3P92A

Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (bpti-k15r/r17g)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRSS3 protein
publication title The P2' residue is a key determinant of mesotrypsin specificity: engineering a high-affinity inhibitor with anticancer activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p92A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p92A02
4CRDA 1GBFA 1TPPA 4B75A 3IG6B 1GMHF 4Y10E 5F03A 1MQ5A 4O3UA 2GTBA 4Z6AH 1ZSKA 3P95A 2F9NA 2Z3CA 1ETSH 1XUIA 5H4IB 1VCPA 1W0YH 1KXEA 1SMFE 4MPXA 2GGVB 1WTHD 3KHVA 2SGFE 3SGBE 3QDZB 4NIYA 1SR5C 1LVOA 4ZROA 3KL6A 3E90B 5AVDA 2H5DA 4WMEA 1AUJA 2CHAB 3KN2A 1O5FH 1UTPA 4O9VA 2A4GA 4QT8C 3L3TA 2NU3E 4ISHH 4TWYA 1OWHA 3FVFB 5EQQA 1IOEA 3RC6A 2DUCA 1UK2A 5AFZH 3GY7A 1ELBA 1NU9A 4YM9A 2BLOA 1IHSH 2ZA5A 5K0HA 3SV2H 1PPFE 3Q77A 1XVOA 1C1SA 2TBSA 1C2MA 1YM0A 2BX4A 1A0JA 1SGNE 3T62A 4FUFA 2PGBB 3I78A 3SHCH 1UJ1A 2PSYA 2A5IA 4MNXA 3P8GA 5FBIA 3S7HB 4ISNA 2A32A 1O5DH 4NIWA 1S82A 1V3XA 4M7GA 4I7YH 3ESTA 4MTBA 3UR6A 3ZZ7A 2CV3A 2ZTZA 1O2IA 1IHTH 1HJAB 4FUIA 1GMHG 3BEUA 2ZPSA 3HPTB 3SNBA 1C5YB 1DITH 1HAHH 4GUXA 2AERH 1GBBA 4OGXA 5DP3A 5FBEA 3BIVH 5FCRA 1O31A 1SBWA 4FVDA 4LOYH 1IQHA 3B23B 1DWBH 5K7RA 1CGHA 4ABEA 1L0ZA 1O2WA 2G4UA 4X2WA 4IW4E 2ZC9H 1DWDH 5GCHG 5JB8S 1MKWK 1IQNA 1TX7A 2ZDAH 1MTWA 4ZKOU 4BNRA 3M7UA 1DWEH 1F0UA 3KQDA 1A3EH 1GI2A 1ANDA 4XE4A 2PSXA 3RXHA 2Y5FA 1EB1H 1EOJA 1Q3XA 1MKWH 4UONA 1S85A 1EPTA 3GCTG 4DW2U 1GMCF 1QGFA 1EZUC 1BRUP 1FDPA 3TVJB 1UHBA 1KTTB 2Q6GA 1TGCA 1MQ6A 2WPKS 5ETXA 4Z0KA 3MYWA 3OX7U 1ANEA 1CHGA 2JETB 2ZHWH 5BRRE 2CJIA 1C5RA 1O2TA 1B0EA 1Q31A 5F8TA 3PWBA 1FI8A 3HGPA 3TK6A 1SGEE 1SFQB 4B74A 2OC0A 5FPYA 5EPYA 2GDDA 4TPIZ 4OGYA 2GP9B 3RXOA 4AGKA 2ZQ1A 3H7OA 1OSSA 1ZRBA 2J34A 1SFIA 3NCLA 1ARBA 4UFEH 1WBGB 2JH5D 3T26A 1IAUA 2BY7X 4JK6A 4WWYA 3SU0A 1K28D 1EATA 5E0HA 2A4OA 5JBBS 2BD9A 3ZZ5A 1L1JA 3ZYEA 1PQAA 3ODDA 3RXDA 1ZPZA 1OWIA 1C5LH 3RU4T 2BDIA 2FLRH 3TGIE 1G37A 1NRSH 1G30B 4Y7BA 1GBJA 3S69A 3AASA 3OU0A 4SGBE 4DIHH 2A2XH 1TGTA 2P3FH 1GI5A 1GG6B 1ELAA 1TNJA 1YCPM 1RFNA 1SLXB 2QN5T 2XBWA 2GMTC 1T8OA 1GBHA 3A87A 1NU7B 2W7UA 2ZFSA 3U8OH 5CMXH 1OWKA 3NK8A 1H9IE 1HPGA 1YC0A 3NXPA 4X8VH 1QB6A 2P8OC 4YZUA 1MH0A 3RXPA 1V2QT 3EAJA 4DJZB 1NPMA 3RXJA 1C4V2 1EZQA 1EOLA 4X6OA 4K8YA 3T27A 5HYOA 1QRXA 1A4WH 1G36A 1QHRB 1BCUH 1GJ5H 1MBMA 3PROA 1KXFA 1C1PA 1XUGA 1ZGVA 5J4SA 2A31A 1XKBC 1ZTJA 4I8LA 1K21H 3FP8E 2UWLA 1EQ9A 6CHAC 1F92A 2ZFFH 3PMJA 1VZQH 2GCHF 1BMLA 3UIRA 1IQIA 3TU7H 3UR9A 3P92A 1A7SA 2BD4A 3U9AH 1GWAA 1Z8RA 3FANA 3R0FA 2SNVA 1EB2A 1ETTH 2W3IA 1BTHH 1KIGH 7GCHG 2Z94A 3RXAA 2H9EH 1QJ7B 3N7OA 3SNEA 5I46H 4IC6A 4JZIA 3A83A 2ODQA 3RXCA 1F7ZA 2FX6A 1AD8H 1UCYK 4INHA 1TPSA 2GZ9A 3UPEA 4RSPA 1T31A 1P05A 1EXFA 3HKIB 6GCHF 2CF8H 1NFXA 3OYPA 1AIXH 3EDXB 4JZ1A 1BTPA 1K1OA 2ZDVH 1Z8GA 1KLIH 1PQ8A 2XC0A 1BOQA 1GHZA 1Z1IA 5HM2A 5T6GA 1C5VA 3MNSA 5GDSH 2PLXA 4E7NA 1UCYH 5A2MH 2G00A 1MD8A 5HGGA 1FV9A 5DP9A 3BG8A 3IITA 2PUQH 1NFYA 3VB4A 1YCPH 2ZU5A 1FZZA 1GJ7B 1O3AA 2CF9H 3MTYA 4J1YA 1O3JA 4B71A 1ZYOA 1NFWA 4YLQH 3AAVA 2FOAA 2VIWA 3QGNB 1UCYE 1S5SA 3P8OA 4A1XA 2EC9H 5E2OA 1CBWC 1K1PA 3W95A 3UQVA 3TLOA 4I8JA 4INKA 3TH3H 5GXPA 1O30A 1O2GH 2GMTB 1S84A 4HFPB 1SC8U 1C5WB 1VGCB 3LDXH 2ZHQH 1ETRH 2BD5A 2Y82A 4U2WA 1TNHA 1ELCA 5GIBA 1SSXA 1DY9A 1SG8B 3KNXA 3VB7A 5GWZA 1PPZA 2P8OB 3BTFE 4BAOB 1DX5M 1JWTA 2BXUH 2ZIQH 2HGTH 2HALA 3MU8A 2Y7XA 1PQ7A 3A88A 4FUGA 2B7DH 2KAIB 1RD3B 3TGKE 1GPZA 3A7VA 5T6FA 3PLKA 4GPGA 1BUIA 2Y7ZA 2TGPZ 1F0SA 1SGYE 3DFLA 3S9BA 7KMEH 3CP7A 3S0NA 1GHYH 1DWCH 2G51A 1GHAG 6CHAB 4BTIB 1S81A 1M9UA 1O39A 1HAVA 1F5LA 2ZKSA 4RN6A 3MHWU 1UMAH 5F6MA 4K1TA 1D4PB 4IBLH 4CHAC 2PFEA 1HAXB 4UEHH 1H9HE 3GDUA 2FOMB 4X1SU 3Q3YA 4JYUH 5T6DA 4BTTB 2VGCB 3ZVAA 1V2JT 5I25A 1A3BH 4BAHB 3SUEA 3M7QA 1HCGA 4MDSA 1P2NA 2FI4E 3MH6A 1ARCA 3T2NA 1SGCA 3E0PB 2NWNA 4Y71A 2G8TA 1O3FA 1UVUH 2CGAA 2Y80A 4CRAA 1BMNH 4K60A 1LTOA 3LJOA 5AHGH 1VITG 5FX5A 2F91A 1KXAA 1LPGB 1W8BH 2ZHFH 1FY5A 1ZRKA 4NWKA 1A2CH 5A8XA 1FONA 1P04A 2FS8A 1GBLA 1GBIA 4X6NA 1TAWA 3SQHE 1C2LA 3LGVA 2Q6DA 4WXIA 4OS2A 1H8DH 2AH4X 2BLVA 2ESTE 3RXQA 1C2GA 2ZTXA 3VB6A 2H2ZA 4Q7ZA 5LPRA 3VB3A 3B8JA 4X0WU 2G81E 4IGDA 2JH0D 1Y3UA 3P70B 1HJ8A 2Z9IA 5C20A 4FVBA 1SB1H 1FY1A 1O3PB 1TALA 1P09A 2A5KA 2BMGB 3C1KA 1C1UH 2A4QA 1HAIH 5ESTE 2P94A 3GY4A 5E2PA 2ZO3H 2G5VA 3VB5A 2PV9B 1N8OC 1UTKA 1ELEE 2UWOA 8ESTE 1KDQB 3QO6A 1SLWB 1UK3A 4AOQA 4KELA 9LPRA 1ZLRA 2BDBA 4NFEA 1D3PB 1BHXB 1KLTA 1TOCB 2RA0A 2WV4A 1GI4A 3U8TH 1LVYA 2BD7A 2VIDA 3U1JB 3SU6A 4JYVH 4UFFH 3KQBA 3RXIA 3SUGA 2FO9A 4UD9H 1AFEH 2DE8A 1C5OH 1EJMA 4JCNA 3M37A 3UFAA 1GI7B 1ELDE 1O3HA 1QL9A 1CA8B 2VIVA 3RXFA 4THNH 1BHXF 1P3CA 5DP8A 4X2YA 4K1SA 1DT2A 1RTFB 3KEEA 1LO6A 2WUBA 2PHBA 3WY8A 4WF8A 2LPRA 4CRGA 1O3MA 1V2MT 2BD2A 3LJJA 1NRNH 4FUEA 4WMDA 5LGOA 2WYGA 1RRKA 1W14U 3MH4A 2BDHA 1UTQA 3EQ0H 2O9QA 4AYYB 3NWUA 2TGTA 1ZZZA 3FP7E 4K8BA 1GI6A 2QIQA 2H9HA 2GZ7A 1QL7A 4YLUA 3SO3A 4FU7A 3SJ9A 1A5GH 3MH5A 1GI3A 1LKBA 4E7RG 1HUTH 1TA2A 1XMNB 1YPEH 1GBDA 4KTUA 3SJIA 3TITA 1SQAA 1DSTA 1C1VH 2GCTC 3PO1B 1D6RA 1D9IA 1GI8B 1C5TA 1O3GA 3MI4A 2VIOA 2Q6FA 5EU8A 1C2IA 2AFQB 1HYLA 4I8KA 5AFYH 3SOSA 1IQEA 1LPKB 1F2SE 1BJUA 1P01A 1V2KT 3SU5A 4MPVA 4AFUA 1QB9A 2QXGA 1YP9A 1UTLM 2WUCA 1LVBA 1Z1JA 2ZGJA 2NU1E 4WMFA 5IDKA 3UNQA 1T4VH 2OC7A 5ESBA 1C1QA 4BAMB 1GHWH 4PROA 3UTUH 1O2JA 1TMTH 1C1TA 1FQ3A 5A0AE 3SW2B 2VWLA 4XBBA 3RXVA 1FY3A 2V6NA 1PFXC 1AKSB 3LPRA 1FLEE 3ZZ9A 4Y8ZA 3SU3A 2I6QA 1BZXE 1C1NA 3M5OA 3RLWH 1SLVB 2TGDA 1O2RA 1H8IH 2H1UA 4TY7A 1PYTC 1ACBE 1TNKA 3BEIB 3SUDA 1G2MA 2HNTE 1LHGH 4D76A 1P0SH 5DP6A 1AB9C 5JBAS 1O33A 3KF2A 2BY6X 3HGNA 2BXTH 1SGFG 2GV7A 4LZ1H 4ASHA 3ZVFA 2XXLA 2GDEH 3OY6U 4MNVA 1LHFH 3U69H 2PTCE 1P10A 2F9VA 5HM9A 3Q3KA 2ILNA 3I29A 3ENSB 4K3JA 4A1TA 1WQVH 1BDAA 1LHCH 1GMDG 1NRRH 1SHHB 2VVVA 4XBDA 4CBNA 4X2XA 2QV1A 3ZVBA 2AS9A 3QGJA 4WJG2 3GY6A 2D8WA 5C5NA 4CREA 2BVRH 2FOCA 4CR9A 2ZHEH 1QIXB 8GCHG 1MAXA 1CA0B 1C2FA 2ZECA 4XFQA 3SU4A 2BM2A 5LPFA 2EEKA 1F5RA 2J2UA 2FMJA 2XC5A 4D7FA 2VH0A 1GHBG 4SGAE 1KXDA 4Y7AA 1TPOA 3SNDA 2FOGA 1QQUA 3O8DA 2ZEBA 2BVSH 1GL0E 1OYTH 1SI5H 2VIPA 3Q76A 2EI6A 1SGTA 1WSSH 3SJKA 3M5NA 2QXJA 2LNCA 4AB8A 5FHTA 1B5GH 3URDA 1DE7H 3GICB 4XDEA 2BOHB 1HAZB 1OWJA 4U01A 1HIAB 2VNTA 1GBAA 3MFJA 2ANMH 1QJ6B 1RS0A 2Z9KA 4BANB 1AWHB 2B8OH 2GD4B 2XCFA 5FXLA 3RUOA 2BX3A 2FTMA 5TCCA 4X2VA 1ESBA 3SGQE 3GY5A 5A8ZA 1O5EH 3BG4B 1O3DA 2FWWA 3SI3H 3ZV9A 6ESTA 1P9SA 3MNCA 5LH8A 4FUJA 5EOKA 3ZZ6A 2OP9A 2PKSC 2C93B 4O3TA 3NUMA 4OS5A 2FOEA 2EI7A 1DXWA 1Z6EA 1SGQE 1GDQA 1P12E 1A0HB 3EA7A 1J16A 1W13U 1QBNA 4XOJA 4RKOB 1EZSC 1GGDC 1V2TT 4JK5A 4U32A 2F9OA 2V3HH 1YPHC 2ZHDA 1OPHB 3TJNA 1C1WH 4X1NU 1Z7KA 4FUBA 1C1RA 1P2MA 3ZV8A 1O2OA 1SGRE 1W11U 2EI8A 1LQEA 1MMJN 3SORA 3BF6H 2P93A 4X6MA 1E37B 3GYMA 5EW2H 1MCTA 1ESTA 3RU4D 3EE0B 1MTSA 4FXGH 2OUAA 1FNIA 2WPJS 3T5FH 1NFUA 1TA6A 2P95A 1AVGH 2J95A 2SFAA 1ESAA 1SLUB 2Y81A 3ZVGA 3A84A 2ZP0H 3LU9B 3TIUA 2BOKA 4JYTA 3FAOA 2R3UA 1TGSZ 2C90B 1ZOMA 2O8LA 3K2UA 3R3GB 2ANWA 1JXPA 1LPZB 1O38A 1UVSH 1DSUA 5DKMA 4D7GA 1F0RA 2ZZUH 3VEQB 2XYAA 5L30H 3PB1E 4NFFA 4ABAA 3TH4H 1GMCG 1VCQA 3U1IB 2OTVA 4Q80A 1SQOA 1O2YA 2W3KA 1EZXC 3HK6B 3F1SB 2K1QA 4B2BA 3RXUA 4Q7XA 3S9AA 2XW9A 1H9LB 2WV5A 1WCZA 3E0NB 5F8XA 2OQUA 2GX4A 1HJ9A 1XUJA 1C5QA 1FXYA 4IN2A 3K6YA 3ZZ8A 1LDTT 2PKSB 3A81A 1SPJA 2BLWA 5DP5A 1V2ST 3RMLH 4UFDH 5A0CA 2ZDMA 2BD8A 2STBE 3BIUH 4LXBH 1THRH 1JMOH 1FPHH 1T32A 4CRCA 5HXFA 1NRQH 1HGTH 1P06A 3LH3A 1P03A 4ZHMU 4CBOA 1J8AA 1O2NA 2QC2A 3GCNA 5CHAC 1L4ZA 5GPIB 1O35A 2Q1JA 3BTHE 4Q2KA 1A46H 1SGFA 2QF3A 4X8SH 4AFZA 1TRNA 1K1IA 1A5IA 1C5NH 1WAYB 3PLPA 2FPZA 1Y5AT 3P6ZB 4NG9H 3VPKA 5DP7A 1DVAH 3DUXH 3P8FA 1FN6A 1QNJA 4OS4A 2PGQB 4B1TA 4JZDH 1F0TA 1XVMA 2ZGXH 2BYAX 1O3KA 2OBOA 2PKAB 2BDCA 1SOZA 4NA9H 3BTQE 1C2DA 1YCPK 1W7XH 1DS2E 2STAE 2A7CA 5FAHA 4VGCC 4MVNA 1KXBA 2A4RA 1L4DA 1J9CH 2J38A 2BY9X 3PMAB 4RKJB 1V2PT 2BD3A 4A5TS 2RA3A 1GBTA 2V3OH 1K22H 3F68H 2ZDLA 3UWIA 1ZGIA 1ELGA 3DA9B 1CU1A 5HMAA 4H6SB 2AYWA 2HPQH 2D1JA 3LH1A 2AGEX 2ZI2H 4AN7A 4MQAA 4XSKU 4FU8A 3T28A 7ESTE 1QB1A 1OXGA 1EPTC 3GY3A 3UOUA 1EASA 2WYJA 1W0ZU 3V13A 2GCHG 2RCEA 2P3UB 1A5HA 4FUHA 1ZR0A 1QBOA 2BQ7B 1AY6H 4YOGA 3NZIA 1CSOE 3V12A 3F9FA 2WPHS 5CE1A 2TPIZ 4UE7H 2CXVA 4B2CA 1THSH 5GJ4B 1KY9A 1MKXK 2BHGA 1GI1A 1HAGE 1O2VA 1TNLA 1HNEE 2NU2E 4KP0A 4I8HA 3UQOA 4JMYA 3O8CA 3A7XA 3RXGA 4LK4A 1BQYA 2QXHA 1GJCB 3FZDA 6GCHG 1EJAA 1KSNA 1GBEA 1MKXH 3D62A 4AG1A 1MTVA 2Z7FE 1G32B 1TABE 3ATMA 3TGJE 1O5CB 1PPHE 1O37A 1WOFA 5DJ7A 4CH8B 2BY5X 4NIXA 1CHOF 2C8XB 4X8UH 5JYIA 3GDSA 4WY3A 2HWLB 1ZTLA 4GLYA 4BAQB 1A1RA 1XUHA 1C2KA 3D23A 2AIPA 1O2QA 1AZZA 2YNAA 5FPTA 1TQ0B 4GCHF 4LZ4B 5F8ZA 3VGCC 4X1QU 3A82A 4ABDA 4J2YB 1A61H 1S0RA 1UVOA 1YBWA 2VIQA 3F9EA 3SGAE 4GHTA 4AZ2B 2ZNKH 1CT4E 3SNAA 1VJ9U 3D49H 1D3QB 4VGCB 2O8UA 1D3TB 1AN1E 2H5CA 2J9NA 4AG2A 1YYY1 3GCOA 4K2YA 4O97A 1QQ4A 3RMNH 1GHXH 3ATWA 1ZPBA 1TPAE 1OP0A 4MNWA 4D9QA 4ABFA 1UVTH 4YOJA 2P59A 4ZKNU 2FOBA 2ZU4A 3RXBA 5EODA 1MTNC 1SVPA 2ALPA 1GJ4H 1C5MD 3ZZBA 1EPTB 2F9BH 3SV7A 1CBWB 4WXVA 1FIWA 1OP8A 4Q7YA 2AGGX 3UNRA 1UHBB 5DGJA 2UWPA 1QBVH 3CS7A 4YT6H 3LGWA 2GVFA 2R9PA 3EGKH 5E8EH 5EXLA 1NC6A 4GVUA 4BAKB 1P2QA 2ZQ2A 1QRZA 1HAPH 2FS9A 3UREA 2ZGCA 4B76A 3A80A 4ABHA 3ELAH 3RLYH 3RC5A 3LGYA 3S9CA 3AAUA 4GCHG 3FP6E 2SNWA 3H5CB 4AGJA 1IQJA 1C9TA 1MZDA 2FX4A 3TK5A 1TRMA 4CRBA 1LKAA 1Y3YA 3LC3A 1C5UA 1PYTD 3PMHB 3QZRA 3A7WA 1OWDA 2OD3B 1TQ7B 3M36A 3V3MA 3SNCA 2QA9E 2ZDKA 2VWOA 4ESTE 4ZKSU 4X1RU 1GBKA 4CHAB 3SV9A 4AX9H 1MD7A 1RIWC 1V2UT 2AEIH 1DPOA 1DDJA 3SI4H 3JZ1B 1HAOH 3P17H 3LIWA 1YPMH 2HOBA 1THPB 1T4UH 2JKHA 2FZZA 1TOMH 4AYVB 4WH6A 1NN6A 4DVAU 3A8CA 1K9OE 3HKJB 2SGEE 3F6UH 1Q2WA 3VGCB 2F9PA 4AFQA 1S6HA 5DO4H 3SN8A 2F3CE 3E8LA 2HVXA 2BZAA 1G3EA 2WPMS 3TJOA 2QYIA 1O2ZA 1RJXB 2ZG0H 1K2I1 3A7TA 3DFJA 8KME2 5JDUB 1EJNA 1PPBH 3H7TA 1V2WT 2WINI 3MO9A 5JBTA 1BITA 3PTBA 1YLCA 4ZHLU 3MO6A 1JRTA 2OC8A 3CENA 2BDAA 4OS6A 4DY7B 1O2HA 4F49A 1G3CA 3M3SA 4OS7A 3SUFA 3RMMH 1C2HA 3EYDA 4K1EA 3ZZ4A 1SL3A 1TGNA 1ABJH 2ANYA 1FUJA 3ZZ3A 1BRCE 4DOQA 5ABWA 3BSQA 1WYKA 3MU0A 4KTSA 1N8OB 5C1XA 3SZNA 3IWMA 2PW8H 1MU8B 3VXFH 1AUTC 1BTYA 5B6OA 5FPSA 4Y8XA 3GOVB 3KQCA 3PWCA 4WH8A 1BBRK 4B73A 2FXRA 1TLDA 2XNIA 1EAXA 2FP7B 4B2AA 2G4TA 3MU5A 3KQEA 1GVZA 1XX9A 3ZVCA 1CE5A 1TWXB 3RDZA 1DICA 4TY6A 2ODPA 3O8BA 3T25A 1Y59T 5FCKA 1O3EA 1HJAC 4INLA 1BBRH 4YO9A 1B0FA 2O8TA 3M3TA 3GY8A 2FEQH 2C3SA 2SGDE 2ZCKP 1CT0E 2ALVA 3JZ2B 3RXKA 1C2EA 1O3NA 5DP4A 4DT7B 1V6DA 1BBRE 4FUCA 4ZHAA 4FU9A 2M5TA 4IMQA 3SU1A 2R2MB 1S6FA 5C67A 3TJUA 1C9PA 1EUFA 1QTFA 1GI0A 3FZZA 2UUYA 3BTTE 3F9HA 1NROH 5EGMA 5AF9H 3QTOH 3O8RA 2QF0A 1K1LA 1UVPA 4Y8YA 3OY5U 1BMMH 1DANH 1GBMA 1WUNH 3T29A 1EAWA 1EKBB 3E6PH 4ABIA 1CT2E 3TH2H 1O36A 1ZMNA 1AO5A 1Y3VA 2FLBH 2Y5GA 2UUKB 2XBYA 1N6YA 3M5LA 1D3DB 1UTOA 1O3LA 1KYNA 1L1GA 4D8NA 1JOUB 2JETC 1Z71A 1DLEA 1HAVB 1P2JA 5GCHF 1J14A 4XBCA 1H1BA 1GVKB 2GCTB 1IQMA 2V0BA 4IC5A 4I32A 5IYTA 1W10U 4IMZA 2BDGA 3K6ZA 4Y11E 3TNTA 1GBCA 2A7JA 1NTPA 1NY22 3ITIA 2KAIA 2XRCA 1VJAU 1XXDA 4ABGA 1PJPA 3V0XA 3QUMP 4I8GA 4ISLA 2QAAA 3I77A 2VU8E 1NO9H 2GT7A 4CR5A 1E38B 1EAIA 1O5AB 5L2ZH 1EX3A 2CMYA 3GCTF 1O3OA 4DCDA 4BXWA 1QCPA 2G5NA 4Y79A 2ZPQA 2Z3EA 1S0QA 2C8YB 2ZGHA 2RDLA 2Z9LA 5EW1H 2PTNA 3GY2A 1FPCH 2OCVB 1CGJE 1MZAA 1HAYB 1BT7A 1QFKH 1E35B 4E05H 3C27B 1ZJDA 2ZCHP 1V2NT 2CN0H 2ZFPH 1FN8A 3RP2A 1EP5A 1TB6H 3NPSA 3MNBA 3M5MA 4R8TB 1LVMA 1DUEA 1GG6C 2OBQA 1F5KU 1RTKA 1C5PA 1P9UA 4UDWH 3MU1A 1W12U 2I6SA 2OLGA 2P3TB 2XWAA 2HLCA 1G3DA 1MBQA 1ELVA 1QA7A 1DFPA 1ZTKA 1IQLA 1HXFH 4GAWA 3E3TA 5EQSA 1QA0A 2UUFB 1O3CA 2TRMA 1QL8A 3RXRA 1GJ9B 1AB9B 3ATLA 4F4OC 1IQKA 2FI3E 1AVXA 1VCWA 2O8WA 5DK1A 1XUKA 1TX8A 2OINA 3LGUA 1V2OT 4YTAA 1AI8H 2XCNA 2FOFA 1E34B 2ZPRA 3TK9A 4ZKRU 5EPNA 3MH7A 1LHEH 1GDNA 1OYQA 1PPCE 1P2IA 2VJ1A 3OTJE 1S83A 2GZ8A 3AW0A 2NU4E 4MPWA 2D2DA 1PQ5A 1X7AC 5JB9S 1O2XA 3ZVDA 2FOHA 3QX5H 1DY8A 2EA3A 5EXNA 5PTPA 4ISOA 1NZQH 2FM2A 3URCA 2BQWB 3LOXA 4NCYA 4NZLA 3RM0H 3MWIU 2H6MA 3SV8A 1W3CA 3LGIA 1KDQA 1U6QA 3OSYA 1ORFA 4JZFH 4D9RA 3ZZCA 2B0FA 1FAXA 4MPUA 3W94A 1GJ8B 3STIA 1GJ6A 4ZXYH 1ZPCA 2A45B 1N1LA 1KTSB 1Z6JH 3SQEE 1TIOA 1UTMA 3GDVA 3K9XB 4ABBA 1BMAA 1GL1A 2ZU2A 1Y3WA 2FI5E 3LGTA 1AFQC 5BPEA 1C5SA 4FUDA 1FAKH 3RM2H 3A8DA 1INCA 1AMHA 6LPRA 2G52A 3SHAH 3LKWA 5EQRA 1GCTC 1YPLH 1TYNA 2C4FH 7GCHF 1BIOA 2BLQA 1BRAA 1SGDE 1YKTA 3RXEA 1K1MA 4CH2B 2J4IA 3A7YA 3ATIA 2RG3A 1OKXA 1WV7H 1Y5BT 3RC4A 3L33A 3BTME 1AQ7A 1C2JA 2A0QB 3DT0H 1CQQA 1VGCC 5EXMA 1GGDB 3E16B 2BVXH 1NM6A 3A8AA 4O03A 5FX6A 3RXLA 3SJ8A 2FYQA 4Y0ZE 5DPAA 2IPHA 3NKKA 2ODYB 1YF4A 1PPEE 1BTZA 1RTLA 5C3NA 1QR3E 3BTKE 3MMGA 1O2UA 2VB0A 4GHQA 1JRSA 3PM3A 3STJA 1AHTH 1DLKB 4HI3A 4MLFB 1RGQA 3Q00A 1UK4A 1V2RT 2B9LA 1XKAC 1AGJA 2ZDNA 3RXMA 2XTTB 1P57B 1HV7A 1OX1A 5C2ZA 4NA8A 3ZZDA 1OOKB 2J94A 4NSVA 1UTJA 5E0GA 1SOTA 3MOCA 2VGCC 3AVZA 1L2EA 3BTWE 3ZVEA 4Y6DA 4ZXXH 3A85A 2FESH 5T3HA 3RXTA 1W2KH 1HBTH 2W26A 1O3IA 3EA8A 3GCHC 4DIIH 2VINA 3TJVA 1TFXA 3QLPH 1YPGH 1FIZA 1P2KA 1SHYA 4BOHA 3A89A 3SJOA 1GHAF 1HFDA 1AFQB 2Y6TA 1ELTA 1HDTH 1K1NA 2P16A 3ZZAA 2VVCA 4ISIH 3UUZA 1T8MA 1AU8A 3PV4A 3SV6A 4KGAA 1YPJH 4JZEH 5J4QA 1GCTB 1YGCH 1C1OA 2AIQA 1DUAA 3DHKH 4UFGH 3EA9A 1AKSA 3BN9A 3L6PA 1MUEB 2ZCLP 3AW1A 1AZ8A 1ANCA 3SU2A 4DGJA 2GKVE 3HATH 2W7SA 3F9GA 2W5EA 1MAYA 2ZFTA 1YLDA 2R0KA 3E91A 1Y8TA 3ZYDA 1QRWA 2OXSA 1TRYA 2BB4A 1C4U2 1NT1A 4TPYA 1VITF 1GI9B 4DG4A 5G4BA 1LQDB 1ZMJA 1GCDA 2J92A 2VWNA 1TBRH 1VR1H 5CHAB 2BTCE 2HNTC 1UTNA 9ESTA 4CRFA 2IOTA 2ULLA 4ZUHA 1DOJA 4KTCA 4X6PA 4ZAEA 2GT8A 1WU1A 2Z3DA 1K1JA 1N6XA 4R0IA 1CO7E 4DURA 1MCVA 5C1UA 5L2YH 4IN1A 5JPMH 1IQGA 1TNGA 2VWMA 5E0JA 5C5OA 2WPIS 3QTVH 2IN2A 1ZSJA 3GISB 2YNBA 3M35A 3ODFA 2OQ5A 2OC1A 1O2MA 1C4Y2 2THFB 1TE0A 3ATKA 1O3BA 4AORA 1SGIB 2UUJB 3MNXA 2DE9A 1W7GH 4K5ZA 5SGAE 3FFGA 1T7CA 2QCYA 3VXEH 2FDAA 5A8YA 1AE8H 3GCHB 1DM4B 1BTUA 3PLBA 2HRVA 2WPLS 1O2KA 3A7ZA 2F9UA 1GHVH 1HIAA 2JH6D 2R3YA 3B9FH 1C5XB 1BB0B 3U98H 1D6WA 1E36B 4H4FA 5EG4A 1YPHE 2ZU1A 2AGIX 1C1MA 2ZGBH 2BDYA 2HPPH 2B5TB 5A09A 7LPRA 1J17T 1TX6A 1UO6A 2BQ6B 3BTEE 1ANBA 1P3EA 1HRTH 2FIRH 3MO3A 1CHOG 4I31A 5DG6A 1ZHPA 3BV9B 4YESB 3UOPA 1AWFH 2QGRA 1T8LA 4TWWA 1NRPH 1BRBE 2YOLA 3PYHA 2GV6A 3BTDE 2AMDA 3QZQA 1TBZH 1FMGA 1DXPA 3E1XB 1GJDB 1ZHRA 4I33A 1KXCA 1GJAB 4HGCA 1QURH 1P8VC 2ZWLH 1JBUH 1RXPA 2SGPE 1G2LA 1A0LA 1O34A 1CGIE 1Z8JB 2XBXA 1J15A 5L6NH 1C5ZB 5A0BA 1BJVA 1NESE 1NS3A 4YOIA 3PO1C 4U30A 2A1DB 1XM1A 4HTCH 1ID5H 5JBCS 2VVUA 3QN7A 1G3BA 3P8NA 1H4WA 2XBVA 1VITH 4TYDA 3CS0A 3PTNA 1ZHMA 1IQFA 1V2VT 3RMOH 4ZMAH 1L1NA 2TIOA 1KLJH 3RXSA 4A6LA 1HLTH 2PR3A 4ZH8A 4ABJA 3TPIZ 2ZF0H 1T8NA 3KCGH 2QXIA 4GSOA 1PPGE 2AMPA 3MU4A 1P2OA 4A1VA 2HNTF 1HXEH 3LT3A 4X1PU 3TNSA 1TNIA 1ZSLA 1AE5A 1B7XB 4H6TA 1SQTA 1O2PA 3GYLB 1OS8A 1WQSA 2A2QH 4KKDA 1CVWH 1GDUA 2Y5HA 1Y3XA 2A7HA 4H42U 2Z9GA 4NWLA 4BTUB 2ANKH 3PMBB 1HB0B 1WTGH 2SGQE 3DD2H 1P02A 4Y0YE 3LONA 4NSYA 4AB9A 1LHDH 1G9IE 2SGAA 1O32A 2NU0E 1MTUA 3SBKA 3UWJH 2FODA 3HK3B 1TMUH 1TGBA 1XXFA 2R2WU 4OS1A 1MTNB 2C8WB 3KGPA 1O5GH 4E06H 1QJ1B 4A7IB 3QWCH 2AMQA 2ASUB 2A5AA 5TJXA 3UY9A 2C8ZB 3M7TA 2R0LA 5LPEA 1ABIH 1ZMLA 1YPKH 2BY8X 2CHAC 2ZTYA 3G01A 2ZU3A 1BTWA 4HZHA 4NA7A 4AFSA 2H9TH 4IS5A 4X8TH 3A86A 3QK1A 4YT7H 1FY4A 1AVWA 3BTGE 2FTLE 4K69A 1O2LA 1SGPE 3BEFB 2VH6A 1GJBB 1XUFA 2Z9JA 2ZFQH 1O2SA 4MG3A 3A8BA 5C1YA 1TONA 3UNSA 3LC5A 4Y76A 2F83A 1JIMA 1TBQH 3K65B 1Z8IB 3M3VA 1QY6A 4NZQA 2PWXA 1CA0C 1FJSA 5TCAA 2O8MA 2TGAA 2IJOB 1FY8E 1TMBH 2XWBI 2Z6BD 8LPRA 1Y5UT 2BZ6H 1ELFA 1O0DH 4A92A 1RIWB 1BA8B 1E0FD 1GMDF 1V2LT 3M61U 4MNYA 2QY0B 3VFEA 1O5BB 1P11E 1OWEA 1GVLA 3Q3XA 1EAUA 2G55A 3RU4E 2D26C 1MU6B 2PKAA 1LCYA 2PUXB 4WVPE 4NIVA 1OP2A 1ZJKA 2ZFRH 1LMWB 2V35A 3S7KB 8GCHF 3V7TA 4NGAH 4BXSA 3U8RH 1BTXA 1EP6A 1GHBF 3BG4C 3KIDU 2FYRA 3D65E 1JIRA 2XC4A
chains in the Genus database with same CATH superfamily
4CRDA 1GBFA 1TPPA 4B75A 3IG6B 1GMHF 1H8ED 4Y10E 5F03A 1MQ5A 4O3UA 2GTBA 4Z6AH 1ZSKA 3P95A 2F9NA 2Z3CA 1ETSH 1XUIA 5H4IB 1VCPA 1W0YH 1KXEA 1SMFE 4MPXA 2GGVB 2KCAA 1WTHD 1K0HA 3KHVA 2SGFE 3SGBE 1SQRA 3QDZB 4NIYA 1SR5C 1LVOA 4ZROA 3KL6A 3E90B 5AVDA 3WWBA 2H5DA 4WMEA 1AUJA 2CHAB 3KN2A 1O5FH 1H8HD 1UTPA 4O9VA 2A4GA 4QT8C 3L3TA 5CDFE 2NU3E 4ISHH 4TWYA 1OWHA 3FVFB 5EQQA 1IOEA 3RC6A 2DUCA 1UK2A 5AFZH 3GY7A 1ELBA 1NU9A 4YM9A 2BLOA 1IHSH 2ZA5A 5K0HA 3SV2H 1PPFE 3Q77A 1XVOA 1C1SA 2TBSA 1C2MA 1YM0A 2BX4A 1A0JA 1SGNE 3T62A 2QF5A 1YWUA 4FUFA 2PGBB 1YY3A 3I78A 3SHCH 1UJ1A 2PSYA 2A5IA 4MNXA 3P8GA 5FBIA 3S7HB 4ISNA 2A32A 2CK3D 1O5DH 4NIWA 1S82A 1V3XA 4I86A 4M7GA 3ESTA 4MTBA 4ACAA 4I7YH 3UR6A 3ZZ7A 2CV3A 2OK5A 2ZTZA 1O2IA 1IHTH 1HJAB 4FUIA 1GMHG 3BEUA 2ZPSA 3HPTB 3SNBA 1C5YB 1DITH 1HAHH 4GUXA 2AERH 1GBBA 4OGXA 5DP3A 5FBEA 3BIVH 2J98B 5FCRA 1O31A 1SBWA 4FVDA 4LOYH 1IQHA 3B23B 1DWBH 5K7RA 1CGHA 4ABEA 1L0ZA 1O2WA 2G4UA 4X2WA 4IW4E 2ZC9H 1DWDH 5GCHG 5EJZA 5JB8S 1MKWK 1IQNA 1TX7A 5B6LA 2ZDAH 1MTWA 4ZKOU 4BNRA 3M7UA 2QE7D 1DWEH 1F0UA 3KQDA 5DN6D 1A3EH 1GI2A 1ANDA 4XE4A 2PSXA 3RXHA 2Y5FA 1EB1H 1EOJA 1Q3XA 1MKWH 4UONA 1S85A 1EPTA 3OFND 3GCTG 4DW2U 1GMCF 1QGFA 1EZUC 1BRUP 1FDPA 3TVJB 1UHBA 1KTTB 2Q6GA 1TGCA 1MQ6A 2WPKS 5ETXA 4Z0KA 3MYWA 3OX7U 1ANEA 1CHGA 2JETB 2ZHWH 5BRRE 2CJIA 1C5RA 1O2TA 1B0EA 1Q31A 5F8TA 3PWBA 1FI8A 3HGPA 3TK6A 1SGEE 1SFQB 4B74A 2OC0A 5FPYA 5EPYA 2GDDA 4TPIZ 4OGYA 2GP9B 3RXOA 4AGKA 2ZQ1A 3H7OA 1OSSA 1ZRBA 2J34A 1NBME 1SFIA 2L74A 3NCLA 1ARBA 4UFEH 1WBGB 2JH5D 3T26A 1IAUA 2BY7X 5F53A 4JK6A 4WWYA 3SU0A 1K28D 1EATA 5E0HA 2A4OA 5GNDA 2BD9A 5JBBS 3ZZ5A 1L1JA 3ZYEA 1PQAA 3ODDA 3RXDA 1ZPZA 1OWIA 4P00A 1C5LH 3RU4T 2BDIA 2FLRH 3TGIE 1G37A 1NRSH 1G30B 4Y7BA 1GBJA 3S69A 3AASA 5T1VA 3OU0A 4SGBE 4DIHH 2A2XH 1TGTA 2P3FH 1GI5A 1GG6B 1ELAA 1TNJA 1YCPM 1RFNA 1SLXB 2QN5T 2XBWA 2GMTC 1T8OA 1GBHA 3A87A 1NU7B 2W7UA 3KYGA 2ZFSA 3U8OH 5CMXH 1OWKA 3NK8A 1H9IE 1HPGA 1YC0A 3NXPA 4X8VH 1QB6A 2P8OC 4YZUA 1MH0A 3RXPA 1V2QT 3EAJA 3F2HA 4DJZB 1NPMA 3RXJA 1C4V2 1EZQA 1EOLA 4X6OA 4K8YA 3T27A 5HYOA 1QRXA 1A4WH 1G36A 1QHRB 1BCUH 1GJ5H 1MBMA 3PROA 1KXFA 1C1PA 1XUGA 1ZGVA 4RT1A 5J4SA 2A31A 1XKBC 1ZTJA 4I8LA 1K21H 3FP8E 2UWLA 1EQ9A 6CHAC 1F92A 2ZFFH 3PMJA 1VZQH 2GCHF 1BMLA 3UIRA 1IQIA 3TU7H 3UR9A 3P92A 3PRDA 1A7SA 2BD4A 3U9AH 1GWAA 1Z8RA 3FANA 4HG6A 3R0FA 2SNVA 4XRNA 1EB2A 1ETTH 2W3IA 1BTHH 1KIGH 7GCHG 2Z94A 3RXAA 2H9EH 1QJ7B 3N7OA 3SNEA 5I46H 4IC6A 4JZIA 3A83A 2ODQA 3RXCA 1F7ZA 2FX6A 1AD8H 1UCYK 4INHA 1TPSA 2GZ9A 3UPEA 4RSPA 1T31A 1P05A 1EXFA 3HKIB 6GCHF 2RDEA 2CF8H 1NFXA 3OYPA 1AIXH 3EDXB 4JZ1A 3SYJA 1BTPA 1K1OA 2ZDVH 1Z8GA 1KLIH 1PQ8A 2XC0A 1BOQA 1GHZA 1Z1IA 5HM2A 5T6GA 1C5VA 3MNSA 5GDSH 2PLXA 4E7NA 1UCYH 5A2MH 2G00A 1MD8A 5EIYA 5HGGA 1FV9A 5DP9A 3BG8A 3IITA 2PUQH 1NFYA 3VB4A 1YCPH 2ZU5A 1FZZA 1GJ7B 1O3AA 2CF9H 3KQ5A 3MTYA 4J1YA 1O3JA 4B71A 1ZYOA 1NFWA 4YLQH 3AAVA 2FOAA 2VIWA 3QGNB 1UCYE 1S5SA 3P8OA 4A1XA 2EC9H 3N7EA 5E2OA 1CBWC 1K1PA 3W95A 3WWFA 3TLOA 3UQVA 4I8JA 4INKA 3TH3H 5GXPA 1O30A 1O2GH 2GMTB 1S84A 4HFPB 1SC8U 1C5WB 1VGCB 3LDXH 2ZHQH 1ETRH 2BD5A 2Y82A 4U2WA 1TNHA 1ELCA 5GIBA 1SSXA 1DY9A 1SG8B 3KNXA 1UW7A 3VB7A 5GWZA 1PPZA 2P8OB 3BTFE 4BAOB 1DX5M 1JWTA 2BXUH 2ZIQH 4F55A 2HGTH 2WV9A 2HALA 3MU8A 2Y7XA 1PQ7A 3A88A 4FUGA 2B7DH 2KAIB 1RD3B 3TGKE 1GPZA 3A7VA 5T6FA 3PLKA 4GPGA 1BUIA 2Y7ZA 2TGPZ 1F0SA 1SGYE 3DFLA 3S9BA 7KMEH 3CP7A 3S0NA 1GHYH 1DWCH 2G51A 1GHAG 6CHAB 4TSFD 4BTIB 1S81A 1M9UA 1O39A 1HAVA 1F5LA 2ZKSA 4RN6A 3MHWU 1UMAH 5F6MA 4K1TA 1D4PB 4IBLH 4CHAC 2PFEA 1HAXB 4UEHH 1H9HE 3GDUA 2FOMB 4X1SU 3Q3YA 4JYUH 5T6DA 4BTTB 2VGCB 3ZVAA 1V2JT 5I25A 1A3BH 4BAHB 3SUEA 3M7QA 1HCGA 2LELA 4MDSA 1P2NA 2FI4E 4TT3D 3MH6A 1ARCA 3T2NA 1SGCA 3E0PB 2NWNA 4Y71A 2G8TA 1O3FA 1UVUH 2CGAA 1QZ8A 2Y80A 4CRAA 2XOKD 1BMNH 4K60A 1LTOA 3LJOA 5AHGH 1VITG 4RI0A 5FX5A 2F91A 1KXAA 4P02A 1LPGB 1W8BH 2ZHFH 1FY5A 1ZRKA 4NWKA 1A2CH 5A8XA 1FONA 1P04A 2FS8A 1GBLA 1GBIA 4X6NA 1TAWA 3SQHE 1C2LA 3LGVA 2Q6DA 2M2AA 4WXIA 4OS2A 1H8DH 2AH4X 2BLVA 2ESTE 3RXQA 1C2GA 2ZTXA 3VB6A 2H2ZA 4Q7ZA 3F2FA 5LPRA 3VB3A 1WDIA 3B8JA 4X0WU 2G81E 4IGDA 4F48B 2JH0D 1Y3UA 3P70B 1HJ8A 2Z9IA 5C20A 4FVBA 1SB1H 1FY1A 1O3PB 1TALA 1P09A 2A5KA 1COWD 2BMGB 3C1KA 1C1UH 2A4QA 1HAIH 5ESTE 2P94A 3GY4A 5E2PA 2ZO3H 2G5VA 3VB5A 2PV9B 1N8OC 1UTKA 1ELEE 2UWOA 8ESTE 1KDQB 3QO6A 1SLWB 1UK3A 4AOQA 4KELA 9LPRA 1ZLRA 3OAAD 2BDBA 4NFEA 2IJD1 5FL7D 1D3PB 1BHXB 1KLTA 1TOCB 2RA0A 2WV4A 1GI4A 3U8TH 1LVYA 2BD7A 2VIDA 3U1JB 3SU6A 4JYVH 4UFFH 3KQBA 3RXIA 3SUGA 2FO9A 4UD9H 1AFEH 2DE8A 1C5OH 1EJMA 4JCNA 3M37A 3UFAA 1GI7B 1ELDE 1O3HA 1QL9A 1CA8B 2VIVA 3RXFA 4THNH 1BHXF 1P3CA 5DP8A 4X2YA 4K1SA 1DT2A 1RTFB 3KEEA 1LO6A 2WUBA 5KEDA 2PHBA 3WY8A 4WF8A 2LPRA 4CRGA 4B6EA 1O3MA 1V2MT 2BD2A 3LJJA 3F3BA 1NRNH 4FUEA 4WMDA 5LGOA 2WYGA 1RRKA 1W14U 3MH4A 2BDHA 1UTQA 3EQ0H 1E79D 2O9QA 4AYYB 3NWUA 2TGTA 2WZQA 1ZZZA 3FP7E 4K8BA 1GI6A 2QIQA 2H9HA 2GZ7A 1QL7A 4YLUA 3SO3A 4FU7A 3SJ9A 1A5GH 3MH5A 1GI3A 1LKBA 4E7RG 1HUTH 1TA2A 1XMNB 1YPEH 3DCLA 1GBDA 4KTUA 3SJIA 3TITA 1SQAA 1DSTA 1C1VH 2GCTC 3PO1B 1D6RA 3MQKC 1D9IA 1GI8B 1C5TA 1O3GA 3MI4A 2VIOA 2Q6FA 5EU8A 1C2IA 2AFQB 1HYLA 4I8KA 5AFYH 3SOSA 1IQEA 1LPKB 1F2SE 1BJUA 1P01A 1V2KT 3SU5A 4MPVA 4AFUA 1QB9A 2QXGA 1YP9A 1UTLM 2WUCA 1LVBA 1Z1JA 2ZGJA 2NU1E 4WMFA 5IDKA 3UNQA 1T4VH 2OC7A 5ESBA 1C1QA 4BAMB 1GHWH 4PROA 3UTUH 1O2JA 1TMTH 1C1TA 1FQ3A 5A0AE 3SW2B 2VWLA 4XBBA 3RXVA 1FY3A 2V6NA 1PFXC 1AKSB 3OE7D 3LPRA 1FLEE 3ZZ9A 4Y8ZA 3SU3A 2I6QA 1BZXE 1C1NA 3M5OA 3RLWH 1SLVB 2TGDA 1O2RA 1H8IH 2H1UA 4TY7A 1PYTC 1ACBE 1TNKA 3BEIB 3SUDA 1G2MA 2HNTE 1LHGH 4D76A 1P0SH 5DP6A 1AB9C 5JBAS 1O33A 3KF2A 2BY6X 3HGNA 2BXTH 1SGFG 2GV7A 2V7QD 4LZ1H 4ASHA 3ZVFA 2XXLA 2GDEH 3OY6U 4MNVA 1LHFH 3U69H 2PTCE 1P10A 4XD7D 2F9VA 5HM9A 3Q3KA 2ILNA 3I29A 3ENSB 4K3JA 3WW7A 1WQVH 4A1TA 1BDAA 1LHCH 1GMDG 1NRRH 1SHHB 2VVVA 4XBDA 4CBNA 4X2XA 2QV1A 3ZVBA 2AS9A 3QGJA 4WJG2 3GY6A 2D8WA 5C5NA 4CREA 2BVRH 5KGOA 2FOCA 5C0TA 4CR9A 2ZHEH 1QIXB 8GCHG 1MAXA 1CA0B 1C2FA 2ZECA 2K8IA 4XFQA 3SU4A 2BM2A 5LPFA 2EEKA 1F5RA 2J2UA 2FMJA 2XC5A 4D7FA 2VH0A 1GHBG 4SGAE 1KXDA 4Y7AA 1TPOA 3SNDA 2FOGA 3U28C 1QQUA 3O8DA 2ZEBA 4FETA 2BVSH 1GL0E 1OYTH 1SI5H 2VIPA 3Q76A 2EI6A 1SGTA 1WSSH 3SJKA 2XNDD 3M5NA 2QXJA 2LNCA 4AB8A 5FHTA 1B5GH 3URDA 1DE7H 3GICB 4XDEA 2BOHB 1HAZB 2WHXA 1OWJA 2YMSC 4U01A 1HIAB 2VNTA 1GBAA 3MFJA 2ANMH 1QJ6B 1RS0A 2Z9KA 4BANB 1AWHB 2B8OH 2GD4B 2XCFA 5FXLA 3RUOA 2BX3A 2FTMA 5TCCA 4X2VA 1ESBA 3SGQE 3GY5A 5A8ZA 1O5EH 3BG4B 1O3DA 2FWWA 3SI3H 3ZV9A 6ESTA 1P9SA 3MNCA 5LH8A 4FUJA 5EOKA 3ZZ6A 2OP9A 2PKSC 2C93B 4O3TA 3NUMA 4OS5A 2FOEA 2EI7A 1DXWA 1Z6EA 1SGQE 1GDQA 1P12E 1A0HB 3EA7A 1J16A 1W13U 1QBNA 4XOJA 4RKOB 1EZSC 1GGDC 5IK2D 1V2TT 4JK5A 4U32A 2F9OA 2V3HH 5EJLA 1YPHC 2ZHDA 1OPHB 3TJNA 1C1WH 4X1NU 1Z7KA 4FUBA 1C1RA 1P2MA 3ZV8A 1O2OA 1SGRE 1W11U 2QF4A 2EI8A 1LQEA 1MMJN 3SORA 3BF6H 2P93A 4X6MA 1E37B 2PP6A 3GYMA 5EW2H 3N7DA 1MCTA 1ESTA 3RU4D 3EE0B 1MTSA 4FXGH 2OUAA 2JIZD 1FNIA 2WPJS 3T5FH 1NFUA 1TA6A 2P95A 3H09A 1AVGH 2J95A 2SFAA 1ESAA 1SLUB 2Y81A 3ZVGA 3UB0A 3A84A 2ZP0H 3LU9B 3TIUA 2BOKA 4JYTA 3FAOA 2R3UA 1TGSZ 2C90B 1ZOMA 2O8LA 3K2UA 2VBCA 3R3GB 2ANWA 1JXPA 1LPZB 1O38A 1UVSH 1S6LA 1DSUA 5DKMA 4D7GA 1F0RA 2ZZUH 3VEQB 2XYAA 5L30H 3PB1E 4NFFA 3KYFA 4ABAA 3TH4H 1GMCG 1VCQA 2YMSB 3U1IB 2OTVA 4Q80A 1SQOA 1O2YA 2W3KA 1EZXC 3HK6B 3F1SB 2K1QA 4B2BA 4AC9A 3RXUA 4Q63A 4Q7XA 3S9AA 2XW9A 1H9LB 5HIZA 2WV5A 1WCZA 3E0NB 5F8XA 2OQUA 2GX4A 1HJ9A 1XUJA 1C5QA 1FXYA 4IN2A 3K6YA 3ZZ8A 1LDTT 2PKSB 2EY4C 3A81A 1SPJA 2BLWA 5DP5A 1V2ST 3RMLH 4UFDH 5A0CA 2ZDMA 2BD8A 2STBE 3BIUH 4LXBH 1THRH 1JMOH 1FPHH 1T32A 3CNRA 4CRCA 5HXFA 1NRQH 1HGTH 1P06A 3LH3A 1P03A 4ZHMU 4CBOA 1J8AA 1O2NA 2QC2A 3GCNA 5CHAC 1L4ZA 5GPIB 1O35A 2Q1JA 3BTHE 4Q2KA 1A46H 1SGFA 2QF3A 4X8SH 4AFZA 1TRNA 1K1IA 1A5IA 1C5NH 1WAYB 3PLPA 2FPZA 1Y5AT 3P6ZB 4NG9H 3VPKA 5DP7A 1DVAH 3DUXH 2JJ2D 3P8FA 1FN6A 1QNJA 4OS4A 2PGQB 4B1TA 4JZDH 1F0TA 1XVMA 2ZGXH 2BYAX 1O3KA 2OBOA 2PKAB 2BDCA 1SOZA 4NA9H 3BTQE 1C2DA 1YCPK 1W7XH 1DS2E 2KFWA 2STAE 2A7CA 5FAHA 4VGCC 4MVNA 1KXBA 2A4RA 1L4DA 1J9CH 2J38A 2BY9X 3PMAB 4RKJB 4ZCNA 1V2PT 2BD3A 4A5TS 2RA3A 1GBTA 2V3OH 1K22H 3F68H 2ZDLA 3UWIA 1ZGIA 1ELGA 3DA9B 1CU1A 5HMAA 4H6SB 2AYWA 2HPQH 2D1JA 3LH1A 2AGEX 2ZI2H 4AN7A 4MQAA 4XSKU 4FU8A 3T28A 7ESTE 1QB1A 1OXGA 1EPTC 3GY3A 3UOUA 1EASA 2WYJA 1W0ZU 3V13A 2GCHG 2HVYB 2RCEA 2JDID 2P3UB 1A5HA 4FUHA 1ZR0A 1QBOA 2BQ7B 1AY6H 4YOGA 3NZIA 1CSOE 3V12A 3F9FA 2WPHS 5CE1A 2TPIZ 4UE7H 2CXVA 3PV2A 4B2CA 1THSH 5GJ4B 1KY9A 1MKXK 2BHGA 1GI1A 1HAGE 1O2VA 1TNLA 1HNEE 2NU2E 4KP0A 4I8HA 3UQOA 4JMYA 3O8CA 3A7XA 3RXGA 4LK4A 1BQYA 2QXHA 1GJCB 3FZDA 6GCHG 1EJAA 1KSNA 1GBEA 1MKXH 3D62A 1NBMD 4AG1A 1MTVA 2Z7FE 1G32B 1TABE 3ATMA 3TGJE 1O5CB 3SZEA 1PPHE 1O37A 1WOFA 5DJ7A 4CH8B 2BY5X 4NIXA 1CHOF 2C8XB 4X8UH 5JYIA 3GDSA 4WY3A 2HWLB 1ZTLA 4GLYA 4B6FA 4BAQB 1A1RA 1XUHA 1C2KA 3D23A 2AIPA 1O2QA 1AZZA 2YNAA 5FPTA 1TQ0B 2HLDD 4GCHF 4LZ4B 5F8ZA 3VGCC 4X1QU 3A82A 4ABDA 4J2YB 1A61H 3PRBA 1S0RA 1UVOA 1YBWA 2VIQA 3F9EA 3SGAE 4GHTA 4AZ2B 2ZNKH 1CT4E 3SNAA 1VJ9U 3D49H 1D3QB 4VGCB 2O8UA 1D3TB 1AN1E 2H5CA 2J9NA 4AG2A 1YLNA 1YYY1 3GCOA 4K2YA 4O97A 1QQ4A 3RMNH 1GHXH 2J98A 3ATWA 1ZPBA 1TPAE 1OP0A 4MNWA 4D9QA 4ABFA 1UVTH 4YOJA 2P59A 4ZKNU 2FOBA 2ZU4A 3RXBA 4M9FA 5C0UA 5EODA 1MTNC 1SVPA 2ALPA 2IPQX 1GJ4H 1C5MD 3ZZBA 1EPTB 2F9BH 3SV7A 1CBWB 4WXVA 1FIWA 1OP8A 4Q7YA 2AGGX 3UNRA 1UHBB 5DGJA 2UWPA 1QBVH 3CS7A 4YT6H 3LGWA 2GVFA 2R9PA 3EGKH 5E8EH 5EXLA 1NC6A 4GVUA 4BAKB 1P2QA 2ZQ2A 1QRZA 1HAPH 2FS9A 3UREA 2ZGCA 4B76A 3A80A 4ABHA 3ELAH 3RLYH 3RC5A 3LGYA 3S9CA 3AAUA 4GCHG 3FP6E 2SNWA 3H5CB 4AGJA 1IQJA 1C9TA 1MZDA 2FX4A 3TK5A 1TRMA 4CRBA 1LKAA 1Y3YA 3LC3A 1C5UA 1PYTD 3PMHB 3QZRA 3A7WA 1OWDA 2OD3B 1TQ7B 3M36A 3V3MA 3SNCA 2QA9E 2ZDKA 2VWOA 4ESTE 4ZKSU 4X1RU 1GBKA 2K0QA 4CHAB 3SV9A 4AX9H 3OTPA 1MD7A 1RIWC 1V2UT 2AEIH 1DPOA 1DDJA 3SI4H 3JZ1B 1HAOH 3P17H 3LIWA 1YPMH 2HOBA 1THPB 2LP6A 3OEED 1T4UH 2JKHA 2FZZA 1TOMH 4AYVB 4WH6A 1NN6A 4DVAU 3A8CA 1K9OE 3HKJB 2SGEE 3F6UH 1Q2WA 3VGCB 2F9PA 4AFQA 1S6HA 5DO4H 3SN8A 2F3CE 3E8LA 2HVXA 2BZAA 1G3EA 2WPMS 3TJOA 2QYIA 1O2ZA 1RJXB 2ZG0H 1K2I1 3A7TA 3DFJA 8KME2 5JDUB 1EJNA 1PPBH 3H7TA 1V2WT 4YXWD 2WINI 3MO9A 5JBTA 1BITA 3PTBA 1YLCA 4ZHLU 3MO6A 1W0JD 3DSGA 1JRTA 2OC8A 3CENA 2BDAA 4OS6A 4DY7B 2KM0A 1O2HA 4F49A 1G3CA 3M3SA 4OS7A 3SUFA 3RMMH 1C2HA 3EYDA 2YMSD 4K1EA 3ZZ4A 1SL3A 1TGNA 1ABJH 2ANYA 1FUJA 3ZZ3A 1BRCE 4DOQA 5ABWA 3BSQA 1WYKA 3MU0A 4KTSA 1N8OB 5C1XA 3SZNA 3IWMA 2PW8H 1MU8B 1SKYE 3VXFH 1AUTC 3PV5A 1BTYA 5B6OA 5FPSA 4Y8XA 3GOVB 3KQCA 5DSFA 3PWCA 4WH8A 1BBRK 4B73A 2FXRA 1TLDA 2XNIA 1EAXA 2FP7B 4B2AA 2G4TA 3MU5A 2F43B 3KQEA 1GVZA 1XX9A 3ZVCA 1CE5A 1TWXB 3RDZA 1DICA 3DSPA 4TY6A 2ODPA 3O8BA 3T25A 1Y59T 5FCKA 1O3EA 1HJAC 4INLA 1BBRH 4YO9A 1B0FA 2O8TA 3M3TA 4Q4LA 3GY8A 2FEQH 2C3SA 2SGDE 2ZCKP 1CT0E 2ALVA 3JZ2B 3RXKA 1C2EA 1O3NA 5DP4A 4DT7B 1V6DA 1BBRE 4FUCA 4ZHAA 4FU9A 2M5TA 4IMQA 3SU1A 2R2MB 1S6FA 5C67A 3TJUA 1C9PA 1EUFA 1QTFA 1GI0A 3FZZA 2UUYA 3BTTE 3F9HA 1NROH 5EGMA 5AF9H 3QTOH 3ZIAD 3O8RA 2QF0A 1K1LA 1KMHB 1UVPA 4Y8YA 3OY5U 1BMMH 1DANH 1GBMA 1WUNH 3T29A 1EAWA 1EKBB 3E6PH 4ABIA 1CT2E 3TH2H 1ZMNA 1O36A 1AO5A 1Y3VA 2FLBH 2Y5GA 2UUKB 2XBYA 1N6YA 3M5LA 1D3DB 1UTOA 1O3LA 1KYNA 1L1GA 4D8NA 1JOUB 2JETC 1Z71A 1DLEA 1HAVB 1P2JA 5GCHF 1J14A 4XBCA 1H1BA 1GVKB 2GCTB 1IQMA 2V0BA 4IC5A 4I32A 5IYTA 1W10U 4IMZA 2BDGA 3K6ZA 4Y11E 3TNTA 1GBCA 2A7JA 1NTPA 1NY22 3ITIA 2KAIA 2XRCA 1VJAU 1XXDA 4ABGA 1PJPA 3V0XA 3QUMP 4I8GA 4ISLA 2QAAA 3W1EA 3I77A 2VU8E 1NO9H 2GT7A 4CR5A 1E38B 1EAIA 1O5AB 5L2ZH 1EX3A 2CMYA 3GCTF 1O3OA 4DCDA 4BXWA 3NRLA 1QCPA 2G5NA 4Y79A 2ZPQA 2Z3EA 1S0QA 2C8YB 2ZGHA 2RDLA 2W6ID 2Z9LA 5EW1H 5C17A 2PTNA 3GY2A 1FPCH 2OCVB 1CGJE 1MZAA 1HAYB 1BT7A 1QFKH 1E35B 4E05H 3C27B 1ZJDA 2ZCHP 1V2NT 2CN0H 2ZFPH 1FN8A 3RP2A 1EP5A 1TB6H 1BMFD 3N99A 3NPSA 3MNBA 3M5MA 4R8TB 1LVMA 1DUEA 1GG6C 2OBQA 4OM9A 1F5KU 1RTKA 1C5PA 1P9UA 4UDWH 3MU1A 1W12U 2I6SA 2OLGA 2P3TB 2KR7A 2XWAA 2HLCA 1G3DA 1MBQA 1ELVA 1QA7A 1DFPA 1ZTKA 1IQLA 1HXFH 4GAWA 3E3TA 5EQSA 2EQNA 1QA0A 2UUFB 1O3CA 2TRMA 1QL8A 3RXRA 1GJ9B 1AB9B 3ATLA 4F4OC 1IQKA 2FI3E 1AVXA 1VCWA 2O8WA 5DK1A 1XUKA 1TX8A 2OINA 3LGUA 1VKYA 1V2OT 4YTAA 1AI8H 2XCNA 2FOFA 1E34B 2ZPRA 3TK9A 4ZKRU 5EPNA 3MH7A 1LHEH 1GDNA 1OYQA 1PPCE 3F2GA 1P2IA 2VJ1A 3OTJE 1S83A 2GZ8A 3AW0A 2NU4E 4MPWA 2D2DA 1PQ5A 1X7AC 5JB9S 3AK5A 1O2XA 3ZVDA 2FOHA 3QX5H 1DY8A 2EA3A 5EXNA 5PTPA 4ISOA 1NZQH 2FM2A 3URCA 2BQWB 3LOXA 4NCYA 4NZLA 3RM0H 3MWIU 2H6MA 3SV8A 1W3CA 3OEHD 3LGIA 1KDQA 1U6QA 3OSYA 1EFRD 1ORFA 4JZFH 4D9RA 1OHHD 3ZZCA 2B0FA 1FAXA 4MPUA 3W94A 1GJ8B 3STIA 1GJ6A 4ZXYH 1ZPCA 2A45B 1N1LA 1KTSB 1Z6JH 3SQEE 1TIOA 1UTMA 3GDVA 3K9XB 4ABBA 4ACBA 1BMAA 1GL1A 2ZU2A 1Y3WA 1MABB 2FI5E 3LGTA 1AFQC 1W0KD 5BPEA 1C5SA 4FUDA 1FAKH 3RM2H 3A8DA 5HKKD 1INCA 1AMHA 2KCYA 6LPRA 2G52A 3SHAH 3LKWA 5EQRA 1GCTC 1YPLH 1TYNA 2C4FH 7GCHF 1BIOA 2KCOA 2BLQA 1BRAA 1SGDE 1YKTA 3RXEA 1K1MA 2RFKC 4CH2B 2J4IA 3A7YA 3ATIA 2RG3A 1OKXA 1WV7H 1Y5BT 3RC4A 3L33A 3BTME 1AQ7A 1C2JA 2A0QB 3DT0H 1CQQA 1VGCC 5EXMA 1GGDB 3E16B 2BVXH 2KCPA 1NM6A 3A8AA 4O03A 5FX6A 3RXLA 3SJ8A 2FYQA 4Y0ZE 5DPAA 2IPHA 3NKKA 2ODYB 1YF4A 1PPEE 1BTZA 1RTLA 5C3NA 1QR3E 3BTKE 3MMGA 1O2UA 2VB0A 4Z1MD 4GHQA 1JRSA 3FO8D 3PM3A 3STJA 1AHTH 1DLKB 4HI3A 4MLFB 1RGQA 3Q00A 3FOAA 1UK4A 1V2RT 2B9LA 1XKAC 1AGJA 2ZDNA 3RXMA 2XTTB 1P57B 1HV7A 1OX1A 5C2ZA 4NA8A 3ZZDA 1OOKB 2J94A 4NSVA 1UTJA 5E0GA 2WSSD 1SOTA 3FKSD 3MOCA 2VGCC 3AVZA 1L2EA 3BTWE 3ZVEA 4Y6DA 4ZXXH 3FN8A 3A85A 2J97A 2FESH 5T3HA 3RXTA 1W2KH 1HBTH 2W26A 1O3IA 3EA8A 3GCHC 4DIIH 2VINA 3TJVA 1TFXA 3QLPH 1YPGH 1FIZA 1P2KA 1SHYA 4BOHA 3A89A 3SJOA 1GHAF 1WXRA 1HFDA 1AFQB 2Y6TA 1ELTA 1HDTH 3F0PA 1K1NA 2P16A 3ZZAA 2VVCA 4ISIH 3UUZA 1T8MA 1AU8A 3PV4A 3SV6A 4KGAA 1YPJH 4JZEH 5J4QA 1GCTB 1YGCH 1C1OA 2AIQA 1DUAA 3DHKH 4UFGH 3EA9A 1AKSA 3BN9A 3L6PA 1MUEB 2ZCLP 3AW1A 1AZ8A 1ANCA 3SU2A 4DGJA 2GKVE 3HATH 2W7SA 3F9GA 2W5EA 1MAYA 2ZFTA 1YLDA 2R0KA 3E91A 1Y8TA 3ZYDA 1QRWA 2OXSA 1TRYA 2BB4A 1C4U2 1NT1A 4TPYA 1VITF 1GI9B 4DG4A 5G4BA 1LQDB 1ZMJA 3DSOA 1GCDA 2J92A 4ASUD 2VWNA 1TBRH 1VR1H 5CHAB 2BTCE 2HNTC 1UTNA 9ESTA 4CRFA 2IOTA 2ULLA 1E1QD 4ZUHA 1DOJA 4KTCA 4X6PA 4ZAEA 2GT8A 1WU1A 2Z3DA 1K1JA 1N6XA 4R0IA 1CO7E 4DURA 1MCVA 5C1UA 5L2YH 4IN1A 5CHBA 5JPMH 1IQGA 1TNGA 2VWMA 5E0JA 5C5OA 2WPIS 3QTVH 2IN2A 1ZSJA 3GISB 2YNBA 3M35A 3ODFA 2OQ5A 2OC1A 1O2MA 1C4Y2 2THFB 1TE0A 3ATKA 3VG8A 1O3BA 4AORA 1SGIB 2UUJB 3MNXA 2DE9A 1W7GH 4K5ZA 3EE7A 5SGAE 3FFGA 1T7CA 2QCYA 4FOUC 3VXEH 2FDAA 5A8YA 1AE8H 3GCHB 1DM4B 1BTUA 3PLBA 2HRVA 2WPLS 1O2KA 3A7ZA 2F9UA 1GHVH 1HIAA 2JH6D 2F4LA 2R3YA 1C5XB 1BB0B 3B9FH 3U98H 5KECA 1D6WA 1E36B 4H4FA 5EG4A 1YPHE 2ZU1A 2AGIX 1C1MA 2ZGBH 2BDYA 2HPPH 2B5TB 5A09A 5C94A 1J17T 1TX6A 7LPRA 1UO6A 2BQ6B 3BTEE 1ANBA 1P3EA 1HRTH 2FIRH 4DT4A 3MO3A 1CHOG 4I31A 5DG6A 1ZHPA 3BV9B 4YESB 3UOPA 1AWFH 2QGRA 1T8LA 4TWWA 1NRPH 1BRBE 2YOLA 3PYHA 2GV6A 3BTDE 2AMDA 3QZQA 1TBZH 1FMGA 1DXPA 2J5UA 3E1XB 1GJDB 1ZHRA 4I33A 2AHME 1KXCA 1GJAB 4HGCA 1QURH 1P8VC 2ZWLH 1JBUH 1RXPA 2SGPE 1G2LA 1A0LA 1O34A 1CGIE 1Z8JB 2XBXA 1J15A 5L6NH 1C5ZB 5HIYA 5A0BA 1BJVA 1NESE 1NS3A 4YOIA 3PO1C 4U30A 2A1DB 1XM1A 4HTCH 1ID5H 5JBCS 2VVUA 2L6OA 3QN7A 1G3BA 1E1RD 3P8NA 1H4WA 2XBVA 1VITH 4TYDA 3CS0A 3PTNA 1ZHMA 1IQFA 1V2VT 2GJGA 3RMOH 4ZMAH 1L1NA 2TIOA 1KLJH 3RXSA 4A6LA 5EJ1A 1HLTH 2PR3A 4ZH8A 2KX4A 4ABJA 3TPIZ 2ZF0H 3F0OA 1T8NA 3KCGH 2QXIA 4GSOA 1PPGE 2AMPA 3MU4A 1P2OA 4A1VA 2HNTF 1HXEH 3LT3A 2JJ1D 4X1PU 3TNSA 1TNIA 1ZSLA 1AE5A 1B7XB 4H6TA 1SQTA 4RT0A 1O2PA 3GYLB 1OS8A 1WQSA 2A2QH 4KKDA 1CVWH 1GDUA 2Y5HA 1Y3XA 2A7HA 4H42U 2Z9GA 4NWLA 4BTUB 2ANKH 3PMBB 1HB0B 1WTGH 2SGQE 3DD2H 1P02A 4Y0YE 3LONA 4NSYA 4AB9A 1LHDH 1G9IE 2SGAA 1O32A 2NU0E 1MTUA 3SBKA 3UWJH 2FODA 3HK3B 1TMUH 1TGBA 1XXFA 2R2WU 4OS1A 1MTNB 2C8WB 3KGPA 1O5GH 4E06H 1QJ1B 4A7IB 3QWCH 2AMQA 2ASUB 2A5AA 5TJXA 3UY9A 2C8ZB 3M7TA 2R0LA 5LPEA 1ABIH 1ZMLA 1YPKH 2BY8X 2CHAC 2ZTYA 3G01A 2ZU3A 1BTWA 4HZHA 4NA7A 2W6JD 4AFSA 2H9TH 4IS5A 4X8TH 3A86A 3QK1A 4YT7H 1FY4A 1AVWA 3BTGE 2FTLE 4K69A 1O2LA 1SGPE 3BEFB 2VH6A 1GJBB 1XUFA 2Z9JA 2ZFQH 1O2SA 4MG3A 3A8BA 5C1YA 1TONA 3UNSA 3LC5A 4Y76A 2F83A 3UAIC 1JIMA 1TBQH 3K65B 1Z8IB 3M3VA 1QY6A 4NZQA 2PWXA 1CA0C 1FJSA 5TCAA 2O8MA 2TGAA 2IJOB 1FY8E 1FX0B 1TMBH 2XWBI 2Z6BD 8LPRA 1Y5UT 2BZ6H 1ELFA 1O0DH 4A92A 1RIWB 2KZ4A 1BA8B 1E0FD 1GMDF 1V2LT 3M61U 4MNYA 2QY0B 3VFEA 1O5BB 1P11E 1OWEA 1GVLA 3Q3XA 1EAUA 2V3MA 2G55A 3RU4E 2D26C 1MU6B 1LCYA 2PKAA 2PUXB 4WVPE 2WPDD 4NIVA 1OP2A 1ZJKA 2ZFRH 1LMWB 3GS9A 2V35A 3S7KB 8GCHF 3V7TA 4NGAH 4BXSA 3U8RH 1BTXA 1EP6A 1GHBF 3BG4C 3KIDU 2FYRA 3D65E 1JIRA 2XC4A
chains in the Genus database with same CATH topology
4CRDA 1GBFA 1TPPA 4B75A 3IG6B 1GMHF 4Y10E 5F03A 1MQ5A 4O3UA 2GTBA 4Z6AH 1ZSKA 3P95A 2F9NA 2Z3CA 1ETSH 1XUIA 5H4IB 1VCPA 1W0YH 1KXEA 1SMFE 4MPXA 2GGVB 1WTHD 3KHVA 2SGFE 3SGBE 3QDZB 4NIYA 1SR5C 1LVOA 4ZROA 3KL6A 3E90B 5AVDA 2H5DA 4WMEA 1AUJA 2CHAB 3KN2A 1O5FH 1UTPA 4O9VA 2A4GA 4QT8C 3L3TA 2NU3E 4ISHH 4TWYA 1OWHA 3FVFB 5EQQA 1IOEA 3RC6A 2DUCA 1UK2A 5AFZH 3GY7A 1ELBA 1NU9A 4YM9A 2BLOA 1IHSH 2ZA5A 5K0HA 3SV2H 1PPFE 3Q77A 1XVOA 1C1SA 2TBSA 1C2MA 1YM0A 2BX4A 1A0JA 1SGNE 3T62A 4FUFA 2PGBB 3I78A 3SHCH 1UJ1A 2PSYA 2A5IA 4MNXA 3P8GA 5FBIA 3S7HB 4ISNA 2A32A 1O5DH 4NIWA 1S82A 1V3XA 4M7GA 4I7YH 3ESTA 4MTBA 3UR6A 3ZZ7A 2CV3A 2ZTZA 1O2IA 1IHTH 1HJAB 4FUIA 1GMHG 3BEUA 2ZPSA 3HPTB 3SNBA 1C5YB 1DITH 1HAHH 4GUXA 2AERH 1GBBA 4OGXA 5DP3A 5FBEA 3BIVH 5FCRA 1O31A 1SBWA 4FVDA 4LOYH 1IQHA 3B23B 1DWBH 5K7RA 1CGHA 4ABEA 1L0ZA 1O2WA 2G4UA 4X2WA 4IW4E 2ZC9H 1DWDH 5GCHG 5JB8S 1MKWK 1IQNA 1TX7A 2ZDAH 1MTWA 4ZKOU 4BNRA 3M7UA 1DWEH 1F0UA 3KQDA 1A3EH 1GI2A 1ANDA 4XE4A 2PSXA 3RXHA 2Y5FA 1EB1H 1EOJA 1Q3XA 1MKWH 4UONA 1S85A 1EPTA 3GCTG 4DW2U 1GMCF 1QGFA 1EZUC 1BRUP 1FDPA 3TVJB 1UHBA 1KTTB 2Q6GA 1TGCA 1MQ6A 2WPKS 5ETXA 4Z0KA 3MYWA 3OX7U 1ANEA 1CHGA 2JETB 2ZHWH 5BRRE 2CJIA 1C5RA 1O2TA 1B0EA 1Q31A 5F8TA 3PWBA 1FI8A 3HGPA 3TK6A 1SGEE 1SFQB 4B74A 2OC0A 5FPYA 5EPYA 2GDDA 4TPIZ 4OGYA 2GP9B 3RXOA 4AGKA 2ZQ1A 3H7OA 1OSSA 1ZRBA 2J34A 1SFIA 3NCLA 1ARBA 4UFEH 1WBGB 2JH5D 3T26A 1IAUA 2BY7X 4JK6A 4WWYA 3SU0A 1K28D 1EATA 5E0HA 2A4OA 5JBBS 2BD9A 3ZZ5A 1L1JA 3ZYEA 1PQAA 3ODDA 3RXDA 1ZPZA 1OWIA 1C5LH 3RU4T 2BDIA 2FLRH 3TGIE 1G37A 1NRSH 1G30B 4Y7BA 1GBJA 3S69A 3AASA 3OU0A 4SGBE 4DIHH 2A2XH 1TGTA 2P3FH 1GI5A 1GG6B 1ELAA 1TNJA 1YCPM 1RFNA 1SLXB 2QN5T 2XBWA 2GMTC 1T8OA 1GBHA 3A87A 1NU7B 2W7UA 2ZFSA 3U8OH 5CMXH 1OWKA 3NK8A 1H9IE 1HPGA 1YC0A 3NXPA 4X8VH 1QB6A 2P8OC 4YZUA 1MH0A 3RXPA 1V2QT 3EAJA 4DJZB 1NPMA 3RXJA 1C4V2 1EZQA 1EOLA 4X6OA 4K8YA 3T27A 5HYOA 1QRXA 1A4WH 1G36A 1QHRB 1BCUH 1GJ5H 1MBMA 3PROA 1KXFA 1C1PA 1XUGA 1ZGVA 5J4SA 2A31A 1XKBC 1ZTJA 4I8LA 1K21H 3FP8E 2UWLA 1EQ9A 6CHAC 1F92A 2ZFFH 3PMJA 1VZQH 2GCHF 1BMLA 3UIRA 1IQIA 3TU7H 3UR9A 3P92A 1A7SA 2BD4A 3U9AH 1GWAA 1Z8RA 3FANA 3R0FA 2SNVA 1EB2A 1ETTH 2W3IA 1BTHH 1KIGH 7GCHG 2Z94A 3RXAA 2H9EH 1QJ7B 3N7OA 3SNEA 5I46H 4IC6A 4JZIA 3A83A 2ODQA 3RXCA 1F7ZA 2FX6A 1AD8H 1UCYK 4INHA 1TPSA 2GZ9A 3UPEA 4RSPA 1T31A 1P05A 1EXFA 3HKIB 6GCHF 2CF8H 1NFXA 3OYPA 1AIXH 3EDXB 4JZ1A 1BTPA 1K1OA 2ZDVH 1Z8GA 1KLIH 1PQ8A 2XC0A 1BOQA 1GHZA 1Z1IA 5HM2A 5T6GA 1C5VA 3MNSA 5GDSH 2PLXA 4E7NA 1UCYH 5A2MH 2G00A 1MD8A 5HGGA 1FV9A 5DP9A 3BG8A 3IITA 2PUQH 1NFYA 3VB4A 1YCPH 2ZU5A 1FZZA 1GJ7B 1O3AA 2CF9H 3MTYA 4J1YA 1O3JA 4B71A 1ZYOA 1NFWA 4YLQH 3AAVA 2FOAA 2VIWA 3QGNB 1UCYE 1S5SA 3P8OA 4A1XA 2EC9H 5E2OA 1CBWC 1K1PA 3W95A 3UQVA 3TLOA 4I8JA 4INKA 3TH3H 5GXPA 1O30A 1O2GH 2GMTB 1S84A 4HFPB 1SC8U 1C5WB 1VGCB 3LDXH 2ZHQH 1ETRH 2BD5A 2Y82A 4U2WA 1TNHA 1ELCA 5GIBA 1SSXA 1DY9A 1SG8B 3KNXA 3VB7A 5GWZA 1PPZA 2P8OB 3BTFE 4BAOB 1DX5M 1JWTA 2BXUH 2ZIQH 2HGTH 2HALA 3MU8A 2Y7XA 1PQ7A 3A88A 4FUGA 2B7DH 2KAIB 1RD3B 3TGKE 1GPZA 3A7VA 5T6FA 3PLKA 4GPGA 1BUIA 2Y7ZA 2TGPZ 1F0SA 1SGYE 3DFLA 3S9BA 7KMEH 3CP7A 3S0NA 1GHYH 1DWCH 2G51A 1GHAG 6CHAB 4BTIB 1S81A 1M9UA 1O39A 1HAVA 1F5LA 2ZKSA 4RN6A 3MHWU 1UMAH 5F6MA 4K1TA 1D4PB 4IBLH 4CHAC 2PFEA 1HAXB 4UEHH 1H9HE 3GDUA 2FOMB 4X1SU 3Q3YA 4JYUH 5T6DA 4BTTB 2VGCB 3ZVAA 1V2JT 5I25A 1A3BH 4BAHB 3SUEA 3M7QA 1HCGA 4MDSA 1P2NA 2FI4E 3MH6A 1ARCA 3T2NA 1SGCA 3E0PB 2NWNA 4Y71A 2G8TA 1O3FA 1UVUH 2CGAA 2Y80A 4CRAA 1BMNH 4K60A 1LTOA 3LJOA 5AHGH 1VITG 5FX5A 2F91A 1KXAA 1LPGB 1W8BH 2ZHFH 1FY5A 1ZRKA 4NWKA 1A2CH 5A8XA 1FONA 1P04A 2FS8A 1GBLA 1GBIA 4X6NA 1TAWA 3SQHE 1C2LA 3LGVA 2Q6DA 4WXIA 4OS2A 1H8DH 2AH4X 2BLVA 2ESTE 3RXQA 1C2GA 2ZTXA 3VB6A 2H2ZA 4Q7ZA 5LPRA 3VB3A 3B8JA 4X0WU 2G81E 4IGDA 2JH0D 1Y3UA 3P70B 1HJ8A 2Z9IA 5C20A 4FVBA 1SB1H 1FY1A 1O3PB 1TALA 1P09A 2A5KA 2BMGB 3C1KA 1C1UH 2A4QA 1HAIH 5ESTE 2P94A 3GY4A 5E2PA 2ZO3H 2G5VA 3VB5A 2PV9B 1N8OC 1UTKA 1ELEE 2UWOA 8ESTE 1KDQB 3QO6A 1SLWB 1UK3A 4AOQA 4KELA 9LPRA 1ZLRA 2BDBA 4NFEA 1D3PB 1BHXB 1KLTA 1TOCB 2RA0A 2WV4A 1GI4A 3U8TH 1LVYA 2BD7A 2VIDA 3U1JB 3SU6A 4JYVH 4UFFH 3KQBA 3RXIA 3SUGA 2FO9A 4UD9H 1AFEH 2DE8A 1C5OH 1EJMA 4JCNA 3M37A 3UFAA 1GI7B 1ELDE 1O3HA 1QL9A 1CA8B 2VIVA 3RXFA 4THNH 1BHXF 1P3CA 5DP8A 4X2YA 4K1SA 1DT2A 1RTFB 3KEEA 1LO6A 2WUBA 2PHBA 3WY8A 4WF8A 2LPRA 4CRGA 1O3MA 1V2MT 2BD2A 3LJJA 1NRNH 4FUEA 4WMDA 5LGOA 2WYGA 1RRKA 1W14U 3MH4A 2BDHA 1UTQA 3EQ0H 2O9QA 4AYYB 3NWUA 2TGTA 1ZZZA 3FP7E 4K8BA 1GI6A 2QIQA 2H9HA 2GZ7A 1QL7A 4YLUA 3SO3A 4FU7A 3SJ9A 1A5GH 3MH5A 1GI3A 1LKBA 4E7RG 1HUTH 1TA2A 1XMNB 1YPEH 1GBDA 4KTUA 3SJIA 3TITA 1SQAA 1DSTA 1C1VH 2GCTC 3PO1B 1D6RA 1D9IA 1GI8B 1C5TA 1O3GA 3MI4A 2VIOA 2Q6FA 5EU8A 1C2IA 2AFQB 1HYLA 4I8KA 5AFYH 3SOSA 1IQEA 1LPKB 1F2SE 1BJUA 1P01A 1V2KT 3SU5A 4MPVA 4AFUA 1QB9A 2QXGA 1YP9A 1UTLM 2WUCA 1LVBA 1Z1JA 2ZGJA 2NU1E 4WMFA 5IDKA 3UNQA 1T4VH 2OC7A 5ESBA 1C1QA 4BAMB 1GHWH 4PROA 3UTUH 1O2JA 1TMTH 1C1TA 1FQ3A 5A0AE 3SW2B 2VWLA 4XBBA 3RXVA 1FY3A 2V6NA 1PFXC 1AKSB 3LPRA 1FLEE 3ZZ9A 4Y8ZA 3SU3A 2I6QA 1BZXE 1C1NA 3M5OA 3RLWH 1SLVB 2TGDA 1O2RA 1H8IH 2H1UA 4TY7A 1PYTC 1ACBE 1TNKA 3BEIB 3SUDA 1G2MA 2HNTE 1LHGH 4D76A 1P0SH 5DP6A 1AB9C 5JBAS 1O33A 3KF2A 2BY6X 3HGNA 2BXTH 1SGFG 2GV7A 4LZ1H 4ASHA 3ZVFA 2XXLA 2GDEH 3OY6U 4MNVA 1LHFH 3U69H 2PTCE 1P10A 2F9VA 5HM9A 3Q3KA 2ILNA 3I29A 3ENSB 4K3JA 4A1TA 1WQVH 1BDAA 1LHCH 1GMDG 1NRRH 1SHHB 2VVVA 4XBDA 4CBNA 4X2XA 2QV1A 3ZVBA 2AS9A 3QGJA 4WJG2 3GY6A 2D8WA 5C5NA 4CREA 2BVRH 2FOCA 4CR9A 2ZHEH 1QIXB 8GCHG 1MAXA 1CA0B 1C2FA 2ZECA 4XFQA 3SU4A 2BM2A 5LPFA 2EEKA 1F5RA 2J2UA 2FMJA 2XC5A 4D7FA 2VH0A 1GHBG 4SGAE 1KXDA 4Y7AA 1TPOA 3SNDA 2FOGA 1QQUA 3O8DA 2ZEBA 2BVSH 1GL0E 1OYTH 1SI5H 2VIPA 3Q76A 2EI6A 1SGTA 1WSSH 3SJKA 3M5NA 2QXJA 2LNCA 4AB8A 5FHTA 1B5GH 3URDA 1DE7H 3GICB 4XDEA 2BOHB 1HAZB 1OWJA 4U01A 1HIAB 2VNTA 1GBAA 3MFJA 2ANMH 1QJ6B 1RS0A 2Z9KA 4BANB 1AWHB 2B8OH 2GD4B 2XCFA 5FXLA 3RUOA 2BX3A 2FTMA 5TCCA 4X2VA 1ESBA 3SGQE 3GY5A 5A8ZA 1O5EH 3BG4B 1O3DA 2FWWA 3SI3H 3ZV9A 6ESTA 1P9SA 3MNCA 5LH8A 4FUJA 5EOKA 3ZZ6A 2OP9A 2PKSC 2C93B 4O3TA 3NUMA 4OS5A 2FOEA 2EI7A 1DXWA 1Z6EA 1SGQE 1GDQA 1P12E 1A0HB 3EA7A 1J16A 1W13U 1QBNA 4XOJA 4RKOB 1EZSC 1GGDC 1V2TT 4JK5A 4U32A 2F9OA 2V3HH 1YPHC 2ZHDA 1OPHB 3TJNA 1C1WH 4X1NU 1Z7KA 4FUBA 1C1RA 1P2MA 3ZV8A 1O2OA 1SGRE 1W11U 2EI8A 1LQEA 1MMJN 3SORA 3BF6H 2P93A 4X6MA 1E37B 3GYMA 5EW2H 1MCTA 1ESTA 3RU4D 3EE0B 1MTSA 4FXGH 2OUAA 1FNIA 2WPJS 3T5FH 1NFUA 1TA6A 2P95A 1AVGH 2J95A 2SFAA 1ESAA 1SLUB 2Y81A 3ZVGA 3A84A 2ZP0H 3LU9B 3TIUA 2BOKA 4JYTA 3FAOA 2R3UA 1TGSZ 2C90B 1ZOMA 2O8LA 3K2UA 3R3GB 2ANWA 1JXPA 1LPZB 1O38A 1UVSH 1DSUA 5DKMA 4D7GA 1F0RA 2ZZUH 3VEQB 2XYAA 5L30H 3PB1E 4NFFA 4ABAA 3TH4H 1GMCG 1VCQA 3U1IB 2OTVA 4Q80A 1SQOA 1O2YA 2W3KA 1EZXC 3HK6B 3F1SB 2K1QA 4B2BA 3RXUA 4Q7XA 3S9AA 2XW9A 1H9LB 2WV5A 1WCZA 3E0NB 5F8XA 2OQUA 2GX4A 1HJ9A 1XUJA 1C5QA 1FXYA 4IN2A 3K6YA 3ZZ8A 1LDTT 2PKSB 3A81A 1SPJA 2BLWA 5DP5A 1V2ST 3RMLH 4UFDH 5A0CA 2ZDMA 2BD8A 2STBE 3BIUH 4LXBH 1THRH 1JMOH 1FPHH 1T32A 4CRCA 5HXFA 1NRQH 1HGTH 1P06A 3LH3A 1P03A 4ZHMU 4CBOA 1J8AA 1O2NA 2QC2A 3GCNA 5CHAC 1L4ZA 5GPIB 1O35A 2Q1JA 3BTHE 4Q2KA 1A46H 1SGFA 2QF3A 4X8SH 4AFZA 1TRNA 1K1IA 1A5IA 1C5NH 1WAYB 3PLPA 2FPZA 1Y5AT 3P6ZB 4NG9H 3VPKA 5DP7A 1DVAH 3DUXH 3P8FA 1FN6A 1QNJA 4OS4A 2PGQB 4B1TA 4JZDH 1F0TA 1XVMA 2ZGXH 2BYAX 1O3KA 2OBOA 2PKAB 2BDCA 1SOZA 4NA9H 3BTQE 1C2DA 1YCPK 1W7XH 1DS2E 2STAE 2A7CA 5FAHA 4VGCC 4MVNA 1KXBA 2A4RA 1L4DA 1J9CH 2J38A 2BY9X 3PMAB 4RKJB 1V2PT 2BD3A 4A5TS 2RA3A 1GBTA 2V3OH 1K22H 3F68H 2ZDLA 3UWIA 1ZGIA 1ELGA 3DA9B 1CU1A 5HMAA 4H6SB 2AYWA 2HPQH 2D1JA 3LH1A 2AGEX 2ZI2H 4AN7A 4MQAA 4XSKU 4FU8A 3T28A 7ESTE 1QB1A 1OXGA 1EPTC 3GY3A 3UOUA 1EASA 2WYJA 1W0ZU 3V13A 2GCHG 2RCEA 2P3UB 1A5HA 4FUHA 1ZR0A 1QBOA 2BQ7B 1AY6H 4YOGA 3NZIA 1CSOE 3V12A 3F9FA 2WPHS 5CE1A 2TPIZ 4UE7H 2CXVA 4B2CA