3P92A

Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (bpti-k15r/r17g)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The P2' residue is a key determinant of mesotrypsin specificity: engineering a high-affinity inhibitor with anticancer activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PRSS3 protein
total genus 51
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p92A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3p92A02
2AIQA 3MWIU 1VITG 1BTUA 1PPZA 3E90B 2ODQA 5AF9H 1VCPA 2ZG0H 2V6NA 3TIUA 1O32A 2J94A 5EQSA 5ESBA 1P2QA 3BEUA 5HM2A 3SJ8A 3MNSA 1QBOA 4H6SB 2BQWB 1Z71A 2KAIA 1UCYE 3SI4H 1P03A 2J34A 3GY6A 3KL6A 4Y8ZA 2ZWLH 1QQUA 3T29A 4WY3A 5EXLA 1GJ7B 1KXFA 1KDQA 3L33A 5EXMA 1KLJH 3F9EA 5F8ZA 1ABIH 5FBEA 2ANKH 4O97A 1ANDA 1AFQC 1K22H 4IN2A 2NU4E 1F7ZA 3UQVA 2GX4A 4E7NA 2ZDLA 2A7JA 1TAWA 1TONA 2VB0A 3VXEH 1O35A 1EAIA 2ZFRH 1BDAA 1Z1IA 1RS0A 3DD2H 1O2ZA 3KGPA 2PFEA 9LPRA 2TGDA 1DPOA 4YOIA 5FCKA 1K1IA 4A7IB 3GISB 3PMJA 5A8ZA 2UUFB 3TH4H 5JBAS 4E7RG 2FDAA 1GBJA 4MLFB 1LQDB 1S5SA 4DIHH 1HB0B 3KQDA 5E2OA 1L0ZA 2Q6GA 2ZIQH 1ACBE 3A7ZA 5GCHG 1ZPBA 1TOMH 4WMDA 1TMTH 2ZPRA 2O8MA 5A0CA 1L4DA 1HNEE 3HKIB 4YZUA 6GCHG 1V2MT 4DOQA 3SORA 1MU8B 3LGUA 1ELTA 3C1KA 1SOTA 3P8NA 2BD2A 4CRFA 1SSXA 3LC3A 3UPEA 3T62A 1KSNA 1L2EA 2XWBI 2OQ5A 3K6ZA 3QN7A 1YPHC 2VIDA 2P59A 1MKWK 1BRUP 4UE7H 1GJ4H 4MG3A 3LJJA 4X1NU 2ZDAH 1Y3XA 3EAJA 5TJXA 1XUFA 2WPMS 3SQEE 3OSYA 3SJ9A 2ZHWH 2WPJS 4R8TB 2GTBA 1AVXA 5CHAB 3GYMA 4HFPB 1BMNH 1D3QB 4X0WU 3KNXA 1GMCF 1W0ZU 4HI3A 1ZOMA 4FUBA 2FLRH 1SFQB 2AFQB 3PROA 1PYTC 3SU3A 3ZZ8A 1DM4B 1O2RA 1VR1H 2B9LA 2QCYA 3U8OH 2ZCKP 4UFDH 1C2KA 1LDTT 5GJ4B 3UREA 4ISOA 3D49H 1O2QA 4WF8A 1QL9A 1GBIA 1F0UA 1WYKA 1S6FA 2ZEBA 5AFZH 5EQQA 3A7YA 5C67A 2XC5A 3SNDA 4NWKA 1WQVH 1S84A 3GOVB 1H9LB 1KTTB 4ZKNU 1ZTKA 3LH1A 4H4FA 3NUMA 3PWCA 1ZMLA 1N1LA 1T8MA 1W7XH 4IS5A 4K5ZA 3BEFB 4FU7A 1AGJA 2H5DA 2ZU3A 2BOHB 1FDPA 4XBBA 1QL8A 3HPTB 3R3GB 1UK3A 2OBQA 1T4VH 2FXRA 5CMXH 2BQ7B 1LPKB 2SNVA 3P95A 4YLQH 1UO6A 2Y5FA 1INCA 3SU6A 4U01A 2FEQH 1KYNA 2B5TB 2HNTF 3TU7H 3D62A 3O8CA 1AVGH 4BAMB 1CGJE 1SHHB 3RXSA 1N8OC 1EP6A 3S7HB 1VJ9U 4XBCA 4FU8A 1FQ3A 5FX5A 2FTLE 2WPHS 1LPZB 5AVDA 1BHXB 4TY7A 3UOUA 1AD8H 2FYQA 2A4QA 4X2WA 5EXNA 1O38A 1GI1A 3GDSA 4FVDA 1LPGB 3PLBA 5T3HA 1HRTH 2Y6TA 4OS7A 3E1XB 1BRBE 2SGEE 4CH8B 2UUKB 2ZHFH 2BB4A 1EOJA 3SU0A 3FP7E 1BBRK 1CVWH 3ATIA 1FY4A 2BZ6H 1KDQB 3A84A 1Q3XA 3RDZA 3ATMA 5T6DA 3A8CA 2H2ZA 2QXJA 3RLYH 1GI9B 1TIOA 1QB9A 2BDBA 1OPHB 2Q6DA 2VGCB 1TA2A 3ATKA 1V2KT 3SNBA 1C5ZB 1DUEA 2PKAA 2R3YA 2WV4A 3RXGA 3ZZBA 1YPJH 2CV3A 1C2MA 4NA9H 3SZNA 1QA0A 1SGQE 3CENA 4AN7A 3ODDA 3HGPA 4CHAB 4ZKSU 5LPRA 2JH0D 1F5RA 3K9XB 1O3MA 3RC6A 1GMDF 1KXBA 5EU8A 1A5IA 4GCHF 3SW2B 1HCGA 5J4SA 2WPIS 4I31A 1NFWA 1FLEE 4A5TS 1RRKA 1V2VT 1FY8E 2A4GA 1XUHA 2ZC9H 4A1TA 2WYJA 1OP0A 1ARBA 2VIOA 2FTMA 1MBQA 5FPSA 1CGIE 3ITIA 2FZZA 4Q7XA 3GY8A 1H4WA 2FIRH 3ZVEA 3NCLA 1GBCA 1O2NA 4WH6A 4DT7B 2GZ7A 1SGIB 1ZMJA 1AFQB 3V12A 4MNXA 4H42U 1GVZA 3M3TA 1V2TT 1IHSH 1WQSA 2R2MB 4NIXA 1FN6A 1KXEA 1A5HA 3LJOA 2PW8H 1AMHA 4Q7YA 3TH2H 3GCNA 1DFPA 1O34A 2O8UA 5BRRE 4TWYA 4AYVB 2GT7A 2ZPQA 1ZLRA 1GI0A 1GJBB 1P9SA 3M3VA 1O3PB 4RKOB 2KAIB 1U6QA 1WU1A 2YNAA 2ZPSA 1P0SH 1NRRH 2BVRH 1KLTA 1O5DH 5BPEA 2J92A 5LPEA 2QAAA 1NTPA 2BDAA 2FOCA 3TJUA 5ABWA 3M3SA 3MYWA 1O2VA 3LOXA 2J95A 1P57B 2NU2E 2O8TA 4LOYH 4TPIZ 2HGTH 1KXCA 5E8EH 2B0FA 1A7SA 4ABEA 5JBCS 3I78A 1EQ9A 3MNBA 1RTKA 3S0NA 4AORA 2Z94A 1CBWB 1C5OH 1GBTA 4MNWA 1XVOA 3RMNH 3SHCH 2P3FH 4D9QA 2K1QA 1N8OB 3PTNA 1C1MA 1ELDE 3NXPA 2RDLA 1TBRH 1G3CA 1XM1A 5F8TA 2NU3E 3ELAH 3RXCA 1FAXA 1GMCG 1FXYA 2STAE 4NFEA 1YP9A 3PV4A 4DURA 1PQAA 3SOSA 1KXAA 3FANA 4KTCA 1BBRE 3LGIA 2ZFSA 4ISNA 3Q76A 2VU8E 1P2MA 4X1PU 5PTPA 4KTUA 1IQEA 2QXGA 3SBKA 1KIGH 1B5GH 1PFXC 2A2XH 4BTUB 2OBOA 1Z6JH 1T31A 2LNCA 1G36A 1EPTC 3KCGH 3OTJE 1GBLA 2BQ6B 1ZTLA 3SV6A 3SO3A 3ZZCA 2QC2A 2ZI2H 4FU9A 1O5EH 1V2UT 1C5XB 1O2HA 2CGAA 1TALA 2C90B 1MBMA 2HNTE 1KTSB 2Y5HA 1GGDC 1FY5A 3K2UA 1SLWB 1QBVH 3TITA 1A0JA 3KF2A 2O9QA 2FLBH 1F92A 4FUCA 1NM6A 3PMBB 2G4UA 2FOFA 3UNQA 3T2NA 3NZIA 1C1VH 2PHBA 2GMTC 3RXHA 3LDXH 3SGAE 1DWBH 4RN6A 1Y3UA 2AMDA 1BUIA 5FAHA 1NRSH 3SU1A 3ZZ4A 1CSOE 1H8DH 3MH5A 4MVNA 2Z9LA 1BRAA 1GJAB 2BVXH 6ESTA 3SI3H 2Y5GA 1L1NA 1E36B 1K1MA 3IITA 3MOCA 3SV2H 2O8WA 1BTXA 3BG4B 3LPRA 4CH2B 3RUOA 3H5CB 1S6HA 1UVSH 1W0YH 2BDCA 2G52A 3EGKH 2HPPH 3TK5A 1X7AC 4X1RU 1ZPZA 4A1VA 2JKHA 1CBWC 2ZTZA 1QRZA 5DP3A 1TPSA 1SGNE 1S0RA 3AASA 2BDHA 3VXFH 4E06H 1HBTH 3TLOA 1QJ1B 3U8TH 1O36A 2FOMB 1W8BH 3T28A 3KHVA 4Q80A 1UVUH 1S81A 4CRCA 4U32A 2BX4A 4FVBA 4MPUA 1TGBA 4ZHLU 4GPGA 1O5CB 3L3TA 3E16B 1SLXB 1UTKA 2ALPA 1EXFA 1HAVB 3IG6B 4Q2KA 1QTFA 1P11E 1DOJA 4I33A 4CR9A 1O5FH 2VINA 4VGCC 1YCPM 5A8XA 4X2XA 1IQGA 3S9CA 4JYTA 5F03A 1SQOA 3QWCH 1GHWH 4DVAU 1OWKA 1RIWC 3MH7A 1ZSJA 3MU4A 1G30B 3FAOA 1W3CA 3UTUH 3SNAA 1BT7A 1ZTJA 4A92A 3RM2H 1QBNA 1W10U 1AHTH 1LKAA 2SGFE 2AYWA 2PTNA 3P8OA 1T8LA 2BD4A 2FM2A 3AW0A 3W95A 3A81A 4ZUHA 4ABGA 1KLIH 1TYNA 2ODPA 1CGHA 3DT0H 1P04A 1O3OA 1CO7E 1HAOH 2GMTB 2BLVA 2UUJB 2FESH 3BSQA 1O3GA 2A31A 5T6GA 4MDSA 1V2JT 2C4FH 5E2PA 4SGAE 1QJ7B 1HXEH 1LQEA 2ZFPH 1W14U 1C5WB 2AH4X 2QIQA 2ESTE 1AIXH 2XBVA 5DP4A 4AFUA 1P8VC 1VCWA 2H5CA 2P8OC 1D9IA 1ELEE 1FY1A 2P94A 5DGJA 4YT7H 1P12E 2XWAA 1TNKA 4TYDA 2ULLA 1CT2E 3S7KB 1ZGIA 1O2LA 2VIVA 4ISLA 3TJNA 4ISIH 5C3NA 1O2XA 2C8XB 3BF6H 4KGAA 2R0KA 1BTYA 5EW1H 1SL3A 1MUEB 1O2UA 3FP8E 1OS8A 3FZDA 2Q1JA 4D7FA 1O2KA 4B2BA 1GMHG 1TBQH 4JYVH 1GBAA 3SUFA 2GP9B 2IPHA 2H9TH 2W5EA 2R0LA 2W7SA 1BIOA 5JBBS 2D26C 1NROH 3PMAB 3VGCC 2OINA 3A80A 4DJZB 1O37A 5T6FA 5SGAE 3JZ2B 5GXPA 4ISHH 1P05A 1C1TA 1PYTD 2J4IA 1TX6A 1ZRKA 3ZZAA 2GKVE 1C2JA 1QHRB 1C4Y2 1EOLA 1ZZZA 1DVAH 3RM0H 4UFGH 2SGAA 1CHGA 4K1EA 2GDEH 1P3CA 4ABDA 4XOJA 3RLWH 3SUEA 2B7DH 3QGJA 2PTCE 1ZMNA 3EQ0H 1GL1A 2ZU1A 1B7XB 2WV5A 4MQAA 4B1TA 3BTHE 4I7YH 2ZQ1A 4D76A 4CRBA 3H7TA 1W11U 3I77A 2ZGCA 3MU0A 1GJ8B 3DUXH 4OS4A 1IQIA 3F9HA 4GCHG 1SQAA 1ZJDA 1C5MD 4Q7ZA 1RJXB 4Y0ZE 1TGNA 3Q3YA 5H4IB 1J17T 2BY9X 4K8BA 2FOBA 2FOGA 1OOKB 1GGDB 3ZV9A 3U69H 2F9UA 1O2MA 2A5AA 4ABBA 2ODYB 1G3DA 8LPRA 2H6MA 1O5BB 2OC1A 5EGMA 1AE5A 1ESTA 3B23B 2Z9KA 2WINI 5F8XA 1SBWA 1RXPA 2A4OA 3RU4T 3L6PA 1K1OA 5EQRA 2BLOA 2R3UA 2QY0B 2BD3A 3M7QA 3E3TA 4X8UH 1ANBA 3RXVA 4D7GA 1CA8B 1TRMA 1OKXA 3SQHE 3NK8A 4ZKOU 4BTIB 1J9CH 2PGBB 1HAPH 5HGGA 2GVFA 1TA6A 1XKBC 7ESTE 3A8BA 4BNRA 3RU4D 3CS7A 2ANYA 2QA9E 3M35A 4JZFH 4XDEA 4OGXA 5GCHF 1GBKA 4A6LA 4ZXXH 3A83A 4F4OC 3RMOH 1W13U 2G81E 1HIAB 1HYLA 3O8DA 1O3BA 3M37A 2GCHF 2OC0A 3RMMH 1BHXF 1MD8A 1CHOG 3SNCA 1A61H 1P2OA 4AB8A 3RXRA 4I8KA 3T5FH 1A4WH 2OCVB 1DSTA 1F0TA 1V2LT 1L4ZA 5A8YA 3P17H 5C5NA 2VIPA 4XSKU 3P8FA 2VVUA 1O3IA 3F68H 2Z6BD 3ZVDA 2C3SA 2AMPA 4XE4A 1HAIH 1UHBA 2VH0A 1UK4A 2OC7A 1QNJA 2H9HA 1O2TA 2ZU4A 1G3BA 3HKJB 1ZYOA 3RXMA 1D6RA 1J14A 4VGCB 4WXIA 5G4BA 3MO3A 2A4RA 1UTLM 4ABJA 1E35B 3H7OA 3SV8A 4ABIA 2UWLA 2XW9A 3PM3A 2GCTB 1DE7H 3VB3A 2VGCC 2ZDNA 4WXVA 3V3MA 1DWCH 1ZHMA 3UUZA 1ETRH 1TGSZ 4B75A 1C9TA 4Y7AA 3K6YA 3VB5A 3AVZA 1J16A 4HGCA 2FX6A 1C5TA 2VJ1A 1GG6B 3KEEA 1F5KU 1WTHD 1ZSKA 5EODA 4DG4A 1J8AA 1O2PA 2F9PA 2THFB 1LTOA 1GBMA 1QB6A 1C5VA 3SHAH 1O30A 2Z9IA 1Q31A 2JH6D 4O3TA 5GPIB 4CBOA 1QRWA 1CT4E 2FS8A 1C5NH 2ALVA 4NFFA 3ZVGA 1DY9A 1ELGA 3QO6A 1Y5AT 3PLPA 1EZUC 1VZQH 1A3EH 4IBLH 1F0RA 2ANWA 5LGOA 4I8GA 3F1SB 1V2QT 1YPHE 2ZGBH 3SU5A 3PYHA 1GVKB 1HAVA 1EJNA 1LHGH 4OGYA 3UQOA 5I46H 5FPYA 1C1PA 3QDZB 2F9OA 1TRNA 1P01A 2VWOA 3TGKE 3LT3A 4Y7BA 1QA7A 1GWAA 1O2IA 1SGDE 1AQ7A 1GCTB 1YF4A 2ZCLP 4UD9H 1GDNA 3KQEA 2NWNA 3ZZ6A 1FUJA 4Y0YE 1TB6H 1XX9A 5JPMH 1XUKA 3TJVA 2DE8A 1JRSA 1AFEH 1TNIA 3ZV8A 3MNXA 1HIAA 4LZ1H 1DSUA 2V3OH 2BY5X 3KQCA 4IC6A 1RTLA 1C9PA 4JYUH 2A32A 1WAYB 1SGCA 2XBXA 4RSPA 2ZU2A 1E38B 2Z3EA 1DICA 2BX3A 4R0IA 1THSH 3G01A 1OSSA 2RA3A 4U2WA 2H1UA 7GCHG 2GV6A 3GCHC 3STIA 1UTQA 1C2GA 1GI8B 1C2IA 4AFSA 4B76A 3O8RA 3Q3XA 5DKMA 1O3AA 2XTTB 3T25A 1O3JA 3P70B 1GJ6A 1O39A 3ZVCA 3UFAA 3RMLH 1GCDA 3M5NA 1DWDH 1VJAU 1F2SE 2W7UA 3ESTA 3GY5A 2OXSA 1C2FA 1K1PA 1YCPH 2Y80A 1G37A 9ESTA 3URCA 3QZRA 1AUTC 4I32A 3RP2A 1TPOA 2UWPA 2OQUA 4B2AA 1YPMH 1GG6C 3BG8A 2FI5E 2M5TA 3R0FA 2ZKSA 3BEIB 2PR3A 4FUHA 1CHOF 4NIWA 1L1GA 3UNRA 4NSYA 1JIMA 1OWIA 1CA0C 1HGTH 2QXHA 2XXLA 1DLKB 3LGYA 5K0HA 1MAYA 5EPNA 1MD7A 2G00A 5E0JA 4BAQB 2XBWA 5E0HA 1UVPA 3TGIE 2G5VA 4ASHA 3N7OA 1SMFE 3PO1C 1HUTH 4D8NA 4JZEH 4QT8C 4OS1A 1NFXA 4X6OA 2JETC 1LMWB 2FS9A 5A2MH 1ANEA 3A82A 3MO9A 1OX1A 2Y82A 1ABJH 3UY9A 4CRGA 1HAHH 1T8NA 4NCYA 1BRCE 4FUDA 3AW1A 1S83A 1DXWA 1FPCH 1EZXC 3NKKA 2Z3DA 4CHAC 1LVOA 4NG9H 8KME2 1GHVH 1DY8A 2HNTC 1AB9B 1P09A 4WMEA 2P95A 4ZKRU 3MO6A 1O2WA 4O9VA 2HVXA 1AO5A 4Y10E 4INKA 5FBIA 3TK6A 1MAXA 4F49A 2XCFA 4LZ4B 1HJAC 3RC4A 1AZZA 1BJVA 2ASUB 1FIWA 1BQYA 3PMHB 3PTBA 4KELA 1B0FA 2TPIZ 4GVUA 2AMQA 1P06A 4I8JA 1GCTC 5DP6A 2TBSA 1XMNB 1Y3YA 1GHBG 1OWJA 1IAUA 1WOFA 1FONA 2OTVA 4ZH8A 3RU4E 1FMGA 8GCHG 4BANB 4X1SU 3STJA 5C2ZA 3ZZ5A 4YTAA 1C5QA 8ESTE 1C1OA 1AVWA 1P10A 3D65E 2STBE 1GHAG 3LU9B 1SFIA 3K65B 3S69A 1GDUA 2BVSH 1O5GH 1QJ6B 3PWBA 3RXBA 4IW4E 1PPGE 1BTPA 1QL7A 3SNEA 1D3PB 4XBDA 1G2LA 3QUMP 5FX6A 1O2YA 4K3JA 1ZR0A 1C5UA 2BDGA 2A2QH 2RG3A 2XCNA 1TPAE 4WH8A 4K2YA 3A7TA 1QGFA 1QY6A 1Z1JA 1SHYA 1GVLA 1HLTH 1P9UA 1GI7B 1QFKH 1MCVA 1EASA 2RA0A 2XC0A 3AAVA 1J15A 1FIZA 4INHA 1TNJA 2QXIA 4HTCH 6GCHF 5DJ7A 3RXQA 3M5OA 1SLVB 4TY6A 4LK4A 1UK2A 2JETB 1SGPE 1IHTH 5AHGH 1BTWA 2P93A 3ZYEA 1K21H 4JK5A 2WPLS 3OX7U 3U8RH 4YOJA 3GCOA 3RXEA 1ELVA 1A0LA 3F9GA 4ABAA 2A5KA 4INLA 3MI4A 1GL0E 1W7GH 6CHAB 2QYIA 1GHZA 4NIYA 3LKWA 1UVTH 5CE1A 1D3TB 2SGPE 2TGAA 3QK1A 1SOZA 2FODA 5DG6A 1DITH 1T4UH 2XNIA 3M5LA 1A0HB 1AZ8A 1SGYE 1BMAA 2J9NA 2ZTYA 3NPSA 2I6SA 4ZROA 1SC8U 1HJAB 4ZHAA 4AZ2B 3SUGA 4K8YA 1HXFH 1TX8A 1F0SA 1E37B 1WBGB 3VB6A 1SGFA 5E0GA 1UTJA 2FI4E 1CQQA 1ZHRA 3DHKH 3RXDA 3GICB 4IMQA 1ID5H 4JMYA 1BBRH 3GDVA 4OS2A 1PQ8A 1D3DB 4AGJA 2GCHG 4AB9A 1YPEH 1JOUB 2ZFFH 1T7CA 3RXIA 5LPFA 3GY3A 3JZ1B 1MMJN 5A0AE 1LVYA 2I6QA 1ZGVA 1ELCA 1S85A 2VH6A 2YOLA 4JCNA 2W3IA 5HXFA 3SJKA 1NZQH 4MNYA 2W3KA 1FN8A 1GDQA 2BMGB 2ZNKH 4UFEH 2TIOA 3BTKE 1K9OE 2C8ZB 4MNVA 3IWMA 4FUIA 1PQ7A 5LH8A 5JBTA 3VEQB 1BOQA 1HAYB 2GV7A 2QGRA 2CHAC 5C5OA 1TGCA 2HOBA 1MKXH 3PB1E 1LHDH 2V3HH 2W26A 2PLXA 3E8LA 3MH4A 2PKSB 4Z6AH 4Y76A 2G4TA 1SG8B 3A7WA 5GIBA 7GCHF 3BTWE 1CE5A 1UTNA 3BIVH 1HAZB 2OD3B 4IGDA 1NO9H 2FP7B 1ZJKA 3EA7A 2DUCA 3M5MA 1RGQA 1A2CH 1C2DA 3A7XA 4AGKA 2ZFQH 1C1UH 4AOQA 3UWJH 1ARCA 4RKJB 2AGGX 2GDDA 4HZHA 2C93B 1BA8B 3UR9A 1V2ST 1MZDA 3RXUA 2SNWA 2QF0A 3DA9B 1NT1A 5DP8A 1JBUH 1B0EA 2BM2A 2OP9A 3S9BA 3BTME 5GDSH 3BN9A 1YM0A 3T27A 2BD9A 3TH3H 5ESTE 5FCRA 4NSVA 1ZRBA 1OWDA 2PGQB 1WSSH 1K2I1 3GY2A 1GHXH 5A09A 1ORFA 3SV9A 3MFJA 2VVCA 2HRVA 4K1TA 1ETTH 5AFYH 2ZZUH 3QZQA 5FPTA 3TPIZ 1Y5UT 1GHYH 2G8TA 2QF3A 5DP9A 2A45B 1GMDG 3VB7A 3C27B 3FVFB 1G9IE 1H1BA 3DFJA 1HAXB 1LCYA 2UWOA 3TK9A 2BYAX 1IQLA 3NWUA 3T26A 2BXTH 1XVMA 2BDYA 4ZHMU 1GI4A 3ZVBA 1LO6A 3HGNA 1LHEH 4ZXYH 2NU0E 1SGFG 2AGIX 1Z8RA 5EG4A 1C1RA 2TRMA 1TBZH 1ELAA 3QTOH 1JIRA 1UMAH 1GJ9B 1PQ5A 2B8OH 4H6TA 3SN8A 4NZQA 4ZMAH 3KN2A 2VWNA 1EP5A 1NU9A 1NRQH 3FZZA 1O3LA 1O3KA 3QX5H 3GY7A 4BXWA 1T8OA 1XUGA 2V0BA 1D4PB 5EW2H 2EI8A 3GYLB 5L2YH 1E0FD 1MKXK 4B74A 1YGCH 2BLWA 3MHWU 1WV7H 2VWLA 1AWFH 4UDWH 4E05H 1PPHE 3D23A 1C5PA 1AN1E 5JYIA 1MZAA 3WY8A 3A8DA 3EYDA 4MPVA 1A3BH 5DP7A 1SB1H 1VITH 2C8WB 4X1QU 4ABHA 2CMYA 2FOAA 3P92A 4NZLA 1V2RT 4CBNA 1P2JA 1SQTA 3ZZ9A 2ZCHP 1RFNA 1AUJA 3SUDA 4O03A 1K1JA 3BTEE 3P8GA 2ZGJA 5C1XA 7KMEH 2D1JA 2A1DB 2F3CE 3A7VA 4B2CA 1EAXA 1FAKH 2PUXB 1O0DH 2ZA5A 2P3TB 4X2YA 1G32B 5ETXA 3VGCB 5IDKA 1MQ6A 1N6XA 3HK6B 2GZ9A 1EUFA 1TQ0B 2Y7ZA 5TCCA 1NESE 5B6OA 1OWHA 1K1NA 2R2WU 3BTDE 4NA7A 3U1JB 2ZGHA 5HM9A 1NU7B 1UJ1A 1GHBF 4FXGH 3MTYA 1O3CA 1QCPA 1NPMA 1GI5A 1IQNA 4XFQA 1P2IA 4BAOB 1QB1A 2GCTC 5I25A 1UCYK 4K1SA 3A87A 3TNTA 1MTVA 3V13A 2QV1A 1NRNH 5IYTA 4JZIA 4FUGA 1VCQA 2ZFTA 3M7UA 1MH0A 1FZZA 1DANH 1MTUA 1LVMA 2GD4B 2Z9JA 2A7CA 4Y79A 6CHAC 1IQKA 1SI5H 2JH5D 3RXAA 1V6DA 4LXBH 1O2JA 1K28D 3LC5A 4CREA 1Z8JB 1CT0E 2QN5T 2CF8H 3SJIA 5L30H 4Y8YA 2ZDVH 1Z7KA 4K60A 7LPRA 2F9BH 2D8WA 2J38A 1DLEA 2BD8A 2HWLB 2PKAB 4CR5A 3A86A 1C5YB 1HPGA 3MU1A 3BV9B 2HLCA 1ZPCA 4Y11E 5HMAA 2GGVB 1EKBB 3RXKA 1Y5BT 1QURH 3F9FA 2VWMA 3GCHB 3GCTG 2GT8A 1GBHA 2ZDMA 3SU2A 4BXSA 3LGWA 5A0BA 3BTGE 3TVJB 8GCHF 2Z3CA 2P16A 1ZHPA 3A8AA 4U30A 4GHTA 1AKSA 1M9UA 1GBDA 1UHBB 1C1SA 2FI3E 2Y7XA 4YT6H 4ESTE 4X2VA 2Z9GA 1HAGE 1V3XA 1YKTA 2BD5A 1T32A 2ZQ2A 4IC5A 2F83A 2YNBA 1DT2A 1TLDA 2ZF0H 1EJMA 1UTOA 1K1LA 1VITF 3RC5A 2EA3A 4UONA 2ZU5A 1YC0A 1YBWA 1GI2A 3GY4A 2WYGA 4BAKB 1OP8A 1IQMA 1XXFA 4JZDH 1THPB 1RTFB 1FPHH 1TWXB 1S0QA 3OY6U 3BG4C 1GPZA 2PV9B 3F6UH 2BTCE 2G55A 3OU0A 1EPTA 1BITA 2XBYA 4WVPE 2OUAA 2CF9H 1ESAA 3EA8A 3KQBA 3BTQE 2C8YB 1GI6A 1PPBH 1C5RA 1JRTA 5J4QA 1GJCB 1YLCA 3LH3A 5L2ZH 1XUIA 2BLQA 4YLUA 4GAWA 1BTHH 3ATLA 1C1NA 1EX3A 3URDA 3HATH 1BMMH 1TOCB 1ELBA 3W94A 4GUXA 1BTZA 1P2KA 1ZSLA 1TNLA 1YPLH 1G2MA 1UCYH 1DWEH 1HDTH 1DX5M 2DE9A 2CJIA 3TGJE 1ESBA 3RXTA 4YESB 1C1QA 1V2NT 1Z8IB 4MPWA 3ZYDA 1SGTA 2ZGXH 4FUEA 1C5SA 1BMLA 1GBEA 3LGVA 4B73A 1SR5C 1ETSH 4X6NA 1OYQA 2TGPZ 3SU4A 3V7TA 1C2HA 1DS2E 2BZAA 3EE0B 4KKDA 3UR6A 3DFLA 3SGBE 2ANMH 2FYRA 3BIUH 1C5LH 2LPRA 3UOPA 5C20A 1ANCA 1AI8H 1FNIA 4X8VH 4ZAEA 2PSYA 3PO1B 5FXLA 5TCAA 2VVVA 1PPCE 1IQJA 2BD7A 2Y81A 4GHQA 4J2YB 4O3UA 3SJOA 2ZHQH 4Y6DA 2XYAA 3OY5U 2PWXA 1SLUB 2BY7X 3U98H 3UNSA 1SGRE 1BCUH 1PPFE 3BTTE 1C4U2 4TWWA 2EI7A 1MTNC 3I29A 1WTGH 4CRDA 4X8TH 2F9VA 1IQFA 1AU8A 1TQ7B 1TFXA 4GLYA 1AE8H 4WWYA 2VIWA 3Q77A 4TPYA 2OLGA 1NC6A 3QLPH 2WUBA 4DGJA 1O3DA 4FUFA 2PSXA 4NGAH 2TGTA 1EATA 3M7TA 3BTFE 2PUQH 5FHTA 1AY6H 4J1YA 3TNSA 3ZZ3A 2ILNA 2A5IA 2XC4A 1DXPA 3CS0A 2F9NA 3ENSB 1V2PT 1HJ8A 2CXVA 5JDUB 4Y71A 3MU5A 1XXDA 1JWTA 2XRCA 1AWHB 4KTSA 2FOHA 3MMGA 1JMOH 2BHGA 4AYYB 5DO4H 3AAUA 4AG2A 2G51A 4I8HA 2P3UB 4I8LA 4BTTB 2VIQA 4YO9A 3RXPA 1GJDB 1YPGH 1P3EA 1SPJA 2Z7FE 2IJOB 1WCZA 3TJOA 1N6YA 2SFAA 2D2DA 1LHFH 1GJ5H 1NN6A 1E34B 1QIXB 4AG1A 3A89A 4K69A 2AERH 4OS6A 3MU8A 1O31A 2ZP0H 3LIWA 3UWIA 1NFYA 2R9PA 4UEHH 3ZZ7A 1IOEA 4D9RA 3O8BA 1NRPH 2ZDKA 3CP7A 2G5NA 1CU1A 4MPXA 1YLDA 2EI6A 4CRAA 2J2UA 2ZHEH 4DIIH 1O3HA 1TABE 2HALA 1DDJA 4B71A 1VGCC 4A1XA 1P2NA 2UUYA 1OWEA 1H8IH 5DP5A 1GBBA 3GDUA 3B9FH 5K7RA 4YOGA 1PJPA 3RXOA 1HFDA 4ABFA 3OYPA 2IN2A 3GCTF 3U1IB 2OC8A 3MH6A 4NIVA 1QRXA 3VPKA 3ZVAA 5GWZA 4BOHA 2FO9A 2GZ8A 2NU1E 3LONA 3MNCA 3FP6E 6LPRA 1MKWH 3V0XA 4M7GA 2A7HA 2O8LA 1MTWA 4JZ1A 2ZTXA 4AFZA 3E0NB 1OP2A 3SGQE 1UVOA 3EDXB 1EB2A 4AFQA 2Q6FA 2ZHDA 2H9EH 4DW2U 1FY3A 1LKBA 2BDIA 3B8JA 1YPKH 5L6NH 2EEKA 3U9AH 1UTPA 3ZZDA 1IQHA 1XKAC 2RCEA 4BAHB 3KIDU 1MTSA 5DK1A 4IN1A 2V35A 2P8OB 4DY7B 1TX7A 1EPTB 1LVBA 2FMJA 3UIRA 1F5LA 1MTNB 4IMZA 2AS9A 1RD3B 3E91A 1YCPK 4JK6A 1TRYA 2EC9H 1O5AB 1XUJA 1Y3WA 3FFGA 2PKSC 3QTVH 3A85A 2FPZA 1O3FA 2FOEA 4NWLA 3VFEA 5JB9S 1FV9A 5F6MA 1H9IE 3ATWA 2BY6X 1S82A 1D6WA 1V2WT 3HK3B 5HYOA 5DPAA 4OS5A 4KP0A 2ZECA 3E6PH 1TE0A 2WUCA 1FJSA 1EAWA 1O3EA 1ELFA 1G3EA 3P6ZB 1TNHA 2BY8X 1LHCH 1L1JA 5JB8S 1Z8GA 1HV7A 2BOKA 1AKSB 2A0QB 3A88A 2SGDE 1MCTA 1GI3A 1P02A 1C2LA 1TGTA 1FI8A 1YYY1 1QR3E 3E0PB 3Q3KA 2CHAB 3M61U 1MQ5A 4PROA 3S9AA 1GHAF 1SGEE 2SGQE 3LGTA 2FWWA 2WPKS 1JXPA 1EZSC 1VGCB 1W2KH 1Z6EA 1Y3VA 1CA0B 2AGEX 2ZO3H 1TMBH 1TPPA 2AEIH 3Q00A 1OYTH 3EA9A 4UFFH 3ZVFA 1KXDA 1BJUA 3QGNB 3M36A 1KY9A 2BXUH 1V2OT 4NA8A 4GSOA 1C1WH 1EAUA 3RXJA 3RXLA 5C1UA 4WJG2 1HJ9A 4X8SH 1DUAA 4FUJA 1O2OA 1GBFA 5C1YA 5EPYA 2AIPA 1NY22 2CN0H 4YM9A 1BZXE 3SV7A 1NS3A 1PPEE 1O2GH 1UTMA 1Q2WA 1C2EA 1GMHF 1EB1H 4Y8XA 1WUNH 1Y8TA 1QQ4A 1THRH 1NFUA 1H9HE 2VNTA 1BB0B 1A46H 3VB4A 2IOTA 2FX4A 2HPQH 4WMFA 5CHAC 1TNGA 4Z0KA 1Y59T 1MU6B 4X6PA 1EZQA 2F91A 1OXGA 3PLKA 1SVPA 1A1RA 4X6MA 3ODFA 1AB9C 5EOKA 1O2SA 1O3NA 1EJAA 1RIWB 4MTBA 1C4V2 1A5GH 4SGBE 1O33A 3RXFA 1TMUH 4AX9H 4THNH 1W12U 4DCDA
chains in the Genus database with same CATH superfamily
2AIQA 3MWIU 1VITG 1BTUA 3NRLA 1PPZA 3E90B 2ODQA 5AF9H 3OFND 1VCPA 2ZG0H 2V6NA 3TIUA 1O32A 2J94A 5EQSA 5ESBA 1P2QA 3BEUA 5HM2A 3SJ8A 3MNSA 1QBOA 4H6SB 2BQWB 1Z71A 2KAIA 1UCYE 3SI4H 1P03A 2JIZD 2J34A 4M9FA 3GY6A 3KL6A 5KEDA 4Y8ZA 1VKYA 2ZWLH 1QQUA 2RFKC 3T29A 4WY3A 5EXLA 1GJ7B 1KXFA 1KDQA 3L33A 5EXMA 1KLJH 3F9EA 5F8ZA 1ABIH 5FBEA 2ANKH 4O97A 1ANDA 1AFQC 1K22H 4IN2A 2NU4E 1F7ZA 3UQVA 2GX4A 4E7NA 2ZDLA 2A7JA 1TAWA 1TONA 2VB0A 3VXEH 1O35A 1EAIA 2ZFRH 1BDAA 1Z1IA 1RS0A 3DD2H 1O2ZA 3KGPA 2PFEA 9LPRA 5C0TA 2J97A 2TGDA 1DPOA 4YOIA 3FOAA 5FCKA 1K1IA 4A7IB 3GISB 3PMJA 5A8ZA 2UUFB 3TH4H 5JBAS 4E7RG 2FDAA 1GBJA 4MLFB 1LQDB 1S5SA 4DIHH 4P02A 1HB0B 2W6JD 3KQDA 5E2OA 3KYGA 1L0ZA 2Q6GA 2ZIQH 1ACBE 3A7ZA 5GCHG 1ZPBA 1TOMH 2XOKD 4WMDA 1TMTH 2ZPRA 2O8MA 5A0CA 1L4DA 1HNEE 3HKIB 4YZUA 6GCHG 1V2MT 4DOQA 2KFWA 3SORA 1MU8B 4FOUC 3LGUA 1ELTA 2KCYA 3C1KA 1SOTA 3P8NA 2BD2A 4CRFA 1SSXA 3AK5A 3LC3A 3UPEA 3T62A 1KSNA 1L2EA 2XWBI 2OQ5A 3K6ZA 3QN7A 1YPHC 2VIDA 2P59A 3VG8A 1MKWK 1BRUP 4UE7H 1GJ4H 4MG3A 3LJJA 4X1NU 2ZDAH 1Y3XA 3EAJA 5TJXA 1XUFA 2WPMS 3SQEE 3OSYA 3SJ9A 2ZHWH 2WPJS 4R8TB 2GTBA 1AVXA 5CHAB 3GYMA 4HFPB 1BMNH 1D3QB 4X0WU 3KNXA 1GMCF 1W0ZU 4HI3A 1ZOMA 4FUBA 2FLRH 1SFQB 2AFQB 3PROA 1PYTC 3SU3A 3ZZ8A 1DM4B 1O2RA 1VR1H 2B9LA 2QCYA 3U8OH 2ZCKP 4UFDH 1C2KA 1LDTT 5GJ4B 3UREA 4ISOA 2WV9A 3D49H 1O2QA 4WF8A 1QL9A 1GBIA 1F0UA 1WYKA 3WWFA 1S6FA 2ZEBA 5AFZH 5EQQA 3A7YA 5C67A 3OAAD 2XC5A 3SNDA 4NWKA 1WQVH 1S84A 3GOVB 1H9LB 1KTTB 2PP6A 4ZKNU 1ZTKA 3LH1A 4H4FA 3NUMA 3PWCA 1ZMLA 1N1LA 1T8MA 1W7XH 4IS5A 4K5ZA 3BEFB 4FU7A 1AGJA 2H5DA 2ZU3A 2BOHB 1FDPA 4XBBA 1QL8A 3HPTB 3R3GB 1UK3A 2OBQA 2YMSD 1T4VH 2FXRA 5CMXH 2BQ7B 3F3BA 1LPKB 2SNVA 3P95A 4YLQH 1UO6A 2Y5FA 1INCA 3SU6A 4U01A 2FEQH 1KYNA 2B5TB 2HNTF 3TU7H 3D62A 3O8CA 1AVGH 4BAMB 3F2GA 1CGJE 1SHHB 3RXSA 1N8OC 1EP6A 3S7HB 1VJ9U 4XBCA 4FU8A 1FQ3A 5FX5A 2FTLE 2WPHS 1LPZB 5AVDA 1BHXB 4TY7A 3UOUA 1AD8H 2FYQA 2A4QA 4X2WA 5EXNA 1O38A 1GI1A 3GDSA 4FVDA 1LPGB 3PLBA 5T3HA 1HRTH 2Y6TA 4OS7A 3F2FA 3E1XB 4RI0A 1BRBE 2SGEE 4CH8B 2UUKB 2ZHFH 2BB4A 1EOJA 3SU0A 3FP7E 1BBRK 1CVWH 3ATIA 1FY4A 2BZ6H 1KDQB 3A84A 1Q3XA 3RDZA 3ATMA 5T6DA 3A8CA 2H2ZA 2QXJA 3RLYH 1GI9B 1TIOA 2AHME 3N7EA 1QB9A 2BDBA 1OPHB 2Q6DA 2VGCB 1TA2A 3ATKA 1V2KT 3SNBA 1C5ZB 1DUEA 2PKAA 2R3YA 3ZIAD 2WV4A 3RXGA 3ZZBA 1YPJH 2CV3A 1C2MA 2J5UA 4DT4A 4NA9H 3OE7D 1QA0A 3SZNA 1SGQE 3CENA 4AN7A 3ODDA 3HGPA 3UB0A 4CHAB 4ZKSU 5LPRA 2JH0D 1F5RA 3K9XB 1O3MA 3RC6A 1GMDF 1KXBA 5EU8A 1A5IA 4GCHF 3SW2B 1HCGA 5J4SA 2WPIS 4I31A 1NFWA 1FLEE 4A5TS 1RRKA 1V2VT 1FY8E 2A4GA 1XUHA 2ZC9H 4A1TA 2WYJA 1OP0A 1ARBA 2VIOA 2FTMA 1MBQA 5FPSA 1CGIE 3ITIA 2FZZA 4Q7XA 3GY8A 1H4WA 2FIRH 3ZVEA 3NCLA 1GBCA 1O2NA 4WH6A 4DT7B 3DSGA 2GZ7A 1S6LA 1NBME 1SGIB 1AFQB 1ZMJA 4MNXA 3V12A 4H42U 4XD7D 1GVZA 3M3TA 1V2TT 1IHSH 1WQSA 2R2MB 4NIXA 1FN6A 1KXEA 1A5HA 3LJOA 2PW8H 1AMHA 4Q7YA 3KQ5A 3TH2H 3GCNA 1DFPA 1O34A 2O8UA 5BRRE 4TWYA 4AYVB 2GT7A 2ZPQA 3PV5A 1ZLRA 1GI0A 1GJBB 1P9SA 3M3VA 1O3PB 4RKOB 2KAIB 1U6QA 1WU1A 2YNAA 2ZPSA 1P0SH 1NRRH 2BVRH 1KLTA 1O5DH 5BPEA 2J92A 5LPEA 2QAAA 1NTPA 2BDAA 2FOCA 3TJUA 5ABWA 3M3SA 3MYWA 1O2VA 3LOXA 2J95A 3WWBA 1P57B 2NU2E 2O8TA 4LOYH 4TPIZ 2HGTH 1KXCA 5E8EH 2B0FA 1A7SA 4ABEA 5JBCS 3I78A 1EQ9A 3MNBA 4ZCNA 1RTKA 3S0NA 4AORA 2Z94A 1CBWB 5HKKD 1C5OH 3U28C 1GBTA 4MNWA 1XVOA 3N99A 3RMNH 3SHCH 2P3FH 4D9QA 2K1QA 1N8OB 4AC9A 3PTNA 1C1MA 1KMHB 1ELDE 3NXPA 2OK5A 2RDLA 1TBRH 1G3CA 1XM1A 5F8TA 2NU3E 3ELAH 3RXCA 1FAXA 1GMCG 1FXYA 2CK3D 2STAE 4NFEA 1YP9A 3PV4A 4DURA 1PQAA 3SOSA 1KXAA 3FANA 4KTCA 1BBRE 3LGIA 2ZFSA 4ISNA 3Q76A 2VU8E 1P2MA 2V7QD 4RT0A 4X1PU 5PTPA 4KTUA 1IQEA 2QXGA 3SBKA 1KIGH 1B5GH 1PFXC 2A2XH 4BTUB 2OBOA 1Z6JH 1T31A 2LNCA 1G36A 1EPTC 3KCGH 3OTJE 1GBLA 2BQ6B 1ZTLA 3SV6A 3SO3A 1SQRA 3ZZCA 2QC2A 2ZI2H 1E1RD 4FU9A 1O5EH 1V2UT 4FETA 1C5XB 1O2HA 2CGAA 1TALA 2C90B 1MBMA 2HNTE 1KTSB 2Y5HA 1GGDC 1FY5A 3K2UA 1SLWB 1QBVH 3TITA 1A0JA 3KF2A 2O9QA 2FLBH 1F92A 4FUCA 1NM6A 3PMBB 2G4UA 2FOFA 3UNQA 3T2NA 3NZIA 1NBMD 1C1VH 2PHBA 2GMTC 3RXHA 3LDXH 3SGAE 1DWBH 4RN6A 1Y3UA 2AMDA 1BUIA 5FAHA 1NRSH 3SU1A 3ZZ4A 1CSOE 1H8DH 3MH5A 4MVNA 2Z9LA 1BRAA 1GJAB 2BVXH 6ESTA 3SI3H 2Y5GA 1L1NA 1E36B 1K1MA 2JDID 3IITA 3MOCA 5EJZA 3SV2H 2O8WA 1BTXA 3BG4B 3LPRA 4CH2B 3RUOA 3H5CB 1S6HA 1UVSH 2WZQA 1W0YH 2BDCA 2G52A 3EGKH 2HPPH 3TK5A 1X7AC 4X1RU 1ZPZA 4A1VA 2JKHA 1CBWC 2ZTZA 1QRZA 5DP3A 1TPSA 3PRBA 1SGNE 1S0RA 3AASA 2BDHA 3VXFH 4E06H 1HBTH 3TLOA 1QJ1B 3U8TH 1O36A 2FOMB 1W8BH 3T28A 3KHVA 4Q80A 1UVUH 1S81A 4CRCA 4U32A 2BX4A 4FVBA 4MPUA 1TGBA 4ZHLU 4GPGA 1O5CB 3L3TA 2F43B 1SLXB 3E16B 1UTKA 2ALPA 1EXFA 1HAVB 3IG6B 4Q2KA 1QTFA 1P11E 1DOJA 4I33A 4CR9A 1O5FH 2VINA 4VGCC 1YCPM 5A8XA 4X2XA 1IQGA 3S9CA 4F55A 4JYTA 5F03A 1SQOA 3QWCH 1GHWH 4DVAU 1OWKA 1RIWC 3MH7A 1ZSJA 3MU4A 1G30B 3FAOA 1W3CA 4TSFD 3UTUH 3SNAA 2IPQX 1BT7A 1ZTJA 4A92A 3RM2H 1QBNA 2QF5A 1W10U 1AHTH 1LKAA 2SGFE 2AYWA 2PTNA 3P8OA 1T8LA 2BD4A 2FM2A 3AW0A 3W95A 3A81A 4ZUHA 4ABGA 1KLIH 1TYNA 2ODPA 1CGHA 3DT0H 1P04A 1O3OA 1CO7E 1HAOH 2GMTB 2BLVA 2UUJB 2FESH 3BSQA 1O3GA 2A31A 5T6GA 4MDSA 4ACBA 4RT1A 1V2JT 2C4FH 5E2PA 4SGAE 1QJ7B 1HXEH 1LQEA 2ZFPH 3CNRA 1W14U 1C5WB 2AH4X 2KR7A 2ESTE 1AIXH 2QIQA 2XBVA 5DP4A 4AFUA 1P8VC 1OHHD 1VCWA 2H5CA 2P8OC 1D9IA 1ELEE 1FY1A 2P94A 5DGJA 4YT7H 1P12E 2XWAA 1TNKA 4TYDA 2ULLA 1CT2E 3S7KB 1ZGIA 1O2LA 2W6ID 2VIVA 4ISLA 3TJNA 4ISIH 5C3NA 1O2XA 2C8XB 3BF6H 4KGAA 2R0KA 1BTYA 5EW1H 4YXWD 1SL3A 1MUEB 1O2UA 3FP8E 1OS8A 3FZDA 2Q1JA 4D7FA 1O2KA 5EJ1A 4B2BA 1GMHG 1TBQH 4JYVH 1GBAA 3SUFA 3GS9A 2GP9B 2IPHA 2H9TH 2W5EA 2R0LA 2W7SA 1BIOA 5JBBS 2D26C 1NROH 3PMAB 3VGCC 2OINA 3A80A 4DJZB 2KCOA 1O37A 5T6FA 5SGAE 3JZ2B 5GXPA 4ISHH 1P05A 1C1TA 1PYTD 2J4IA 1TX6A 1ZRKA 3ZZAA 2GKVE 1C2JA 1QHRB 1C4Y2 1EOLA 1ZZZA 1DVAH 3RM0H 4UFGH 2SGAA 1CHGA 4K1EA 2GDEH 1P3CA 4ABDA 4XOJA 3RLWH 3SUEA 2B7DH 3QGJA 2PTCE 1ZMNA 3EQ0H 1GL1A 2ZU1A 1B7XB 2WV5A 4MQAA 4B1TA 3BTHE 4I7YH 2ZQ1A 2HVYB 4D76A 4CRBA 3H7TA 1W11U 2L74A 3I77A 2ZGCA 3MU0A 1GJ8B 3DUXH 4OS4A 1IQIA 3F9HA 4GCHG 1SQAA 1ZJDA 1C5MD 4Q7ZA 1RJXB 4Y0ZE 1TGNA 3Q3YA 5H4IB 1J17T 2BY9X 4K8BA 2FOBA 2FOGA 1OOKB 1GGDB 3ZV9A 3U69H 2F9UA 1O2MA 2A5AA 4ABBA 2ODYB 1G3DA 8LPRA 2H6MA 1O5BB 2OC1A 5EGMA 1AE5A 1ESTA 3B23B 2Z9KA 2WINI 5F8XA 1SBWA 1RXPA 2KCPA 2LP6A 2A4OA 3RU4T 3L6PA 1K1OA 5EQRA 2BLOA 2R3UA 2QY0B 2BD3A 3M7QA 3E3TA 4X8UH 1ANBA 3RXVA 4D7GA 1CA8B 1TRMA 1OKXA 3SQHE 3NK8A 4ZKOU 4BTIB 1J9CH 2PGBB 1HAPH 5HGGA 2GVFA 1TA6A 1XKBC 7ESTE 3A8BA 4BNRA 3RU4D 3CS7A 2ANYA 2QA9E 3M35A 4JZFH 4XDEA 4OGXA 4Z1MD 5GCHF 1GBKA 4A6LA 4ZXXH 3A83A 4F4OC 3RMOH 5T1VA 1W13U 2G81E 1HIAB 1HYLA 3O8DA 1O3BA 3M37A 2GCHF 2OC0A 3RMMH 1BHXF 1MD8A 1CHOG 3SNCA 1A61H 1P2OA 4AB8A 3RXRA 4I8KA 3T5FH 1A4WH 2OCVB 1DSTA 1F0TA 1V2LT 1L4ZA 5A8YA 3P17H 5C5NA 2VIPA 4XSKU 3P8FA 2VVUA 1O3IA 3F68H 2Z6BD 3ZVDA 2C3SA 2AMPA 4XE4A 1HAIH 3OEED 1UHBA 2VH0A 1UK4A 2OC7A 1QNJA 5CDFE 2H9HA 1O2TA 2ZU4A 1G3BA 3HKJB 1ZYOA 3RXMA 1YLNA 2QF4A 5KECA 1D6RA 1J14A 4VGCB 4WXIA 5G4BA 3MO3A 2A4RA 1UTLM 4ABJA 1E35B 3H7OA 3SV8A 4ABIA 2UWLA 2XW9A 5C94A 3PM3A 5DSFA 2GCTB 1DE7H 3VB3A 2VGCC 2ZDNA 4WXVA 3V3MA 1DWCH 1ZHMA 3UUZA 1ETRH 1TGSZ 4B75A 1C9TA 4Y7AA 3K6YA 3VB5A 1SKYE 3AVZA 1J16A 4HGCA 2FX6A 1C5TA 2VJ1A 1GG6B 3KEEA 1F5KU 1WTHD 1ZSKA 5EODA 4DG4A 1J8AA 1O2PA 3EE7A 2F9PA 2THFB 1LTOA 1GBMA 1QB6A 1C5VA 3SHAH 1O30A 2Z9IA 1Q31A 2JH6D 4O3TA 5GPIB 4CBOA 1QRWA 1CT4E 2FS8A 1C5NH 2ALVA 4NFFA 3ZVGA 1DY9A 1ELGA 3QO6A 2WHXA 1Y5AT 3PLPA 1EZUC 1VZQH 1A3EH 4IBLH 1F0RA 2ANWA 5LGOA 4I8GA 3F1SB 1V2QT 1YPHE 2ZGBH 3SU5A 3PYHA 1GVKB 1HAVA 1EJNA 1LHGH 4OGYA 3UQOA 5I46H 5FPYA 1C1PA 3QDZB 2F9OA 1TRNA 1P01A 2VWOA 3TGKE 2WSSD 3LT3A 4Y7BA 1QA7A 3F0PA 1GWAA 1O2IA 1SGDE 1AQ7A 1GCTB 1YF4A 2ZCLP 4B6EA 4UD9H 1GDNA 3KQEA 2NWNA 3ZZ6A 1FUJA 3DCLA 4Y0YE 1TB6H 1XX9A 5JPMH 1XUKA 3TJVA 2DE8A 1JRSA 1AFEH 1TNIA 3ZV8A 3MNXA 1HIAA 4LZ1H 1DSUA 2V3OH 2BY5X 3KQCA 4IC6A 1RTLA 1C9PA 4JYUH 2A32A 1WAYB 1SGCA 2XBXA 4RSPA 2ZU2A 1E38B 2Z3EA 1DICA 2BX3A 4R0IA 1THSH 3G01A 1OSSA 2RA3A 4U2WA 2H1UA 7GCHG 2GV6A 3GCHC 3STIA 1UTQA 1C2GA 1GI8B 1C2IA 4AFSA 4B76A 3O8RA 3Q3XA 5DKMA 1O3AA 2XTTB 3T25A 1O3JA 3P70B 1GJ6A 1H8ED 1O39A 3UFAA 3ZVCA 2JJ2D 3RMLH 1QZ8A 1GCDA 1YWUA 3M5NA 1DWDH 1VJAU 2V3MA 1F2SE 2W7UA 3ESTA 3GY5A 2OXSA 1C2FA 1K1PA 1YCPH 2Y80A 1G37A 9ESTA 3URCA 3QZRA 1AUTC 4I32A 3RP2A 1TPOA 2UWPA 2OQUA 4B2AA 1YPMH 1GG6C 3BG8A 2FI5E 2M5TA 3R0FA 2ZKSA 3BEIB 2PR3A 4FUHA 1CHOF 4NIWA 1L1GA 3UNRA 4NSYA 1JIMA 1OWIA 1CA0C 1HGTH 2QXHA 2XXLA 1DLKB 3LGYA 5K0HA 1MAYA 5EPNA 1MD7A 2G00A 5E0JA 4BAQB 2XBWA 5E0HA 1UVPA 3TGIE 2EQNA 2G5VA 4ASHA 3N7OA 1SMFE 3PO1C 1HUTH 3DSOA 4D8NA 2RDEA 2L6OA 4JZEH 4QT8C 4OS1A 1NFXA 2JJ1D 4X6OA 2JETC 1LMWB 2FS9A 5A2MH 1ANEA 3A82A 3MO9A 1OX1A 3PRDA 1E1QD 2Y82A 1ABJH 3SZEA 3UY9A 4CRGA 1HAHH 1T8NA 4NCYA 1BRCE 4FUDA 3AW1A 5IK2D 1S83A 1DXWA 1FPCH 1EZXC 3NKKA 2Z3DA 4CHAC 1LVOA 4NG9H 8KME2 1GHVH 1DY8A 2HNTC 1AB9B 1P09A 4WMEA 2P95A 4ZKRU 3MO6A 1O2WA 4O9VA 2HVXA 1AO5A 4Y10E 4INKA 5FBIA 3TK6A 1MAXA 4F49A 2XCFA 4LZ4B 1HJAC 3RC4A 1AZZA 1BJVA 2ASUB 1FIWA 1BQYA 3PMHB 3PTBA 4KELA 1B0FA 2TPIZ 4GVUA 2AMQA 1P06A 4I8JA 1GCTC 5DP6A 2TBSA 1XMNB 1Y3YA 1GHBG 1OWJA 1IAUA 1WOFA 1FONA 2OTVA 4ZH8A 3RU4E 1FMGA 8GCHG 4BANB 4X1SU 3STJA 5C2ZA 3ZZ5A 4YTAA 2WPDD 1C5QA 8ESTE 1C1OA 1AVWA 1P10A 3D65E 2STBE 1GHAG 3LU9B 1SFIA 3K65B 3S69A 1GDUA 3OTPA 2BVSH 1O5GH 1QJ6B 3PWBA 3RXBA 4IW4E 1PPGE 1BTPA 1QL7A 3SNEA 1D3PB 4XBDA 1G2LA 3QUMP 5FX6A 1O2YA 4K3JA 1ZR0A 1C5UA 2BDGA 2A2QH 2RG3A 2XCNA 1TPAE 4WH8A 4K2YA 3A7TA 5HIZA 1QGFA 1QY6A 1Z1JA 1SHYA 1GVLA 1HLTH 1P9UA 1GI7B 1QFKH 1MCVA 1EASA 2RA0A 2XC0A 3AAVA 1J15A 1FIZA 4INHA 1TNJA 2QXIA 4HTCH 6GCHF 5DJ7A 3RXQA 3M5OA 1SLVB 4TY6A 4LK4A 1UK2A 2JETB 1SGPE 2VBCA 1IHTH 5AHGH 1BTWA 2P93A 3ZYEA 1K21H 4JK5A 2WPLS 3OX7U 3U8RH 4YOJA 3GCOA 3RXEA 1ELVA 1A0LA 3F9GA 4ABAA 2A5KA 4INLA 3MI4A 1GL0E 3H09A 1W7GH 6CHAB 2QYIA 1GHZA 4NIYA 3LKWA 1UVTH 5CE1A 1D3TB 2SGPE 2TGAA 3QK1A 1SOZA 2FODA 4B6FA 5DG6A 1DITH 5C17A 1T4UH 2XNIA 3M5LA 1A0HB 1AZ8A 1SGYE 1BMAA 2J9NA 2ZTYA 3NPSA 2I6SA 4ZROA 1SC8U 1HJAB 4ZHAA 2EY4C 4AZ2B 3SUGA 4K8YA 1HXFH 1TX8A 1F0SA 1E37B 1WBGB 3VB6A 1SGFA 5E0GA 1UTJA 2FI4E 1CQQA 1ZHRA 3DHKH 1YY3A 3RXDA 3GICB 4IMQA 1ID5H 4JMYA 1BBRH 3GDVA 4OS2A 1PQ8A 1D3DB 4AGJA 2GCHG 4AB9A 1YPEH 1JOUB 2ZFFH 1T7CA 3RXIA 5LPFA 3GY3A 3JZ1B 1MMJN 2KX4A 5A0AE 1LVYA 2I6QA 1ZGVA 2KCAA 1ELCA 1S85A 2VH6A 2YOLA 4JCNA 2W3IA 5HXFA 3SJKA 1NZQH 4MNYA 2W3KA 1FN8A 1GDQA 2BMGB 2ZNKH 4UFEH 2TIOA 3BTKE 1K9OE 2C8ZB 4MNVA 3IWMA 4FUIA 1PQ7A 5LH8A 5JBTA 3VEQB 1BOQA 1HAYB 2GV7A 4TT3D 2QGRA 2CHAC 5C5OA 1TGCA 2HOBA 1MKXH 3PB1E 1LHDH 2V3HH 2W26A 2PLXA 3E8LA 3MH4A 2PKSB 4Z6AH 4I86A 4Y76A 2G4TA 1SG8B 3A7WA 5GIBA 7GCHF 3BTWE 1CE5A 1UTNA 3BIVH 1HAZB 2OD3B 4IGDA 1NO9H 2FP7B 1ZJKA 3EA7A 2DUCA 3M5MA 1RGQA 1A2CH 1C2DA 3A7XA 4AGKA 2ZFQH 1C1UH 4AOQA 3UWJH 1ARCA 4RKJB 3N7DA 2AGGX 2GDDA 4HZHA 2C93B 1BA8B 3UR9A 1V2ST 1MZDA 3RXUA 2SNWA 2QF0A 3DA9B 1NT1A 5DP8A 1JBUH 1B0EA 2BM2A 2OP9A 3S9BA 3BTME 5GDSH 3BN9A 1YM0A 3T27A 2BD9A 3TH3H 1UW7A 5ESTE 5FCRA 4NSVA 1ZRBA 1OWDA 2PGQB 1WSSH 1K2I1 3GY2A 1GHXH 5A09A 1ORFA 3SV9A 3MFJA 2VVCA 2YMSB 2HRVA 4K1TA 1ETTH 5AFYH 2ZZUH 3QZQA 5FPTA 3TPIZ 4ASUD 1Y5UT 1GHYH 2G8TA 2QF3A 5DP9A 2A45B 1GMDG 3VB7A 3C27B 3FVFB 1G9IE 1H1BA 3DFJA 1HAXB 1LCYA 2UWOA 3TK9A 2BYAX 1IQLA 3FO8D 3NWUA 3T26A 2BXTH 1XVMA 2BDYA 4ZHMU 1GI4A 3ZVBA 1LO6A 3HGNA 1LHEH 4ZXYH 2NU0E 1SGFG 2KM0A 2AGIX 1Z8RA 5EG4A 1C1RA 2TRMA 1TBZH 1ELAA 3QTOH 1JIRA 1UMAH 1GJ9B 1PQ5A 2B8OH 4H6TA 3SN8A 4NZQA 4ZMAH 3KN2A 2VWNA 1EP5A 1NU9A 1NRQH 3FZZA 1O3LA 1O3KA 3QX5H 3GY7A 4BXWA 1T8OA 1XUGA 2V0BA 1D4PB 5EW2H 2EI8A 3GYLB 5L2YH 1E0FD 1EFRD 1MKXK 4B74A 4ACAA 1YGCH 2BLWA 2J98A 3MHWU 1WV7H 2VWLA 1AWFH 4UDWH 4E05H 1PPHE 3D23A 3UAIC 1C5PA 1AN1E 5JYIA 1MZAA 3WY8A 3A8DA 3EYDA 4MPVA 1A3BH 5DP7A 5HIYA 1SB1H 1VITH 5EIYA 2C8WB 4X1QU 4ABHA 2CMYA 2FOAA 3P92A 4NZLA 1V2RT 4CBNA 1P2JA 1SQTA 3ZZ9A 2ZCHP 1RFNA 1AUJA 3SUDA 4O03A 1K1JA 3BTEE 3P8GA 2ZGJA 5C1XA 7KMEH 2D1JA 2A1DB 2F3CE 3A7VA 4B2CA 1EAXA 1FAKH 2PUXB 1O0DH 2ZA5A 2P3TB 4X2YA 5FL7D 5C0UA 1G32B 5ETXA 3VGCB 5IDKA 1MQ6A 1N6XA 3HK6B 2GZ9A 1EUFA 1TQ0B 2Y7ZA 5EJLA 5TCCA 1NESE 5B6OA 1OWHA 1K1NA 2R2WU 2IJD1 3BTDE 4NA7A 3U1JB 2ZGHA 5HM9A 1NU7B 1UJ1A 5B6LA 1GHBF 4FXGH 3MTYA 1O3CA 1QCPA 1NPMA 1GI5A 1IQNA 4XFQA 1P2IA 4BAOB 1QB1A 2GCTC 5I25A 1UCYK 4K1SA 3A87A 3TNTA 1MTVA 3V13A 1FX0B 2QV1A 1NRNH 5IYTA 4JZIA 4FUGA 1VCQA 2ZFTA 3M7UA 1MH0A 1FZZA 1DANH 1MTUA 1LVMA 2GD4B 2Z9JA 2A7CA 4Y79A 6CHAC 1IQKA 1SI5H 2JH5D 3RXAA 1V6DA 4LXBH 1O2JA 1K28D 3LC5A 4CREA 1Z8JB 1CT0E 2QN5T 2CF8H 3SJIA 5L30H 4Y8YA 2ZDVH 1Z7KA 4K60A 7LPRA 2F9BH 2D8WA 2J38A 1DLEA 2BD8A 2HWLB 2PKAB 4CR5A 3A86A 1C5YB 1HPGA 3MU1A 2QE7D 3BV9B 2HLCA 5DN6D 1ZPCA 4Y11E 5HMAA 2GGVB 1EKBB 3RXKA 2XNDD 1WDIA 1Y5BT 1QURH 3F9FA 2VWMA 3GCHB 3GCTG 2GT8A 1GBHA 2ZDMA 3SU2A 4BXSA 3LGWA 5A0BA 3BTGE 3TVJB 8GCHF 2Z3CA 2P16A 1ZHPA 3A8AA 4HG6A 4U30A 4GHTA 1AKSA 1M9UA 1GBDA 1UHBB 1C1SA 2FI3E 2Y7XA 4YT6H 4ESTE 4X2VA 2Z9GA 1HAGE 1V3XA 1YKTA 2BD5A 1T32A 2ZQ2A 4IC5A 2F83A 2YNBA 1DT2A 1TLDA 2ZF0H 1EJMA 1UTOA 1K1LA 1VITF 3RC5A 2EA3A 4UONA 2ZU5A 1YC0A 1YBWA 1GI2A 3GY4A 2WYGA 4BAKB 1OP8A 1IQMA 1XXFA 4JZDH 1THPB 1RTFB 1FPHH 1TWXB 1S0QA 3OY6U 3BG4C 1GPZA 2PV9B 3F6UH 2BTCE 2G55A 3OU0A 1EPTA 1BITA 2XBYA 4WVPE 2OUAA 2CF9H 1ESAA 3EA8A 3KQBA 3BTQE 2C8YB 1GI6A 1PPBH 1C5RA 1JRTA 5J4QA 1GJCB 1YLCA 3LH3A 5L2ZH 1XUIA 2BLQA 4YLUA 4GAWA 1BTHH 3ATLA 1C1NA 1EX3A 3URDA 3HATH 1BMMH 1TOCB 1ELBA 3W94A 4GUXA 1BTZA 1P2KA 1ZSLA 1TNLA 1YPLH 1G2MA 1UCYH 1DWEH 1HDTH 1DX5M 2DE9A 2CJIA 3TGJE 1ESBA 3RXTA 4YESB 1C1QA 1V2NT 1Z8IB 4MPWA 3ZYDA 1SGTA 2ZGXH 4FUEA 1C5SA 1BMLA 1GBEA 3LGVA 4B73A 1SR5C 1ETSH 2K8IA 4F48B 4X6NA 1OYQA 2TGPZ 3SU4A 3V7TA 1C2HA 1DS2E 2BZAA 3EE0B 4KKDA 3UR6A 3DFLA 3SGBE 2ANMH 2FYRA 3BIUH 1C5LH 2LPRA 3UOPA 5C20A 1ANCA 1AI8H 1FNIA 4X8VH 4ZAEA 2PSYA 3PO1B 5FXLA 5TCAA 2VVVA 1PPCE 1IQJA 2BD7A 2Y81A 4GHQA 4J2YB 4O3UA 3SJOA 2ZHQH 4Y6DA 2XYAA 3OY5U 3WW7A 2PWXA 1SLUB 2BY7X 3U98H 3UNSA 1SGRE 1BCUH 1PPFE 3BTTE 1C4U2 4TWWA 4P00A 2EI7A 1MTNC 3I29A 1WTGH 4CRDA 4X8TH 2F9VA 1IQFA 1AU8A 1TQ7B 1TFXA 4GLYA 2F4LA 1AE8H 4WWYA 2VIWA 3F0OA 3Q77A 4TPYA 2OLGA 1NC6A 3QLPH 2WUBA 4DGJA 1O3DA 4FUFA 2PSXA 4NGAH 2TGTA 1EATA 3M7TA 3BTFE 2PUQH 5FHTA 1AY6H 4J1YA 4XRNA 3TNSA 3ZZ3A 2ILNA 2A5IA 2XC4A 1DXPA 3CS0A 2F9NA 3ENSB 3W1EA 1COWD 1V2PT 5GNDA 1HJ8A 2CXVA 5JDUB 1E79D 4Y71A 3MU5A 1XXDA 1JWTA 3KYFA 2XRCA 1AWHB 4KTSA 2FOHA 3MMGA 1JMOH 2BHGA 4AYYB 5DO4H 3AAUA 4AG2A 2G51A 4I8HA 2KZ4A 2P3UB 3OEHD 4I8LA 4BTTB 2VIQA 4YO9A 3RXPA 1GJDB 1YPGH 5F53A 1P3EA 1SPJA 2Z7FE 2IJOB 1WCZA 3TJOA 1N6YA 2SFAA 2D2DA 1LHFH 1GJ5H 1NN6A 1E34B 1QIXB 4AG1A 3A89A 4K69A 2AERH 1W0JD 4OS6A 3MU8A 1O31A 2ZP0H 3LIWA 3UWIA 1NFYA 2R9PA 4UEHH 3ZZ7A 1IOEA 4D9RA 3O8BA 1NRPH 2ZDKA 3CP7A 2G5NA 1CU1A 4MPXA 1YLDA 2EI6A 4CRAA 2J2UA 2ZHEH 4DIIH 1O3HA 1TABE 2HALA 1DDJA 4B71A 1VGCC 4A1XA 1P2NA 2UUYA 1OWEA 1H8IH 5DP5A 1GBBA 3GDUA 3B9FH 5K7RA 4YOGA 1PJPA 3RXOA 1HFDA 4ABFA 2J98B 3OYPA 2IN2A 3GCTF 3U1IB 2OC8A 3MH6A 4NIVA 1QRXA 3VPKA 3ZVAA 5GWZA 4BOHA 2FO9A 2GZ8A 2NU1E 3LONA 3MNCA 3FP6E 6LPRA 1MKWH 3V0XA 4M7GA 2A7HA 2O8LA 1MTWA 4JZ1A 2ZTXA 4AFZA 3E0NB 1OP2A 3SGQE 1WXRA 1UVOA 3EDXB 1EB2A 4AFQA 2Q6FA 2ZHDA 2H9EH 4DW2U 1FY3A 1LKBA 2BDIA 3B8JA 3FN8A 1YPKH 5L6NH 2EEKA 3U9AH 1UTPA 3ZZDA 1IQHA 1XKAC 2RCEA 4BAHB 3MQKC 3KIDU 4Q4LA 1MTSA 5DK1A 4IN1A 2V35A 2P8OB 4DY7B 1TX7A 1EPTB 1LVBA 2K0QA 2FMJA 3UIRA 1F5LA 1MTNB 4IMZA 2AS9A 3F2HA 1RD3B 3E91A 1YCPK 4JK6A 1TRYA 2EC9H 1O5AB 1XUJA 1Y3WA 3FFGA 2PKSC 3QTVH 3A85A 2FPZA 1O3FA 2FOEA 4NWLA 3VFEA 5JB9S 1FV9A 5F6MA 1H9IE 3ATWA 2BY6X 1S82A 1D6WA 1H8HD 1V2WT 3HK3B 5HYOA 5DPAA 4OS5A 4KP0A 2ZECA 3E6PH 1TE0A 1MABB 2WUCA 1FJSA 1EAWA 2LELA 1O3EA 1ELFA 1G3EA 3P6ZB 1TNHA 2BY8X 1LHCH 1L1JA 5JB8S 1Z8GA 1W0KD 1HV7A 5CHBA 2BOKA 1AKSB 2A0QB 3A88A 3PV2A 2SGDE 1MCTA 1GI3A 1P02A 3FKSD 1C2LA 1TGTA 1FI8A 1YYY1 1QR3E 3E0PB 3Q3KA 2CHAB 3M61U 2GJGA 1MQ5A 4PROA 3S9AA 1GHAF 1SGEE 2SGQE 1BMFD 3LGTA 2FWWA 2WPKS 1JXPA 1EZSC 1VGCB 1W2KH 1Z6EA 1Y3VA 1CA0B 2AGEX 2ZO3H 1TMBH 1TPPA 2HLDD 2AEIH 3Q00A 1OYTH 3EA9A 3SYJA 4UFFH 3ZVFA 1KXDA 1BJUA 3QGNB 3M36A 1KY9A 2BXUH 1V2OT 4NA8A 4GSOA 1C1WH 1EAUA 3RXJA 3RXLA 5C1UA 4WJG2 1HJ9A 4X8SH 1DUAA 4Q63A 4FUJA 1O2OA 1GBFA 5C1YA 5EPYA 2AIPA 1NY22 2CN0H 4YM9A 1BZXE 3SV7A 1K0HA 1NS3A 2M2AA 1PPEE 1O2GH 1UTMA 1Q2WA 1C2EA 1GMHF 1EB1H 4Y8XA 1WUNH 1Y8TA 1QQ4A 1THRH 1NFUA 1H9HE 2VNTA 1BB0B 1A46H 3VB4A 4OM9A 2IOTA 2FX4A 2HPQH 4WMFA 5CHAC 1TNGA 4Z0KA 1Y59T 1MU6B 4X6PA 1EZQA 2F91A 1OXGA 3PLKA 1SVPA 1A1RA 4X6MA 2YMSC 3DSPA 3ODFA 1AB9C 5EOKA 5KGOA 1O2SA 1O3NA 1EJAA 1RIWB 4MTBA 1C4V2 1A5GH 4SGBE 1O33A 3RXFA 1TMUH 4AX9H 4THNH 1W12U 4DCDA
chains in the Genus database with same CATH topology
2AIQA 3MWIU 1VITG 1BTUA 1PPZA 3E90B 2ODQA 5AF9H 1VCPA 2ZG0H 2V6NA 3TIUA 1O32A 2J94A 5EQSA 5ESBA 1P2QA 3BEUA 5HM2A 3SJ8A 3MNSA 1QBOA 4H6SB 2BQWB 1Z71A 2KAIA 1UCYE 3SI4H 1P03A 2J34A 3GY6A 3KL6A 4Y8ZA 2ZWLH 1QQUA 3T29A 4WY3A 5EXLA 1GJ7B 1KXFA 1KDQA 3L33A 5EXMA 1KLJH 3F9EA 5F8ZA 1ABIH 5FBEA 2ANKH 4O97A 1ANDA 1AFQC 1K22H 4IN2A 2NU4E 1F7ZA 3UQVA 2GX4A 4E7NA 2ZDLA 2A7JA 1TAWA 1TONA 2VB0A 3VXEH 1O35A 1EAIA 2ZFRH 1BDAA 1Z1IA 1RS0A 3DD2H 1O2ZA 3KGPA 2PFEA 9LPRA 2TGDA 1DPOA 4YOIA 5FCKA 1K1IA 4A7IB 3GISB 3PMJA 5A8ZA 2UUFB 3TH4H 5JBAS 4E7RG 2FDAA 1GBJA 4MLFB 1LQDB 1S5SA 4DIHH 1HB0B 3KQDA 5E2OA 1L0ZA 2Q6GA 2ZIQH 1ACBE 3A7ZA 5GCHG 1ZPBA 1TOMH 4WMDA 1TMTH 2ZPRA 2O8MA 5A0CA 1L4DA 1HNEE 3HKIB 4YZUA 6GCHG 1V2MT 4DOQA 3SORA 1MU8B 3LGUA 1ELTA 3C1KA 1SOTA 3P8NA 2BD2A 4CRFA 1SSXA 3LC3A 3UPEA 3T62A 1KSNA 1L2EA 2XWBI 2OQ5A 3K6ZA 3QN7A 1YPHC 2VIDA 2P59A 1MKWK 1BRUP 4UE7H 1GJ4H 4MG3A 3LJJA 4X1NU 2ZDAH 1Y3XA 3EAJA 5TJXA 1XUFA 2WPMS 3SQEE 3OSYA 3SJ9A 2ZHWH 2WPJS 4R8TB 2GTBA 1AVXA 5CHAB 3GYMA 4HFPB 1BMNH 1D3QB 4X0WU 3KNXA 1GMCF 1W0ZU 4HI3A 1ZOMA 4FUBA 2FLRH 1SFQB 2AFQB 3PROA 1PYTC 3SU3A 3ZZ8A 1DM4B 1O2RA 1VR1H 2B9LA 2QCYA 3U8OH 2ZCKP 4UFDH 1C2KA 1LDTT 5GJ4B 3UREA 4ISOA 3D49H 1O2QA 4WF8A 1QL9A 1GBIA 1F0UA 1WYKA 1S6FA 2ZEBA 5AFZH 5EQQA 3A7YA 5C67A 2XC5A 3SNDA 4NWKA 1WQVH 1S84A 3GOVB 1H9LB 1KTTB 4ZKNU 1ZTKA 3LH1A 4H4FA 3NUMA 3PWCA 1ZMLA 1N1LA 1T8MA 1W7XH 4IS5A 4K5ZA 3BEFB 4FU7A 1AGJA 2H5DA 2ZU3A 2BOHB 1FDPA 4XBBA 1QL8A 3HPTB 3R3GB 1UK3A 2OBQA 1T4VH 2FXRA 5CMXH 2BQ7B 1LPKB 2SNVA 3P95A 4YLQH 1UO6A 2Y5FA 1INCA 3SU6A 4U01A 2FEQH 1KYNA 2B5TB 2HNTF 3TU7H 3D62A 3O8CA 1AVGH 4BAMB 1CGJE 1SHHB 3RXSA 1N8OC 1EP6A 3S7HB 1VJ9U 4XBCA 4FU8A 1FQ3A 5FX5A 2FTLE 2WPHS 1LPZB 5AVDA 1BHXB 4TY7A 3UOUA 1AD8H 2FYQA 2A4QA 4X2WA 5EXNA 1O38A 1GI1A 3GDSA 4FVDA 1LPGB 3PLBA 5T3HA 1HRTH 2Y6TA 4OS7A 3E1XB 1BRBE 2SGEE 4CH8B 2UUKB 2ZHFH 2BB4A 1EOJA 3SU0A 3FP7E 1BBRK 1CVWH 3ATIA 1FY4A 2BZ6H 1KDQB 3A84A 1Q3XA 3RDZA 3ATMA 5T6DA 3A8CA 2H2ZA 2QXJA 3RLYH 1GI9B 1TIOA 1QB9A 2BDBA 1OPHB 2Q6DA 2VGCB 1TA2A 3ATKA 1V2KT 3SNBA 1C5ZB 1DUEA 2PKAA 2R3YA 2WV4A 3RXGA 3ZZBA 1YPJH 2CV3A 1C2MA 4NA9H 3SZNA 1QA0A 1SGQE 3CENA 4AN7A 3ODDA 3HGPA 4CHAB 4ZKSU 5LPRA 2JH0D 1F5RA 3K9XB 1O3MA 3RC6A 1GMDF 1KXBA 5EU8A 1A5IA 4GCHF 3SW2B 1HCGA 5J4SA 2WPIS 4I31A 1NFWA 1FLEE 4A5TS 1RRKA 1V2VT 1FY8E 2A4GA 1XUHA 2ZC9H 4A1TA 2WYJA 1OP0A 1ARBA 2VIOA 2FTMA 1MBQA 5FPSA 1CGIE 3ITIA 2FZZA 4Q7XA 3GY8A 1H4WA 2FIRH 3ZVEA 3NCLA 1GBCA 1O2NA 4WH6A 4DT7B 2GZ7A 1SGIB 1ZMJA 1AFQB 3V12A 4MNXA 4H42U 1GVZA 3M3TA 1V2TT 1IHSH 1WQSA 2R2MB 4NIXA 1FN6A 1KXEA 1A5HA 3LJOA 2PW8H 1AMHA 4Q7YA 3TH2H 3GCNA 1DFPA 1O34A 2O8UA 5BRRE 4TWYA 4AYVB 2GT7A 2ZPQA 1ZLRA 1GI0A 1GJBB 1P9SA 3M3VA 1O3PB 4RKOB 2KAIB 1U6QA 1WU1A 2YNAA 2ZPSA 1P0SH 1NRRH 2BVRH 1KLTA 1O5DH 5BPEA 2J92A 5LPEA 2QAAA 1NTPA 2BDAA 2FOCA 3TJUA 5ABWA 3M3SA 3MYWA 1O2VA 3LOXA 2J95A 1P57B 2NU2E 2O8TA 4LOYH 4TPIZ 2HGTH 1KXCA 5E8EH 2B0FA 1A7SA 4ABEA 5JBCS 3I78A 1EQ9A 3MNBA 1RTKA 3S0NA 4AORA 2Z94A 1CBWB 1C5OH 1GBTA 4MNWA 1XVOA 3RMNH 3SHCH 2P3FH 4D9QA 2K1QA 1N8OB 3PTNA 1C1MA 1ELDE 3NXPA 2RDLA 1TBRH 1G3CA 1XM1A 5F8TA 2NU3E 3ELAH 3RXCA 1FAXA 1GMCG 1FXYA 2STAE 4NFEA 1YP9A 3PV4A 4DURA 1PQAA 3SOSA 1KXAA 3FANA 4KTCA 1BBRE 3LGIA 2ZFSA 4ISNA 3Q76A 2VU8E 1P2MA 4X1PU 5PTPA 4KTUA 1IQEA 2QXGA 3SBKA 1KIGH 1B5GH 1PFXC 2A2XH 4BTUB 2OBOA 1Z6JH 1T31A 2LNCA 1G36A 1EPTC 3KCGH 3OTJE 1GBLA 2BQ6B 1ZTLA 3SV6A 3SO3A 3ZZCA 2QC2A 2ZI2H 4FU9A 1O5EH 1V2UT 1C5XB 1O2HA 2CGAA 1TALA 2C90B 1MBMA 2HNTE 1KTSB 2Y5HA 1GGDC 1FY5A 3K2UA 1SLWB 1QBVH 3TITA 1A0JA 3KF2A 2O9QA 2FLBH 1F92A 4FUCA 1NM6A 3PMBB 2G4UA 2FOFA 3UNQA 3T2NA 3NZIA 1C1VH 2PHBA 2GMTC 3RXHA 3LDXH 3SGAE 1DWBH 4RN6A 1Y3UA 2AMDA 1BUIA 5FAHA 1NRSH 3SU1A 3ZZ4A 1CSOE 1H8DH 3MH5A 4MVNA 2Z9LA 1BRAA 1GJAB 2BVXH 6ESTA 3SI3H 2Y5GA 1L1NA 1E36B 1K1MA 3IITA 3MOCA 3SV2H 2O8WA 1BTXA 3BG4B 3LPRA 4CH2B 3RUOA 3H5CB 1S6HA 1UVSH 1W0YH 2BDCA 2G52A 3EGKH 2HPPH 3TK5A 1X7AC 4X1RU 1ZPZA 4A1VA 2JKHA 1CBWC 2ZTZA 1QRZA 5DP3A 1TPSA 1SGNE 1S0RA 3AASA 2BDHA 3VXFH 4E06H 1HBTH 3TLOA 1QJ1B 3U8TH 1O36A 2FOMB 1W8BH 3T28A 3KHVA 4Q80A 1UVUH 1S81A 4CRCA 4U32A 2BX4A 4FVBA 4MPUA 1TGBA 4ZHLU 4GPGA 1O5CB 3L3TA 3E16B 1SLXB 1UTKA 2ALPA 1EXFA 1HAVB 3IG6B 4Q2KA 1QTFA 1P11E 1DOJA 4I33A 4CR9A 1O5FH 2VINA 4VGCC 1YCPM 5A8XA 4X2XA 1IQGA 3S9CA 4JYTA 5F03A 1SQOA 3QWCH 1GHWH 4DVAU 1OWKA 1RIWC 3MH7A 1ZSJA 3MU4A 1G30B 3FAOA 1W3CA 3UTUH 3SNAA 1BT7A 1ZTJA 4A92A 3RM2H 1QBNA 1W10U 1AHTH 1LKAA 2SGFE 2AYWA 2PTNA 3P8OA 1T8LA 2BD4A 2FM2A 3AW0A 3W95A 3A81A 4ZUHA 4ABGA 1KLIH 1TYNA 2ODPA 1CGHA 3DT0H 1P04A 1O3OA 1CO7E 1HAOH 2GMTB 2BLVA 2UUJB 2FESH 3BSQA 1O3GA 2A31A 5T6GA 4MDSA 1V2JT 2C4FH 5E2PA 4SGAE 1QJ7B 1HXEH 1LQEA 2ZFPH 1W14U 1C5WB 2AH4X 2QIQA 2ESTE 1AIXH 2XBVA 5DP4A 4AFUA 1P8VC 1VCWA 2H5CA 2P8OC 1D9IA 1ELEE 1FY1A 2P94A 5DGJA 4YT7H 1P12E 2XWAA 1TNKA 4TYDA 2ULLA 1CT2E 3S7KB 1ZGIA 1O2LA 2VIVA 4ISLA 3TJNA 4ISIH 5C3NA 1O2XA 2C8XB 3BF6H 4KGAA 2R0KA 1BTYA 5EW1H 1SL3A 1MUEB 1O2UA 3FP8E 1OS8A 3FZDA 2Q1JA 4D7FA 1O2KA 4B2BA 1GMHG 1TBQH 4JYVH 1GBAA 3SUFA 2GP9B 2IPHA 2H9TH 2W5EA 2R0LA 2W7SA 1BIOA 5JBBS 2D26C 1NROH 3PMAB 3VGCC 2OINA 3A80A 4DJZB 1O37A 5T6FA 5SGAE 3JZ2B 5GXPA 4ISHH 1P05A 1C1TA 1PYTD 2J4IA 1TX6A 1ZRKA 3ZZAA 2GKVE 1C2JA 1QHRB 1C4Y2 1EOLA 1ZZZA 1DVAH 3RM0H 4UFGH 2SGAA 1CHGA 4K1EA 2GDEH 1P3CA 4ABDA 4XOJA 3RLWH 3SUEA 2B7DH 3QGJA 2PTCE 1ZMNA 3EQ0H 1GL1A 2ZU1A 1B7XB 2WV5A 4MQAA 4B1TA 3BTHE 4I7YH 2ZQ1A 4D76A 4CRBA 3H7TA 1W11U 3I77A 2ZGCA 3MU0A 1GJ8B 3DUXH 4OS4A 1IQIA 3F9HA 4GCHG 1SQAA 1ZJDA 1C5MD 4Q7ZA 1RJXB 4Y0ZE 1TGNA 3Q3YA 5H4IB 1J17T 2BY9X 4K8BA 2FOBA 2FOGA 1OOKB 1GGDB 3ZV9A 3U69H 2F9UA 1O2MA 2A5AA 4ABBA 2ODYB 1G3DA 8LPRA 2H6MA 1O5BB 2OC1A 5EGMA 1AE5A 1ESTA 3B23B 2Z9KA 2WINI 5F8XA 1SBWA 1RXPA 2A4OA 3RU4T 3L6PA 1K1OA 5EQRA 2BLOA 2R3UA 2QY0B 2BD3A 3M7QA 3E3TA 4X8UH 1ANBA 3RXVA 4D7GA 1CA8B 1TRMA 1OKXA 3SQHE 3NK8A 4ZKOU 4BTIB 1J9CH 2PGBB 1HAPH 5HGGA 2GVFA 1TA6A 1XKBC 7ESTE 3A8BA 4BNRA 3RU4D 3CS7A 2ANYA 2QA9E 3M35A 4JZFH 4XDEA 4OGXA 5GCHF 1GBKA 4A6LA 4ZXXH 3A83A 4F4OC 3RMOH 1W13U 2G81E 1HIAB 1HYLA 3O8DA 1O3BA 3M37A 2GCHF 2OC0A 3RMMH 1BHXF 1MD8A 1CHOG 3SNCA 1A61H 1P2OA 4AB8A 3RXRA 4I8KA 3T5FH 1A4WH 2OCVB 1DSTA 1F0TA 1V2LT 1L4ZA 5A8YA 3P17H 5C5NA 2VIPA 4XSKU 3P8FA 2VVUA 1O3IA 3F68H 2Z6BD 3ZVDA 2C3SA 2AMPA 4XE4A 1HAIH 1UHBA 2VH0A 1UK4A 2OC7A 1QNJA 2H9HA 1O2TA 2ZU4A 1G3BA 3HKJB 1ZYOA 3RXMA 1D6RA 1J14A 4VGCB 4WXIA 5G4BA 3MO3A 2A4RA 1UTLM 4ABJA 1E35B 3H7OA 3SV8A 4ABIA 2UWLA 2XW9A 3PM3A 2GCTB 1DE7H 3VB3A 2VGCC 2ZDNA 4WXVA 3V3MA 1DWCH 1ZHMA 3UUZA 1ETRH 1TGSZ 4B75A 1C9TA 4Y7AA 3K6YA 3VB5A 3AVZA 1J16A 4HGCA 2FX6A 1C5TA 2VJ1A 1GG6B 3KEEA 1F5KU 1WTHD 1ZSKA 5EODA 4DG4A 1J8AA 1O2PA 2F9PA 2THFB 1LTOA 1GBMA 1QB6A 1C5VA 3SHAH 1O30A 2Z9IA 1Q31A 2JH6D 4O3TA 5GPIB 4CBOA 1QRWA 1CT4E 2FS8A 1C5NH 2ALVA 4NFFA 3ZVGA 1DY9A 1ELGA 3QO6A 1Y5AT 3PLPA 1EZUC 1VZQH 1A3EH 4IBLH 1F0RA 2ANWA 5LGOA 4I8GA 3F1SB 1V2QT 1YPHE 2ZGBH 3SU5A 3PYHA 1GVKB 1HAVA 1EJNA 1LHGH 4OGYA 3UQOA 5I46H 5FPYA 1C1PA 3QDZB 2F9OA 1TRNA 1P01A 2VWOA 3TGKE 3LT3A 4Y7BA 1QA7A 1GWAA 1O2IA 1SGDE 1AQ7A 1GCTB 1YF4A 2ZCLP 4UD9H 1GDNA 3KQEA 2NWNA 3ZZ6A 1FUJA 4Y0YE 1TB6H 1XX9A 5JPMH 1XUKA 3TJVA 2DE8A 1JRSA 1AFEH 1TNIA 3ZV8A 3MNXA 1HIAA 4LZ1H 1DSUA 2V3OH 2BY5X 3KQCA 4IC6A 1RTLA 1C9PA 4JYUH 2A32A 1WAYB 1SGCA 2XBXA 4RSPA 2ZU2A 1E38B 2Z3EA 1DICA 2BX3A 4R0IA 1THSH 3G01A 1OSSA 2RA3A 4U2WA 2H1UA 7GCHG 2GV6A 3GCHC 3STIA 1UTQA 1C2GA 1GI8B 1C2IA 4AFSA 4B76A 3O8RA 3Q3XA 5DKMA 1O3AA 2XTTB 3T25A 1O3JA 3P70B 1GJ6A 1O39A 3ZVCA 3UFAA 3RMLH 1GCDA 3M5NA 1DWDH 1VJAU 1F2SE 2W7UA 3ESTA 3GY5A 2OXSA 1C2FA 1K1PA 1YCPH 2Y80A 1G37A 9ESTA 3URCA 3QZRA 1AUTC 4I32A 3RP2A 1TPOA 2UWPA 2OQUA 4B2AA 1YPMH 1GG6C 3BG8A 2FI5E 2M5TA 3R0FA 2ZKSA 3BEIB 2PR3A 4FUHA 1CHOF 4NIWA 1L1GA 3UNRA 4NSYA 1JIMA 1OWIA 1CA0C 1HGTH 2QXHA 2XXLA 1DLKB 3LGYA 5K0HA 1MAYA 5EPNA 1MD7A 2G00A 5E0JA 4BAQB 2XBWA 5E0HA