4I8HA

Bovine trypsin at 0.75 resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title On the reproducibility of protein crystal structures: five atomic resolution structures of trypsin.
pubmed doi rcsb
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8hA02
1C5WB 1GHBF 1SGFA 4D8NA 2XWBI 8KME2 1MKXK 3U98H 3PYHA 1NRQH 1EJMA 5L6NH 1ELFA 2PR3A 4OS2A 1JMOH 2GCTC 2TIOA 2OQ5A 1MBQA 2P3FH 5T3HA 4IW4E 1BJUA 2H5CA 2F9UA 1EZQA 1F92A 3FVFB 1SGTA 2A7JA 3CS0A 1UTJA 3E16B 1RGQA 1V2OT 2QCYA 3PTNA 3RXRA 1KTSB 1QJ7B 2FI3E 1Z1JA 5GJ4B 4TPIZ 1O32A 4XOJA 2GZ7A 3ZZ3A 1HJ8A 2GVFA 2OC7A 2BM2A 2R3UA 1D4PB 1VJAU 2QN5T 2BD2A 5IDKA 1YC0A 2UUJB 1T31A 4NIWA 4Y79A 3GY2A 3SN8A 5E0GA 1P3CA 1GPZA 1SFIA 4ZUHA 3A81A 1DT2A 5ESBA 1V2MT 4ZXYH 5DG6A 1AKSA 1DOJA 3KQBA 1IQLA 2VU8E 1D3PB 4OS4A 3SU0A 1YPGH 2ZFQH 2WYGA 2QYIA 1XUGA 1IQEA 1S6FA 3GOVB 1GJ5H 4KTUA 1N6YA 5FX6A 3W94A 1BRCE 3A7YA 4UFGH 4XBCA 1P02A 1C5LH 1FONA 2PWXA 1K1PA 2B0FA 4CRDA 4YOJA 2GZ8A 2ZFTA 1J17T 3V0XA 3MNCA 5A0CA 1NRSH 1UHBA 1ZMJA 5FPYA 2AIQA 1SMFE 1UK3A 3OX7U 1RJXB 3ZV8A 5TJXA 4XE4A 5HM2A 3Q3KA 3VXEH 3E3TA 1TPOA 1CU1A 2H9TH 4I8JA 5JDUB 5DP3A 4AYYB 5L2ZH 3U69H 5EG4A 4ZHLU 1O34A 2DUCA 2FYRA 2PTNA 2QXHA 3ZZDA 1P12E 2V3OH 4FU9A 2BZ6H 1FPCH 3C1KA 1TX8A 3M5OA 3V13A 4B2BA 1O2LA 1C2MA 1A0JA 4FUEA 5F8TA 2ZHDA 5DP7A 5GCHF 3RXIA 3SU2A 3TGIE 1BRAA 4X0WU 2HNTF 1GVLA 1DICA 1OOKB 1TMTH 4BAKB 1C5SA 2FOBA 2EI6A 7KMEH 1P9UA 2O8MA 1A5HA 1QL7A 5L2YH 3VB4A 3SZNA 2J38A 3M37A 1V2LT 2VWOA 1NT1A 2TGDA 3F9EA 4NIYA 1AB9B 1FIZA 1AN1E 2ANMH 4A7IB 2AIPA 4UE7H 1C1QA 1LKAA 1C1UH 1O5GH 4MG3A 1HXFH 2Q6DA 2THFB 4TPYA 4IMZA 2P8OB 2XC4A 3A8DA 4OS1A 3VGCB 4F49A 1ELEE 1Y3YA 4AGKA 5A0BA 4JZFH 4GVUA 1S0QA 5I46H 1OYQA 3BTQE 4A92A 1AVWA 1LHCH 3F1SB 1ZHMA 1C5RA 3BG4B 4OS6A 2IOTA 2QF0A 1AUJA 2J95A 2Z3DA 1GBKA 2OINA 1GJ8B 4IC6A 1O30A 1C5PA 1O3CA 2FOEA 1O3EA 3SUDA 1K9OE 1F0UA 3LJOA 1RFNA 1C4V2 1IOEA 1QRZA 1C1OA 2AGIX 2B5TB 1A0LA 1YF4A 3TVJB 2QGRA 2TBSA 2ZNKH 4GCHG 3UTUH 1C1TA 2V3HH 1ZHPA 2C8ZB 1FJSA 4CRFA 1C2GA 1D6WA 1TNLA 1YP9A 2ZG0H 1Z8GA 1ZRBA 5AFYH 1KDQB 1WBGB 1O2XA 1C2JA 2BDHA 1TYNA 5T6DA 1IQKA 3ZVAA 5LGOA 1DSUA 1CBWC 2OTVA 4ABDA 1E36B 1RTKA 4WH8A 2ZGBH 3OY6U 1AFEH 4A1VA 1FAXA 3MNBA 3UR6A 3M36A 1MCTA 4K69A 4DT7B 2WPMS 2WUCA 2FX4A 4X6MA 3STJA 2R2MB 3UOPA 4K8YA 1B0EA 4AN7A 2PTCE 4DOQA 2Y5GA 1H8DH 3MU4A 1BUIA 1O3LA 1DWDH 1EOLA 4GCHF 1HRTH 1CT2E 1LVOA 3QO6A 5T6GA 2BD4A 5C1UA 4BAOB 3I77A 3SUEA 3SGQE 2ZO3H 3PLKA 1TIOA 4YLUA 3A87A 4JYTA 5J4SA 3S9BA 1AZ8A 1O2KA 1CO7E 2BDGA 3DFJA 1O3IA 1WOFA 1GHZA 1ELDE 2BYAX 2SGFE 3TK5A 3HK3B 3SGBE 1BRBE 4ZH8A 1GBFA 3U1JB 2WINI 1J8AA 1GJCB 4UFEH 1HJAB 1UTOA 2P95A 2AMPA 1O2UA 3GY6A 1BTXA 1ZHRA 4ABJA 1YPHC 3S9AA 5DP8A 4FUFA 1ZMNA 2ZHFH 5EPYA 1C2EA 1DE7H 4Z6AH 1FXYA 1OYTH 2PUXB 1OWDA 3QGJA 3TLOA 1INCA 1EQ9A 1KLTA 2DE9A 1XM1A 1SL3A 3D62A 4ABIA 1GDQA 2ZDVH 1JXPA 1Y3UA 2A4RA 1WAYB 2GTBA 1AE8H 1IQJA 2ODPA 3T28A 1P2KA 1PQ7A 1DSTA 2WPKS 4X6PA 5F6MA 3R0FA 1HAGE 7ESTE 3UFAA 2CMYA 2CF8H 4CRAA 3QX5H 1PPZA 3RXEA 5H4IB 4DY7B 1V2QT 3K6YA 3SJKA 1UTNA 2ALPA 3PLBA 1LKBA 3LGTA 1NO9H 2CJIA 2GV6A 1SOTA 3Q00A 2Y7XA 1O2PA 1HDTH 5FAHA 1QJ6B 2C93B 3DUXH 5EW1H 1TGBA 2OC1A 1AWHB 2EI8A 3Q77A 4X1RU 1DS2E 3LGIA 2A2QH 2QC2A 3P8NA 3LH3A 1G3EA 3SO3A 1FY3A 1FY8E 3RXBA 3VEQB 2BVSH 2ZU3A 4YOGA 1TGSZ 3IWMA 3W95A 4O9VA 1SGPE 1YPJH 1AY6H 2A7HA 2FTMA 3VGCC 3RC6A 2W3IA 1XXDA 4MNYA 2P3UB 1QA7A 4RN6A 1SI5H 2SGAA 3HPTB 4NSYA 3U9AH 1TQ0B 1NESE 1KIGH 3QTOH 3NCLA 2ZDMA 1GVKB 1NRPH 1SPJA 1C5MD 2FWWA 5E2OA 7GCHG 1LPZB 1IQNA 1DX5M 1QB1A 1BJVA 5C5OA 1BB0B 3DHKH 3NKKA 4Y7BA 1RS0A 4YOIA 4IGDA 2Q6GA 3SU5A 2HPQH 1QL8A 1T8OA 3KNXA 1Q31A 1O35A 1V2RT 1FQ3A 4XSKU 1G3CA 3EE0B 1XUFA 1N6XA 4O97A 2PLXA 2VWMA 3UPEA 1C1WH 4NZQA 1F0RA 1ZMLA 1TA6A 2BB4A 1TABE 1WQVH 2VIOA 3TU7H 2BLWA 1F5LA 3ZZAA 1EASA 1MD7A 2PV9B 1DWCH 2HNTE 1RXPA 4X2YA 7GCHF 1GL1A 1NFXA 3OSYA 3AW0A 1UTLM 5C20A 2HLCA 3FP8E 4YZUA 5FBEA 3A80A 5EXMA 3BTDE 3SNEA 5A8XA 1WQSA 1PPGE 2Y81A 1VITG 4D7FA 4U2WA 1GWAA 1ZGIA 3BIVH 4CR9A 1GMHG 4KTCA 1HAIH 3EA9A 1AD8H 1C5ZB 1HXEH 2R0LA 4AYVB 2FODA 4M7GA 3A88A 2WV5A 2VWNA 2HPPH 1P0SH 5AF9H 3RXPA 2OBOA 1BZXE 1LTOA 1KLJH 1L1GA 2IJOB 3SJOA 2P93A 2BLQA 5K0HA 1O5AB 1VCPA 3P70B 3VXFH 1SLVB 2GT8A 1PYTC 3DFLA 3SQHE 1EXFA 1VITF 3TIUA 1GMHF 1TA2A 1HAOH 3S7KB 1GJ4H 2BD8A 1KSNA 1A7SA 2NU1E 1MU8B 1T4VH 4U01A 4XBBA 3E1XB 2Z7FE 4U30A 1GI7B 4X8UH 4SGBE 2OQUA 3GYLB 4OS5A 1GBDA 4Q2KA 3B23B 3RXLA 3GDSA 1XX9A 4ZHMU 1GMCG 3PB1E 1NFWA 1LVYA 4MVNA 1TGTA 3LU9B 1DLEA 1O2TA 2A5IA 3RXFA 3AAUA 3FP6E 1C4Y2 3BTWE 4IC5A 1LHDH 1HPGA 4INHA 5GDSH 2OC0A 1LPGB 4RKJB 2BX3A 1O2HA 1TB6H 4IS5A 3O8CA 1MBMA 4FUDA 2V35A 3KF2A 4UFFH 2ZTZA 1NU9A 4JZIA 1CBWB 1ETTH 1MTVA 4J1YA 3PMBB 4DGJA 1T8NA 4DURA 3MNSA 1ZJKA 5DK1A 4CRGA 1GCDA 3M5LA 7LPRA 2ZZUH 1GMCF 1Y8TA 2Z9GA 3LPRA 2ZGCA 4B2CA 4AOQA 1YGCH 4ZKSU 1MQ6A 2XC0A 1YPKH 2G55A 1KXCA 4AFUA 1GBBA 4ZMAH 1QJ1B 1SG8B 2F3CE 3RXVA 5DP6A 1JBUH 2Z6BD 4K60A 1IQMA 1CA8B 3UR9A 1YLDA 3RXKA 2VVUA 1JWTA 1FMGA 3M3VA 4H4FA 1P06A 2ZFPH 1Z1IA 1B5GH 2J92A 4DJZB 5C2ZA 1E37B 5HMAA 2XNIA 3V12A 2ZGXH 1KXEA 2LNCA 1HAHH 3GY4A 3U8OH 2FIRH 1FLEE 2FP7B 4B76A 1SSXA 1RRKA 5DPAA 1H8IH 2ESTE 4IN1A 4FXGH 1ARCA 1TPAE 3QLPH 1G3BA 1UMAH 4CBNA 1DY8A 2ZQ2A 1QBNA 2CF9H 3M35A 1NZQH 1CGIE 2CN0H 2FS9A 1Z6JH 1G32B 2G51A 3MO9A 1AQ7A 3GCNA 5BRRE 1NN6A 2RCEA 1S0RA 2ODYB 5C67A 2A32A 5CE1A 4GPGA 3RXSA 4NIVA 4ZXXH 2G5NA 1OP8A 2IN2A 2BQ6B 3NUMA 1GI8B 8LPRA 1FZZA 1ELAA 5DP5A 1FNIA 3MOCA 1VGCC 1QHRB 1JRSA 5A0AE 4MNVA 1DUAA 1TNIA 1SBWA 1TMBH 3SI4H 1PPEE 5PTPA 1BQYA 1P2JA 2BY8X 1O2ZA 4D9QA 1GBLA 1A2CH 2PUQH 1VCWA 2J4IA 3S69A 4MPVA 1O3NA 2FI4E 4D7GA 1ABJH 1U6QA 1TPPA 3HATH 1AO5A 4NGAH 3RXCA 2ZHQH 1K21H 2BLVA 1SGRE 1S84A 2ZDKA 1C4U2 3ATIA 1FIWA 1KYNA 2ZHWH 1EZSC 3QWCH 3A82A 3RXHA 4LZ4B 2F83A 2ZQ1A 1HJ9A 1UTMA 2Q1JA 1GVZA 3RXJA 1A0HB 1Z71A 2XBYA 3K65B 2EC9H 3MYWA 3RXQA 1ANBA 1BBRH 1MKWK 1W11U 3M7QA 4YO9A 2ZCHP 3RM2H 2PKAB 4B1TA 1L2EA 2A45B 2JH6D 3UWIA 1HNEE 1SGEE 1CSOE 1EAUA 1ELBA 3FFGA 5C1XA 1K1JA 1S5SA 1CQQA 1THSH 1BMLA 2ZGHA 4E7RG 1BRUP 2Y7ZA 3F6UH 1EJNA 2A4GA 1GHVH 3NK8A 1O3OA 3ATWA 2ZEBA 1NU7B 5HYOA 4AFZA 3MU1A 3SQEE 3FAOA 1TNHA 1YPLH 1ESBA 1O5FH 2BY9X 2A2XH 3UNQA 1A5IA 4PROA 1PQ5A 3BG8A 3TNTA 1IQGA 3ZZCA 2VB0A 1YCPK 1QB9A 2ZTXA 2BD3A 4B71A 1FI8A 2D2DA 1KXDA 4NA8A 4Y8ZA 4NFEA 5GXPA 2XXLA 2W7SA 1P2OA 3DD2H 2YOLA 4CRBA 3MU5A 1NRNH 2ZIQH 2BQWB 1YPHE 1YYY1 5TCAA 1O2NA 1O33A 2R9PA 4UEHH 2PGQB 4FU7A 1P05A 2BD7A 1C9PA 2BQ7B 1O2IA 2VIPA 3BF6H 3RMLH 4KKDA 1O3HA 4AGJA 2Z9KA 1PPHE 1BMNH 1NRRH 1AHTH 4DW2U 1ANCA 3BSQA 1FPHH 1C5UA 2Y80A 1MTUA 5C1YA 4MNXA 2O8TA 1PQ8A 2ZC9H 2ZPQA 1UTPA 4B74A 2FTLE 2Y5HA 5BPEA 1S83A 4HFPB 3SU6A 2AGGX 4ZHAA 2NWNA 2BOHB 3VFEA 4K1EA 5JYIA 5FCRA 2TGAA 5LPEA 3SOSA 1K1LA 5EXLA 1WU1A 4KGAA 1PYTD 5JBCS 4I8LA 3MH7A 1GBMA 2QXJA 1TX7A 3AAVA 1C1VH 3H7TA 3KQDA 1ELTA 2FM2A 2OP9A 4ABHA 1K1MA 5F03A 1O2WA 2FS8A 2J9NA 1DFPA 1GHAG 4I31A 1GL0E 1C1NA 4KTSA 3GCHC 1SGFG 2NU3E 3K2UA 1ZPCA 5EW2H 2AMQA 1EJAA 3TK6A 4BXSA 3LKWA 1H9LB 1ID5H 3KGPA 1J16A 5DP4A 3U8TH 3ATLA 1Y3XA 3TJUA 2C4FH 2FXRA 2ILNA 5SGAE 1KTTB 1FAKH 2BDIA 1UTKA 1AE5A 1ELGA 3ODFA 9ESTA 4FUBA 1F7ZA 1GI6A 4TYDA 1P04A 1A5GH 2A4OA 1O3GA 3ELAH 2D8WA 3OTJE 5J4QA 2ZTYA 1C5OH 5EPNA 1PFXC 1GHAF 4FUGA 3GICB 4MPWA 1HBTH 1OWJA 1GHYH 4OS7A 2W3KA 1H9IE 2BDAA 3RXTA 4O03A 3L33A 1SGDE 1SLXB 2CGAA 3PO1C 1IQIA 1GJ7B 2BOKA 4CR5A 3PMJA 2VH6A 1RTLA 1AZZA 1IHTH 4FVBA 4R0IA 3MWIU 1S81A 1KY9A 1GBTA 3HKIB 2BXUH 1EB1H 4NA9H 4JZEH 3BTFE 1BTWA 3B8JA 2BY6X 4LZ1H 2ZKSA 3P8FA 4I8HA 1JIMA 1JRTA 1TLDA 4DIHH 2R0KA 5AVDA 5FXLA 1V2NT 1C2DA 1B0FA 5TCCA 3SU4A 1C2KA 1P09A 2HOBA 1Q2WA 3RC4A 4AX9H 1GBHA 3F9GA 3MH6A 1V2WT 1J15A 1TBQH 1AIXH 1XUHA 2G4UA 5A09A 2FLBH 3A83A 3ESTA 2B7DH 3MHWU 2H6MA 4KELA 1WCZA 3SBKA 2Z3CA 3NZIA 1MZAA 1CA0C 4AZ2B 3RXGA 4MDSA 2H9HA 4RKOB 1VGCB 4LOYH 2HVXA 2ANYA 3OU0A 3G01A 4X6OA 1QNJA 1QCPA 2C8XB 3RXOA 4DVAU 2GX4A 1O3DA 2VIDA 1WYKA 1YCPM 2KAIB 2HGTH 3PV4A 3TJOA 2G5VA 5C5NA 1BTZA 1AU8A 3N7OA 1G2MA 2G52A 5ETXA 3SJIA 5E8EH 3ZZBA 1HAPH 3KQEA 3RMNH 4D76A 4CRCA 3SORA 1L1NA 3BTME 1T4UH 1HIAB 2GDDA 5EOKA 1SR5C 1EP5A 1RD3B 2XWAA 1EZXC 4B73A 1QA0A 1QQ4A 4E05H 1MD8A 1EZUC 2ZU5A 1ZTJA 3B9FH 5EU8A 1RIWC 4VGCC 2YNAA 5E0HA 2ZFFH 1HLTH 5HM9A 1LQEA 1GHXH 5FPTA 3P92A 2GV7A 1NTPA 4AB9A 3A7XA 3URDA 4UFDH 4BANB 3KN2A 4WVPE 4Q7YA 2RDLA 2GMTC 2F91A 2J2UA 3P8GA 3T25A 1GMDG 3TK9A 4AORA 3BTEE 4Q80A 1ZPBA 3SNDA 1MAYA 6ESTA 1V2TT 3GY7A 3VB7A 4JYVH 5GWZA 2P94A 1LQDB 4GAWA 2CV3A 2G81E 4K3JA 4IMQA 3RP2A 3UY9A 4A1XA 3TGJE 2OXSA 3TJNA 1O2YA 4XBDA 4NWKA 4D9RA 2I6SA 1ORFA 1L4ZA 2WPJS 5GPIB 1OP2A 1XUKA 2P16A 1P57B 2GP9B 2QIQA 1QY6A 1TOMH 1ZOMA 4WH6A 3VB3A 1TPSA 4ISIH 3ZV9A 2A1DB 3ZVBA 3T29A 1GBJA 1O5EH 3RU4D 1VCQA 2QY0B 3BN9A 1GMDF 1HFDA 2VGCC 1E0FD 3TH3H 1EPTC 3RDZA 1SHYA 1TQ7B 2FOCA 3PM3A 4ASHA 3CS7A 3MMGA 1V2JT 1AKSB 4TWYA 3O8DA 1LCYA 3A86A 3FP7E 3JZ1B 1UVOA 2A5AA 1F2SE 4ABFA 3S0NA 1C1SA 1QL9A 2QV1A 2A0QB 6CHAC 2Z94A 2C8WB 5EODA 1DY9A 1MKXH 5EXNA 1WSSH 1T7CA 1QBOA 5EQQA 5K7RA 1KDQA 4HI3A 5CMXH 2GCHG 3A8AA 2Y6TA 1TNKA 3M61U 3KIDU 2AYWA 4YT6H 1SHHB 3E8LA 2PW8H 3SV2H 1O5CB 3KQCA 3PROA 2BXTH 3QZQA 1SQAA 3A7VA 5FHTA 2ALVA 3QUMP 3D65E 4X1NU 1ZZZA 1GI5A 5AHGH 5C3NA 3M5NA 2BVRH 4X2VA 1XXFA 1G3DA 2VVVA 1GBAA 5I25A 4Y0ZE 1HGTH 1SGQE 4ZROA 4ISNA 4DCDA 1GI2A 1NPMA 1ARBA 3QGNB 1EATA 3C27B 4ABBA 3TH4H 2FMJA 3A8CA 1WV7H 1V2PT 4TY7A 1FY4A 3SHCH 1AGJA 1EP6A 4Q7XA 1D3DB 2FOGA 4ABGA 1SGNE 1GCTC 1UK4A 3AASA 2ODQA 3SGAE 3ZVGA 1YPMH 3GCHB 4IN2A 2YNBA 1MZDA 2VJ1A 1SVPA 1MUEB 2VNTA 3K6ZA 2BMGB 3S7HB 1GG6C 4Y10E 1W3CA 1MTNC 1ZSJA 2PKSC 4DIIH 1K1IA 3MO3A 3SU1A 3GISB 1GGDC 1O5BB 3EDXB 1TGNA 4I8KA 4NSVA 2ZCKP 4AG1A 1HB0B 2SFAA 4WWYA 2SGQE 1KXBA 1TOCB 2BDYA 3LIWA 4YM9A 8ESTE 3F9FA 1A3EH 2A4QA 3E91A 1LDTT 4ZAEA 1D9IA 2OD3B 1F0TA 3BTHE 1UTQA 1TONA 1TNJA 3P17H 3PO1B 2Q6FA 4LXBH 1OX1A 4NA7A 3RU4E 1W13U 1QIXB 1D3TB 3LONA 1LHEH 3URCA 3RUOA 4Y8YA 1PQAA 1YCPH 1UVTH 3BV9B 4WXVA 2DE8A 3MTYA 2XBWA 4KP0A 1O2RA 3Q76A 3SV6A 1THRH 4Q7ZA 1C5NH 5FCKA 1N1LA 4YTAA 1CGJE 2BZAA 3BEUA 3QK1A 4AG2A 1H9HE 3RXUA 2RG3A 2EA3A 3SW2B 4MNWA 2H9EH 1W7GH 2G00A 3V7TA 1Y3VA 4BXWA 4A6LA 2FX6A 1GHBG 1GI1A 3BIUH 3ZVCA 1Z8RA 1FN8A 3IG6B 5JB9S 4FUIA 3ZZ7A 4X1QU 4JYUH 1NM6A 1DDJA 1S6HA 1O5DH 3GYMA 5JPMH 1CA0B 3AW1A 4GHQA 3SNCA 4MQAA 1IHSH 3STIA 2AS9A 3EA7A 3UIRA 3GY5A 1Y5UT 4FU8A 2CXVA 2XBXA 3NXPA 1LHGH 1QRXA 1JOUB 2BDCA 3RM0H 3GY3A 4Z0KA 1H1BA 1O0DH 3MU8A 5CHAC 5A2MH 4BAQB 4YLQH 1O3MA 2W26A 4JZ1A 1ZGVA 2BY7X 1AMHA 1AVXA 1LVMA 4B75A 1ESAA 3MFJA 3PTBA 1RTFB 1S85A 1P10A 1XMNB 1BITA 3M3TA 2PSXA 2F9BH 1C1RA 1K1OA 2F9PA 2XYAA 1E38B 3EGKH 2V0BA 3ZZ9A 4ABAA 4GHTA 4MTBA 4INLA 1Z8IB 3EYDA 3CENA 1RIWB 3PMAB 4IBLH 4VGCB 1GDNA 2I6QA 4U32A 1TRYA 4JZDH 2A31A 1K2I1 2F9NA 1TRNA 2BHGA 2XC5A 3SNBA 2SNWA 4WMEA 1M9UA 2ZU4A 3ITIA 2XRCA 4E06H 4J2YB 2UWPA 1PPCE 2Z3EA 2F9VA 5T6FA 1BHXF 2OUAA 1BCUH 5JB8S 2GMTB 2XTTB 1NROH 3T27A 1LPKB 1CT4E 1G9IE 4O3TA 2ZF0H 4GSOA 4ZKRU 1MCVA 3SUGA 4JK6A 4NCYA 5B6OA 1O38A 3M5MA 3RU4T 1DANH 3BEFB 2H2ZA 4INKA 2JKHA 3LGVA 2BX4A 1C5VA 3A7WA 4FUJA 2GKVE 2QA9E 2D1JA 4Y76A 2JETB 2PFEA 3SJ8A 1EUFA 2HWLB 2J94A 3VB6A 3NWUA 3UQOA 5GCHG 1CE5A 1DPOA 1ZTLA 3A84A 1EAIA 3F9HA 1FN6A 1ETSH 1OSSA 1KLIH 3S9CA 3P95A 2VGCB 1EPTB 2ZCLP 4NFFA 1O37A 4E7NA 2XBVA 1NFYA 4A1TA 3M7UA 3I29A 1CHGA 8GCHG 5EGMA 2CHAC 1WUNH 1KXFA 1FUJA 1C1MA 3ZYEA 3MI4A 2WPHS 1ZPZA 2FYQA 1TRMA 1IQFA 4Y8XA 2BY5X 1HAVB 3M7TA 2ANWA 2TRMA 2PGBB 2FI5E 3ZVFA 6CHAB 3MH5A 3KEEA 3E90B 5G4BA 2TPIZ 4H6SB 1D6RA 3VB5A 3T5FH 1CT0E 1N8OC 1C2LA 5ESTE 1TAWA 1UCYK 1ELCA 1HYLA 1KXAA 1TNGA 2IPHA 2Z9LA 4WF8A 3TJVA 3RXDA 4HGCA 1DLKB 3LOXA 2ZA5A 5JBAS 8GCHF 2AGEX 1DVAH 2ZDAH 3A89A 1OXGA 1L4DA 1W12U 2QAAA 3MU0A 1ZLRA 4SGAE 1ETRH 3BEIB 2UWOA 2ULLA 2WPIS 1OWHA 1GJAB 4YESB 1XUJA 2SNVA 1AFQB 4JK5A 2NU0E 1C9TA 2ZDNA 1L1JA 1C5TA 1C5YB 5LPRA 1J14A 1Y5BT 1QTFA 1T8LA 1GCTB 1O31A 3A85A 1C2FA 3ZZ5A 2OC8A 1A1RA 1MQ5A 3T62A 1SGIB 5EQSA 1PPFE 2H1UA 4ISOA 1EKBB 3SUFA 1VITH 5DGJA 3FZZA 1FY5A 1MMJN 1W10U 1BHXB 2GGVB 2ZHEH 1C5XB 1Q3XA 1XVOA 1GG6B 1MTNB 2PKSB 4CH8B 4ISLA 2FZZA 6GCHG 4WY3A 1GGDB 1FDPA 1BOQA 2C90B 1YM0A 3HK6B 3LT3A 4AFSA 3UREA 1SOZA 4BNRA 2F9OA 1EAWA 1ANEA 1O36A 1SFQB 3ATKA 1BTPA 3F68H 1W0ZU 2GD4B 4CREA 4CHAB 3EQ0H 1MH0A 1BBRK 2R2WU 1W2KH 2O8LA 4MPXA 3LH1A 6LPRA 5JBBS 5FPSA 2FO9A 3AVZA 3WY8A 2SGDE 1BT7A 4LK4A 4FUCA 4DG4A 1P9SA 2ANKH 3QTVH 1Z6EA 1L0ZA 3KL6A 2B9LA 4ISHH 5DP9A 3UNSA 1O2SA 2B8OH 1F5KU 3RLWH 6GCHF 1C5QA 1TFXA 2G4TA 4X8VH 1QBVH 3RC5A 4Y0YE 5LH8A 3DT0H 1ZJDA 1O3KA 1QFKH 1O2VA 3RMMH 1Y59T 2AFQB 1MU6B 1BTYA 1K28D 4AB8A 2JH0D 3SI3H 5A8ZA 1HCGA 4I33A 2FESH 4FUHA 2VIVA 4AFQA 2TGTA 3L6PA 1GBEA 3LGYA 4UD9H 1P2NA 1XVMA 1LHFH 2RA3A 1ABIH 3LJJA 2ZP0H 3PWCA 1K1NA 2O9QA 2P3TB 1YBWA 2VWLA 1SGYE 1GJ9B 3TH2H 1WTGH 1UVUH 5A8YA 2QXIA 2QF3A 3UQVA 1O39A 1DXPA 2AMDA 1C2HA 2RA0A 3RXMA 3V3MA 2ZDLA 3PLPA 3P8OA 1P2IA 3EAJA 2ZFRH 1XKAC 1BTUA 2XCFA 3MH4A 1O3JA 3E6PH 2PKAA 4A5TS 2FPZA 4QT8C 1SLUB 1E34B 1QB6A 5ABWA 3QDZB 1ANDA 4NWLA 4NG9H 2UUYA 4OGXA 2WV4A 3UWJH 4X2XA 2ZWLH 5CHAB 1PPBH 3CP7A 4UONA 1NY22 3SU3A 1YLCA 3NPSA 1T32A 1W14U 2OLGA 3PMHB 5F8XA 2EEKA 1O2GH 2BTCE 2QXGA 2A7CA 1MAXA 1S82A 2AH4X 1O2JA 2GCTB 5DO4H 1EAXA 1V2ST 4K1TA 1V2UT 3IITA 3TNSA 1Y5AT 2HRVA 3FANA 3QN7A 2ZU1A 1GHWH 2BD5A 3LDXH 4I7YH 1O3FA 1XKBC 5EQRA 2Z9IA 3SHAH 1EX3A 5FX5A 1SC8U 1A3BH 1TALA 4UDWH 3PWBA 1DITH 2SGPE 3VPKA 4X8SH 4GUXA 3O8RA 1UO6A 2ZFSA 1SGCA 3SV7A 4BAHB 1MTSA 1EB2A 1EPTA 1ESTA 2R3YA 4K1SA 1A4WH 2EI7A 3H5CB 2SGEE 1BMMH 1TGCA 1DWBH 1PJPA 1AVGH 1O2OA 2C8YB 4X8TH 2ZPRA 3Q3XA 1OWKA 2GT7A 3KHVA 4XDEA 2UUFB 1TWXB 1HAVA 1NC6A 2ZECA 4BOHA 2PHBA 3SV8A 2ZI2H 5E0JA 2WUBA 1C1PA 1W7XH 4X1SU 1J9CH 4TWWA 1YKTA 1ZSKA 2A5KA 2FOHA 4X1PU 1G36A 1P01A 4I32A 1GBIA 4CBOA 1UK2A 1G37A 2JETC 4WMDA 1O3BA 1TBRH 3ZZ6A 1NS3A 5DJ7A 1MTWA 1IAUA 1G30B 1T8MA 1TX6A 1BTHH 1XUIA 2ASUB 2HALA 5HGGA 3LC5A 1ZYOA 3T2NA 2STBE 1K22H 3RLYH 1OWEA 3SNAA 4OGYA 5AFZH 1TMUH 1HUTH 2XCNA 3SV9A 2CHAB 5L30H 1CGHA 4NIXA 4BTTB 3GCTG 2XW9A 5LPFA 1GDUA 1GI4A 4K8BA 1JIRA 3UNRA 1SQOA 2WPLS 1FV9A 1O2QA 4XFQA 1C2IA 1P2QA 1O3PB 3D49H 1F5RA 1QQUA 4ZKOU 1IQHA 2JH5D 4Y71A 1N8OB 2VVCA 4TY6A 4HZHA 3E0NB 3BTGE 1BMAA 3HGPA 1A46H 3K9XB 3ZZ4A 3Q3YA 4Y7AA 3BTTE 3GCOA 1ZTKA 4HTCH 3U1IB 1GI3A 1F0SA 1UHBB 2H5DA 3P6ZB 2AEIH 3KCGH 3ZYDA 1W0YH 3BTKE 3ZVDA 1A61H 4I8GA 1B7XB 3ENSB 1QRWA 3GCTF 1TBZH 3LGWA 3OY5U 3U8RH 1AB9C 2D26C 4K5ZA 1VR1H 1P03A 3L3TA 2C3SA 2GZ9A 4WJG2 4Y11E 2OCVB 3TITA 5JBTA 4BTUB 4YT7H 3MO6A 1LVBA 3E0PB 2OBQA 3T26A 4F4OC 2O8WA 3GDUA 1TE0A 4JMYA 2P8OC 3RXAA 1BIOA 5GIBA 1EOJA 2FOAA 4BTIB 1GI9B 1AFQC 4B2AA 1AWFH 1VZQH 1UVSH 2GCHF 1CHOG 2Z9JA 3QZRA 3SJ9A 2VIWA 3BG4C 1NFUA 4THNH 4ESTE 2ZU2A 1DXWA 4FVDA 2NU2E 3LC3A 1LO6A 1P11E 3EA8A 3ODDA 1MKWH 4H6TA 2VIQA 2FOMB 1FY1A 2VH0A 2FOFA 2O8UA 1D3QB 3R3GB 5FBIA 4JCNA 1QURH 2LPRA 5F8ZA 4K2YA 4O3UA 1HAYB 3I78A 2PSYA 1AUTC 1LMWB 3GDVA 2GDEH 1DWEH 2TGPZ 4MPUA 2W7UA 1O2MA 1BDAA 4X6NA 1CVWH 1G2LA 2NU4E 4R8TB 1V2KT 3HKJB 2W5EA 1V6DA 1CHOF 3TPIZ 2BD9A 3A7TA 3M3SA 2K1QA 3ZZ8A 1THPB 4Y6DA 2V6NA 4CHAC 3HGNA 1ACBE 1UCYE 1UVPA 1SLWB 4ZKNU 1QR3E 3MNXA 9LPRA 3A7ZA 2VINA 3OYPA 5IYTA 3ZVEA 1E35B 4WXIA 1ELVA 2AERH 1HAZB 2Y5FA 1AI8H 1SB1H 1DUEA 3O8BA 4ABEA 3A8BA 1Y3WA 4RSPA 3LGUA 1OWIA 1BA8B 2M5TA 1GJDB 1GJBB 2FDAA 3DA9B 1GBCA 2UUKB 1GI0A 3JZ2B 5HXFA 4H42U 1Z7KA 2KAIA 3FZDA 1V2VT 4MLFB 4NZLA 3RMOH 1OPHB 2Y82A 2HNTC 2WYJA 5DKMA 1QGFA 1HAXB 3ATMA 1WTHD 1HV7A 1ZSLA 1ZR0A 2BVXH 2FEQH 2ZPSA 1P8VC 2ZGJA 4BAMB 1HJAC 1P2MA 3GY8A 1O3AA 3UUZA 1P3EA 1HIAA 1UCYH 1OS8A 3H7OA 1UJ1A 1VJ9U 2FLRH 1YPEH 2BDBA 4CH2B 4GLYA 3D23A 1V3XA 2P59A 1SQTA 3UOUA 1W8BH 5E2PA 1OP0A 1OKXA 1ZRKA 2UWLA 1DM4B 1H4WA 2J34A 3TGKE 1BBRE 1X7AC 1GJ6A 4WMFA 2STAE 1Z8JB 4X2WA 2BLOA 2G8TA
chains in the Genus database with same CATH superfamily
1C5WB 4P00A 1GHBF 1SGFA 4D8NA 2XWBI 8KME2 1MKXK 3U98H 3PYHA 1NRQH 1EJMA 5L6NH 1ELFA 2PR3A 4OS2A 1JMOH 2GCTC 2TIOA 2OQ5A 1MBQA 2P3FH 5T3HA 4IW4E 1BJUA 2H5CA 2F9UA 1EZQA 1F92A 3FVFB 1SGTA 2A7JA 3CS0A 1UTJA 3E16B 1RGQA 1V2OT 2QCYA 3PTNA 3RXRA 1KTSB 1QJ7B 2FI3E 1Z1JA 5GJ4B 4TPIZ 1O32A 4XOJA 2KCYA 2GZ7A 3ZZ3A 1HJ8A 3W1EA 2GVFA 2OC7A 2BM2A 2R3UA 1D4PB 1VJAU 2QN5T 2BD2A 5IDKA 1YC0A 2UUJB 1T31A 4NIWA 4Y79A 3GY2A 3SN8A 5E0GA 1P3CA 1GPZA 1SFIA 4ZUHA 3A81A 1DT2A 5ESBA 1V2MT 4ZXYH 5DG6A 1AKSA 1DOJA 2WZQA 3KQBA 1IQLA 2VU8E 1D3PB 4OS4A 3SU0A 1YPGH 2ZFQH 2WYGA 2QYIA 1XUGA 1IQEA 1S6FA 3GOVB 1GJ5H 4KTUA 1N6YA 5FX6A 3W94A 1BRCE 3A7YA 4UFGH 4XBCA 1P02A 1C5LH 3DSGA 1FONA 2PWXA 1K1PA 2B0FA 4CRDA 4YOJA 2GZ8A 2ZFTA 1J17T 3V0XA 3MNCA 5A0CA 1NRSH 1UHBA 1ZMJA 5FPYA 2AIQA 3KQ5A 1SMFE 1UK3A 3OX7U 1RJXB 3ZV8A 5TJXA 4XE4A 5HM2A 3Q3KA 3VXEH 3E3TA 1TPOA 1CU1A 2H9TH 4I8JA 5JDUB 5DP3A 4AYYB 5L2ZH 3U69H 5EG4A 4ZHLU 1O34A 2DUCA 2FYRA 2PTNA 2QXHA 5HKKD 3ZZDA 1P12E 2V3OH 4FU9A 2BZ6H 5F53A 1FPCH 3C1KA 1TX8A 3M5OA 3V13A 4B2BA 1O2LA 1C2MA 1A0JA 4FUEA 5F8TA 2ZHDA 5DP7A 5GCHF 3RXIA 3SU2A 3TGIE 1BRAA 4X0WU 2KR7A 2HNTF 1GVLA 1DICA 1OOKB 1TMTH 4BAKB 1C5SA 2FOBA 2EI6A 7KMEH 1P9UA 2O8MA 1A5HA 1QL7A 5L2YH 3VB4A 3SZNA 2J38A 3M37A 2L74A 1V2LT 2VWOA 1NT1A 2TGDA 3F9EA 4NIYA 1AB9B 1FIZA 1AN1E 2ANMH 2K8IA 4A7IB 2AIPA 2PP6A 4UE7H 1C1QA 1LKAA 1C1UH 1O5GH 5T1VA 4MG3A 1HXFH 2Q6DA 2THFB 4TPYA 4IMZA 2P8OB 2XC4A 3A8DA 4OS1A 3VGCB 4F49A 1ELEE 1Y3YA 4AGKA 5A0BA 4JZFH 4GVUA 1S0QA 5I46H 1OYQA 3BTQE 4A92A 1AVWA 1LHCH 3F1SB 1ZHMA 1C5RA 5C0TA 3BG4B 4OS6A 2IOTA 2QF0A 1AUJA 2J95A 2Z3DA 1GBKA 2OINA 2IJD1 1GJ8B 4IC6A 1O30A 1C5PA 1H8ED 1O3CA 2FOEA 1O3EA 3SUDA 1K9OE 5HIZA 1F0UA 3LJOA 1RFNA 1C4V2 1IOEA 1QRZA 1C1OA 2AGIX 2B5TB 1A0LA 1YF4A 3TVJB 2QGRA 2TBSA 2ZNKH 4GCHG 3UTUH 4RI0A 1C1TA 2V3HH 1ZHPA 2C8ZB 1FJSA 4CRFA 1C2GA 1D6WA 1TNLA 1YP9A 2ZG0H 1Z8GA 1ZRBA 5AFYH 1KDQB 1WBGB 1O2XA 1C2JA 2BDHA 1TYNA 5T6DA 1IQKA 3ZVAA 5LGOA 1DSUA 1CBWC 2OTVA 4ABDA 1E36B 1RTKA 4WH8A 2ZGBH 3OY6U 1AFEH 4A1VA 1FAXA 3MNBA 3UR6A 3M36A 1MCTA 4K69A 4DT7B 2WPMS 2WUCA 2WSSD 2FX4A 4X6MA 3STJA 2R2MB 3UOPA 4K8YA 1B0EA 4AN7A 2PTCE 4DOQA 2Y5GA 1H8DH 3MU4A 1BUIA 1O3LA 1DWDH 1EOLA 4GCHF 1HRTH 1CT2E 1LVOA 3QO6A 5T6GA 2BD4A 5C1UA 4BAOB 3I77A 3SUEA 3SGQE 2ZO3H 3PLKA 1TIOA 4YLUA 3A87A 4JYTA 5J4SA 3S9BA 1AZ8A 1O2KA 1CO7E 2BDGA 3DFJA 1O3IA 1WOFA 1GHZA 1ELDE 2BYAX 2SGFE 3TK5A 3HK3B 2KCOA 3SGBE 1BRBE 4ZH8A 1GBFA 3U1JB 2WINI 1J8AA 1GJCB 1EFRD 4UFEH 1HJAB 1UTOA 2P95A 2AMPA 1O2UA 3GY6A 1BTXA 1ZHRA 4ABJA 1YPHC 3S9AA 5DP8A 4FUFA 1ZMNA 2ZHFH 5EPYA 1C2EA 1DE7H 4Z6AH 1FXYA 1OYTH 2PUXB 1OWDA 3QGJA 3TLOA 1INCA 1EQ9A 1KLTA 2DE9A 1XM1A 1SL3A 3D62A 2VBCA 4ABIA 1GDQA 2ZDVH 1JXPA 1Y3UA 2A4RA 2WV9A 1WAYB 2GTBA 1AE8H 1IQJA 2ODPA 3T28A 1P2KA 1PQ7A 1DSTA 2WPKS 4X6PA 5F6MA 3R0FA 1HAGE 7ESTE 3UFAA 2IPQX 2CMYA 2CF8H 4CRAA 3QX5H 1PPZA 3RXEA 5H4IB 4DY7B 1V2QT 3K6YA 3SJKA 1UTNA 2ALPA 3PLBA 1LKBA 3LGTA 1NO9H 2CJIA 2GV6A 1SOTA 3Q00A 2Y7XA 1O2PA 1HDTH 5FAHA 1QJ6B 2C93B 3DUXH 1SQRA 5EW1H 1TGBA 2OC1A 1AWHB 2EI8A 3F0OA 3Q77A 4X1RU 1DS2E 3LGIA 2A2QH 2QC2A 3P8NA 3LH3A 1G3EA 3SO3A 1FY3A 1FY8E 5KEDA 3RXBA 3VEQB 2BVSH 2ZU3A 4YOGA 1TGSZ 3IWMA 3W95A 4O9VA 1SGPE 1YPJH 1AY6H 2A7HA 2FTMA 3VGCC 3RC6A 2W3IA 1XXDA 4MNYA 2P3UB 1QA7A 4RN6A 1SI5H 2SGAA 3HPTB 4NSYA 3U9AH 1TQ0B 1NESE 1KIGH 3QTOH 3NCLA 2ZDMA 3VG8A 1GVKB 1NRPH 1SPJA 1C5MD 2FWWA 5E2OA 7GCHG 1LPZB 1IQNA 1DX5M 1QB1A 1BJVA 5C5OA 1BB0B 3DHKH 3NKKA 4Y7BA 1RS0A 4YOIA 4IGDA 1QZ8A 3CNRA 2Q6GA 3SU5A 2HPQH 1QL8A 1T8OA 3KNXA 1Q31A 1O35A 1V2RT 1FQ3A 4XSKU 1G3CA 3EE0B 1XUFA 1N6XA 4O97A 2PLXA 2VWMA 3UPEA 1C1WH 4NZQA 1F0RA 1ZMLA 1TA6A 2BB4A 1TABE 1WQVH 2VIOA 3TU7H 2BLWA 1F5LA 3ZZAA 3N7EA 1EASA 1MD7A 2PV9B 1DWCH 2HNTE 1RXPA 4X2YA 7GCHF 1GL1A 1NFXA 3OSYA 3AW0A 1UTLM 5C20A 2HLCA 3FP8E 4YZUA 5FBEA 3A80A 5EXMA 3BTDE 3SNEA 5A8XA 1WQSA 2KCAA 2LELA 1PPGE 2JJ2D 1VITG 2Y81A 4D7FA 4U2WA 1GWAA 1ZGIA 3BIVH 4CR9A 1GMHG 4KTCA 1HAIH 3EA9A 1AD8H 1C5ZB 1HXEH 2R0LA 4AYVB 2FODA 4M7GA 3A88A 2WV5A 2HLDD 2HPPH 2VWNA 1P0SH 5AF9H 3RXPA 2OBOA 1BZXE 1LTOA 1KLJH 1L1GA 2IJOB 3SJOA 2P93A 2BLQA 5K0HA 1O5AB 1VCPA 3P70B 3VXFH 1SLVB 2GT8A 1PYTC 3DFLA 3SQHE 1EXFA 1VITF 3TIUA 3F3BA 2V3MA 1GMHF 1TA2A 1HAOH 3S7KB 1GJ4H 2BD8A 1KSNA 1A7SA 2NU1E 1MU8B 1T4VH 4U01A 4XBBA 3E1XB 2Z7FE 4U30A 1GI7B 4X8UH 4SGBE 2OQUA 3GYLB 4OS5A 1GBDA 4Q2KA 3B23B 3RXLA 3PRDA 3GDSA 1XX9A 4ZHMU 1GMCG 4TT3D 3PB1E 3U28C 1NFWA 1LVYA 4MVNA 1TGTA 3LU9B 1DLEA 1O2TA 2A5IA 3RXFA 3AAUA 3FP6E 1C4Y2 3BTWE 4IC5A 1LHDH 1HPGA 2JDID 4INHA 2OC0A 5GDSH 2QF4A 1LPGB 4RKJB 2GJGA 2BX3A 1O2HA 1TB6H 4IS5A 3O8CA 1MBMA 4FUDA 2V35A 3KF2A 4UFFH 2ZTZA 1NU9A 4JZIA 1CBWB 1ETTH 1MTVA 3OEED 4J1YA 3PMBB 4DGJA 1T8NA 4DURA 3MNSA 1ZJKA 5DK1A 4CRGA 1GCDA 3M5LA 2JJ1D 7LPRA 2ZZUH 1GMCF 1Y8TA 2Z9GA 3LPRA 2ZGCA 4B2CA 4AOQA 1YGCH 4ZKSU 1MQ6A 2XC0A 1YPKH 2G55A 1KXCA 4AFUA 1GBBA 4ZMAH 1QJ1B 1SG8B 2F3CE 3RXVA 5DP6A 1JBUH 2Z6BD 4K60A 1IQMA 1CA8B 3UR9A 1YLDA 2M2AA 3RXKA 2VVUA 1JWTA 1FMGA 3M3VA 4H4FA 1P06A 2ZFPH 1Z1IA 2KZ4A 1B5GH 2J92A 4DJZB 5DN6D 5C2ZA 1E37B 5HMAA 2XNIA 3WW7A 3V12A 2ZGXH 1KXEA 2LNCA 1HAHH 3GY4A 3U8OH 2FIRH 1FLEE 2FP7B 4B76A 1SSXA 1RRKA 5DPAA 1H8IH 2ESTE 4IN1A 4FXGH 3OE7D 1ARCA 1TPAE 1W0KD 3QLPH 1G3BA 3EE7A 1UMAH 4CBNA 1DY8A 2ZQ2A 1QBNA 2CF9H 3M35A 1NZQH 1CGIE 2CN0H 2FS9A 1Z6JH 1G32B 2G51A 3MO9A 1AQ7A 5C17A 3GCNA 5BRRE 1NN6A 2RCEA 1S0RA 2ODYB 5C67A 2A32A 5CE1A 4GPGA 3RXSA 4NIVA 4ZXXH 2G5NA 1OP8A 2IN2A 2BQ6B 3NUMA 1GI8B 8LPRA 3PRBA 1FZZA 1ELAA 1FX0B 5DP5A 1FNIA 3MOCA 1VGCC 1QHRB 1JRSA 5A0AE 4MNVA 1DUAA 1TNIA 1SBWA 1TMBH 3SI4H 1PPEE 1E79D 1BQYA 1P2JA 2BY8X 5PTPA 1O2ZA 2LP6A 4D9QA 1GBLA 1A2CH 2PUQH 1VCWA 2J4IA 3S69A 4MPVA 1O3NA 2FI4E 4D7GA 1ABJH 1U6QA 1TPPA 3HATH 1AO5A 4NGAH 3RXCA 2ZHQH 1K21H 2BLVA 1SGRE 1S84A 2ZDKA 4YXWD 1C4U2 3ATIA 1FIWA 1KYNA 2ZHWH 1EZSC 3QWCH 3A82A 3RXHA 4LZ4B 2F83A 2ZQ1A 1HJ9A 1UTMA 2Q1JA 1GVZA 3RXJA 3OEHD 1A0HB 1Z71A 2XBYA 3K65B 2EC9H 3MYWA 3RXQA 1ANBA 1BBRH 1MKWK 1W11U 3M7QA 4YO9A 2ZCHP 3RM2H 2PKAB 4B1TA 1L2EA 2A45B 2JH6D 3UWIA 1HNEE 1SGEE 1CSOE 2JIZD 1EAUA 1ELBA 3FFGA 5C1XA 1K1JA 1S5SA 1CQQA 1THSH 1BMLA 2ZGHA 4E7RG 1BRUP 2Y7ZA 1SKYE 3F6UH 1EJNA 2A4GA 1GHVH 3NK8A 1O3OA 3ATWA 2ZEBA 1NU7B 5HYOA 4AFZA 3PV5A 3MU1A 3SQEE 3FAOA 1TNHA 1YPLH 1ESBA 1O5FH 2BY9X 2A2XH 5GNDA 3UNQA 1A5IA 4PROA 1PQ5A 5EIYA 3BG8A 3TNTA 1IQGA 3ZZCA 5IK2D 2VB0A 1YCPK 1QB9A 2ZTXA 2BD3A 4B71A 1FI8A 2D2DA 1KXDA 4NA8A 4Y8ZA 4NFEA 5GXPA 2XXLA 2W7SA 1P2OA 3DD2H 2YOLA 4CRBA 3MU5A 1NRNH 2ZIQH 2BQWB 1YPHE 1YYY1 5TCAA 1O2NA 1O33A 2R9PA 4UEHH 2PGQB 4FU7A 1P05A 2BD7A 1C9PA 2BQ7B 1O2IA 1YLNA 2VIPA 3BF6H 3RMLH 4KKDA 1O3HA 4AGJA 2Z9KA 1PPHE 1BMNH 1NRRH 2J98A 1AHTH 4DW2U 3WWFA 1ANCA 3BSQA 1FPHH 1C5UA 2Y80A 1MTUA 5C1YA 2QF5A 3F2HA 4MNXA 2O8TA 1PQ8A 2ZC9H 2ZPQA 1UTPA 4B74A 2FTLE 2Y5HA 5BPEA 1S83A 4HFPB 3SU6A 2AGGX 4ZHAA 2NWNA 2BOHB 1KMHB 3VFEA 4K1EA 5JYIA 5FCRA 2TGAA 5LPEA 3SOSA 1K1LA 2CK3D 5EXLA 1WU1A 4KGAA 1PYTD 5JBCS 4I8LA 3MH7A 1GBMA 2QXJA 1TX7A 3AAVA 3OTPA 1C1VH 3H7TA 3KQDA 1ELTA 2FM2A 2OP9A 4ABHA 1K1MA 5F03A 1O2WA 2FS8A 2J9NA 1DFPA 1GHAG 4I31A 1GL0E 1C1NA 4KTSA 3GCHC 1SGFG 2NU3E 3K2UA 1ZPCA 5EW2H 4P02A 1WDIA 2AMQA 2KFWA 1EJAA 3TK6A 4BXSA 3LKWA 1H9LB 1ID5H 3KGPA 1J16A 5DP4A 3U8TH 3ATLA 1Y3XA 3TJUA 2C4FH 2FXRA 2ILNA 5SGAE 1KTTB 1FAKH 2BDIA 1UTKA 1AE5A 1ELGA 3ODFA 9ESTA 4FUBA 1F7ZA 1GI6A 4TYDA 1P04A 1A5GH 2A4OA 1O3GA 3ELAH 4TSFD 2D8WA 3OTJE 5J4QA 2ZTYA 1C5OH 5EPNA 1PFXC 1GHAF 4FUGA 3GICB 4MPWA 1HBTH 1OWJA 5HIYA 1GHYH 4OS7A 2W3KA 1H9IE 2BDAA 3RXTA 4O03A 1E1QD 3L33A 1SGDE 1SLXB 2CGAA 3PO1C 1IQIA 5DSFA 3FKSD 1GJ7B 1H8HD 2BOKA 4CR5A 3PMJA 2VH6A 1RTLA 1AZZA 1IHTH 4FVBA 4R0IA 3MWIU 1S81A 1KY9A 1GBTA 3HKIB 2BXUH 1BMFD 1EB1H 4NA9H 4JZEH 3BTFE 1BTWA 4ACBA 3B8JA 2BY6X 4LZ1H 2ZKSA 3P8FA 4I8HA 1JIMA 1JRTA 1TLDA 4DIHH 2R0KA 5AVDA 5FXLA 1V2NT 1C2DA 1B0FA 5TCCA 3SU4A 1C2KA 1P09A 2HOBA 1Q2WA 3RC4A 4AX9H 1GBHA 3F9GA 3MH6A 3H09A 1V2WT 1J15A 1TBQH 1AIXH 1XUHA 4HG6A 2G4UA 5A09A 2FLBH 3A83A 3ESTA 2B7DH 1W0JD 3MHWU 2H6MA 4KELA 1WCZA 3SBKA 2Z3CA 3NZIA 1MZAA 1CA0C 4AZ2B 3RXGA 4MDSA 2H9HA 4RKOB 1VGCB 4LOYH 2HVXA 3SYJA 2ANYA 4F48B 3OU0A 3G01A 4X6OA 1QNJA 1QCPA 2C8XB 3RXOA 4DVAU 2GX4A 1O3DA 2VIDA 1WYKA 1YWUA 1YCPM 2KAIB 2HGTH 3PV4A 3TJOA 2G5VA 5C5NA 1BTZA 1AU8A 3N7OA 2RFKC 1G2MA 2G52A 5ETXA 3SJIA 5E8EH 3ZZBA 1HAPH 3KQEA 3RMNH 4D76A 4CRCA 3SORA 2J5UA 1L1NA 3BTME 1T4UH 1HIAB 2GDDA 5EOKA 1SR5C 1EP5A 1RD3B 2XWAA 1EZXC 4B73A 1QA0A 1QQ4A 4E05H 1MD8A 1EZUC 2ZU5A 1ZTJA 3B9FH 5EU8A 1RIWC 4VGCC 2YNAA 5E0HA 3KYFA 2ZFFH 1HLTH 5HM9A 1LQEA 1GHXH 5FPTA 3P92A 2GV7A 1NTPA 4AB9A 3A7XA 3URDA 4UFDH 4BANB 3KN2A 3PV2A 4WVPE 4Q7YA 2RDLA 2GMTC 2F91A 2J2UA 3OFND 3P8GA 3T25A 1GMDG 3TK9A 4AORA 3BTEE 4Q80A 1ZPBA 3SNDA 1MAYA 6ESTA 1V2TT 3GY7A 3VB7A 4JYVH 5GWZA 2P94A 1LQDB 4GAWA 2CV3A 2G81E 4K3JA 4IMQA 3RP2A 3UY9A 4A1XA 3TGJE 2OXSA 3FOAA 3TJNA 1O2YA 4XBDA 4NWKA 4D9RA 4ZCNA 2I6SA 1ORFA 2J97A 1L4ZA 2WPJS 5GPIB 1OP2A 1XUKA 2P16A 1P57B 2GP9B 2QIQA 1QY6A 1TOMH 4ACAA 4FETA 1ZOMA 4WH6A 3VB3A 5EJZA 1TPSA 4ISIH 3ZV9A 2A1DB 3ZVBA 3T29A 1GBJA 1O5EH 3RU4D 1VCQA 2QY0B 3BN9A 1GMDF 1HFDA 2VGCC 1E0FD 3TH3H 1EPTC 3RDZA 1SHYA 1TQ7B 2FOCA 4DT4A 3PM3A 4ASHA 3CS7A 3MMGA 1V2JT 4AC9A 1AKSB 4TWYA 3O8DA 1LCYA 3A86A 3FP7E 3JZ1B 1UVOA 2A5AA 1F2SE 4ABFA 3S0NA 1C1SA 1QL9A 4XRNA 2QV1A 2A0QB 6CHAC 2Z94A 2C8WB 5EODA 1DY9A 1MKXH 5EXNA 1WSSH 1T7CA 1QBOA 5EQQA 5K7RA 1KDQA 4HI3A 5CMXH 2GCHG 1OHHD 2F4LA 3A8AA 2Y6TA 1TNKA 3M61U 3NRLA 3KIDU 2AYWA 4YT6H 1K0HA 1SHHB 3E8LA 2PW8H 3SV2H 1O5CB 3KQCA 3PROA 2BXTH 3QZQA 1SQAA 3A7VA 5FHTA 2ALVA 3QUMP 3D65E 4X1NU 1ZZZA 1GI5A 5AHGH 5C3NA 3M5NA 2BVRH 4X2VA 1XXFA 1G3DA 2VVVA 1GBAA 5I25A 4Y0ZE 1HGTH 1SGQE 4ZROA 4ISNA 4DCDA 1GI2A 1NPMA 1ARBA 3QGNB 1EATA 3C27B 4ABBA 3TH4H 3UAIC 2FMJA 3A8CA 1WV7H 1V2PT 4TY7A 1FY4A 3SHCH 1AGJA 1EP6A 4Q7XA 1D3DB 5KECA 2FOGA 4ABGA 1SGNE 1GCTC 1UK4A 3AASA 2ODQA 2WPDD 3SGAE 3ZVGA 1YPMH 3GCHB 4IN2A 2YNBA 1MZDA 2VJ1A 1SVPA 1MUEB 2VNTA 3K6ZA 2BMGB 3S7HB 1GG6C 4Y10E 1W3CA 1MTNC 1ZSJA 2PKSC 4DIIH 1K1IA 3MO3A 3SU1A 3GISB 1GGDC 1O5BB 3EDXB 1MABB 1TGNA 4I8KA 4NSVA 2ZCKP 4AG1A 1HB0B 1WXRA 2SFAA 4WWYA 2SGQE 1KXBA 1TOCB 2BDYA 3LIWA 4YM9A 8ESTE 3F9FA 1A3EH 2EY4C 2A4QA 3E91A 1LDTT 4ZAEA 1D9IA 2OD3B 1F0TA 3BTHE 1UTQA 1TONA 1TNJA 3P17H 3PO1B 2Q6FA 4LXBH 1OX1A 4NA7A 3RU4E 1W13U 1QIXB 1D3TB 3LONA 1LHEH 3URCA 3RUOA 4Y8YA 1E1RD 1PQAA 1YCPH 1UVTH 3BV9B 4WXVA 2DE8A 3MTYA 2XBWA 4KP0A 1O2RA 3Q76A 3SV6A 1THRH 2XOKD 4Q7ZA 1C5NH 5FCKA 1N1LA 4YTAA 1CGJE 2BZAA 3BEUA 3QK1A 4AG2A 1H9HE 3RXUA 2W6ID 2RG3A 2EA3A 2V7QD 3SW2B 4MNWA 2H9EH 1W7GH 2G00A 3V7TA 5KGOA 1Y3VA 4BXWA 4A6LA 2FX6A 1GHBG 1GI1A 3BIUH 3ZVCA 1Z8RA 1FN8A 3IG6B 5JB9S 4FUIA 3ZZ7A 4X1QU 4F55A 4JYUH 1NM6A 1DDJA 1S6HA 1O5DH 1UW7A 3GYMA 5JPMH 1CA0B 3AW1A 4GHQA 3SNCA 4MQAA 1IHSH 3STIA 2KCPA 2AS9A 3EA7A 3UIRA 3GY5A 1Y5UT 4FU8A 2CXVA 2XBXA 3NXPA 1LHGH 1QRXA 1JOUB 2BDCA 3RM0H 3GY3A 4Z0KA 1H1BA 1O0DH 3MU8A 5CHAC 5A2MH 4BAQB 4YLQH 1O3MA 2W26A 4JZ1A 3ZIAD 1ZGVA 2BY7X 1AMHA 1AVXA 1LVMA 4B75A 1S6LA 1ESAA 3MFJA 3PTBA 2L6OA 1RTFB 1S85A 1P10A 1XMNB 1BITA 3M3TA 2PSXA 2F9BH 1C1RA 1K1OA 2F9PA 2XYAA 1E38B 3EGKH 2V0BA 3ZZ9A 4ABAA 4GHTA 4MTBA 4INLA 1Z8IB 3EYDA 3CENA 4I86A 1RIWB 3PMAB 4IBLH 4VGCB 1GDNA 2I6QA 4U32A 1TRYA 4JZDH 2A31A 1K2I1 2F9NA 1TRNA 2BHGA 2XC5A 3SNBA 2SNWA 4WMEA 1M9UA 2ZU4A 3ITIA 2XRCA 3N99A 4E06H 4J2YB 2UWPA 1PPCE 2Z3EA 2F9VA 5T6FA 1BHXF 2OUAA 1BCUH 5JB8S 2GMTB 2XTTB 1NROH 3T27A 1LPKB 1CT4E 4B6EA 1G9IE 4O3TA 2ZF0H 4GSOA 4ZKRU 1MCVA 3SUGA 4JK6A 4NCYA 5B6OA 1O38A 3M5MA 3RU4T 1DANH 3BEFB 2H2ZA 4INKA 2JKHA 3LGVA 2BX4A 1C5VA 3A7WA 4FUJA 2F43B 2GKVE 2D1JA 2QA9E 4Y76A 2JETB 2PFEA 3SJ8A 1EUFA 2HWLB 2J94A 3VB6A 3NWUA 3UQOA 5GCHG 1CE5A 1DPOA 1ZTLA 3A84A 1EAIA 3F9HA 1FN6A 1ETSH 3SZEA 1OSSA 1KLIH 3S9CA 3P95A 2VGCB 1EPTB 2ZCLP 4NFFA 1O37A 4E7NA 2XBVA 1NFYA 4A1TA 3M7UA 3I29A 1VKYA 1CHGA 8GCHG 5EGMA 2CHAC 1WUNH 1KXFA 1FUJA 1C1MA 4Q4LA 3ZYEA 3MI4A 2WPHS 1ZPZA 2FYQA 1TRMA 1IQFA 4Y8XA 2BY5X 1HAVB 3M7TA 2ANWA 2TRMA 2PGBB 2FI5E 3ZVFA 6CHAB 3MH5A 3KEEA 3E90B 5G4BA 2TPIZ 4H6SB 1D6RA 3VB5A 3T5FH 1CT0E 1N8OC 1C2LA 5ESTE 1TAWA 1UCYK 1ELCA 1HYLA 1KXAA 5C0UA 1TNGA 2IPHA 2Z9LA 4WF8A 3TJVA 3RXDA 4HGCA 1DLKB 3LOXA 2ZA5A 5JBAS 8GCHF 2AGEX 1DVAH 2ZDAH 3F0PA 3A89A 3AK5A 1OXGA 1L4DA 1W12U 2QAAA 4RT0A 3MU0A 1ZLRA 4SGAE 1ETRH 3BEIB 2UWOA 2ULLA 2WPIS 1OWHA 1GJAB 4YESB 4Z1MD 1XUJA 2SNVA 1AFQB 4JK5A 2NU0E 1C9TA 2ZDNA 1L1JA 1C5TA 1C5YB 5LPRA 1J14A 1Y5BT 1QTFA 1T8LA 1GCTB 1O31A 3A85A 1C2FA 3ZZ5A 2OC8A 1A1RA 1MQ5A 3T62A 1SGIB 5EQSA 1PPFE 2H1UA 4ISOA 1EKBB 3SUFA 1COWD 1VITH 3FZZA 5DGJA 1FY5A 1MMJN 1W10U 1BHXB 2GGVB 2ZHEH 4ASUD 1C5XB 1Q3XA 1XVOA 3DSOA 1GG6B 1MTNB 2PKSB 4CH8B 4ISLA 2FZZA 6GCHG 4WY3A 1GGDB 1FDPA 1BOQA 2C90B 1YM0A 3HK6B 3LT3A 4AFSA 3UREA 1SOZA 4BNRA 2F9OA 1EAWA 1ANEA 1O36A 1SFQB 3ATKA 1BTPA 3F68H 5EJ1A 1W0ZU 2GD4B 4CREA 4CHAB 4FOUC 3EQ0H 1MH0A 1BBRK 2R2WU 1W2KH 2O8LA 4MPXA 3LH1A 6LPRA 5JBBS 2YMSC 5FPSA 4XD7D 2FO9A 3AVZA 3WY8A 2SGDE 1BT7A 4LK4A 4FUCA 4DG4A 1P9SA 2ANKH 3QTVH 1Z6EA 1L0ZA 3KL6A 2B9LA 4ISHH 5DP9A 3UNSA 1O2SA 2B8OH 1F5KU 3RLWH 6GCHF 1C5QA 1TFXA 2G4TA 4X8VH 1QBVH 3FO8D 3RC5A 4Y0YE 5LH8A 3DT0H 1ZJDA 1O3KA 1QFKH 1O2VA 3RMMH 1Y59T 2AFQB 1MU6B 1BTYA 1K28D 4AB8A 2JH0D 3SI3H 5A8ZA 1HCGA 4I33A 2FESH 4FUHA 2VIVA 4AFQA 2TGTA 3L6PA 1GBEA 3LGYA 4UD9H 1P2NA 3GS9A 1XVMA 1LHFH 2RA3A 1ABIH 3LJJA 2ZP0H 3PWCA 1K1NA 2O9QA 2P3TB 1YBWA 2VWLA 1SGYE 1GJ9B 3TH2H 1WTGH 1UVUH 5A8YA 4RT1A 2QXIA 2QF3A 3UQVA 5CHBA 1O39A 1DXPA 2AMDA 1C2HA 2RA0A 3RXMA 3V3MA 2ZDLA 3PLPA 3P8OA 1P2IA 3EAJA 2ZFRH 1XKAC 1BTUA 2XCFA 3MH4A 1O3JA 3E6PH 2PKAA 4A5TS 2FPZA 4QT8C 1SLUB 1E34B 1QB6A 5ABWA 3QDZB 1ANDA 4NWLA 4NG9H 2UUYA 4OGXA 2WV4A 3UWJH 4X2XA 2ZWLH 5CHAB 1PPBH 3CP7A 4UONA 1NY22 2QE7D 3SU3A 1YLCA 3NPSA 1T32A 1W14U 2OLGA 3PMHB 5F8XA 2EEKA 1O2GH 2BTCE 2QXGA 2A7CA 1MAXA 1S82A 2AH4X 1O2JA 2GCTB 5DO4H 1EAXA 1V2ST 4K1TA 2K0QA 1V2UT 3IITA 3TNSA 1Y5AT 2HRVA 3FANA 2EQNA 3QN7A 2ZU1A 1GHWH 2BD5A 3LDXH 4I7YH 1O3FA 1XKBC 4OM9A 5EQRA 2Z9IA 3SHAH 1EX3A 5FX5A 1SC8U 1A3BH 1TALA 4UDWH 3PWBA 1DITH 2SGPE 3VPKA 3N7DA 4X8SH 4GUXA 3O8RA 1UO6A 2ZFSA 1SGCA 3SV7A 4BAHB 3DSPA 1MTSA 1EB2A 1EPTA 1ESTA 2R3YA 4K1SA 1A4WH 2EI7A 3H5CB 3UB0A 2SGEE 1BMMH 1TGCA 1DWBH 1PJPA 1AVGH 1O2OA 2C8YB 4X8TH 2ZPRA 3Q3XA 1OWKA 2GT7A 3KHVA 4XDEA 2AHME 2UUFB 4Q63A 1NBMD 1TWXB 1HAVA 1NC6A 2ZECA 2OK5A 4BOHA 2PHBA 3SV8A 2ZI2H 5E0JA 2WUBA 1C1PA 1W7XH 4X1SU 1J9CH 4TWWA 1YKTA 1ZSKA 2A5KA 2FOHA 4X1PU 1G36A 1P01A 4I32A 1GBIA 4CBOA 1UK2A 1G37A 2JETC 4WMDA 1O3BA 1TBRH 3ZZ6A 1NS3A 5DJ7A 1MTWA 1IAUA 1G30B 1T8MA 1TX6A 1BTHH 1XUIA 2ASUB 2HALA 5HGGA 3LC5A 1ZYOA 3T2NA 2STBE 1K22H 3RLYH 1OWEA 3SNAA 4OGYA 5AFZH 1TMUH 1HUTH 2XCNA 3SV9A 2CHAB 5L30H 1CGHA 4NIXA 4BTTB 5B6LA 3GCTG 2XW9A 5LPFA 1GDUA 1GI4A 4K8BA 1JIRA 1YY3A 3UNRA 1SQOA 2WPLS 1FV9A 1O2QA 4XFQA 1C2IA 1P2QA 2RDEA 1O3PB 3D49H 1F5RA 1QQUA 4ZKOU 1IQHA 2JH5D 4Y71A 1N8OB 2VVCA 4TY6A 4HZHA 3E0NB 3BTGE 1BMAA 2WHXA 3HGPA 3MQKC 1A46H 3K9XB 3ZZ4A 3Q3YA 4Y7AA 3BTTE 2KX4A 3GCOA 1ZTKA 4HTCH 3U1IB 1GI3A 1F0SA 1UHBB 2H5DA 3P6ZB 2AEIH 3KCGH 3ZYDA 1W0YH 3BTKE 3ZVDA 1A61H 4I8GA 1B7XB 3ENSB 1QRWA 3GCTF 5CDFE 1TBZH 3LGWA 3OY5U 3U8RH 3F2GA 1AB9C 2D26C 4K5ZA 1VR1H 1P03A 3L3TA 2C3SA 2GZ9A 4WJG2 4Y11E 2OCVB 3TITA 5JBTA 4BTUB 4YT7H 3MO6A 1LVBA 3E0PB 2OBQA 3T26A 4F4OC 2KM0A 2O8WA 3GDUA 1TE0A 4JMYA 2P8OC 3RXAA 1BIOA 5GIBA 1EOJA 2FOAA 4BTIB 1GI9B 1AFQC 4B2AA 1AWFH 1VZQH 1UVSH 2GCHF 1CHOG 2Z9JA 3QZRA 3SJ9A 2VIWA 3BG4C 1NFUA 4THNH 4ESTE 2ZU2A 1DXWA 4FVDA 2NU2E 3LC3A 1LO6A 1P11E 2HVYB 3EA8A 3ODDA 1MKWH 4H6TA 2VIQA 2FOMB 1FY1A 2VH0A 2FOFA 2O8UA 1D3QB 3R3GB 5FBIA 4JCNA 1QURH 2LPRA 4M9FA 5F8ZA 4K2YA 4O3UA 1NBME 1HAYB 2J98B 3I78A 3WWBA 2PSYA 1AUTC 1LMWB 3GDVA 2GDEH 1DWEH 2TGPZ 4MPUA 2W7UA 1O2MA 1BDAA 4X6NA 1CVWH 1G2LA 2NU4E 4R8TB 1V2KT 2W6JD 3HKJB 2W5EA 1V6DA 1CHOF 3TPIZ 2BD9A 3A7TA 3M3SA 2K1QA 2YMSB 3ZZ8A 1THPB 4Y6DA 2V6NA 4CHAC 3HGNA 1ACBE 1UCYE 1UVPA 1SLWB 4ZKNU 3F2FA 1QR3E 3MNXA 9LPRA 3A7ZA 2VINA 3OYPA 5IYTA 3FN8A 3ZVEA 1E35B 4WXIA 1ELVA 2AERH 1HAZB 2YMSD 2Y5FA 1AI8H 1SB1H 1DUEA 3O8BA 4ABEA 3A8BA 1Y3WA 4RSPA 3LGUA 1OWIA 1BA8B 2M5TA 1GJDB 1GJBB 2FDAA 3DA9B 1GBCA 2UUKB 1GI0A 3JZ2B 3KYGA 5HXFA 4H42U 1Z7KA 2KAIA 3FZDA 1V2VT 4MLFB 4NZLA 5C94A 3RMOH 3OAAD 1OPHB 2Y82A 2HNTC 2WYJA 3DCLA 5DKMA 1QGFA 1HAXB 3ATMA 1WTHD 1HV7A 1ZSLA 1ZR0A 2BVXH 2FEQH 2ZPSA 1P8VC 2ZGJA 4BAMB 1HJAC 1P2MA 3GY8A 1O3AA 3UUZA 1P3EA 1HIAA 1UCYH 1OS8A 3H7OA 1UJ1A 1VJ9U 2FLRH 1YPEH 4B6FA 5EJLA 2BDBA 4CH2B 4GLYA 3D23A 1V3XA 2P59A 1SQTA 3UOUA 1W8BH 5E2PA 1OP0A 1OKXA 1ZRKA 2UWLA 1DM4B 1H4WA 2J34A 2XNDD 3TGKE 1BBRE 1X7AC 1GJ6A 4WMFA 2STAE 5FL7D 1Z8JB 4X2WA 2BLOA 2G8TA
chains in the Genus database with same CATH topology
1C5WB 1GHBF 1SGFA 4D8NA 2XWBI 8KME2 1MKXK 3U98H 3PYHA 1NRQH 1EJMA 5L6NH 1ELFA 2PR3A 4OS2A 1JMOH 2GCTC 2TIOA 2OQ5A 1MBQA 2P3FH 5T3HA 4IW4E 1BJUA 2H5CA 2F9UA 1EZQA 1F92A 3FVFB 1SGTA 2A7JA 3CS0A 1UTJA 3E16B 1RGQA 1V2OT 2QCYA 3PTNA 3RXRA 1KTSB 1QJ7B 2FI3E 1Z1JA 5GJ4B 4TPIZ 1O32A 4XOJA 2GZ7A 3ZZ3A 1HJ8A 2GVFA 2OC7A 2BM2A 2R3UA 1D4PB 1VJAU 2QN5T 2BD2A 5IDKA 1YC0A 2UUJB 1T31A 4NIWA 4Y79A 3GY2A 3SN8A 5E0GA 1P3CA 1GPZA 1SFIA 4ZUHA 3A81A 1DT2A 5ESBA 1V2MT 4ZXYH 5DG6A 1AKSA 1DOJA 3KQBA 1IQLA 2VU8E 1D3PB 4OS4A 3SU0A 1YPGH 2ZFQH 2WYGA 2QYIA 1XUGA 1IQEA 1S6FA 3GOVB 1GJ5H 4KTUA 1N6YA 5FX6A 3W94A 1BRCE 3A7YA 4UFGH 4XBCA 1P02A 1C5LH 1FONA 2PWXA 1K1PA 2B0FA 4CRDA 4YOJA 2GZ8A 2ZFTA 1J17T 3V0XA 3MNCA 5A0CA 1NRSH 1UHBA 1ZMJA 5FPYA 2AIQA 1SMFE 1UK3A 3OX7U 1RJXB 3ZV8A 5TJXA 4XE4A 5HM2A 3Q3KA 3VXEH 3E3TA 1TPOA 1CU1A 2H9TH 4I8JA 5JDUB 5DP3A 4AYYB 5L2ZH 3U69H 5EG4A 4ZHLU 1O34A 2DUCA 2FYRA 2PTNA 2QXHA 3ZZDA 1P12E 2V3OH 4FU9A 2BZ6H 1FPCH 3C1KA 1TX8A 3M5OA 3V13A 4B2BA 1O2LA 1C2MA 1A0JA 4FUEA 5F8TA 2ZHDA 5DP7A 5GCHF 3RXIA 3SU2A 3TGIE 1BRAA 4X0WU 2HNTF 1GVLA 1DICA 1OOKB 1TMTH 4BAKB 1C5SA 2FOBA 2EI6A 7KMEH 1P9UA 2O8MA 1A5HA 1QL7A 5L2YH 3VB4A 3SZNA 2J38A 3M37A 1V2LT 2VWOA 1NT1A 2TGDA 3F9EA 4NIYA 1AB9B 1FIZA 1AN1E 2ANMH 4A7IB 2AIPA 4UE7H 1C1QA 1LKAA 1C1UH 1O5GH 4MG3A 1HXFH 2Q6DA 2THFB 4TPYA 4IMZA 2P8OB 2XC4A 3A8DA 4OS1A 3VGCB 4F49A 1ELEE 1Y3YA 4AGKA 5A0BA 4JZFH 4GVUA 1S0QA 5I46H 1OYQA 3BTQE 4A92A 1AVWA 1LHCH 3F1SB 1ZHMA 1C5RA 3BG4B 4OS6A 2IOTA 2QF0A 1AUJA 2J95A 2Z3DA 1GBKA 2OINA 1GJ8B 4IC6A 1O30A 1C5PA 1O3CA 2FOEA 1O3EA 3SUDA 1K9OE 1F0UA 3LJOA 1RFNA 1C4V2 1IOEA 1QRZA 1C1OA 2AGIX 2B5TB 1A0LA 1YF4A 3TVJB 2QGRA 2TBSA 2ZNKH 4GCHG 3UTUH 1C1TA 2V3HH 1ZHPA 2C8ZB 1FJSA 4CRFA 1C2GA 1D6WA 1TNLA 1YP9A 2ZG0H 1Z8GA 1ZRBA 5AFYH 1KDQB 1WBGB 1O2XA 1C2JA 2BDHA 1TYNA 5T6DA 1IQKA 3ZVAA 5LGOA 1DSUA 1CBWC 2OTVA 4ABDA 1E36B 1RTKA 4WH8A 2ZGBH 3OY6U 1AFEH 4A1VA 1FAXA 3MNBA 3UR6A 3M36A 1MCTA 4K69A 4DT7B 2WPMS 2WUCA 2FX4A 4X6MA 3STJA 2R2MB 3UOPA 4K8YA 1B0EA 4AN7A 2PTCE 4DOQA 2Y5GA 1H8DH 3MU4A 1BUIA 1O3LA 1DWDH 1EOLA 4GCHF 1HRTH 1CT2E 1LVOA 3QO6A 5T6GA 2BD4A 5C1UA 4BAOB 3I77A 3SUEA 3SGQE 2ZO3H 3PLKA 1TIOA 4YLUA 3A87A 4JYTA 5J4SA 3S9BA 1AZ8A 1O2KA 1CO7E 2BDGA 3DFJA 1O3IA 1WOFA 1GHZA 1ELDE 2BYAX 2SGFE 3TK5A 3HK3B 3SGBE 1BRBE 4ZH8A 1GBFA 3U1JB 2WINI 1J8AA 1GJCB 4UFEH 1HJAB 1UTOA 2P95A 2AMPA 1O2UA 3GY6A 1BTXA 1ZHRA 4ABJA 1YPHC 3S9AA 5DP8A 4FUFA 1ZMNA 2ZHFH 5EPYA 1C2EA 1DE7H 4Z6AH 1FXYA 1OYTH 2PUXB 1OWDA 3QGJA 3TLOA 1INCA 1EQ9A 1KLTA 2DE9A 1XM1A 1SL3A 3D62A 4ABIA 1GDQA 2ZDVH 1JXPA 1Y3UA 2A4RA 1WAYB 2GTBA 1AE8H 1IQJA 2ODPA 3T28A 1P2KA 1PQ7A 1DSTA 2WPKS 4X6PA 5F6MA 3R0FA 1HAGE 7ESTE 3UFAA 2CMYA 2CF8H 4CRAA 3QX5H 1PPZA 3RXEA 5H4IB 4DY7B 1V2QT 3K6YA 3SJKA 1UTNA 2ALPA 3PLBA 1LKBA 3LGTA 1NO9H 2CJIA 2GV6A 1SOTA 3Q00A 2Y7XA 1O2PA 1HDTH 5FAHA 1QJ6B 2C93B 3DUXH 5EW1H 1TGBA 2OC1A 1AWHB 2EI8A 3Q77A 4X1RU 1DS2E 3LGIA 2A2QH 2QC2A 3P8NA 3LH3A 1G3EA 3SO3A 1FY3A 1FY8E 3RXBA 3VEQB 2BVSH 2ZU3A 4YOGA 1TGSZ 3IWMA 3W95A 4O9VA 1SGPE 1YPJH 1AY6H 2A7HA 2FTMA 3VGCC 3RC6A 2W3IA 1XXDA 4MNYA 2P3UB 1QA7A 4RN6A 1SI5H 2SGAA 3HPTB 4NSYA 3U9AH 1TQ0B 1NESE 1KIGH 3QTOH 3NCLA 2ZDMA 1GVKB 1NRPH 1SPJA 1C5MD 2FWWA 5E2OA 7GCHG 1LPZB 1IQNA 1DX5M 1QB1A 1BJVA 5C5OA 1BB0B 3DHKH 3NKKA 4Y7BA 1RS0A 4YOIA 4IGDA 2Q6GA 3SU5A 2HPQH 1QL8A 1T8OA 3KNXA 1Q31A 1O35A 1V2RT 1FQ3A 4XSKU 1G3CA 3EE0B 1XUFA 1N6XA 4O97A 2PLXA 2VWMA 3UPEA 1C1WH 4NZQA 1F0RA 1ZMLA 1TA6A 2BB4A 1TABE 1WQVH 2VIOA 3TU7H 2BLWA 1F5LA 3ZZAA 1EASA 1MD7A 2PV9B 1DWCH 2HNTE 1RXPA 4X2YA 7GCHF 1GL1A 1NFXA 3OSYA 3AW0A 1UTLM 5C20A 2HLCA 3FP8E 4YZUA 5FBEA 3A80A 5EXMA 3BTDE 3SNEA 5A8XA 1WQSA 1PPGE 2Y81A 1VITG 4D7FA 4U2WA 1GWAA 1ZGIA 3BIVH 4CR9A 1GMHG 4KTCA 1HAIH 3EA9A 1AD8H 1C5ZB 1HXEH 2R0LA 4AYVB 2FODA 4M7GA 3A88A 2WV5A 2VWNA 2HPPH 1P0SH 5AF9H 3RXPA 2OBOA 1BZXE 1LTOA 1KLJH 1L1GA 2IJOB 3SJOA 2P93A 2BLQA 5K0HA 1O5AB 1VCPA 3P70B 3VXFH 1SLVB 2GT8A 1PYTC 3DFLA 3SQHE 1EXFA 1VITF 3TIUA 1GMHF 1TA2A 1HAOH 3S7KB 1GJ4H 2BD8A 1KSNA 1A7SA 2NU1E 1MU8B 1T4VH 4U01A 4XBBA 3E1XB 2Z7FE 4U30A 1GI7B 4X8UH 4SGBE 2OQUA 3GYLB 4OS5A 1GBDA 4Q2KA 3B23B 3RXLA 3GDSA 1XX9A 4ZHMU 1GMCG 3PB1E 1NFWA 1LVYA 4MVNA 1TGTA 3LU9B 1DLEA 1O2TA 2A5IA 3RXFA 3AAUA 3FP6E 1C4Y2 3BTWE 4IC5A 1LHDH 1HPGA 4INHA 5GDSH 2OC0A 1LPGB 4RKJB 2BX3A 1O2HA 1TB6H 4IS5A 3O8CA 1MBMA 4FUDA 2V35A 3KF2A 4UFFH 2ZTZA 1NU9A 4JZIA 1CBWB 1ETTH 1MTVA 4J1YA 3PMBB 4DGJA 1T8NA 4DURA 3MNSA 1ZJKA 5DK1A 4CRGA 1GCDA 3M5LA 7LPRA 2ZZUH 1GMCF 1Y8TA 2Z9GA 3LPRA 2ZGCA 4B2CA 4AOQA 1YGCH 4ZKSU 1MQ6A 2XC0A 1YPKH 2G55A 1KXCA 4AFUA 1GBBA 4ZMAH 1QJ1B 1SG8B 2F3CE 3RXVA 5DP6A 1JBUH 2Z6BD 4K60A 1IQMA 1CA8B 3UR9A 1YLDA 3RXKA 2VVUA 1JWTA 1FMGA 3M3VA 4H4FA 1P06A 2ZFPH 1Z1IA 1B5GH 2J92A 4DJZB 5C2ZA 1E37B 5HMAA 2XNIA 3V12A 2ZGXH 1KXEA 2LNCA 1HAHH 3GY4A 3U8OH 2FIRH 1FLEE 2FP7B 4B76A 1SSXA 1RRKA 5DPAA 1H8IH 2ESTE 4IN1A 4FXGH 1ARCA 1TPAE 3QLPH 1G3BA 1UMAH 4CBNA 1DY8A 2ZQ2A 1QBNA 2CF9H 3M35A 1NZQH 1CGIE 2CN0H 2FS9A 1Z6JH 1G32B 2G51A 3MO9A 1AQ7A 3GCNA 5BRRE 1NN6A 2RCEA 1S0RA 2ODYB 5C67A 2A32A 5CE1A 4GPGA 3RXSA 4NIVA 4ZXXH 2G5NA 1OP8A 2IN2A 2BQ6B 3NUMA 1GI8B 8LPRA 1FZZA 1ELAA 5DP5A 1FNIA 3MOCA 1VGCC 1QHRB 1JRSA 5A0AE 4MNVA 1DUAA 1TNIA 1SBWA 1TMBH 3SI4H 1PPEE 5PTPA 1BQYA 1P2JA 2BY8X 1O2ZA 4D9QA 1GBLA 1A2CH 2PUQH 1VCWA 2J4IA 3S69A 4MPVA 1O3NA 2FI4E 4D7GA 1ABJH 1U6QA 1TPPA 3HATH 1AO5A 4NGAH 3RXCA 2ZHQH 1K21H 2BLVA 1SGRE 1S84A 2ZDKA 1C4U2 3ATIA 1FIWA 1KYNA 2ZHWH 1EZSC 3QWCH 3A82A 3RXHA 4LZ4B 2F83A 2ZQ1A 1HJ9A 1UTMA 2Q1JA 1GVZA 3RXJA 1A0HB 1Z71A 2XBYA 3K65B 2EC9H 3MYWA 3RXQA 1ANBA 1BBRH 1MKWK 1W11U 3M7QA 4YO9A 2ZCHP 3RM2H 2PKAB 4B1TA 1L2EA 2A45B 2JH6D 3UWIA 1HNEE 1SGEE 1CSOE 1EAUA 1ELBA 3FFGA 5C1XA 1K1JA 1S5SA 1CQQA 1THSH 1BMLA 2ZGHA 4E7RG 1BRUP 2Y7ZA 3F6UH 1EJNA 2A4GA 1GHVH 3NK8A 1O3OA 3ATWA 2ZEBA 1NU7B 5HYOA 4AFZA 3MU1A 3SQEE 3FAOA 1TNHA 1YPLH 1ESBA 1O5FH 2BY9X 2A2XH 3UNQA 1A5IA 4PROA 1PQ5A 3BG8A 3TNTA 1IQGA 3ZZCA 2VB0A 1YCPK 1QB9A 2ZTXA 2BD3A 4B71A 1FI8A 2D2DA 1KXDA 4NA8A 4Y8ZA 4NFEA 5GXPA 2XXLA 2W7SA 1P2OA 3DD2H 2YOLA 4CRBA 3MU5A 1NRNH 2ZIQH 2BQWB 1YPHE 1YYY1 5TCAA 1O2NA 1O33A 2R9PA 4UEHH 2PGQB 4FU7A 1P05A 2BD7A 1C9PA 2BQ7B 1O2IA 2VIPA 3BF6H 3RMLH 4KKDA 1O3HA 4AGJA 2Z9KA 1PPHE 1BMNH 1NRRH 1AHTH 4DW2U 1ANCA 3BSQA 1FPHH 1C5UA 2Y80A 1MTUA 5C1YA 4MNXA 2O8TA 1PQ8A 2ZC9H 2ZPQA 1UTPA 4B74A 2FTLE 2Y5HA 5BPEA 1S83A 4HFPB 3SU6A 2AGGX 4ZHAA 2NWNA 2BOHB 3VFEA 4K1EA 5JYIA 5FCRA 2TGAA 5LPEA 3SOSA 1K1LA 5EXLA 1WU1A 4KGAA 1PYTD 5JBCS 4I8LA 3MH7A 1GBMA 2QXJA 1TX7A 3AAVA 1C1VH 3H7TA 3KQDA 1ELTA 2FM2A 2OP9A 4ABHA 1K1MA 5F03A 1O2WA 2FS8A 2J9NA 1DFPA 1GHAG 4I31A 1GL0E 1C1NA 4KTSA 3GCHC 1SGFG 2NU3E 3K2UA 1ZPCA 5EW2H 2AMQA 1EJAA 3TK6A 4BXSA 3LKWA 1H9LB 1ID5H 3KGPA 1J16A 5DP4A 3U8TH 3ATLA 1Y3XA 3TJUA 2C4FH 2FXRA 2ILNA 5SGAE 1KTTB 1FAKH 2BDIA 1UTKA 1AE5A 1ELGA 3ODFA 9ESTA 4FUBA 1F7ZA 1GI6A 4TYDA 1P04A 1A5GH 2A4OA 1O3GA 3ELAH 2D8WA 3OTJE 5J4QA 2ZTYA 1C5OH 5EPNA 1PFXC 1GHAF 4FUGA 3GICB 4MPWA 1HBTH 1OWJA 1GHYH 4OS7A 2W3KA 1H9IE 2BDAA 3RXTA 4O03A 3L33A 1SGDE 1SLXB 2CGAA 3PO1C 1IQIA 1GJ7B 2BOKA 4CR5A 3PMJA 2VH6A 1RTLA 1AZZA 1IHTH 4FVBA 4R0IA 3MWIU 1S81A 1KY9A 1GBTA 3HKIB 2BXUH 1EB1H 4NA9H 4JZEH 3BTFE 1BTWA 3B8JA 2BY6X 4LZ1H 2ZKSA 3P8FA 4I8HA 1JIMA 1JRTA 1TLDA 4DIHH 2R0KA 5AVDA 5FXLA 1V2NT 1C2DA 1B0FA 5TCCA 3SU4A 1C2KA 1P09A 2HOBA 1Q2WA 3RC4A 4AX9H 1GBHA 3F9GA 3MH6A 1V2WT 1J15A 1TBQH 1AIXH 1XUHA 2G4UA 5A09A 2FLBH 3A83A 3ESTA 2B7DH 3MHWU 2H6MA 4KELA 1WCZA 3SBKA 2Z3CA 3NZIA 1MZAA 1CA0C 4AZ2B 3RXGA 4MDSA 2H9HA 4RKOB 1VGCB 4LOYH 2HVXA 2ANYA 3OU0A 3G01A 4X6OA 1QNJA 1QCPA 2C8XB 3RXOA 4DVAU 2GX4A 1O3DA 2VIDA 1WYKA 1YCPM 2KAIB 2HGTH 3PV4A 3TJOA 2G5VA 5C5NA 1BTZA 1AU8A 3N7OA 1G2MA 2G52A 5ETXA 3SJIA 5E8EH 3ZZBA 1HAPH 3KQEA 3RMNH 4D76A 4CRCA 3SORA 1L1NA 3BTME 1T4UH 1HIAB 2GDDA 5EOKA 1SR5C 1EP5A 1RD3B 2XWAA 1EZXC 4B73A 1QA0A 1QQ4A 4E05H 1MD8A 1EZUC 2ZU5A 1ZTJA 3B9FH 5EU8A