1INCA

Crystal structures of the complex of porcine pancreatic elastase with two valine-derived benzoxazinone inhibitors
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Crystal structures of the complex of porcine pancreatic elastase with two valine-derived benzoxazinone inhibitors.
pubmed doi rcsb
source organism Sus scrofa domestica
molecule tags Hydrolase(serine proteinase)
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1incA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1incA01
1E35B 1LPGB 2SGPE 1O5AB 8GCHG 4UONA 3F9HA 3B23B 3D49H 3ZVCA 1QTFA 3BN9A 1AUJA 8GCHF 2HVXA 3TNTA 3GY2A 1NU7B 1TFXA 1YF4A 4XFQA 1EX3A 1EPTC 1O3LA 4DGJA 1Y3WA 1D3QB 1FAXA 1RIWC 4MVNA 1GI9B 3E0NB 5EXMA 2ZPRA 1WCZA 3M37A 3SW2B 4LZ1H 1F0SA 3QTVH 2PKAB 1MU8B 1SGTA 3TK5A 2PUXB 4CHAC 4RN6A 3HGPA 1F2SE 4LZ4B 1TRNA 5L2YH 1O5BB 1J16A 3SI4H 1A0LA 5EPYA 4AFZA 4NIWA 5JBTA 1PFXC 1HJ8A 1VCPA 1GBHA 2NWNA 1K1MA 4BOHA 1NRPH 3DA9B 2GP9B 1SFQB 4U32A 1P2QA 1GI4A 1TPAE 2ANKH 1DDJA 1AFQC 2YNAA 1C4V2 2A4QA 1TNKA 2FPZA 3HK3B 4A5TS 2GV7A 1XXDA 1Z7KA 2BLWA 4OGXA 1KSNA 3MU5A 1QFKH 3BG4C 2ZC9H 2BVRH 3UR9A 2FYQA 3F9GA 2VIPA 3URDA 1EASA 2ANMH 3RLYH 1W0YH 1KLJH 3A81A 1QL7A 3KQDA 3MH5A 3NCLA 1JXPA 4IW4E 2A7CA 4INKA 1HFDA 5EQSA 1C9PA 3RXIA 2QA9E 3GY5A 2BDAA 2FZZA 4ZXXH 1QBNA 2TGPZ 2F9NA 1C4U2 3TJUA 1UTQA 1RFNA 2PR3A 4B2AA 5HYOA 2ODYB 1SOTA 2FX6A 2OCVB 2Y6TA 3A84A 3ZVBA 1WTGH 3SV2H 1ZMJA 1SB1H 3QK1A 3UNSA 1EZUC 4AORA 3E91A 5FHTA 1CT0E 4MNXA 1LHGH 4IC6A 4YOJA 4GPGA 4O03A 3CS7A 4ABIA 4WMDA 1ZHRA 3A7ZA 3UNQA 1DXWA 1GHVH 2BLVA 1FY3A 3S7KB 5C2ZA 4BAMB 1AKSB 1T7CA 1EOLA 4AX9H 1ZGVA 1LMWB 4HGCA 1AZ8A 5EW2H 4CH8B 3W94A 2WPHS 1XUFA 1DE7H 5GJ4B 2B8OH 2KAIB 4X2XA 1FIWA 1YKTA 1EP5A 2ZEBA 4K8YA 3QGJA 1O2PA 2EI7A 5K0HA 1O2YA 4TY6A 3QWCH 5I46H 3VGCC 2PKAA 1H9IE 1YPGH 1A5GH 2XWAA 4YOIA 4NA9H 1L4ZA 2G8TA 3ZZ9A 3ZZBA 1HV7A 1NRNH 2CN0H 4RKJB 1MTNC 5DP7A 1ELDE 2RA3A 1O34A 5EGMA 2ZDVH 1CT2E 1TQ7B 4THNH 3BG4B 2RG3A 1L0ZA 2Y81A 2ODQA 1KLIH 3SJ8A 3P95A 3A86A 3BTFE 1O36A 2H9EH 2J92A 2OXSA 3PMBB 2AS9A 1F0RA 2SGQE 4Y7AA 4K69A 5E0HA 3BTQE 1UVPA 4TYDA 1AVWA 1O5GH 1PQ5A 2BXTH 4FUJA 3OU0A 1GMDG 1TGSZ 3KGPA 3DFLA 1FONA 2BDHA 1C1TA 1GMDF 1GL0E 2O8WA 3PO1C 4GAWA 2FI3E 1SL3A 3BTWE 4JZEH 2XRCA 4GHQA 1QNJA 1G3CA 1HAZB 1K1NA 1AGJA 1Z6JH 4LK4A 3H7TA 4X2YA 1GI2A 1TX7A 3GDVA 1TWXB 1N6XA 4NZLA 3K2UA 3MNBA 3VB6A 2EI6A 1XKBC 3HATH 2XXLA 3K6YA 1ZTJA 3EQ0H 3MO6A 2ALVA 2BDYA 5A0CA 3ITIA 5DPAA 4U2WA 2LPRA 2BQ6B 2A4OA 2P3UB 1O5FH 1A5IA 1KXBA 4FUHA 1HXEH 2GCHG 3V12A 1NRQH 1MKXK 3BTHE 4X1SU 1OWIA 1EKBB 1XVOA 2GCHF 4WY3A 2ZI2H 3TK6A 1V2KT 3F68H 3GY6A 4B74A 1KXEA 1VCQA 2FXRA 2HNTC 3RXTA 1TB6H 1EPTA 2H9HA 1T8OA 1KTTB 4SGAE 3ESTA 3U8OH 1EP6A 4YTAA 1A3EH 1EJAA 5CE1A 2QF3A 1ELFA 1D3DB 2WYJA 2SNVA 2STAE 1O37A 1O0DH 1CHGA 1F0UA 3A89A 2VGCB 1KLTA 2FMJA 4FU8A 4I8KA 1TNLA 4ZROA 4U30A 1EB2A 1O2GH 3LH3A 1O3BA 1DUAA 4Y8YA 3MTYA 2EC9H 4M7GA 1MTNB 2O8TA 2KAIA 1RD3B 5TCCA 2A4RA 1EZXC 1ESTA 2BD9A 4JZFH 3ZYDA 3TVJB 2ZCHP 2BY6X 4ZXYH 3LU9B 2M5TA 1W10U 3P8NA 1OWHA 2AMQA 1TRMA 3ZZCA 2VU8E 4CBNA 5C5NA 1D3PB 1TOMH 1K22H 1DUEA 2J34A 4I32A 3GCHC 3TIUA 2VWNA 1QJ1B 5EU8A 4NSYA 3GYMA 3MU4A 3LPRA 2DUCA 2SGDE 2VWOA 2FLBH 3E16B 4CR5A 2Y5HA 3GCNA 1FXYA 3PWBA 4TY7A 1O5EH 2BOKA 2WV4A 1W11U 4XBBA 3RU4D 1G30B 1SVPA 1J9CH 1K28D 1TX8A 3LONA 1G37A 1T32A 1OP8A 1GHWH 3IWMA 2AMPA 3BIVH 2HALA 3SU3A 2BM2A 2Z9GA 5B6OA 1QR3E 1NN6A 1P2KA 1OYQA 3K6ZA 4CRAA 1SC8U 2UUJB 1P2JA 3SNAA 2AIPA 2Z9KA 3DD2H 1OYTH 1BHXB 3F1SB 4ABJA 2G5NA 1QBVH 1JOUB 1DS2E 5DK1A 1UK3A 1YPJH 3H7OA 3EA9A 1THPB 2VH0A 1ZR0A 2ZU3A 1Z8IB 1AB9C 5EG4A 2OBQA 3HKIB 1T8NA 1G32B 1QB1A 1UTMA 4WXIA 1QGFA 3VB7A 1O2WA 3BEUA 4AFSA 3FZZA 4WJG2 1IQJA 3RXBA 3RC5A 2C8XB 3LC3A 4ABHA 1YLDA 4AG2A 3SUEA 1NTPA 4Y6DA 5DP4A 3ZZ6A 1B5GH 1BMMH 3MFJA 3U98H 1CQQA 5T6FA 3LIWA 4NSVA 4NWKA 2R2WU 2A2XH 1C5QA 2Q6GA 3I77A 1S5SA 3UQOA 4XE4A 2R3UA 3ZVGA 2Y80A 2W7UA 2PLXA 3GY8A 5C67A 2ZDAH 3L6PA 3ATMA 2PKSB 1DX5M 1HPGA 4YT7H 5F8XA 1HLTH 2A5IA 1ZSLA 3UR6A 2WPJS 5T6GA 1QL9A 3U69H 4A7IB 1IQNA 1QB9A 3PWCA 1NY22 1E38B 1XXFA 4ISLA 2GTBA 3TGKE 1MCVA 1TGTA 3SNDA 1QQUA 3D23A 1O2NA 5HM9A 1ANBA 5LH8A 4UE7H 4ZKNU 1SQTA 3TLOA 1GDQA 1XKAC 5CHAC 4DURA 1GBBA 1U6QA 1ZPBA 1BMLA 1SI5H 1GHBG 1Z6EA 2GD4B 5FCKA 2WINI 3ZZAA 4QT8C 1GHBF 3F9FA 2BDIA 2FS9A 3UREA 3NKKA 1N8OB 1S82A 4X6MA 2NU0E 2VINA 4FVBA 3A82A 3UY9A 1MD8A 1UK2A 2AH4X 3QLPH 1P12E 1GGDC 2HPPH 1O2MA 4DCDA 4FUEA 5GCHF 8KME2 1G2MA 4ZH8A 1QA0A 4YESB 1VITG 1EAXA 4AYVB 2OC7A 1OWEA 1AVXA 1SGYE 1ZJKA 1FPHH 1VITF 2QV1A 4UFDH 1IQEA 5EW1H 1GBLA 4YLQH 4DG4A 1FAKH 3JZ2B 1PJPA 3TU7H 1GBJA 2CF9H 4ZAEA 1K1LA 1PYTC 3OY6U 2WPMS 2PSXA 2FDAA 1OPHB 1FN6A 3M5LA 3RMOH 5G4BA 1F7ZA 1W13U 2UWLA 2SNWA 1ANEA 1QRXA 1HB0B 1ZTKA 3DFJA 2FODA 2XBXA 3OX7U 2BZAA 1BTXA 1THSH 4NFEA 3RXGA 1UVOA 2FEQH 1GL1A 2CJIA 5TJXA 4WH6A 4YO9A 1Y5AT 7LPRA 5DP8A 3A88A 1AWHB 3ATWA 3RXFA 2OUAA 4CRBA 3UTUH 1EJNA 2BQ7B 2F91A 4NGAH 2Y5FA 2TGAA 4ZKRU 1F92A 1L1JA 2RDLA 1NFWA 1C2DA 3S9BA 1LHCH 3BV9B 4KTCA 2BLOA 4BTIB 5CHAB 1WAYB 2F9BH 2FIRH 2QXIA 3KCGH 2UUFB 4Y11E 1GHAG 3ATIA 1MZAA 2BXUH 1ZPZA 2ODPA 1GHAF 4Z6AH 5DP5A 1O3EA 2A5KA 1AE5A 3RLWH 2WYGA 1MMJN 1FDPA 3T62A 1VJAU 2GKVE 1O3DA 1SGFA 1EZQA 3MOCA 2SGAA 4MTBA 3UWJH 1O2KA 3MO3A 1TNJA 3BTME 3UOPA 5HMAA 1O3CA 2BD2A 1Y3UA 5F6MA 3C1KA 3BEFB 2PFEA 4D76A 1RTLA 1IQLA 1AY6H 3CENA 2OTVA 1O2IA 2THFB 3GOVB 1C2KA 1CE5A 1GI6A 1TE0A 3VFEA 2ZU5A 2VH6A 3H5CB 1DICA 1Y59T 4X8UH 1AO5A 1O2JA 4NIVA 1HAHH 1IQFA 1TABE 4A1XA 2BZ6H 5A8XA 2J38A 5GPIB 1ETSH 1KXDA 2ZO3H 2W26A 4I33A 1CBWC 1DXPA 2ANWA 1OWJA 1TALA 3T25A 1G2LA 4WH8A 1YCPH 2BD4A 2ZIQH 1QJ7B 1C5XB 1EXFA 3VPKA 1ZSJA 4ZHAA 1RS0A 1A61H 1BRAA 1C5SA 1ZRBA 2O9QA 1GI5A 1LHEH 4FUGA 5FPSA 1QRWA 1DPOA 3TGIE 1D9IA 3HPTB 3QGNB 3MH4A 2QCYA 1TAWA 1OP2A 1O2HA 1GJDB 1EZSC 3PTNA 1SGCA 3RM0H 3G01A 1XUHA 4ABGA 1F0TA 4X1PU 1C2LA 3U1JB 1DWBH 2W3KA 1T4VH 3STJA 3P8OA 1MQ6A 1QQ4A 3S9AA 2Z3CA 3T27A 1GBAA 1BCUH 1V2LT 1SG8B 4H6SB 2OINA 1S81A 3MH6A 4JZ1A 3QTOH 2DE8A 6CHAC 4ISHH 1MUEB 1GJ9B 4GSOA 4ZKOU 5F8TA 2ANYA 3RC4A 1UCYK 4ABAA 1K1PA 1B7XB 1MZDA 2CV3A 4HFPB 1K9OE 2J9NA 4CRFA 1L2EA 4K5ZA 4MNYA 1YLCA 5DJ7A 3A8AA 5BPEA 1P01A 3PMHB 3KQEA 4YZUA 3SU1A 4AYYB 4I8JA 2BDBA 3TJVA 1Z1IA 1ESBA 1Y8TA 3E1XB 2ZF0H 2ZPSA 1BRUP 1C5PA 4Y71A 1CBWB 1SGIB 1O2XA 1CU1A 2FP7B 3KN2A 3BTGE 1C5OH 1CA0B 1O2TA 1PQ7A 2OQUA 2PUQH 1YCPM 1GCTB 2VVUA 3SORA 2XBWA 2ZU4A 3TJNA 3FP8E 2A2QH 1VR1H 1TGBA 3P6ZB 1SGDE 2FOFA 4WMEA 4X1QU 1YP9A 3SUGA 2WV5A 4YM9A 1BJVA 4X1NU 1S6FA 1ELEE 2ESTE 4UFGH 5JYIA 3QDZB 2CF8H 1SSXA 5C3NA 1DM4B 4K1SA 1XVMA 1C4Y2 2GGVB 1RGQA 2FOHA 2ZFQH 2VIQA 4CRCA 5C5OA 3LGVA 4OS6A 5A2MH 1LVBA 1QURH 4HTCH 2JKHA 3ZZ3A 4Y79A 2IN2A 2CHAB 1GBTA 1JRSA 2I6SA 1SFIA 1BRCE 1G3EA 1H8DH 1P3EA 3PM3A 3TJOA 1ESAA 3RXRA 5T3HA 1L4DA 2ZGBH 4WXVA 3RMLH 6CHAB 2NU4E 3RXAA 1C2JA 5FCRA 1V2UT 2HGTH 4Q80A 1W12U 2P8OC 3MNCA 2CXVA 1GJ4H 1A0HB 1AE8H 1CGHA 3LDXH 2Z9JA 2GX4A 5C1YA 3ZZ7A 1ID5H 3GCTG 1F5LA 1FMGA 3UWIA 2VGCC 3E0PB 3A83A 3GCTF 2ZFTA 1WV7H 5JB8S 3RXQA 4Y76A 1MQ5A 3SOSA 2PGQB 1EAIA 4DJZB 4MPUA 4XBDA 2HWLB 1O3AA 4X0WU 1TA2A 3RC6A 3WY8A 3FP7E 3RU4E 1GBIA 1DY8A 4ABBA 2C8ZB 1C5TA 2PWXA 4D7FA 3R3GB 4I7YH 1GBDA 3A7YA 1RRKA 1CO7E 3E3TA 4X1RU 3T29A 3SU6A 3HK6B 1A5HA 1C9TA 3PMAB 1CHOF 3IG6B 2AIQA 1O3HA 1UO6A 1HAIH 2XWBI 3GDSA 1TOCB 1QCPA 1FNIA 1H4WA 2ZTZA 2B7DH 1NT1A 1TMBH 3SU4A 1Z8GA 1P03A 1UVSH 2QY0B 1GBCA 4YLUA 1ELVA 4Q7XA 2BB4A 1GJ7B 1Y3XA 4UDWH 1E37B 1HJAC 4IMZA 1K1OA 5FPYA 1GHYH 4TWYA 1C5NH 4O97A 2QIQA 2IJOB 1S6HA 2FWWA 1NPMA 1AUTC 4NA8A 3ZZ5A 3M35A 2W7SA 1JIRA 1ABIH 1GBKA 1O32A 3Q3XA 1CGJE 1HYLA 1QB6A 1HAXB 1Y5BT 3GYLB 1O3JA 1T8MA 2GMTB 2VB0A 5A8YA 1GI7B 2P8OB 1DSTA 1G3DA 1YM0A 2SGFE 1OS8A 1KDQB 1O3MA 3K65B 1DY9A 1PPHE 2UWOA 5E2OA 2BOHB 1VGCC 2BD3A 2BX3A 3ATKA 1AKSA 3O8DA 1BTUA 1FY8E 3A8BA 4UD9H 3LKWA 2GZ7A 5IYTA 4MG3A 2ZHWH 1NRRH 3A8CA 1T8LA 2SFAA 3A8DA 3ZVAA 1DWEH 1CVWH 1UHBB 3UIRA 3P17H 5FBEA 1XUIA 4X8VH 1UVUH 1TQ0B 2HOBA 4D9QA 1YPHE 3W95A 3M3VA 5GIBA 2OBOA 1P9UA 1GI1A 4RKOB 1A1RA 2STBE 2D1JA 3SJKA 5HXFA 1Y3VA 1BJUA 4MNWA 4BXSA 3PV4A 2XNIA 3HGNA 4MPWA 2FI4E 3V0XA 2PKSC 1NS3A 3O8CA 1C5YB 5PTPA 1BBRH 2BY7X 3NK8A 3ZZ8A 1HCGA 3RXOA 1YGCH 3SBKA 2V3HH 2O8LA 2ZHDA 1NO9H 1G9IE 5FX5A 1GJ8B 4A1TA 3SNBA 1HJAB 1N6YA 5AFZH 1LKBA 1SGNE 1NFXA 1QHRB 1PQ8A 4Y10E 2GZ9A 3MMGA 1HAVB 2P93A 1QA7A 3BF6H 4BNRA 1GBMA 3RUOA 5GWZA 4YT6H 1M9UA 3MHWU 1IQKA 3ELAH 2FOBA 1ELCA 2F9OA 1N8OC 1BTHH 2ZGJA 5E0GA 1KXFA 3SHAH 2K1QA 1ANCA 3V13A 4B2CA 5ESBA 4ESTE 5L2ZH 1VGCB 3UQVA 1GI3A 1WYKA 5L6NH 2OP9A 5A8ZA 1SLXB 2IPHA 5ABWA 1MH0A 2ZFRH 1A4WH 4JMYA 3A7XA 4B73A 4ISIH 1C1OA 3SV9A 4FUCA 4BAKB 4ZHMU 1TRYA 2FLRH 2GVFA 3NUMA 2AERH 4OS1A 1DOJA 4PROA 1KDQA 3P92A 1O2ZA 1QRZA 1BBRK 2Z94A 2ZCLP 1B0EA 1GI8B 4FUDA 1K1IA 3SU2A 5A09A 4NZQA 1HRTH 1KXCA 2J94A 4D9RA 3RDZA 3EA7A 3PLKA 1TPPA 1P2MA 3KF2A 1FN8A 4R8TB 4OS4A 4I8LA 2AGEX 1UHBA 1BMNH 1DWCH 4JYUH 1LHDH 1WSSH 1JBUH 2PGBB 5AVDA 4A6LA 2JETC 1O3FA 3OYPA 1P2NA 2BDCA 4F4OC 1ZMLA 1BDAA 1THRH 1ELAA 1GPZA 2Z6BD 3MNSA 3FAOA 3TH2H 1A2CH 1DLEA 3NPSA 3I78A 4OGYA 1BTPA 1MTSA 1TNIA 3ZVDA 1SR5C 4LXBH 2VIVA 4UEHH 1YYY1 3SNEA 2XYAA 2TRMA 2GCTC 3UNRA 2B0FA 5DGJA 3QN7A 3AAUA 3SQEE 2JH5D 1HNEE 4AB9A 4DT7B 3KQBA 4KGAA 2AGGX 1BMAA 2QAAA 3VEQB 2TPIZ 3EAJA 1ZGIA 5L30H 1WBGB 2GV6A 1NM6A 4CREA 3LH1A 1GDUA 1W8BH 2C3SA 2WPKS 5AFYH 1MCTA 2FYRA 3U1IB 3B9FH 1RXPA 5GCHG 4CRDA 4DIIH 3BG8A 1RJXB 4O3UA 2OQ5A 5GDSH 1SGEE 1HAVA 3CP7A 3FFGA 3RXLA 2QYIA 3ENSB 3SU0A 4NIXA 1IAUA 3QUMP 5E8EH 1RTFB 1ELBA 1GDNA 1ZSKA 3FZDA 2V35A 3MYWA 2ZHEH 3LOXA 1UK4A 3UUZA 3VXFH 3SHCH 1P9SA 1PYTD 3M7QA 2B5TB 3STIA 2UUYA 3RXCA 9ESTA 3A7TA 1FPCH 3C27B 3BTTE 3RXJA 1PPCE 4AZ2B 6ESTA 1LKAA 6GCHG 2BX4A 4Y0YE 1LCYA 3O8BA 4ABDA 6GCHF 1IHTH 4AOQA 1FLEE 1S0RA 2F3CE 4Q7ZA 4E7RG 5C1UA 1V2OT 1J8AA 1SGPE 1AVGH 2ZGHA 1YPEH 1ZHPA 2JETB 4FUFA 2JH0D 3L3TA 3SJOA 1ABJH 1ZMNA 1O2LA 1D3TB 4Y8XA 1AU8A 3FANA 1O3NA 3CS0A 1GJCB 1PPZA 3QZRA 4MNVA 2XBVA 2ZA5A 1EJMA 3RXHA 5C20A 3SI3H 3IITA 3I29A 1F5RA 2BTCE 1H8IH 2SGEE 2G4TA 1HBTH 2YOLA 3EE0B 1GJ6A 1LTOA 1C5LH 2GCTB 4B76A 1P02A 3VB5A 1GI0A 1HAOH 3AVZA 2ZDNA 4MDSA 5E0JA 3TH4H 3AW0A 1PQAA 5IDKA 1GJAB 2ZGXH 4OS7A 1V2QT 1W7XH 4ZHLU 1C1RA 1P04A 2TGDA 3RXMA 1C1MA 1ZYOA 1C5UA 2QGRA 1TGNA 1MBQA 1KTSB 1BHXF 2HNTF 4B1TA 1ZHMA 1UTLM 4NIYA 1ZPCA 2Z9IA 1LVMA 4UFEH 1TMTH 5JBBS 8LPRA 1S84A 1IQGA 4BTTB 1GBFA 1VITH 2G5VA 1HJ9A 1SLVB 4KP0A 1D6RA 5EQRA 1NU9A 2Q6DA 4WF8A 3FP6E 1PPEE 2P59A 1F5KU 4AGJA 1ZTLA 1QJ6B 1C2FA 2LNCA 2C4FH 3Q3YA 2P94A 1XUJA 1WUNH 2FO9A 2A1DB 3KEEA 3DUXH 1E36B 1EAUA 4IBLH 1DITH 1BQYA 4X8TH 1ZOMA 4ISNA 2PV9B 1CA0C 1GCTC 1TBQH 3M7TA 5DP3A 1LDTT 4GHTA 4K60A 1W2KH 2HPQH 4INLA 3MH7A 3ATLA 5FPTA 3GICB 1GG6B 1AFEH 3A85A 1Y5UT 4O9VA 4JCNA 3MU0A 1FUJA 1AD8H 5E2PA 1CSOE 5FX6A 2Y7XA 1V2TT 3ZVEA 4H42U 4X6OA 3P8FA 1XUGA 2PW8H 1BOQA 2ZWLH 2AYWA 2VWLA 2Z7FE 3LJJA 1SGFG 3MNXA 3QX5H 1G36A 2BQWB 1HGTH 2VWMA 5JPMH 2ZPQA 2A7HA 1O3IA 1ZRKA 1AIXH 2H6MA 1O31A 4DIHH 4NCYA 4INHA 1MKWH 4JZDH 3T2NA 1WQVH 1UTOA 7GCHF 3RU4T 2ZFFH 4J1YA 4BAHB 2CHAC 2PTCE 2CMYA 3RMNH 1MTVA 2ZDMA 1JIMA 1LQDB 1GHXH 1PPGE 4K2YA 3BTKE 5JB9S 2A45B 1XMNB 4NG9H 2D8WA 4AN7A 2A31A 3MI4A 1LQEA 2B9LA 3SGBE 1ACBE 2D26C 2ZNKH 4FU9A 2GDEH 5SGAE 1INCA 1GVLA 1UCYE 3LGWA 4GCHG 3PB1E 1ETRH 1JRTA 2A0QB 1RTKA 2OC1A 2XW9A 3SGQE 2G00A 1FJSA 4GCHF 3KHVA 3TNSA 5A0AE 4FVDA 2BVSH 3SV7A 4Y8ZA 1HAYB 2BYAX 2TIOA 1ETTH 2ZQ1A 1YCPK 3NWUA 2HLCA 2XTTB 3S9CA 2ZHFH 3UPEA 2HRVA 2Q1JA 3U8TH 2AMDA 3VXEH 2O8UA 1SHYA 3O8RA 2DE9A 3M5OA 4A1VA 1YPKH 3AASA 1SMFE 3S0NA 1BUIA 1UTKA 4ZMAH 2XC5A 2HNTE 4Y7BA 2ZFSA 2R0LA 4CR9A 1EQ9A 2FOAA 3LGYA 3RXDA 1Z8RA 4LOYH 1MAYA 1O2QA 4KTUA 1C1WH 1C1QA 1CA8B 1D6WA 2WPLS 3ODDA 4TPIZ 1EAWA 1MKWK 3KQCA 1FV9A 2WUBA 3Q3KA 1WU1A 4BAOB 1C1NA 3LC5A 1O3GA 1GHZA 2Z3EA 4XBCA 3M5NA 4F49A 1P10A 2V6NA 2OD3B 2FOEA 3KNXA 1V2ST 1Z1JA 4IS5A 1JMOH 2C93B 1FY4A 1O2RA 2VIWA 3B8JA 5K7RA 2ZP0H 4JYTA 3SZNA 1TMUH 2ZTXA 5F03A 4O3TA 2R9PA 1X7AC 5EOKA 5F8ZA 3RXVA 3RM2H 3DHKH 2GDDA 1HAGE 3SQHE 1DANH 3M5MA 3OTJE 4NWLA 3Q00A 1EPTB 1TPOA 1P57B 1UJ1A 3U8RH 1RIWB 3TITA 2GMTC 2JH6D 4D8NA 4H6TA 1JWTA 2ILNA 3UFAA 2Z3DA 3QO6A 1C5ZB 1ORFA 4CHAB 1TIOA 2BY9X 3PMJA 3GDUA 2ZZUH 1FY1A 1YBWA 1DSUA 4DY7B 1TNHA 2QN5T 1BA8B 4ISOA 1AI8H 1NZQH 4VGCC 4AGKA 1TX6A 2UWPA 3EA8A 1HAPH 4U01A 1A46H 3SU5A 2NU3E 2AFQB 3BSQA 4I8GA 1V6DA 4OS2A 1MKXH 1VZQH 4MLFB 1CHOG 1DVAH 1EUFA 1BTYA 1AQ7A 2C8YB 3HKJB 2J2UA 1V2MT 1AFQB 1GCDA 4MQAA 3RXSA 2TGTA 2VVVA 1WOFA 4K3JA 3ZZDA 1AHTH 2WUCA 2J4IA 4Q2KA 5C1XA 1TPSA 1DT2A 1C5RA 4ASHA 3T26A 3SJIA 1O2VA 1TLDA 2Q6FA 2TBSA 4E7NA 4E06H 1TGCA 2VNTA 5DP9A 3ODFA 4ABFA 2PTNA 1AWFH 2FESH 1KY9A 1EOJA 3LT3A 1BRBE 1C5WB 1WQSA 4JZIA 2XC4A 1V2JT 1C2GA 3M3SA 2QXJA 4I8HA 2ZU2A 1C1SA 4B75A 1TBZH 3EGKH 2ASUB 1MTUA 5AF9H 4WWYA 9LPRA 3U9AH 3TPIZ 3VB3A 3Q76A 3R0FA 2ZECA 4UFFH 3NZIA 4BAQB 2ZGCA 5FAHA 1SQOA 4BTUB 1P0SH 1ZJDA 1K2I1 3T28A 4TPYA 5FXLA 2XC0A 1T31A 1O2SA 5HGGA 3A7VA 3SN8A 3TH3H 2F9PA 3RXUA 1O5CB 4GLYA 1P06A 3LJOA 5LPRA 1HIAB 5GXPA 1FZZA 4GVUA 4VGCB 1NC6A 1ANDA 1S0QA 2F9VA 4J2YB 3A7WA 1OP0A 1W3CA 1HDTH 4NFFA 4KELA 3VGCB 1UTPA 2QF0A 1GVKB 5EXLA 1TONA 4IGDA 3FVFB 4X2WA 1ELTA 5ESTE 1O2UA 3D65E 2QC2A 4WVPE 1AZZA 4X6NA 5BRRE 2A32A 2PSYA 2C90B 3L33A 1TNGA 3SUDA 3AW1A 4SGBE 1J15A 1OKXA 2P95A 4A92A 1YPMH 1V2PT 4KKDA 2P16A 4JK6A 4HI3A 1O3PB 1UTJA 1BZXE 3NXPA 1C2IA 1OOKB 5J4SA 2EEKA 2CGAA 3GY4A 3QZQA 2Y82A 2YNBA 5EPNA 1C2EA 3PO1B 1V2WT 1DWDH 1W7GH 3T5FH 4FUBA 5EXNA 1O2OA 2FI5E 4FU7A 1GVZA 4B71A 1L1NA 8ESTE 1CGIE 3KL6A 2FTMA 1P3CA 1WTHD 4XSKU 3V7TA 4DVAU 4B2BA 2G51A 5J4QA 3TGJE 1BIOA 1T4UH 3DT0H 4XDEA 4XOJA 1MTWA 5LGOA 3EDXB 2ZCKP 2Y7ZA 3GISB 1LVYA 2ZTYA 3GY7A 2FOMB 1SGQE 2RA0A 2ALPA 4JYVH 5JBCS 2H2ZA 1V2RT 3SV6A 1KYNA 2A7JA 2O8MA 2EI8A 4IMQA 2BVXH 1ZZZA 2H5DA 1FIZA 1LPZB 1BBRE 3M61U 1SPJA 3AAVA 4MPXA 4DOQA 7KMEH 3P70B 1P05A 3GCOA 3OSYA 2VJ1A 1HXFH 3GY3A 1PPBH 3BTDE 2GZ8A 4BXWA 1QY6A 2XCFA 2ZKSA 2GT7A 2OLGA 1HIAA 2PHBA 4KTSA 2R3YA 4ZKSU 1KIGH 1GMHG 1C1UH 2BD5A 1GBEA 2Y5GA 2ZU1A 1GMHF 3E8LA 1TA6A 2RCEA 1QL8A 3F9EA 4JK5A 4GUXA 1FQ3A 1Z8JB 2EA3A 5JDUB 3Q77A 1QBOA 5LPFA 1Y3YA 2FOCA 3E6PH 4MPVA 2W3IA 3BTEE 3SNCA 1EB1H 2BLQA 1S85A 1FI8A 1OWKA 1SOZA 2QXGA 3SO3A 4D7GA 1P2IA 3GCHB 3M36A 3BIUH 1O33A 1SBWA 2I6QA 3MU1A 1GMCG 4K1EA 1O3KA 2XCNA 5DG6A 1BTZA 1OWDA 2R0KA 2G55A 1GMCF 2IOTA 1K21H 5CMXH 3PROA 1O39A 4ABEA 1IQHA 2F9UA 4CBOA 1N1LA 3LGTA 1H9LB 2XBYA 1C5MD 2ZFPH 3M7UA 5I25A 1DLKB 1FY5A 1YPHC 4DW2U 1IOEA 2AEIH 2V3OH 3SUFA 3S7HB 2Z9LA 2ZDLA 2ZQ2A 5EQQA 1V3XA 2R2MB 4AG1A 1EATA 3TK9A 2BY8X 3PYHA 3ZV9A 1HUTH 4RSPA 1C2HA 1VCWA 3URCA 2A4GA 3PTBA 5TCAA 1W14U 1ARBA 1ARCA 1O38A 1AB9B 5DKMA 6LPRA 3SGAE 2AGIX 2BD7A 3RMMH 1BTWA 1C5VA 2V0BA 5DO4H 1L1GA 1O30A 2NU1E 1TBRH 1VJ9U 2G81E 2ZDKA 3E90B 4IC5A 4AB8A 1K1JA 2OC8A 4AFUA 4R0IA 1MAXA 2BD8A 2FS8A 2VIDA 1LO6A 5LPEA 4OS5A 1LVOA 1OX1A 1E34B 2BMGB 3RXEA 1GG6C 2VIOA 7ESTE 1Q31A 3KIDU 1NRSH 2D2DA 2H1UA 2F83A 3OY5U 1CT4E 1Z71A 5HM2A 1NESE 1NFUA 3EYDA 3P8GA 3ZVFA 1B0FA 2BHGA 1SGRE 4Q7YA 4WMFA 1AN1E 3RXPA 4AFQA 5ETXA 4ZUHA 3LGIA 1MD7A 1MBMA 2FTLE 4H4FA 3ZV8A 1KXAA 1SLUB 1P2OA 1C1VH 1P11E 3RP2A 4BANB 3K9XB 3MU8A 3PLBA 1A3BH 2WPIS 1XX9A 1BB0B 3MO9A 1GWAA 2A5AA 3D62A 1OXGA 1P8VC 3V3MA 5T6DA 1AMHA 1UTNA 4CRGA 1Q3XA 2G4UA 2FOGA 2OC0A 1YC0A 4Z0KA 1V2VT 4K8BA 2GT8A 3SV8A 1W0ZU 4FUIA 1O3OA 3MWIU 4NA7A 3LGUA 1MU6B 1Q2WA 5JBAS 1GJ5H 1ZLRA 2P3TB 1O5DH 1NFYA 1OSSA 2QXHA 2BY5X 1O35A 2UUKB 1XUKA 4I31A 4K1TA 5EODA 2H5CA 1V2NT 2ZG0H 1GJBB 2VVCA 5AHGH 1YPLH 1XM1A 2FM2A 1BITA 1E0FD 1GGDB 3N7OA 2FX4A 3SJ9A 4CH2B 2NU2E 2BDGA 3A87A 4X8SH 5H4IB 1ELGA 3A80A 1IHSH 5DP6A 4X6PA 1J17T 2J95A 2ULLA 1UVTH 1DFPA 2W5EA 3S69A 1TYNA 4IN2A 1SLWB 3F6UH 4FXGH 4X2VA 1PPFE 1H1BA 3ZZ4A 2P3FH 1SQAA 3UOUA 1J14A 4Y0ZE 1S83A 1LHFH 3ZYEA 1UCYH 3BEIB 1SHHB 2ZHQH 3JZ1B 1LPKB 1A0JA 1UMAH 1QIXB 4YOGA 1D4PB 1BT7A 5FBIA 4E05H 3PLPA 1P09A 1C1PA 4IN1A 3RXKA 2C8WB 1NROH 5A0BA 1G3BA 4HZHA 1IQMA 2G52A 1IQIA 7GCHG 1A7SA 2H9TH 3M3TA 4TWWA 3VB4A 1H9HE 1C2MA
chains in the Genus database with same CATH superfamily
1E35B 1LPGB 2SGPE 1O5AB 8GCHG 4UONA 3F9HA 3B23B 3D49H 3ZVCA 1QTFA 3BN9A 1AUJA 8GCHF 2HVXA 3TNTA 3GY2A 1NU7B 1TFXA 1YF4A 4XFQA 1EX3A 1EPTC 1O3LA 4DGJA 1Y3WA 1D3QB 1FAXA 1RIWC 4MVNA 1GI9B 3E0NB 5EXMA 2ZPRA 1WCZA 3M37A 3SW2B 4LZ1H 1F0SA 3QTVH 2PKAB 1MU8B 1SGTA 3TK5A 2PUXB 4CHAC 4RN6A 3HGPA 1F2SE 4LZ4B 1TRNA 5L2YH 1O5BB 1J16A 3SI4H 1E79D 1A0LA 5EPYA 4AFZA 4NIWA 5JBTA 1PFXC 1HJ8A 1VCPA 1GBHA 2NWNA 1K1MA 4BOHA 1NRPH 3DA9B 4P02A 2GP9B 1SFQB 4U32A 1P2QA 1GI4A 1TPAE 2WZQA 2ANKH 1DDJA 1AFQC 2YNAA 1C4V2 4RT1A 2A4QA 1TNKA 2FPZA 3HK3B 4A5TS 2GV7A 1XXDA 1Z7KA 2BLWA 4OGXA 1KSNA 3MU5A 1QFKH 3BG4C 2ZC9H 2BVRH 3UR9A 2FYQA 3F9GA 2VIPA 3URDA 1EASA 2ANMH 3RLYH 1W0YH 1KLJH 3A81A 1QL7A 3KQDA 3MH5A 3NCLA 1JXPA 4IW4E 2A7CA 4INKA 3DSPA 1HFDA 4M9FA 5EQSA 1C9PA 3RXIA 2QA9E 3GY5A 2BDAA 2FZZA 4ZXXH 1QBNA 2TGPZ 2F9NA 1C4U2 2LELA 3TJUA 1UTQA 4HG6A 1RFNA 2PR3A 4B2AA 5HYOA 2ODYB 1SOTA 2FX6A 2OCVB 2Y6TA 3A84A 3ZVBA 1WTGH 3SV2H 1ZMJA 1SB1H 3QK1A 3UNSA 1EZUC 4AORA 3E91A 5FHTA 1CT0E 4MNXA 1LHGH 4IC6A 4YOJA 4GPGA 4O03A 3CS7A 4ABIA 4WMDA 1ZHRA 3A7ZA 3UNQA 1DXWA 1GHVH 2BLVA 1FY3A 3S7KB 5C2ZA 4BAMB 1AKSB 1T7CA 1EOLA 4AX9H 3FN8A 1ZGVA 1LMWB 4HGCA 1AZ8A 5EW2H 4CH8B 3W94A 2WPHS 5EJ1A 1XUFA 1DE7H 5GJ4B 2B8OH 2KAIB 4X2XA 1FIWA 1YKTA 1EP5A 2QE7D 2ZEBA 4K8YA 3QGJA 1O2PA 2EI7A 5K0HA 1O2YA 4TY6A 3QWCH 5I46H 3VGCC 3F2FA 2PKAA 1H9IE 5C94A 1YPGH 1A5GH 2XWAA 4YOIA 4NA9H 1L4ZA 2G8TA 3ZZ9A 3ZZBA 1HV7A 1NRNH 2CN0H 4RKJB 1MTNC 5DP7A 1ELDE 2RA3A 1O34A 5EGMA 2ZDVH 1CT2E 1TQ7B 4THNH 3BG4B 2RG3A 1L0ZA 2Y81A 2ODQA 1KLIH 3SJ8A 3P95A 3A86A 2CK3D 3BTFE 1O36A 2H9EH 2J92A 2OXSA 3DSOA 2AS9A 1F0RA 2SGQE 3PMBB 4K69A 4Y7AA 5E0HA 3BTQE 1UVPA 4TYDA 1AVWA 1O5GH 1PQ5A 2BXTH 4FUJA 3OU0A 1GMDG 1TGSZ 3KGPA 3DFLA 1FONA 2BDHA 1C1TA 1GMDF 1GL0E 2O8WA 3PO1C 4GAWA 2FI3E 1SL3A 3BTWE 4JZEH 2XRCA 1FX0B 1QNJA 1G3CA 1HAZB 1K1NA 1AGJA 1Z6JH 4GHQA 3H7TA 4LK4A 4X2YA 1GI2A 1TX7A 3GDVA 1TWXB 1N6XA 4NZLA 3K2UA 3MNBA 1UW7A 3VB6A 2EI6A 1XKBC 3HATH 2XXLA 3K6YA 1ZTJA 3EQ0H 3MO6A 2ALVA 2BDYA 5A0CA 3ITIA 5DPAA 4P00A 4U2WA 2LPRA 2BQ6B 2A4OA 2P3UB 1O5FH 1A5IA 1KXBA 4FUHA 1HXEH 2GCHG 3V12A 1NRQH 1MKXK 3BTHE 4X1SU 1OWIA 1EKBB 1XVOA 2GCHF 4WY3A 2ZI2H 1E1QD 3TK6A 1V2KT 3F68H 3GY6A 4B74A 1KXEA 1VCQA 2FXRA 2HNTC 3RXTA 1TB6H 1EPTA 2H9HA 1T8OA 1KTTB 4SGAE 3ESTA 3U8OH 1EP6A 4YTAA 1A3EH 1EJAA 5CE1A 2QF3A 1ELFA 1D3DB 2WYJA 2SNVA 2STAE 1O37A 2F43B 1O0DH 1CHGA 1F0UA 3A89A 2VGCB 1KLTA 2FMJA 4FU8A 4I8KA 1TNLA 4ZROA 4U30A 1EB2A 1O2GH 3LH3A 1O3BA 1DUAA 4Y8YA 1NBME 3MTYA 2EC9H 4M7GA 1MTNB 2O8TA 2KAIA 1RD3B 5TCCA 2A4RA 1EZXC 1ESTA 2BD9A 4JZFH 3ZYDA 3TVJB 2ZCHP 2BY6X 4ZXYH 3LU9B 2M5TA 1W10U 3P8NA 1OWHA 2AMQA 1TRMA 3ZZCA 2VU8E 4CBNA 5C5NA 1D3PB 1TOMH 1K22H 1DUEA 2J34A 4I32A 3GCHC 3TIUA 2VWNA 1QJ1B 5EU8A 4NSYA 3GYMA 3MU4A 3LPRA 2DUCA 2SGDE 2VWOA 2FLBH 3E16B 4CR5A 2Y5HA 3GCNA 1FXYA 3PWBA 4TY7A 1O5EH 2BOKA 2WV4A 1W11U 4XBBA 3RU4D 1G30B 1SVPA 1J9CH 1K28D 1TX8A 3LONA 1G37A 1T32A 1OP8A 1GHWH 3IWMA 2AMPA 3BIVH 2HALA 3SU3A 2BM2A 2Z9GA 5B6OA 1QR3E 1NN6A 1P2KA 1OYQA 3K6ZA 4CRAA 1SC8U 2UUJB 2W6JD 1P2JA 3SNAA 2AIPA 2Z9KA 3DD2H 1OYTH 4F55A 1BHXB 3F1SB 4ABJA 2G5NA 1QBVH 1JOUB 1DS2E 5DK1A 1UK3A 1YPJH 3H7OA 3EA9A 1THPB 2VH0A 1ZR0A 2ZU3A 1Z8IB 1AB9C 5EG4A 2OBQA 3HKIB 3H09A 2L6OA 1T8NA 1G32B 1QB1A 1UTMA 4WXIA 1QGFA 3VB7A 1O2WA 3BEUA 4AFSA 3FZZA 4WJG2 1IQJA 3RXBA 3RC5A 2C8XB 3LC3A 4ABHA 1YLDA 4AG2A 3SUEA 1NTPA 4Y6DA 5DP4A 3ZZ6A 1B5GH 2KR7A 1BMMH 3MFJA 3U98H 1CQQA 1YLNA 5T6FA 3CNRA 3LIWA 4NSVA 4NWKA 2R2WU 2A2XH 1C5QA 2Q6GA 3I77A 1S5SA 3UQOA 4XE4A 2R3UA 3ZVGA 1EFRD 2Y80A 2W7UA 2PLXA 3GY8A 5C67A 4XD7D 2ZDAH 3L6PA 3ATMA 2PKSB 1DX5M 1HPGA 4YT7H 5F8XA 1HLTH 2A5IA 1ZSLA 3UR6A 2WPJS 5T6GA 1QL9A 3PRBA 3U69H 4A7IB 1IQNA 1QB9A 3PWCA 1NY22 1YY3A 1E38B 1XXFA 4ISLA 2GTBA 2YMSD 3TGKE 1MCVA 1TGTA 5CDFE 3SNDA 1QQUA 3D23A 1O2NA 5HM9A 1ANBA 5LH8A 4UE7H 3KQ5A 4ZKNU 1SQTA 3TLOA 1GDQA 1XKAC 5CHAC 4DURA 1GBBA 1U6QA 1ZPBA 1BMLA 1SI5H 1GHBG 1Z6EA 2GD4B 5FCKA 2WINI 3ZZAA 4QT8C 1GHBF 3F9FA 2BDIA 2FS9A 3UREA 3NKKA 1N8OB 1S82A 4X6MA 2NU0E 2VINA 4FVBA 3A82A 3UY9A 1MD8A 1UK2A 2AH4X 2KX4A 3QLPH 2RFKC 1P12E 1GGDC 2HPPH 1O2MA 4DCDA 4FUEA 5GCHF 4B6EA 8KME2 1G2MA 4ZH8A 1QA0A 4YESB 1VITG 1EAXA 4AYVB 2OC7A 1OWEA 1AVXA 1SGYE 1ZJKA 1FPHH 1VITF 2QV1A 4UFDH 1IQEA 5EW1H 1GBLA 4YLQH 4DG4A 1FAKH 3JZ2B 1PJPA 3TU7H 1GBJA 2CF9H 3PV5A 4ZAEA 1K1LA 1PYTC 4DT4A 3OY6U 2WPMS 2PSXA 2FDAA 1OPHB 1FN6A 3M5LA 5EJZA 3RMOH 5G4BA 1F7ZA 3UAIC 1W13U 2UWLA 2SNWA 1ANEA 1QRXA 1HB0B 1ZTKA 3DFJA 2FODA 2XBXA 3OX7U 2QF4A 2BZAA 1BTXA 1THSH 4NFEA 3RXGA 1UVOA 2FEQH 1GL1A 2CJIA 5TJXA 4WH6A 4YO9A 1Y5AT 7LPRA 5DP8A 3A88A 1AWHB 3ATWA 3RXFA 2OUAA 4CRBA 1COWD 3UTUH 1EJNA 2BQ7B 2F91A 4NGAH 2Y5FA 2TGAA 4ZKRU 1F92A 1L1JA 2RDLA 1NFWA 1C2DA 2J5UA 3S9BA 1LHCH 3BV9B 4KTCA 4ASUD 2BLOA 4BTIB 5CHAB 1WAYB 2F9BH 2FIRH 2QXIA 3KCGH 2UUFB 4Y11E 1GHAG 3ATIA 1MZAA 2BXUH 1ZPZA 2ODPA 1GHAF 4Z6AH 5DP5A 1O3EA 2A5KA 3OEED 1AE5A 3RLWH 2WYGA 1MMJN 1FDPA 2LP6A 1VJAU 3T62A 2GKVE 1O3DA 1SGFA 1EZQA 3MOCA 5IK2D 2SGAA 4MTBA 3UWJH 3F2GA 1O2KA 3MO3A 1TNJA 3BTME 3UOPA 5HMAA 1O3CA 2BD2A 1Y3UA 5F6MA 3C1KA 3BEFB 2PFEA 4D76A 1RTLA 1IQLA 1AY6H 3CENA 2OTVA 1O2IA 2THFB 3NRLA 3GOVB 1C2KA 2KM0A 1CE5A 1GI6A 1TE0A 3VFEA 2ZU5A 2VH6A 3H5CB 1DICA 1Y59T 4X8UH 1AO5A 1O2JA 4NIVA 1HAHH 1IQFA 1TABE 4A1XA 2BZ6H 5A8XA 2J38A 5GPIB 1ETSH 1KXDA 2ZO3H 2W26A 4I33A 1CBWC 1DXPA 2ANWA 1OWJA 1TALA 3T25A 1G2LA 4WH8A 1OHHD 1YCPH 2BD4A 2ZIQH 1QJ7B 1C5XB 1EXFA 3VPKA 1ZSJA 4ZHAA 5EIYA 1RS0A 1A61H 1BRAA 1C5SA 1ZRBA 2KCYA 2O9QA 1GI5A 1LHEH 5HIYA 4FUGA 5FPSA 1QRWA 1DPOA 3TGIE 1H8HD 1D9IA 3HPTB 3QGNB 3MH4A 2QCYA 1TAWA 1OP2A 3SYJA 1O2HA 1GJDB 2K0QA 1EZSC 3PTNA 1SGCA 3RM0H 3G01A 1XUHA 4ACAA 4ABGA 1F0TA 4X1PU 1C2LA 3U1JB 1DWBH 2W3KA 1T4VH 3STJA 3P8OA 1MQ6A 1QQ4A 3S9AA 2Z3CA 3T27A 1GBAA 1BCUH 1V2LT 1SG8B 4H6SB 2OINA 1S81A 3MH6A 4JZ1A 3QTOH 2DE8A 6CHAC 4ISHH 1MUEB 1GJ9B 4GSOA 4ZKOU 3KYFA 5C17A 5F8TA 2ANYA 3RC4A 1UCYK 4ABAA 1K1PA 1B7XB 1MZDA 2CV3A 4HFPB 1K9OE 2J9NA 4CRFA 1L2EA 4K5ZA 4MNYA 1YLCA 5DJ7A 3A8AA 5BPEA 1P01A 3FO8D 3PMHB 3KQEA 4YZUA 3SU1A 4AYYB 4I8JA 2BDBA 3TJVA 1Z1IA 1ESBA 1Y8TA 2GJGA 3E1XB 2ZF0H 2ZPSA 1BRUP 1C5PA 4Y71A 1CBWB 1SGIB 1O2XA 1CU1A 2FP7B 3KN2A 3BTGE 1C5OH 1CA0B 1O2TA 1PQ7A 2OQUA 2PUQH 1YCPM 1GCTB 2VVUA 3SORA 2XBWA 2ZU4A 3TJNA 3FP8E 2JJ1D 2A2QH 1VR1H 1TGBA 3P6ZB 1SGDE 2FOFA 4WMEA 4X1QU 1YP9A 3SUGA 2WV5A 4YM9A 1BJVA 4X1NU 1S6FA 5C0UA 1ELEE 2ESTE 4UFGH 5JYIA 3QDZB 3MQKC 2CF8H 1SSXA 5C3NA 1DM4B 4K1SA 1XVMA 1C4Y2 2GGVB 1RGQA 2FOHA 1H8ED 2ZFQH 2VIQA 4CRCA 5C5OA 3LGVA 4OS6A 5A2MH 1LVBA 1QURH 4HTCH 2JKHA 3ZZ3A 2WSSD 4Y79A 2IN2A 2CHAB 1GBTA 1JRSA 2I6SA 1SFIA 1BRCE 1G3EA 1H8DH 1SQRA 1P3EA 3PM3A 3TJOA 1ESAA 3RXRA 5T3HA 1L4DA 2ZGBH 4WXVA 3RMLH 6CHAB 2NU4E 3F0OA 3RXAA 4OM9A 1C2JA 5FCRA 1V2UT 2HGTH 4Q80A 1W12U 2P8OC 3MNCA 2CXVA 1GJ4H 1A0HB 1AE8H 1CGHA 3LDXH 2Z9JA 2GX4A 5C1YA 3ZZ7A 1ID5H 5T1VA 3GCTG 1F5LA 1FMGA 3UWIA 2VGCC 3E0PB 3A83A 3GCTF 2ZFTA 1WV7H 5JB8S 3RXQA 4Y76A 1MQ5A 3SOSA 2PGQB 1EAIA 4DJZB 1E1RD 4MPUA 4XBDA 2HWLB 1O3AA 4X0WU 1TA2A 3RC6A 3WY8A 3FP7E 3RU4E 4FOUC 1GBIA 1DY8A 4ABBA 2C8ZB 1C5TA 2PWXA 4D7FA 3R3GB 4I7YH 1GBDA 3A7YA 1RRKA 1CO7E 3E3TA 4X1RU 3T29A 3SU6A 3HK6B 1A5HA 1C9TA 3VG8A 3PMAB 4RI0A 1CHOF 2W6ID 3IG6B 2AIQA 1O3HA 1UO6A 1HAIH 2XWBI 3GDSA 4TT3D 1TOCB 1QCPA 1FNIA 1H4WA 2ZTZA 2B7DH 1NT1A 1TMBH 3SU4A 1Z8GA 1P03A 1UVSH 2QY0B 5DSFA 1GBCA 4YLUA 1ELVA 4Q7XA 2J98B 2BB4A 1GJ7B 1Y3XA 4UDWH 1E37B 1HJAC 4IMZA 3WWFA 1K1OA 5FPYA 1GHYH 4TWYA 1C5NH 4O97A 2QIQA 2IJOB 1S6HA 2FWWA 1NPMA 1AUTC 4NA8A 3UB0A 3ZZ5A 3M35A 2W7SA 1JIRA 1ABIH 1GBKA 1O32A 3Q3XA 1CGJE 1HYLA 1QB6A 1HAXB 1Y5BT 3GYLB 1O3JA 1T8MA 2GMTB 2VB0A 5A8YA 1GI7B 2P8OB 1DSTA 1G3DA 1YM0A 2SGFE 1OS8A 1KDQB 1O3MA 3K65B 1DY9A 1PPHE 2UWOA 5E2OA 2BOHB 1VGCC 2BD3A 2BX3A 3ATKA 1AKSA 3O8DA 1BTUA 1FY8E 3A8BA 4UD9H 5FL7D 3LKWA 2GZ7A 5IYTA 4MG3A 2ZHWH 1NRRH 3A8CA 1T8LA 2SFAA 3A8DA 3ZVAA 1DWEH 1CVWH 1UHBB 3UIRA 3P17H 5FBEA 1XUIA 4X8VH 1UVUH 1TQ0B 3EE7A 2HOBA 4D9QA 1YPHE 3W95A 3M3VA 5GIBA 2OBOA 1P9UA 1GI1A 4RKOB 4B6FA 3SZEA 1A1RA 2STBE 2D1JA 3SJKA 5HXFA 1Y3VA 1BJUA 4MNWA 4BXSA 3PV4A 2XNIA 3HGNA 4MPWA 2FI4E 3V0XA 2PKSC 1NS3A 3O8CA 1C5YB 5PTPA 1BBRH 2BY7X 2EQNA 3NK8A 3ZZ8A 1HCGA 3RXOA 1YGCH 3SBKA 2V3HH 2O8LA 2ZHDA 1QZ8A 1NO9H 1G9IE 5FX5A 1GJ8B 4A1TA 3SNBA 1HJAB 1N6YA 5AFZH 2K8IA 1LKBA 1SGNE 1NFXA 1QHRB 1PQ8A 4Y10E 2GZ9A 4ZCNA 2JIZD 3MMGA 1HAVB 2P93A 1QA7A 3BF6H 4BNRA 1GBMA 2J98A 3RUOA 5GWZA 4YT6H 1M9UA 4AC9A 3MHWU 1IQKA 2WPDD 3ELAH 2FOBA 3N99A 1ELCA 2F9OA 1N8OC 1BTHH 2ZGJA 5E0GA 1KXFA 3SHAH 2K1QA 1ANCA 3V13A 4B2CA 5ESBA 4ESTE 5L2ZH 1VGCB 3UQVA 1GI3A 1WYKA 5L6NH 2OP9A 5A8ZA 1SLXB 2IPHA 5ABWA 1MH0A 2ZFRH 1A4WH 4JMYA 3A7XA 4B73A 4ISIH 1C1OA 3SV9A 4FUCA 5B6LA 4BAKB 4ZHMU 1TRYA 2FLRH 2GVFA 3NUMA 2AERH 4OS1A 1DOJA 4PROA 1KDQA 3P92A 1O2ZA 1QRZA 1BBRK 2Z94A 2ZCLP 1B0EA 1GI8B 1W0JD 3WW7A 4FUDA 1K1IA 3SU2A 5A09A 4NZQA 1HRTH 1KXCA 2J94A 4D9RA 3RDZA 3EA7A 3PLKA 1TPPA 1P2MA 3KF2A 1FN8A 4R8TB 4OS4A 4I8LA 2AGEX 1UHBA 1BMNH 1DWCH 4JYUH 1LHDH 1WSSH 1JBUH 2PGBB 5AVDA 4A6LA 2JETC 1O3FA 3OYPA 1P2NA 2BDCA 4F4OC 1ZMLA 1BDAA 1THRH 1ELAA 1GPZA 2Z6BD 3MNSA 3FAOA 3TH2H 1A2CH 1DLEA 3NPSA 3I78A 4OGYA 1BTPA 1MTSA 1TNIA 3ZVDA 1SR5C 4LXBH 2VIVA 4UEHH 1YYY1 3SNEA 2XYAA 2TRMA 2GCTC 3UNRA 2B0FA 5DGJA 3QN7A 3AAUA 3SQEE 2JH5D 1HNEE 4AB9A 4DT7B 3KQBA 4KGAA 2AGGX 1BMAA 2QAAA 3VEQB 2TPIZ 3EAJA 1ZGIA 5L30H 1WBGB 2GV6A 2RDEA 1NM6A 4CREA 3LH1A 1GDUA 3GS9A 1W8BH 2C3SA 2WPKS 5AFYH 1MCTA 2FYRA 3U1IB 3B9FH 1RXPA 5GCHG 4CRDA 4DIIH 3BG8A 1RJXB 4O3UA 2OQ5A 5GDSH 1SGEE 1HAVA 3CP7A 3FFGA 3RXLA 2QYIA 3ENSB 3SU0A 4NIXA 1IAUA 3QUMP 5E8EH 1RTFB 1ELBA 1GDNA 1ZSKA 3FZDA 2V35A 3MYWA 3N7DA 1BMFD 2ZHEH 3LOXA 1UK4A 3UUZA 2L74A 3VXFH 3SHCH 1P9SA 1PYTD 3M7QA 2B5TB 3STIA 2UUYA 3RXCA 9ESTA 3A7TA 1FPCH 3C27B 3BTTE 3RXJA 1PPCE 4AZ2B 6ESTA 1LKAA 6GCHG 2QF5A 2BX4A 4Y0YE 1LCYA 1MABB 3O8BA 4ABDA 6GCHF 1IHTH 4AOQA 1FLEE 1S0RA 2F3CE 4Q7ZA 2V3MA 4E7RG 5C1UA 1V2OT 1J8AA 1SGPE 1AVGH 2ZGHA 1YPEH 1ZHPA 2JETB 4FUFA 5CHBA 2JH0D 3L3TA 3SJOA 1ABJH 1ZMNA 1O2LA 1D3TB 4Y8XA 1AU8A 3FANA 1O3NA 3CS0A 1GJCB 1PPZA 3QZRA 4MNVA 2XBVA 2ZA5A 1EJMA 3RXHA 5C20A 3SI3H 3IITA 3PRDA 3I29A 1F5RA 2BTCE 1H8IH 2SGEE 2G4TA 1HBTH 2YOLA 3EE0B 1GJ6A 1LTOA 1C5LH 2GCTB 4B76A 1P02A 3VB5A 1GI0A 1HAOH 3AVZA 2YMSB 2ZDNA 4MDSA 5E0JA 3TH4H 3AW0A 1PQAA 5IDKA 1GJAB 2V7QD 2ZGXH 4OS7A 1V2QT 1W7XH 4ZHLU 3AK5A 1C1RA 1P04A 2TGDA 5GNDA 3RXMA 1C1MA 1ZYOA 1C5UA 2QGRA 1TGNA 1MBQA 1KTSB 1BHXF 2HNTF 4B1TA 1ZHMA 1UTLM 4NIYA 1ZPCA 2Z9IA 1LVMA 4UFEH 1TMTH 5JBBS 8LPRA 1S84A 1IQGA 4BTTB 1GBFA 1VITH 2G5VA 3OFND 1HJ9A 1SLVB 4KP0A 1D6RA 5EQRA 1NU9A 2Q6DA 4WF8A 3FP6E 1PPEE 2P59A 1F5KU 4AGJA 1ZTLA 1QJ6B 1C2FA 2LNCA 2C4FH 3Q3YA 2P94A 1XUJA 1WUNH 2FO9A 2A1DB 3KEEA 3DUXH 1E36B 1EAUA 4IBLH 1DITH 1BQYA 4X8TH 1ZOMA 4ISNA 2PV9B 1CA0C 1GCTC 1TBQH 3M7TA 5DP3A 1LDTT 4GHTA 4K60A 1W2KH 2HPQH 4INLA 3MH7A 3ATLA 5FPTA 3GICB 1GG6B 3ZIAD 1AFEH 3A85A 1Y5UT 4O9VA 4JCNA 3MU0A 1FUJA 1AD8H 5E2PA 1CSOE 4Q4LA 5FX6A 2Y7XA 1V2TT 3KYGA 4H42U 3ZVEA 4X6OA 3P8FA 1XUGA 2PW8H 1BOQA 2ZWLH 2AYWA 2VWLA 2Z7FE 3LJJA 1SGFG 3MNXA 3QX5H 2PP6A 1G36A 2BQWB 1HGTH 2VWMA 5JPMH 2ZPQA 2A7HA 1O3IA 1ZRKA 1AIXH 2H6MA 1O31A 4DIHH 4NCYA 4INHA 1MKWH 4JZDH 3T2NA 1WQVH 1UTOA 7GCHF 3RU4T 2ZFFH 4J1YA 4BAHB 2CHAC 2PTCE 2CMYA 3RMNH 1MTVA 2ZDMA 1JIMA 1LQDB 1GHXH 1PPGE 4K2YA 3BTKE 5JB9S 2A45B 1XMNB 4NG9H 2D8WA 4AN7A 2HVYB 2A31A 3MI4A 1LQEA 2B9LA 3SGBE 1ACBE 2D26C 2ZNKH 4FU9A 2GDEH 5SGAE 1INCA 1GVLA 1UCYE 3LGWA 4GCHG 3PB1E 1WXRA 1ETRH 1JRTA 2A0QB 1RTKA 2OC1A 2XW9A 2OK5A 3SGQE 2G00A 1FJSA 4GCHF 3KHVA 3OE7D 3TNSA 5A0AE 4FVDA 2BVSH 2EY4C 3SV7A 4Z1MD 4Y8ZA 1HAYB 2BYAX 2TIOA 1ETTH 2ZQ1A 5DN6D 1YCPK 5HKKD 5F53A 3NWUA 1VKYA 2HLCA 2XTTB 3S9CA 2ZHFH 3UPEA 2HRVA 2Q1JA 4TSFD 3U8TH 2AMDA 3VXEH 2O8UA 1SHYA 3O8RA 2DE9A 3M5OA 4A1VA 1YPKH 3AASA 1SMFE 2XOKD 3S0NA 1BUIA 1UTKA 4ZMAH 2XC5A 2HNTE 4Y7BA 2ZFSA 3N7EA 2R0LA 4CR9A 1EQ9A 2FOAA 3LGYA 3RXDA 1Z8RA 4LOYH 1MAYA 1O2QA 4KTUA 1C1WH 1C1QA 1CA8B 1D6WA 2WPLS 3ODDA 4TPIZ 1EAWA 1MKWK 3KQCA 1FV9A 2WUBA 3Q3KA 1WU1A 4BAOB 1C1NA 2F4LA 3LC5A 1O3GA 5KGOA 1GHZA 2Z3EA 4XBCA 3M5NA 4F49A 1P10A 2V6NA 2OD3B 2FOEA 3KNXA 1V2ST 1Z1JA 4IS5A 1JMOH 2C93B 1FY4A 1O2RA 1W0KD 2VIWA 3B8JA 5K7RA 2ZP0H 4JYTA 2WV9A 3SZNA 1TMUH 3DSGA 2ZTXA 5F03A 4O3TA 2R9PA 1X7AC 5EOKA 5F8ZA 3RXVA 3RM2H 5EJLA 3DHKH 2GDDA 1HAGE 3SQHE 1DANH 3M5MA 3OTJE 4NWLA 3Q00A 1EPTB 1TPOA 1P57B 1UJ1A 3U8RH 1RIWB 3TITA 2GMTC 2JH6D 4D8NA 4H6TA 1JWTA 2ILNA 3UFAA 2Z3DA 3QO6A 1C5ZB 2KCPA 1ORFA 4CHAB 1TIOA 2BY9X 3PMJA 3GDUA 2ZZUH 1FY1A 1YBWA 2KCOA 1DSUA 4DY7B 1TNHA 2IJD1 2QN5T 1BA8B 4ISOA 1AI8H 1NZQH 4VGCC 4AGKA 1TX6A 2UWPA 3EA8A 1HAPH 4U01A 1A46H 3SU5A 2AFQB 2NU3E 3BSQA 4I8GA 1V6DA 4OS2A 1MKXH 1VZQH 4MLFB 1CHOG 3OEHD 1DVAH 1EUFA 1BTYA 1AQ7A 2C8YB 3HKJB 2J2UA 1V2MT 1AFQB 1GCDA 4MQAA 3RXSA 2TGTA 2VVVA 1WOFA 3OAAD 4K3JA 3ZZDA 1AHTH 2WUCA 2J4IA 4Q2KA 5C1XA 1TPSA 1DT2A 1C5RA 4ASHA 3T26A 3SJIA 1O2VA 1TLDA 5C0TA 2Q6FA 4F48B 2TBSA 4E7NA 4E06H 1TGCA 2VNTA 5DP9A 3ODFA 4ABFA 2PTNA 1AWFH 2FESH 1KY9A 1EOJA 3LT3A 1BRBE 1C5WB 1WQSA 4JZIA 2XC4A 1V2JT 1C2GA 3M3SA 2QXJA 4I8HA 2ZU2A 1C1SA 4B75A 2XNDD 1TBZH 3EGKH 2ASUB 1MTUA 5AF9H 2AHME 4WWYA 9LPRA 3U9AH 3TPIZ 3VB3A 3Q76A 3R0FA 1K0HA 2ZECA 4UFFH 3NZIA 4BAQB 2ZGCA 5FAHA 1SQOA 4BTUB 1P0SH 1ZJDA 1K2I1 3T28A 4TPYA 5FXLA 2XC0A 1T31A 1O2SA 5HGGA 3A7VA 3SN8A 3TH3H 2F9PA 3RXUA 1O5CB 4GLYA 1P06A 3LJOA 5LPRA 1HIAB 1SKYE 5GXPA 3W1EA 1FZZA 3WWBA 4GVUA 4VGCB 1NC6A 1ANDA 1S0QA 2F9VA 4J2YB 3A7WA 1OP0A 1W3CA 1HDTH 4NFFA 4KELA 3VGCB 5HIZA 1UTPA 2QF0A 1GVKB 5EXLA 1TONA 4ACBA 4IGDA 3FVFB 4X2WA 1ELTA 5ESTE 1O2UA 3D65E 2QC2A 4WVPE 1AZZA 4X6NA 5BRRE 2A32A 2PSYA 2C90B 3L33A 1TNGA 3SUDA 3AW1A 4SGBE 1J15A 1OKXA 2P95A 4A92A 1YPMH 1V2PT 4KKDA 2P16A 4JK6A 4HI3A 1O3PB 1UTJA 1BZXE 3NXPA 1C2IA 1OOKB 5J4SA 2EEKA 2CGAA 3GY4A 3F2HA 2Y82A 3QZQA 2YNBA 5EPNA 1C2EA 3PO1B 1V2WT 1DWDH 1W7GH 3T5FH 4FUBA 5EXNA 1O2OA 2FI5E 4FU7A 1GVZA 4B71A 1L1NA 8ESTE 1CGIE 2J97A 3KL6A 2FTMA 1P3CA 1WTHD 4XSKU 3V7TA 4DVAU 4B2BA 2G51A 5J4QA 3TGJE 1BIOA 1T4UH 3DT0H 4XDEA 4XOJA 1MTWA 5LGOA 3EDXB 2ZCKP 2Y7ZA 3GISB 1LVYA 2ZTYA 3GY7A 2FOMB 1SGQE 2RA0A 2ALPA 2JJ2D 4JYVH 5JBCS 2H2ZA 1V2RT 3SV6A 1KYNA 2A7JA 2O8MA 2EI8A 4IMQA 2BVXH 1ZZZA 2H5DA 3FKSD 1FIZA 1LPZB 1BBRE 3M61U 1SPJA 3AAVA 4MPXA 1WDIA 4DOQA 7KMEH 3P70B 1P05A 2KFWA 3GCOA 3OSYA 2VJ1A 1HXFH 3GY3A 1PPBH 3BTDE 2GZ8A 4BXWA 1QY6A 2XCFA 2ZKSA 2GT7A 3OTPA 2OLGA 1HIAA 2PHBA 4KTSA 2R3YA 4ZKSU 1KIGH 1GMHG 1C1UH 2BD5A 1GBEA 2KCAA 2Y5GA 2ZU1A 1GMHF 2WHXA 3E8LA 1TA6A 2RCEA 1QL8A 3F9EA 4JK5A 4GUXA 1FQ3A 1Z8JB 2EA3A 5JDUB 3Q77A 1QBOA 5LPFA 1Y3YA 2FOCA 3E6PH 4MPVA 2W3IA 3BTEE 3SNCA 1EB1H 2BLQA 1S85A 2KZ4A 1FI8A 1OWKA 1SOZA 2QXGA 3SO3A 4D7GA 1P2IA 3GCHB 3M36A 3BIUH 1O33A 1SBWA 2I6QA 3MU1A 1GMCG 4K1EA 1O3KA 2XCNA 2YMSC 5DG6A 1BTZA 1OWDA 2R0KA 2G55A 1GMCF 2IOTA 1K21H 5CMXH 1NBMD 3PROA 1O39A 4ABEA 1IQHA 2F9UA 4CBOA 1N1LA 3LGTA 4XRNA 1H9LB 2XBYA 1C5MD 2ZFPH 3M7UA 5I25A 1DLKB 1FY5A 1YPHC 4DW2U 1IOEA 2AEIH 2V3OH 3SUFA 3S7HB 2Z9LA 2ZDLA 2ZQ2A 5EQQA 1V3XA 2R2MB 4AG1A 1EATA 3TK9A 2BY8X 3PYHA 3ZV9A 1HUTH 4RSPA 1C2HA 1VCWA 3PV2A 3URCA 2A4GA 3PTBA 5TCAA 4FETA 2VBCA 1W14U 1ARBA 1ARCA 1O38A 1AB9B 5DKMA 6LPRA 3SGAE 2AGIX 2BD7A 3RMMH 1BTWA 1C5VA 2V0BA 3F0PA 5DO4H 1L1GA 1O30A 1TBRH 1VJ9U 2G81E 2NU1E 2ZDKA 3E90B 4IC5A 4AB8A 1K1JA 1KMHB 2OC8A 4AFUA 4R0IA 5KECA 1MAXA 2BD8A 2FS8A 2VIDA 4YXWD 1LO6A 5LPEA 4OS5A 1LVOA 1OX1A 1E34B 2BMGB 2HLDD 3RXEA 1GG6C 2IPQX 2VIOA 7ESTE 1Q31A 3KIDU 1NRSH 2D2DA 2H1UA 2F83A 3OY5U 1CT4E 1Z71A 5HM2A 1NESE 1NFUA 3EYDA 3P8GA 3ZVFA 1B0FA 2BHGA 1SGRE 4Q7YA 4WMFA 4I86A 1AN1E 3RXPA 4AFQA 5ETXA 4ZUHA 1S6LA 3LGIA 1MD7A 1MBMA 2FTLE 4H4FA 3ZV8A 1KXAA 1SLUB 1P2OA 1C1VH 1P11E 3U28C 3RP2A 3DCLA 4BANB 3K9XB 3MU8A 3PLBA 1A3BH 2WPIS 1XX9A 1BB0B 3MO9A 1GWAA 2A5AA 3D62A 1OXGA 1P8VC 3V3MA 5T6DA 1AMHA 1UTNA 4CRGA 1Q3XA 2G4UA 2FOGA 2OC0A 1YC0A 4Z0KA 1V2VT 4K8BA 2GT8A 4RT0A 3SV8A 1W0ZU 4FUIA 1O3OA 3MWIU 4NA7A 3LGUA 1MU6B 1Q2WA 5JBAS 1GJ5H 1ZLRA 2P3TB 1O5DH 1NFYA 1OSSA 2QXHA 4Q63A 2BY5X 1O35A 2UUKB 1XUKA 4I31A 4K1TA 5EODA 2H5CA 1V2NT 2ZG0H 1GJBB 2JDID 2VVCA 5AHGH 1YPLH 1XM1A 2FM2A 1BITA 1E0FD 1GGDB 3F3BA 3N7OA 2FX4A 3SJ9A 4CH2B 2BDGA 2NU2E 3A87A 4X8SH 5H4IB 1ELGA 3A80A 1IHSH 5DP6A 4X6PA 1J17T 2J95A 2ULLA 3FOAA 1UVTH 1DFPA 2W5EA 3S69A 1TYNA 4IN2A 1SLWB 3F6UH 4FXGH 4X2VA 1PPFE 2M2AA 1H1BA 3ZZ4A 2P3FH 1SQAA 3UOUA 1J14A 1YWUA 4Y0ZE 1S83A 1LHFH 3ZYEA 1UCYH 3BEIB 5KEDA 1SHHB 2ZHQH 3JZ1B 1LPKB 1A0JA 1UMAH 1QIXB 4YOGA 1D4PB 1BT7A 5FBIA 4E05H 3PLPA 1P09A 1C1PA 4IN1A 3RXKA 2C8WB 1NROH 5A0BA 1G3BA 4HZHA 1IQMA 2G52A 1IQIA 7GCHG 1A7SA 2H9TH 3M3TA 4TWWA 3VB4A 1H9HE 1C2MA
chains in the Genus database with same CATH topology
1E35B 1LPGB 2SGPE 1O5AB 8GCHG 4UONA 3F9HA 3B23B 3D49H 3ZVCA 1QTFA 3BN9A 1AUJA 8GCHF 2HVXA 3TNTA 3GY2A 1NU7B 1TFXA 1YF4A 4XFQA 1EX3A 1EPTC 1O3LA 4DGJA 1Y3WA 1D3QB 1FAXA 1RIWC 4MVNA 1GI9B 3E0NB 5EXMA 2ZPRA 1WCZA 3M37A 3SW2B 4LZ1H 1F0SA 3QTVH 2PKAB 1MU8B 1SGTA 3TK5A 2PUXB 4CHAC 4RN6A 3HGPA 1F2SE 4LZ4B 1TRNA 5L2YH 1O5BB 1J16A 3SI4H 1A0LA 5EPYA 4AFZA 4NIWA 5JBTA 1PFXC 1HJ8A 1VCPA 1GBHA 2NWNA 1K1MA 4BOHA 1NRPH 3DA9B 2GP9B 1SFQB 4U32A 1P2QA 1GI4A 1TPAE 2ANKH 1DDJA 1AFQC 2YNAA 1C4V2 2A4QA 1TNKA 2FPZA 3HK3B 4A5TS 2GV7A 1XXDA 1Z7KA 2BLWA 4OGXA 1KSNA 3MU5A 1QFKH 3BG4C 2ZC9H 2BVRH 3UR9A 2FYQA 3F9GA 2VIPA 3URDA 1EASA 2ANMH 3RLYH 1W0YH 1KLJH 3A81A 1QL7A 3KQDA 3MH5A 3NCLA 1JXPA 4IW4E 2A7CA 4INKA 1HFDA 5EQSA 1C9PA 3RXIA 2QA9E 3GY5A 2BDAA 2FZZA 4ZXXH 1QBNA 2TGPZ 2F9NA 1C4U2 3TJUA 1UTQA 1RFNA 2PR3A 4B2AA 5HYOA 2ODYB 1SOTA 2FX6A 2OCVB 2Y6TA 3A84A 3ZVBA 1WTGH 3SV2H 1ZMJA 1SB1H 3QK1A 3UNSA 1EZUC 4AORA 3E91A 5FHTA 1CT0E 4MNXA 1LHGH 4IC6A 4YOJA 4GPGA 4O03A 3CS7A 4ABIA 4WMDA 1ZHRA 3A7ZA 3UNQA 1DXWA 1GHVH 2BLVA 1FY3A 3S7KB 5C2ZA 4BAMB 1AKSB 1T7CA 1EOLA 4AX9H 1ZGVA 1LMWB 4HGCA 1AZ8A 5EW2H 4CH8B 3W94A 2WPHS 1XUFA 1DE7H 5GJ4B 2B8OH 2KAIB 4X2XA 1FIWA 1YKTA 1EP5A 2ZEBA 4K8YA 3QGJA 1O2PA 2EI7A 5K0HA 1O2YA 4TY6A 3QWCH 5I46H 3VGCC 2PKAA 1H9IE 1YPGH 1A5GH 2XWAA 4YOIA 4NA9H 1L4ZA 2G8TA 3ZZ9A 3ZZBA 1HV7A 1NRNH 2CN0H 4RKJB 1MTNC 5DP7A 1ELDE 2RA3A 1O34A 5EGMA 2ZDVH 1CT2E 1TQ7B 4THNH 3BG4B 2RG3A 1L0ZA 2Y81A 2ODQA 1KLIH 3SJ8A 3P95A 3A86A 3BTFE 1O36A 2H9EH 2J92A 2OXSA 3PMBB 2AS9A 1F0RA 2SGQE 4Y7AA 4K69A 5E0HA 3BTQE 1UVPA 4TYDA 1AVWA 1O5GH 1PQ5A 2BXTH 4FUJA 3OU0A 1GMDG 1TGSZ 3KGPA 3DFLA 1FONA 2BDHA 1C1TA 1GMDF 1GL0E 2O8WA 3PO1C 4GAWA 2FI3E 1SL3A 3BTWE 4JZEH 2XRCA 4GHQA 1QNJA 1G3CA 1HAZB 1K1NA 1AGJA 1Z6JH 4LK4A 3H7TA 4X2YA 1GI2A 1TX7A 3GDVA 1TWXB 1N6XA 4NZLA 3K2UA 3MNBA 3VB6A 2EI6A 1XKBC 3HATH 2XXLA 3K6YA 1ZTJA 3EQ0H 3MO6A 2ALVA 2BDYA 5A0CA 3ITIA 5DPAA 4U2WA 2LPRA 2BQ6B 2A4OA 2P3UB 1O5FH 1A5IA 1KXBA 4FUHA 1HXEH 2GCHG 3V12A 1NRQH 1MKXK 3BTHE 4X1SU 1OWIA 1EKBB 1XVOA 2GCHF 4WY3A 2ZI2H 3TK6A 1V2KT 3F68H 3GY6A 4B74A 1KXEA 1VCQA 2FXRA 2HNTC 3RXTA 1TB6H 1EPTA 2H9HA 1T8OA 1KTTB 4SGAE 3ESTA 3U8OH 1EP6A 4YTAA 1A3EH 1EJAA 5CE1A 2QF3A 1ELFA 1D3DB 2WYJA 2SNVA 2STAE 1O37A 1O0DH 1CHGA 1F0UA 3A89A 2VGCB 1KLTA 2FMJA 4FU8A 4I8KA 1TNLA 4ZROA 4U30A 1EB2A 1O2GH 3LH3A 1O3BA 1DUAA 4Y8YA 3MTYA 2EC9H 4M7GA 1MTNB 2O8TA 2KAIA 1RD3B 5TCCA 2A4RA 1EZXC 1ESTA 2BD9A 4JZFH 3ZYDA 3TVJB 2ZCHP 2BY6X 4ZXYH 3LU9B 2M5TA 1W10U 3P8NA 1OWHA 2AMQA 1TRMA 3ZZCA 2VU8E 4CBNA 5C5NA 1D3PB 1TOMH 1K22H 1DUEA 2J34A 4I32A 3GCHC 3TIUA 2VWNA 1QJ1B 5EU8A 4NSYA 3GYMA 3MU4A 3LPRA 2DUCA 2SGDE 2VWOA 2FLBH 3E16B 4CR5A 2Y5HA 3GCNA 1FXYA 3PWBA 4TY7A 1O5EH 2BOKA 2WV4A 1W11U 4XBBA 3RU4D 1G30B 1SVPA 1J9CH 1K28D 1TX8A 3LONA 1G37A 1T32A 1OP8A 1GHWH 3IWMA 2AMPA 3BIVH 2HALA 3SU3A 2BM2A 2Z9GA 5B6OA 1QR3E 1NN6A 1P2KA 1OYQA 3K6ZA 4CRAA 1SC8U 2UUJB 1P2JA 3SNAA 2AIPA 2Z9KA 3DD2H 1OYTH 1BHXB 3F1SB 4ABJA 2G5NA 1QBVH 1JOUB 1DS2E 5DK1A 1UK3A 1YPJH 3H7OA 3EA9A 1THPB 2VH0A 1ZR0A 2ZU3A 1Z8IB 1AB9C 5EG4A 2OBQA 3HKIB 1T8NA 1G32B 1QB1A 1UTMA 4WXIA 1QGFA 3VB7A 1O2WA 3BEUA 4AFSA 3FZZA 4WJG2 1IQJA 3RXBA 3RC5A 2C8XB 3LC3A 4ABHA 1YLDA 4AG2A 3SUEA 1NTPA 4Y6DA 5DP4A 3ZZ6A 1B5GH 1BMMH 3MFJA 3U98H 1CQQA 5T6FA 3LIWA 4NSVA 4NWKA 2R2WU 2A2XH 1C5QA 2Q6GA 3I77A 1S5SA 3UQOA 4XE4A 2R3UA 3ZVGA 2Y80A 2W7UA 2PLXA 3GY8A 5C67A 2ZDAH 3L6PA 3ATMA 2PKSB 1DX5M 1HPGA 4YT7H 5F8XA 1HLTH 2A5IA 1ZSLA 3UR6A 2WPJS 5T6GA 1QL9A 3U69H 4A7IB 1IQNA 1QB9A 3PWCA 1NY22 1E38B 1XXFA 4ISLA 2GTBA 3TGKE 1MCVA 1TGTA 3SNDA 1QQUA 3D23A 1O2NA 5HM9A 1ANBA 5LH8A 4UE7H 4ZKNU 1SQTA 3TLOA 1GDQA 1XKAC 5CHAC 4DURA 1GBBA 1U6QA 1ZPBA 1BMLA 1SI5H 1GHBG 1Z6EA 2GD4B 5FCKA 2WINI 3ZZAA 4QT8C 1GHBF 3F9FA 2BDIA 2FS9A 3UREA 3NKKA 1N8OB 1S82A 4X6MA 2NU0E 2VINA 4FVBA 3A82A 3UY9A 1MD8A 1UK2A 2AH4X 3QLPH 1P12E 1GGDC 2HPPH 1O2MA 4DCDA 4FUEA 5GCHF 8KME2 1G2MA 4ZH8A 1QA0A 4YESB 1VITG 1EAXA 4AYVB 2OC7A 1OWEA 1AVXA 1SGYE 1ZJKA 1FPHH 1VITF 2QV1A 4UFDH 1IQEA 5EW1H 1GBLA 4YLQH 4DG4A 1FAKH 3JZ2B 1PJPA 3TU7H 1GBJA 2CF9H 4ZAEA 1K1LA 1PYTC 3OY6U 2WPMS 2PSXA 2FDAA 1OPHB 1FN6A 3M5LA 3RMOH 5G4BA 1F7ZA 1W13U 2UWLA 2SNWA 1ANEA 1QRXA 1HB0B 1ZTKA 3DFJA 2FODA 2XBXA 3OX7U 2BZAA 1BTXA 1THSH 4NFEA 3RXGA 1UVOA 2FEQH 1GL1A 2CJIA 5TJXA 4WH6A 4YO9A 1Y5AT 7LPRA 5DP8A 3A88A 1AWHB 3ATWA 3RXFA 2OUAA 4CRBA 3UTUH 1EJNA 2BQ7B 2F91A 4NGAH 2Y5FA 2TGAA 4ZKRU 1F92A 1L1JA 2RDLA 1NFWA 1C2DA 3S9BA 1LHCH 3BV9B 4KTCA 2BLOA 4BTIB 5CHAB 1WAYB 2F9BH 2FIRH 2QXIA 3KCGH 2UUFB 4Y11E 1GHAG 3ATIA 1MZAA 2BXUH 1ZPZA 2ODPA 1GHAF 4Z6AH 5DP5A 1O3EA 2A5KA 1AE5A 3RLWH 2WYGA 1MMJN 1FDPA 3T62A 1VJAU 2GKVE 1O3DA 1SGFA 1EZQA 3MOCA 2SGAA 4MTBA 3UWJH 1O2KA 3MO3A 1TNJA 3BTME 3UOPA 5HMAA 1O3CA 2BD2A 1Y3UA 5F6MA 3C1KA 3BEFB 2PFEA 4D76A 1RTLA 1IQLA 1AY6H 3CENA 2OTVA 1O2IA 2THFB 3GOVB 1C2KA 1CE5A 1GI6A 1TE0A 3VFEA 2ZU5A 2VH6A 3H5CB 1DICA 1Y59T 4X8UH 1AO5A 1O2JA 4NIVA 1HAHH 1IQFA 1TABE 4A1XA 2BZ6H 5A8XA 2J38A 5GPIB 1ETSH 1KXDA 2ZO3H 2W26A 4I33A 1CBWC 1DXPA 2ANWA 1OWJA 1TALA 3T25A 1G2LA 4WH8A 1YCPH 2BD4A 2ZIQH 1QJ7B 1C5XB 1EXFA 3VPKA 1ZSJA 4ZHAA 1RS0A 1A61H 1BRAA 1C5SA 1ZRBA 2O9QA 1GI5A 1LHEH 4FUGA 5FPSA 1QRWA 1DPOA 3TGIE 1D9IA 3HPTB 3QGNB 3MH4A 2QCYA 1TAWA 1OP2A 1O2HA 1GJDB 1EZSC 3PTNA 1SGCA 3RM0H 3G01A 1XUHA 4ABGA 1F0TA 4X1PU 1C2LA 3U1JB 1DWBH 2W3KA 1T4VH 3STJA 3P8OA 1MQ6A 1QQ4A 3S9AA 2Z3CA 3T27A 1GBAA 1BCUH 1V2LT 1SG8B 4H6SB 2OINA 1S81A 3MH6A 4JZ1A 3QTOH 2DE8A 6CHAC 4ISHH 1MUEB 1GJ9B 4GSOA 4ZKOU 5F8TA 2ANYA 3RC4A 1UCYK 4ABAA 1K1PA 1B7XB 1MZDA 2CV3A 4HFPB 1K9OE 2J9NA 4CRFA 1L2EA 4K5ZA 4MNYA 1YLCA 5DJ7A 3A8AA 5BPEA 1P01A 3PMHB 3KQEA 4YZUA 3SU1A 4AYYB 4I8JA 2BDBA 3TJVA 1Z1IA 1ESBA 1Y8TA 3E1XB 2ZF0H 2ZPSA 1BRUP 1C5PA 4Y71A 1CBWB 1SGIB 1O2XA 1CU1A 2FP7B 3KN2A 3BTGE 1C5OH 1CA0B 1O2TA 1PQ7A 2OQUA 2PUQH 1YCPM 1GCTB 2VVUA 3SORA 2XBWA 2ZU4A 3TJNA 3FP8E 2A2QH 1VR1H 1TGBA 3P6ZB 1SGDE 2FOFA 4WMEA 4X1QU 1YP9A 3SUGA 2WV5A 4YM9A 1BJVA 4X1NU 1S6FA 1ELEE 2ESTE 4UFGH 5JYIA 3QDZB 2CF8H 1SSXA 5C3NA 1DM4B 4K1SA 1XVMA 1C4Y2 2GGVB 1RGQA 2FOHA 2ZFQH 2VIQA 4CRCA 5C5OA 3LGVA 4OS6A 5A2MH 1LVBA 1QURH 4HTCH 2JKHA 3ZZ3A 4Y79A 2IN2A 2CHAB 1GBTA 1JRSA 2I6SA 1SFIA 1BRCE 1G3EA 1H8DH 1P3EA 3PM3A 3TJOA 1ESAA 3RXRA 5T3HA 1L4DA 2ZGBH 4WXVA 3RMLH 6CHAB 2NU4E 3RXAA 1C2JA 5FCRA 1V2UT 2HGTH 4Q80A 1W12U 2P8OC 3MNCA 2CXVA 1GJ4H 1A0HB 1AE8H 1CGHA 3LDXH 2Z9JA 2GX4A 5C1YA 3ZZ7A 1ID5H 3GCTG 1F5LA 1FMGA 3UWIA 2VGCC 3E0PB 3A83A 3GCTF 2ZFTA 1WV7H 5JB8S 3RXQA 4Y76A 1MQ5A 3SOSA 2PGQB 1EAIA 4DJZB 4MPUA 4XBDA 2HWLB 1O3AA 4X0WU 1TA2A 3RC6A 3WY8A 3FP7E 3RU4E 1GBIA 1DY8A 4ABBA 2C8ZB 1C5TA 2PWXA 4D7FA 3R3GB 4I7YH 1GBDA 3A7YA 1RRKA 1CO7E 3E3TA 4X1RU 3T29A 3SU6A 3HK6B 1A5HA 1C9TA 3PMAB 1CHOF 3IG6B 2AIQA 1O3HA 1UO6A 1HAIH 2XWBI 3GDSA 1TOCB 1QCPA 1FNIA 1H4WA 2ZTZA 2B7DH 1NT1A 1TMBH 3SU4A 1Z8GA 1P03A 1UVSH 2QY0B 1GBCA 4YLUA 1ELVA 4Q7XA 2BB4A 1GJ7B 1Y3XA 4UDWH 1E37B 1HJAC 4IMZA 1K1OA 5FPYA 1GHYH 4TWYA 1C5NH 4O97A 2QIQA 2IJOB 1S6HA 2FWWA 1NPMA 1AUTC 4NA8A 3ZZ5A 3M35A 2W7SA 1JIRA 1ABIH 1GBKA 1O32A 3Q3XA 1CGJE 1HYLA 1QB6A 1HAXB 1Y5BT 3GYLB 1O3JA 1T8MA 2GMTB 2VB0A 5A8YA 1GI7B 2P8OB 1DSTA 1G3DA 1YM0A 2SGFE 1OS8A 1KDQB 1O3MA 3K65B 1DY9A 1PPHE 2UWOA 5E2OA 2BOHB 1VGCC 2BD3A 2BX3A 3ATKA 1AKSA 3O8DA 1BTUA 1FY8E 3A8BA 4UD9H 3LKWA 2GZ7A 5IYTA 4MG3A 2ZHWH 1NRRH 3A8CA 1T8LA 2SFAA 3A8DA 3ZVAA 1DWEH 1CVWH 1UHBB 3UIRA 3P17H 5FBEA 1XUIA 4X8VH 1UVUH 1TQ0B 2HOBA 4D9QA 1YPHE 3W95A 3M3VA 5GIBA 2OBOA 1P9UA 1GI1A 4RKOB 1A1RA 2STBE 2D1JA 3SJKA 5HXFA 1Y3VA 1BJUA 4MNWA 4BXSA 3PV4A 2XNIA 3HGNA 4MPWA 2FI4E 3V0XA 2PKSC 1NS3A 3O8CA 1C5YB 5PTPA 1BBRH 2BY7X 3NK8A 3ZZ8A 1HCGA 3RXOA 1YGCH 3SBKA 2V3HH 2O8LA 2ZHDA 1NO9H 1G9IE 5FX5A 1GJ8B 4A1TA 3SNBA 1HJAB 1N6YA 5AFZH 1LKBA 1SGNE 1NFXA 1QHRB 1PQ8A 4Y10E 2GZ9A 3MMGA 1HAVB 2P93A 1QA7A 3BF6H 4BNRA 1GBMA 3RUOA 5GWZA 4YT6H 1M9UA 3MHWU 1IQKA 3ELAH 2FOBA 1ELCA 2F9OA <