1INCA

Crystal structures of the complex of porcine pancreatic elastase with two valine-derived benzoxazinone inhibitors
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Crystal structures of the complex of porcine pancreatic elastase with two valine-derived benzoxazinone inhibitors.
pubmed doi rcsb
source organism Sus scrofa domestica
molecule tags Hydrolase(serine proteinase)
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1incA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1incA01
1TRNA 4FVDA 3BTFE 3ODFA 4WH6A 1KLJH 2AEIH 1CSOE 1WBGB 4FUHA 4O3TA 1BMNH 5K0HA 1P05A 3GICB 1C1SA 1W12U 2A7JA 1P06A 2CF8H 1ANEA 2VWOA 1ZMJA 4ABJA 4XDEA 2UUJB 1GJAB 1YPGH 3OX7U 3SJKA 2VIWA 3BIUH 1NZQH 1DWBH 1ELVA 3NPSA 2R0KA 4X8SH 3T27A 8KME2 1GBJA 1JXPA 2PTNA 4MPVA 2CHAC 3P8OA 2VWLA 2ZTYA 3GISB 3HKJB 5T3HA 1SQAA 4HZHA 1SOZA 2WYGA 3F68H 3ZZ7A 6ESTA 5FPTA 1TPPA 2ZFRH 4K8BA 4CREA 1CT2E 2P3UB 3RC6A 4D8NA 2BLOA 1ZLRA 2AMDA 1ORFA 1BRCE 2BY7X 1C5UA 3MNXA 5DK1A 3DHKH 5FX6A 1CQQA 4ABBA 5JB8S 5L2ZH 1TE0A 3BTME 3QO6A 1A1RA 5C2ZA 4UONA 1SGFA 3UQOA 3SUDA 1SBWA 1GI2A 1MBMA 1KLIH 2ZDNA 3SHAH 2P3FH 2FP7B 4TY6A 1O5BB 1EB2A 3P8GA 4MG3A 3UR6A 1XUJA 6LPRA 4BTIB 5G4BA 2ZTXA 3GCTF 3MO9A 1GHXH 1LO6A 3E3TA 4DY7B 1TOCB 1ZJKA 2FOEA 1UK4A 5DP4A 4FU8A 2R0LA 1S5SA 4NSVA 2VVUA 1H1BA 1DITH 1A3BH 1CHOG 3LGVA 5EPYA 1D3PB 3IITA 4VGCB 1QQ4A 2FI3E 1ELTA 2ZCKP 4ZHLU 4UEHH 1EAUA 1C2GA 1O2LA 2CMYA 1TYNA 2SGEE 1W7XH 2XW9A 3Q00A 3RDZA 1H8IH 3EA7A 3GY3A 3E0NB 1RIWB 4F4OC 4HI3A 4CHAC 1C2MA 1TGTA 1XUHA 4I8JA 3T62A 3U8OH 3ZZ9A 1IQNA 4D9RA 2FOMB 4ZXXH 2F9UA 3RU4D 1C1QA 1Y3UA 1ETRH 2WUBA 3PMBB 1C2KA 1P03A 1FONA 1MTWA 5EXNA 1BDAA 2OC7A 1ANCA 2VIVA 1O2KA 5LPFA 1IHTH 1CBWC 3TJNA 3RXLA 1DANH 1GMCG 1CT4E 2FO9A 1V6DA 1QGFA 3TJUA 1UTJA 4FU7A 2AERH 2O9QA 3HKIB 4D76A 1TNGA 1CGJE 1AWHB 3SU0A 3M7QA 3RXBA 1LQEA 4IS5A 5HXFA 5JYIA 1AHTH 8ESTE 3ELAH 4AOQA 3BG4C 2IN2A 4CRDA 1SFQB 1WTHD 3QZRA 1O0DH 4BAKB 2W7UA 2FOCA 1BQYA 2GZ8A 1TGCA 1O30A 1THRH 3G01A 1GHWH 1J9CH 4FXGH 1OS8A 1BRUP 3F9FA 1ZOMA 2J2UA 3M5OA 1ZHPA 4I31A 2ANKH 2BVXH 1YLDA 1C1UH 4WH8A 1ESAA 1V2NT 1TPAE 1WOFA 2ZGBH 4YM9A 4AGKA 1QRWA 3SNBA 4INLA 1IQJA 1VCQA 4AFQA 3A7ZA 1TNJA 1TX7A 4ABHA 2BQ6B 4AGJA 2BY5X 2SNWA 1ZTKA 2QN5T 1P2IA 1SGPE 1DY9A 3GY5A 3GY2A 3KF2A 3SUFA 3U69H 2TGTA 2F3CE 2VWMA 2FI4E 1FY5A 4MDSA 1O2HA 2NU2E 3B8JA 1BTZA 5A0CA 1YPHE 3ATLA 5EXLA 3O8CA 1JOUB 7ESTE 1O38A 3JZ1B 1OWDA 2W5EA 1CU1A 2R9PA 3FP7E 1QJ6B 2WPJS 2ZDAH 2FODA 1KTSB 2GMTB 3QGNB 3MH4A 3TGJE 3RM0H 4OS5A 4AX9H 3OSYA 4XBBA 4CR5A 1EASA 2UUYA 2H9EH 1MCTA 3SUEA 1V2LT 1O2IA 1T8OA 1GHVH 4K8YA 4YOGA 1ZR0A 2AGIX 3S9BA 3S7KB 1WQSA 1TX6A 3TVJB 4X8TH 2DE8A 3ZZBA 1BTXA 2PLXA 1WQVH 1HNEE 1HPGA 2NU3E 3F9GA 2FX6A 1EUFA 2VIPA 4SGBE 2WPHS 2EI7A 4AB8A 1UTOA 2O8TA 2Z9JA 9LPRA 3GY6A 3D23A 2Z3DA 4ZHMU 1FY8E 2Y5HA 2AYWA 2O8UA 1O3HA 1CO7E 2FWWA 2FTLE 3ESTA 1V2RT 1V2UT 2BY8X 4YOJA 3P95A 1BBRE 1FY1A 2BD7A 3STIA 4CBOA 1O5DH 1SGYE 1DSUA 1G3DA 4AORA 4AYYB 1F0SA 3K2UA 1CT0E 1O2JA 1GI1A 2XC4A 1VITG 3Q76A 1GBMA 2GV6A 1QURH 1BTWA 4JK5A 4NZQA 1V2JT 2CHAB 2Z9GA 5CHAC 1ZYOA 1K1JA 1PPGE 1SPJA 3VGCC 3ATKA 1TFXA 1HV7A 2AH4X 1C2IA 4LK4A 2WPLS 1NRSH 3JZ2B 3NXPA 4A1TA 1MU6B 1TMBH 3GYMA 5C67A 2TGDA 1K1NA 1G3CA 4IN1A 5FPYA 1GHYH 1W7GH 3RC4A 3ZZ6A 1FIZA 4CRCA 2A4RA 2VU8E 4LZ1H 2EI6A 1J15A 1ELDE 2BOHB 1AE5A 1P2OA 4ZROA 1FDPA 1BUIA 1GJ6A 4H42U 4ISOA 1T7CA 1PPCE 2NU0E 1BIOA 1S0RA 3VB5A 4NG9H 2NU4E 5DG6A 4OS6A 3LGWA 3TGIE 1EXFA 1KXEA 1E37B 3TK5A 5DP9A 2SGPE 2BY6X 1BOQA 1O3EA 1SI5H 2VIDA 2OQ5A 4Y7AA 1TLDA 2W3IA 1C5NH 1SGQE 2YOLA 1OWIA 1SGTA 2ZIQH 5FCKA 3SV9A 3PO1C 1DICA 1SGNE 2PKSC 1UHBB 1BCUH 1EZSC 7GCHG 2BD2A 2BMGB 3NKKA 1GBEA 2WV4A 4B2CA 1KSNA 3K65B 4IGDA 1DSTA 2XC0A 1V2TT 1BB0B 1PYTC 1UVUH 3MO6A 4CHAB 1TBQH 3V13A 3VFEA 1C4Y2 1BTYA 2Z9IA 1HXFH 3EA8A 1VCPA 1DWCH 1L2EA 3MNSA 3EAJA 1MKXK 2ANYA 1EAXA 1LVBA 4RN6A 3TPIZ 1GWAA 3S9CA 1GDNA 1WU1A 5DGJA 1KLTA 1LKAA 5EW1H 1CBWB 2I6QA 3A8AA 2Y7XA 1W14U 4CRFA 1C1RA 2TGPZ 4NSYA 1Z8IB 2BDHA 4DGJA 1NN6A 3U9AH 1UTNA 3KCGH 1MKWK 1PPFE 3D49H 1BA8B 5GIBA 3SU5A 1G36A 2AGGX 1P2JA 2G51A 4ISIH 3ZZCA 5GCHG 3SQEE 1FPCH 2P95A 1F0RA 2ASUB 5C20A 1FY4A 2C8YB 3PROA 1ZZZA 3OU0A 1BT7A 5EGMA 4INHA 5J4SA 3P70B 3U1JB 1DLEA 1G2MA 3PYHA 3BG4B 1PFXC 5DJ7A 4RSPA 2QV1A 3TJOA 1P01A 1SGRE 3LDXH 1TWXB 3T29A 4GSOA 4Q80A 1VR1H 3ATMA 4X2YA 1D4PB 1WSSH 4H6TA 1AFEH 2PTCE 1EKBB 3KGPA 1P57B 4WMDA 1KDQB 1L1JA 3AW1A 1MZAA 1C5ZB 5HMAA 4J1YA 2F9NA 1HAHH 1XUKA 1D6WA 1J16A 3QZQA 1AUJA 1GBLA 4I8LA 4Y7BA 3PM3A 5EQSA 1ZRBA 4E05H 2QF0A 2A7HA 1G32B 4I7YH 1RFNA 1TX8A 1Z1IA 5E2OA 3CS0A 1OWEA 2VGCC 4Y11E 4ZXYH 3LC5A 1VZQH 4WF8A 1UMAH 1EPTC 2QXGA 4B75A 1GJDB 3RXEA 1CA0B 1C2HA 4X1RU 1HYLA 3UQVA 4FUFA 2FM2A 1NO9H 1TABE 2HWLB 1MTVA 2GZ7A 4BAMB 1CVWH 1BTPA 5JBTA 6GCHG 3SNDA 2BD4A 3H7TA 3DA9B 3FANA 1HIAA 5E2PA 4WY3A 1Y3XA 1AGJA 1EZUC 1C5MD 1KIGH 3FP8E 1CHOF 1K21H 1ZSKA 2HALA 1GBIA 4ABDA 1NRPH 1LDTT 4H4FA 3UOUA 1HJ8A 2J4IA 4AB9A 1NFUA 2BLVA 4OGYA 1H9HE 1H8DH 5E0JA 3H7OA 2UWPA 1XX9A 1S84A 3MH7A 4F49A 2G55A 1ESBA 1YGCH 3MO3A 4CBNA 1SHHB 2Z9LA 3M5MA 3DFJA 1C1TA 1DM4B 1LVMA 2WPKS 1GHBF 1HIAB 2BDCA 2BLWA 5T6GA 1IQFA 2ZHEH 2XCFA 2GZ9A 1LCYA 4ISLA 1GMCF 4ZAEA 1F5KU 1MUEB 1KY9A 3VPKA 4GCHG 2Z3CA 3RM2H 2XBWA 5CHAB 1GBBA 3VGCB 1C5VA 4Q7XA 2C8XB 2GT7A 2VB0A 1UCYK 3BTKE 3PLBA 3NCLA 2D1JA 1O3IA 2PSXA 3E0PB 3P6ZB 1UJ1A 3ZVEA 1AY6H 3UNRA 1ELBA 1XKAC 5AFYH 1A2CH 1C1VH 1S6FA 2GD4B 2BHGA 3U8RH 2CJIA 1MBQA 3QUMP 1O33A 3VEQB 1IHSH 1ZHMA 1O3NA 2Y5FA 1ARCA 3CENA 3SGQE 3E16B 2HOBA 2BYAX 2JH0D 2QGRA 1EZXC 2WPIS 3A7TA 4U2WA 4UDWH 2C4FH 3GCHC 2P8OC 3F6UH 3PLKA 2ZPQA 2H5DA 1V2PT 1T4VH 1GDQA 3LKWA 3PMAB 1MTNC 3RC5A 2XXLA 2SNVA 4NCYA 1T31A 4WMEA 1O2VA 4ABEA 3K9XB 2KAIA 3NK8A 3RUOA 1AO5A 3SV8A 2P3TB 3PO1B 2PKSB 1C5YB 1TGNA 2PV9B 2R2MB 4QT8C 2FLRH 4Q2KA 3T28A 3UR9A 3SJIA 1Q2WA 2FDAA 4FUCA 1P2KA 4JYTA 3DFLA 1BHXB 1F92A 3SI3H 2QXJA 3A89A 1AU8A 1DUEA 1ELAA 3A7WA 5C1XA 3A84A 3EYDA 4K2YA 1TAWA 2FX4A 5AFZH 3EA9A 3RXJA 5JB9S 3VXFH 1TONA 3V7TA 2PKAA 5JBBS 5B6OA 2KAIB 4X6OA 2ZFFH 1W0YH 1OP2A 1VCWA 3MHWU 4O03A 2BOKA 1Z8GA 1SLWB 1OSSA 1TRMA 1GJ4H 1AFQC 5SGAE 2VH0A 5C3NA 2ZHQH 4K60A 1ID5H 1T8LA 3S9AA 2WPMS 1KYNA 3LGYA 1ZTJA 3NUMA 2F9BH 1BJUA 1ZJDA 4AG2A 2VNTA 4ESTE 3E91A 4AN7A 1W0ZU 1C4V2 3DD2H 3ZVDA 1YLCA 1O5FH 3Q3XA 1SLUB 2ZZUH 5A2MH 3UWJH 1RRKA 3Q3YA 4KKDA 3OY6U 1EPTA 1C5QA 2ZFQH 1VITF 1GVKB 4HTCH 1O2MA 1FI8A 2PKAB 1SQTA 5DP5A 1O36A 2JH6D 1UTPA 4TWYA 3PTNA 3RXVA 1Y8TA 1HAOH 4X0WU 3R0FA 3BTHE 3EGKH 1MAXA 4B1TA 1PQAA 3HK6B 1S82A 4INKA 2GGVB 3M5LA 2B8OH 1YPJH 3HGNA 1OP0A 2BDYA 1GJBB 2H9TH 1BHXF 2BZAA 4KTUA 1XXFA 4TWWA 2ZPSA 1SVPA 4IW4E 4DVAU 1MTSA 2THFB 5FCRA 1ELCA 1P2QA 5T6FA 1W2KH 2VGCB 4IC6A 1W13U 4FUGA 1GI7B 1EPTB 2ZU3A 1YPMH 1FXYA 2Z3EA 3A88A 2RA0A 4X6PA 1GI5A 5A8YA 1RTLA 3AAVA 5ETXA 3SN8A 2GCHG 3MU5A 3C27B 3A8CA 3QLPH 1TBZH 3T26A 2VWNA 3QGJA 2BXUH 2ZTZA 3LGTA 4UFGH 5FAHA 2TBSA 4Y8ZA 2TGAA 2OD3B 3LH1A 2QXHA 3MU0A 1G3EA 1T8NA 1HGTH 2IPHA 1NY22 1A5HA 3UNQA 3GCOA 2XCNA 5DP7A 1EP5A 1DY8A 2GX4A 3T25A 1LVYA 3P8NA 7GCHF 5F8ZA 1LHGH 2AIQA 1JIRA 1O34A 3BTWE 3MU4A 4YT6H 1GJ8B 3BTQE 2BD3A 1GCTC 2LNCA 2G5NA 3QTVH 5EQRA 2F83A 2J38A 4BTTB 4UD9H 4MQAA 3SU4A 1P12E 4THNH 3PLPA 4OS4A 5IYTA 4MPUA 4X2XA 3TNTA 2EA3A 1FIWA 3RXTA 1LHDH 1S6HA 2GDEH 4MVNA 4O97A 1OKXA 3GDUA 2BVRH 1RTKA 1YP9A 4Y0YE 1O5GH 4ISHH 1B7XB 1QJ1B 1W10U 5LGOA 5GCHF 2ZCHP 2OXSA 4FUIA 4KTSA 4X6MA 1HAVA 3ZZ5A 3A82A 4RKJB 1GI3A 1NRNH 1TQ7B 1GBFA 1G30B 2G5VA 3ZYDA 3TH2H 2GVFA 1P02A 4WMFA 2GTBA 3HPTB 2OP9A 2AS9A 1UK3A 4NFFA 1ZSLA 1V3XA 2P93A 3BEIB 4A6LA 1H4WA 4WWYA 2C8ZB 1QB6A 3U8TH 3TIUA 2J94A 2ESTE 2Y7ZA 4Q7YA 1C5OH 3ZZ4A 3RXRA 4FUEA 1J8AA 1N1LA 3LJJA 4ZKSU 3GCHB 2HNTC 1LHFH 3ENSB 1A7SA 5AVDA 2WYJA 1HAVB 3IG6B 1MTNB 1L0ZA 1F2SE 4K1EA 1M9UA 1C1NA 1TA2A 1C2EA 1ABJH 1PPHE 2XWAA 3SHCH 4CRBA 3QDZB 1N6YA 1XXDA 4NA7A 4Z6AH 4JK6A 3AW0A 2BD5A 5CE1A 1O2RA 4Y79A 4ZMAH 8GCHG 1S0QA 4BANB 1QTFA 1C5LH 4GVUA 3RXOA 4FUDA 2QC2A 1ESTA 2BXTH 3BTDE 4IMQA 4YESB 4TPYA 3HATH 5A8ZA 2R3UA 2OINA 3DUXH 2B9LA 4X1NU 2AMQA 1P10A 3LGIA 2ULLA 6GCHF 1O37A 3E1XB 4A1XA 1XKBC 4YO9A 2QAAA 1XVOA 5HYOA 2FOBA 1HAPH 2FZZA 1VITH 1AUTC 1O2WA 1OYQA 4AFUA 3QX5H 3E90B 1O3GA 1A0JA 1QL7A 4GHTA 3I78A 4OGXA 3NZIA 2NU1E 3LOXA 1MKXH 1GL0E 1O2UA 3ZVFA 4K1TA 1EX3A 2BDAA 1BMLA 2FS8A 1IQMA 2BDIA 2A4OA 1AFQB 3BEFB 2Q6FA 4Y10E 1J17T 4Y0ZE 4JZFH 1F5LA 2BLQA 4IN2A 1J14A 2FTMA 3K6YA 2RA3A 1SLXB 1N8OC 1Q3XA 2ZU4A 1MKWH 1NPMA 4DURA 1O3BA 1HJAC 4X1SU 3UFAA 1ZHRA 1MZDA 1ZGVA 1T32A 2STBE 1U6QA 3Q3KA 3ZVAA 5DKMA 1PPBH 1GHAG 4WVPE 3RXDA 1P09A 2W3KA 3PTBA 3QN7A 2FYRA 3M5NA 5FBIA 3A83A 1C4U2 2D26C 4WXVA 4GCHF 1L1GA 1GI4A 5I46H 1ZPZA 3ITIA 2UUFB 2BQ7B 1FAXA 1TMTH 2FPZA 4MNYA 4CH2B 4GUXA 2FOGA 5L6NH 1EZQA 4ABIA 3OTJE 2OC0A 3SGBE 4IMZA 1N6XA 4ABFA 1O2XA 1RXPA 5LPRA 2ZDLA 1G9IE 1OYTH 5A0AE 4I8KA 3SGAE 3VB4A 3TK9A 1OXGA 2ZHFH 5AF9H 3KQEA 1GMHG 2Z6BD 3DT0H 3P92A 3N7OA 2OBOA 3TH3H 3PB1E 1KXBA 4X2VA 3D65E 4B2AA 5GWZA 1BZXE 4E7NA 3A85A 3MNCA 1O2ZA 3RXPA 1SR5C 3KEEA 1GJ7B 3R3GB 1Y3YA 4MPWA 1GG6C 5T6DA 5K7RA 3ZZ8A 5LPEA 2BDBA 1GI6A 4YLQH 1MQ6A 1PQ7A 1V2MT 8LPRA 3UTUH 1Q31A 1GBCA 3M3SA 3SI4H 2A2QH 2SGQE 5TCAA 2FS9A 1X7AC 2F9PA 4ISNA 5F8XA 3P8FA 4BNRA 4A92A 2ANMH 3M3TA 1GCTB 1GI8B 1V2QT 3L3TA 2JETC 3KQCA 2A5KA 2CXVA 2ZI2H 1NFYA 3SNCA 1P0SH 4GLYA 3TITA 2ZNKH 4LOYH 1RGQA 3EE0B 3OY5U 1HAYB 1YC0A 4CR9A 4BTUB 4U32A 2PFEA 3SNAA 1KXAA 1E35B 2TIOA 5EG4A 5GXPA 4B73A 1EOJA 2BY9X 2ZCLP 1QBVH 4U30A 1O5EH 3UREA 3TJVA 1ARBA 1NFWA 2FYQA 1JBUH 1PQ8A 5E0HA 2XBXA 1HUTH 1LHCH 1QB9A 1O3JA 3RXCA 1OX1A 1DVAH 5ESBA 3FVFB 4UFDH 2A45B 2G4UA 3PWBA 1AMHA 1UCYH 1BMMH 1L4DA 3E8LA 1KXFA 4CH8B 1OWKA 3RP2A 3GY4A 2AGEX 1JMOH 3SJ8A 1GGDC 4DJZB 1IQKA 4AYVB 4ZKOU 4ZKRU 1ELGA 4JCNA 2ZECA 4DIIH 1AB9C 2V35A 3AASA 3Q77A 3MFJA 1D6RA 2A0QB 4ZKNU 1NTPA 1BRAA 1NC6A 3M7TA 3HK3B 3SU6A 3RMOH 1OWJA 5AHGH 3VB3A 2C90B 1GJ5H 3IWMA 3LU9B 4LZ4B 1W3CA 1LPKB 3E6PH 3SBKA 1ACBE 1Z8JB 4FUBA 1IQLA 1PQ5A 1QA7A 4A1VA 1JWTA 1G2LA 1GMDG 1B5GH 1SGDE 1FUJA 1V2ST 2PGBB 2VVVA 4AZ2B 2OC1A 3AVZA 1YPHC 3SNEA 3QTOH 1FMGA 2AFQB 3BTEE 1BTHH 5C5OA 4JZEH 2V6NA 1YYY1 3RU4T 1C1MA 4GPGA 1DS2E 2XRCA 2PR3A 5DO4H 7LPRA 3ATIA 1AZ8A 2GCHF 4LXBH 2VIQA 2F9VA 4R8TB 1O2GH 3KQDA 1A0LA 1O32A 1C2DA 3L6PA 2JH5D 1TNHA 2OQUA 2FLBH 3K6ZA 1O3FA 1HRTH 2ZDKA 1Z71A 1A4WH 1NM6A 5L30H 1E38B 1TRYA 3S69A 1O2YA 4X1QU 2H2ZA 4TPIZ 1LPGB 4JYVH 2BD8A 1DXPA 3ZVBA 1CA8B 4HFPB 1NROH 2FOAA 1C5SA 3QK1A 1L4ZA 2EI8A 2EC9H 2Z94A 1GL1A 4ASHA 1GVLA 3SJOA 1DFPA 5JPMH 1O2SA 3A86A 5EU8A 3RMMH 3T2NA 1ZPBA 2HNTF 1GJ9B 2W7SA 1N8OB 3UY9A 3ZYEA 7KMEH 4D7FA 2QYIA 2J92A 1HJAB 3TNSA 1AI8H 1YM0A 4JZIA 2G81E 4M7GA 1DX5M 1NU7B 2ZFPH 4BXWA 1C1WH 4BAHB 1SC8U 4JYUH 3UNSA 1BTUA 2B0FA 1DDJA 1EJAA 2Y5GA 3FAOA 1K1MA 1QRZA 2BQWB 1MU8B 4X6NA 1JIMA 1JRSA 1SHYA 4OS1A 4YT7H 1K22H 4DIHH 1QY6A 3M3VA 1Z8RA 1BBRK 1F0TA 5DP8A 1SQOA 2QA9E 2BX4A 2ZDVH 5TJXA 1ZMLA 4DW2U 1HDTH 3TU7H 1P11E 5C5NA 2ZU2A 3MU8A 3TLOA 1CHGA 2Y80A 1LQDB 2FEQH 4SGAE 1ETTH 1YCPK 4U01A 2VH6A 1ZGIA 2A31A 2GDDA 4K5ZA 3GOVB 1SG8B 5JDUB 1FPHH 1FQ3A 3BV9B 1BITA 4Y76A 4BXSA 5GJ4B 1TGBA 3QWCH 3FP6E 2Y6TA 3M36A 3A7XA 3V0XA 3ATWA 4A5TS 1XUGA 4YLUA 1K1PA 1THPB 4NIYA 3LJOA 3GDSA 3PV4A 5BRRE 3U1IB 1MMJN 2WINI 1NFXA 5GDSH 2PHBA 1QA0A 3LONA 1IQHA 4NIWA 1AD8H 1O3OA 2RCEA 4WJG2 2WUCA 4E7RG 1HCGA 1GBDA 1XUIA 3ZZDA 1QL8A 4JZ1A 1GG6B 4AG1A 4NA8A 3VXEH 1E0FD 4UFFH 4BAQB 4XOJA 2DE9A 5DP6A 1G37A 1C5XB 4ZHAA 4NGAH 4AFZA 1D3QB 3FFGA 5C1YA 5PTPA 5C1UA 3BTGE 2STAE 2HVXA 8GCHF 1P9SA 1DWEH 5J4QA 3A8BA 1GCDA 2W26A 1C5PA 5DPAA 2OC8A 2PUXB 1O5AB 2ZGJA 2JETB 2G00A 2YNAA 2FESH 3KQBA 4X8UH 3FZDA 1AVWA 1P2NA 1UTMA 3H5CB 2BVSH 4Y71A 1DWDH 1HJ9A 2EEKA 3A7YA 1SSXA 2ZWLH 2XC5A 5EOKA 1FN8A 1TQ0B 2A2XH 1QB1A 1BMAA 1QIXB 1TNLA 3D62A 4NIVA 1TGSZ 3UPEA 1NU9A 1RD3B 4CRGA 1C2FA 1W8BH 3UWIA 2ZU5A 1QBNA 3EDXB 3S0NA 4DT7B 2J34A 1BRBE 2CGAA 5FBEA 2H6MA 1QHRB 2ZP0H 3RXHA 1GHBG 3TGKE 2M5TA 3SV2H 3LT3A 3W95A 1UVTH 3KN2A 3LH3A 4XBDA 2IJOB 4HGCA 4DOQA 2PSYA 2CV3A 5FXLA 1MTUA 5FX5A 1WTGH 2XYAA 1HAIH 1S85A 1QBOA 1GHAF 3FZZA 4KP0A 3RMLH 4DCDA 2GCTC 1C2LA 3F1SB 1Y3VA 1O2TA 2D2DA 4MNVA 4X2WA 1GGDB 1JRTA 2ZEBA 1SMFE 4JZDH 4MPXA 1DOJA 1TA6A 2A1DB 2A4GA 1INCA 1ANDA 1YPEH 3SU3A 2Q6GA 2XWBI 3RXMA 1AB9B 3I29A 1O3AA 2QXIA 2J9NA 4K3JA 3BG8A 4UE7H 4B71A 1LVOA 2P94A 1MD8A 1UO6A 2ZKSA 2F9OA 5ESTE 4PROA 4XFQA 1PPZA 2V0BA 2BDGA 1EB1H 1IQGA 4K1SA 5BPEA 3B23B 3SORA 1EATA 3GYLB 3WY8A 2FXRA 1SGCA 2G52A 1THSH 1O39A 2GT8A 5DP3A 1S81A 3A8DA 4I33A 1GMHF 2ZDMA 1NS3A 3C1KA 3KNXA 1D3TB 1AZZA 4DG4A 4NFEA 1BJVA 2FMJA 3HGPA 1ETSH 1HAZB 3EQ0H 5HGGA 3RXFA 1C9TA 3LC3A 3RXIA 3F9HA 1T4UH 1Y5BT 1ABIH 1O3MA 2ZQ2A 3URCA 3V3MA 1UCYE 3A80A 3RU4E 1SL3A 3A87A 1W11U 1VJ9U 1EP6A 4JMYA 1UVSH 1O3CA 1TB6H 5TCCA 1NRQH 2HLCA 2ZQ1A 2OBQA 1MQ5A 1CA0C 1K2I1 4H6SB 1TPOA 1A0HB 3ZZAA 1ELFA 1GBAA 5EW2H 2UWLA 1VGCC 3O8RA 1TALA 2UWOA 1K1LA 4XBCA 3O8DA 1Z7KA 2I6SA 4Y8YA 1SOTA 1Y5AT 2P8OB 2XNIA 2C8WB 3PMJA 2ANWA 4AFSA 1P3EA 1AQ7A 1GI0A 4D7GA 2HGTH 5ABWA 2ZG0H 4Z0KA 1Y3WA 2AIPA 1G3BA 1NT1A 1TNKA 1YF4A 3SO3A 3M7UA 2A7CA 4O3UA 1EOLA 1DT2A 2BZ6H 3O8BA 5A0BA 1TPSA 5EQQA 2O8LA 1OWHA 2K1QA 3RLWH 3LGUA 2ZFSA 1DXWA 2C93B 2R3YA 2ZC9H 1O2OA 1YKTA 2VINA 3GCTG 5FHTA 4NIXA 5EXMA 1GDUA 5HM2A 1FLEE 1V2VT 3MTYA 1UTQA 2QCYA 1QFKH 3V12A 1LMWB 2D8WA 1WUNH 4FUJA 4KTCA 1AIXH 1HFDA 1E34B 1GBHA 1UK2A 1EQ9A 4ABAA 1D3DB 4ZUHA 1GVZA 4IBLH 2ZPRA 1E36B 5F8TA 3ODDA 1YCPM 1OOKB 1FV9A 1YPLH 2BB4A 2OCVB 1CGHA 1XVMA 1YBWA 1QL9A 4D9QA 3T5FH 2QY0B 1Z6EA 1HBTH 3MH6A 2Y81A 1DE7H 3SUGA 4NA9H 4ZH8A 5JBCS 1UVPA 1ZRKA 1KTTB 1Y59T 1DUAA 2OTVA 1EAWA 3GDVA 1QJ7B 1ZPCA 3L33A 1HAGE 2Z7FE 5E8EH 5A09A 1TBRH 1F5RA 1MCVA 4I8GA 5I25A 4E06H 2XTTB 1HB0B 1HXEH 1YPKH 2VJ1A 1O3KA 1O5CB 1AE8H 1TIOA 6CHAC 2FOFA 1P2MA 1FAKH 2A4QA 3KL6A 2SGAA 2TRMA 3M35A 1NESE 4I32A 4X8VH 1UHBA 1XM1A 2GKVE 2O8MA 4KGAA 1GMDF 2ODQA 1AVGH 1P04A 1C5WB 1SLVB 1IAUA 4NWLA 5F03A 4K69A 4A7IB 4OS7A 4BOHA 2FIRH 1O31A 2ALVA 1A46H 1UTLM 3MOCA 3SU1A 4NZLA 4TYDA 4OS2A 2ZO3H 1RJXB 1QRXA 1WYKA 4UFEH 1O3DA 2Y82A 1O2PA 2ODPA 2LPRA 4YZUA 5CMXH 1C2JA 3A81A 4R0IA 1FNIA 3RXSA 1XUFA 2ZU1A 1P9UA 4Y6DA 3SV7A 3VB6A 1SGFG 2BD9A 1MH0A 1V2KT 4YTAA 3RXUA 2CF9H 1B0FA 1SFIA 2PGQB 2Q6DA 2H9HA 1AWFH 1AVXA 1K1IA 1P3CA 2G4TA 3BF6H 4X1PU 1TOMH 1A3EH 1SGIB 1AKSA 2GV7A 2F91A 1HAXB 1QQUA 2PWXA 4IC5A 1FJSA 1KXCA 1EAIA 2H5CA 5FPSA 1GJCB 1IQIA 1EJMA 5EPNA 2Q1JA 2J95A 1SGEE 2ILNA 1KDQA 2O8WA 1GBTA 1ANBA 3STJA 1C9PA 2Z9KA 2BX3A 2GCTB 4ABGA 5JBAS 2RDLA 2ZHWH 2V3OH 4MLFB 1GI9B 2OLGA 3GY8A 3ZV9A 1P8VC 2OUAA 2ODYB 4FVBA 3TH4H 3MU1A 1EJNA 3TK6A 1ELEE 3UIRA 3SQHE 2TPIZ 1HLTH 3MNBA 1TMUH 1D9IA 1UVOA 3S7HB 4YOIA 1WAYB 3RXQA 3ZVGA 4VGCC 4RKOB 2XBYA 2ZHDA 1DLKB 1QR3E 1A5IA 2P59A 1AKSB 3U98H 2BTCE 1Z6JH 3CS7A 1V2OT 1CGIE 2A5AA 2B7DH 2FOHA 1ZSJA 1K9OE 4GAWA 3MWIU 2IOTA 1PJPA 3VB7A 1RIWC 3BN9A 3UOPA 4I8HA 3P17H 2SGFE 1O3PB 1LHEH 3SV6A 2QIQA 1C5RA 1DPOA 2FI5E 4J2YB 3RXAA 3CP7A 3ZZ3A 4BAOB 2PW8H 1WV7H 3ZV8A 1T8MA 3GY7A 2G8TA 1C5TA 4XE4A 1QCPA 3GCNA 1F7ZA 1SB1H 1Z1JA 1VJAU 5EODA 1Y5UT 3LPRA 2A32A 3BEUA 1RTFB 4B2BA 1XMNB 3MI4A 2A5IA 1C1OA 3KIDU 2WV5A 2ZA5A 1C1PA 1S83A 1V2WT 1VGCB 2GP9B 2AMPA 2PUQH 2ZGCA 4WXIA 1CE5A 1O2QA 3MYWA 2ZF0H 2VVCA 3NWUA 3MMGA 1O35A 4MNWA 1GBKA 1GPZA 3B9FH 1O2NA 1K1OA 2RG3A 3SOSA 1GHZA 1L1NA 2YNBA 1ZTLA 1OP8A 3M61U 1IQEA 1UTKA 3RLYH 2ZGHA 1LPZB 2H1UA 3URDA 1PPEE 2HNTE 3RMNH 3BTTE 3BSQA 2C3SA 2UUKB 1MD7A 1FY3A 2ALPA 1O3LA 2DUCA 3SU2A 2P16A 1LTOA 1NRRH 2HPQH 1AN1E 5E0GA 1B0EA 2V3HH 5HM9A 5A8XA 3PMHB 3KHVA 1BBRH 4XSKU 3MH5A 1H9IE 1PYTD 3RXGA 4O9VA 2B5TB 2JKHA 5LH8A 2BM2A 5H4IB 3RXKA 1FN6A 4MNXA 4FU9A 1TNIA 3BIVH 1A5GH 2NWNA 1A61H 2VIOA 3ZVCA 3I77A 4B76A 4TY7A 5L2YH 1F0UA 1QNJA 2HRVA 3SW2B 1IOEA 1WCZA 1YCPH 2GMTC 2XBVA 4KELA 5GPIB 3SZNA 4NWKA 1ZMNA 2ZGXH 1K28D 1KXDA 2SFAA 3AAUA 2R2WU 1H9LB 3SJ9A 1OPHB 2CN0H 9ESTA 3UUZA 1RS0A 3M37A 4MTBA 5F6MA 1LKBA 3PWCA 6CHAB 3A7VA 4B74A 2QF3A 3W94A 2SGDE 1MAYA 3LIWA 4Q7ZA 4CRAA 5IDKA 3OYPA 4Y8XA 3F9EA 2ZFTA 4GHQA 1FZZA 2HPPH
chains in the Genus database with same CATH superfamily
1TRNA 4FVDA 4Z1MD 3BTFE 2EQNA 3ODFA 4WH6A 1KLJH 2AEIH 1CSOE 1WBGB 4FUHA 4O3TA 4XRNA 1BMNH 5K0HA 1P05A 3GICB 1C1SA 1W12U 2A7JA 1P06A 2CF8H 1ANEA 2VWOA 1ZMJA 4ABJA 4XDEA 2UUJB 1GJAB 1YPGH 3OX7U 3SJKA 2VIWA 3BIUH 1NZQH 1DWBH 1ELVA 3NPSA 2R0KA 4X8SH 3T27A 8KME2 1GBJA 1JXPA 2PTNA 4MPVA 2CHAC 3P8OA 2VWLA 2ZTYA 3GISB 3HKJB 5T3HA 1SQAA 4HZHA 1SOZA 2WYGA 3F68H 5CDFE 3ZZ7A 3KYFA 6ESTA 5FPTA 1TPPA 2ZFRH 4K8BA 4CREA 1CT2E 2P3UB 3RC6A 4D8NA 2BLOA 1ZLRA 2AMDA 1ORFA 1BRCE 2J97A 2BY7X 1C5UA 3MNXA 5DK1A 3DHKH 5FX6A 1CQQA 4ABBA 5JB8S 5L2ZH 1TE0A 3BTME 3QO6A 1A1RA 4FOUC 5C2ZA 4UONA 1SGFA 3UQOA 3SUDA 1SBWA 1GI2A 1MBMA 1KLIH 2ZDNA 3SHAH 2P3FH 2FP7B 4TY6A 1O5BB 1EB2A 3P8GA 4MG3A 3UR6A 1XUJA 6LPRA 2XNDD 4BTIB 5G4BA 2ZTXA 3GCTF 3MO9A 1GHXH 1LO6A 3E3TA 4DY7B 1TOCB 1ZJKA 2FOEA 1UK4A 5DP4A 4FU8A 3MQKC 2R0LA 1S5SA 4NSVA 2VVUA 1H1BA 1DITH 1A3BH 1CHOG 3LGVA 5EPYA 1D3PB 3IITA 3DSPA 4VGCB 1QQ4A 2FI3E 1ELTA 2ZCKP 4ZHLU 4UEHH 1EAUA 3DSOA 4B6FA 1C2GA 1O2LA 2CMYA 1TYNA 3KQ5A 2SGEE 1W7XH 2XW9A 3Q00A 3RDZA 1H8IH 3EA7A 3GY3A 3E0NB 1RIWB 4F4OC 4HI3A 4CHAC 1C2MA 1TGTA 1XUHA 4I8JA 3T62A 3U8OH 3ZZ9A 1IQNA 4D9RA 2FOMB 4ZXXH 2F9UA 3RU4D 1C1QA 1Y3UA 1ETRH 2WUBA 3PMBB 1C2KA 2GJGA 1P03A 1FONA 1MTWA 5EXNA 1BDAA 2OC7A 1ANCA 2VIVA 1O2KA 2W6ID 5LPFA 1IHTH 1CBWC 3TJNA 3RXLA 1DANH 1GMCG 1CT4E 2FO9A 1V6DA 1QGFA 3TJUA 1UTJA 4FU7A 2AERH 2O9QA 3HKIB 4D76A 2KCAA 1TNGA 1CGJE 1AWHB 3SU0A 3M7QA 5KEDA 3RXBA 1LQEA 4IS5A 5HXFA 5JYIA 1AHTH 3W1EA 8ESTE 3ELAH 4AOQA 3BG4C 2IN2A 4CRDA 1SFQB 1WTHD 3QZRA 1O0DH 4BAKB 2W7UA 2FOCA 1BQYA 2GZ8A 1TGCA 1O30A 1THRH 3G01A 1GHWH 1J9CH 4FXGH 1OS8A 1BRUP 3F9FA 1ZOMA 2J2UA 3M5OA 1ZHPA 4I31A 2ANKH 2BVXH 1YLDA 1C1UH 4WH8A 1ESAA 1V2NT 2QF4A 1TPAE 1WOFA 2ZGBH 4YM9A 4AGKA 1QRWA 3SNBA 4INLA 1IQJA 1VCQA 4AFQA 3A7ZA 1TNJA 3FO8D 1TX7A 4ABHA 2BQ6B 4AGJA 2BY5X 4TT3D 2SNWA 1ZTKA 2QN5T 1P2IA 1SGPE 1DY9A 3GY5A 3GY2A 3KF2A 3SUFA 3U69H 2TGTA 2F3CE 3PRDA 2VWMA 2FI4E 1FY5A 4MDSA 1O2HA 2NU2E 3B8JA 1BTZA 5A0CA 1YPHE 4F55A 3ATLA 5EXLA 3O8CA 1JOUB 7ESTE 1O38A 3JZ1B 1OWDA 2W5EA 1CU1A 2R9PA 3FP7E 1QJ6B 2WPJS 2ZDAH 2FODA 3OE7D 1KTSB 2GMTB 3QGNB 3MH4A 3TGJE 3RM0H 4OS5A 4AX9H 3OSYA 4XBBA 4CR5A 1EASA 2UUYA 2H9EH 1MCTA 3SUEA 1V2LT 1O2IA 1T8OA 1GHVH 3N99A 4K8YA 4YOGA 1ZR0A 2AGIX 3S9BA 3S7KB 1WQSA 1TX6A 3TVJB 2WSSD 4X8TH 2DE8A 3ZZBA 1BTXA 2PLXA 3SZEA 1WQVH 1HNEE 1HPGA 2NU3E 3F9GA 4ACAA 2FX6A 1EUFA 2VIPA 4SGBE 2WPHS 2EI7A 4AB8A 1UTOA 2O8TA 2Z9JA 9LPRA 3GY6A 3D23A 3OFND 2Z3DA 4ZHMU 1FY8E 2Y5HA 2AYWA 1O3HA 1CO7E 2O8UA 2FWWA 2FTLE 3ESTA 1V2RT 1V2UT 2BY8X 4YOJA 3P95A 1BBRE 2JJ1D 1FY1A 2BD7A 3STIA 4CBOA 1O5DH 1SGYE 1DSUA 2K8IA 1G3DA 4AORA 4AYYB 1F0SA 4B6EA 3K2UA 5C0TA 1CT0E 1O2JA 1GI1A 2XC4A 1VITG 2KCPA 3Q76A 1GBMA 2GV6A 1QURH 1BTWA 4JK5A 4NZQA 1V2JT 2CHAB 2Z9GA 5CHAC 1ZYOA 1K1JA 1PPGE 1SPJA 3VGCC 3ATKA 1TFXA 1HV7A 2AH4X 1C2IA 4LK4A 2WPLS 1NRSH 3JZ2B 3NXPA 4A1TA 1MU6B 2IPQX 1TMBH 3GYMA 5C67A 2TGDA 1K1NA 1G3CA 4FETA 4IN1A 5FPYA 1GHYH 1W7GH 3DCLA 3RC4A 3ZZ6A 1FIZA 4CRCA 2A4RA 2VU8E 4LZ1H 2EI6A 1J15A 1ELDE 2BOHB 1AE5A 1P2OA 4ZROA 1FDPA 1BUIA 1GJ6A 4H42U 4ISOA 1T7CA 1PPCE 2NU0E 1BIOA 1S0RA 3VB5A 4NG9H 2NU4E 5DG6A 4OS6A 3LGWA 5B6LA 3TGIE 1EXFA 1KXEA 1E37B 3TK5A 5DP9A 2SGPE 5CHBA 2BY6X 1BOQA 1O3EA 1SI5H 2VIDA 2OQ5A 2OK5A 4Y7AA 1TLDA 2W3IA 1C5NH 1SGQE 3FOAA 2YOLA 1OWIA 1SGTA 2ZIQH 5FCKA 3SV9A 3PO1C 1DICA 1SGNE 2PKSC 1UHBB 1BCUH 1EZSC 7GCHG 2BD2A 2JJ2D 2BMGB 3NKKA 5IK2D 1GBEA 4F48B 2WV4A 4B2CA 1KSNA 3K65B 4IGDA 1DSTA 2XC0A 1V2TT 1BB0B 1PYTC 1UVUH 3MO6A 4CHAB 1TBQH 3V13A 3VFEA 3NRLA 1C4Y2 1BTYA 2Z9IA 1HXFH 3EA8A 1VCPA 1DWCH 1L2EA 3MNSA 3EAJA 1MKXK 2ANYA 1EAXA 1LVBA 4RN6A 3TPIZ 1GWAA 3S9CA 1GDNA 3UAIC 1WU1A 5DGJA 1KLTA 1LKAA 5EW1H 1CBWB 2I6QA 3A8AA 2Y7XA 1W14U 4CRFA 1C1RA 2TGPZ 4NSYA 1Z8IB 2BDHA 5KGOA 4DGJA 1NN6A 3U9AH 1UTNA 3KCGH 1MKWK 1PPFE 3D49H 1BA8B 5GIBA 3SU5A 1G36A 2AGGX 1P2JA 2G51A 4ISIH 3ZZCA 5GCHG 3SQEE 1FPCH 2P95A 1F0RA 2ASUB 5C20A 1FY4A 2C8YB 3PROA 1ZZZA 3OU0A 1BT7A 5EGMA 4INHA 5J4SA 3P70B 3U1JB 2K0QA 1DLEA 1G2MA 3PYHA 3BG4B 1PFXC 5DJ7A 4RSPA 2QV1A 3TJOA 1P01A 2L74A 1SGRE 3LDXH 1TWXB 3T29A 4GSOA 4P00A 4Q80A 2HLDD 1VR1H 3ATMA 3F2GA 4X2YA 1D4PB 1WSSH 4H6TA 1AFEH 2PTCE 1EKBB 3KGPA 1P57B 4WMDA 1KDQB 1L1JA 3AW1A 1MZAA 1C5ZB 5HMAA 5EJLA 4J1YA 2F9NA 1HAHH 1XUKA 1D6WA 1J16A 3QZQA 1AUJA 1GBLA 4I8LA 4Y7BA 3PM3A 5EQSA 1ZRBA 4E05H 2QF0A 2A7HA 1G32B 4I7YH 1RFNA 1TX8A 1Z1IA 5E2OA 3CS0A 1OWEA 2VGCC 4Q4LA 4Y11E 4ZXYH 3LC5A 1VZQH 4WF8A 1UMAH 1EPTC 2QXGA 4B75A 2V3MA 1GJDB 2F4LA 3RXEA 1CA0B 1C2HA 4X1RU 1HYLA 3UQVA 1YWUA 4FUFA 2FM2A 1NO9H 1TABE 2HWLB 1MTVA 2GZ7A 4BAMB 1CVWH 1BTPA 5JBTA 6GCHG 3SNDA 2BD4A 3H7TA 3DA9B 3FANA 1HIAA 5E2PA 4WY3A 1Y3XA 1AGJA 1EZUC 1C5MD 1KIGH 3FP8E 1CHOF 1K21H 1ZSKA 2HALA 2QE7D 1H8HD 1GBIA 4ABDA 1NRPH 1LDTT 4H4FA 3UOUA 1HJ8A 2J4IA 4AB9A 1NFUA 2BLVA 4OGYA 1H9HE 1H8DH 5E0JA 3H7OA 2UWPA 1XX9A 1S84A 3MH7A 4F49A 2G55A 3DSGA 1ESBA 1YGCH 5C0UA 3MO3A 4CBNA 1SHHB 2Z9LA 3M5MA 3DFJA 1C1TA 1DM4B 1LVMA 2WPKS 1GHBF 1HIAB 2BDCA 2BLWA 5T6GA 1IQFA 2ZHEH 2XCFA 2GZ9A 1LCYA 4ISLA 1GMCF 4ZAEA 1F5KU 1MUEB 2WV9A 1KY9A 3VPKA 4GCHG 2Z3CA 3RM2H 2XBWA 5CHAB 1GBBA 3KYGA 3VGCB 1C5VA 4Q7XA 2C8XB 2GT7A 2VB0A 1UCYK 3BTKE 3PLBA 3NCLA 2D1JA 1O3IA 2PSXA 3E0PB 3P6ZB 4OM9A 1UJ1A 3ZVEA 1AY6H 3UNRA 1ELBA 1XKAC 5AFYH 1A2CH 1C1VH 1S6FA 2GD4B 2BHGA 3U8RH 2CJIA 1MBQA 3QUMP 1O33A 3VEQB 1IHSH 1ZHMA 1O3NA 2Y5FA 1ARCA 3CENA 3SGQE 3E16B 2HOBA 2BYAX 2JH0D 2QGRA 1EZXC 2WPIS 3A7TA 4U2WA 4UDWH 2C4FH 3GCHC 2P8OC 3F6UH 3PLKA 2ZPQA 2H5DA 1V2PT 1T4VH 1GDQA 3LKWA 3PMAB 1MTNC 3RC5A 2XXLA 2SNVA 4NCYA 2CK3D 1T31A 2V7QD 4WMEA 1O2VA 4ABEA 3K9XB 2KAIA 3U28C 3NK8A 3RUOA 1AO5A 3SV8A 2P3TB 3PO1B 2PKSB 1C5YB 1TGNA 2PV9B 2R2MB 4QT8C 2FLRH 4Q2KA 3T28A 5T1VA 3UR9A 3SJIA 1Q2WA 2FDAA 4FUCA 1P2KA 4JYTA 3DFLA 1BHXB 1F92A 3SI3H 2QXJA 3A89A 1AU8A 1DUEA 1ELAA 2W6JD 3A7WA 5C1XA 3A84A 3EYDA 4K2YA 1TAWA 2FX4A 5AFZH 3EA9A 3RXJA 5JB9S 3VXFH 1TONA 3V7TA 2PKAA 5JBBS 5B6OA 2KAIB 4X6OA 2ZFFH 5FL7D 1W0YH 1OP2A 1VCWA 3MHWU 4O03A 2BOKA 1Z8GA 1SLWB 3F3BA 1OSSA 1TRMA 1GJ4H 1AFQC 5SGAE 2VH0A 5C3NA 2ZHQH 2KFWA 4K60A 3WWFA 1ID5H 2RDEA 1T8LA 3S9AA 2WPMS 1KYNA 3LGYA 1ZTJA 3NUMA 2F9BH 1BJUA 1ZJDA 4AG2A 2VNTA 4ESTE 3E91A 4AN7A 1W0ZU 1C4V2 3DD2H 3ZVDA 1YLCA 4RT1A 1O5FH 3Q3XA 1SLUB 2ZZUH 5A2MH 3UWJH 1RRKA 3Q3YA 4KKDA 3OY6U 1EPTA 1C5QA 2ZFQH 1VITF 1GVKB 4HTCH 1O2MA 1FI8A 2PKAB 1SQTA 5DP5A 1O36A 2JH6D 1UTPA 5EJ1A 5HIZA 4TWYA 3PTNA 3RXVA 1Y8TA 1HAOH 4X0WU 3R0FA 3BTHE 3EGKH 1MAXA 4B1TA 1PQAA 3HK6B 1S82A 4INKA 3FKSD 2GGVB 3M5LA 2B8OH 1YPJH 3HGNA 1OP0A 2BDYA 2HVYB 2J98A 4HG6A 1E1QD 1GJBB 2H9TH 1BHXF 2BZAA 4KTUA 1XXFA 4TWWA 2ZPSA 1SVPA 4IW4E 4DVAU 1MTSA 2THFB 5FCRA 1ELCA 1P2QA 5T6FA 1W2KH 2VGCB 4IC6A 1W13U 4FUGA 2VBCA 1GI7B 1EPTB 2ZU3A 1YPMH 1FXYA 2Z3EA 3A88A 2RA0A 4X6PA 1GI5A 5A8YA 1RTLA 3AAVA 5ETXA 3SN8A 2GCHG 3MU5A 3C27B 3A8CA 3QLPH 1TBZH 3T26A 2VWNA 3QGJA 2BXUH 2ZTZA 3LGTA 4UFGH 5FAHA 2TBSA 4Y8ZA 2TGAA 2OD3B 3LH1A 1MABB 2F43B 2QXHA 3MU0A 1G3EA 1T8NA 2EY4C 1HGTH 2IPHA 1NY22 1A5HA 3UNQA 3GCOA 2XCNA 5DP7A 1EP5A 1DY8A 2GX4A 3T25A 1LVYA 3P8NA 7GCHF 5F8ZA 1LHGH 2AIQA 1JIRA 1O34A 3BTWE 3MU4A 4YT6H 1GJ8B 3SYJA 3BTQE 2BD3A 1GCTC 2LNCA 1KMHB 2G5NA 3QTVH 5EQRA 2F83A 2J38A 4BTTB 4UD9H 4MQAA 3SU4A 1P12E 4THNH 3PLPA 4OS4A 5IYTA 3GS9A 4MPUA 4X2XA 3TNTA 2EA3A 1FIWA 3RXTA 1LHDH 1S6HA 2GDEH 4MVNA 4O97A 3PV5A 1OKXA 3GDUA 2BVRH 1RTKA 1YP9A 4Y0YE 1O5GH 4ISHH 1B7XB 1QJ1B 1W10U 5LGOA 5GCHF 2ZCHP 2OXSA 4FUIA 4KTSA 4X6MA 1HAVA 3ZZ5A 3A82A 4RKJB 1GI3A 1NRNH 1TQ7B 1GBFA 1G30B 2G5VA 3ZYDA 3TH2H 2GVFA 1P02A 4WMFA 2GTBA 2IJD1 3HPTB 4I86A 2OP9A 2AS9A 1UK3A 4NFFA 1ZSLA 1V3XA 2P93A 3BEIB 4A6LA 1H4WA 4WWYA 2C8ZB 3OAAD 1QB6A 3U8TH 3TIUA 2J94A 2ESTE 2Y7ZA 4Q7YA 1C5OH 3ZZ4A 3RXRA 4FUEA 1J8AA 1N1LA 3LJJA 4ZKSU 3GCHB 2HNTC 1VKYA 1LHFH 4ASUD 3ENSB 1A7SA 5AVDA 2WYJA 1HAVB 3IG6B 1MTNB 1L0ZA 1F2SE 4K1EA 1M9UA 1C1NA 1TA2A 1C2EA 1ABJH 1PPHE 2XWAA 3SHCH 4CRBA 3QDZB 1N6YA 1XXDA 4NA7A 4Z6AH 4JK6A 3AW0A 2BD5A 5CE1A 1O2RA 4Y79A 4ZMAH 8GCHG 1S0QA 4BANB 1QTFA 1C5LH 4GVUA 3RXOA 1W0JD 4FUDA 2QC2A 1ESTA 2BXTH 3BTDE 4IMQA 4YESB 4TPYA 2QF5A 3HATH 2R3UA 2OINA 3DUXH 5A8ZA 2B9LA 4X1NU 2AMQA 1P10A 3LGIA 2ULLA 6GCHF 1O37A 3E1XB 4A1XA 1XKBC 4YO9A 2QAAA 1XVOA 5HYOA 2FOBA 1HAPH 2FZZA 1VITH 1AUTC 1O2WA 1OYQA 4AFUA 3QX5H 3E90B 1O3GA 1A0JA 1QL7A 4GHTA 3I78A 4OGXA 3NZIA 2NU1E 3LOXA 1MKXH 5EIYA 1GL0E 1O2UA 3ZVFA 4K1TA 1EX3A 2BDAA 1BMLA 2FS8A 4P02A 1IQMA 2BDIA 2A4OA 1AFQB 3BEFB 5C94A 2Q6FA 4Y10E 1J17T 4Y0ZE 4JZFH 1F5LA 2BLQA 4IN2A 1J14A 2FTMA 3K6YA 2RA3A 1SLXB 1N8OC 1Q3XA 2ZU4A 1MKWH 1NPMA 4DURA 1O3BA 1HJAC 4X1SU 3UFAA 1ZHRA 1MZDA 1ZGVA 1T32A 5DN6D 2STBE 3ZIAD 1U6QA 3Q3KA 3ZVAA 5DKMA 1PPBH 1GHAG 4WVPE 3RXDA 1P09A 2W3KA 3PTBA 3QN7A 1BMFD 2FYRA 2WHXA 3OTPA 3M5NA 5FBIA 3A83A 1C4U2 2D26C 4WXVA 4GCHF 1L1GA 1GI4A 5I46H 1ZPZA 3ITIA 2UUFB 2BQ7B 1FAXA 1TMTH 2FPZA 4MNYA 4CH2B 4YXWD 4GUXA 2FOGA 5L6NH 1EZQA 4ABIA 3OEED 3OTJE 2OC0A 3SGBE 4IMZA 1N6XA 4ABFA 1O2XA 1RXPA 4ZCNA 5LPRA 2ZDLA 1G9IE 1OYTH 5A0AE 4I8KA 3SGAE 3VB4A 3TK9A 1OXGA 2ZHFH 5AF9H 3KQEA 1GMHG 2Z6BD 3DT0H 3P92A 3N7OA 2OBOA 3TH3H 3PB1E 1KXBA 4X2VA 3D65E 4B2AA 5GWZA 1BZXE 4E7NA 3A85A 3MNCA 1O2ZA 3RXPA 1SR5C 3KEEA 1GJ7B 3R3GB 3PV2A 1Y3YA 4MPWA 1GG6C 5T6DA 5K7RA 3ZZ8A 2KX4A 5LPEA 2BDBA 1GI6A 4YLQH 1MQ6A 1PQ7A 1V2MT 8LPRA 3UTUH 1Q31A 1GBCA 3M3SA 3SI4H 2A2QH 2SGQE 5TCAA 2FS9A 1X7AC 2F9PA 4ISNA 5F8XA 3P8FA 4BNRA 4A92A 2ANMH 3M3TA 1GCTB 1GI8B 1V2QT 3N7EA 3L3TA 2JETC 1NBMD 3KQCA 3AK5A 2A5KA 2CXVA 2ZI2H 1NFYA 3SNCA 1P0SH 4GLYA 3TITA 2ZNKH 3F2HA 4LOYH 1RGQA 3EE0B 3OY5U 1HAYB 1YC0A 4CR9A 4BTUB 3VG8A 4U32A 2PFEA 3SNAA 1KXAA 1E35B 2TIOA 5EG4A 5GXPA 4B73A 1EOJA 2BY9X 2ZCLP 1QBVH 4U30A 1O5EH 3UREA 3TJVA 1ARBA 1NFWA 2FYQA 1JBUH 1PQ8A 5E0HA 2XBXA 1HUTH 1LHCH 1QB9A 1O3JA 3RXCA 1OX1A 1DVAH 5ESBA 3FVFB 4UFDH 2A45B 2G4UA 3PWBA 1AMHA 1UCYH 1BMMH 1L4DA 3E8LA 1KXFA 4CH8B 1OWKA 3RP2A 3GY4A 2AGEX 1JMOH 3SJ8A 1GGDC 4DJZB 1IQKA 4AYVB 4ZKOU 4ZKRU 1ELGA 4JCNA 2ZECA 4DIIH 1AB9C 2V35A 3AASA 3Q77A 3MFJA 1D6RA 2A0QB 4ZKNU 1NTPA 1BRAA 1NC6A 3M7TA 3HK3B 3SU6A 3RMOH 1OWJA 5AHGH 1YY3A 3VB3A 2C90B 1GJ5H 3IWMA 3LU9B 4LZ4B 1W3CA 1LPKB 3E6PH 3SBKA 1ACBE 1Z8JB 4FUBA 1IQLA 1PQ5A 1QA7A 4A1VA 1JWTA 1G2LA 1GMDG 1B5GH 1SGDE 1FUJA 1V2ST 2PGBB 2VVVA 4AZ2B 2OC1A 3AVZA 1YPHC 2WZQA 3SNEA 3QTOH 1FMGA 2AFQB 3BTEE 1YLNA 1BTHH 5C5OA 4JZEH 2V6NA 1YYY1 3RU4T 1C1MA 4GPGA 1DS2E 2XRCA 2PR3A 5DO4H 7LPRA 2WPDD 2JDID 3ATIA 1AZ8A 2GCHF 4LXBH 2VIQA 2F9VA 4R8TB 1O2GH 3KQDA 1A0LA 1O32A 1C2DA 3L6PA 2JH5D 1TNHA 1K0HA 2OQUA 2FLBH 3K6ZA 1O3FA 1HRTH 2ZDKA 1Z71A 1A4WH 1NM6A 5L30H 1E38B 1TRYA 3S69A 1O2YA 4X1QU 2H2ZA 4TPIZ 1LPGB 4JYVH 2BD8A 1DXPA 3ZVBA 1CA8B 4HFPB 1NROH 2FOAA 1C5SA 3QK1A 3UB0A 1L4ZA 2EI8A 2EC9H 2Z94A 1GL1A 4ASHA 1GVLA 3SJOA 1DFPA 5JPMH 1O2SA 3A86A 5EU8A 3RMMH 3T2NA 1ZPBA 2HNTF 1GJ9B 2W7SA 1N8OB 3UY9A 3ZYEA 7KMEH 4D7FA 2QYIA 2J92A 1HJAB 3TNSA 1AI8H 1YM0A 4JZIA 2G81E 4M7GA 1DX5M 1NU7B 2ZFPH 4BXWA 1C1WH 4BAHB 1SC8U 4JYUH 3UNSA 1BTUA 2B0FA 1DDJA 1EJAA 2Y5GA 3FAOA 1K1MA 1QRZA 2BQWB 1MU8B 4X6NA 1JIMA 1JRSA 1SHYA 4OS1A 4YT7H 1K22H 4DIHH 1QY6A 3M3VA 1Z8RA 1BBRK 4DT4A 1F0TA 5DP8A 1SQOA 2QA9E 2BX4A 2ZDVH 5TJXA 1ZMLA 4DW2U 1HDTH 3TU7H 1P11E 5C5NA 2ZU2A 3MU8A 3TLOA 1CHGA 2Y80A 1LQDB 2FEQH 4SGAE 1ETTH 1YCPK 4U01A 2VH6A 1ZGIA 2A31A 2GDDA 2AHME 4K5ZA 3GOVB 1SG8B 5JDUB 1FPHH 1FQ3A 3BV9B 1BITA 3CNRA 4Y76A 4BXSA 5GJ4B 1TGBA 3QWCH 3FP6E 2Y6TA 3M36A 3A7XA 1UW7A 3V0XA 3ATWA 4A5TS 1XUGA 4YLUA 5EJZA 1K1PA 1THPB 4NIYA 3LJOA 3GDSA 3PV4A 5BRRE 3U1IB 1MMJN 2WINI 1NFXA 5GDSH 2PHBA 1QA0A 3LONA 1IQHA 4NIWA 1AD8H 1O3OA 2RCEA 4WJG2 2WUCA 4E7RG 1HCGA 1GBDA 1XUIA 3ZZDA 1QL8A 4JZ1A 1GG6B 4AG1A 4NA8A 3VXEH 1E0FD 4UFFH 4BAQB 4XOJA 2DE9A 5DP6A 1E79D 1G37A 5GNDA 1C5XB 4ZHAA 4NGAH 4AFZA 1D3QB 3FFGA 5C1YA 5PTPA 5C1UA 3BTGE 2STAE 2HVXA 8GCHF 1P9SA 1DWEH 5J4QA 3A8BA 1GCDA 2W26A 1C5PA 5DPAA 2OC8A 2PUXB 3F0OA 1O5AB 2ZGJA 2JETB 2G00A 2YNAA 2FESH 3KQBA 4X8UH 3FZDA 1AVWA 1P2NA 1UTMA 3H5CB 2BVSH 4Y71A 1DWDH 1HJ9A 2XOKD 2EEKA 3A7YA 1SSXA 2ZWLH 2XC5A 5EOKA 1FN8A 1TQ0B 1SKYE 2A2XH 1QB1A 2J5UA 1BMAA 1QIXB 1TNLA 3D62A 1QZ8A 4NIVA 1TGSZ 3UPEA 1NU9A 1OHHD 1RD3B 4CRGA 1C2FA 1W8BH 3UWIA 2ZU5A 1QBNA 3EDXB 2KR7A 3S0NA 4DT7B 2J34A 1BRBE 2CGAA 5FBEA 2H6MA 1QHRB 2ZP0H 3RXHA 1GHBG 3TGKE 2M5TA 3SV2H 3PRBA 3LT3A 3W95A 1UVTH 3KN2A 3LH3A 4XBDA 2IJOB 4HGCA 4DOQA 2PSYA 2CV3A 5FXLA 1MTUA 2J98B 5FX5A 1WTGH 2XYAA 1HAIH 1S85A 1QBOA 1GHAF 3FZZA 4KP0A 3RMLH 4DCDA 2GCTC 1C2LA 3F1SB 5DSFA 1Y3VA 1O2TA 4M9FA 2D2DA 4MNVA 4X2WA 1GGDB 1JRTA 2ZEBA 1SMFE 4JZDH 4MPXA 1DOJA 2KCOA 1TA6A 2A1DB 2A4GA 1INCA 1ANDA 1YPEH 3SU3A 2Q6GA 2XWBI 3RXMA 1AB9B 3I29A 1O3AA 2QXIA 2J9NA 4K3JA 3BG8A 4UE7H 4B71A 1LVOA 2JIZD 2P94A 1MD8A 1UO6A 2ZKSA 2F9OA 5ESTE 4PROA 4XFQA 1PPZA 3F2FA 2V0BA 2BDGA 1EB1H 1IQGA 4K1SA 5BPEA 3B23B 3SORA 1EATA 3GYLB 3WY8A 2FXRA 1SGCA 2G52A 1THSH 1O39A 2GT8A 5DP3A 1S81A 3A8DA 4I33A 1GMHF 2ZDMA 1NS3A 3FN8A 3C1KA 4RT0A 3KNXA 1D3TB 1AZZA 4DG4A 4NFEA 1BJVA 2FMJA 3HGPA 1ETSH 1HAZB 3EQ0H 4Q63A 5HGGA 3RXFA 1C9TA 3LC3A 3RXIA 3F9HA 1T4UH 2L6OA 1Y5BT 1ABIH 1O3MA 2ZQ2A 3URCA 3V3MA 5C17A 1UCYE 3A80A 3RU4E 1SL3A 3A87A 1W11U 1VJ9U 1EP6A 2LELA 4JMYA 1UVSH 1O3CA 1TB6H 5TCCA 5KECA 1NRQH 2HLCA 2ZQ1A 2OBQA 1MQ5A 1CA0C 1K2I1 1E1RD 4H6SB 1TPOA 1A0HB 3ZZAA 1ELFA 1GBAA 5EW2H 2UWLA 1VGCC 3O8RA 1TALA 2UWOA 1K1LA 4XBCA 3O8DA 1Z7KA 2I6SA 4Y8YA 1SOTA 1Y5AT 3H09A 4AC9A 2P8OB 2XNIA 2C8WB 3PMJA 2ANWA 4AFSA 1P3EA 1AQ7A 1GI0A 1COWD 4D7GA 2HGTH 5ABWA 2ZG0H 4Z0KA 1Y3WA 2AIPA 1G3BA 1NT1A 1TNKA 1YF4A 2KCYA 3SO3A 3M7UA 2A7CA 4O3UA 1EOLA 1DT2A 2BZ6H 3O8BA 5A0BA 1TPSA 5EQQA 2O8LA 1OWHA 2K1QA 3RLWH 3LGUA 2ZFSA 1DXWA 2C93B 2R3YA 2ZC9H 1O2OA 1YKTA 2VINA 3GCTG 5FHTA 4NIXA 5EXMA 1GDUA 2LP6A 1FLEE 1V2VT 5HM2A 3MTYA 1UTQA 2QCYA 1QFKH 3V12A 1LMWB 2D8WA 2YMSC 1WUNH 4FUJA 4KTCA 1AIXH 1HFDA 1E34B 1GBHA 1UK2A 1EQ9A 4ABAA 1D3DB 4ZUHA 1GVZA 4IBLH 2ZPRA 1E36B 5F8TA 1EFRD 1YCPM 1OOKB 1FV9A 1W0KD 1YPLH 2BB4A 3ODDA 2OCVB 1CGHA 1XVMA 1YBWA 1QL9A 4D9QA 3T5FH 2QY0B 1Z6EA 1HBTH 3MH6A 2Y81A 1DE7H 3SUGA 4NA9H 4ZH8A 5JBCS 1UVPA 1ZRKA 1KTTB 1Y59T 1DUAA 2OTVA 1EAWA 3GDVA 1QJ7B 1ZPCA 3L33A 1HAGE 2Z7FE 5E8EH 5A09A 1TBRH 1F5RA 1MCVA 4I8GA 3WWBA 5I25A 4E06H 2XTTB 1HB0B 1HXEH 1YPKH 2VJ1A 1O3KA 1O5CB 1AE8H 1TIOA 6CHAC 2FOFA 1P2MA 1FAKH 1SQRA 2A4QA 3KL6A 2KZ4A 2SGAA 2TRMA 3M35A 1NESE 4I32A 4X8VH 1UHBA 1XM1A 2GKVE 2O8MA 4KGAA 1GMDF 2ODQA 1AVGH 1P04A 1C5WB 1SLVB 1IAUA 4NWLA 5F03A 4K69A 4A7IB 4OS7A 4BOHA 2FIRH 1O31A 2ALVA 1A46H 1UTLM 3MOCA 3SU1A 4NZLA 4TYDA 4OS2A 2ZO3H 1RJXB 1QRXA 1WYKA 4UFEH 1O3DA 2KM0A 2Y82A 1O2PA 1WXRA 2ODPA 2LPRA 4YZUA 5CMXH 1C2JA 3A81A 4R0IA 1H8ED 1FNIA 4XD7D 3RXSA 1XUFA 2ZU1A 1P9UA 4Y6DA 3SV7A 3VB6A 1SGFG 2BD9A 1MH0A 1V2KT 4YTAA 3RXUA 2CF9H 1B0FA 1SFIA 2PGQB 2Q6DA 5F53A 2H9HA 1AWFH 1AVXA 1K1IA 1P3CA 2G4TA 3BF6H 4X1PU 1TOMH 1A3EH 1SGIB 1AKSA 2GV7A 2F91A 1HAXB 1QQUA 2PWXA 4IC5A 1FJSA 1KXCA 1EAIA 2H5CA 5FPSA 1GJCB 1IQIA 1EJMA 5EPNA 2Q1JA 2J95A 1SGEE 2ILNA 1KDQA 2O8WA 1GBTA 1ANBA 3STJA 1C9PA 2Z9KA 2BX3A 2GCTB 4ABGA 5JBAS 2RDLA 2ZHWH 2V3OH 4MLFB 1GI9B 2OLGA 3GY8A 3ZV9A 1P8VC 2OUAA 2ODYB 4FVBA 3TH4H 3MU1A 1EJNA 3TK6A 2M2AA 1ELEE 3UIRA 3SQHE 2TPIZ 1HLTH 3MNBA 1TMUH 1D9IA 1S6LA 1UVOA 3S7HB 4YOIA 1WAYB 3RXQA 3ZVGA 4VGCC 4RKOB 2XBYA 2ZHDA 1DLKB 1QR3E 1A5IA 2P59A 1AKSB 3U98H 2BTCE 1Z6JH 3CS7A 5HKKD 1V2OT 3N7DA 1CGIE 2A5AA 2B7DH 2YMSD 2FOHA 1ZSJA 1K9OE 4GAWA 3MWIU 2IOTA 1PJPA 3VB7A 1RIWC 3BN9A 3UOPA 4I8HA 3P17H 2SGFE 1O3PB 1LHEH 3SV6A 2QIQA 1C5RA 1DPOA 2FI5E 4J2YB 3RXAA 3CP7A 3ZZ3A 4BAOB 2PW8H 1WV7H 3ZV8A 1T8MA 3GY7A 2G8TA 1C5TA 4XE4A 4RI0A 1QCPA 3GCNA 1F7ZA 1SB1H 3WW7A 1Z1JA 1VJAU 5EODA 1Y5UT 3LPRA 2A32A 3BEUA 1RTFB 4B2BA 1XMNB 3MI4A 2A5IA 1WDIA 1C1OA 1FX0B 3KIDU 2WV5A 2ZA5A 1C1PA 1S83A 1V2WT 1VGCB 2GP9B 2AMPA 2PUQH 2ZGCA 4WXIA 1CE5A 4ACBA 1O2QA 3MYWA 2ZF0H 2VVCA 3NWUA 3F0PA 3MMGA 1O35A 4MNWA 1GBKA 1GPZA 3B9FH 1O2NA 1K1OA 2RG3A 3SOSA 3EE7A 1GHZA 1L1NA 2YNBA 1ZTLA 1OP8A 3M61U 1IQEA 1UTKA 3RLYH 2ZGHA 1LPZB 2H1UA 3URDA 4TSFD 1PPEE 2HNTE 3RMNH 3BTTE 3BSQA 2C3SA 2UUKB 1MD7A 1FY3A 2ALPA 1O3LA 2YMSB 2DUCA 3SU2A 2P16A 1LTOA 1NRRH 2HPQH 1AN1E 5E0GA 1B0EA 2V3HH 5HM9A 5A8XA 3PMHB 3KHVA 1BBRH 4XSKU 3MH5A 1H9IE 1PYTD 3RXGA 4O9VA 2PP6A 2B5TB 2JKHA 5LH8A 2BM2A 5H4IB 3RXKA 1FN6A 4MNXA 1NBME 4FU9A 1TNIA 5HIYA 3BIVH 1A5GH 2NWNA 1A61H 2VIOA 3ZVCA 3I77A 4B76A 4TY7A 5L2YH 1F0UA 1QNJA 2HRVA 3SW2B 1IOEA 2RFKC 1WCZA 1YCPH 2GMTC 2XBVA 4KELA 5GPIB 3SZNA 4NWKA 1ZMNA 2ZGXH 1K28D 1KXDA 3OEHD 2SFAA 3AAUA 2R2WU 1H9LB 3SJ9A 1OPHB 2CN0H 9ESTA 3UUZA 1RS0A 3M37A 4MTBA 5F6MA 1LKBA 3PWCA 6CHAB 3A7VA 4B74A 2QF3A 3W94A 2SGDE 1MAYA 3LIWA 4Q7ZA 4CRAA 5IDKA 3OYPA 4Y8XA 3F9EA 2ZFTA 4GHQA 1FZZA 2HPPH
chains in the Genus database with same CATH topology
1TRNA 4FVDA 3BTFE 3ODFA 4WH6A 1KLJH 2AEIH 1CSOE 1WBGB 4FUHA 4O3TA 1BMNH 5K0HA 1P05A 3GICB 1C1SA 1W12U 2A7JA 1P06A 2CF8H 1ANEA 2VWOA 1ZMJA 4ABJA 4XDEA 2UUJB 1GJAB 1YPGH 3OX7U 3SJKA 2VIWA 3BIUH 1NZQH 1DWBH 1ELVA 3NPSA 2R0KA 4X8SH 3T27A 8KME2 1GBJA 1JXPA 2PTNA 4MPVA 2CHAC 3P8OA 2VWLA 2ZTYA 3GISB 3HKJB 5T3HA 1SQAA 4HZHA 1SOZA 2WYGA 3F68H 3ZZ7A 6ESTA 5FPTA 1TPPA 2ZFRH 4K8BA 4CREA 1CT2E 2P3UB 3RC6A 4D8NA 2BLOA 1ZLRA 2AMDA 1ORFA 1BRCE 2BY7X 1C5UA 3MNXA 5DK1A 3DHKH 5FX6A 1CQQA 4ABBA 5JB8S 5L2ZH 1TE0A 3BTME 3QO6A 1A1RA 5C2ZA 4UONA 1SGFA 3UQOA 3SUDA 1SBWA 1GI2A 1MBMA 1KLIH 2ZDNA 3SHAH 2P3FH 2FP7B 4TY6A 1O5BB 1EB2A 3P8GA 4MG3A 3UR6A 1XUJA 6LPRA 4BTIB 5G4BA 2ZTXA 3GCTF 3MO9A 1GHXH 1LO6A 3E3TA 4DY7B 1TOCB 1ZJKA 2FOEA 1UK4A 5DP4A 4FU8A 2R0LA 1S5SA 4NSVA 2VVUA 1H1BA 1DITH 1A3BH 1CHOG 3LGVA 5EPYA 1D3PB 3IITA 4VGCB 1QQ4A 2FI3E 1ELTA 2ZCKP 4ZHLU 4UEHH 1EAUA 1C2GA 1O2LA 2CMYA 1TYNA 2SGEE 1W7XH 2XW9A 3Q00A 3RDZA 1H8IH 3EA7A 3GY3A 3E0NB 1RIWB 4F4OC 4HI3A 4CHAC 1C2MA 1TGTA 1XUHA 4I8JA 3T62A 3U8OH 3ZZ9A 1IQNA 4D9RA 2FOMB 4ZXXH 2F9UA 3RU4D 1C1QA 1Y3UA 1ETRH 2WUBA 3PMBB 1C2KA 1P03A 1FONA 1MTWA 5EXNA 1BDAA 2OC7A 1ANCA 2VIVA 1O2KA 5LPFA 1IHTH 1CBWC 3TJNA 3RXLA 1DANH 1GMCG 1CT4E 2FO9A 1V6DA 1QGFA 3TJUA 1UTJA 4FU7A 2AERH 2O9QA 3HKIB 4D76A 1TNGA 1CGJE 1AWHB 3SU0A 3M7QA 3RXBA 1LQEA 4IS5A 5HXFA 5JYIA 1AHTH 8ESTE 3ELAH 4AOQA 3BG4C 2IN2A 4CRDA 1SFQB 1WTHD 3QZRA 1O0DH 4BAKB 2W7UA 2FOCA 1BQYA 2GZ8A 1TGCA 1O30A 1THRH 3G01A 1GHWH 1J9CH 4FXGH 1OS8A 1BRUP 3F9FA 1ZOMA 2J2UA 3M5OA 1ZHPA 4I31A 2ANKH 2BVXH 1YLDA 1C1UH 4WH8A 1ESAA 1V2NT 1TPAE 1WOFA 2ZGBH 4YM9A 4AGKA 1QRWA 3SNBA 4INLA 1IQJA 1VCQA 4AFQA 3A7ZA 1TNJA 1TX7A 4ABHA 2BQ6B 4AGJA 2BY5X 2SNWA 1ZTKA 2QN5T 1P2IA 1SGPE 1DY9A 3GY5A 3GY2A 3KF2A 3SUFA 3U69H 2TGTA 2F3CE 2VWMA 2FI4E 1FY5A 4MDSA 1O2HA 2NU2E 3B8JA 1BTZA 5A0CA 1YPHE 3ATLA 5EXLA 3O8CA 1JOUB 7ESTE 1O38A 3JZ1B 1OWDA 2W5EA 1CU1A 2R9PA 3FP7E 1QJ6B 2WPJS 2ZDAH 2FODA 1KTSB 2GMTB 3QGNB 3MH4A 3TGJE 3RM0H 4OS5A 4AX9H 3OSYA 4XBBA 4CR5A 1EASA 2UUYA 2H9EH 1MCTA 3SUEA 1V2LT 1O2IA 1T8OA 1GHVH 4K8YA 4YOGA 1ZR0A 2AGIX 3S9BA 3S7KB 1WQSA 1TX6A 3TVJB 4X8TH 2DE8A 3ZZBA 1BTXA 2PLXA 1WQVH 1HNEE 1HPGA 2NU3E 3F9GA 2FX6A 1EUFA 2VIPA 4SGBE 2WPHS 2EI7A 4AB8A 1UTOA 2O8TA 2Z9JA 9LPRA 3GY6A 3D23A 2Z3DA 4ZHMU 1FY8E 2Y5HA 2AYWA 2O8UA 1O3HA 1CO7E 2FWWA 2FTLE 3ESTA 1V2RT 1V2UT 2BY8X 4YOJA 3P95A 1BBRE 1FY1A 2BD7A 3STIA 4CBOA 1O5DH 1SGYE 1DSUA 1G3DA 4AORA 4AYYB 1F0SA 3K2UA 1CT0E 1O2JA 1GI1A 2XC4A 1VITG 3Q76A 1GBMA 2GV6A 1QURH 1BTWA 4JK5A 4NZQA 1V2JT 2CHAB 2Z9GA 5CHAC 1ZYOA 1K1JA 1PPGE 1SPJA 3VGCC 3ATKA 1TFXA 1HV7A 2AH4X 1C2IA 4LK4A 2WPLS 1NRSH 3JZ2B 3NXPA 4A1TA 1MU6B 1TMBH 3GYMA 5C67A 2TGDA 1K1NA 1G3CA 4IN1A 5FPYA 1GHYH 1W7GH 3RC4A 3ZZ6A 1FIZA 4CRCA 2A4RA 2VU8E 4LZ1H 2EI6A 1J15A 1ELDE 2BOHB 1AE5A 1P2OA 4ZROA 1FDPA 1BUIA 1GJ6A 4H42U 4ISOA 1T7CA 1PPCE 2NU0E 1BIOA 1S0RA 3VB5A 4NG9H 2NU4E 5DG6A 4OS6A 3LGWA 3TGIE 1EXFA 1KXEA 1E37B 3TK5A 5DP9A 2SGPE 2BY6X 1BOQA 1O3EA 1SI5H 2VIDA 2OQ5A 4Y7AA 1TLDA 2W3IA 1C5NH 1SGQE 2YOLA 1OWIA 1SGTA 2ZIQH 5FCKA 3SV9A 3PO1C 1DICA 1SGNE 2PKSC 1UHBB 1BCUH 1EZSC 7GCHG 2BD2A 2BMGB 3NKKA 1GBEA 2WV4A 4B2CA 1KSNA 3K65B 4IGDA 1DSTA 2XC0A 1V2TT 1BB0B 1PYTC 1UVUH 3MO6A 4CHAB 1TBQH 3V13A 3VFEA 1C4Y2 1BTYA 2Z9IA 1HXFH 3EA8A 1VCPA 1DWCH 1L2EA 3MNSA 3EAJA 1MKXK 2ANYA 1EAXA 1LVBA 4RN6A 3TPIZ 1GWAA 3S9CA 1GDNA 1WU1A 5DGJA 1KLTA 1LKAA 5EW1H 1CBWB 2I6QA 3A8AA 2Y7XA 1W14U 4CRFA 1C1RA 2TGPZ 4NSYA 1Z8IB 2BDHA 4DGJA 1NN6A 3U9AH 1UTNA 3KCGH 1MKWK 1PPFE 3D49H 1BA8B 5GIBA 3SU5A 1G36A 2AGGX 1P2JA 2G51A 4ISIH 3ZZCA 5GCHG 3SQEE 1FPCH 2P95A 1F0RA 2ASUB 5C20A 1FY4A 2C8YB 3PROA 1ZZZA 3OU0A 1BT7A 5EGMA 4INHA 5J4SA 3P70B 3U1JB 1DLEA 1G2MA 3PYHA 3BG4B 1PFXC 5DJ7A 4RSPA 2QV1A 3TJOA 1P01A 1SGRE 3LDXH 1TWXB 3T29A 4GSOA 4Q80A 1VR1H 3ATMA 4X2YA 1D4PB 1WSSH 4H6TA 1AFEH 2PTCE 1EKBB 3KGPA 1P57B 4WMDA 1KDQB 1L1JA 3AW1A 1MZAA 1C5ZB 5HMAA 4J1YA 2F9NA 1HAHH 1XUKA 1D6WA 1J16A 3QZQA 1AUJA 1GBLA 4I8LA 4Y7BA 3PM3A 5EQSA 1ZRBA 4E05H 2QF0A 2A7HA 1G32B 4I7YH 1RFNA 1TX8A 1Z1IA 5E2OA 3CS0A 1OWEA 2VGCC 4Y11E 4ZXYH 3LC5A 1VZQH 4WF8A 1UMAH 1EPTC 2QXGA 4B75A 1GJDB 3RXEA 1CA0B 1C2HA 4X1RU 1HYLA 3UQVA 4FUFA 2FM2A 1NO9H 1TABE 2HWLB 1MTVA 2GZ7A 4BAMB 1CVWH 1BTPA 5JBTA 6GCHG 3SNDA 2BD4A 3H7TA 3DA9B 3FANA 1HIAA 5E2PA 4WY3A 1Y3XA 1AGJA 1EZUC 1C5MD 1KIGH 3FP8E 1CHOF 1K21H 1ZSKA 2HALA 1GBIA 4ABDA 1NRPH 1LDTT 4H4FA 3UOUA 1HJ8A 2J4IA 4AB9A 1NFUA 2BLVA 4OGYA 1H9HE 1H8DH 5E0JA 3H7OA 2UWPA 1XX9A 1S84A 3MH7A 4F49A 2G55A 1ESBA 1YGCH 3MO3A 4CBNA 1SHHB 2Z9LA 3M5MA 3DFJA 1C1TA 1DM4B 1LVMA 2WPKS 1GHBF 1HIAB 2BDCA 2BLWA 5T6GA 1IQFA 2ZHEH 2XCFA 2GZ9A 1LCYA 4ISLA 1GMCF 4ZAEA 1F5KU 1MUEB 1KY9A 3VPKA 4GCHG 2Z3CA 3RM2H 2XBWA 5CHAB 1GBBA 3VGCB 1C5VA 4Q7XA 2C8XB 2GT7A 2VB0A 1UCYK 3BTKE 3PLBA 3NCLA 2D1JA 1O3IA 2PSXA 3E0PB 3P6ZB 1UJ1A 3ZVEA 1AY6H 3UNRA 1ELBA 1XKAC 5AFYH 1A2CH 1C1VH 1S6FA 2GD4B 2BHGA 3U8RH 2CJIA 1MBQA 3QUMP 1O33A 3VEQB 1IHSH 1ZHMA 1O3NA 2Y5FA 1ARCA 3CENA 3SGQE 3E16B 2HOBA 2BYAX 2JH0D 2QGRA 1EZXC 2WPIS 3A7TA 4U2WA 4UDWH 2C4FH 3GCHC 2P8OC 3F6UH 3PLKA 2ZPQA 2H5DA 1V2PT 1T4VH 1GDQA 3LKWA 3PMAB 1MTNC 3RC5A 2XXLA 2SNVA 4NCYA 1T31A 4WMEA 1O2VA 4ABEA 3K9XB 2KAIA 3NK8A 3RUOA 1AO5A 3SV8A 2P3TB 3PO1B 2PKSB 1C5YB 1TGNA 2PV9B 2R2MB 4QT8C 2FLRH 4Q2KA 3T28A 3UR9A 3SJIA 1Q2WA 2FDAA 4FUCA 1P2KA 4JYTA 3DFLA 1BHXB 1F92A 3SI3H 2QXJA 3A89A 1AU8A 1DUEA 1ELAA 3A7WA 5C1XA 3A84A 3EYDA 4K2YA 1TAWA 2FX4A 5AFZH 3EA9A 3RXJA 5JB9S 3VXFH 1TONA 3V7TA 2PKAA 5JBBS 5B6OA 2KAIB 4X6OA 2ZFFH 1W0YH 1OP2A 1VCWA 3MHWU 4O03A 2BOKA 1Z8GA 1SLWB 1OSSA 1TRMA 1GJ4H 1AFQC 5SGAE 2VH0A 5C3NA 2ZHQH 4K60A 1ID5H 1T8LA 3S9AA 2WPMS 1KYNA 3LGYA 1ZTJA 3NUMA 2F9BH 1BJUA 1ZJDA 4AG2A 2VNTA 4ESTE 3E91A 4AN7A 1W0ZU 1C4V2 3DD2H 3ZVDA 1YLCA 1O5FH 3Q3XA 1SLUB 2ZZUH 5A2MH 3UWJH 1RRKA 3Q3YA 4KKDA 3OY6U 1EPTA 1C5QA 2ZFQH 1VITF 1GVKB 4HTCH 1O2MA 1FI8A 2PKAB 1SQTA 5DP5A 1O36A 2JH6D 1UTPA 4TWYA 3PTNA 3RXVA 1Y8TA 1HAOH 4X0WU 3R0FA 3BTHE 3EGKH 1MAXA 4B1TA 1PQAA 3HK6B 1S82A 4INKA 2GGVB 3M5LA 2B8OH 1YPJH 3HGNA 1OP0A 2BDYA 1GJBB 2H9TH 1BHXF 2BZAA 4KTUA 1XXFA 4TWWA 2ZPSA 1SVPA 4IW4E 4DVAU 1MTSA 2THFB 5FCRA 1ELCA 1P2QA 5T6FA 1W2KH 2VGCB 4IC6A 1W13U 4FUGA 1GI7B 1EPTB 2ZU3A 1YPMH 1FXYA 2Z3EA 3A88A 2RA0A 4X6PA 1GI5A 5A8YA 1RTLA 3AAVA 5ETXA 3SN8A 2GCHG 3MU5A 3C27B 3A8CA 3QLPH 1TBZH 3T26A 2VWNA 3QGJA 2BXUH 2ZTZA 3LGTA 4UFGH 5FAHA 2TBSA 4Y8ZA 2TGAA 2OD3B 3LH1A 2QXHA 3MU0A 1G3EA 1T8NA 1HGTH 2IPHA 1NY22 1A5HA 3UNQA 3GCOA 2XCNA 5DP7A 1EP5A 1DY8A 2GX4A 3T25A 1LVYA 3P8NA 7GCHF 5F8ZA 1LHGH 2AIQA 1JIRA 1O34A 3BTWE 3MU4A 4YT6H 1GJ8B 3BTQE 2BD3A 1GCTC 2LNCA 2G5NA 3QTVH 5EQRA 2F83A 2J38A 4BTTB 4UD9H 4MQAA 3SU4A 1P12E 4THNH 3PLPA 4OS4A 5IYTA 4MPUA 4X2XA 3TNTA 2EA3A 1FIWA 3RXTA 1LHDH 1S6HA 2GDEH 4MVNA 4O97A 1OKXA 3GDUA 2BVRH 1RTKA 1YP9A 4Y0YE 1O5GH 4ISHH 1B7XB 1QJ1B 1W10U 5LGOA 5GCHF 2ZCHP 2OXSA 4FUIA 4KTSA 4X6MA 1HAVA 3ZZ5A 3A82A 4RKJB 1GI3A 1NRNH 1TQ7B 1GBFA 1G30B 2G5VA 3ZYDA 3TH2H 2GVFA 1P02A 4WMFA 2GTBA 3HPTB 2OP9A 2AS9A 1UK3A 4NFFA 1ZSLA 1V3XA 2P93A 3BEIB 4A6LA 1H4WA 4WWYA 2C8ZB 1QB6A 3U8TH 3TIUA 2J94A 2ESTE 2Y7ZA 4Q7YA 1C5OH 3ZZ4A 3RXRA 4FUEA 1J8AA 1N1LA 3LJJA 4ZKSU 3GCHB 2HNTC 1LHFH 3ENSB 1A7SA 5AVDA 2WYJA 1HAVB 3IG6B 1MTNB 1L0ZA 1F2SE 4K1EA 1M9UA 1C1NA 1TA2A 1C2EA 1ABJH 1PPHE 2XWAA 3SHCH 4CRBA 3QDZB 1N6YA 1XXDA 4NA7A 4Z6AH 4JK6A 3AW0A 2BD5A 5CE1A 1O2RA 4Y79A 4ZMAH 8GCHG 1S0QA 4BANB 1QTFA 1C5LH 4GVUA 3RXOA 4FUDA 2QC2A 1ESTA 2BXTH 3BTDE 4IMQA 4YESB 4TPYA 3HATH 5A8ZA 2R3UA 2OINA 3DUXH 2B9LA 4X1NU 2AMQA 1P10A 3LGIA 2ULLA 6GCHF 1O37A 3E1XB 4A1XA 1XKBC 4YO9A 2QAAA 1XVOA 5HYOA 2FOBA 1HAPH 2FZZA 1VITH 1AUTC 1O2WA 1OYQA 4AFUA 3QX5H 3E90B 1O3GA 1A0JA 1QL7A 4GHTA 3I78A 4OGXA 3NZIA 2NU1E 3LOXA 1MKXH 1GL0E 1O2UA 3ZVFA 4K1TA 1EX3A 2BDAA 1BMLA 2FS8A 1IQMA 2BDIA 2A4OA 1AFQB 3BEFB 2Q6FA 4Y10E 1J17T 4Y0ZE 4JZFH 1F5LA 2BLQA 4IN2A 1J14A 2FTMA 3K6YA 2RA3A 1SLXB 1N8OC