E 2A5AA 4DOQA 1LQDB 1OYTH 1CT2E 1QY6A 3MTYA 4XFQA 5AF9H 3QN7A 1FJSA 3M5OA 4YTAA 4UD9H 2Q6GA 3F68H 4SGBE 1SR5C 4B71A 1OWIA 2K1QA 1AWHB 5T3HA 1UTOA 2JETB 4WXIA 4PROA 2A2XH 3NWUA 1TWXB 2C8YB 1HAGE 1L4DA 1AIXH 2VGCB 3STJA 4AB9A 4JZDH 3ODDA 1GI0A 3E16B 3U8TH 1V2WT 2FTLE 1RRKA 4DW2U 3RXVA 2ZCHP 2ZCLP 5GCHG 3VGCC 1GJCB 2QN5T 1X7AC 4YZUA 1C9TA 1BTHH 1YPGH 1EAXA 1W0YH 3PROA 3DD2H 3T27A 1JMOH 1VITH 1V3XA 1GL0E 5DKMA 3TGIE 4TWYA 1BRUP 3L6PA 1C2EA 5EQSA 1A4WH 2GMTC 1EAIA 5HM2A 5EODA 3O8BA 1C1QA 5DJ7A 4Y7AA 3W94A 1TPPA 1W14U 3TNTA 3FZZA 1D3QB 5C1XA 3S0NA 1SLWB 3LDXH 3M36A 2VWMA 2PUQH 1A46H 1EKBB 1K1PA 1TQ0B 5EU8A 3T5FH 3U1IB 4BANB 4WVPE 1TNLA 1Z8JB 2QXGA 2YOLA 1THPB 3OTJE 1LDTT 1A0HB 4CR9A 4A1VA 3RXDA 3U98H 4FUGA 2IPHA 1ZHPA 3UR6A 1GHAG 3FANA 4A92A 1EZSC 1YLCA 3GOVB 1OWJA 1W3CA 1NU9A 1TIOA 1EOLA 2F91A 3A8CA 4AORA 2UWPA 1DOJA 4KKDA 1CT4E 1G36A 5E2PA 1F2SE 2BY5X 2PWXA 3RXSA 1ANBA 1C2KA 2BVRH 4YESB 4I7YH 4DURA 2Z3DA 3V3MA 4WMDA 3ZZ4A 3QUMP 2G5NA 1O32A 2ZU3A 4X2YA 3SQHE 1BTPA 1YM0A 1BMAA 2HWLB 1J9CH 2LNCA 2SGAA 3FP8E 1S5SA 1GBFA 5PTPA 1JOUB 1O5DH 1P3CA 3SGBE 1BMLA 1WUNH 3SU4A 3TU7H 1O3KA 1QJ1B 2CXVA 4INLA 1NY22 3M7QA 2GMTB 1O3PB 1JRTA 2J2UA 3PTBA 3D62A 1MAYA 1QGFA 1QQ4A 2OD3B 5FXLA 1L1JA 1UVOA 1C5SA 3ODFA 2RG3A 3HKIB 1YYY1 2FOBA 1LO6A 1G2LA 3LGTA 3VGCB 1MZDA 2P8OB 1GG6C 4CRD