1INCA

Crystal structures of the complex of porcine pancreatic elastase with two valine-derived benzoxazinone inhibitors
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine proteinase)
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Crystal structures of the complex of porcine pancreatic elastase with two valine-derived benzoxazinone inhibitors.
pubmed doi rcsb
source organism Sus scrofa domestica
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1incA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1incA01
5T6DA 3FANA 1TLDA 1O36A 1GMDF 3DA9B 3ZYDA 1O37A 3LT3A 1BBRK 1NRSH 2WPKS 1WQSA 1A1RA 3KQCA 3ZZ7A 5JBCS 2WV5A 3HGNA 4NSVA 1GI2A 3KL6A 1Z1JA 3PTNA 4CHAB 3TH2H 1IQIA 2C8XB 1ZHRA 2GVFA 2A45B 1IQMA 5FPTA 1QB9A 3TH3H 4AFSA 1HAOH 3UIRA 1G3EA 1SBWA 4K1EA 3SI4H 3QZQA 4IN2A 3I29A 1OXGA 3LGWA 1Y3XA 1SHHB 1SMFE 1SPJA 5EPYA 1BZXE 2QY0B 4ABJA 2ANYA 3GY3A 2FOBA 4ZHMU 1GMHF 1A3EH 1THRH 3GYLB 1ESTA 1CU1A 2J94A 1E37B 4HFPB 3KNXA 5DPAA 4X1SU 1AFEH 4ZHAA 3RXLA 3SGBE 1BTUA 1UK2A 1MCVA 1ZOMA 3BTFE 4VGCC 4FU7A 4DGJA 1MMJN 3Q77A 1FDPA 2BDAA 1JIRA 2HNTC 1EJMA 1EZXC 1YM0A 3QDZB 3TGKE 4AB9A 1RRKA 5EODA 5A8ZA 2SGEE 3K65B 1H1BA 1ZJKA 2XBXA 1ETSH 3ZVDA 1C1SA 2ULLA 2A5AA 8GCHF 1BBRH 2ALPA 4UFDH 3U98H 1W3CA 1QJ7B 4HTCH 5EOKA 2A5IA 1A5GH 3UFAA 4OS2A 1VJAU 5L2ZH 1HLTH 1O5AB 2VH6A 4UD9H 1AO5A 3LU9B 3BIUH 4O97A 3SN8A 2O8LA 1YPJH 2KAIB 1S84A 1HBTH 3ATWA 2P8OC 1QRZA 4GSOA 2UUKB 3K6YA 2BD2A 1H4WA 3SU4A 5FHTA 4CH2B 2XC0A 4I8HA 1P02A 1NRRH 1AD8H 1YCPK 2J4IA 4NCYA 1C4U2 2VJ1A 5IDKA 2IOTA 1ELFA 3AAVA 1LPKB 1P8VC 4Z0KA 6ESTA 2A7JA 1F92A 2HOBA 2ZFRH 4A92A 4MG3A 1YPMH 3HK6B 6CHAC 3S0NA 1XMNB 2V3HH 2TPIZ 3QLPH 2FI3E 1J17T 3BEFB 1HIAA 4X6NA 1NY22 1NU9A 1O3CA 2ASUB 1GJ9B 1TMUH 4YOGA 3RXDA 3K2UA 2SGFE 2A5KA 2GKVE 1ELGA 2BDHA 5DO4H 1P2OA 2BLVA 2SNWA 1GHZA 2IJOB 5FX5A 2Q1JA 5LPEA 1TRMA 5FPSA 5JB8S 1BTZA 1UVUH 1GI6A 1K21H 3RC6A 5E0JA 3S7HB 3RXPA 4MNWA 3T62A 3TK9A 3A7VA 4Y8YA 1TAWA 1QJ6B 3D62A 2BX4A 1O3NA 1GHXH 2FDAA 4NA7A 2ZHQH 4Z6AH 1T4VH 4ISOA 1EB2A 1PQ7A 5C1XA 3LJOA 2ZDMA 5DP9A 3UWJH 1YCPH 2UUFB 1GI8B 1YP9A 1BA8B 2OD3B 3HK3B 1K9OE 2XTTB 1OWJA 1JWTA 1MAYA 1P2JA 1DXWA 2BX3A 5LPRA 4JK6A 4A6LA 1A0JA 2BXUH 2SGQE 3SU3A 1UVSH 1K1MA 1L4DA 1GHBF 2RCEA 1ZHPA 4BAMB 1D3QB 2P95A 3SU1A 4ISHH 3O8BA 4ABDA 1FY8E 1GJBB 3PYHA 1FPHH 1TGCA 1KXDA 2A0QB 2ZFSA 1UTQA 1ELAA 1IQKA 1MD7A 4J2YB 4Y79A 1TGBA 4X0WU 4KTCA 5DP5A 3RXFA 1GBFA 3ZZBA 4WJG2 1FQ3A 5GCHG 3SJ8A 2BY6X 2BD9A 3EA8A 3P70B 3QO6A 2R2WU 3KCGH 4KKDA 4IMZA 1NFUA 1RIWC 1F0UA 3PWCA 1MQ6A 3GCHC 3M61U 1A4WH 1TPOA 1O3HA 1N1LA 3H5CB 1V2JT 3U8OH 2ZKSA 1DVAH 4CRAA 3L3TA 5A0CA 4YM9A 4Y76A 2R0LA 5ETXA 1CT4E 2R3UA 1DUEA 4YOIA 3NKKA 1SVPA 1GJ8B 1K2I1 4D9RA 3PLPA 4BTIB 4U01A 4A1TA 3QN7A 3PLKA 4ZUHA 4NFEA 3KGPA 2PHBA 3TK6A 2B5TB 2ZU1A 4XFQA 2LPRA 2VIDA 5C3NA 2QV1A 2CHAB 3A88A 2PWXA 3TLOA 3AVZA 4GPGA 2CGAA 5F6MA 2FOAA 3KF2A 2XW9A 5AHGH 1JBUH 2VVUA 2UWLA 1O3EA 5ABWA 3RP2A 2UUJB 1AHTH 1TOMH 4MPUA 1UTLM 1K22H 2Y7ZA 2GCHF 1P9UA 4GHQA 1NN6A 2ZGBH 1P2IA 1W8BH 1CT0E 4WVPE 1FY4A 1DE7H 1GBBA 1O2YA 2P3FH 4AGKA 4BANB 1YF4A 3K9XB 3BF6H 4UFEH 1ZRKA 3RXMA 1Z6EA 2XC4A 2ZQ2A 4DVAU 3LH3A 5JYIA 5A09A 1O3LA 1C1TA 4IGDA 5F03A 5AFZH 2JH5D 2ESTE 1C2FA 4K8YA 3SJOA 3GY8A 4YOJA 1W12U 3ZVCA 3MU8A 2A4RA 3ZZ9A 7KMEH 3TJVA 1NRPH 3TK5A 2BYAX 2XXLA 2ODYB 3Q3KA 3QUMP 3E91A 5TJXA 2G52A 3P8OA 4X6PA 4X2XA 1QQ4A 3ZYEA 1W13U 2ZI2H 2VVCA 4X2VA 2FOHA 2WUBA 1EJAA 1ZPCA 3RXIA 1O2HA 1O2NA 1DANH 3OYPA 4Y0ZE 1LQDB 4IBLH 1K28D 1OP8A 2WINI 1KY9A 3GISB 1EP5A 1VITF 3UQOA 1BDAA 1C5TA 2FPZA 1XUHA 1LVYA 1GJ4H 1RTKA 1PPZA 2BDGA 1GJAB 3EYDA 2R3YA 1ZRBA 4THNH 3E16B 5LPFA 4B73A 1O2GH 4CR5A 1C1NA 4M7GA 3SNAA 3RM0H 1GL1A 2ZDNA 1ACBE 1ZTKA 3URDA 1P2NA 4ISLA 2P93A 4JCNA 1TA2A 3SQEE 3MYWA 2AH4X 3M3SA 2J95A 1MTWA 3TIUA 1GBMA 1FN8A 3B9FH 1QHRB 1BTHH 1JRSA 3EDXB 1Z6JH 1ZYOA 2Q6DA 1BT7A 3VB6A 3MH4A 4ZKOU 3A8DA 1Y5UT 2Y5FA 1XVMA 1GBKA 3UY9A 5EW2H 3L33A 4ABBA 4DCDA 2JH0D 2ZIQH 3RXAA 2RA3A 1QRXA 1TMTH 1A46H 1O2WA 2P59A 2ZGJA 3F68H 3I78A 1DWDH 1CHOG 3BTTE 2WPHS 1LPGB 4Q7YA 2ZCKP 1RXPA 4TY6A 1DSUA 4CRGA 5L2YH 1QQUA 3A8AA 1AVGH 1EQ9A 4DURA 2FX6A 4X8TH 1S81A 2CHAC 1W7GH 2TIOA 3BTHE 3FAOA 3KQBA 3I77A 3KHVA 4ESTE 1MKXK 1TNJA 3MFJA 2A31A 1NTPA 2CJIA 2LNCA 3M35A 1ZHMA 4ISIH 2O8TA 5GXPA 1UVTH 1W7XH 2P3UB 2CF9H 1MTNB 3STIA 1Y3YA 4ZROA 1AIXH 3N7OA 3RXJA 3SJ9A 1V2KT 2PW8H 1TONA 4WMFA 1SGDE 1FIWA 1O3MA 2FTMA 4A1XA 2EI6A 2O8UA 3LC5A 2ZFTA 5T3HA 1GJ7B 5EXMA 2A1DB 1AZ8A 1O2QA 2ODPA 2BLOA 2NWNA 3BEUA 1LMWB 1XVOA 2BDCA 1OPHB 5T6FA 4XE4A 1C4V2 2FODA 1BB0B 2J92A 2VWLA 4FUDA 4JZFH 4E7NA 3C27B 2TGPZ 1DT2A 2V0BA 1S6FA 4B1TA 4I31A 1EP6A 3ENSB 2FOFA 2FZZA 1XKAC 1LVMA 1B5GH 2VVVA 4Y7BA 1KDQB 4AFUA 4DJZB 4ZKNU 1KSNA 2SGAA 3KN2A 1QR3E 4X1NU 1XM1A 4A7IB 2HWLB 2PGQB 1L1JA 1MKXH 1BMNH 1S0QA 4Y6DA 4YLUA 2VIPA 5DGJA 4BXWA 1K1JA 3FP8E 2G51A 1C1WH 3SOSA 1TGSZ 2J2UA 3A7TA 1ETTH 4NIWA 1D3DB 1BTXA 3SU0A 3MU0A 2GD4B 3ITIA 2P8OB 1GJ6A 4DIIH 4MPWA 3M7TA 1O30A 3CP7A 2OC8A 1NFWA 1HDTH 2CXVA 5E8EH 3SJKA 4Q7ZA 6GCHF 2PKAA 4YT6H 1DXPA 1HXEH 1J8AA 2QF0A 2G55A 3U8TH 3ELAH 2TGAA 2GP9B 6CHAB 1L1GA 1XUIA 4HGCA 3ZZ5A 4AORA 4B76A 2AMPA 1GDNA 2YNAA 4ABEA 3A7XA 3D23A 1UCYH 2I6QA 1GDQA 2AERH 3O8RA 3E0PB 2XCNA 1INCA 1O2TA 1LHCH 2B7DH 2IN2A 3S9BA 1A3BH 4U32A 2F9NA 2H9TH 3S69A 4MNYA 1EB1H 4GCHG 1V3XA 1J15A 2QN5T 3JZ1B 4ABFA 3GYMA 4X1PU 3AW1A 4IW4E 1CGHA 2OXSA 1S83A 3PO1B 2IPHA 1YGCH 4DW2U 4XBBA 3TJOA 2GMTB 3MO6A 3R3GB 4F49A 4LZ1H 4AZ2B 3MNCA 4CR9A 4IC5A 1QY6A 4WMDA 3MH5A 1UHBA 2Z7FE 4INKA 3RXCA 2BLWA 1TX6A 2A4GA 3SI3H 2FIRH 1P05A 3T26A 1GHVH 2GZ7A 1GVKB 3PM3A 3F6UH 4DY7B 2W7UA 2HNTF 3ESTA 1ELBA 1TGTA 1BMLA 1G3DA 5B6OA 1HAVB 2OUAA 1GBAA 2A2XH 3EQ0H 2I6SA 1O32A 1G30B 2XYAA 2FP7B 1VR1H 4ABHA 1C5ZB 2H1UA 1HJ8A 3LPRA 4ZKSU 8KME2 2NU1E 1MTNC 4D8NA 4R0IA 1RGQA 2VNTA 1AQ7A 1DOJA 2GZ8A 1EJNA 1GJ5H 4AG2A 3UPEA 3QGJA 1NZQH 1F0RA 2GDEH 3ZZ4A 1FY1A 1GI0A 4GVUA 1OSSA 2AS9A 3DT0H 2VH0A 1GCTC 1PJPA 1Q3XA 1S6HA 2FI4E 1SGTA 1RIWB 3ZZ8A 3GCHB 2ZTYA 4UE7H 1AVXA 2AMQA 3SV9A 1HAPH 1C5UA 4MPXA 4CRBA 3H7TA 1SGFA 2PUXB 4Q7XA 3MO3A 1GI5A 2A4QA 2BD8A 4OS4A 2J34A 1HV7A 3BEIB 2PGBB 1YLCA 1UTNA 3A83A 3RU4E 4ABAA 3E8LA 1WCZA 4NZLA 3VXFH 1O35A 1Y3VA 1LHEH 2UWPA 1ARCA 1V2WT 3E1XB 3MNBA 1D3TB 1QJ1B 3GCNA 2FEQH 1SQOA 2RA0A 1JMOH 3RM2H 4NWLA 2ZF0H 1SGFG 1TNKA 1VCWA 1TE0A 1DFPA 1GBLA 1TX7A 3OY6U 3CS0A 3DUXH 2BXTH 3RMLH 1FLEE 1FXYA 1AKSB 3V3MA 3U1IB 4A1VA 1LCYA 4MQAA 1GDUA 1ZMLA 1QIXB 2SFAA 3M5LA 1VITH 2H9HA 2Y80A 2OQ5A 5AVDA 2EC9H 1ZGIA 1THPB 3UWIA 7GCHF 1MTUA 2GGVB 2ZTZA 1ABIH 3NUMA 1LTOA 5AF9H 4TWWA 1O2OA 4WXVA 2H9EH 2FWWA 4O3TA 4B2AA 1IAUA 2QGRA 1WV7H 4CRDA 2DUCA 4WY3A 4ZH8A 5DP6A 1YKTA 1SG8B 3PO1C 3SNEA 1WBGB 1C5RA 2W3KA 1HRTH 3P8FA 1FY3A 1Z8RA 1QB6A 2GMTC 1O33A 1PQ8A 1YC0A 2D1JA 1C5WB 4BNRA 1V2PT 2GCTC 1C4Y2 4O3UA 4X2WA 2C8WB 3UNQA 4U30A 1GVLA 3NK8A 5GWZA 1TNHA 4I8JA 5FBIA 2A2QH 3PWBA 1PFXC 1V6DA 5A0AE 1C2IA 1ZLRA 2WUCA 3A85A 1NESE 2HLCA 3BTKE 3DD2H 1WU1A 4ZAEA 2CN0H 1YPHE 2B0FA 5F8ZA 1T8NA 3A84A 2W3IA 3M5NA 1SL3A 3F9GA 3E90B 1F0TA 1SQAA 5JBAS 2OCVB 1LHDH 2QXGA 3F1SB 1GHAG 3LH1A 5DG6A 4ASHA 4CBOA 3GY4A 2ZWLH 2Z6BD 4R8TB 1VCQA 5LH8A 3BN9A 5EXLA 2FESH 3B8JA 1O3DA 3HKJB 3G01A 1P06A 3P8NA 4NG9H 1MAXA 4AFQA 5C1UA 1BQYA 1D9IA 2FMJA 5PTPA 1TMBH 3FFGA 3Q3YA 5C20A 1ZMNA 1C5VA 4E7RG 1GCDA 1O5BB 4A5TS 2G8TA 1SGEE 2ANWA 3AW0A 1ANDA 2AGIX 2PLXA 3SNDA 1KTSB 1TBZH 9LPRA 1EPTB 2DE8A 3M36A 4YESB 4BTUB 4NGAH 1O5EH 1Z8GA 2BTCE 1KLIH 1JOUB 1AMHA 1G3CA 1HYLA 1QNJA 3GCTF 4Y10E 4JYUH 1TOCB 1YPKH 1NO9H 4Y0YE 5K7RA 1O2XA 4D9QA 1G37A 1YLDA 4D76A 2HVXA 3RXQA 2OC0A 3RXGA 4WXIA 2UUYA 1FUJA 1P03A 4MTBA 5JBBS 2G00A 1W0YH 2RDLA 4FXGH 3RXRA 2FOCA 2FOMB 1KXEA 1D4PB 2B9LA 1HAIH 5ESBA 1O2UA 4X6MA 3KQEA 2WYJA 3T25A 4BTTB 1BJVA 3LGUA 1K1IA 1V2MT 1GMDG 1CA8B 1EZQA 1SGNE 1MU6B 2ZC9H 1GWAA 1C5OH 1EZSC 1BITA 4IS5A 1FPCH 4AFZA 2OC7A 4NIXA 2D8WA 4H6SB 4K1SA 4F4OC 1O3GA 5EQRA 1KTTB 1LHGH 1KLJH 1WYKA 2WPIS 3TGJE 1T8OA 1O3KA 1C1UH 1TX8A 4TPYA 5HXFA 2PSYA 1QA7A 2OINA 4OS7A 1MQ5A 1F5KU 1P2QA 4KTUA 3SU5A 2GV7A 1K1NA 4LXBH 1BMAA 1O3PB 1IQGA 1C1OA 3LGIA 2WYGA 3VB5A 1P2KA 1XUKA 4XOJA 4NIYA 4NZQA 2OQUA 2H5CA 2PFEA 5HMAA 2ZP0H 1P3EA 3ZZAA 2ZU4A 1GMHG 3TJNA 5HM9A 3DHKH 3ZZ6A 4B74A 3MNXA 1K1PA 1AU8A 4X8UH 2TGDA 1CGJE 5E2OA 1HUTH 1O5GH 4X1QU 4DOQA 3QZRA 2ZNKH 3BTGE 5JBTA 3H7OA 1O2RA 4FUIA 5DK1A 1GMCF 5F8TA 5CHAB 4MLFB 1C2JA 3NZIA 4KTSA 1BMMH 4Y8ZA 1UK3A 1EAUA 2VIWA 1EUFA 2ZU3A 3V0XA 2RG3A 8GCHG 3P6ZB 1BTPA 1QFKH 1AB9C 2STBE 2O9QA 3RMNH 3QWCH 4AX9H 4AYVB 4JK5A 2BQ7B 4BAKB 7LPRA 3OY5U 6LPRA 1IHTH 2ZZUH 1H8DH 1HAVA 1SOZA 3MWIU 1LHFH 1P12E 1FN6A 3SNBA 3RXKA 1OYQA 1P57B 1Z1IA 4YTAA 3RLYH 3M5OA 3SU2A 1TPPA 1QL8A 3LGTA 3VEQB 1GL0E 1RTLA 2Z94A 1SGIB 1FI8A 1RD3B 2JETB 4XBCA 2XCFA 2ZDKA 4UONA 4I8LA 2ZCHP 1VGCB 1QBOA 3UOUA 1E0FD 3SBKA 5TCAA 1ZTJA 3SGQE 1SQTA 1HJAC 1EKBB 1AWHB 1D6RA 1YYY1 1CSOE 1A0HB 1L1NA 1O2KA 4FUHA 1HIAB 2JKHA 1V2RT 1V2ST 1SLUB 2BD4A 5C2ZA 1EPTC 1P0SH 2O8MA 2SGDE 2WPJS 2PKSC 1O2ZA 1ELDE 1NFXA 1TFXA 4INLA 4YO9A 1WOFA 3F9EA 1BRCE 1SGRE 5FCKA 1YCPM 2EA3A 1QL9A 1EOJA 3SQHE 1TYNA 3P17H 1SFQB 2GT7A 1C5SA 1ZSKA 4K1TA 4GAWA 2Z9JA 1BTWA 3EA7A 1DX5M 2PUQH 1F5LA 3MU1A 4X1RU 3E6PH 1CA0B 4GLYA 3A82A 2QCYA 1C2EA 1SOTA 3SO3A 2QXIA 2KAIA 1HB0B 1O2JA 3DFLA 3MU4A 4JYVH 4OS1A 3HATH 1EAWA 2GDDA 2ZG0H 3LKWA 1OP0A 2VWMA 3W94A 4X8VH 1TIOA 1C2HA 1YPEH 1EASA 5K0HA 1QBVH 1GI1A 5G4BA 4ABIA 5EQSA 2BQ6B 1LPZB 1UCYE 4H6TA 5E2PA 3MH7A 1NPMA 3M7UA 2AMDA 1XX9A 2BVXH 5CMXH 1A5HA 2FS8A 2BHGA 1BJUA 1DY8A 8LPRA 4YLQH 3MNSA 4O03A 3PROA 1E38B 3AAUA 1C5LH 2BD3A 2FS9A 3GY7A 3Q76A 1SFIA 1PPCE 1GCTB 5A0BA 1CT2E 1T4UH 2ZHEH 4ZXYH 5FBEA 1XKBC 4WF8A 1Y8TA 4JZIA 3TNSA 1ANBA 4OGXA 2BM2A 1TWXB 1P09A 2WV4A 5GDSH 1UTMA 3FZZA 5DP7A 5I46H 1SLXB 1P10A 2BY8X 4YT7H 1LO6A 3T5FH 3F9HA 4RKJB 5A2MH 1A5IA 1EATA 1SGYE 2OTVA 3ZZCA 3KIDU 4XBDA 5CHAC 1CGIE 1GBIA 1PYTC 1G2MA 1O2VA 1O5CB 3BTDE 1S82A 1B7XB 1T8MA 1AUJA 1KXAA 2OLGA 4LK4A 1IQFA 2PTNA 4FU8A 5GIBA 2BZ6H 1UVPA 1T31A 4FUEA 1C2LA 1BRUP 1AY6H 2OP9A 1MTSA 1Z8IB 3Q00A 1PPGE 3FVFB 3RXEA 1LKAA 1Q31A 3MO9A 3SW2B 3MI4A 2ODQA 3S7KB 1Y3UA 1JIMA 1ESBA 1OWEA 1CBWC 2HPPH 1T7CA 4H42U 1C1QA 5E0GA 1A2CH 1IQLA 4AG1A 2PSXA 1DPOA 3M37A 2R9PA 2JETC 3TH4H 2BD5A 5IYTA 2GCHG 5E0HA 1VGCC 4NA8A 1MKWK 4K2YA 1UVOA 2XBYA 5GCHF 1B0FA 1F7ZA 3HPTB 1ABJH 3GY6A 3LJJA 5I25A 2XNIA 3OSYA 2SGPE 1YPGH 2ILNA 2ZHWH 4K69A 3WY8A 2TGTA 1B0EA 1BBRE 3SUFA 1G36A 1DLKB 1W11U 1ELCA 2V6NA 3U1JB 3O8CA 2AIPA 1EAIA 1ZR0A 2Z9GA 4I7YH 2R2MB 4GHTA 3SV6A 2Q6GA 3LIWA 2CV3A 4Y71A 3PTBA 1FMGA 2QA9E 1S5SA 2GCTB 1AUTC 3BSQA 1TA6A 1CE5A 3AASA 5L30H 1XUJA 1FY5A 2AEIH 2GTBA 3RU4D 3VPKA 1WUNH 3RXSA 1CA0C 4H4FA 3RXBA 4FUCA 2XRCA 3EAJA 2Y7XA 5JB9S 5JPMH 1SI5H 2C8YB 2BMGB 3GOVB 4XDEA 4CRCA 4CRFA 1VITG 4DIHH 1SGCA 5DKMA 2C3SA 2M5TA 3LC3A 1SLVB 2FYRA 4AGJA 1MKWH 2ZFFH 3ATIA 3ODDA 7ESTE 1ZPBA 2H2ZA 2A4OA 3SU6A 2BDYA 3A86A 5C5OA 3RXOA 1PYTD 1OWDA 4UDWH 2ZFPH 3T29A 1MCTA 1QBNA 3A8CA 1H9IE 4ABGA 2BY7X 1GG6C 2NU2E 2SNVA 1UJ1A 1NRQH 4E05H 1BTYA 2ZPRA 1BOQA 1VJ9U 2AGGX 3MTYA 4I8GA 2BDBA 1PPEE 3RLWH 1UTJA 3GDVA 5EW1H 1KLTA 3UR6A 4KGAA 2EI8A 1OWIA 1CQQA 2C8ZB 3T27A 1OYTH 1BRBE 2VIQA 3TU7H 1ZGVA 4SGBE 1GBTA 2ZEBA 3M3VA 3T2NA 4BOHA 2XBWA 1ZJDA 4BAOB 3MH6A 1C5QA 3M7QA 3BG4B 4LOYH 3RXHA 3RUOA 1TBRH 3V7TA 2VGCB 3R0FA 5BRRE 1GHWH 1RFNA 1KIGH 4U2WA 1RS0A 1KYNA 4FUJA 4BAQB 2R0KA 3A89A 4FUFA 1UK4A 1N6XA 2PR3A 2Z3DA 3IG6B 1W10U 1TABE 5EQQA 1DITH 1TGNA 4TPIZ 3ZVFA 1DWBH 1ZSLA 1GI3A 2O8WA 4AN7A 2ZCLP 3ODFA 1CHGA 2ZQ1A 4Q2KA 5EG4A 2Y81A 4Y7AA 1V2LT 1QL7A 1XXFA 1J9CH 3RXUA 1GVZA 3A81A 3RC5A 1YBWA 1IQJA 4TYDA 1HAHH 1Z71A 2FLRH 3HGPA 5L6NH 1P9SA 2HRVA 3IITA 3MHWU 5TCCA 1O3OA 3EGKH 4K5ZA 1OKXA 3ZVEA 1ANEA 1HJ9A 3RXTA 2P3TB 1ESAA 4E06H 2FOGA 4I8KA 1AFQC 2ZO3H 4MNVA 1FIZA 5DP4A 3M5MA 1PQ5A 4ZHLU 3UREA 1L2EA 3B23B 4FUBA 5J4QA 1O31A 2ALVA 5GJ4B 2F9OA 4IN1A 1F5RA 2VWOA 2Y5GA 1O2SA 2BLQA 2OBQA 2BOHB 3HKIB 2ZDVH 1ORFA 3BTEE 3BG8A 1SGPE 2XWBI 3OX7U 4PROA 4K60A 1ELEE 2W26A 4JZEH 4MPVA 2BD7A 1NRNH 1SGQE 1K1LA 3VB4A 1DM4B 2HPQH 5DJ7A 3UNSA 1ETRH 5SGAE 1HCGA 2Z9LA 4X6OA 2C4FH 1KXBA 5BPEA 1A61H 2FXRA 1GBDA 1CVWH 2QXHA 1O2IA 2D26C 1AZZA 1TRNA 1CHOF 1LDTT 4B2CA 2ZGHA 3TNTA 1O2MA 1FONA 2ZFQH 1GI4A 1HAYB 3ZVBA 1DSTA 3MMGA 3BV9B 2QYIA 4X8SH 1UTKA 3CENA 3SGAE 4JZDH 2BY5X 4RN6A 3P95A 1AB9B 1TNIA 4UFGH 3BTWE 4OGYA 2XC5A 3U8RH 1H9HE 5DP3A 4HI3A 2B8OH 3IWMA 1JXPA 1V2TT 2G4UA 4ISNA 3TGIE 2G5NA 1AE5A 2THFB 3V13A 3ZVGA 3K6ZA 1O39A 2ZU5A 4I33A 2W5EA 1O2LA 1ZSJA 4LZ4B 1CO7E 1MD8A 1F2SE 3A80A 2K1QA 1OS8A 2PKAB 2ZDLA 3SZNA 2ZHFH 6GCHG 4CHAC 1GBEA 1QTFA 5C1YA 1HXFH 1O2PA 1EXFA 1J14A 1NT1A 1C2DA 2ZPSA 3TVJB 1G9IE 4XSKU 2ZECA 3OTJE 1HJAB 2QAAA 1D3PB 2FLBH 2BZAA 3PMBB 1UMAH 1A0LA 4AOQA 1V2UT 5H4IB 1C2MA 3GDSA 3UNRA 2H6MA 1BIOA 2FM2A 2GZ9A 4QT8C 4KELA 2F83A 2NU3E 3LGVA 2PKSB 3UQVA 3BG4C 4AYYB 3SHAH 2DE9A 1BRAA 2VGCC 3QTOH 1OOKB 2QIQA 1O3FA 1KDQA 4INHA 1V2QT 1T32A 1ANCA 3E3TA 3SHCH 2BOKA 2VU8E 1TALA 1TB6H 1Z7KA 2Y82A 4D7FA 1GI7B 4JMYA 1TNGA 1UHBB 2F3CE 4WH8A 3W95A 1YPLH 4FVDA 5J4SA 1ELVA 3FP7E 1C9TA 4JYTA 5ESTE 3L6PA 4ZMAH 3C1KA 4WMEA 2GX4A 2V35A 2CF8H 1Q2WA 2ANKH 1C5XB 5JDUB 2HNTE 1TQ0B 2PV9B 1FAXA 1UTOA 1S85A 1MBQA 1HAXB 1IHSH 2VIOA 1U6QA 5FPYA 2JH6D 1NS3A 3DFJA 2GV6A 3VGCB 4OS5A 1ZZZA 5FXLA 3V12A 8ESTE 5DP8A 4CH8B 1H9LB 2TRMA 3UR9A 1WTHD 1L4ZA 1GGDB 4WWYA 1V2OT 4I32A 2A7CA 2EEKA 3VXEH 1RTFB 3PMJA 3A7WA 1BCUH 3GICB 2PTCE 5F8XA 1DLEA 4GCHF 4RKOB 1IQEA 1G32B 1QGFA 3A7YA 3A8BA 1AI8H 2F91A 4ZXXH 1NC6A 5EU8A 2A7HA 3JZ2B 2YNBA 2F9BH 3TPIZ 3S9CA 2J38A 2VINA 3EA9A 2Q6FA 3SV7A 2V3OH 5FAHA 1FZZA 3PMAB 2FYQA 1TRYA 1WAYB 3D65E 3NPSA 1FNIA 2UWOA 1HNEE 3TITA 1S0RA 1VZQH 1N8OB 1FV9A 1Y5AT 1UO6A 2Z9IA 1HPGA 2AIQA 1DWCH 1WTGH 4UFFH 1GBJA 3VFEA 3FZDA 3RMOH 2H5DA 1O3BA 1E35B 3UTUH 1FAKH 1O38A 1C2GA 4DG4A 1C9PA 2BVSH 1MH0A 3A87A 2G4TA 3MOCA 4K8BA 1P04A 2G81E 3Q3XA 1LVOA 3ZZDA 2ZGCA 1ID5H 4AB8A 1CBWB 1QB1A 3ATKA 5HYOA 3SORA 5C5NA 2STAE 3QK1A 3BTME 1BUIA 2FTLE 4YZUA 3P8GA 1C5PA 3SUGA 1XUGA 4BAHB 1EAXA 1O0DH 2BQWB 2G5VA 5A8XA 2XBVA 3KEEA 4NA9H 3RDZA 1HAZB 1K1OA 4NFFA 3UOPA 5LGOA 1GBCA 3GDUA 4Y11E 3SNCA 1PPHE 1OP2A 3PB1E 4BXSA 1XXDA 3LOXA 3TJUA 1HGTH 1C1MA 1Y3WA 7GCHG 4MNXA 2ANMH 2A32A 1HAGE 1O3AA 5FX6A 3QX5H 1ARBA 1NROH 1E36B 3M3TA 3STJA 1AGJA 4SGAE 2F9VA 2WPLS 1W14U 2P94A 3LGYA 1LQEA 2WPMS 2FO9A 3A7ZA 1H8IH 1IQHA 3F9FA 1AN1E 5GPIB 1MBMA 1F0SA 2Y5HA 1C5NH 1NM6A 2ZPQA 3SUDA 3MU5A 1TQ7B 1EZUC 2ZGXH 3RMMH 1PPBH 4JZ1A 5HGGA 1DDJA 1D6WA 1TNLA 1QCPA 1GPZA 4NIVA 1Y59T 4X2YA 1ZTLA 4DT7B 3E0NB 1C1RA 3SJIA 4GUXA 1C1VH 1P01A 3LDXH 2OBOA 3BIVH 1XUFA 2FX4A 2ZHDA 3QTVH 3PLBA 4NWKA 4FUGA 2BVRH 2EI7A 4J1YA 1WSSH 4B75A 1NFYA 1HFDA 1MZAA 1VCPA 1AKSA 1Z8JB 2HALA 3RU4T 4Y8XA 1GHBG 1GI9B 2NU0E 2F9PA 1GG6B 3VGCC 1WQVH 1PQAA 1SB1H 3T28A 1V2VT 1QURH 1O34A 2ZU2A 3GY5A 1SC8U 1DS2E 5CE1A 2AGEX 2C90B 2AFQB 2FOEA 2VWNA 1IOEA 1BHXB 3URCA 1GGDC 1O3JA 1DICA 1ZPZA 1QRWA 1M9UA 2P16A 1V2NT 1P2MA 2XWAA 2TBSA 2VIVA 1MU8B 3P92A 1EOLA 1GJDB 1GJCB 1C5MD 4TWYA 2BY9X 2ZTXA 9ESTA 2J9NA 4VGCB 1OWKA 2AYWA 3U9AH 1L0ZA 3BTQE 1OWHA 1OX1A 1NU7B 4O9VA 4UEHH 1UCYK 3VB7A 3CS7A 1FJSA 3GCTG 5A8YA 1DY9A 1DUAA 1N8OC 2Z3EA 3VB3A 3ZV9A 3QGNB 1AE8H 5EXNA 4KP0A 2Y6TA 1EX3A 1JRTA 1KXFA 1O5DH 4CREA 4OS6A 3NWUA 2D2DA 1SLWB 2QC2A 2ZA5A 1T8LA 3ZVAA 1MTVA 4RSPA 1W0ZU 2C93B 1TPSA 1SSXA 3GY2A 3ATMA 1G3BA 2GT8A 2NU4E 1AFQB 1GHAF 2OC1A 3S9AA 1C5YB 3ATLA 4CBNA 1O5FH 3PV4A 3FP6E 3ZZ3A 4IC6A 4MVNA 3KQDA 4TY7A 3SV8A 1GBHA 1ELTA 4WH6A 4D7GA 1MUEB 1N6YA 2Z9KA 1QA0A 3UUZA 2ZDAH 4NSYA 3SV2H 1C2KA 5HM2A 1P3CA 4HZHA 1P11E 1GHYH 3NXPA 2CMYA 3RXVA 1J16A 2HGTH 3D49H 3GCOA 3NCLA 2VB0A 1ZMJA 5FCRA 4B2BA 2F9UA 2FI5E 5EPNA 4IMQA 3RC4A 3LONA 1EPTA 1YPHC 4MDSA 3SUEA 1RJXB 1W2KH 4ZKRU 1LKBA 5EGMA 3PMHB 1PPFE 4FVBA 4K3JA 3ZV8A 2YOLA 1BHXF 5T6GA 5C67A 1KXCA 4FU9A 3EE0B 2Z3CA 1G2LA 3OU0A 2BDIA 1Y5BT 1AVWA 4Q80A 1A7SA 1C1PA 1THSH 1TPAE 1AWFH 2QXJA 1GMCG 3U69H 1IQNA 1LVBA 2QF3A 1O3IA 1UTPA 1TBQH 1X7AC 2BB4A 2W7SA 1SHYA 1DWEH 1SR5C 1MZDA 3O8DA 5AFYH 1E34B 4B71A
chains in the Genus database with same CATH superfamily
3OEED 3FANA 1TLDA 5T6DA 2OK5A 1O36A 3EE7A 1GMDF 3DA9B 3ZYDA 1O37A 3LT3A 1BBRK 1NRSH 2WPKS 1WQSA 1A1RA 3KQCA 3ZZ7A 5JBCS 2WV5A 3HGNA 4NSVA 1GI2A 3KL6A 1Z1JA 3PTNA 4CHAB 3TH2H 1IQIA 2C8XB 1ZHRA 2GVFA 2A45B 1IQMA 5FPTA 1QB9A 3TH3H 4AFSA 1HAOH 3UIRA 1G3EA 1SBWA 4K1EA 3SI4H 3QZQA 4IN2A 3I29A 1OXGA 3LGWA 1Y3XA 1SHHB 1SMFE 1SPJA 5EPYA 1BZXE 2QY0B 4ABJA 2ANYA 3GY3A 2FOBA 4ZHMU 1GMHF 1A3EH 1THRH 3GYLB 1ESTA 1CU1A 2J94A 1E37B 4HFPB 3KNXA 5DPAA 4X1SU 1AFEH 4ZHAA 3RXLA 3SGBE 1BTUA 1UK2A 3KYFA 1MCVA 1ZOMA 3CNRA 3BTFE 4VGCC 4FU7A 4DGJA 1MMJN 3Q77A 1FDPA 2BDAA 1JIRA 2HNTC 1EJMA 1EZXC 1YM0A 3QDZB 3OEHD 4AB9A 3TGKE 1RRKA 5EODA 5A8ZA 2SGEE 3K65B 1H1BA 1ZJKA 2XBXA 1ETSH 2K8IA 3ZVDA 1C1SA 2ULLA 2A5AA 8GCHF 1BBRH 2ALPA 4UFDH 3U98H 1W3CA 1QJ7B 4HTCH 5EOKA 2A5IA 1A5GH 3UFAA 4OS2A 1VJAU 5L2ZH 1HLTH 1O5AB 2VH6A 4UD9H 1AO5A 3LU9B 5EIYA 3BIUH 4O97A 3SN8A 2O8LA 1YPJH 2KAIB 1S84A 1HBTH 3ATWA 2P8OC 1QRZA 4GSOA 2UUKB 3K6YA 2BD2A 1H4WA 3SU4A 5FHTA 4CH2B 2XC0A 4I8HA 2EQNA 1P02A 1NRRH 1AD8H 1YCPK 2J4IA 3NRLA 4NCYA 1C4U2 2VJ1A 5IDKA 2IOTA 1ELFA 3AAVA 1LPKB 1P8VC 4Z0KA 6ESTA 2A7JA 1F92A 2HOBA 2ZFRH 4RT1A 4A92A 4MG3A 1YPMH 3HK6B 6CHAC 3S0NA 1XMNB 2V3HH 2TPIZ 3QLPH 5T1VA 2FI3E 1J17T 3MQKC 3BEFB 1HIAA 4X6NA 1NY22 1NU9A 1O3CA 2ASUB 1GJ9B 1TMUH 4YOGA 3RXDA 3K2UA 2SGFE 2A5KA 2GKVE 1ELGA 2BDHA 5DO4H 1P2OA 2BLVA 2SNWA 1GHZA 2IJOB 5FX5A 2Q1JA 4F48B 5LPEA 1TRMA 5FPSA 5JB8S 1BTZA 1UVUH 1GI6A 1K21H 3RC6A 5E0JA 3S7HB 3RXPA 4MNWA 4XD7D 3T62A 2KCYA 3TK9A 3A7VA 4Y8YA 1TAWA 1QJ6B 3D62A 2BX4A 1O3NA 1GHXH 2FDAA 4NA7A 2ZHQH 4Z6AH 1T4VH 4ISOA 1EB2A 1PQ7A 5C1XA 3LJOA 2ZDMA 5DP9A 3UWJH 1YCPH 2UUFB 1GI8B 1YP9A 1BA8B 2OD3B 3HK3B 1K9OE 2XTTB 1OWJA 3N99A 1JWTA 1MAYA 1P2JA 1DXWA 2BX3A 5LPRA 4JK6A 4A6LA 1A0JA 2BXUH 2SGQE 3SU3A 1UVSH 1K1MA 1L4DA 1GHBF 2RCEA 1ZHPA 4Q4LA 4BAMB 1D3QB 2P95A 3SU1A 4ISHH 3O8BA 4ABDA 1FY8E 1GJBB 3PYHA 1FPHH 1TGCA 1KXDA 2A0QB 2ZFSA 1UTQA 1ELAA 1IQKA 1MD7A 4J2YB 4Y79A 1TGBA 4X0WU 4KTCA 5DP5A 3RXFA 1GBFA 3ZZBA 5EJ1A 4WJG2 1FQ3A 5GCHG 3SJ8A 2BY6X 2HLDD 2BD9A 3EA8A 3P70B 3QO6A 2R2WU 3KCGH 3N7EA 4KKDA 4IMZA 1NFUA 1RIWC 1F0UA 3PWCA 1MQ6A 3GCHC 3M61U 2RFKC 1A4WH 1OHHD 1O3HA 1TPOA 1N1LA 3H5CB 1V2JT 3U8OH 2ZKSA 1DVAH 4CRAA 3L3TA 1YLNA 5A0CA 4YM9A 4Y76A 2R0LA 5ETXA 1CT4E 2R3UA 1DUEA 4YOIA 3NKKA 1SVPA 1GJ8B 1K2I1 4D9RA 3PLPA 4BTIB 4U01A 4A1TA 3QN7A 3PLKA 4ZUHA 4NFEA 3KGPA 2PHBA 3TK6A 2B5TB 2HVYB 4ZCNA 2ZU1A 4XFQA 2LPRA 2VIDA 5C3NA 2XOKD 2QV1A 2CHAB 3A88A 2PWXA 3TLOA 3AVZA 4GPGA 2CGAA 5F6MA 2FOAA 3KF2A 2XW9A 5AHGH 1JBUH 2VVUA 2UWLA 1O3EA 5ABWA 3RP2A 3FKSD 2UUJB 1AHTH 1TOMH 4MPUA 5CDFE 1UTLM 1K22H 2Y7ZA 2GCHF 1P9UA 4GHQA 1NN6A 4Q63A 2ZGBH 1P2IA 1W8BH 5KECA 1CT0E 4WVPE 1FY4A 1DE7H 1GBBA 1O2YA 2P3FH 4AGKA 4BANB 1YF4A 3K9XB 3BF6H 4UFEH 1ZRKA 3RXMA 1Z6EA 2XC4A 2ZQ2A 4DVAU 3LH3A 5JYIA 5A09A 1O3LA 1C1TA 4IGDA 5F03A 5AFZH 2JH5D 2ESTE 1C2FA 3N7DA 4K8YA 3SJOA 3GY8A 4YOJA 1W12U 3ZVCA 3MU8A 2A4RA 3ZZ9A 7KMEH 3TJVA 1NRPH 3TK5A 2BYAX 2XXLA 2ODYB 3Q3KA 3QUMP 3E91A 5TJXA 2G52A 3P8OA 4X6PA 4X2XA 1QQ4A 3ZYEA 1W13U 2ZI2H 2VVCA 4X2VA 2FOHA 2WUBA 1EJAA 1ZPCA 3RXIA 1O2HA 1O2NA 1DANH 4TSFD 3OYPA 4Y0ZE 1LQDB 4IBLH 1K28D 1OP8A 2WINI 2KM0A 1KY9A 3GISB 1EP5A 1VITF 3UQOA 1BDAA 1C5TA 2FPZA 1XUHA 1LVYA 1GJ4H 1RTKA 1PPZA 2BDGA 1GJAB 3EYDA 2R3YA 1ZRBA 4THNH 3E16B 5LPFA 4B73A 2RDEA 1O2GH 4CR5A 1C1NA 4M7GA 3SNAA 3RM0H 1GL1A 2KR7A 2ZDNA 1ACBE 1ZTKA 3URDA 1P2NA 4ISLA 2P93A 3WW7A 4JCNA 1TA2A 3SQEE 3MYWA 2EY4C 2AH4X 3M3SA 2J95A 1MTWA 3TIUA 1GBMA 1FN8A 3B9FH 2XNDD 1QHRB 1BTHH 1JRSA 3EDXB 1Z6JH 1ZYOA 2Q6DA 1BT7A 3VB6A 3MH4A 3DSGA 4ZKOU 3A8DA 1Y5UT 2Y5FA 1XVMA 1GBKA 3UY9A 5EW2H 3L33A 4ABBA 4DCDA 2JH0D 2ZIQH 3RXAA 2RA3A 1QRXA 1TMTH 1A46H 1O2WA 2P59A 2ZGJA 3F68H 3I78A 1DWDH 2W6JD 1CHOG 3BTTE 2WPHS 1LPGB 4Q7YA 2ZCKP 1RXPA 4TY6A 1DSUA 4CRGA 5L2YH 1QQUA 3A8AA 1AVGH 1EQ9A 4DURA 2FX6A 4X8TH 1S81A 2CHAC 1W7GH 2TIOA 3BTHE 3FAOA 3KQBA 3I77A 3KHVA 4ESTE 1MKXK 1TNJA 3MFJA 2A31A 1NTPA 2CJIA 2LNCA 3M35A 1ZHMA 4ISIH 2O8TA 5EJLA 2YMSB 5GXPA 3DCLA 1UVTH 1W7XH 2P3UB 2CF9H 1MTNB 3STIA 1Y3YA 4ZROA 1AIXH 3N7OA 3RXJA 3SJ9A 1V2KT 2PW8H 1TONA 4WMFA 4ASUD 1SGDE 1WXRA 1FIWA 1O3MA 2FTMA 4A1XA 2EI6A 2O8UA 3LC5A 2ZFTA 5T3HA 1GJ7B 5EXMA 1H8HD 2A1DB 1AZ8A 1O2QA 2ODPA 2BLOA 2NWNA 3BEUA 1LMWB 1XVOA 2BDCA 1OPHB 2L6OA 5T6FA 4XE4A 1C4V2 2FODA 1BB0B 2J92A 2VWLA 4FUDA 4JZFH 4E7NA 3C27B 2TGPZ 1DT2A 2V0BA 1S6FA 4B1TA 4I31A 1EP6A 3ENSB 2FOFA 2FZZA 1XKAC 1LVMA 1B5GH 2VVVA 4Y7BA 1KDQB 4AFUA 4DJZB 4ZKNU 1KSNA 2SGAA 3KN2A 1QR3E 4X1NU 1XM1A 4A7IB 2HWLB 2PGQB 1L1JA 1MKXH 1BMNH 1S0QA 4Y6DA 4YLUA 2VIPA 5DGJA 4BXWA 1K1JA 3FP8E 2G51A 1C1WH 3SOSA 1TGSZ 2J2UA 3A7TA 1ETTH 4NIWA 1D3DB 1BTXA 3SU0A 3MU0A 2GD4B 3ITIA 2P8OB 1GJ6A 4DIIH 4MPWA 3M7TA 5C94A 1O30A 3CP7A 2OC8A 2IJD1 1NFWA 1HDTH 2CXVA 5E8EH 3SJKA 4Q7ZA 6GCHF 2PKAA 3OTPA 4YT6H 1DXPA 4FETA 1HXEH 1J8AA 4DT4A 2QF0A 2G55A 3U8TH 3ELAH 2TGAA 2GP9B 2WZQA 6CHAB 1L1GA 1XUIA 4HGCA 3ZZ5A 4AORA 4B76A 2AMPA 1GDNA 2YNAA 4ABEA 3A7XA 3D23A 1UCYH 2I6QA 1GDQA 2AERH 3O8RA 3E0PB 2XCNA 1INCA 1O2TA 1LHCH 2B7DH 2IN2A 3S9BA 1A3BH 4U32A 2F9NA 2H9TH 3S69A 4MNYA 2WPDD 1EB1H 4GCHG 1V3XA 1J15A 2QN5T 3JZ1B 4ABFA 3GYMA 4X1PU 3AW1A 4IW4E 1CGHA 2OXSA 1S83A 3PO1B 2IPHA 1YGCH 4DW2U 4XBBA 3TJOA 2GMTB 3MO6A 3R3GB 4F49A 4I86A 5FL7D 4LZ1H 4AZ2B 3MNCA 4CR9A 4IC5A 1QY6A 4WMDA 3MH5A 1UHBA 2Z7FE 4INKA 3RXCA 2BLWA 1TX6A 2A4GA 3SI3H 2FIRH 1P05A 3T26A 1GHVH 2GZ7A 1GVKB 3PM3A 3F6UH 4DY7B 2W7UA 2HNTF 3ESTA 1ELBA 1TGTA 5DSFA 1BMLA 1G3DA 5B6OA 1HAVB 2OUAA 1GBAA 2A2XH 3EQ0H 2I6SA 1O32A 1G30B 2XYAA 2YMSC 2FP7B 1VR1H 4ABHA 1C5ZB 2H1UA 1HJ8A 2VBCA 3LPRA 4ZKSU 8KME2 2NU1E 1MTNC 4D8NA 4R0IA 1RGQA 2VNTA 1AQ7A 1DOJA 2GZ8A 1EJNA 1GJ5H 4AG2A 3UPEA 4FOUC 3QGJA 1NZQH 1F0RA 2GDEH 3ZZ4A 1FY1A 2KFWA 1GI0A 4GVUA 1OSSA 2AS9A 3DT0H 2VH0A 1GCTC 1PJPA 1Q3XA 1S6HA 2FI4E 1SGTA 1RIWB 3ZZ8A 3GCHB 2ZTYA 4UE7H 1AVXA 2AMQA 3SV9A 1HAPH 1C5UA 4MPXA 4CRBA 3H7TA 1SGFA 2PUXB 4Q7XA 3MO3A 1GI5A 2A4QA 2BD8A 4OS4A 2J34A 1HV7A 3BEIB 2PGBB 1YLCA 1UTNA 3A83A 3RU4E 4ABAA 3E8LA 1WCZA 4NZLA 3VXFH 1O35A 1Y3VA 1LHEH 2UWPA 1ARCA 1V2WT 3E1XB 3MNBA 1D3TB 1QJ1B 3GCNA 2FEQH 3SYJA 1SQOA 2RA0A 1JMOH 3RM2H 4NWLA 2ZF0H 1SGFG 1TNKA 1VCWA 1TE0A 1DFPA 2KCAA 1GBLA 1TX7A 3OY6U 3CS0A 3DUXH 2J97A 2BXTH 3RMLH 1FLEE 1FXYA 1AKSB 3V3MA 3U1IB 4A1VA 1LCYA 4MQAA 1GDUA 1ZMLA 1QIXB 2SFAA 3M5LA 1VITH 2H9HA 2Y80A 2OQ5A 5AVDA 2EC9H 1ZGIA 1THPB 1COWD 3UWIA 7GCHF 1MTUA 2GGVB 2ZTZA 1ABIH 3NUMA 1LTOA 5AF9H 4TWWA 1O2OA 4WXVA 2H9EH 2FWWA 4O3TA 2YMSD 4B2AA 1IAUA 2QGRA 1WV7H 4CRDA 2DUCA 4WY3A 4ZH8A 5DP6A 1YKTA 1SG8B 3PO1C 3SNEA 1WBGB 1C5RA 2W3KA 1HRTH 3P8FA 1FY3A 1Z8RA 1QB6A 2GMTC 1O33A 1PQ8A 1YC0A 2D1JA 1C5WB 4BNRA 1V2PT 2GCTC 1C4Y2 4O3UA 4X2WA 2C8WB 3UNQA 4U30A 1GVLA 3NK8A 5GWZA 1TNHA 4I8JA 5FBIA 2A2QH 3PWBA 1PFXC 1V6DA 5A0AE 1C2IA 1ZLRA 2WUCA 3A85A 1NESE 2HLCA 3BTKE 3DD2H 1WU1A 4ZAEA 2CN0H 1YPHE 2B0FA 5F8ZA 1T8NA 3A84A 2W3IA 3M5NA 1SL3A 3F9GA 3E90B 1F0TA 1SQAA 5JBAS 2OCVB 1LHDH 2QXGA 3F1SB 1GHAG 3LH1A 4XRNA 5DG6A 4ASHA 4CBOA 3GY4A 2ZWLH 2LELA 2Z6BD 4R8TB 1VCQA 5LH8A 3BN9A 5EXLA 2FESH 3B8JA 1O3DA 3HKJB 3G01A 1P06A 3P8NA 4NG9H 1MAXA 4AFQA 5C1UA 1BQYA 1D9IA 2FMJA 5PTPA 1TMBH 3FFGA 3Q3YA 5C20A 1ZMNA 1C5VA 4E7RG 1GCDA 1O5BB 4A5TS 2G8TA 1SGEE 2ANWA 3AW0A 1ANDA 2AGIX 2PLXA 3SNDA 1KTSB 1TBZH 9LPRA 1EPTB 2DE8A 3M36A 4YESB 4BTUB 4NGAH 1O5EH 1Z8GA 2BTCE 1KLIH 1JOUB 1AMHA 1G3CA 1HYLA 1QNJA 3GCTF 4Y10E 4JYUH 1TOCB 1YPKH 1NO9H 4Y0YE 3VG8A 5K7RA 1O2XA 4D9QA 1G37A 1YLDA 4D76A 2HVXA 3RXQA 2OC0A 3RXGA 4WXIA 2UUYA 1FUJA 3KYGA 1P03A 4MTBA 4HG6A 5JBBS 2G00A 1W0YH 2RDLA 4FXGH 3RXRA 2FOCA 2FOMB 1KXEA 3W1EA 1D4PB 2B9LA 2F43B 1HAIH 5ESBA 1O2UA 3PV2A 4X6MA 3KQEA 2WYJA 3T25A 4BTTB 1BJVA 3LGUA 1K1IA 1V2MT 1GMDG 1CA8B 1EZQA 1SGNE 1MU6B 2ZC9H 1GWAA 1C5OH 2KCPA 1EZSC 1BITA 4IS5A 1FPCH 4AFZA 5C0TA 2OC7A 4NIXA 2D8WA 1E79D 4H6SB 4K1SA 4F4OC 1O3GA 5EQRA 1KTTB 1LHGH 1KLJH 1WYKA 2WPIS 3TGJE 1T8OA 1O3KA 1C1UH 1TX8A 4TPYA 5HXFA 2PSYA 1QA7A 2QE7D 2OINA 4OS7A 1MQ5A 1F5KU 1P2QA 4KTUA 3SU5A 2GV7A 1K1NA 4LXBH 2J98A 1BMAA 1O3PB 1IQGA 1C1OA 3LGIA 2WYGA 3VB5A 1P2KA 1XUKA 4XOJA 4NIYA 4NZQA 2OQUA 2H5CA 2PFEA 5HMAA 1SKYE 2ZP0H 1S6LA 1P3EA 3ZZAA 2ZU4A 1GMHG 3TJNA 5HM9A 3DHKH 3ZZ6A 4B74A 3MNXA 1K1PA 1AU8A 4X8UH 2TGDA 1CGJE 5E2OA 1HUTH 1O5GH 4X1QU 4DOQA 3QZRA 2ZNKH 3BTGE 4RI0A 5JBTA 3H7OA 1O2RA 4FUIA 5DK1A 5GNDA 1GMCF 5F8TA 5CHAB 4MLFB 1C2JA 3NZIA 4KTSA 1BMMH 3FO8D 4Y8ZA 1UK3A 1EAUA 2VIWA 1EUFA 2ZU3A 3V0XA 2RG3A 8GCHG 3P6ZB 1BTPA 1QFKH 1AB9C 2STBE 2O9QA 3RMNH 3QWCH 4AX9H 4AYVB 4JK5A 2BQ7B 3H09A 4BAKB 7LPRA 3OY5U 6LPRA 1IHTH 2ZZUH 1H8DH 3PV5A 1HAVA 1SOZA 3MWIU 1LHFH 1P12E 1FN6A 3SNBA 3RXKA 1OYQA 1P57B 1Z1IA 4YTAA 3RLYH 3M5OA 3SU2A 1TPPA 1QL8A 3LGTA 3VEQB 1GL0E 1RTLA 2Z94A 2IPQX 1SGIB 1FI8A 1RD3B 3GS9A 2JETB 4XBCA 2XCFA 4P02A 2ZDKA 4UONA 4I8LA 2ZCHP 1VGCB 1QBOA 3UOUA 1E0FD 3F0OA 3SBKA 5TCAA 1ZTJA 3SGQE 1SQTA 1HJAC 1EKBB 1AWHB 1D6RA 1YYY1 1CSOE 1A0HB 1L1NA 1O2KA 4FUHA 1HIAB 2JKHA 1V2RT 1V2ST 1SLUB 2BD4A 5C2ZA 1EPTC 1P0SH 2O8MA 2SGDE 2WPJS 2PKSC 1O2ZA 1ELDE 1NFXA 1TFXA 4INLA 4YO9A 1WOFA 3F9EA 1BRCE 1SGRE 5FCKA 1YCPM 2EA3A 2V3MA 1QL9A 3SZEA 1EOJA 3SQHE 1TYNA 3P17H 4F55A 1SFQB 2GT7A 1C5SA 1ZSKA 4K1TA 4GAWA 2Z9JA 1BTWA 3EA7A 1DX5M 2PUQH 1F5LA 3MU1A 4X1RU 3E6PH 1CA0B 4GLYA 3A82A 2QCYA 1C2EA 1SOTA 3SO3A 2QXIA 2KAIA 1HB0B 1O2JA 3DFLA 3FN8A 3MU4A 4JYVH 4OS1A 3HATH 1EAWA 2GDDA 2ZG0H 3LKWA 1OP0A 2VWMA 3W94A 4X8VH 1TIOA 1C2HA 1YPEH 1EASA 1W0KD 5K0HA 1QBVH 1GI1A 5G4BA 4ABIA 5EQSA 2BQ6B 1LPZB 1UCYE 4H6TA 5E2PA 3MH7A 1NPMA 3M7UA 2AMDA 5HKKD 1XX9A 2BVXH 5CMXH 1A5HA 2FS8A 2BHGA 1BJUA 1DY8A 8LPRA 4YLQH 3MNSA 4O03A 3PROA 1E38B 3AAUA 1C5LH 2BD3A 2FS9A 2JIZD 3GY7A 3Q76A 1SFIA 1PPCE 1GCTB 5A0BA 1CT2E 1T4UH 2ZHEH 4ZXYH 5FBEA 1XKBC 4WF8A 1Y8TA 4JZIA 3TNSA 3OE7D 5B6LA 1ANBA 4OGXA 2BM2A 1TWXB 1P09A 2WV4A 5GDSH 1UTMA 3FZZA 5DP7A 5I46H 1BMFD 1SLXB 1P10A 2BY8X 4YT7H 1LO6A 3T5FH 3F9HA 4RKJB 2WSSD 5A2MH 1A5IA 1EATA 1SGYE 2OTVA 3ZZCA 3KIDU 4XBDA 5CHAC 1CGIE 1GBIA 1PYTC 1G2MA 1O2VA 1O5CB 3BTDE 1S82A 1B7XB 1T8MA 1AUJA 1KXAA 2KZ4A 2OLGA 4LK4A 1IQFA 2PTNA 4FU8A 5GIBA 2BZ6H 1UVPA 1T31A 4FUEA 1C2LA 1BRUP 1AY6H 2OP9A 1MTSA 3UAIC 1Z8IB 3Q00A 1PPGE 3FVFB 3RXEA 1LKAA 1Q31A 3MO9A 3SW2B 3MI4A 2ODQA 2KCOA 3S7KB 1Y3UA 1JIMA 1ESBA 1OWEA 1CBWC 2HPPH 1T7CA 4H42U 1C1QA 5E0GA 1A2CH 1IQLA 2LP6A 4AG1A 2PSXA 1DPOA 3M37A 2R9PA 2JETC 3TH4H 2BD5A 2K0QA 5IYTA 2GCHG 5E0HA 1VGCC 4NA8A 1MKWK 4K2YA 1UVOA 2XBYA 5GCHF 1B0FA 1F7ZA 3HPTB 1ABJH 3GY6A 3LJJA 5I25A 2XNIA 3OSYA 2SGPE 1YPGH 2ILNA 2ZHWH 4K69A 3WY8A 2TGTA 1B0EA 1BBRE 3SUFA 1G36A 2L74A 1DLKB 1W11U 2WV9A 1ELCA 2V6NA 3U1JB 1QZ8A 3O8CA 2AIPA 1EAIA 1ZR0A 2Z9GA 4I7YH 2R2MB 4GHTA 3SV6A 2Q6GA 3LIWA 2CV3A 4Y71A 3PTBA 1FMGA 2QA9E 1S5SA 2GCTB 1AUTC 3BSQA 1TA6A 1CE5A 3AASA 5L30H 1XUJA 1FY5A 2AEIH 2GTBA 3RU4D 3VPKA 1WUNH 3RXSA 1H8ED 1CA0C 4H4FA 3RXBA 4FUCA 2QF5A 2XRCA 3EAJA 2Y7XA 5JB9S 5JPMH 1SI5H 2C8YB 2BMGB 3GOVB 4XDEA 4CRCA 4CRFA 1VITG 1NBME 4DIHH 3PRDA 1SGCA 5DKMA 2C3SA 2M5TA 4TT3D 3LC3A 1SLVB 2FYRA 4AGJA 1EFRD 1MKWH 2ZFFH 3ATIA 3ODDA 7ESTE 1ZPBA 2H2ZA 2A4OA 3SU6A 2BDYA 3A86A 5C5OA 3WWFA 3RXOA 1PYTD 1OWDA 3DSOA 4UDWH 2ZFPH 3T29A 1MCTA 1QBNA 3A8CA 1H9IE 4ABGA 2BY7X 1GG6C 3F2FA 2NU2E 2J5UA 2SNVA 1UJ1A 1NRQH 4E05H 1BTYA 2ZPRA 4OM9A 1BOQA 1VJ9U 2AGGX 3MTYA 4I8GA 2BDBA 1PPEE 3RLWH 1UTJA 3GDVA 5EW1H 1KLTA 3UR6A 4KGAA 2EI8A 1OWIA 2GJGA 1CQQA 2C8ZB 3T27A 1OYTH 1BRBE 2VIQA 3TU7H 1ZGVA 4SGBE 1GBTA 2ZEBA 3M3VA 3T2NA 4BOHA 2XBWA 2JDID 1ZJDA 4BAOB 3MH6A 1C5QA 3M7QA 3BG4B 4LOYH 3RXHA 3RUOA 1TBRH 3V7TA 2VGCB 3R0FA 5BRRE 1GHWH 1RFNA 1KIGH 1W0JD 4U2WA 1RS0A 1KYNA 4FUJA 4BAQB 2R0KA 3A89A 4FUFA 1UK4A 1N6XA 2PR3A 2Z3DA 3IG6B 1W10U 1TABE 5EQQA 1DITH 1TGNA 4TPIZ 3ZVFA 1DWBH 1ZSLA 2W6ID 1GI3A 3PRBA 2O8WA 4AN7A 2ZCLP 3ODFA 1CHGA 2ZQ1A 4Q2KA 5EG4A 2Y81A 4Y7AA 1V2LT 1QL7A 1XXFA 1J9CH 3RXUA 1GVZA 3A81A 3RC5A 1YBWA 1IQJA 4TYDA 1HAHH 1Z71A 2FLRH 3HGPA 3U28C 5L6NH 1P9SA 2HRVA 3IITA 3MHWU 5TCCA 1O3OA 3EGKH 4K5ZA 1OKXA 3ZVEA 1ANEA 1HJ9A 3RXTA 2P3TB 1ESAA 5KGOA 4E06H 2FOGA 4I8KA 1E1QD 1AFQC 2ZO3H 4MNVA 1FIZA 5DP4A 3M5MA 1PQ5A 4ZHLU 1YWUA 3UREA 1L2EA 3B23B 4FUBA 5J4QA 1O31A 2ALVA 5GJ4B 2F9OA 4IN1A 1F5RA 2VWOA 2Y5GA 1O2SA 2BLQA 2OBQA 2BOHB 3HKIB 2ZDVH 5F53A 1ORFA 3BTEE 3BG8A 1SGPE 2XWBI 3OX7U 4PROA 4K60A 1ELEE 2W26A 4JZEH 4MPVA 2BD7A 1NRNH 1SGQE 1K1LA 3VB4A 1DM4B 2HPQH 5DJ7A 3UNSA 1ETRH 2QF4A 5SGAE 1HCGA 2Z9LA 4X6OA 2C4FH 1KXBA 5BPEA 1A61H 2FXRA 1GBDA 1CVWH 2QXHA 1O2IA 2D26C 1AZZA 1TRNA 1CHOF 1LDTT 4B2CA 2ZGHA 3TNTA 1O2MA 1FONA 2ZFQH 1GI4A 1HAYB 3WWBA 3ZVBA 1DSTA 3MMGA 3BV9B 2QYIA 4X8SH 1UTKA 3CENA 3SGAE 4JZDH 2BY5X 4RN6A 3P95A 1AB9B 1TNIA 4UFGH 3BTWE 4OGYA 2XC5A 4M9FA 3U8RH 1H9HE 2PP6A 5DP3A 4HI3A 2B8OH 3IWMA 1JXPA 1V2TT 2G4UA 4ISNA 3TGIE 2CK3D 2G5NA 1AE5A 2THFB 3V13A 1FX0B 3ZVGA 3K6ZA 1O39A 4RT0A 2ZU5A 4I33A 2W5EA 1O2LA 1ZSJA 4LZ4B 1CO7E 1MD8A 1F2SE 4B6EA 3A80A 2K1QA 1OS8A 2PKAB 2ZDLA 3SZNA 2ZHFH 6GCHG 4CHAC 1GBEA 1QTFA 5C1YA 1HXFH 1O2PA 1EXFA 1J14A 1NT1A 1C2DA 2ZPSA 3TVJB 1G9IE 4XSKU 2ZECA 3OTJE 1HJAB 2QAAA 1D3PB 2FLBH 2BZAA 3PMBB 1UMAH 1A0LA 4AOQA 4ACBA 1V2UT 5H4IB 1C2MA 3GDSA 3UNRA 2JJ2D 2H6MA 1BIOA 2FM2A 2GZ9A 4QT8C 4KELA 2F83A 2NU3E 3LGVA 2PKSB 3UQVA 3BG4C 5HIZA 4AYYB 3SHAH 2DE9A 4B6FA 1BRAA 2VGCC 3QTOH 1UW7A 1OOKB 2QIQA 1O3FA 1KDQA 4INHA 1V2QT 1T32A 1ANCA 3E3TA 3SHCH 2BOKA 2VU8E 1TALA 1TB6H 1Z7KA 2Y82A 4D7FA 1GI7B 4JMYA 1TNGA 1UHBB 2F3CE 4WH8A 3W95A 1YPLH 4FVDA 5J4SA 1ELVA 3FP7E 1C9TA 4JYTA 5ESTE 3L6PA 4ZMAH 3C1KA 4WMEA 2GX4A 2V35A 2CF8H 1Q2WA 2ANKH 1C5XB 5JDUB 2HNTE 1TQ0B 2PV9B 1FAXA 1UTOA 2KX4A 1K0HA 1S85A 2WHXA 1MBQA 1HAXB 1IHSH 2VIOA 5KEDA 1U6QA 5FPYA 2JH6D 1NS3A 4P00A 3DFJA 2GV6A 3UB0A 3VGCB 4OS5A 1ZZZA 5FXLA 3V12A 8ESTE 5DN6D 5DP8A 4CH8B 1H9LB 2V7QD 2TRMA 3UR9A 1WTHD 1L4ZA 1GGDB 4WWYA 1V2OT 4I32A 2A7CA 2EEKA 3VXEH 1RTFB 3PMJA 3A7WA 1E1RD 1BCUH 3GICB 2PTCE 5IK2D 5F8XA 1DLEA 4GCHF 4RKOB 1IQEA 1G32B 1QGFA 1VKYA 3A7YA 3A8BA 1AI8H 2F91A 3F2GA 4ZXXH 1NC6A 5EU8A 2A7HA 3JZ2B 2YNBA 2F9BH 3TPIZ 3S9CA 2J38A 2VINA 3EA9A 2Q6FA 3SV7A 2V3OH 5FAHA 1FZZA 3PMAB 2FYQA 5C17A 1TRYA 1WAYB 3D65E 3NPSA 1FNIA 2UWOA 1HNEE 3TITA 1S0RA 1VZQH 1N8OB 1FV9A 1Y5AT 1UO6A 2Z9IA 1HPGA 2AIQA 1DWCH 1WTGH 4UFFH 1GBJA 3VFEA 3FZDA 3RMOH 2H5DA 1O3BA 1E35B 3UTUH 1FAKH 1O38A 1C2GA 4DG4A 1C9PA 2BVSH 1MH0A 3A87A 2G4TA 3MOCA 4K8BA 1P04A 2G81E 3Q3XA 1LVOA 3ZZDA 2ZGCA 1ID5H 4AB8A 1CBWB 1QB1A 3ATKA 5HYOA 3SORA 5C5NA 2STAE 3QK1A 3BTME 1BUIA 2FTLE 4YZUA 3P8GA 1C5PA 3SUGA 1XUGA 3ZIAD 4BAHB 1EAXA 1O0DH 2BQWB 2G5VA 5A8XA 2XBVA 3KEEA 4NA9H 3RDZA 1HAZB 1K1OA 4NFFA 3UOPA 5LGOA 1GBCA 3GDUA 4Y11E 3SNCA 1PPHE 1OP2A 3PB1E 4BXSA 5HIYA 1XXDA 3LOXA 3TJUA 1HGTH 1C1MA 1Y3WA 3AK5A 7GCHG 4MNXA 2ANMH 2A32A 1HAGE 1O3AA 5FX6A 3QX5H 4YXWD 1ARBA 1NROH 1E36B 3M3TA 3STJA 1AGJA 4SGAE 2F9VA 2WPLS 1W14U 2P94A 3LGYA 1LQEA 2WPMS 2FO9A 3A7ZA 1H8IH 1IQHA 3F9FA 1AN1E 5GPIB 1MBMA 1F0SA 2Y5HA 1C5NH 1NM6A 2ZPQA 3SUDA 3MU5A 3FOAA 1TQ7B 1EZUC 2ZGXH 3RMMH 1PPBH 4JZ1A 5HGGA 1DDJA 1D6WA 1TNLA 1QCPA 1GPZA 4NIVA 1Y59T 4X2YA 1ZTLA 3F2HA 4DT7B 3E0NB 1C1RA 3SJIA 4GUXA 1C1VH 1P01A 3LDXH 2OBOA 3BIVH 1XUFA 2FX4A 2ZHDA 3QTVH 4ACAA 5EJZA 3PLBA 3OFND 4NWKA 4FUGA 2BVRH 2EI7A 4J1YA 1WSSH 4B75A 1NFYA 1HFDA 1MZAA 1VCPA 1AKSA 1Z8JB 2HALA 3RU4T 4Y8XA 1GHBG 1GI9B 2NU0E 2F9PA 1GG6B 3VGCC 1WQVH 1PQAA 1SB1H 3T28A 1V2VT 1QURH 1O34A 2ZU2A 3GY5A 1SC8U 1DS2E 5CE1A 2AGEX 2C90B 2AFQB 2FOEA 2VWNA 1IOEA 1BHXB 3URCA 1GGDC 1O3JA 1DICA 1ZPZA 1QRWA 1M9UA 2P16A 1V2NT 1P2MA 2XWAA 2TBSA 2VIVA 1MU8B 3P92A 1EOLA 1GJDB 1GJCB 1C5MD 4TWYA 2BY9X 2ZTXA 9ESTA 2J9NA 4VGCB 1OWKA 2F4LA 2AYWA 3U9AH 1L0ZA 3BTQE 1SQRA 1OWHA 1OX1A 1NU7B 1MABB 4O9VA 4UEHH 1UCYK 3VB7A 3CS7A 1FJSA 3GCTG 5A8YA 1DY9A 1DUAA 1N8OC 2Z3EA 3VB3A 3ZV9A 3QGNB 1AE8H 5EXNA 4KP0A 2Y6TA 1EX3A 1JRTA 3F0PA 1KXFA 1O5DH 4CREA 4OS6A 3NWUA 2D2DA 1SLWB 2QC2A 2ZA5A 1T8LA 1YY3A 3ZVAA 1MTVA 1NBMD 4RSPA 1W0ZU 2C93B 1TPSA 1SSXA 3GY2A 3ATMA 1G3BA 2GT8A 2NU4E 1AFQB 1GHAF 2OC1A 3S9AA 1C5YB 5C0UA 3ATLA 4CBNA 1O5FH 3PV4A 3FP6E 3ZZ3A 4IC6A 4MVNA 4AC9A 3KQDA 4TY7A 3SV8A 1GBHA 1ELTA 4WH6A 4D7GA 2AHME 1MUEB 1N6YA 2Z9KA 1QA0A 3UUZA 2ZDAH 4NSYA 3SV2H 1C2KA 5HM2A 1P3CA 4HZHA 1P11E 2J98B 1GHYH 3F3BA 2CMYA 3NXPA 3RXVA 2M2AA 4Z1MD 1J16A 3KQ5A 2HGTH 3D49H 3GCOA 3NCLA 2VB0A 1ZMJA 5FCRA 4B2BA 2F9UA 2FI5E 5EPNA 4IMQA 3RC4A 3LONA 1EPTA 1YPHC 4MDSA 3SUEA 1RJXB 1W2KH 4ZKRU 1KMHB 1LKBA 5EGMA 3PMHB 1PPFE 4FVBA 4K3JA 3ZV8A 2JJ1D 2YOLA 1BHXF 5T6GA 5C67A 5CHBA 1KXCA 4FU9A 3EE0B 2Z3CA 1G2LA 3OU0A 2BDIA 1Y5BT 1AVWA 4Q80A 1A7SA 1C1PA 1THSH 1TPAE 1AWFH 2QXJA 1GMCG 3U69H 1IQNA 1LVBA 2QF3A 1O3IA 1UTPA 1TBQH 1X7AC 3OAAD 2BB4A 2W7SA 1SHYA 1WDIA 1DWEH 3DSPA 1SR5C 1MZDA 3O8DA 5AFYH 1E34B 4B71A
chains in the Genus database with same CATH topology
5T6DA 3FANA 1TLDA 1O36A 1GMDF 3DA9B 3ZYDA 1O37A 3LT3A 1BBRK 1NRSH 2WPKS 1WQSA 1A1RA 3KQCA 3ZZ7A 5JBCS 2WV5A 3HGNA 4NSVA 1GI2A 3KL6A 1Z1JA 3PTNA 4CHAB 3TH2H 1IQIA 2C8XB 1ZHRA 2GVFA 2A45B 1IQMA 5FPTA 1QB9A 3TH3H 4AFSA 1HAOH 3UIRA 1G3EA 1SBWA 4K1EA 3SI4H 3QZQA 4IN2A 3I29A 1OXGA 3LGWA 1Y3XA 1SHHB 1SMFE 1SPJA 5EPYA 1BZXE 2QY0B 4ABJA 2ANYA 3GY3A 2FOBA 4ZHMU 1GMHF 1A3EH 1THRH 3GYLB 1ESTA 1CU1A 2J94A 1E37B 4HFPB 3KNXA 5DPAA 4X1SU 1AFEH 4ZHAA 3RXLA 3SGBE 1BTUA 1UK2A 1MCVA 1ZOMA 3BTFE 4VGCC 4FU7A 4DGJA 1MMJN 3Q77A 1FDPA 2BDAA 1JIRA 2HNTC 1EJMA 1EZXC 1YM0A 3QDZB 3TGKE 4AB9A 1RRKA 5EODA 5A8ZA 2SGEE 3K65B 1H1BA 1ZJKA 2XBXA 1ETSH 3ZVDA 1C1SA 2ULLA 2A5AA 8GCHF 1BBRH 2ALPA 4UFDH 3U98H 1W3CA 1QJ7B 4HTCH 5EOKA 2A5IA 1A5GH 3UFAA 4OS2A 1VJAU 5L2ZH 1HLTH 1O5AB 2VH6A 4UD9H 1AO5A 3LU9B 3BIUH 4O97A 3SN8A 2O8LA 1YPJH 2KAIB 1S84A 1HBTH 3ATWA 2P8OC 1QRZA 4GSOA 2UUKB 3K6YA 2BD2A 1H4WA 3SU4A 5FHTA 4CH2B 2XC0A 4I8HA 1P02A 1NRRH 1AD8H 1YCPK 2J4IA 4NCYA 1C4U2 2VJ1A 5IDKA 2IOTA 1ELFA 3AAVA 1LPKB 1P8VC 4Z0KA 6ESTA 2A7JA 1F92A 2HOBA 2ZFRH 4A92A 4MG3A 1YPMH 3HK6B 6CHAC 3S0NA 1XMNB 2V3HH 2TPIZ 3QLPH 2FI3E 1J17T 3BEFB 1HIAA 4X6NA 1NY22 1NU9A 1O3CA 2ASUB 1GJ9B 1TMUH 4YOGA 3RXDA 3K2UA 2SGFE 2A5KA 2GKVE 1ELGA 2BDHA 5DO4H 1P2OA 2BLVA 2SNWA 1GHZA 2IJOB 5FX5A 2Q1JA 5LPEA 1TRMA 5FPSA 5JB8S 1BTZA 1UVUH 1GI6A 1K21H 3RC6A 5E0JA 3S7HB 3RXPA 4MNWA 3T62A 3TK9A 3A7VA 4Y8YA 1TAWA 1QJ6B 3D62A 2BX4A 1O3NA 1GHXH 2FDAA 4NA7A 2ZHQH 4Z6AH 1T4VH 4ISOA 1EB2A 1PQ7A 5C1XA 3LJOA 2ZDMA 5DP9A 3UWJH 1YCPH 2UUFB 1GI8B 1YP9A 1BA8B 2OD3B 3HK3B 1K9OE 2XTTB 1OWJA 1JWTA 1MAYA 1P2JA 1DXWA 2BX3A 5LPRA 4JK6A 4A6LA 1A0JA 2BXUH 2SGQE 3SU3A 1UVSH 1K1MA 1L4DA 1GHBF 2RCEA 1ZHPA 4BAMB 1D3QB 2P95A 3SU1A 4ISHH 3O8BA 4ABDA 1FY8E 1GJBB 3PYHA 1FPHH 1TGCA 1KXDA 2A0QB 2ZFSA 1UTQA 1ELAA 1IQKA 1MD7A 4J2YB 4Y79A 1TGBA 4X0WU 4KTCA 5DP5A 3RXFA 1GBFA 3ZZBA 4WJG2 1FQ3A 5GCHG 3SJ8A 2BY6X 2BD9A 3EA8A 3P70B 3QO6A 2R2WU 3KCGH 4KKDA 4IMZA 1NFUA 1RIWC 1F0UA 3PWCA 1MQ6A 3GCHC 3M61U 1A4WH 1TPOA 1O3HA 1N1LA 3H5CB 1V2JT 3U8OH 2ZKSA 1DVAH 4CRAA 3L3TA 5A0CA 4YM9A 4Y76A 2R0LA 5ETXA 1CT4E 2R3UA 1DUEA 4YOIA 3NKKA 1SVPA 1GJ8B 1K2I1 4D9RA 3PLPA 4BTIB 4U01A 4A1TA 3QN7A 3PLKA 4ZUHA 4NFEA 3KGPA 2PHBA 3TK6A 2B5TB 2ZU1A 4XFQA 2LPRA 2VIDA 5C3NA 2QV1A 2CHAB 3A88A 2PWXA 3TLOA 3AVZA 4GPGA 2CGAA 5F6MA 2FOAA 3KF2A 2XW9A 5AHGH 1JBUH 2VVUA 2UWLA 1O3EA 5ABWA 3RP2A 2UUJB 1AHTH 1TOMH 4MPUA 1UTLM 1K22H 2Y7ZA 2GCHF 1P9UA 4GHQA 1NN6A 2ZGBH 1P2IA 1W8BH 1CT0E 4WVPE 1FY4A 1DE7H 1GBBA 1O2YA 2P3FH 4AGKA 4BANB 1YF4A 3K9XB 3BF6H 4UFEH 1ZRKA 3RXMA 1Z6EA 2XC4A 2ZQ2A 4DVAU 3LH3A 5JYIA 5A09A 1O3LA 1C1TA 4IGDA 5F03A 5AFZH 2JH5D 2ESTE 1C2FA 4K8YA 3SJOA 3GY8A 4YOJA 1W12U 3ZVCA 3MU8A 2A4RA 3ZZ9A 7KMEH 3TJVA 1NRPH 3TK5A 2BYAX 2XXLA 2ODYB 3Q3KA 3QUMP 3E91A 5TJXA 2G52A 3P8OA 4X6PA 4X2XA 1QQ4A 3ZYEA 1W13U 2ZI2H 2VVCA 4X2VA 2FOHA 2WUBA 1EJAA 1ZPCA 3RXIA 1O2HA 1O2NA 1DANH 3OYPA 4Y0ZE 1LQDB 4IBLH 1K28D 1OP8A 2WINI 1KY9A 3GISB 1EP5A 1VITF 3UQOA 1BDAA 1C5TA 2FPZA 1XUHA 1LVYA 1GJ4H 1RTKA 1PPZA 2BDGA 1GJAB 3EYDA 2R3YA 1ZRBA 4THNH 3E16B 5LPFA 4B73A 1O2GH 4CR5A 1C1NA 4M7GA 3SNAA 3RM0H 1GL1A 2ZDNA 1ACBE 1ZTKA 3URDA 1P2NA 4ISLA 2P93A 4JCNA 1TA2A 3SQEE 3MYWA 2AH4X 3M3SA 2J95A 1MTWA 3TIUA 1GBMA 1FN8A 3B9FH 1QHRB 1BTHH 1JRSA 3EDXB 1Z6JH 1ZYOA 2Q6DA 1BT7A 3VB6A 3MH4A 4ZKOU 3A8DA 1Y5UT 2Y5FA 1XVMA 1GBKA 3UY9A 5EW2H 3L33A 4ABBA 4DCDA 2JH0D 2ZIQH 3RXAA 2RA3A 1QRXA 1TMTH 1A46H 1O2WA 2P59A 2ZGJA 3F68H 3I78A 1DWDH 1CHOG 3BTTE 2WPHS 1LPGB 4Q7YA 2ZCKP 1RXPA 4TY6A 1DSUA 4CRGA 5L2YH 1QQUA 3A8AA 1AVGH 1EQ9A 4DURA 2FX6A 4X8TH 1S81A 2CHAC 1W7GH 2TIOA 3BTHE 3FAOA 3KQBA 3I77A 3KHVA 4ESTE 1MKXK 1TNJA 3MFJA 2A31A 1NTPA 2CJIA 2LNCA 3M35A 1ZHMA 4ISIH 2O8TA 5GXPA 1UVTH 1W7XH 2P3UB 2CF9H 1MTNB 3STIA 1Y3YA 4ZROA 1AIXH 3N7OA 3RXJA 3SJ9A 1V2KT 2PW8H 1TONA 4WMFA 1SGDE 1FIWA 1O3MA 2FTMA 4A1XA 2EI6A 2O8UA 3LC5A 2ZFTA 5T3HA 1GJ7B 5EXMA 2A1DB 1AZ8A 1O2QA 2ODPA 2BLOA 2NWNA 3BEUA 1LMWB 1XVOA 2BDCA 1OPHB 5T6FA 4XE4A 1C4V2 2FODA 1BB0B 2J92A 2VWLA 4FUDA 4JZFH 4E7NA 3C27B 2TGPZ 1DT2A 2V0BA 1S6FA 4B1TA 4I31A 1EP6A 3ENSB 2FOFA 2FZZA 1XKAC 1LVMA 1B5GH 2VVVA 4Y7BA 1KDQB 4AFUA 4DJZB 4ZKNU 1KSNA 2SGAA 3KN2A 1QR3E 4X1NU 1XM1A 4A7IB 2HWLB 2PGQB 1L1JA 1MKXH 1BMNH 1S0QA 4Y6DA 4YLUA 2VIPA 5DGJA 4BXWA 1K1JA 3FP8E 2G51A 1C1WH 3SOSA 1TGSZ 2J2UA 3A7TA 1ETTH 4NIWA 1D3DB 1BTXA 3SU0A 3MU0A 2GD4B 3ITIA 2P8OB 1GJ6A 4DIIH 4MPWA 3M7TA 1O30A 3CP7A 2OC8A 1NFWA 1HDTH 2CXVA 5E8EH 3SJKA 4Q7ZA 6GCHF 2PKAA 4YT6H 1DXPA 1HXEH 1J8AA 2QF0A 2G55A 3U8TH 3ELAH 2TGAA 2GP9B 6CHAB 1L1GA 1XUIA 4HGCA 3ZZ5A 4AORA 4B76A 2AMPA 1GDNA 2YNAA 4ABEA 3A7XA 3D23A 1UCYH 2I6QA 1GDQA 2AERH 3O8RA 3E0PB 2XCNA 1INCA 1O2TA 1LHCH 2B7DH 2IN2A 3S9BA 1A3BH 4U32A 2F9NA 2H9TH 3S69A 4MNYA 1EB1H 4GCHG 1V3XA 1J15A 2QN5T 3JZ1B 4ABFA 3GYMA 4X1PU 3AW1A 4IW4E 1CGHA 2OXSA 1S83A 3PO1B 2IPHA 1YGCH 4DW2U 4XBBA 3TJOA 2GMTB 3MO6A 3R3GB 4F49A 4LZ1H 4AZ2B 3MNCA 4CR9A 4IC5A 1QY6A 4WMDA 3MH5A 1UHBA 2Z7FE 4INKA 3RXCA 2BLWA 1TX6A 2A4GA 3SI3H 2FIRH 1P05A 3T26A 1GHVH 2GZ7A 1GVKB 3PM3A 3F6UH 4DY7B 2W7UA 2HNTF 3ESTA 1ELBA 1TGTA 1BMLA 1G3DA 5B6OA 1HAVB 2OUAA 1GBAA 2A2XH 3EQ0H 2I6SA 1O32A 1G30B 2XYAA 2FP7B 1VR1H 4ABHA 1C5ZB 2H1UA 1HJ8A 3LPRA 4ZKSU 8KME2 2NU1E 1MTNC 4D8NA 4R0IA 1RGQA 2VNTA 1AQ7A 1DOJA 2GZ8A 1EJNA 1GJ5H 4AG2A 3UPEA 3QGJA 1NZQH 1F0RA 2GDEH 3ZZ4A 1FY1A 1GI0A 4GVUA 1OSSA 2AS9A 3DT0H 2VH0A 1GCTC 1PJPA 1Q3XA 1S6HA 2FI4E 1SGTA 1RIWB 3ZZ8A 3GCHB 2ZTYA 4UE7H 1AVXA 2AMQA 3SV9A 1HAPH 1C5UA 4MPXA 4CRBA 3H7TA 1SGFA 2PUXB 4Q7XA 3MO3A 1GI5A 2A4QA 2BD8A 4OS4A 2J34A 1HV7A 3BEIB 2PGBB 1YLCA 1UTNA 3A83A 3RU4E 4ABAA 3E8LA 1WCZA 4NZLA 3VXFH 1O35A 1Y3VA 1LHEH 2UWPA 1ARCA 1V2WT 3E1XB 3MNBA 1D3TB 1QJ1B 3GCNA 2FEQH 1SQOA 2RA0A 1JMOH 3RM2H 4NWLA 2ZF0H 1SGFG 1TNKA 1VCWA 1TE0A 1DFPA 1GBLA 1TX7A 3OY6U 3CS0A 3DUXH 2BXTH 3RMLH 1FLEE 1FXYA 1AKSB 3V3MA 3U1IB 4A1VA 1LCYA 4MQAA 1GDUA 1ZMLA 1QIXB 2SFAA 3M5LA 1VITH 2H9HA 2Y80A 2OQ5A 5AVDA 2EC9H 1ZGIA 1THPB 3UWIA 7GCHF 1MTUA 2GGVB 2ZTZA 1ABIH 3NUMA 1LTOA 5AF9H 4TWWA 1O2OA 4WXVA 2H9EH 2FWWA 4O3TA 4B2AA 1IAUA 2QGRA 1WV7H 4CRDA 2DUCA 4WY3A 4ZH8A 5DP6A 1YKTA 1SG8B 3PO1C 3SNEA 1WBGB 1C5RA 2W3KA 1HRTH 3P8FA 1FY3A 1Z8RA 1QB6A 2GMTC 1O33A 1PQ8A 1YC0A 2D1JA 1C5WB 4BNRA 1V2PT 2GCTC 1C4Y2 4O3UA 4X2WA 2C8WB 3UNQA 4U30A 1GVLA 3NK8A 5GWZA 1TNHA 4I8JA 5FBIA 2A2QH 3PWBA 1PFXC 1V6DA 5A0AE 1C2IA 1ZLRA 2WUCA 3A85A 1NESE 2HLCA 3BTKE 3DD2H 1WU1A 4ZAEA 2CN0H 1YPHE 2B0FA 5F8ZA 1T8NA 3A84A 2W3IA 3M5NA 1SL3A 3F9GA 3E90B 1F0TA 1SQAA 5JBAS 2OCVB 1LHDH 2QXGA 3F1SB 1GHAG 3LH1A 5DG6A 4ASHA 4CBOA 3GY4A 2ZWLH 2Z6BD 4R8TB 1VCQA 5LH8A 3BN9A 5EXLA 2FESH 3B8JA 1O3DA 3HKJB 3G01A 1P06A 3P8NA 4NG9H 1MAXA 4AFQA 5C1UA 1BQYA 1D9IA 2FMJA 5PTPA 1TMBH 3FFGA 3Q3YA 5C20A 1ZMNA 1C5VA 4E7RG 1GCDA 1O5BB 4A5TS 2G8TA 1SGEE 2ANWA 3AW0A 1ANDA 2AGIX 2PLXA 3SNDA 1KTSB 1TBZH 9LPRA 1EPTB 2DE8A 3M36A 4YESB 4BTUB 4NGAH 1O5EH 1Z8GA 2BTCE 1KLIH 1JOUB 1AMHA 1G3CA 1HYLA 1QNJA 3GCTF 4Y10E 4JYUH 1TOCB 1YPKH 1NO9H 4Y0YE 5K7RA 1O2XA 4D9QA 1G37A 1YLDA 4D76A 2HVXA 3RXQA 2OC0A 3RXGA 4WXIA 2UUYA 1FUJA 1P03A 4MTBA 5JBBS 2G00A 1W0YH 2RDLA 4FXGH 3RXRA 2FOCA 2FOMB 1KXEA 1D4PB 2B9LA 1HAIH 5ESBA 1O2UA 4X6MA 3KQEA 2WYJA 3T25A 4BTTB 1BJVA 3LGUA 1K1IA 1V2MT 1GMDG 1CA8B 1EZQA 1SGNE 1MU6B 2ZC9H 1GWAA 1C5OH 1EZSC 1BITA 4IS5A 1FPCH 4AFZA 2OC7A 4NIXA 2D8WA 4H6SB 4K1SA 4F4OC 1O3GA 5EQRA 1KTTB 1LHGH 1KLJH 1WYKA 2WPIS 3TGJE 1T8OA 1O3KA 1C1UH 1TX8A 4TPYA 5HXFA 2PSYA 1QA7A 2OINA 4OS7A 1MQ5A 1F5KU 1P2QA 4KTUA 3SU5A 2GV7A 1K1NA 4LXBH 1BMAA 1O3PB 1IQGA 1C1OA 3LGIA 2WYGA 3VB5A 1P2KA 1XUKA 4XOJA 4NIYA 4NZQA 2OQUA 2H5CA 2PFEA 5HMAA 2ZP0H 1P3EA 3ZZAA 2ZU4A 1GMHG 3TJNA 5HM9A 3DHKH 3ZZ6A 4B74A 3MNXA 1K1PA 1AU8A 4X8UH 2TGDA 1CGJE 5E2OA 1HUTH 1O5GH 4X1QU 4DOQA 3QZRA 2ZNKH 3BTGE 5JBTA 3H7OA 1O2RA 4FUIA 5DK1A 1GMCF 5F8TA 5CHAB 4MLFB 1C2JA 3NZIA 4KTSA 1BMMH 4Y8ZA 1UK3A 1EAUA 2VIWA 1EUFA 2ZU3A 3V0XA 2RG3A