3P92A

Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (bpti-k15r/r17g)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PRSS3 protein
publication title The P2' residue is a key determinant of mesotrypsin specificity: engineering a high-affinity inhibitor with anticancer activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p92A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p92A02
1DPOA 1O37A 2ZCLP 3STIA 1BUIA 9ESTA 2SFAA 1LHFH 4MNVA 1BMNH 1LVYA 1HAYB 1P9UA 1GBJA 2AGGX 2XWBI 2SGEE 2EA3A 2ZHFH 2ZHQH 1O3GA 2XBWA 5H4IB 2FDAA 5DPAA 3KN2A 1SHHB 1MTWA 2XC0A 4KTSA 1EB2A 1O2ZA 2GTBA 3RXIA 1G36A 1MTNC 1PPEE 2VGCC 3UY9A 4HFPB 1LTOA 4FVBA 3A7XA 1FPHH 1BTYA 1DUAA 1EAXA 1W7XH 1AO5A 2R9PA 4CBOA 2BLWA 1YBWA 1TGNA 1C5MD 4NSVA 4XE4A 4ISLA 3OY6U 3VB4A 5EXMA 1P9SA 1EAWA 4IC6A 3KQDA 7KMEH 3MH5A 1Q2WA 3E8LA 5PTPA 3FFGA 4AX9H 4B1TA 2ILNA 2PWXA 1HNEE 3TJOA 5LPRA 2ZGCA 4ZHAA 2UUKB 1EAIA 3LPRA 2VIWA 3MU0A 2H2ZA 4A5TS 3LKWA 2XCFA 1QIXB 2BD3A 4TY6A 3BIVH 5AF9H 2W3KA 4AG2A 3SGAE 1P2OA 2SNWA 1L2EA 1KDQA 2STAE 2ZP0H 1ETSH 1RIWC 3SUGA 3P6ZB 4MNXA 4H42U 1UK4A 2UUYA 4UDWH 2J92A 3DUXH 3SJIA 4WF8A 5C1YA 1O2RA 1SOTA 3B23B 1V2WT 2YOLA 1XUJA 3E16B 2BQ6B 1BJUA 5EGMA 5HM2A 5DP7A 1A1RA 4CBNA 1OKXA 3FP6E 1C1WH 2G5VA 1QBOA 2WPMS 1UVTH 1C9TA 3VEQB 3V12A 2BD9A 4ZXYH 3A8AA 3GCOA 3ZVBA 1YP9A 4RKOB 4A92A 2WV5A 5GCHF 2Z7FE 1N8OB 3GYLB 2A5KA 3A80A 1W0ZU 2ZGHA 2ZDVH 1KXDA 3MOCA 4GPGA 1BMLA 1XX9A 2ZWLH 3IWMA 2BTCE 4KP0A 2BYAX 1O5CB 3M36A 2H5DA 1TX8A 2ZA5A 4WXIA 1WOFA 3NWUA 2A7HA 1VJ9U 2PGQB 4ISHH 3A86A 4ABGA 2F83A 2ANYA 1TNJA 2SGQE 2ZTYA 5E2PA 1BTZA 2Y5HA 4DURA 2Q1JA 1FNIA 1IQLA 2FOAA 5JDUB 1VITG 2P3TB 3MH6A 1A4WH 1LVMA 5EQRA 1TYNA 1C1SA 4AFZA 4AN7A 1QRZA 4U2WA 3QLPH 2FMJA 1C5QA 1SGQE 1HIAB 1BITA 1TNHA 4X6NA 1F5KU 3E1XB 1LMWB 3MFJA 1QB9A 4JYUH 1UHBB 1A0LA 1YM0A 4BAHB 1S6FA 2ZPQA 1SGFG 1AFQB 3E0PB 2OLGA 5DO4H 1LKAA 2OBOA 2ZGXH 1CHGA 1EKBB 1G2LA 4K60A 2BVXH 2BHGA 1IHSH 1MTVA 1RJXB 5L2ZH 3S9BA 3HPTB 1DUEA 1GVKB 1S82A 1QL7A 1GVZA 5DP3A 4I8HA 4E05H 3JZ1B 4E7RG 2GZ8A 4YT6H 1ZLRA 5A8ZA 1KXCA 1GHZA 3BEIB 1LPZB 2J2UA 2OINA 4X6PA 3ZYDA 7ESTE 4ZUHA 1WSSH 3AAVA 1HRTH 3FAOA 3KQBA 2F9VA 1CGJE 4B2CA 1V2KT 2V3OH 1Z8RA 1E0FD 1O2LA 1TRYA 3TGIE 4AZ2B 4E06H 1C5VA 1SGEE 1E36B 3A7VA 1FY1A 4ABIA 2VIOA 1A3EH 2VIQA 4X1SU 3S9AA 1YLCA 1OP2A 1BB0B 4MDSA 4FUCA 4Y79A 8GCHF 1F5LA 5A0CA 1YPJH 2ZCHP 1ACBE 4INKA 4B2AA 1NRSH 1UJ1A 3MNCA 1KLTA 3MU5A 2CXVA 4K1EA 1TX7A 4B73A 2VWNA 1O2JA 4ZKOU 4BOHA 1NT1A 1O34A 1HAGE 4MNYA 3SV2H 2RA0A 4I8LA 2RDLA 1SPJA 4GLYA 2Y81A 1AQ7A 1SLWB 1YPGH 3WY8A 1NFWA 3ZZ9A 4AB9A 3LH1A 1EJNA 3URDA 2R3YA 3A83A 1W14U 3SNDA 1DDJA 1C2DA 4X0WU 1FPCH 1FXYA 4X1RU 3QX5H 3SV7A 1G3DA 3SU0A 3RM2H 3S0NA 1NN6A 1K21H 5CHAB 2IOTA 1MKWH 1GJ8B 1GJDB 2ZFRH 3UQVA 3ZZ3A 2VB0A 5EG4A 1GMDG 1KLIH 4X6MA 2XC5A 4DGJA 4DCDA 1BIOA 1ZTKA 1XKAC 1AFQC 2XTTB 1GMHG 1SLUB 1C1UH 2TBSA 3LH3A 1C1PA 2GP9B 1GI4A 3BTTE 3RC6A 1GHAG 4YLUA 1PQAA 1WTHD 5E8EH 1K1OA 1YCPH 1F5RA 3CS0A 2EEKA 1ZZZA 5F03A 6ESTA 2J34A 1GCTC 3M35A 1O38A 5ABWA 1T7CA 2HLCA 4MPWA 1FZZA 3MTYA 3F1SB 1C1VH 1ZJDA 1QQ4A 3S7HB 2FTLE 1ANBA 1VITF 1ZPCA 1E37B 5GPIB 1TLDA 1IQGA 3SNEA 3LGWA 3ZZ8A 1DS2E 1SGFA 4WMFA 2QF0A 3T25A 5C1UA 3SU1A 1QBNA 1AIXH 5DP9A 2FI5E 4CR5A 1F2SE 2ZTXA 5HMAA 4X8UH 3C1KA 1NFXA 1WQSA 2VVCA 2BY5X 1YLDA 2CJIA 3S7KB 1L4DA 1VR1H 4CRAA 3SUEA 1MQ6A 1ESAA 2XBVA 4YESB 1ZR0A 2YNAA 2QAAA 1AMHA 3A8BA 1LO6A 2Z9IA 4WWYA 2Z3CA 5F8TA 1UVOA 1GHBG 1NRRH 5C20A 2OUAA 3RXCA 5EW1H 4B76A 3UNSA 2VINA 1VGCB 2ZDLA 1WBGB 1LPGB 3F9HA 3MU8A 5BPEA 2AFQB 1ZHMA 1H8IH 4DT7B 1EATA 1RTLA 3PMJA 1OS8A 3SGQE 1BHXB 3K9XB 1EZQA 1ZJKA 2C8ZB 3AASA 1KXFA 3KEEA 1BRCE 2OTVA 4Y7BA 1FDPA 3BG8A 2BY9X 3MWIU 1IQFA 3RMOH 4ZAEA 4BTTB 1TGBA 1TRNA 1ZTJA 3A88A 4I32A 3BG4B 3T5FH 5C2ZA 1GBAA 2PKSB 2GCTB 4ABEA 5CHAC 1RTFB 5BRRE 1E34B 4J1YA 2IJOB 2UWPA 1SSXA 4BANB 3QTVH 3V13A 2O8WA 4WMEA 1TQ0B 4GSOA 1L1JA 4FVDA 5I46H 1MMJN 1O2KA 3TPIZ 5GJ4B 1IQEA 1QY6A 1SOZA 1J16A 5FCRA 1Z1JA 2Z9JA 1ZOMA 1PQ7A 3OSYA 1HXEH 1SGDE 1UVPA 3SU2A 1CHOG 1KTTB 3DT0H 2RG3A 3TH4H 3E90B 3DHKH 2WPIS 1O2VA 2H1UA 1P03A 1NC6A 1N1LA 2F9BH 2VH0A 1V2PT 1W11U 4Q80A 3V3MA 3QK1A 1DLKB 3BN9A 1BMMH 1JBUH 4ZHLU 2FP7B 5EU8A 4Q7XA 4UE7H 3ZZ4A 8KME2 2TGPZ 1LKBA 3IITA 3SJOA 1QR3E 2CHAB 1OWEA 1TBZH 2F9NA 4AFQA 2AMPA 4YOJA 4TWWA 2LPRA 4ISNA 1HYLA 1O2UA 2AYWA 3TGJE 1UTOA 1W13U 3ZV8A 6CHAB 1WU1A 4ZKNU 1GBMA 1KTSB 1C2EA 1GBLA 1MAYA 1GMHF 2IPHA 1GJBB 2BLQA 2ZQ2A 1ELVA 1VZQH 1P04A 1P11E 1D6WA 1O3EA 2FXRA 2VWOA 3GCNA 3MH4A 2PW8H 4YM9A 1Y3UA 2OQUA 1GDUA 3M3VA 1P3EA 2A4GA 1VGCC 3P8GA 2ODQA 1GJAB 1NESE 2O9QA 2PTCE 1FY3A 1OWIA 1W0YH 3Q00A 1HAOH 1NFYA 4OS6A 1W3CA 3PROA 3A85A 2G81E 5ETXA 1WTGH 4X2VA 1GHYH 1O5DH 5EODA 2ZFFH 4HI3A 2AMDA 3BG4C 1RS0A 6GCHG 1AKSA 1DWDH 2ODPA 1C2IA 1CSOE 2GCTC 2PKSC 3OTJE 3RUOA 2QA9E 2ZDMA 5IDKA 1V2VT 4IC5A 2XXLA 3SQHE 2C8XB 1OYTH 2C8YB 2FPZA 3PWCA 1IQHA 4GHTA 1YPMH 1GHBF 2PHBA 1FMGA 2FOEA 2R2WU 1XVOA 2J9NA 1EOLA 4GVUA 3P8NA 2Y7XA 3D65E 3RMMH 1G30B 1GG6C 2CMYA 4TWYA 1AZZA 1B5GH 1PPCE 1P0SH 1GHXH 4B71A 1THRH 5E0HA 1A7SA 4JK5A 1RRKA 1A5IA 1Z8JB 1K1PA 3EAJA 1FN8A 3ATWA 2FLBH 4FUEA 1ZHPA 1WYKA 3I78A 5HM9A 2WUCA 4GUXA 2P59A 1YKTA 2CHAC 4IS5A 1K1JA 2ZU3A 1UTQA 2A5AA 2R2MB 3B9FH 8ESTE 1IAUA 1Y5AT 4LK4A 4YLQH 1Y8TA 6CHAC 1YPEH 1PPGE 3SI3H 1EJMA 2AGEX 3E91A 3TNTA 3BTHE 1CHOF 1TGSZ 1VITH 1UTLM 2V6NA 6LPRA 2J4IA 4AGJA 5FCKA 1Y3XA 3RXVA 3UOUA 1JRSA 2ZHWH 1W12U 3A7YA 1GBEA 5E0GA 3PMHB 3PO1B 4JYTA 3EA9A 3MH7A 5AVDA 1QJ6B 1THSH 3Q3KA 1GMCF 2PR3A 3KL6A 1O3HA 3NXPA 1GL0E 1T4UH 3C27B 2YNBA 1SQOA 1ELEE 2BM2A 2WPKS 1W7GH 1OWDA 2OC7A 1D3DB 3ZVGA 4R8TB 3EA7A 2Z3EA 2BLVA 3GDUA 4I8JA 1DSUA 2VWMA 1V2TT 1TNLA 2AEIH 2ZQ1A 1KXAA 5HYOA 3SBKA 4MQAA 3RXAA 4ABAA 4XOJA 1E35B 3SHAH 2WINI 3NUMA 1AWHB 2UUFB 3STJA 3TITA 2ZI2H 2HALA 1K2I1 4LZ4B 3BTME 4JYVH 4XBCA 1EZXC 2P93A 3VGCB 1U6QA 3AW1A 2BQWB 3HK6B 2IN2A 3DFJA 4WVPE 1P2JA 5C5OA 1GHVH 4X1NU 2JH6D 1HXFH 1ZSJA 4A6LA 4A1VA 1Z6JH 1TFXA 2ZU5A 2BZAA 1G3EA 3GY5A 2HRVA 4TPIZ 3ATMA 1D3PB 2FWWA 1DFPA 3GY2A 4ABDA 5C5NA 2SNVA 2CF9H 2O8UA 2ZO3H 1AD8H 5L2YH 1SVPA 1HAPH 3TH3H 4FUHA 3P95A 1JMOH 2ALVA 1GCDA 3I29A 3T62A 3MNBA 2G4TA 2FOGA 3MO6A 2BY7X 3SO3A 4F49A 3UWJH 4K69A 1OP0A 3L6PA 2H9HA 4I8KA 4BNRA 1EXFA 1ZSLA 3RXJA 3UNQA 1AI8H 1S5SA 1ELTA 3GY8A 3LOXA 5C3NA 2Z9GA 4NFFA 4Y8ZA 4BAMB 1QTFA 4YT7H 1Z71A 1W10U 2FS8A 3SV8A 2C93B 3ZV9A 3RXTA 1O3KA 3PO1C 1MBQA 2FTMA 2B9LA 1BRAA 3FZDA 3U98H 1F7ZA 2GKVE 1C4Y2 2EI6A 4A1XA 3ZVAA 4INHA 1QURH 2FO9A 2OD3B 2QY0B 3RXKA 5C67A 3A8DA 3TIUA 4UONA 3SU5A 2FYRA 1PPFE 2G52A 2I6QA 4FUDA 2EC9H 2F3CE 4Y76A 1E38B 4IBLH 1VJAU 4JZ1A 1PJPA 1SR5C 1C9PA 1J17T 1AE8H 2ZECA 1C5RA 4BAOB 1MTSA 3GY6A 2QN5T 2ZC9H 5JBBS 2J94A 1YC0A 3EDXB 3P8OA 2W3IA 7GCHG 2BDCA 1TX6A 1OPHB 3VGCC 2FEQH 3GICB 4NWLA 5E2OA 1ETTH 4INLA 1IQNA 1BTHH 1CQQA 2AS9A 2A0QB 1NU7B 1L1NA 3BTKE 3FANA 4FU8A 3ZVDA 5T3HA 1Y3YA 3GCTG 1X7AC 1BTUA 1LHEH 4CH8B 1T8MA 2GCHG 2FX6A 3I77A 3SU4A 2BVSH 1SMFE 3P70B 2AIPA 4O03A 3RXBA 4Y7AA 1DXWA 2A7JA 1GBBA 2FX4A 3ZZ5A 1XXFA 1NY22 1S83A 2FOHA 5DGJA 3ZVEA 3M5LA 5EQSA 2Y6TA 1CO7E 1LVOA 3R0FA 4D9QA 1BTXA 1L4ZA 1GCTB 1GL1A 1SBWA 1S6HA 3RU4D 3D49H 2C4FH 3F68H 1SHYA 3QGNB 4OS1A 2PKAA 1V2ST 5FPSA 1MD7A 1QQUA 3A7ZA 3RP2A 2QCYA 4FUJA 1EZUC 2GT8A 2HPPH 4LXBH 1BT7A 4YO9A 2R0LA 4RSPA 1HB0B 3QGJA 1GDNA 2G5NA 2R3UA 2BXUH 4B2BA 3R3GB 4AORA 4RKJB 1NFUA 1V2UT 3M61U 4FXGH 5A0BA 1V3XA 1TE0A 4AFUA 1GHWH 1AHTH 1F92A 1ORFA 3A82A 4JZIA 2OC8A 4B75A 1O2HA 1F0UA 1Z8GA 3QZRA 3RXFA 2ZTZA 1KYNA 1VCPA 3SUDA 2O8MA 2DE8A 2FI3E 1O2SA 4NZQA 2NU3E 3T2NA 2XNIA 1ZMNA 2A4RA 1C5UA 3SJ9A 2OC0A 1DWEH 3LT3A 4K2YA 1QJ7B 3PLKA 1GBHA 2PTNA 1V2MT 1EPTB 4O3TA 1OSSA 2BY6X 1LDTT 2FOMB 1O3IA 3JZ2B 1TABE 1P2IA 3E0NB 1YPHC 3UTUH 2A2XH 2HWLB 1T4VH 1O3FA 1T8OA 1Z7KA 1ZYOA 1TONA 3BEFB 2G00A 3SNAA 4YOGA 4KKDA 1GI3A 1S81A 2XYAA 4WY3A 3U8RH 1UO6A 1DICA 4LOYH 4JZDH 1J15A 1DM4B 2Y5GA 2KAIB 4K3JA 4Y10E 2Z9LA 1C4U2 2GV6A 1HAVB 3LGTA 2B7DH 1H9LB 1O3JA 2A1DB 3RXOA 4BTUB 7GCHF 3CP7A 3U1IB 5T6FA 4E7NA 4AOQA 4ZROA 4AB8A 1EP6A 2TGTA 3A7TA 3KGPA 3TK9A 5JBTA 5TCCA 2FODA 1TIOA 1C2GA 1N6YA 3W94A 1FJSA 1C5YB 1FONA 3LGVA 3ATLA 3M3SA 4FUFA 4ASHA 2ZKSA 2QXHA 2GGVB 2D2DA 3F9FA 3GCTF 3SHCH 5FPYA 5GDSH 1ANEA 1G3CA 3MU4A 5FHTA 1PYTC 4CR9A 1NZQH 4UEHH 3LC3A 1TNKA 3MU1A 5J4QA 2THFB 3RLYH 3BTFE 2D8WA 5TCAA 2GDDA 1BJVA 2SGPE 3SI4H 1O3BA 1OX1A 3UOPA 2H6MA 4VGCB 3CS7A 4DVAU 3BV9B 1C5XB 2BZ6H 1EB1H 3SU6A 1C1NA 2BOHB 2F91A 1HPGA 3UPEA 3Q3YA 1T8LA 2CN0H 2PSYA 1HAHH 2M5TA 3LONA 1SFIA 4D76A 1FAKH 2TPIZ 3SZNA 4FUIA 4Q7ZA 1OWKA 4D7FA 3ATIA 1P12E 1DXPA 3TGKE 1TA6A 4K8YA 1EPTC 2AERH 1GBTA 1O5AB 1CBWB 1MKXK 2ZEBA 3QDZB 3UNRA 3FP8E 1FY4A 3RM0H 5A8XA 4Z6AH 3GY3A 1MH0A 3RXGA 1S0RA 3K65B 5LPFA 1P09A 1DANH 1MKXH 1V2LT 4ZHMU 1O31A 2EI7A 1RGQA 1SFQB 2NU2E 3ZYEA 5A0AE 1V6DA 4SGBE 3RMNH 3UIRA 2PUQH 1K1LA 1GG6B 1BMAA 2A7CA 3TVJB 2FI4E 1C2HA 2DE9A 1TALA 1HIAA 3FP7E 3IG6B 4I7YH 4BXWA 5A2MH 2Z9KA 4AYVB 2ANKH 1EAUA 1THPB 1DVAH 2ZDNA 1AGJA 1UHBA 2P3FH 2ZIQH 1ZTLA 1ARBA 2CV3A 5F8ZA 1HLTH 2PV9B 1TGTA 1P2KA 1C2LA 1HJ8A 1MZAA 1O0DH 1T32A 5T6GA 1FUJA 1T31A 1G2MA 1GMDF 3M7UA 3M3TA 2ZU1A 3PMAB 5TJXA 3EA8A 1C1QA 1TMBH 4BXSA 2XW9A 3RXEA 1QGFA 1TWXB 1C5PA 1WCZA 1Z1IA 3F9EA 2UWOA 1O2GH 2GMTB 2JH0D 1O5EH 1P05A 4IW4E 2A5IA 2F9OA 4A1TA 1GHAF 3F9GA 3LJOA 4NCYA 4VGCC 4ABFA 2G51A 3BEUA 2ZDAH 1KDQB 4MVNA 4FU9A 3UWIA 1BBRE 1H9HE 3MNSA 3RXDA 1BCUH 1ZMLA 1MQ5A 1S84A 1XXDA 1XKBC 2XWAA 3GISB 1TOCB 2TIOA 1O3NA 1MZDA 4NIVA 2QGRA 3RXUA 3Q3XA 2HOBA 3PM3A 3BF6H 1CBWC 1GGDB 3GDSA 1MBMA 1HAXB 2BLOA 2QXGA 2BD5A 4H4FA 4BAQB 1SGTA 2C3SA 2AH4X 2G55A 2ZHDA 4O97A 4AYYB 1SL3A 3MO3A 2BY8X 3NK8A 4MG3A 1QNJA 5J4SA 4NSYA 1L0ZA 4I31A 1SGYE 1NROH 3ZVCA 1WQVH 3MO9A 1SGIB 3EQ0H 1JOUB 1NRQH 3LU9B 2V35A 1UK2A 1O30A 2JETB 5GWZA 4KTUA 4ZH8A 1P2MA 2W26A 4WJG2 1RD3B 4Y8XA 5LH8A 3NPSA 3T29A 1ZMJA 1LHCH 5GIBA 1BRUP 1YGCH 1GVLA 1EUFA 1YCPM 4NA7A 4U01A 1ELCA 3T27A 1ZRKA 4JCNA 1LCYA 1TA2A 2QYIA 2XRCA 4CREA 1AVGH 2ZG0H 4Q2KA 3BTEE 1JWTA 1WV7H 4MPVA 2VU8E 3L3TA 1O33A 4ZMAH 1SGCA 2P94A 2ZU2A 1IQMA 1TPAE 1D4PB 3MNXA 1GPZA 3EYDA 5AHGH 1TMTH 4UFFH 1SGRE 3TK6A 1K1MA 5EPYA 4CRBA 1PQ8A 3SNBA 3LGIA 1T8NA 2GZ7A 1D9IA 3PMBB 2GMTC 5DP5A 5F6MA 2BMGB 1G9IE 5A8YA 4JZFH 4MNWA 1C5TA 2AGIX 4XBBA 1K22H 3RC4A 3RU4E 5G4BA 1PFXC 3B8JA 2CF8H 4UFEH 2Q6GA 2WUBA 4AFSA 1AU8A 1ELDE 1MU8B 1S0QA 2HVXA 2FOBA 1NPMA 3QUMP 1IOEA 1UVUH 1O2YA 3MHWU 2VH6A 2ZF0H 1QBVH 2WV4A 3BTGE 3PB1E 3RXHA 1CT4E 2Z94A 4U32A 4JMYA 1NRPH 4UFGH 3TNSA 1DWCH 1GGDC 1CVWH 1LPKB 4X1QU 1K28D 3KF2A 2ULLA 4OS7A 1Y3VA 2ZDKA 3ZZ6A 1LHDH 1AVXA 1MTUA 3U1JB 1C5ZB 2Q6FA 5EXLA 1O3OA 3SOSA 4X2YA 5LPEA 4HGCA 1NO9H 1YPKH 1ID5H 3RDZA 4Y8YA 1UK3A 5L30H 5K0HA 3TJVA 3P17H 5E0JA 2ZFTA 4IMQA 1DY9A 1ANCA 3RMLH 1TNIA 2JETC 1HDTH 2BOKA 4HZHA 1ZGVA 1IQKA 4GHQA 4ZXXH 1D6RA 2SGFE 2XBXA 1UCYE 4Y6DA 1JXPA 1C2FA 3V0XA 1TOMH 1HV7A 1WUNH 5EPNA 1KSNA 2Y80A 3U8TH 1CE5A 3ESTA 4YZUA 6GCHF 2OCVB 2O8TA 1AE5A 4X8SH 1V2JT 3RXMA 2VIVA 2OP9A 4DOQA 2HNTF 1KXEA 1GDQA 1QL8A 3EE0B 2ZPRA 4Z0KA 3ODFA 3VXFH 3GCHB 9LPRA 1V2OT 2P16A 2VIDA 2ZCKP 4OS5A 1C1TA 5EOKA 1C5NH 3QTOH 3A8CA 2HNTE 4O9VA 1KXBA 4NG9H 1P2QA 2BVRH 1GI0A 1O3CA 1BBRK 1AUTC 3RC5A 1CU1A 5EW2H 3MYWA 3LDXH 3ZVFA 1PQ5A 2GX4A 4DW2U 3AW0A 3VXEH 3SQEE 1HAIH 4XBDA 8GCHG 4YOIA 2NU0E 1INCA 1G32B 2AMQA 3RXLA 3LIWA 3OY5U 3TJUA 2WPLS 1AFEH 2J38A 3ENSB 1BBRH 1MCVA 2QC2A 5LGOA 1LQDB 1XUIA 1HJAB 4DY7B 4ESTE 4CHAC 1C2MA 1TBQH 1O2NA 3M5MA 1AZ8A 3KQCA 1GWAA 2RA3A 3SORA 3QZQA 4M7GA 2FOCA 1PYTD 1O2QA 3VB5A 2BDGA 2GD4B 1ARCA 5DP4A 3ELAH 1N6XA 1SG8B 1HJ9A 2ESTE 3QN7A 1TB6H 1FY5A 5HGGA 3PV4A 1QB1A 2ZPSA 2VWLA 1O2WA 1UTPA 3E3TA 1AN1E 4ZKSU 1AUJA 1SGPE 4MLFB 2ZFPH 4X8TH 4J2YB 2ANMH 2GVFA 4GAWA 4OS4A 5AFYH 3RXPA 2BDIA 2QXIA 3PYHA 1B7XB 2BDBA 4K1TA 2ANWA 3M5OA 1O5GH 2BX3A 1H8DH 1C2KA 4TY7A 2H9EH 3H7TA 5FPTA 4KTCA 2OXSA 5ESTE 1Y3WA 1K9OE 5DP6A 3UQOA 5AFZH 1UTKA 3H5CB 3SJ8A 3RU4T 2ZFSA 4ABJA 3TH2H 2WPJS 2CGAA 2Y7ZA 1QRWA 2QV1A 4NFEA 1GBDA 1C2JA 4RN6A 5JPMH 5SGAE 1YPLH 3QO6A 1UTJA 1ZSKA 3ATKA 3GCHC 1LVBA 2FM2A 1FIZA 4DIIH 1A46H 3NZIA 4HTCH 4WXVA 2G8TA 1GI7B 3DA9B 3TK5A 3S9CA 3BIUH 1DE7H 3DFLA 3OU0A 2D26C 3SU3A 1PPBH 3OYPA 1BQYA 2Q6DA 2P3UB 1CT2E 2W5EA 4NA8A 1FQ3A 1TGCA 3A81A 1LQEA 3Q77A 2XCNA 4GCHG 3BTWE 1OWJA 1DX5M 1QFKH 4K8BA 1A61H 4OGYA 1HFDA 5A09A 1TAWA 4Y0ZE 3UUZA 3ITIA 4CRDA 1A5GH 2GV7A 3S69A 1VCQA 3AVZA 1HJAC 2A2QH 1OWHA 2PLXA 3G01A 1V2RT 2A32A 1QA7A 1SC8U 8LPRA 1FV9A 1Y5BT 1ABJH 2P8OB 2ZGBH 3VPKA 4BTIB 2FYQA 2A31A 4FUBA 3KHVA 1NU9A 4NIYA 2FIRH 5JYIA 3TLOA 4ABHA 4X8VH 1RFNA 2TRMA 1C1OA 5EXNA 1FIWA 4U30A 2BDAA 1SQTA 2XBYA 2A4OA 1BA8B 4XDEA 4NZLA 1Y59T 2A4QA 1A2CH 3AAUA 3GDVA 2QIQA 2BXTH 2P95A 4X1PU 1O2OA 4I33A 1H9IE 1B0FA 3PLBA 4UFDH 4Y0YE 1QRXA 2BD8A 2ODYB 3VB3A 1UCYK 4X2WA 2B8OH 2B0FA 1V2NT 4F4OC 1XVMA 1HUTH 1N8OC 3GYMA 4A7IB 3LGYA 1ESBA 4DIHH 1AVWA 3SV9A 1AKSB 2I6SA 5FBEA 3SV6A 1XUGA 1HBTH 4K1SA 4MPXA 3KQEA 5EQQA 1UCYH 2BB4A 1NS3A 2Y82A 1V2QT 1ESTA 1MKWK 1H1BA 2GDEH 5JB8S 2H9TH 2G4UA 2NWNA 4WMDA 1GBFA 4X2XA 3MMGA 3EGKH 4OS2A 1DITH 1GJ4H 1NRNH 2C8WB 1TNGA 2VNTA 2LNCA 3HKIB 1CA0B 3LC5A 3HKJB 1FI8A 2O8LA 3L33A 3VB7A 3F6UH 3PWBA 3O8CA 3SJKA 3T28A 4XFQA 4AG1A 1GJ7B 2BD7A 3Q76A 5K7RA 3P92A 2R0KA 1SB1H 2TGDA 1YCPK 1SI5H 1QL9A 2A45B 3SW2B 5ESBA 1BRBE 4TPYA 4I8GA 1YF4A 1EZSC 4CRCA 3A84A 4X6OA 2VIPA 3M37A 1JIMA 1MU6B 3SGBE 1HGTH 2GCHF 3K6ZA 3OX7U 1QB6A 1D3TB 1H4WA 1O3MA 4PROA 1HAZB 2Z6BD 1GJ9B 5FX6A 2P8OC 3HGPA 3W95A 1OOKB 3D62A 2NU1E 3A87A 3VFEA 3FZZA 5T6DA 2FOFA 2WYJA 1GJCB 1TBRH 1C5SA 4H6SB 1BTWA 3MI4A 3ZZBA 1ZHRA 3M7TA 3H7OA 1FAXA 2EI8A 3ZZAA 1BDAA 1UVSH 4NA9H 4GCHF 1A0HB 1YYY1 1ZGIA 2OQ5A 1TQ7B 2BDHA 5HXFA 1P02A 1O5FH 2WPHS 1ABIH 1FLEE 2ZGJA 2SGAA 3VB6A 1O2IA 3RXRA 3U8OH 1Z8IB 1P8VC 1QHRB 4JZEH 1KY9A 3UR6A 1F0SA 1NTPA 2ZHEH 1ELGA 1J8AA 3BSQA 1A5HA 1A3BH 4ISIH 5DG6A 1SLVB 4TYDA 4KELA 1MD8A 1KIGH 1GI5A 3O8DA 4WH6A 5GXPA 1DLEA 1AY6H 1CA0C 2PGBB 3NKKA 4AGKA 2PFEA 1TMUH 4QT8C 3O8BA 1O35A 2FS9A 3PLPA 2PSXA 2UWLA 1MCTA 1AB9B 2FZZA 3URCA 4FU7A 4THNH 5F8XA 3RXQA 1SLXB 2BQ7B 1XUFA 1MUEB 3U69H 1O3DA 4KGAA 2WYGA 2C90B 4IN2A 2JH5D 2ZZUH 1CA8B 3BTDE 1VCWA 2STBE 1OXGA 1O32A 1W8BH 3KNXA 1F0TA 4MTBA 2BD2A 3P8FA 1YPHE 5JBCS 1XUKA 1HCGA 2K1QA 2HPQH 1F0RA 1CT0E 4LZ1H 4MPUA 1GI1A 1GI2A 2F9UA 3UFAA 1O3AA 4H6TA 7LPRA 2Z3DA 3TJNA 1GMCG 1PPHE 3M5NA 1P06A 1K1IA 3LGUA 1DSTA 2ZU4A 2H5CA 3CENA 1EOJA 1TPPA 1ELAA 1BOQA 2VVUA 5FBIA 1O2XA 4R0IA 1C5LH 2GT7A 1GBCA 4D8NA 3U9AH 2GZ9A 1BZXE 1ZPBA 1C5OH 3ODDA 1DWBH 4ZKRU 1Y5UT 2BX4A 2TGAA 4NIXA 1Z6EA 1D3QB 3PTBA 3D23A 2PUXB 1B0EA 1IHTH 1C1RA 1LHGH 2SGDE 1S85A 1SGNE 2V3HH 2VJ1A 1JRTA 3SNCA 1G3BA 1FN6A 3K2UA 2ALPA 3ZZCA 3N7OA 1P3CA 4B74A 4NIWA 1QCPA 1XM1A 5DKMA 5FX5A 3A89A 1MAXA 1TPOA 1O2PA 3ZZ7A 2RCEA 1XMNB 5CE1A 2NU4E 3TU7H 1JIRA 1EPTA 2W7UA 1XUHA 1M9UA 3SUFA 1OP8A 1C1MA 1EQ9A 1KLJH 1QA0A 1Q3XA 1W2KH 1GJ5H 1FY8E 3E6PH 1WAYB 1ELFA 1AB9C 2OBQA 2OC1A 3SN8A 3A7WA 1PPZA 2ASUB 1GI6A 2AIQA 4BAKB 3UR9A 1L1GA 2HNTC 1P01A 1RXPA 1BTPA 1AWFH 3HK3B 4IN1A 2JKHA 2XC4A 2KAIA 1O39A 4JK6A 1CGIE 2VVVA 5FXLA 5JBAS 4D9RA 2QXJA 1HAVA 1O3PB 3GY7A 2J95A 1UTMA 2Y5FA 1GJ6A 3O8RA 5JB9S 1EP5A 5B6OA 1P2NA 1OYQA 1MTNB 3LJJA 1GBIA 5I25A 2VGCB 4DJZB 2ZFQH 1RTKA 5L6NH 4SGAE 4CRGA 1IQIA 1SQAA 4ISOA 2HGTH 4K5ZA 2FLRH 5FAHA 1DY8A 4WH8A 4IGDA 1O5BB 3HGNA 5IYTA 1QJ1B 3V7TA 1O3LA 3T26A 1P57B 2V0BA 4ABBA 1EASA 5DJ7A 1NM6A 3K6YA 4CH2B 4Y71A 2PKAB 3NCLA 1UTNA 1G37A 5C1XA 1K1NA 1O2TA 5CMXH 1ZRBA 5GCHG 1UMAH 1DT2A 4Q7YA 3KCGH 1O36A 1ELBA 4FUGA 3GOVB 3RLWH 1O2MA 1GI9B 2FESH 3ZZDA 4CHAB 1ANDA 1EJAA 1RIWB 2ZNKH 1C4V2 3PTNA 3DD2H 4Y11E 3QWCH 4CRFA 4DG4A 1C5WB 1J9CH 1EX3A 2BDYA 5DK1A 4IMZA 3KIDU 3FVFB 1ZPZA 3HATH 1Q31A 4XSKU 3RXSA 2B5TB 4YTAA 5DP8A 4NWKA 3UREA 1BHXF 1J14A 1A0JA 2F9PA 2DUCA 1IQJA 3BTQE 1GBKA 1P10A 4UD9H 1GI8B 2BD4A 4NGAH 4OGXA 3GY4A 2UUJB 1CGHA 1ETRH 4O3UA 1TPSA 2QF3A 2W7SA 1TRMA 1DOJA 4D7GA 3M7QA 2D1JA
chains in the Genus database with same CATH superfamily
1DPOA 1O37A 2ZCLP 2J98B 3STIA 1BUIA 9ESTA 2SFAA 1LHFH 4MNVA 1BMNH 1LVYA 1HAYB 1P9UA 1GBJA 2AGGX 2XWBI 2SGEE 2EA3A 5C17A 2ZHFH 2ZHQH 1O3GA 2XBWA 5H4IB 2FDAA 5DPAA 3KN2A 1SHHB 1MTWA 2XC0A 4KTSA 1EB2A 1O2ZA 2GTBA 2LP6A 3RXIA 1G36A 1MTNC 1PPEE 2VGCC 3UY9A 4HFPB 1LTOA 4FVBA 3A7XA 1FPHH 1BTYA 1DUAA 1EAXA 1W7XH 1AO5A 2R9PA 4CBOA 2BLWA 1YBWA 1TGNA 1C5MD 4NSVA 4XE4A 4ISLA 3OY6U 3VB4A 5EXMA 1P9SA 1EAWA 4IC6A 3KQDA 7KMEH 3MH5A 1Q2WA 3E8LA 5PTPA 3FFGA 4AX9H 4B1TA 2ILNA 2PWXA 1HNEE 3TJOA 5LPRA 2ZGCA 4ZHAA 2UUKB 1EAIA 3LPRA 2VIWA 3MU0A 2H2ZA 4A5TS 3LKWA 2XCFA 1QIXB 2BD3A 4TY6A 3BIVH 5AF9H 2VBCA 2W3KA 4AG2A 3SGAE 1P2OA 2SNWA 1L2EA 1KDQA 2STAE 2ZP0H 1ETSH 1RIWC 3SUGA 5FL7D 3P6ZB 4MNXA 4H42U 1UK4A 2UUYA 4UDWH 2J92A 3DUXH 3SJIA 4WF8A 5C1YA 1O2RA 1SOTA 3B23B 1V2WT 2YOLA 1XUJA 2XOKD 4FOUC 3E16B 2BQ6B 1BJUA 5EGMA 5HM2A 3DCLA 5DP7A 2JIZD 1A1RA 4CBNA 1OKXA 3FP6E 1C1WH 2G5VA 1QBOA 2WPMS 1UVTH 1C9TA 3VEQB 3V12A 2BD9A 4ZXYH 3A8AA 3GCOA 3ZVBA 1YP9A 4RKOB 4A92A 2WV5A 5GCHF 2Z7FE 1N8OB 3GYLB 2A5KA 3A80A 1W0ZU 2ZGHA 2ZDVH 1W0JD 1KXDA 3MOCA 4GPGA 1BMLA 1XX9A 2ZWLH 3IWMA 2BTCE 4KP0A 2BYAX 1O5CB 3M36A 2H5DA 1TX8A 3N7EA 2ZA5A 4WXIA 1WOFA 3NWUA 2A7HA 1VJ9U 2PGQB 4ISHH 3A86A 4ABGA 2F83A 2ANYA 1TNJA 2SGQE 2ZTYA 3NRLA 5E2PA 1BTZA 2Y5HA 4DURA 2PP6A 2Q1JA 1FNIA 1IQLA 2FOAA 1EFRD 5JDUB 1VITG 2P3TB 3MH6A 5EJLA 1A4WH 1LVMA 5EQRA 1TYNA 3U28C 1C1SA 4AFZA 4AN7A 3F2GA 1QRZA 4U2WA 5CHBA 3QLPH 2FMJA 1C5QA 1SGQE 1HIAB 1BITA 1TNHA 4X6NA 1F5KU 3E1XB 1LMWB 3MFJA 2M2AA 1QB9A 4JYUH 1UHBB 1A0LA 1YM0A 4AC9A 4BAHB 1S6FA 2J5UA 1SGFG 2ZPQA 1AFQB 3E0PB 3W1EA 2OLGA 5DO4H 1LKAA 2OBOA 2ZGXH 1CHGA 1EKBB 1G2LA 4K60A 2BVXH 2BHGA 1IHSH 1MTVA 1RJXB 5L2ZH 3S9BA 3HPTB 2OK5A 1DUEA 1GVKB 1S82A 1QL7A 1GVZA 5DP3A 4I8HA 4E05H 3JZ1B 4E7RG 2GZ8A 4YT6H 1ZLRA 5A8ZA 1KXCA 2IPQX 3OFND 1GHZA 3BEIB 1LPZB 2J2UA 2OINA 4X6PA 3ZYDA 7ESTE 4ZUHA 1WSSH 3AAVA 1HRTH 3FAOA 3KQBA 4M9FA 2F9VA 1CGJE 4B2CA 1V2KT 2V3OH 1Z8RA 1E0FD 1O2LA 1TRYA 3TGIE 4AZ2B 4E06H 1C5VA 1SGEE 1E36B 3A7VA 1FY1A 4ABIA 2VIOA 1A3EH 2VIQA 4X1SU 3S9AA 1YLCA 1OP2A 1BB0B 4MDSA 1KMHB 4FUCA 4Y79A 8GCHF 1F5LA 5A0CA 1YPJH 2ZCHP 1ACBE 4INKA 4B2AA 1NRSH 1UJ1A 3MNCA 1KLTA 3MU5A 2CXVA 4K1EA 1TX7A 4B73A 2VWNA 1O2JA 4ZKOU 4BOHA 1NT1A 1O34A 1HAGE 4MNYA 3SV2H 2JJ2D 2RA0A 4I8LA 2RDLA 3FKSD 1SPJA 4GLYA 2Y81A 1AQ7A 1SLWB 1YPGH 3WWBA 3WY8A 1NFWA 3ZZ9A 4AB9A 3LH1A 1EJNA 3URDA 2R3YA 3A83A 1W14U 3F2FA 3SNDA 1DDJA 1C2DA 4X0WU 1FPCH 1FXYA 4X1RU 3QX5H 3SV7A 1G3DA 3SU0A 3RM2H 3S0NA 1NN6A 1K21H 5CHAB 2IOTA 1MKWH 1GJ8B 1GJDB 2ZFRH 3UQVA 3ZZ3A 2VB0A 5EG4A 1GMDG 1KLIH 4RI0A 4X6MA 2XC5A 4DGJA 4DCDA 1BIOA 1ZTKA 1XKAC 1AFQC 2XTTB 1GMHG 1SLUB 1C1UH 2TBSA 3KQ5A 3LH3A 1C1PA 2GP9B 1GI4A 3BTTE 3RC6A 1GHAG 4YLUA 1PQAA 1WTHD 5E8EH 1K1OA 1YCPH 1F5RA 3CS0A 2EEKA 1ZZZA 1E1RD 5F03A 6ESTA 2J34A 1GCTC 3M35A 1O38A 5ABWA 1T7CA 2HLCA 4MPWA 1FZZA 3VG8A 3MTYA 3F1SB 5GNDA 1C1VH 1ZJDA 1QQ4A 3S7HB 2FTLE 1ANBA 1VITF 1ZPCA 1E37B 5GPIB 1TLDA 1IQGA 3OAAD 3SNEA 3LGWA 3ZZ8A 1DS2E 1SGFA 4WMFA 2QF0A 3T25A 5C1UA 3SU1A 1QBNA 1AIXH 5DP9A 2FI5E 4CR5A 1F2SE 2ZTXA 5HMAA 4X8UH 3C1KA 1NFXA 1WQSA 2VVCA 2BY5X 1YLDA 2CJIA 3S7KB 1L4DA 2YMSB 1VR1H 4CRAA 3SUEA 1MQ6A 1ESAA 2XBVA 4YESB 1ZR0A 2YNAA 2QAAA 1AMHA 3A8BA 1LO6A 2Z9IA 4WWYA 2Z3CA 5F8TA 1UVOA 1GHBG 1NRRH 5C20A 2OUAA 3RXCA 5EW1H 4B76A 3UNSA 2VINA 1VGCB 2ZDLA 1WBGB 3FOAA 1LPGB 3F9HA 3MU8A 5BPEA 2AFQB 1ZHMA 1FX0B 1H8IH 4DT7B 1EATA 1RTLA 3PMJA 1OS8A 3SGQE 1BHXB 3K9XB 1EZQA 1ZJKA 2C8ZB 3AASA 1KXFA 3KEEA 1BRCE 2OTVA 4XRNA 4Y7BA 1FDPA 3BG8A 2BY9X 3MWIU 1IQFA 3RMOH 4ZAEA 4BTTB 1TGBA 1TRNA 1ZTJA 3A88A 4I32A 3BG4B 3T5FH 5C2ZA 1GBAA 2PKSB 2GCTB 4ABEA 5CHAC 1RTFB 5BRRE 1E34B 4J1YA 2IJOB 2UWPA 1SSXA 4BANB 3QTVH 3V13A 2O8WA 2KCOA 4WMEA 1TQ0B 4GSOA 1L1JA 4FVDA 5I46H 1MMJN 1O2KA 3TPIZ 5GJ4B 1IQEA 1QY6A 5HIZA 1SOZA 1J16A 5FCRA 1Z1JA 2Z9JA 1ZOMA 1PQ7A 2KZ4A 3OSYA 1HXEH 1SGDE 1UVPA 3SU2A 2HVYB 1CHOG 1KTTB 3DT0H 2RG3A 2L6OA 3E90B 3TH4H 3DHKH 2WPIS 1O2VA 2H1UA 1P03A 1NC6A 1N1LA 2F9BH 2VH0A 1V2PT 1W11U 4Q80A 3V3MA 3QK1A 1DLKB 3BN9A 1BMMH 1JBUH 4ZHLU 2FP7B 5EU8A 4Q7XA 4UE7H 3ZZ4A 8KME2 2TGPZ 1LKBA 3IITA 3SJOA 1QR3E 2CHAB 1OWEA 1TBZH 2F9NA 4AFQA 2AMPA 4YOJA 4TWWA 2LPRA 4ISNA 1HYLA 1O2UA 2AYWA 3TGJE 1UTOA 1W13U 3ZV8A 6CHAB 1WU1A 1UW7A 4ZKNU 1GBMA 1KTSB 1C2EA 1GBLA 1MAYA 1GMHF 2IPHA 1GJBB 2BLQA 2ZQ2A 2YMSC 1ELVA 3PRBA 1VZQH 1P04A 1P11E 1D6WA 1O3EA 2FXRA 2VWOA 3GCNA 3MH4A 2PW8H 4YM9A 1Y3UA 2OQUA 1GDUA 3M3VA 1P3EA 2A4GA 1VGCC 3P8GA 2ODQA 1GJAB 1NESE 2O9QA 2PTCE 1FY3A 1OWIA 1W0YH 3Q00A 1HAOH 1NFYA 4OS6A 1W3CA 3PROA 3A85A 2G81E 5ETXA 1WTGH 4X2VA 1GHYH 1O5DH 5EODA 2ZFFH 4HI3A 2AMDA 3BG4C 1RS0A 6GCHG 1AKSA 1DWDH 2ODPA 1C2IA 1CSOE 2GCTC 2PKSC 1E79D 3OTJE 3RUOA 2QA9E 2ZDMA 5IDKA 1V2VT 4IC5A 2XXLA 3SQHE 2C8XB 1OYTH 2C8YB 2FPZA 3PWCA 2WPDD 1IQHA 4GHTA 1YPMH 1GHBF 2PHBA 1FMGA 2FOEA 2R2WU 1XVOA 2J9NA 3PV5A 1EOLA 4GVUA 3P8NA 2Y7XA 3D65E 3RMMH 1G30B 1GG6C 2CMYA 4TWYA 1AZZA 1B5GH 1PPCE 1P0SH 1GHXH 4B71A 5C0TA 1THRH 5E0HA 1A7SA 4JK5A 1RRKA 3F0OA 1A5IA 4I86A 1Z8JB 1K1PA 1NBMD 2V3MA 3EAJA 1FN8A 3ATWA 2FLBH 4FUEA 1ZHPA 1WYKA 3I78A 2KM0A 2JDID 5HM9A 2WUCA 4GUXA 2P59A 1YKTA 4B6FA 2CHAC 2QF4A 4IS5A 1K1JA 2ZU3A 1UTQA 2A5AA 2R2MB 3B9FH 5KECA 8ESTE 1IAUA 1Y5AT 4LK4A 4YLQH 1Y8TA 6CHAC 1YPEH 1PPGE 1SQRA 3SI3H 1EJMA 2AGEX 2V7QD 3E91A 3TNTA 3BTHE 1CHOF 1TGSZ 1VITH 4RT1A 1UTLM 2V6NA 6LPRA 2J4IA 4AGJA 5FCKA 1Y3XA 3RXVA 3UOUA 4XD7D 1JRSA 2ZHWH 3MQKC 1W12U 3A7YA 1GBEA 5E0GA 3PMHB 3PO1B 4JYTA 3EA9A 3MH7A 5AVDA 1QJ6B 1THSH 3Q3KA 1GMCF 2KCPA 2PR3A 3KL6A 1O3HA 3NXPA 1GL0E 1T4UH 3OTPA 3C27B 2YNBA 1SQOA 1ELEE 2BM2A 2WPKS 1W7GH 1OWDA 2OC7A 1D3DB 3ZVGA 4R8TB 3EA7A 2Z3EA 2BLVA 3GDUA 4I8JA 1DSUA 2VWMA 1V2TT 1TNLA 2AEIH 2ZQ1A 1KXAA 5HYOA 3SBKA 4MQAA 3RXAA 4ABAA 4XOJA 1E35B 3SHAH 2WINI 3NUMA 1AWHB 2UUFB 3STJA 3TITA 2ZI2H 2RFKC 2HALA 1K2I1 4LZ4B 3BTME 4JYVH 4XBCA 1EZXC 1S6LA 2P93A 3VGCB 2W6JD 1U6QA 3AW1A 2BQWB 1OHHD 3HK6B 2IN2A 3DFJA 4WVPE 1P2JA 5C5OA 1GHVH 4X1NU 2JH6D 1HXFH 1ZSJA 4A6LA 4A1VA 1Z6JH 1TFXA 2ZU5A 2BZAA 1G3EA 3GY5A 2HRVA 4TPIZ 3ATMA 1D3PB 2FWWA 1DFPA 3GY2A 4ABDA 5C5NA 2SNVA 2CF9H 2O8UA 2ZO3H 1AD8H 5L2YH 1SVPA 1HAPH 3TH3H 4FUHA 3P95A 1JMOH 3DSPA 2ALVA 1GCDA 3I29A 3T62A 3MNBA 2G4TA 4ZCNA 2FOGA 3MO6A 2BY7X 3SO3A 4F49A 3UWJH 4K69A 1OP0A 3L6PA 2H9HA 4I8KA 4BNRA 1EXFA 1ZSLA 3RXJA 3UNQA 1AI8H 1S5SA 1ELTA 3UB0A 3GY8A 3LOXA 5C3NA 2Z9GA 4NFFA 4Y8ZA 4BAMB 1QTFA 4YT7H 1H8HD 1Z71A 1W10U 2FS8A 3SV8A 2C93B 3ZV9A 3RXTA 1O3KA 3PO1C 1MBQA 3WW7A 2FTMA 2B9LA 1BRAA 3FZDA 3U98H 3OEHD 1F7ZA 2GKVE 1C4Y2 2EI6A 4A1XA 3ZVAA 4INHA 3SYJA 1QURH 2FO9A 2OD3B 2QY0B 3RXKA 5C67A 3A8DA 3TIUA 4UONA 3SU5A 2FYRA 1PPFE 2G52A 2I6QA 4FUDA 2EC9H 2F3CE 4Y76A 3DSOA 1E38B 4IBLH 1VJAU 4JZ1A 1PJPA 1SR5C 1C9PA 1J17T 1AE8H 2ZECA 1C5RA 4BAOB 1MTSA 3GY6A 2QN5T 2ZC9H 5JBBS 2J94A 1YC0A 3EDXB 3P8OA 2W3IA 7GCHG 2BDCA 1TX6A 1OPHB 2EY4C 3VGCC 2FEQH 3GICB 4NWLA 5E2OA 1ETTH 4INLA 1IQNA 1BTHH 1CQQA 2AS9A 2A0QB 1NU7B 1L1NA 3BTKE 3FANA 4FU8A 3ZVDA 5T3HA 1Y3YA 3GCTG 1X7AC 1BTUA 1LHEH 4CH8B 1T8MA 2GCHG 2FX6A 3I77A 3SU4A 2BVSH 1SMFE 3P70B 5KEDA 2AIPA 4O03A 3RXBA 4Y7AA 1DXWA 1K0HA 2A7JA 1GBBA 2FX4A 3ZZ5A 1XXFA 1NY22 1S83A 2FOHA 5DGJA 3ZVEA 3M5LA 5EQSA 2F4LA 2Y6TA 1CO7E 1LVOA 3R0FA 4D9QA 1BTXA 1L4ZA 1GCTB 1GL1A 1SBWA 1S6HA 3RU4D 3D49H 2C4FH 3F68H 1SHYA 3QGNB 4OS1A 2PKAA 1V2ST 5FPSA 1MD7A 1QQUA 3A7ZA 3RP2A 2QCYA 4FUJA 1EZUC 2GT8A 2HPPH 4LXBH 1BT7A 4YO9A 2R0LA 4RSPA 1HB0B 3QGJA 1GDNA 2G5NA 2R3UA 2BXUH 4B2BA 3R3GB 4AORA 4RKJB 1COWD 1NFUA 1V2UT 3M61U 4FXGH 2KCYA 3F2HA 5A0BA 1V3XA 1TE0A 4AFUA 1GHWH 1AHTH 1F92A 1ORFA 2YMSD 3A82A 4JZIA 2OC8A 4B75A 1O2HA 1F0UA 1Z8GA 3QZRA 3RXFA 2ZTZA 3H09A 1KYNA 1VCPA 3SUDA 2O8MA 2DE8A 2FI3E 2WSSD 1O2SA 4NZQA 2NU3E 3T2NA 2XNIA 1ZMNA 2A4RA 1C5UA 3SJ9A 2OC0A 1DWEH 3LT3A 4K2YA 1QJ7B 3PLKA 1GBHA 2PTNA 5IK2D 1V2MT 1EPTB 4O3TA 1OSSA 2BY6X 1LDTT 2FOMB 1O3IA 3JZ2B 1TABE 1P2IA 3E0NB 1YPHC 3UTUH 2A2XH 2HWLB 2J98A 1T4VH 1O3FA 1T8OA 1Z7KA 1ZYOA 1TONA 3BEFB 2G00A 3SNAA 3F0PA 4YOGA 4KKDA 1GI3A 1S81A 2XYAA 4WY3A 4DT4A 3U8RH 1UO6A 1DICA 4P02A 4LOYH 4JZDH 1J15A 1DM4B 2Y5GA 2KAIB 4K3JA 4Y10E 2Z9LA 1C4U2 2GV6A 1HAVB 3LGTA 2B7DH 1H9LB 1O3JA 2A1DB 3RXOA 4BTUB 7GCHF 3CP7A 3U1IB 5T6FA 4E7NA 1NBME 4AOQA 4ZROA 4AB8A 1EP6A 2TGTA 3A7TA 3KGPA 3TK9A 5JBTA 5TCCA 2FODA 1TIOA 1C2GA 1N6YA 3W94A 1FJSA 1C5YB 1FONA 2LELA 3LGVA 3ATLA 3M3SA 4FUFA 4ASHA 2ZKSA 2QXHA 2GGVB 2D2DA 2KFWA 3F9FA 3GCTF 3SHCH 5FPYA 5GDSH 1ANEA 1G3CA 3MU4A 5FHTA 1PYTC 4CR9A 1NZQH 5EJZA 4UEHH 3LC3A 1TNKA 3MU1A 5J4QA 2XNDD 2THFB 3RLYH 3BTFE 3OEED 2D8WA 5TCAA 1WDIA 2GDDA 1BJVA 2SGPE 3SI4H 1O3BA 1OX1A 3UOPA 2H6MA 4VGCB 3CS7A 1E1QD 4DVAU 3BV9B 1C5XB 2BZ6H 1EB1H 3SU6A 1C1NA 4OM9A 2BOHB 2F91A 1HPGA 3UPEA 3Q3YA 1T8LA 2CN0H 2PSYA 1HAHH 2M5TA 3LONA 1SFIA 4D76A 1FAKH 2TPIZ 3SZNA 4FUIA 4Q7ZA 1OWKA 4D7FA 3ATIA 1P12E 3EE7A 1DXPA 3TGKE 1TA6A 4K8YA 1EPTC 2AERH 2WHXA 1GBTA 1O5AB 1CBWB 1MKXK 2ZEBA 3QDZB 3UNRA 3FP8E 1FY4A 3RM0H 5A8XA 4Z6AH 1WXRA 3GY3A 1MH0A 3RXGA 1S0RA 3K65B 5LPFA 1P09A 1DANH 1MKXH 1V2LT 4ZHMU 1O31A 2EI7A 1RGQA 1SFQB 2NU2E 3ZYEA 5A0AE 1V6DA 4SGBE 3RMNH 3UIRA 2PUQH 1K1LA 1GG6B 1BMAA 2A7CA 3TVJB 4FETA 2FI4E 1C2HA 2QF5A 2DE9A 1TALA 1HIAA 3FP7E 3IG6B 4I7YH 4BXWA 5A2MH 2Z9KA 4AYVB 2ANKH 1EAUA 4TSFD 1THPB 1DVAH 2ZDNA 1AGJA 1UHBA 2P3FH 2ZIQH 1ZTLA 1ARBA 2CV3A 5F8ZA 1HLTH 2PV9B 1TGTA 1P2KA 1C2LA 1HJ8A 1MZAA 1O0DH 1T32A 5T6GA 1FUJA 1T31A 1G2MA 1GMDF 3M7UA 3M3TA 2ZU1A 3PMAB 5TJXA 3EA8A 1C1QA 1TMBH 4BXSA 2XW9A 4ASUD 3RXEA 1QGFA 1TWXB 1C5PA 1WCZA 1Z1IA 3F9EA 2UWOA 1O2GH 2GMTB 2JH0D 1O5EH 1P05A 4IW4E 2A5IA 2F9OA 4A1TA 1GHAF 3F9GA 3LJOA 4NCYA 4VGCC 4ABFA 2G51A 3BEUA 2ZDAH 1KDQB 4MVNA 4FU9A 3UWIA 1BBRE 1H9HE 3MNSA 3RXDA 1BCUH 1ZMLA 1MQ5A 1S84A 1XXDA 1XKBC 2XWAA 3GISB 1TOCB 2TIOA 1O3NA 4Q63A 1MZDA 4NIVA 2QGRA 3RXUA 3Q3XA 2HOBA 3PM3A 3UAIC 3BF6H 1CBWC 1GGDB 3GDSA 1MBMA 1HAXB 2BLOA 2QXGA 2BD5A 4H4FA 4BAQB 1SGTA 2C3SA 4RT0A 2AH4X 2G55A 2ZHDA 4O97A 4AYYB 1SL3A 3MO3A 5DN6D 2BY8X 3NK8A 4MG3A 1QNJA 5J4SA 4NSYA 1L0ZA 4I31A 1SGYE 1NROH 3ZVCA 1WQVH 3MO9A 1SGIB 3EQ0H 1JOUB 1NRQH 3LU9B 2V35A 1UK2A 1O30A 2JETB 5GWZA 4KTUA 4ZH8A 1P2MA 2W26A 4WJG2 1RD3B 4Y8XA 5LH8A 3NPSA 3T29A 2AHME 1ZMJA 1LHCH 5GIBA 1BRUP 1YGCH 1GVLA 1EUFA 1YCPM 4NA7A 4U01A 1ELCA 3T27A 1ZRKA 4JCNA 1LCYA 1TA2A 2QYIA 2XRCA 4CREA 1AVGH 2ZG0H 4Q2KA 3BTEE 1JWTA 1WV7H 4MPVA 2VU8E 3L3TA 2L74A 1O33A 4ZMAH 1SGCA 2P94A 2ZU2A 1IQMA 1TPAE 1D4PB 3MNXA 1GPZA 3EYDA 5AHGH 1TMTH 4UFFH 3AK5A 1SGRE 3TK6A 1K1MA 5EPYA 4CRBA 1PQ8A 4YXWD 3SNBA 3LGIA 1T8NA 2GZ7A 1D9IA 3PMBB 2GMTC 5DP5A 5F6MA 2BMGB 3FO8D 1G9IE 5A8YA 4JZFH 4MNWA 1C5TA 2AGIX 4XBBA 1K22H 3RC4A 3RU4E 5G4BA 1PFXC 3B8JA 2CF8H 4UFEH 2Q6GA 2WUBA 4AFSA 1AU8A 1ELDE 1MU8B 1S0QA 2HVXA 2FOBA 2EQNA 1NPMA 2RDEA 3PRDA 3QUMP 1IOEA 1UVUH 1O2YA 3MHWU 2VH6A 2ZF0H 1QBVH 2WV4A 3BTGE 3PB1E 3RXHA 1CT4E 2Z94A 4U32A 4JMYA 1NRPH 4UFGH 3TNSA 1DWCH 1GGDC 1CVWH 1LPKB 4X1QU 1K28D 3KF2A 2ULLA 4OS7A 1Y3VA 2ZDKA 3ZZ6A 1LHDH 1AVXA 1MTUA 3U1JB 1C5ZB 2Q6FA 5EXLA 1O3OA 3SOSA 4X2YA 5LPEA 4HGCA 1NO9H 1YPKH 1ID5H 3RDZA 4Y8YA 1UK3A 5L30H 5K0HA 3TJVA 5EJ1A 3P17H 5E0JA 2ZFTA 4IMQA 1DY9A 1ANCA 3RMLH 5C94A 1TNIA 2JETC 1HDTH 2BOKA 2KX4A 4HZHA 1ZGVA 1IQKA 4GHQA 4ZXXH 1D6RA 2SGFE 2XBXA 1UCYE 4Y6DA 1JXPA 1C2FA 3V0XA 1TOMH 1HV7A 1WUNH 5EPNA 1KSNA 3ZIAD 2Y80A 3U8TH 1CE5A 3ESTA 4YZUA 6GCHF 2OCVB 2O8TA 1AE5A 4X8SH 1V2JT 3RXMA 2HLDD 2VIVA 2OP9A 4P00A 5HIYA 4DOQA 2QE7D 2HNTF 1KXEA 1YWUA 1GDQA 1QL8A 3EE0B 2ZPRA 4Z0KA 3ODFA 3VXFH 3GCHB 9LPRA 1V2OT 2P16A 2VIDA 2ZCKP 4OS5A 1C1TA 5EOKA 1C5NH 3QTOH 3A8CA 2HNTE 4O9VA 1KXBA 4NG9H 1P2QA 2BVRH 1GI0A 1O3CA 1BBRK 1AUTC 3RC5A 1CU1A 5EW2H 3MYWA 3LDXH 3ZVFA 1PQ5A 2GX4A 2WV9A 4DW2U 3AW0A 3VXEH 3SQEE 1HAIH 4XBDA 8GCHG 4YOIA 2NU0E 1INCA 1G32B 2AMQA 3RXLA 3LIWA 3OY5U 2KCAA 3TJUA 2WPLS 1AFEH 2J38A 3ENSB 1BBRH 1MCVA 2QC2A 5DSFA 5LGOA 1LQDB 1XUIA 1HJAB 4DY7B 4ESTE 4CHAC 1C2MA 1TBQH 1VKYA 1O2NA 3M5MA 1AZ8A 3KQCA 1GWAA 2RA3A 3SORA 3QZQA 4M7GA 2FOCA 1PYTD 1O2QA 3VB5A 2BDGA 2GD4B 1ARCA 5DP4A 2IJD1 3ELAH 1N6XA 1SG8B 1HJ9A 2ESTE 3QN7A 1TB6H 1FY5A 5HGGA 3PV4A 1QB1A 2ZPSA 2VWLA 1O2WA 1UTPA 3E3TA 1AN1E 4ZKSU 1AUJA 1SGPE 4MLFB 2ZFPH 4X8TH 4J2YB 2ANMH 2GVFA 4GAWA 4OS4A 5AFYH 3RXPA 2BDIA 2QXIA 3PYHA 1B7XB 2BDBA 4K1TA 2ANWA 3M5OA 1O5GH 2BX3A 1H8DH 1C2KA 4TY7A 2H9EH 3H7TA 5FPTA 1W0KD 4KTCA 2OXSA 5ESTE 1Y3WA 1K9OE 5DP6A 3UQOA 5AFZH 1SKYE 1UTKA 3H5CB 3SJ8A 3RU4T 2ZFSA 4Z1MD 4ABJA 3TH2H 2WPJS 2CGAA 2Y7ZA 3PV2A 1QRWA 2QV1A 4NFEA 1GBDA 1C2JA 4RN6A 5JPMH 5SGAE 1YPLH 3QO6A 3DSGA 1UTJA 1ZSKA 3ATKA 3GCHC 1LVBA 2FM2A 1FIZA 4DIIH 1A46H 3NZIA 4HTCH 4WXVA 2G8TA 1GI7B 3DA9B 3TK5A 3S9CA 3BIUH 1DE7H 3DFLA 3OU0A 2D26C 3SU3A 1PPBH 3OYPA 1BQYA 2Q6DA 2P3UB 1CT2E 2W5EA 4NA8A 1FQ3A 1TGCA 3A81A 1LQEA 1YY3A 3Q77A 2XCNA 4GCHG 3BTWE 1OWJA 1DX5M 1QFKH 4K8BA 1A61H 4OGYA 5EIYA 1HFDA 5A09A 1TAWA 4Y0ZE 3UUZA 3ITIA 4CRDA 2CK3D 1A5GH 2GV7A 3S69A 1VCQA 3AVZA 1HJAC 2A2QH 1OWHA 2PLXA 3G01A 1V2RT 2A32A 1QA7A 1SC8U 8LPRA 1FV9A 1Y5BT 1ABJH 2P8OB 2ZGBH 3VPKA 4BTIB 2FYQA 2A31A 4FUBA 3KHVA 1NU9A 4NIYA 2FIRH 5CDFE 5JYIA 3TLOA 4ABHA 4X8VH 5T1VA 1RFNA 2TRMA 1C1OA 5EXNA 1FIWA 4U30A 2BDAA 1SQTA 2XBYA 2A4OA 1BA8B 4XDEA 4NZLA 1Y59T 2A4QA 1A2CH 3AAUA 3GDVA 2QIQA 2BXTH 2P95A 4X1PU 1O2OA 4I33A 1H9IE 1B0FA 3PLBA 4UFDH 4Y0YE 1QRXA 2BD8A 2ODYB 3VB3A 1UCYK 4Q4LA 4X2WA 2B8OH 2B0FA 1V2NT 4F4OC 1XVMA 1HUTH 1N8OC 3GYMA 5KGOA 3GS9A 4A7IB 3LGYA 1ESBA 4DIHH 1AVWA 3SV9A 1AKSB 2I6SA 4B6EA 4TT3D 5FBEA 3SV6A 1XUGA 1HBTH 4K1SA 4MPXA 3KQEA 5EQQA 1UCYH 2BB4A 1NS3A 2Y82A 1V2QT 1ESTA 1MKWK 1H1BA 2GDEH 5JB8S 2H9TH 2G4UA 2NWNA 4WMDA 1GBFA 4X2XA 3MMGA 3EGKH 4OS2A 1DITH 1GJ4H 1NRNH 2C8WB 1TNGA 2VNTA 2LNCA 3HKIB 1CA0B 3LC5A 3KYGA 3HKJB 1FI8A 2O8LA 3L33A 3VB7A 3F6UH 3PWBA 3O8CA 2K0QA 3SJKA 3T28A 4XFQA 4AG1A 1GJ7B 2BD7A 3Q76A 5K7RA 3P92A 2R0KA 1SB1H 2TGDA 1YCPK 1SI5H 3FN8A 1QL9A 2A45B 3SW2B 5ESBA 1BRBE 4TPYA 4I8GA 1YF4A 1EZSC 4CRCA 3A84A 4X6OA 2VIPA 3M37A 1JIMA 1MU6B 3SGBE 2J97A 3F3BA 1HGTH 2GCHF 3K6ZA 3OX7U 1QB6A 1D3TB 1H4WA 1O3MA 4PROA 1HAZB 2Z6BD 1GJ9B 5FX6A 2P8OC 3HGPA 3W95A 1OOKB 3D62A 2NU1E 3A87A 3VFEA 3FZZA 1YLNA 5T6DA 2FOFA 2WYJA 1GJCB 1TBRH 1C5SA 4H6SB 1BTWA 3KYFA 3MI4A 3ZZBA 1ZHRA 3M7TA 3H7OA 1FAXA 2EI8A 2W6ID 3ZZAA 1BDAA 1UVSH 4NA9H 4GCHF 1A0HB 1YYY1 1ZGIA 2OQ5A 1TQ7B 3WWFA 2BDHA 5HXFA 1P02A 1O5FH 2WPHS 1ABIH 1FLEE 2ZGJA 2SGAA 3VB6A 1O2IA 3RXRA 3U8OH 1Z8IB 1P8VC 1QHRB 4JZEH 1KY9A 3UR6A 1F0SA 1NTPA 2ZHEH 1ELGA 5B6LA 1J8AA 3BSQA 1A5HA 1A3BH 4ISIH 5DG6A 1SLVB 4TYDA 1MABB 2K8IA 1MD8A 4KELA 1KIGH 1GI5A 3O8DA 4WH6A 5GXPA 1DLEA 1AY6H 1CA0C 2PGBB 3NKKA 4AGKA 2PFEA 1TMUH 4QT8C 3O8BA 1O35A 3OE7D 2FS9A 3PLPA 2PSXA 2UWLA 1MCTA 1AB9B 2FZZA 3URCA 4FU7A 4THNH 5F8XA 3RXQA 1SLXB 2BQ7B 1XUFA 1MUEB 3U69H 1O3DA 4KGAA 2WYGA 2C90B 4IN2A 2JH5D 2ZZUH 1CA8B 3BTDE 1VCWA 2STBE 1OXGA 1O32A 1W8BH 3KNXA 1F0TA 4MTBA 2BD2A 3P8FA 1YPHE 5JBCS 1XUKA 1HCGA 2K1QA 2HPQH 1F0RA 1CT0E 4LZ1H 4MPUA 1GI1A 1GI2A 2F9UA 3UFAA 1O3AA 4H6TA 7LPRA 2Z3DA 3TJNA 1GMCG 1PPHE 3M5NA 5C0UA 1P06A 3N7DA 1K1IA 3LGUA 1DSTA 2F43B 2ZU4A 2H5CA 3CENA 1EOJA 1TPPA 1ELAA 1BOQA 2VVUA 5FBIA 1O2XA 4R0IA 1C5LH 2GT7A 1GBCA 2WZQA 4D8NA 3U9AH 2GZ9A 1BZXE 1ZPBA 1C5OH 3ODDA 1DWBH 4ZKRU 4F48B 1Y5UT 2BX4A 2TGAA 4NIXA 1Z6EA 1D3QB 3PTBA 3D23A 2PUXB 1B0EA 1IHTH 1C1RA 1LHGH 3N99A 2SGDE 1S85A 1QZ8A 1SGNE 2V3HH 1JRTA 2VJ1A 3SNCA 1H8ED 1G3BA 1FN6A 3K2UA 2ALPA 3ZZCA 3N7OA 1P3CA 4B74A 4NIWA 1QCPA 1XM1A 5DKMA 5FX5A 3A89A 1MAXA 1TPOA 1O2PA 3ZZ7A 2RCEA 1XMNB 5CE1A 2NU4E 3TU7H 1JIRA 1EPTA 2W7UA 1XUHA 1M9UA 3SUFA 1OP8A 1C1MA 1EQ9A 2GJGA 1KLJH 1QA0A 1Q3XA 1W2KH 1GJ5H 1FY8E 3E6PH 1WAYB 1ELFA 1AB9C 2OBQA 2OC1A 3SN8A 3A7WA 1PPZA 2ASUB 5HKKD 1GI6A 2AIQA 4BAKB 3UR9A 1L1GA 2HNTC 1P01A 1RXPA 1BTPA 1AWFH 3HK3B 4IN1A 2JKHA 2XC4A 2KAIA 1O39A 4JK6A 1CGIE 2VVVA 5FXLA 5JBAS 4D9RA 2QXJA 1HAVA 1O3PB 3GY7A 2J95A 3SZEA 1UTMA 2Y5FA 1GJ6A 3O8RA 5JB9S 1EP5A 5B6OA 1P2NA 1OYQA 4HG6A 1MTNB 3LJJA 1GBIA 5I25A 2VGCB 4DJZB 2ZFQH 1RTKA 5L6NH 4ACAA 4SGAE 4CRGA 1IQIA 1SQAA 4ACBA 4ISOA 2HGTH 4K5ZA 2FLRH 5FAHA 1DY8A 4WH8A 4IGDA 1O5BB 3HGNA 5IYTA 1QJ1B 3V7TA 1O3LA 3T26A 1P57B 2V0BA 4ABBA 1EASA 5DJ7A 1NM6A 3K6YA 4CH2B 4Y71A 2PKAB 3NCLA 1UTNA 1G37A 5C1XA 1K1NA 1O2TA 5CMXH 1ZRBA 5GCHG 4F55A 1UMAH 1DT2A 4Q7YA 3KCGH 1O36A 1ELBA 4FUGA 3GOVB 3RLWH 1O2MA 1GI9B 2FESH 3ZZDA 4CHAB 1ANDA 1EJAA 1RIWB 2ZNKH 1C4V2 3PTNA 3DD2H 4Y11E 3QWCH 4CRFA 4DG4A 1C5WB 1J9CH 1EX3A 2BDYA 5DK1A 4IMZA 3KIDU 3FVFB 1ZPZA 3HATH 1Q31A 4XSKU 3RXSA 3CNRA 2B5TB 4YTAA 5DP8A 4NWKA 2KR7A 3UREA 1BHXF 1J14A 1A0JA 2F9PA 5F53A 2DUCA 1IQJA 3BTQE 1GBKA 1P10A 4UD9H 1GI8B 2BD4A 4NGAH 4OGXA 2JJ1D 3GY4A 2UUJB 1CGHA 1ETRH 4O3UA 1TPSA 2QF3A 2W7SA 1BMFD 1TRMA 1DOJA 4D7GA 3M7QA 2D1JA
chains in the Genus database with same CATH topology
1DPOA 1O37A 2ZCLP 3STIA 1BUIA 9ESTA 2SFAA 1LHFH 4MNVA 1BMNH 1LVYA 1HAYB 1P9UA 1GBJA 2AGGX 2XWBI 2SGEE 2EA3A 2ZHFH 2ZHQH 1O3GA 2XBWA 5H4IB 2FDAA 5DPAA 3KN2A 1SHHB 1MTWA 2XC0A 4KTSA 1EB2A 1O2ZA 2GTBA 3RXIA 1G36A 1MTNC 1PPEE 2VGCC 3UY9A 4HFPB 1LTOA 4FVBA 3A7XA 1FPHH 1BTYA 1DUAA 1EAXA 1W7XH 1AO5A 2R9PA 4CBOA 2BLWA 1YBWA 1TGNA 1C5MD 4NSVA 4XE4A 4ISLA 3OY6U 3VB4A 5EXMA 1P9SA 1EAWA 4IC6A 3KQDA 7KMEH 3MH5A 1Q2WA 3E8LA 5PTPA 3FFGA 4AX9H 4B1TA 2ILNA 2PWXA 1HNEE 3TJOA 5LPRA 2ZGCA 4ZHAA 2UUKB 1EAIA 3LPRA 2VIWA 3MU0A 2H2ZA 4A5TS 3LKWA 2XCFA 1QIXB 2BD3A 4TY6A 3BIVH 5AF9H 2W3KA 4AG2A 3SGAE 1P2OA 2SNWA 1L2EA 1KDQA 2STAE 2ZP0H 1ETSH 1RIWC 3SUGA 3P6ZB 4MNXA 4H42U 1UK4A 2UUYA 4UDWH 2J92A 3DUXH 3SJIA 4WF8A 5C1YA 1O2RA 1SOTA 3B23B 1V2WT 2YOLA 1XUJA 3E16B 2BQ6B 1BJUA 5EGMA 5HM2A 5DP7A 1A1RA 4CBNA 1OKXA 3FP6E 1C1WH 2G5VA 1QBOA 2WPMS 1UVTH 1C9TA 3VEQB 3V12A 2BD9A 4ZXYH 3A8AA 3GCOA 3ZVBA 1YP9A 4RKOB 4A92A 2WV5A 5GCHF 2Z7FE 1N8OB 3GYLB 2A5KA 3A80A 1W0ZU 2ZGHA 2ZDVH 1KXDA 3MOCA 4GPGA 1BMLA 1XX9A 2ZWLH 3IWMA 2BTCE 4KP0A 2BYAX 1O5CB 3M36A 2H5DA 1TX8A 2ZA5A 4WXIA 1WOFA 3NWUA 2A7HA 1VJ9U 2PGQB 4ISHH 3A86A 4ABGA 2F83A 2ANYA 1TNJA 2SGQE 2ZTYA 5E2PA 1BTZA 2Y5HA 4DURA 2Q1JA 1FNIA 1IQLA 2FOAA 5JDUB 1VITG 2P3TB 3MH6A 1A4WH 1LVMA 5EQRA 1TYNA 1C1SA 4AFZA 4AN7A 1QRZA 4U2WA 3QLPH 2FMJA 1C5QA 1SGQE 1HIAB 1BITA 1TNHA 4X6NA 1F5KU 3E1XB 1LMWB 3MFJA 1QB9A 4JYUH 1UHBB 1A0LA 1YM0A 4BAHB 1S6FA 2ZPQA 1SGFG 1AFQB 3E0PB 2OLGA 5DO4H 1LKAA 2OBOA 2ZGXH 1CHGA 1EKBB 1G2LA 4K60A 2BVXH 2BHGA 1IHSH 1MTVA 1RJXB 5L2ZH 3S9BA 3HPTB 1DUEA 1GVKB 1S82A 1QL7A 1GVZA 5DP3A 4I8HA 4E05H 3JZ1B 4E7RG 2GZ8A 4YT6H 1ZLRA 5A8ZA 1KXCA 1GHZA 3BEIB 1LPZB 2J2UA 2OINA 4X6PA 3ZYDA 7ESTE 4ZUHA 1WSSH 3AAVA 1HRTH 3FAOA 3KQBA 2F9VA 1CGJE 4B2CA 1V2KT 2V3OH 1Z8RA 1E0FD 1O2LA 1TRYA 3TGIE 4AZ2B 4E06H 1C5VA 1SGEE 1E36B 3A7VA 1FY1A 4ABIA 2VIOA 1A3EH 2VIQA 4X1SU 3S9AA 1YLCA 1OP2A 1BB0B 4MDSA 4FUCA 4Y79A 8GCHF 1F5LA 5A0CA 1YPJH 2ZCHP 1ACBE 4INKA 4B2AA 1NRSH 1UJ1A 3MNCA 1KLTA 3MU5A 2CXVA 4K1EA 1TX7A 4B73A 2VWNA 1O2JA 4ZKOU 4BOHA 1NT1A 1O34A 1HAGE 4MNYA 3SV2H 2RA0A 4I8LA 2RDLA 1SPJA 4GLYA 2Y81A 1AQ7A 1SLWB 1YPGH 3WY8A 1NFWA 3ZZ9A 4AB9A 3LH1A 1EJNA 3URDA 2R3YA 3A83A 1W14U 3SNDA 1DDJA 1C2DA 4X0WU 1FPCH 1FXYA 4X1RU 3QX5H 3SV7A 1G3DA 3SU0A 3RM2H 3S0NA 1NN6A 1K21H 5CHAB 2IOTA 1MKWH 1GJ8B 1GJDB 2ZFRH 3UQVA 3ZZ3A 2VB0A 5EG4A 1GMDG 1KLIH 4X6MA 2XC5A 4DGJA 4DCDA 1BIOA 1ZTKA 1XKAC 1AFQC 2XTTB 1GMHG 1SLUB 1C1UH 2TBSA 3LH3A 1C1PA 2GP9B 1GI4A 3BTTE 3RC6A 1GHAG 4YLUA 1PQAA 1WTHD 5E8EH 1K1OA 1YCPH 1F5RA 3CS0A 2EEKA 1ZZZA 5F03A 6ESTA 2J34A 1GCTC 3M35A 1O38A 5ABWA 1T7CA 2HLCA 4MPWA 1FZZA 3MTYA 3F1SB 1C1VH 1ZJDA 1QQ4A 3S7HB 2FTLE 1ANBA 1VITF 1ZPCA 1E37B 5GPIB 1TLDA 1IQGA 3SNEA 3LGWA 3ZZ8A 1DS2E 1SGFA 4WMFA 2QF0A 3T25A 5C1UA 3SU1A 1QBNA 1AIXH 5DP9A 2FI5E 4CR5A 1F2SE 2ZTXA 5HMAA 4X8UH 3C1KA 1NFXA 1WQSA 2VVCA 2BY5X 1YLDA 2CJIA 3S7KB 1L4DA 1VR1H 4CRAA 3SUEA 1MQ6A 1ESAA 2XBVA 4YESB 1ZR0A 2YNAA 2QAAA 1AMHA 3A8BA 1LO6A 2Z9IA 4WWYA 2Z3CA 5F8TA 1UVOA 1GHBG 1NRRH 5C20A 2OUAA 3RXCA 5EW1H 4B76A 3UNSA 2VINA 1VGCB 2ZDLA 1WBGB 1LPGB 3F9HA 3MU8A 5BPEA 2AFQB 1ZHMA 1H8IH 4DT7B 1EATA 1RTLA 3PMJA 1OS8A 3SGQE 1BHXB 3K9XB 1EZQA 1ZJKA 2C8ZB 3AASA 1KXFA 3KEEA 1BRCE 2OTVA 4Y7BA 1FDPA 3BG8A 2BY9X 3MWIU 1IQFA 3RMOH 4ZAEA 4BTTB 1TGBA 1TRNA 1ZTJA 3A88A 4I32A 3BG4B 3T5FH 5C2ZA 1GBAA 2PKSB 2GCTB 4ABEA 5CHAC 1RTFB 5BRRE 1E34B 4J1YA 2IJOB 2UWPA 1SSXA 4BANB 3QTVH 3V13A 2O8WA 4WMEA 1TQ0B 4GSOA 1L1JA 4FVDA 5I46H 1MMJN 1O2KA 3TPIZ 5GJ4B 1IQEA 1QY6A 1SOZA 1J16A 5FCRA 1Z1JA 2Z9JA 1ZOMA 1PQ7A 3OSYA 1HXEH 1SGDE 1UVPA 3SU2A 1CHOG 1KTTB 3DT0H 2RG3A 3TH4H 3E90B 3DHKH 2WPIS 1O2VA 2H1UA 1P03A 1NC6A 1N1LA 2F9BH 2VH0A 1V2PT 1W11U 4Q80A 3V3MA 3QK1A 1DLKB 3BN9A 1BMMH 1JBUH 4ZHLU 2FP7B 5EU8A 4Q7XA 4UE7H 3ZZ4A 8KME2 2TGPZ 1LKBA 3IITA 3SJOA 1QR3E 2CHAB 1OWEA 1TBZH 2F9NA 4AFQA 2AMPA 4YOJA 4TWWA 2LPRA 4ISNA 1HYLA 1O2UA 2AYWA 3TGJE 1UTOA 1W13U 3ZV8A 6CHAB 1WU1A 4ZKNU 1GBMA 1KTSB 1C2EA 1GBLA 1MAYA 1GMHF 2IPHA 1GJBB 2BLQA 2ZQ2A 1ELVA 1VZQH 1P04A 1P11E 1D6WA 1O3EA 2FXRA 2VWOA 3GCNA 3MH4A 2PW8H 4YM9A 1Y3UA 2OQUA 1GDUA 3M3VA 1P3EA 2A4GA 1VGCC 3P8GA 2ODQA 1GJAB 1NESE 2O9QA 2PTCE 1FY3A 1OWIA 1W0YH 3Q00A 1HAOH 1NFYA 4OS6A 1W3CA 3PROA 3A85A 2G81E 5ETXA 1WTGH 4X2VA 1GHYH 1O5DH 5EODA 2ZFFH 4HI3A 2AMDA 3BG4C 1RS0A 6GCHG 1AKSA 1DWDH 2ODPA 1C2IA 1CSOE 2GCTC 2PKSC 3OTJE 3RUOA 2QA9E 2ZDMA 5IDKA 1V2VT 4IC5A 2XXLA 3SQHE 2C8XB 1OYTH 2C8YB 2FPZA 3PWCA 1IQHA 4GHTA 1YPMH 1GHBF 2PHBA 1FMGA 2FOEA 2R2WU 1XVOA 2J9NA 1EOLA 4GVUA 3P8NA 2Y7XA 3D65E 3RMMH 1G30B 1GG6C 2CMYA 4TWYA 1AZZA 1B5GH 1PPCE 1P0SH 1GHXH 4B71A 1THRH 5E0HA 1A7SA 4JK5A 1RRKA 1A5IA 1Z8JB 1K1PA 3EAJA 1FN8A 3ATWA 2FLBH 4FUEA 1ZHPA 1WYKA 3I78A 5HM9A 2WUCA 4GUXA 2P59A 1YKTA 2CHAC 4IS5A 1K1JA 2ZU3A 1UTQA 2A5AA 2R2MB 3B9FH 8ESTE 1IAUA 1Y5AT 4LK4A 4YLQH 1Y8TA 6CHAC 1YPEH 1PPGE 3SI3H 1EJMA 2AGEX 3E91A 3TNTA 3BTHE 1CHOF 1TGSZ 1VITH 1UTLM 2V6NA 6LPRA 2J4IA 4AGJA 5FCKA 1Y3XA 3RXVA 3UOUA 1JRSA 2ZHWH 1W12U 3A7YA 1GBEA 5E0GA 3PMHB 3PO1B 4JYTA 3EA9A 3MH7A 5AVDA 1QJ6B 1THSH 3Q3KA 1GMCF 2PR3A 3KL6A 1O3HA 3NXPA 1GL0E 1T4UH 3C27B 2YNBA 1SQOA 1ELEE 2BM2A 2WPKS 1W7GH 1OWDA 2OC7A 1D3DB 3ZVGA 4R8TB 3EA7A 2Z3EA 2BLVA 3GDUA 4I8JA 1DSUA 2VWMA 1V2TT 1TNLA 2AEIH 2ZQ1A 1KXAA 5HYOA 3SBKA 4MQAA 3RXAA 4ABAA 4XOJA 1E35B 3SHAH 2WINI 3NUMA 1AWHB 2UUFB 3STJA 3TITA 2ZI2H 2HALA 1K2I1 4LZ4B 3BTME 4JYVH 4XBCA 1EZXC 2P93A 3VGCB 1U6QA 3AW1A 2BQWB 3HK6B 2IN2A 3DFJA 4WVPE 1P2JA 5C5OA 1GHVH 4X1NU 2JH6D 1HXFH 1ZSJA 4A6LA 4A1VA 1Z6JH 1TFXA 2ZU5A 2BZAA 1G3EA 3GY5A 2HRVA 4TPIZ 3ATMA 1D3PB 2FWWA 1DFPA 3GY2A 4ABDA 5C5NA 2SNVA 2CF9H 2O8UA 2ZO3H 1AD8H 5L2YH 1SVPA 1HAPH 3TH3H 4FUHA 3P95A 1JMOH 2ALVA 1GCDA 3I29A 3T62A 3MNBA 2G4TA 2FOGA 3MO6A 2BY7X 3SO3A 4F49A 3UWJH 4K69A 1OP0A 3L6PA 2H9HA 4I8KA 4BNRA 1EXFA 1ZSLA 3RXJA 3UNQA 1AI8H 1S5SA 1ELTA 3GY8A 3LOXA 5C3NA 2Z9GA 4NFFA 4Y8ZA 4BAMB 1QTFA 4YT7H 1Z71A 1W10U 2FS8A 3SV8A 2C93B 3ZV9A 3RXTA 1O3KA 3PO1C 1MBQA 2FTMA 2B9LA 1BRAA 3FZDA 3U98H 1F7ZA 2GKVE 1C4Y2 2EI6A 4A1XA 3ZVAA 4INHA 1QURH 2FO9A 2OD3B 2QY0B 3RXKA 5C67A 3A8DA 3TIUA 4UONA 3SU5A 2FYRA 1PPFE 2G52A 2I6QA 4FUDA 2EC9H 2F3CE 4Y76A 1E38B 4IBLH 1VJAU 4JZ1A 1PJPA 1SR5C 1C9PA 1J17T 1AE8H 2ZECA 1C5RA 4BAOB 1MTSA 3GY6A 2QN5T 2ZC9H 5JBBS 2J94A 1YC0A 3EDXB 3P8OA 2W3IA 7GCHG 2BDCA 1TX6A 1OPHB 3VGCC 2FEQH 3GICB 4NWLA 5E2OA 1ETTH 4INLA 1IQNA 1BTHH 1CQQA 2AS9A 2A0QB 1NU7B 1L1NA 3BTKE 3FANA 4FU8A 3ZVDA 5T3HA 1Y3YA 3GCTG 1X7AC 1BTUA 1LHEH 4CH8B 1T8MA 2GCHG 2FX6A 3I77A 3SU4A 2BVSH 1SMFE 3P70B 2AIPA 4O03A 3RXBA 4Y7AA 1DXWA 2A7JA 1GBBA 2FX4A 3ZZ5A 1XXFA 1NY22 1S83A 2FOHA 5DGJA 3ZVEA 3M5LA 5EQSA 2Y6TA 1CO7E 1LVOA 3R0FA 4D9QA 1BTXA 1L4ZA 1GCTB 1GL1A 1SBWA 1S6HA 3RU4D 3D49H 2C4FH 3F68H 1SHYA 3QGNB 4OS1A 2PKAA 1V2ST 5FPSA 1MD7A 1QQUA 3A7ZA 3RP2A 2QCYA 4FUJA 1EZUC 2GT8A 2HPPH 4LXBH 1BT7A 4YO9A 2R0LA 4RSPA 1HB0B 3QGJA 1GDNA 2G5NA 2R3UA 2BXUH 4B2BA 3R3GB 4AORA 4RKJB 1NFUA 1V2UT 3M61U 4FXGH 5A0BA 1V3XA 1TE0A 4AFUA 1GHWH 1AHTH 1F92A 1ORFA 3A82A 4JZIA 2OC8A 4B75A 1O2HA 1F0UA 1Z8GA 3QZRA 3RXFA 2ZTZA 1KYNA 1VCPA 3SUDA 2O8MA 2DE8A 2FI3E 1O2SA 4NZQA 2NU3E 3T2NA 2XNIA 1ZMNA 2A4RA 1C5UA 3SJ9A 2OC0A 1DWEH 3LT3A 4K2YA 1QJ7B 3PLKA 1GBHA 2PTNA 1V2MT 1EPTB 4O3TA 1OSSA 2BY6X 1LDTT 2FOMB 1O3IA 3JZ2B 1TABE 1P2IA 3E0NB 1YPHC 3UTUH 2A2XH 2HWLB 1T4VH 1O3FA 1T8OA 1Z7KA 1ZYOA 1TONA 3BEFB 2G00A 3SNAA 4YOGA 4KKDA 1GI3A 1S81A 2XYAA 4WY3A 3U8RH 1UO6A 1DICA 4LOYH 4JZDH 1J15A 1DM4B 2Y5GA 2KAIB 4K3JA 4Y10E 2Z9LA 1C4U2 2GV6A 1HAVB 3LGTA 2B7DH 1H9LB 1O3JA 2A1DB 3RXOA 4BTUB 7GCHF 3CP7A 3U1IB 5T6FA 4E7NA 4AOQA 4ZROA 4AB8A 1EP6A 2TGTA 3A7TA 3KGPA 3TK9A 5JBTA 5TCCA 2FODA 1TIOA 1C2GA 1N6YA 3W94A 1FJSA 1C5YB 1FONA 3LGVA 3ATLA 3M3SA 4FUFA 4ASHA 2ZKSA 2QXHA 2GGVB 2D2DA 3F9FA 3GCTF 3SHCH 5FPYA 5GDSH 1ANEA 1G3CA 3MU4A 5FHTA 1PYTC 4CR9A 1NZQH 4UEHH 3LC3A 1TNKA 3MU1A 5J4QA 2THFB 3RLYH 3BTFE 2D8WA