3RXQA

Crystal structure of trypsin complexed with benzamide (f01 and f05, cocktail experiment)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxqA02
1GWAA 4WF8A 1Z1IA 3MNCA 3RXEA 1NU7B 1AUTC 3ZZ8A 3W95A 1IQJA 2QN5T 3U1IB 1QHRB 5JPMH 3W94A 1Q2WA 1CQQA 1MZDA 1O32A 1GL0E 1BJVA 1O3DA 3GY6A 1G32B 2NU3E 3Q00A 1IQMA 4HZHA 3N7OA 1OXGA 2Y6TA 4YM9A 1C2MA 3R0FA 4Q80A 1O2MA 1BTPA 1DUEA 1N6YA 5C5NA 3NWUA 3ZZ6A 1UCYK 4AG1A 4K1TA 1ABIH 4XOJA 2Y5HA 1OP2A 1P11E 1C5OH 2A7JA 2CHAC 5HM2A 3ATLA 1FPCH 1SLVB 1GI4A 3PLKA 1KTTB 2NWNA 1AWHB 3T25A 2HWLB 5FPSA 1Z71A 3NPSA 3MH5A 3ODDA 1S0QA 1JRSA 1GMHF 4OS7A 4OS6A 1XUFA 3GY5A 4K3JA 2Z94A 4AYVB 2FTLE 4ABEA 2AERH 2GX4A 3VXFH 1TMBH 3GY2A 4B75A 1ID5H 5LPFA 3ZZ9A 4MNVA 3P92A 1WV7H 3TJOA 3LH1A 1W0ZU 2Z9IA 2ANKH 2H5CA 2VIDA 2A4RA 3GY7A 4H42U 4AOQA 2ZI2H 4GSOA 1ZSLA 2YNBA 1F2SE 1THRH 5JBCS 2OQ5A 3SV9A 2XBWA 1V2TT 3S0NA 2OC0A 1UCYH 1MU8B 1KDQA 1ESAA 3UWJH 3U8RH 3HGNA 3LT3A 1DSTA 1WU1A 2ZFTA 1TIOA 4INKA 5EW1H 3WY8A 2ZCKP 3MH6A 3ODFA 4M7GA 1O37A 2PGQB 1VJAU 4BTIB 4X8SH 1GDUA 2AIQA 1DFPA 5EGMA 1TA6A 2VWLA 4ZXXH 3RXLA 3V12A 3Q76A 1CBWB 2ZGHA 1DLKB 3A7YA 3RXHA 3MHWU 1O2TA 2GT8A 2BD5A 4GLYA 3OY5U 2BOKA 3GDSA 1CA8B 7LPRA 5A8YA 1B0EA 3QDZB 2AFQB 3T2NA 1KIGH 2H9TH 4Z6AH 4YO9A 5A0BA 1O33A 1F7ZA 1QB1A 4J2YB 2HVXA 1P3CA 3RC4A 3F9EA 3SGAE 1P02A 1TPSA 2Y81A 4Y8XA 1SGCA 1UVUH 1TNGA 4ZKRU 2VIQA 1GBLA 1Z8IB 1L1GA 4FXGH 3HKIB 2V6NA 1CT0E 2IJOB 2XBYA 4DG4A 4UEHH 4XDEA 1HJ8A 2STAE 3KCGH 1KLJH 2WYJA 2BX4A 1TYNA 1LVMA 2H9HA 2FXRA 3A80A 4K5ZA 1ZRKA 1AO5A 3LKWA 2P94A 2G52A 1QQUA 1CVWH 3EGKH 5SGAE 1MKWK 2JKHA 2GMTB 2Y7ZA 3SV8A 1NU9A 2FOEA 3GISB 1HLTH 1A0LA 1QL7A 4MNYA 4MTBA 5DK1A 1C5VA 5JB8S 4FUCA 4ABGA 1A7SA 4H6TA 4WY3A 3RLYH 1CT4E 4ESTE 8GCHF 3K6ZA 1ANDA 3D23A 1RIWC 3TK5A 1TNJA 3VB5A 2GCTB 4D9RA 1XM1A 1T8LA 1Z6EA 4NSVA 1O5GH 4CHAB 3MU0A 1FY4A 1GBCA 4A92A 4LXBH 2UWOA 2O8WA 2QF0A 5F8ZA 1VITG 2ZDKA 5J4SA 1AN1E 2XBVA 4PROA 1TWXB 1MTNC 1TPOA 3SGQE 4ZMAH 4HFPB 3GCHC 4OGYA 2OUAA 3VB7A 4X1RU 4XBCA 3ELAH 4FUDA 2W3KA 1A1RA 1O3HA 5FAHA 3RXVA 1F5LA 1OWHA 2D26C 2VH6A 1GBFA 2CF8H 1BT7A 3AW0A 3PWCA 1AY6H 1EAWA 1QRXA 1FXYA 2BTCE 1W10U 2PLXA 3G01A 4IN1A 1QQ4A 1SLXB 1F0TA 1C5WB 3NCLA 1FI8A 4YT6H 4DIHH 5F8TA 2XCNA 2UWLA 1V2MT 5AF9H 1UK3A 2F9PA 5C1UA 4MDSA 1EXFA 2NU2E 5F8XA 1CSOE 2BZAA 4NWLA 5GWZA 2VB0A 3ITIA 3TIUA 1FLEE 3O8BA 1YM0A 4KP0A 2XRCA 1GI6A 5FPYA 1GCDA 1W12U 1C5QA 1PFXC 3PMBB 1AVXA 1P2JA 3BTWE 4ISNA 5J4QA 2BD7A 1A5HA 3O8DA 3MMGA 1BRBE 1XMNB 2GCHG 1GMHG 1HIAB 2FWWA 3V3MA 1T31A 3GY3A 1AFQC 1LHEH 4WJG2 1AQ7A 2BQ6B 3PROA 1YPEH 1ELAA 3VXEH 2F9NA 4CBOA 1GI8B 1Y5BT 4DCDA 1BMNH 5DP6A 1V2JT 2WPMS 2FIRH 3SBKA 4ABHA 1YBWA 1ZGVA 3E90B 4JZIA 1BTUA 2CV3A 1QURH 1ZPBA 1LMWB 1O39A 4Y71A 1P09A 1SL3A 1GDNA 4X6NA 1OWJA 1YKTA 2UUFB 2R2WU 1IQEA 1XKAC 3GY4A 3SJIA 1HPGA 1XX9A 4ZHAA 3ZZBA 1NFXA 2QXJA 2AGIX 1T4UH 3VPKA 3DUXH 2ZGBH 4VGCC 1EP5A 1K22H 1LPKB 4AYYB 3F68H 2JH0D 3BTTE 1AKSA 1ETSH 4BAKB 1D3TB 1AGJA 1O31A 1O5AB 3VGCB 1P2KA 2FOBA 3SU3A 3Q3YA 1BTYA 2XC4A 1PPBH 1SGIB 6CHAB 2OQUA 1GJBB 1P01A 3GCTF 1GCTC 1Q3XA 4TPYA 1DXWA 1GHVH 1L2EA 1EB1H 1Z8JB 1ZOMA 1SGRE 4WH8A 3ZVFA 3QX5H 3SHCH 2QYIA 3FANA 4NSYA 2BDBA 1UVTH 1O2GH 2AMDA 1HAIH 5A2MH 3SUFA 2RA3A 5C1YA 1L1JA 2C8WB 1D3PB 1UVPA 2IOTA 5LPRA 2ZFQH 1C5MD 1AB9C 1LQEA 2A7CA 3SOSA 2XC0A 4LZ4B 2SNVA 4OS2A 2EI6A 1ZTLA 4I8LA 1P9SA 2WPLS 1FN6A 3I77A 4Q7YA 2B5TB 2FP7B 1LVOA 1V2QT 4A1VA 2C4FH 2H5DA 2ZGJA 2G5NA 4TYDA 3FZZA 1G2LA 5GCHF 3SNAA 4CHAC 1O34A 3ZVBA 3GICB 1C5PA 3NXPA 1ZMJA 2ZHQH 5HM9A 1HJAC 1ARCA 2GT7A 1QY6A 2FX6A 2THFB 1C5YB 3H7TA 4Y7BA 1GJ8B 3EE0B 2QV1A 3AASA 2RDLA 2HNTF 1TALA 4K2YA 1OOKB 2ZQ2A 1FY1A 5EXLA 5K0HA 2A2XH 3GCTG 4UFGH 1O3LA 3FP6E 1P2IA 1O2HA 4WXIA 1NRSH 2AS9A 1XXFA 2QY0B 1YPHC 2G4TA 1MH0A 5HMAA 5DKMA 2AMQA 1MTSA 1GHYH 4DJZB 1Z6JH 2BM2A 1ZGIA 1FY8E 1A3BH 1VGCB 5DP4A 2FOMB 4CREA 1J9CH 3M37A 1XKBC 4CR5A 3OYPA 2SGFE 1GBBA 3PMAB 1EJMA 1A3EH 3KGPA 4MPXA 4ISHH 3F9FA 1SGPE 3LGUA 1OWEA 1ZSJA 4I8KA 2G4UA 1HAGE 1O3PB 1JOUB 2BY6X 1E38B 1DUAA 4Q2KA 4CRBA 4NA7A 3T26A 4X8TH 1V2NT 4U2WA 3BG8A 2H1UA 2VVCA 1QJ7B 3GCHB 3EDXB 4E7RG 5JB9S 2BB4A 3LPRA 1W3CA 2OBQA 2SGQE 1E0FD 1V3XA 1JBUH 1UVOA 4DVAU 2ZWLH 1EB2A 1GBDA 2BD3A 3A88A 4B2CA 2BXTH 3PWBA 2HNTC 1W7XH 1YP9A 4TWYA 1TBQH 3M5MA 2SGAA 4KKDA 5CMXH 2ILNA 3TH2H 1GBJA 1UJ1A 4KGAA 3S9BA 2JETC 2GZ9A 1GJDB 4BXWA 2H2ZA 4MNXA 2Q6DA 3LOXA 1DITH 1FY3A 1BRUP 4D8NA 3GDUA 4BAOB 3CP7A 4X0WU 1C4U2 1HAVA 3URCA 1UMAH 4O97A 1PQAA 4SGBE 4O3TA 3M3VA 3TK6A 1IQFA 5JBBS 1EZQA 2GZ7A 3QO6A 1TOCB 1VR1H 4B74A 1BBRH 3E6PH 1XVOA 1Y3XA 3UOUA 1ZHMA 2FLRH 5IYTA 5H4IB 4FU9A 5GIBA 5EU8A 1WTGH 5HGGA 1SC8U 1PPGE 2FM2A 1GI7B 2F83A 2BQ7B 1FV9A 1QRWA 3P8NA 4VGCB 1BOQA 1SGFA 1THPB 4YOJA 3RLWH 4D7FA 1C1TA 1D9IA 3RXSA 4JYVH 3S9AA 4I8JA 2VIOA 1ELEE 1H8DH 5FXLA 1VZQH 1RTFB 2YNAA 3GYLB 1RXPA 4IN2A 5GXPA 4AFQA 2OLGA 1BTZA 3TPIZ 5FCRA 4CH2B 3BEFB 4KELA 1FZZA 1MCTA 3E0NB 1Q31A 1SB1H 4X2WA 1KDQB 3RC5A 3DHKH 1V2RT 1B7XB 1DANH 1KXBA 1MTNB 2ULLA 4Y76A 3TLOA 1O3IA 2DE9A 2TIOA 1C5ZB 1K1IA 3P6ZB 2OC8A 3T62A 1A2CH 4HTCH 4BAMB 2ZTYA 4QT8C 1WBGB 5C2ZA 1A5IA 1SSXA 1TB6H 4R8TB 1ZMNA 2OINA 4INLA 1K21H 3QN7A 1D3QB 4ABJA 1FUJA 1ELBA 1GHAG 1H9LB 1YPMH 3K9XB 1GVLA 1GCTB 1O5EH 1TX7A 4UONA 1Y3VA 1IQNA 1HAYB 1K1PA 1THSH 2TGDA 3UNQA 4ZHLU 2TGPZ 1C4Y2 1FAXA 3JZ2B 3KQEA 4ABFA 2DUCA 3UR9A 1O5DH 4THNH 4WMEA 1H9IE 5E0HA 2BQWB 4K1SA 2H6MA 1MAYA 1O2XA 3RXRA 3U9AH 3K6YA 1G3CA 2ZPRA 1QA7A 3UY9A 5FBEA 1U6QA 3ZVGA 1BCUH 1SLUB 1BTWA 1TQ7B 3RXFA 1O5FH 3RXAA 2UUYA 5FHTA 3HGPA 2F9VA 1V2KT 2JETB 1C5UA 1JRTA 3FP8E 1GMCG 2C8XB 3FFGA 1OWKA 4ZHMU 1SFIA 5GJ4B 1C5NH 2BDIA 4BANB 4GAWA 1GBEA 1LVYA 2FX4A 1G3DA 3RXIA 1BJUA 3QGNB 1K28D 3M3SA 4I7YH 3SUGA 1TA2A 4MLFB 2PSXA 2GTBA 1DSUA 4BAHB 1LHGH 1MMJN 2O9QA 2CGAA 8LPRA 4O03A 4XBBA 3HKJB 1DPOA 1F0RA 1C1WH 3OTJE 3BN9A 1HAVB 3V0XA 4ZKOU 3LGVA 2ODYB 3PO1B 3M3TA 3HPTB 4XBDA 4GUXA 2OC1A 1TX8A 3M7QA 2G00A 4OGXA 1GBHA 1SGTA 3RMLH 1A46H 1NTPA 1S82A 3PB1E 5JDUB 1J17T 1SQAA 3BG4B 1NFWA 1S84A 1PYTD 1GJ9B 5I46H 1IHTH 1VJ9U 1GHBF 1GG6B 2BXUH 3TGKE 1J15A 3Q77A 3PLPA 2ZDLA 3UPEA 3GDVA 5DPAA 4WWYA 3MI4A 2GGVB 5FPTA 1O3NA 3VB4A 3UR6A 1Z8GA 3TJVA 3E0PB 5AHGH 3RXGA 4DURA 3S69A 1C1OA 2ZTXA 1EPTC 3FVFB 4Z0KA 4BNRA 4FUIA 5HXFA 3A8CA 1O2QA 2GVFA 4BTTB 5L6NH 3MOCA 3A82A 2W7SA 1O2KA 1BA8B 2PV9B 3C1KA 1GBAA 3RXKA 1MQ6A 1GJ5H 5PTPA 1MTUA 1AMHA 1TNHA 1TNKA 3E16B 2J34A 2BHGA 1DDJA 4E05H 4Y8ZA 3RDZA 1NROH 1AU8A 1DE7H 1KSNA 4DOQA 5EXNA 1YPGH 1E35B 1DWEH 4K8YA 2ZF0H 3FP7E 3ENSB 2G5VA 2FODA 2J9NA 3A89A 1UK2A 3RXMA 1MKXH 1SGYE 2A5AA 4Y6DA 1G37A 1EX3A 1O3FA 4MG3A 4X6MA 3ATWA 1ELFA 1SLWB 1XUGA 1P3EA 1QB6A 1UTKA 4TY7A 2AGGX 3MNBA 2KAIA 1GHBG 1JIMA 1O2SA 3RXQA 4YT7H 1D4PB 2TPIZ 1OP8A 5F03A 1TGNA 3BF6H 1ACBE 4IC6A 1ZSKA 1C5SA 3K2UA 2R2MB 2CJIA 2ZDVH 1QTFA 2I6SA 3L3TA 2ZFSA 2GZ8A 3UOPA 3SN8A 2Z9GA 2XTTB 4TPIZ 2FOHA 1ZHPA 1DM4B 1P9UA 3NKKA 2ZCHP 4X1SU 4B2AA 3ZVAA 2QCYA 2PUQH 1YPHE 1V6DA 2ZO3H 4AB8A 3BG4C 4NFFA 3A84A 1O3MA 1HJ9A 2UUKB 4NG9H 4INHA 5ABWA 1O2PA 1QBNA 3T29A 3RP2A 3SJ8A 4I33A 1SI5H 1C1QA 3VB3A 3LONA 1V2UT 1PPHE 2R9PA 2ZPQA 1KLIH 2O8MA 4IC5A 4IMQA 1Y5UT 4ISOA 3RXOA 1NFUA 2F9OA 1NZQH 1UTQA 1FIZA 1C1NA 4K1EA 2ZU1A 5C5OA 1HAXB 1Y3YA 4ABIA 4YZUA 3MO9A 1FIWA 5IDKA 4NFEA 5HYOA 2FOAA 1P2NA 1O2YA 1BRAA 5GPIB 4CR9A 2VNTA 4HI3A 1HFDA 1UTPA 1ZJDA 5BRRE 2WV4A 3A8AA 1K9OE 1ZLRA 4B2BA 1AKSB 1XUKA 3HATH 1Z8RA 2A1DB 3KN2A 3TGIE 1SQOA 4H4FA 4ZKSU 5LPEA 1CGHA 2ODQA 2HNTE 4RKJB 1SG8B 2FOFA 1N1LA 1FJSA 2OC7A 1G3EA 1O2UA 1ESTA 4GVUA 4X2YA 2BX3A 1AIXH 1W13U 4FUFA 2AEIH 2R3YA 2BVRH 3SV6A 2ZIQH 2WPKS 3MNXA 5DP7A 3P8FA 1HRTH 2W26A 3PLBA 3DFJA 4CRAA 4ABAA 1RIWB 1TE0A 3ZZAA 2BDCA 1OSSA 3RM2H 3CS0A 4ISLA 1HAPH 2KAIB 1CA0B 5F6MA 1F0UA 1X7AC 4B76A 2J94A 1RRKA 2O8UA 2XWBI 4WVPE 3RM0H 3VB6A 1EASA 3TH3H 6GCHF 3MH7A 2ZNKH 1WOFA 2JH5D 5CE1A 1BUIA 1SGDE 3TGJE 4FVBA 1AD8H 3RXUA 5DO4H 1LO6A 1EP6A 2CMYA 3LC3A 1F5RA 1LCYA 1BB0B 1TLDA 3MNSA 1SMFE 2Y5GA 1HXEH 4GPGA 1OX1A 3ATIA 3MYWA 3OX7U 4X1NU 3PYHA 4Q7ZA 2WPJS 4K8BA 1MTVA 1TGSZ 7KMEH 3V13A 1UTLM 3BIUH 7GCHG 2FESH 1MKWH 1XUIA 2VWNA 3B8JA 2Z9JA 3E3TA 4MPWA 8GCHG 4NZQA 3KNXA 4OS5A 1C1SA 3MFJA 5A09A 4FVDA 1PYTC 2A4QA 3ATMA 2AH4X 2UWPA 4X2VA 3LH3A 3LIWA 1SGEE 2CN0H 3CS7A 4CRDA 2NU1E 3SUEA 1AFEH 2A45B 2IPHA 3PO1C 2XC5A 2A4GA 1SGNE 2QA9E 1C5RA 2ALPA 2P8OC 3ZVCA 3B23B 2SGDE 2YOLA 4J1YA 1QFKH 1Y5AT 3SU6A 1NM6A 4ZKNU 3UUZA 5C1XA 3BEUA 3RU4E 3IITA 2V3HH 1TABE 1S83A 3TNSA 1WCZA 2XBXA 1KLTA 2PUXB 3QTVH 4I8GA 1EZSC 1LHFH 3D62A 3BTKE 1O2LA 1MD7A 2VINA 1F0SA 5AVDA 1S85A 1A61H 3LU9B 2VVUA 5E0GA 3RUOA 1HB0B 6CHAC 1UVSH 5EODA 4DIIH 4CBNA 2A2QH 1GJAB 4RN6A 3UIRA 1KXFA 3JZ1B 4X6PA 2C3SA 1V2LT 3EQ0H 5DP9A 1CGIE 5FX6A 3PM3A 4LZ1H 3PMHB 3TH4H 1IQHA 3A8BA 2QXHA 4YLUA 1MD8A 2HPPH 1ZMLA 1C4V2 3T28A 7GCHF 1K1MA 3PV4A 1AUJA 2GKVE 1QL9A 4YESB 4FU7A 1EQ9A 4RSPA 1H1BA 3QZQA 1T7CA 3DD2H 3UFAA 1Y8TA 2UUJB 1BMLA 1CU1A 1P0SH 8ESTE 1B0FA 1P06A 1UTNA 2Z3CA 2VIVA 3SQHE 9ESTA 3OY6U 3OU0A 3SNEA 3QLPH 4FUBA 1QRZA 1O3OA 1BBRE 1ABJH 4B73A 1W8BH 1CO7E 2BLWA 4A5TS 2FS9A 3HK6B 1MUEB 1YC0A 4AORA 2ZDMA 1B5GH 1O2ZA 1P05A 3M36A 4UDWH 5JYIA 3VEQB 1G36A 1CHGA 3PTNA 4GCHF 5G4BA 1UCYE 3VGCC 3AVZA 2F91A 2FOGA 1DY8A 6ESTA 5EPYA 2OP9A 3ZV9A 1DXPA 3SU1A 2VGCB 3SU5A 1OWDA 1C2KA 1NRPH 3U69H 1JMOH 1QCPA 2Y80A 5BPEA 3MO6A 3ATKA 1NY22 3QK1A 1AVWA 2FI3E 2NU0E 3SW2B 1N8OC 2HALA 4X1QU 1HJAB 1A0JA 2GD4B 1TRYA 1BITA 1W0YH 3ZZCA 3VFEA 1GGDC 1W7GH 1HAZB 2BYAX 2JH6D 2Q6FA 1P2MA 1Z1JA 3MU8A 3RXDA 1V2ST 3SJOA 4Y0ZE 1LPZB 1SGQE 2GV6A 1O2JA 1JIRA 5A0AE 2ALVA 1QR3E 1O2RA 2ZU3A 4YTAA 1AWFH 1DX5M 1VGCC 4A1XA 1EOJA 4R0IA 3LGTA 5EG4A 4JK5A 3UQVA 1O2WA 1C2IA 3IG6B 1LDTT 3C27B 3PMJA 5TJXA 3STIA 5EW2H 4IBLH 2GDDA 2F3CE 5T6GA 2FTMA 4O9VA 4JZDH 8KME2 1HAHH 2PR3A 5ESBA 4D76A 2Q1JA 1LTOA 1MTWA 1OWIA 2P8OB 5EOKA 2HGTH 3M5LA 2HRVA 2ZCLP 4AGJA 1IQIA 1CT2E 2WUBA 2WYGA 4KTSA 1QBOA 3L33A 1ELCA 1ZR0A 1SPJA 3EYDA 1BIOA 4NA8A 1BBRK 1EPTA 2WPHS 4UFEH 3SNBA 2ZC9H 2A5KA 3STJA 1XUJA 5TCAA 4ASHA 3GCNA 3E1XB 4BOHA 2F9BH 1S0RA 2BLVA 2Z3DA 2TGTA 3UNSA 1EAUA 1ELTA 1KXCA 1O3BA 2ZFFH 3L6PA 3F1SB 1CBWC 3M35A 2XW9A 1TGCA 1LHCH 1GI5A 4CRCA 3EA9A 1TQ0B 3Q3KA 1SVPA 4MPVA 1MAXA 2VWOA 1O38A 4WXVA 4AB9A 1J8AA 1AE8H 2G8TA 1QNJA 1H9HE 2FMJA 1O5CB 4WH6A 2P95A 4YLQH 3UNRA 2ZU5A 1J14A 1XVMA 3LGWA 2QIQA 1ZZZA 5EQSA 2V0BA 1CE5A 3SO3A 1QA0A 3MH4A 3SV7A 5C20A 1IQKA 1KXDA 1YGCH 2QXIA 2Q6GA 1GHZA 1Y3UA 2XXLA 1IQGA 4I31A 1NS3A 1C2LA 2AIPA 1NESE 1HV7A 2WV5A 1T8NA 1TBZH 3D49H 5FX5A 1CHOG 1GI1A 4JZEH 1BMAA 2QAAA 3RXJA 3S7HB 2P3UB 2AYWA 3F9HA 1GL1A 1SBWA 5EPNA 1GJ6A 1P2QA 1DOJA 2FEQH 1TNIA 1GVZA 4GHQA 3SJ9A 1ELVA 1EOLA 3RU4D 4NIWA 2O8TA 1O3AA 1MBQA 1ESBA 1UTMA 1DY9A 2W5EA 2Y82A 4D9QA 1TMUH 3EAJA 5E2OA 1S6FA 1YCPK 1SHHB 3I29A 1H4WA 4LK4A 1JXPA 1NRQH 2C93B 1IHSH 1DICA 1VITF 2PSYA 4E06H 1HBTH 4Y11E 1EZUC 1FDPA 3HK3B 1C2HA 2OCVB 4CRGA 1YLCA 1TRMA 2A0QB 1GMDG 2AGEX 1O2NA 1DVAH 2QGRA 2ZU2A 1T8MA 2FPZA 2BVXH 3SNDA 1P8VC 1UO6A 4F49A 1DWBH 2D1JA 4ZXYH 3SU4A 2DE8A 3S7KB 2BMGB 1EAIA 4FUGA 3KEEA 2QC2A 2Y7XA 1ZHRA 2ZFPH 5E8EH 1ZTJA 1K1OA 2AMPA 2B9LA 2P3TB 4UD9H 1MZAA 4BAQB 3UTUH 4X2XA 1WQSA 1A4WH 2OTVA 2B8OH 3BTDE 3TITA 2HPQH 1VCPA 2A32A 1W14U 4U30A 1AE5A 4FUHA 2HLCA 2C8YB 1EKBB 1VCQA 1SOZA 5T3HA 3RU4T 1GBKA 2FOCA 1O36A 1AFQB 2RA0A 2WPIS 1SR5C 1O35A 3SV2H 5AFZH 3BTEE 1TPPA 1AZ8A 1FNIA 4KTCA 1O3KA 4AX9H 1L1NA 1P04A 4ZAEA 3PTBA 1E34B 1WTHD 3F9GA 2ZFRH 1NT1A 1WUNH 2FO9A 5FCKA 4AFSA 1G2MA 1PPEE 1TONA 2GCHF 3BTFE 2R0LA 4RKOB 3SGBE 3AW1A 1C1UH 1OP0A 1S81A 3KQBA 4FUEA 1EPTB 1GJ7B 1UTOA 2EC9H 3SQEE 4Y8YA 1LVBA 3RMOH 4KTUA 4D7GA 3GYMA 4WMDA 5DP5A 4I8HA 2OD3B 5A8XA 2PTCE 2XCFA 1C1RA 1TMTH 1HDTH 2F9UA 1C2EA 2R0KA 1XUHA 3P95A 2FYQA 1C1MA 2V35A 1SGFG 9LPRA 2WINI 3E91A 2VWMA 1QJ1B 1O30A 2P93A 1O2VA 1P2OA 2H9EH 3RXTA 1C2JA 1WQVH 1OYQA 1W2KH 2BY5X 3BEIB 2A31A 4CH8B 2RCEA 1HGTH 1YCPH 2CXVA 4AFZA 2J38A 3O8CA 4AZ2B 3T5FH 4A7IB 1BTXA 3H7OA 6GCHG 1KYNA 5DG6A 2D8WA 2J95A 1AI8H 2LNCA 3GOVB 4JZ1A 1DT2A 5ESTE 1V2OT 2P59A 2VIPA 4IS5A 1K1JA 2FS8A 1G30B 1D6WA 4ZUHA 1BRCE 1GJCB 4A1TA 1YPKH 4Y10E 1BHXB 1ZPZA 1PPCE 3SU2A 3E8LA 1M9UA 2BDYA 4JYUH 2D2DA 4Q7XA 3NUMA 2BD2A 1GMCF 3ZZ5A 1HNEE 3QTOH 1PPZA 1SFQB 3NZIA 2A7HA 2VJ1A 2ZKSA 1QJ6B 3A86A 3MWIU 1C5LH 1CHOF 1MU6B 2BZ6H 5TCCA 4Y7AA 2J92A 1PJPA 2XNIA 3U8TH 1KTSB 1GHXH 1EATA 3DA9B 4GHTA 2ZP0H 3A7ZA 4DGJA 1ZTKA 1O3CA 3KF2A 3MU1A 1OPHB 2BLQA 1V2VT 4JK6A 2BDHA 4TWWA 3EA7A 2SNWA 5LGOA 1VITH 2VVVA 4U32A 2PHBA 1BMMH 1DWCH 1E36B 1ANCA 1ARBA 3A83A 1LKBA 5DP8A 1HXFH 1ETTH 6LPRA 1TFXA 3RXPA 5GCHG 3I78A 1V2WT 3T27A 4ZH8A 1GDQA 1FONA 3QUMP 2O8LA 2ZQ1A 3RXBA 3GY8A 4K60A 4ABDA 4Y0YE 3KL6A 1C9PA 5A0CA 1QGFA 3ZVEA 1AVGH 1GMDF 1UK4A 1ELGA 2PKSB 5I25A 3TNTA 3F6UH 1MBMA 1UTJA 3A85A 1ZRBA 1KY9A 2ZPSA 3KQCA 1PQ7A 1EZXC 3KQDA 1RTKA 3ZYDA 1IQLA 1LQDB 2ZECA 2SFAA 3SNCA 1ANBA 3FZDA 3BTME 2BVSH 2BY9X 4MQAA 4JZFH 1GG6C 1TPAE 4NA9H 4YOGA 2TGAA 1GBMA 1K1NA 1GBIA 1L4ZA 3TU7H 3CENA 3DFLA 1GPZA 1AHTH 1RGQA 1TGBA 2BOHB 2VU8E 5E2PA 3LGIA 2CF9H 3URDA 1NO9H 4X8VH 2OBOA 1IAUA 1CA0C 1T32A 2C8ZB 1AB9B 5K7RA 4A6LA 1WYKA 5C3NA 1DWDH 3ZV8A 1PQ5A 2ESTE 1VCWA 1PQ8A 5AFYH 4ZROA 2QXGA 2PTNA 4JYTA 1QBVH 2BD9A 3A7TA 2ODPA 4GCHG 1Y3WA 2ZZUH 3MTYA 2EI8A 2ASUB 2ZU4A 4UFDH 2BD8A 1GVKB 2FI5E 1QB9A 3KIDU 2Z7FE 3SI3H 1K2I1 4BXSA 2J4IA 3BV9B 3MU5A 1FAKH 2Z6BD 4U01A 1C2GA 3RXCA 3Q3XA 2P16A 3IWMA 1ZYOA 1EAXA 2EA3A 3GCOA 3M61U 1YF4A 2R3UA 1GI9B 4OS1A 4NIVA 3UWIA 4IGDA 1SHYA 1N6XA 1H8IH 4DY7B 1FN8A 4FUJA 2G81E 1TNLA 4MVNA 4X6OA 1T8OA 3O8RA 5JBTA 2A5IA 4JCNA 4MPUA 2BDAA 2B7DH 2NU4E 2SGPE 3LJOA 3P8OA 1NPMA 2VH0A 3U98H 1D3DB 3EA8A 3TK9A 2Z9LA 5DGJA 1KXEA 5LH8A 2FDAA 4Y79A 5CHAB 1SQTA 1UHBB 2OXSA 1GI2A 1KXAA 3QZRA 5T6FA 1Z7KA 2PFEA 2CHAB 1DLEA 2ZTZA 2XWAA 1C1VH 4ISIH 2XYAA 5L2YH 1RJXB 2STBE 3U1JB 1MKXK 2LPRA 3MO3A 2VIWA 1E37B 3TJUA 1K1LA 1L4DA 3ZZ7A 2TRMA 3U8OH 1C9TA 2ZHFH 4BTUB 2FLBH 1P03A 1O3JA 3SU0A 2I6QA 5JBAS 2Y5FA 2EEKA 2G55A 1WSSH 5B6OA 2RG3A 4XE4A 3ZZ4A 1ETRH 2M5TA 2ZHDA 3ESTA 1J16A 4NGAH 3LDXH 1FPHH 1EJAA 4TY6A 4B1TA 1QIXB 1GJ4H 4X1PU 1A0HB 2P3FH 1D6RA 4O3UA 4YOIA 2G51A 3SI4H 3ZZDA 4F4OC 4JMYA 1GHAF 2PWXA 1INCA 5A8ZA 2IN2A 1HCGA 1O5BB 3K65B 4AG2A 5EQRA 2V3OH 3RC6A 3M7TA 4AGKA 3SORA 1TRNA 4K69A 1S5SA 1ORFA 2ANWA 2SGEE 3ZZ3A 4FU8A 1OYTH 1BHXF 1G9IE 3B9FH 1F92A 3A8DA 1RS0A 3AAUA 4HGCA 1BQYA 3A7VA 4E7NA 4I32A 1FY5A 4DW2U 3QGJA 1GI0A 2B0FA 4DT7B 3LJJA 4X8UH 1TGTA 2C90B 1ANEA 3BIVH 2BY8X 1T4VH 1N8OB 1NN6A 2BY7X 5DP3A 1W11U 4OS4A 1MQ5A 1NC6A 1GGDB 2W7UA 5FBIA 3FAOA 4ABBA 1RTLA 3D65E 1G3BA 1TOMH 3LGYA 1IOEA 1O2IA 1LPGB 4SGAE 1UHBA 1O2OA 2QF3A 4B71A 3SUDA 4XSKU 3S9CA 5DJ7A 1YPLH 2BDGA 1LKAA 3RMMH 2J2UA 4UE7H 1O0DH 1ZJKA 2FYRA 3V7TA 2FZZA 4CRFA 4WMFA 3TVJB 2ZHWH 5L30H 1YLDA 2PKAB 2PW8H 1C5TA 4NIYA 1PPFE 3P8GA 1S6HA 3SHAH 2GV7A 1QL8A 3A7XA 5T6DA 3R3GB 5CHAC 1AZZA 3BTQE 2W3IA 1BZXE 4H6SB 1NRNH 4MNWA 4NIXA 2FI4E 3BTHE 2GMTC 1HIAA 4NCYA 1P10A 3BTGE 3OSYA 3BSQA 2GP9B 3M7UA 7ESTE 1GHWH 1OKXA 2PKSC 3LC5A 4IW4E 1F5KU 4NWKA 2ZDAH 2HOBA 1CGJE 3A87A 3UREA 2ANMH 3ZYEA 1DS2E 1WAYB 1YYY1 1V2PT 3QWCH 4AFUA 1XXDA 5E0JA 4IMZA 1GI3A 1BTHH 3SJKA 2BLOA 4XFQA 3KHVA 5ETXA 1YCPM 3M5NA 2ZHEH 1ZPCA 1L0ZA 1C2FA 3SZNA 5L2ZH 1TBRH 4AN7A 1LHDH 2K1QA 3UQOA 2ZGCA 2PKAA 2VGCC 3MU4A 2ANYA 1MCVA 1YPJH 3P17H 1ELDE 5C67A 1NRRH 1GBTA 3NK8A 2GCTC 1HUTH 3DT0H 5EXMA 1RD3B 2WUCA 1NFYA 4NZLA 1SOTA 1HAOH 1OS8A 2ZGXH 1RFNA 3AAVA 2ZG0H 2EI7A 1P57B 2PGBB 3M5OA 2GDEH 1C5XB 1C1PA 3ZVDA 2ZDNA 3A81A 3H5CB 1HYLA 4LOYH 1FMGA 1TX6A 2BD4A 3P70B 2A4OA 3TJNA 1Y59T 3A7WA 1A5GH 2ZA5A 1EJNA 1JWTA 1FQ3A 2TBSA 1EUFA 2Z3EA 3RMNH 1BDAA 5GDSH 1O3EA 1C2DA 5EQQA 1TAWA 2ZEBA 1O3GA 2Z9KA 1P12E 4UFFH
chains in the Genus database with same CATH superfamily
1GWAA 4WF8A 1Z1IA 3MNCA 3RXEA 1NU7B 1AUTC 3ZZ8A 3W95A 1IQJA 2QN5T 3U1IB 1QHRB 5JPMH 3W94A 1Q2WA 1CQQA 1MZDA 1O32A 1GL0E 1BJVA 1O3DA 3GY6A 1G32B 2NU3E 3Q00A 1IQMA 4HZHA 3N7OA 1OXGA 2Y6TA 4YM9A 1C2MA 2KR7A 3R0FA 4Q80A 1O2MA 1BTPA 1DUEA 1N6YA 5C5NA 3NWUA 3ZZ6A 1UCYK 4AG1A 4K1TA 1ABIH 4XOJA 2Y5HA 3WWFA 1OP2A 1P11E 1C5OH 2A7JA 2CHAC 5HM2A 3ATLA 1FPCH 1SLVB 1GI4A 1YLNA 3W1EA 3PLKA 1KTTB 2NWNA 1AWHB 3T25A 2HWLB 5FPSA 1Z71A 3NPSA 3MH5A 3ODDA 1S0QA 1JRSA 1GMHF 2HVYB 4OS7A 4OS6A 1XUFA 3GY5A 4K3JA 2Z94A 4AYVB 2FTLE 4ABEA 2AERH 2GX4A 3VXFH 1TMBH 3GY2A 4B75A 1ID5H 5LPFA 3ZZ9A 4MNVA 3P92A 1WV7H 3TJOA 3LH1A 1W0ZU 2Z9IA 2ANKH 3UAIC 2H5CA 2VIDA 2A4RA 3GY7A 4H42U 4AOQA 2ZI2H 4GSOA 1ZSLA 2YNBA 1F2SE 1THRH 5JBCS 2OQ5A 3SV9A 2XBWA 1V2TT 3S0NA 2OC0A 1UCYH 1MU8B 1KDQA 1ESAA 3UWJH 2QF5A 3U8RH 3HGNA 3LT3A 2IJD1 1DSTA 1WU1A 2ZFTA 1TIOA 4INKA 5EW1H 3WY8A 2ZCKP 3MH6A 3ODFA 4M7GA 1O37A 2PGQB 1VJAU 4BTIB 5KECA 4X8SH 1GDUA 2AIQA 1DFPA 5EGMA 1TA6A 2VWLA 4ZXXH 5KGOA 3RXLA 4Q63A 3V12A 3Q76A 1CBWB 2ZGHA 1DLKB 3A7YA 3RXHA 3MHWU 1O2TA 2GT8A 2BD5A 3FKSD 3OY5U 4GLYA 2BOKA 3GDSA 1CA8B 7LPRA 5A8YA 1B0EA 3QDZB 2AFQB 3T2NA 1KIGH 2H9TH 4Z6AH 4YO9A 5A0BA 1O33A 1F7ZA 1QB1A 4J2YB 2HVXA 1P3CA 3RC4A 3F9EA 3SGAE 1P02A 1TPSA 2Y81A 4Y8XA 1SGCA 1UVUH 1TNGA 4ZKRU 2VIQA 1GBLA 1Z8IB 1L1GA 4FXGH 3HKIB 2V6NA 1CT0E 2IJOB 2XBYA 4DG4A 4UEHH 4XDEA 1HJ8A 2STAE 3KCGH 1KLJH 2WYJA 2BX4A 1TYNA 1LVMA 2H9HA 2FXRA 3A80A 4K5ZA 1ZRKA 1AO5A 3EE7A 3LKWA 2P94A 2G52A 1QQUA 1CVWH 3EGKH 5SGAE 1MKWK 2JKHA 2GMTB 2Y7ZA 3SV8A 1NU9A 3PRBA 2FOEA 3GISB 1HLTH 1A0LA 1QL7A 5C0TA 4MNYA 4MTBA 5DK1A 1C5VA 5JB8S 4FUCA 4ABGA 1A7SA 4H6TA 4WY3A 3RLYH 1CT4E 4ESTE 8GCHF 3K6ZA 1ANDA 3D23A 1RIWC 3TK5A 1TNJA 3VB5A 2GCTB 4D9RA 1XM1A 1T8LA 1Z6EA 4NSVA 1O5GH 4CHAB 3MU0A 1FY4A 1GBCA 4A92A 4LXBH 2UWOA 2O8WA 2QF0A 5F8ZA 1VITG 2ZDKA 5J4SA 1AN1E 2XBVA 4PROA 2WV9A 4AC9A 1TWXB 1MTNC 1TPOA 3SGQE 4ZMAH 4HFPB 3GCHC 4OGYA 2OUAA 3VB7A 4X1RU 4XBCA 3ELAH 4FUDA 2W3KA 1A1RA 1O3HA 5FAHA 3RXVA 2W6ID 1F5LA 1OWHA 2KCPA 4RT1A 2D26C 2VH6A 1GBFA 2CF8H 1BT7A 3AW0A 3PWCA 1H8ED 1AY6H 3F0OA 1EAWA 1QRXA 1FXYA 2BTCE 1W10U 2PLXA 3G01A 4IN1A 1QQ4A 1SLXB 1F0TA 1C5WB 3NCLA 1FI8A 4YT6H 4DIHH 5F8TA 4TT3D 2XCNA 2UWLA 1V2MT 5AF9H 1UK3A 2F9PA 5C1UA 4MDSA 1EXFA 2NU2E 5F8XA 1CSOE 2BZAA 4NWLA 5GWZA 2VB0A 3ITIA 3TIUA 1FLEE 3O8BA 1YM0A 4KP0A 2XRCA 1GI6A 5FPYA 1GCDA 1W12U 1C5QA 1PFXC 3PMBB 2L74A 1AVXA 1P2JA 3BTWE 4ISNA 5J4QA 2BD7A 1A5HA 3O8DA 3MMGA 1BRBE 1XMNB 2GCHG 1GMHG 1HIAB 2FWWA 2QF4A 3V3MA 1T31A 3GY3A 3DCLA 1AFQC 1LHEH 4WJG2 1AQ7A 2BQ6B 3PROA 1YPEH 1ELAA 3VXEH 2F9NA 4CBOA 1GI8B 1Y5BT 4DCDA 3SZEA 1BMNH 5DP6A 1V2JT 2WPMS 2FIRH 3SBKA 4ABHA 1YBWA 3F0PA 1ZGVA 5GNDA 3E90B 4JZIA 1BTUA 2CV3A 1QURH 1ZPBA 1LMWB 1O39A 4Y71A 1P09A 1SL3A 1GDNA 2YMSB 4X6NA 1OWJA 1YKTA 2UUFB 2R2WU 1IQEA 1XKAC 2VBCA 3GY4A 3SJIA 1HPGA 1XX9A 4ZHAA 3ZZBA 1NFXA 2QXJA 2AGIX 1T4UH 3VPKA 3DUXH 2ZGBH 4VGCC 1EP5A 1K22H 1LPKB 4AYYB 3F68H 2JH0D 3BTTE 1AKSA 1ETSH 4BAKB 1D3TB 1AGJA 1O31A 1O5AB 3VGCB 1P2KA 2FOBA 2V3MA 3SU3A 3Q3YA 1BTYA 2XC4A 3VG8A 1PPBH 1SGIB 6CHAB 2OQUA 1GJBB 1P01A 3GCTF 1GCTC 1Q3XA 4TPYA 1DXWA 3DSOA 1GHVH 1L2EA 1EB1H 1Z8JB 1ZOMA 1SGRE 4WH8A 3ZVFA 3QX5H 3SHCH 2QYIA 3FANA 4NSYA 1YWUA 1UVTH 2BDBA 1O2GH 2AMDA 1HAIH 5A2MH 3SUFA 2RA3A 5C1YA 1L1JA 2C8WB 1D3PB 1UVPA 2IOTA 5LPRA 2ZFQH 1C5MD 1AB9C 1LQEA 2A7CA 3SOSA 2XC0A 4LZ4B 2SNVA 4OS2A 2EI6A 1ZTLA 4I8LA 1P9SA 2WPLS 1FN6A 3I77A 4Q7YA 2B5TB 2FP7B 1LVOA 1V2QT 4A1VA 2C4FH 2H5DA 2ZGJA 2G5NA 2KM0A 4TYDA 3FZZA 1G2LA 5GCHF 3SNAA 4CHAC 1O34A 5EJLA 3N7DA 2RFKC 3ZVBA 3GICB 1C5PA 3NXPA 1ZMJA 2ZHQH 5HM9A 1HJAC 1ARCA 2GT7A 1QY6A 2FX6A 2THFB 1C5YB 3H7TA 4Y7BA 1GJ8B 3EE0B 2QV1A 3AASA 2RDLA 2HNTF 1TALA 4K2YA 1OOKB 2ZQ2A 2LELA 2KCOA 1FY1A 5EXLA 5K0HA 2A2XH 3GCTG 4UFGH 1O3LA 3FP6E 1P2IA 1O2HA 4WXIA 1NRSH 3GS9A 2AS9A 1XXFA 2QY0B 1YPHC 2G4TA 1MH0A 5HMAA 5DKMA 2AMQA 1MTSA 5B6LA 1GHYH 4DJZB 1Z6JH 2BM2A 1ZGIA 1FY8E 1A3BH 1VGCB 5DP4A 2FOMB 4CREA 1J9CH 3M37A 1XKBC 4CR5A 3OYPA 2SGFE 1GBBA 3PMAB 2EQNA 1EJMA 1A3EH 3KGPA 4MPXA 4ISHH 3F9FA 1SGPE 3LGUA 1OWEA 1ZSJA 2YMSC 4I8KA 2G4UA 1HAGE 1O3PB 1JOUB 2BY6X 1E38B 1DUAA 4Q2KA 1S6LA 4CRBA 4NA7A 3T26A 4X8TH 1V2NT 4U2WA 3BG8A 2H1UA 2VVCA 1QJ7B 3GCHB 3EDXB 4E7RG 5JB9S 2BB4A 3LPRA 1W3CA 2OBQA 2SGQE 1E0FD 1V3XA 1JBUH 1UVOA 4DVAU 2ZWLH 3OTPA 1EB2A 1GBDA 2BD3A 3A88A 4B2CA 2BXTH 3PWBA 2HNTC 1W7XH 5C17A 1YP9A 4TWYA 3ZIAD 1TBQH 3M5MA 2SGAA 4KKDA 5CMXH 2ILNA 3TH2H 1GBJA 5EIYA 1UJ1A 4KGAA 3S9BA 2JETC 2GZ9A 1GJDB 4BXWA 4ASUD 2H2ZA 4MNXA 2Q6DA 3LOXA 1DITH 1FY3A 1BRUP 4D8NA 3GDUA 4BAOB 3CP7A 2KZ4A 4X0WU 1C4U2 3NRLA 1HAVA 3URCA 1UMAH 4O97A 1PQAA 4SGBE 4O3TA 3M3VA 3TK6A 1IQFA 5JBBS 1EZQA 2GZ7A 3QO6A 1TOCB 1VR1H 4B74A 1BBRH 3E6PH 1XVOA 2J98B 2PP6A 1Y3XA 3UOUA 1ZHMA 2FLRH 5IYTA 5H4IB 4FU9A 5GIBA 5EU8A 1WTGH 2L6OA 5HGGA 1SC8U 1PPGE 2FM2A 1GI7B 3FO8D 2F83A 2BQ7B 1FV9A 1QRWA 3P8NA 4VGCB 1BOQA 1SGFA 1THPB 4YOJA 3RLWH 4D7FA 1C1TA 1D9IA 3RXSA 4JYVH 3S9AA 4I8JA 2VIOA 1ELEE 1H8DH 5FXLA 1VZQH 1RTFB 2YNAA 3GYLB 1RXPA 4IN2A 5GXPA 4AFQA 2OLGA 1BTZA 3TPIZ 5FCRA 4CH2B 3BEFB 4KELA 1FZZA 1MCTA 3E0NB 1Q31A 1SB1H 4X2WA 1KDQB 3RC5A 3DHKH 1V2RT 1B7XB 1DANH 1KXBA 1MTNB 2ULLA 4Y76A 3TLOA 1O3IA 2DE9A 2TIOA 1C5ZB 1K1IA 3P6ZB 4M9FA 2OC8A 4B6FA 3T62A 1A2CH 4HTCH 4BAMB 2ZTYA 4QT8C 1WBGB 5C2ZA 4B6EA 1A5IA 1SSXA 1TB6H 4R8TB 1ZMNA 2OINA 4INLA 1K21H 3QN7A 1D3QB 4ABJA 1FUJA 1ELBA 1GHAG 1H9LB 1YPMH 3K9XB 1GVLA 1GCTB 1O5EH 1TX7A 4UONA 1Y3VA 3OEHD 1IQNA 1HAYB 1K1PA 1THSH 2TGDA 3UNQA 4ZHLU 2TGPZ 1C4Y2 1FAXA 3JZ2B 3KQEA 4ABFA 2DUCA 3UR9A 4F48B 1O5DH 4THNH 4WMEA 1H9IE 5E0HA 4I86A 2BQWB 4K1SA 2H6MA 1MAYA 1O2XA 4F55A 3RXRA 3U9AH 3K6YA 1G3CA 2ZPRA 1QA7A 3UY9A 5FBEA 1U6QA 3ZVGA 1BCUH 1SLUB 1BTWA 1TQ7B 3RXFA 1O5FH 3RXAA 2UUYA 5FHTA 3HGPA 2F9VA 1V2KT 2JETB 1C5UA 1JRTA 3FP8E 1GMCG 2C8XB 3FFGA 1OWKA 4ZHMU 1SFIA 5GJ4B 1C5NH 2BDIA 4BANB 4GAWA 1GBEA 1LVYA 2FX4A 1G3DA 3RXIA 1BJUA 3QGNB 1K28D 3M3SA 4I7YH 3SUGA 1TA2A 4MLFB 2PSXA 2GTBA 1DSUA 4BAHB 1LHGH 3WW7A 1MMJN 2O9QA 2CGAA 3H09A 8LPRA 4O03A 4XBBA 3HKJB 1DPOA 1F0RA 1C1WH 3OTJE 3BN9A 1HAVB 3F2FA 3V0XA 4ZKOU 3LGVA 2ODYB 3PO1B 3M3TA 3HPTB 4XBDA 4GUXA 2OC1A 1TX8A 3M7QA 2G00A 4OGXA 1SQRA 1GBHA 1SGTA 3RMLH 1A46H 1NTPA 1S82A 3DSGA 3PB1E 5JDUB 1J17T 1SQAA 2XNDD 3BG4B 1NFWA 1S84A 1PYTD 1GJ9B 5I46H 1IHTH 1VJ9U 1GHBF 1GG6B 2BXUH 3TGKE 1J15A 3Q77A 3PLPA 2ZDLA 3UPEA 3GDVA 5DPAA 4WWYA 3MI4A 2GGVB 5FPTA 1O3NA 3VB4A 3UR6A 1Z8GA 3TJVA 3E0PB 5AHGH 3RXGA 4DURA 3S69A 1C1OA 2ZTXA 1EPTC 3FVFB 4Z0KA 3WWBA 4FUIA 4BNRA 5HXFA 5CDFE 3A8CA 1O2QA 2GVFA 4BTTB 5L6NH 5EJZA 3MOCA 3A82A 2W7SA 1O2KA 1BA8B 2PV9B 3C1KA 1GBAA 3RXKA 1MQ6A 1GJ5H 5PTPA 1MTUA 1AMHA 1TNHA 1TNKA 3E16B 2J34A 2BHGA 1DDJA 4E05H 4Y8ZA 3RDZA 1NROH 2WHXA 1AU8A 1DE7H 1KSNA 4DOQA 5EXNA 1YPGH 1E35B 1DWEH 4K8YA 2ZF0H 3FP7E 3ENSB 2G5VA 2FODA 2J9NA 3A89A 1UK2A 1UW7A 3RXMA 1MKXH 1SGYE 2A5AA 4Y6DA 1G37A 1EX3A 1O3FA 4MG3A 4X6MA 3ATWA 1WXRA 1ELFA 1SLWB 2EY4C 1XUGA 1P3EA 1QB6A 1UTKA 2J97A 2AGGX 4TY7A 3MNBA 2KAIA 1GHBG 1E1QD 1JIMA 1O2SA 3RXQA 4YT7H 2XOKD 1D4PB 2TPIZ 1OP8A 5F03A 1TGNA 3BF6H 1ACBE 4IC6A 1ZSKA 1C5SA 3K2UA 2R2MB 2CJIA 2ZDVH 1QTFA 2I6SA 3L3TA 2ZFSA 2GZ8A 3UOPA 3SN8A 2Z9GA 2XTTB 4TPIZ 2FOHA 1ZHPA 1DM4B 1P9UA 3NKKA 2ZCHP 4X1SU 4B2AA 3ZVAA 2QCYA 2PUQH 1YPHE 1V6DA 1NBMD 2ZO3H 4AB8A 3BG4C 3PV2A 4NFFA 3OFND 3A84A 1O3MA 1HJ9A 2UUKB 4NG9H 4ACBA 4INHA 5ABWA 1O2PA 1QBNA 3T29A 3RP2A 3SJ8A 4I33A 1SI5H 1C1QA 3VB3A 3LONA 1V2UT 1PPHE 2R9PA 2ZPQA 1KLIH 2O8MA 4IC5A 4IMQA 1FX0B 1Y5UT 4ISOA 3RXOA 1NFUA 2F9OA 1NZQH 1UTQA 1FIZA 1C1NA 4K1EA 2ZU1A 5C5OA 1HAXB 4FOUC 1Y3YA 4ABIA 4YZUA 3MO9A 1FIWA 5IDKA 4NFEA 1QZ8A 2FOAA 5HYOA 1P2NA 1O2YA 1BRAA 5GPIB 4CR9A 2JIZD 2VNTA 4HI3A 1HFDA 1UTPA 1ZJDA 5BRRE 2WV4A 3A8AA 1K9OE 1ZLRA 4B2BA 1AKSB 1XUKA 3HATH 1Z8RA 2A1DB 3KN2A 3TGIE 1SQOA 4H4FA 4ZKSU 5LPEA 1CGHA 2ODQA 2HNTE 4RKJB 1SG8B 4Z1MD 2FOFA 1N1LA 1FJSA 2OC7A 1G3EA 1O2UA 1ESTA 4GVUA 4X2YA 2BX3A 1AIXH 1W13U 2WPDD 4FUFA 2AEIH 2R3YA 2BVRH 1E1RD 3SV6A 2ZIQH 2WPKS 3MNXA 5DP7A 3P8FA 1HRTH 2W26A 3PLBA 3DFJA 4CRAA 4ABAA 1RIWB 1TE0A 3ZZAA 2BDCA 1OSSA 3RM2H 3CS0A 4ISLA 1HAPH 2KAIB 1CA0B 5F6MA 1F0UA 1X7AC 4B76A 2J94A 1RRKA 2O8UA 2XWBI 3PRDA 4WVPE 3RM0H 3VB6A 1EASA 3TH3H 6GCHF 3MH7A 2ZNKH 1WOFA 2JH5D 5CE1A 1BUIA 1SGDE 3TGJE 3FOAA 4FVBA 1AD8H 3RXUA 5DO4H 1LO6A 1EP6A 2CMYA 3LC3A 1F5RA 1LCYA 1BB0B 1TLDA 3MNSA 1SMFE 2Y5GA 1HXEH 4GPGA 1OX1A 3ATIA 3MYWA 3OX7U 4X1NU 3PYHA 4Q7ZA 3AK5A 2WPJS 4K8BA 1MTVA 1TGSZ 7KMEH 3V13A 1UTLM 3BIUH 7GCHG 2FESH 1MKWH 4ZCNA 1XUIA 2VWNA 3B8JA 2Z9JA 3E3TA 4MPWA 8GCHG 2JJ2D 4NZQA 3KNXA 4OS5A 1C1SA 3MFJA 5A09A 4FVDA 1PYTC 2A4QA 3ATMA 2AH4X 2UWPA 4X2VA 3LH3A 3LIWA 1SGEE 2CN0H 3CS7A 3OE7D 4CRDA 2NU1E 3SUEA 1AFEH 2A45B 2IPHA 3PO1C 4P02A 5DSFA 2XC5A 2A4GA 1SGNE 2QA9E 1C5RA 2ALPA 2P8OC 3ZVCA 3B23B 2F43B 2SGDE 4RT0A 1W0KD 2YOLA 4J1YA 1QFKH 1Y5AT 3SU6A 1NM6A 4ZKNU 3UUZA 5C1XA 3BEUA 3RU4E 3IITA 2V3HH 1TABE 1S83A 3TNSA 1WCZA 2XBXA 1KLTA 2PUXB 3QTVH 4I8GA 1EZSC 1LHFH 3D62A 3BTKE 1O2LA 1MD7A 2VINA 4HG6A 1F0SA 5AVDA 1S85A 1A61H 3LU9B 2VVUA 5E0GA 3RUOA 1HB0B 6CHAC 2K8IA 1UVSH 5EODA 4DIIH 4CBNA 2A2QH 1GJAB 4RN6A 3UIRA 1KXFA 3JZ1B 4X6PA 2C3SA 1V2LT 3EQ0H 5DP9A 1CGIE 5FX6A 3PM3A 4LZ1H 3PMHB 3TH4H 1IQHA 3A8BA 2QXHA 4YLUA 1MD8A 2HPPH 1ZMLA 1C4V2 3T28A 7GCHF 1K1MA 3PV4A 1AUJA 2GKVE 1QL9A 4YESB 4FU7A 1EQ9A 4RSPA 1H1BA 3QZQA 1T7CA 3DD2H 3UFAA 1Y8TA 2UUJB 1BMLA 1CU1A 1P0SH 8ESTE 3U28C 1B0FA 1P06A 1UTNA 2Z3CA 2VIVA 3SQHE 9ESTA 3OY6U 3OU0A 3SNEA 2IPQX 3QLPH 4FUBA 2OK5A 1QRZA 1O3OA 1BBRE 1ABJH 4B73A 1W8BH 1CO7E 2BLWA 4A5TS 2FS9A 3HK6B 1MUEB 1YC0A 4AORA 2ZDMA 1B5GH 1O2ZA 1P05A 3M36A 3CNRA 4UDWH 5JYIA 3VEQB 5IK2D 3MQKC 1G36A 1CHGA 3PTNA 4GCHF 5G4BA 1UCYE 3VGCC 3AVZA 2F91A 2FOGA 1DY8A 6ESTA 5EPYA 2OP9A 3ZV9A 1DXPA 3SU1A 2VGCB 3SU5A 1OWDA 1C2KA 1NRPH 3U69H 1JMOH 1QCPA 2Y80A 5BPEA 3MO6A 3ATKA 1NY22 2AHME 3QK1A 1AVWA 2FI3E 2NU0E 5F53A 3SW2B 1N8OC 2HALA 4X1QU 1HJAB 1A0JA 1COWD 2GD4B 1TRYA 1BITA 1W0YH 3ZZCA 3VFEA 1GGDC 1W7GH 1HAZB 2BYAX 2JH6D 2Q6FA 1P2MA 1Z1JA 3MU8A 3RXDA 1NBME 1V2ST 3SJOA 4Y0ZE 1LPZB 1SGQE 2GV6A 1O2JA 1JIRA 5A0AE 2ALVA 1QR3E 1O2RA 2ZU3A 4YTAA 1AWFH 1DX5M 1VGCC 4A1XA 1EOJA 4R0IA 3LGTA 5EG4A 4JK5A 3UQVA 1O2WA 1C2IA 3IG6B 1LDTT 3C27B 3PMJA 5TJXA 3STIA 5EW2H 4IBLH 2GDDA 2F3CE 5T6GA 2FTMA 4O9VA 4JZDH 8KME2 1HAHH 2PR3A 5ESBA 4D76A 2Q1JA 1LTOA 4TSFD 1MTWA 4XD7D 1OWIA 2P8OB 5EOKA 2HGTH 3M5LA 2HRVA 2ZCLP 4AGJA 1IQIA 1CT2E 2WUBA 2WYGA 4KTSA 1QBOA 3L33A 1ELCA 1ZR0A 1SPJA 3EYDA 1BIOA 4NA8A 1BBRK 1EPTA 2WPHS 4UFEH 3SNBA 2ZC9H 2A5KA 3STJA 1XUJA 5TCAA 4ASHA 3GCNA 3E1XB 4BOHA 4ACAA 3N99A 2F9BH 1S0RA 2BLVA 2Z3DA 2TGTA 3UNSA 1EAUA 1ELTA 1KXCA 1O3BA 2ZFFH 3L6PA 3F1SB 1CBWC 3M35A 2XW9A 1TGCA 1LHCH 5CHBA 1GI5A 4CRCA 3EA9A 1TQ0B 3Q3KA 4XRNA 1SVPA 4MPVA 1MAXA 2VWOA 1O38A 4WXVA 4AB9A 1J8AA 1AE8H 2G8TA 1QNJA 1H9HE 2FMJA 5HIZA 1O5CB 4WH6A 2P95A 4YLQH 3OEED 1H8HD 2JJ1D 3UNRA 2ZU5A 1J14A 1XVMA 3LGWA 2QIQA 1ZZZA 5EQSA 2V0BA 1CE5A 3SO3A 2W6JD 1QA0A 3MH4A 4Q4LA 3SV7A 5C20A 1IQKA 1KXDA 1YGCH 2QXIA 2Q6GA 1GHZA 1Y3UA 2XXLA 5HKKD 1IQGA 4I31A 1NS3A 1C2LA 2AIPA 1NESE 1HV7A 2WV5A 1T8NA 1TBZH 3D49H 5FX5A 1CHOG 1GI1A 4JZEH 1BMAA 2QAAA 3RXJA 3S7HB 2P3UB 2AYWA 3F9HA 1GL1A 1SBWA 5EPNA 1GJ6A 1P2QA 1DOJA 2FEQH 1TNIA 1GVZA 4RI0A 4GHQA 3SJ9A 1ELVA 1EOLA 3RU4D 3PV5A 4NIWA 2O8TA 1O3AA 1MBQA 1ESBA 2JDID 1UTMA 1DY9A 2W5EA 2Y82A 4D9QA 1TMUH 3EAJA 5E2OA 1S6FA 1YCPK 1SHHB 3I29A 1H4WA 4LK4A 1JXPA 1NRQH 2C93B 1IHSH 1DICA 1VITF 2PSYA 4E06H 1HBTH 4Y11E 1EZUC 2M2AA 1FDPA 3HK3B 1C2HA 2OCVB 2HLDD 4CRGA 1YLCA 1TRMA 2A0QB 1GMDG 2AGEX 1O2NA 1DVAH 2QGRA 2ZU2A 1T8MA 2FPZA 2BVXH 3SNDA 1P8VC 1UO6A 4F49A 1DWBH 1EFRD 2D1JA 4ZXYH 3SU4A 1E79D 2DE8A 2BMGB 1EAIA 3S7KB 4FUGA 3KEEA 2QC2A 2Y7XA 1ZHRA 2ZFPH 5E8EH 2KX4A 1ZTJA 1K1OA 2K0QA 2AMPA 2B9LA 2P3TB 4UD9H 1MZAA 4BAQB 3UTUH 4X2XA 5T1VA 1WQSA 1A4WH 2OTVA 2B8OH 3BTDE 3TITA 2HPQH 1VCPA 2A32A 1W14U 4U30A 1AE5A 4FUHA 2HLCA 2C8YB 2J5UA 1EKBB 1K0HA 1VCQA 1YY3A 1SOZA 5T3HA 3RU4T 1GBKA 2FOCA 1O36A 1AFQB 2RA0A 2WPIS 1SR5C 1O35A 1BMFD 3SV2H 5AFZH 3BTEE 1TPPA 1AZ8A 1FNIA 4KTCA 1O3KA 4AX9H 1L1NA 1P04A 3DSPA 4ZAEA 3PTBA 1E34B 1WTHD 3F9GA 2ZFRH 1NT1A 1WUNH 2KCAA 2FO9A 5FCKA 4AFSA 1G2MA 1PPEE 2GJGA 1TONA 2GCHF 2QE7D 3BTFE 2R0LA 4RKOB 3SGBE 3AW1A 1C1UH 1OP0A 1S81A 3KQBA 4FUEA 1EPTB 1GJ7B 1UTOA 2EC9H 3SQEE 4Y8YA 1LVBA 3RMOH 4KTUA 4D7GA 3GYMA 4WMDA 5DP5A 4I8HA 2OD3B 5A8XA 2PTCE 2XCFA 1C1RA 1TMTH 1HDTH 2F9UA 1KMHB 1C2EA 2R0KA 1XUHA 3P95A 2FYQA 1C1MA 2V35A 1SGFG 9LPRA 2WINI 3E91A 2VWMA 2CK3D 1QJ1B 1O30A 2P93A 1O2VA 4DT4A 1P2OA 1W0JD 2H9EH 3RXTA 1C2JA 1WQVH 1OYQA 1W2KH 2BY5X 3BEIB 2A31A 4CH8B 2RCEA 1HGTH 1YCPH 3N7EA 2CXVA 4AFZA 2J38A 3O8CA 4AZ2B 3T5FH 4A7IB 1BTXA 3H7OA 4P00A 6GCHG 1KYNA 5DG6A 2D8WA 2J95A 1AI8H 2LNCA 3GOVB 4JZ1A 1DT2A 5ESTE 1V2OT 2P59A 2F4LA 2VIPA 4IS5A 1K1JA 2FS8A 1G30B 1D6WA 4ZUHA 1BRCE 1GJCB 4A1TA 1YPKH 4Y10E 1BHXB 1ZPZA 1PPCE 3SU2A 3E8LA 1M9UA 2BDYA 4JYUH 2D2DA 4Q7XA 3NUMA 2BD2A 1GMCF 3ZZ5A 1HNEE 3QTOH 1PPZA 1SFQB 3NZIA 2A7HA 2VJ1A 2ZKSA 1QJ6B 3A86A 2LP6A 3MWIU 1C5LH 1CHOF 1MU6B 2BZ6H 5TCCA 4Y7AA 2J92A 1PJPA 2XNIA 3U8TH 1KTSB 1GHXH 1EATA 3DA9B 4GHTA 2ZP0H 3A7ZA 4DGJA 1ZTKA 1O3CA 3FN8A 3KF2A 3MU1A 1OPHB 2BLQA 1V2VT 4JK6A 2BDHA 4TWWA 2KCYA 2SNWA 3EA7A 5LGOA 1VITH 2VVVA 4U32A 2PHBA 1BMMH 1DWCH 1E36B 1ANCA 1ARBA 3A83A 1LKBA 5DP8A 1HXFH 1ETTH 6LPRA 1TFXA 3RXPA 5GCHG 3I78A 2KFWA 1V2WT 3T27A 4ZH8A 1GDQA 1FONA 3QUMP 2O8LA 2ZQ1A 3RXBA 3GY8A 4K60A 4ABDA 4Y0YE 3KL6A 1C9PA 5A0CA 1QGFA 3ZVEA 1AVGH 1GMDF 1UK4A 1ELGA 2PKSB 5I25A 1OHHD 3TNTA 2RDEA 3F6UH 1MBMA 1UTJA 3A85A 1ZRBA 1KY9A 2ZPSA 3KQCA 1PQ7A 1EZXC 3KQDA 1RTKA 3ZYDA 1IQLA 5C94A 1LQDB 2ZECA 2SFAA 3SNCA 1ANBA 3FZDA 3BTME 2BVSH 2BY9X 4MQAA 4JZFH 1GG6C 1TPAE 4NA9H 4YOGA 2TGAA 1GBMA 1K1NA 1GBIA 1L4ZA 3TU7H 3CENA 3DFLA 1GPZA 1AHTH 1RGQA 1TGBA 2BOHB 2VU8E 5E2PA 3LGIA 1SKYE 2CF9H 3URDA 1NO9H 4X8VH 2OBOA 1IAUA 1CA0C 1T32A 2C8ZB 1AB9B 5K7RA 4A6LA 1WYKA 5C3NA 1DWDH 3ZV8A 1PQ5A 2ESTE 1VCWA 1PQ8A 5AFYH 4ZROA 2QXGA 2PTNA 4JYTA 1QBVH 2BD9A 3A7TA 2ODPA 4GCHG 1Y3WA 2ZZUH 3MTYA 2EI8A 2ASUB 2ZU4A 5FL7D 4UFDH 2BD8A 3F2GA 1GVKB 2FI5E 1QB9A 3KIDU 2Z7FE 3SI3H 1K2I1 4BXSA 2J4IA 3BV9B 3MU5A 1FAKH 1VKYA 2Z6BD 4U01A 1C2GA 3RXCA 3Q3XA 2P16A 3SYJA 3IWMA 1ZYOA 1EAXA 2EA3A 3GCOA 3M61U 1YF4A 2R3UA 1GI9B 4OS1A 4NIVA 3UWIA 4IGDA 1SHYA 1N6XA 1H8IH 2V7QD 4DY7B 1FN8A 4FUJA 2G81E 1TNLA 3OAAD 4MVNA 4X6OA 1T8OA 3O8RA 5JBTA 2A5IA 4JCNA 4MPUA 2BDAA 2B7DH 2NU4E 2SGPE 3LJOA 3P8OA 1NPMA 2VH0A 3U98H 1D3DB 3EA8A 3F3BA 3TK9A 2Z9LA 5DGJA 1KXEA 5LH8A 2FDAA 4Y79A 5CHAB 1SQTA 1UHBB 2OXSA 1GI2A 1KXAA 3QZRA 5T6FA 3KYFA 1Z7KA 2PFEA 2CHAB 1DLEA 2ZTZA 2XWAA 1C1VH 4ISIH 2XYAA 5L2YH 1RJXB 2STBE 3U1JB 1MKXK 2LPRA 3MO3A 2VIWA 1E37B 3TJUA 1K1LA 1L4DA 3ZZ7A 2TRMA 3U8OH 1C9TA 2ZHFH 4BTUB 5HIYA 2FLBH 3KQ5A 1P03A 1O3JA 3SU0A 2I6QA 5JBAS 2Y5FA 2EEKA 2G55A 1WSSH 5B6OA 2RG3A 4XE4A 3ZZ4A 1ETRH 2M5TA 2ZHDA 3ESTA 1J16A 4NGAH 3LDXH 2WSSD 1FPHH 1EJAA 4TY6A 3KYGA 4B1TA 1QIXB 1GJ4H 4X1PU 1A0HB 2P3FH 1D6RA 4O3UA 4YOIA 2G51A 3SI4H 3ZZDA 4F4OC 4JMYA 1GHAF 2PWXA 1INCA 5A8ZA 2IN2A 1HCGA 1O5BB 3K65B 4AG2A 5EQRA 2V3OH 3RC6A 3M7TA 4AGKA 3SORA 1TRNA 4K69A 1S5SA 1ORFA 2ANWA 2SGEE 3ZZ3A 4FU8A 1OYTH 1BHXF 1G9IE 3B9FH 1F92A 3A8DA 1RS0A 3AAUA 4HGCA 5KEDA 1BQYA 3A7VA 4E7NA 4I32A 1FY5A 4DW2U 3QGJA 1GI0A 2B0FA 4DT7B 4FETA 3LJJA 4X8UH 1TGTA 2C90B 1ANEA 3BIVH 2BY8X 1T4VH 1N8OB 1NN6A 2BY7X 5DP3A 1W11U 2WZQA 4OS4A 1MQ5A 4YXWD 1NC6A 1GGDB 2W7UA 5FBIA 3FAOA 4ABBA 3UB0A 1RTLA 3D65E 1G3BA 1TOMH 3LGYA 1IOEA 1O2IA 1LPGB 4SGAE 1UHBA 1O2OA 2QF3A 4B71A 3SUDA 4XSKU 3S9CA 5DJ7A 1YPLH 2BDGA 1LKAA 3RMMH 2J2UA 4UE7H 1O0DH 5DN6D 1ZJKA 2FYRA 3V7TA 2FZZA 4CRFA 4WMFA 3TVJB 2ZHWH 5L30H 1YLDA 2PKAB 2PW8H 1C5TA 4NIYA 1PPFE 3P8GA 1S6HA 3SHAH 2GV7A 1QL8A 3A7XA 3F2HA 5T6DA 3R3GB 5CHAC 1AZZA 3BTQE 2W3IA 1BZXE 4H6SB 1NRNH 4MNWA 4NIXA 2FI4E 3BTHE 2GMTC 1HIAA 4NCYA 1P10A 3BTGE 3OSYA 3BSQA 2GP9B 3M7UA 7ESTE 1GHWH 1OKXA 4OM9A 2PKSC 3LC5A 4IW4E 2YMSD 5C0UA 1F5KU 4NWKA 2ZDAH 2HOBA 1CGJE 3A87A 3UREA 2ANMH 3ZYEA 1DS2E 1WAYB 1YYY1 1V2PT 3QWCH 4AFUA 1XXDA 5E0JA 4IMZA 1GI3A 1BTHH 3SJKA 2BLOA 4XFQA 3KHVA 5ETXA 1YCPM 3M5NA 2ZHEH 1ZPCA 1L0ZA 1C2FA 3SZNA 5L2ZH 1TBRH 4AN7A 1LHDH 2K1QA 3UQOA 2ZGCA 2PKAA 2VGCC 3MU4A 2ANYA 1MCVA 1YPJH 3P17H 1ELDE 5C67A 1NRRH 1GBTA 3NK8A 2GCTC 1HUTH 3DT0H 5EXMA 1RD3B 2WUCA 1NFYA 4NZLA 1SOTA 1HAOH 1OS8A 2ZGXH 1RFNA 3AAVA 2ZG0H 2EI7A 1P57B 2PGBB 3M5OA 2GDEH 1C5XB 1C1PA 3ZVDA 2ZDNA 3A81A 3H5CB 1HYLA 4LOYH 1FMGA 1TX6A 2BD4A 3P70B 2A4OA 3TJNA 1Y59T 3A7WA 1A5GH 2ZA5A 1EJNA 1JWTA 1FQ3A 2TBSA 1EUFA 2Z3EA 3RMNH 1BDAA 5EJ1A 5GDSH 1O3EA 1C2DA 5EQQA 1TAWA 2ZEBA 1MABB 2J98A 1O3GA 1WDIA 2Z9KA 1P12E 4UFFH
chains in the Genus database with same CATH topology
1GWAA 4WF8A 1Z1IA 3MNCA 3RXEA 1NU7B 1AUTC 3ZZ8A 3W95A 1IQJA 2QN5T 3U1IB 1QHRB 5JPMH 3W94A 1Q2WA 1CQQA 1MZDA 1O32A 1GL0E 1BJVA 1O3DA 3GY6A 1G32B 2NU3E 3Q00A 1IQMA 4HZHA 3N7OA 1OXGA 2Y6TA 4YM9A 1C2MA 3R0FA 4Q80A 1O2MA 1BTPA 1DUEA 1N6YA 5C5NA 3NWUA 3ZZ6A 1UCYK 4AG1A 4K1TA 1ABIH 4XOJA 2Y5HA 1OP2A 1P11E 1C5OH 2A7JA 2CHAC 5HM2A 3ATLA 1FPCH 1SLVB 1GI4A 3PLKA 1KTTB 2NWNA 1AWHB 3T25A 2HWLB 5FPSA 1Z71A 3NPSA 3MH5A 3ODDA 1S0QA 1JRSA 1GMHF 4OS7A 4OS6A 1XUFA 3GY5A 4K3JA 2Z94A 4AYVB 2FTLE 4ABEA 2AERH 2GX4A 3VXFH 1TMBH 3GY2A 4B75A 1ID5H 5LPFA 3ZZ9A 4MNVA 3P92A 1WV7H 3TJOA 3LH1A 1W0ZU 2Z9IA 2ANKH 2H5CA 2VIDA 2A4RA 3GY7A 4H42U 4AOQA 2ZI2H 4GSOA 1ZSLA 2YNBA 1F2SE 1THRH 5JBCS 2OQ5A 3SV9A 2XBWA 1V2TT 3S0NA 2OC0A 1UCYH 1MU8B 1KDQA 1ESAA 3UWJH 3U8RH 3HGNA 3LT3A 1DSTA 1WU1A 2ZFTA 1TIOA 4INKA 5EW1H 3WY8A 2ZCKP 3MH6A 3ODFA 4M7GA 1O37A 2PGQB 1VJAU 4BTIB 4X8SH 1GDUA 2AIQA 1DFPA 5EGMA 1TA6A 2VWLA 4ZXXH 3RXLA 3V12A 3Q76A 1CBWB 2ZGHA 1DLKB 3A7YA 3RXHA 3MHWU 1O2TA 2GT8A 2BD5A 4GLYA 3OY5U 2BOKA 3GDSA 1CA8B 7LPRA 5A8YA 1B0EA 3QDZB 2AFQB 3T2NA 1KIGH 2H9TH 4Z6AH 4YO9A 5A0BA 1O33A 1F7ZA 1QB1A 4J2YB 2HVXA 1P3CA 3RC4A 3F9EA 3SGAE 1P02A 1TPSA 2Y81A 4Y8XA 1SGCA 1UVUH 1TNGA 4ZKRU 2VIQA 1GBLA 1Z8IB 1L1GA 4FXGH 3HKIB 2V6NA 1CT0E 2IJOB 2XBYA 4DG4A 4UEHH 4XDEA 1HJ8A 2STAE 3KCGH 1KLJH 2WYJA 2BX4A 1TYNA 1LVMA 2H9HA 2FXRA 3A80A 4K5ZA 1ZRKA 1AO5A 3LKWA 2P94A 2G52A 1QQUA 1CVWH 3EGKH 5SGAE 1MKWK 2JKHA 2GMTB 2Y7ZA 3SV8A 1NU9A 2FOEA 3GISB 1HLTH 1A0LA 1QL7A 4MNYA 4MTBA 5DK1A 1C5VA 5JB8S 4FUCA 4ABGA 1A7SA 4H6TA 4WY3A 3RLYH 1CT4E 4ESTE 8GCHF 3K6ZA 1ANDA 3D23A 1RIWC 3TK5A 1TNJA 3VB5A 2GCTB 4D9RA 1XM1A 1T8LA 1Z6EA 4NSVA 1O5GH 4CHAB 3MU0A 1FY4A 1GBCA 4A92A 4LXBH 2UWOA 2O8WA 2QF0A 5F8ZA 1VITG 2ZDKA 5J4SA 1AN1E 2XBVA 4PROA 1TWXB 1MTNC 1TPOA 3SGQE 4ZMAH 4HFPB 3GCHC 4OGYA 2OUAA 3VB7A 4X1RU 4XBCA 3ELAH 4FUDA 2W3KA 1A1RA 1O3HA 5FAHA 3RXVA 1F5LA 1OWHA 2D26C 2VH6A 1GBFA 2CF8H 1BT7A 3AW0A 3PWCA 1AY6H 1EAWA 1QRXA 1FXYA 2BTCE 1W10U 2PLXA 3G01A 4IN1A 1QQ4A 1SLXB 1F0TA 1C5WB 3NCLA 1FI8A 4YT6H 4DIHH 5F8TA 2XCNA 2UWLA 1V2MT 5AF9H 1UK3A 2F9PA 5C1UA 4MDSA 1EXFA 2NU2E 5F8XA 1CSOE 2BZAA 4NWLA 5GWZA 2VB0A 3ITIA 3TIUA 1FLEE 3O8BA 1YM0A 4KP0A 2XRCA 1GI6A 5FPYA 1GCDA 1W12U 1C5QA 1PFXC 3PMBB 1AVXA 1P2JA 3BTWE 4ISNA 5J4QA 2BD7A 1A5HA 3O8DA 3MMGA 1BRBE 1XMNB 2GCHG 1GMHG 1HIAB 2FWWA 3V3MA 1T31A 3GY3A 1AFQC 1LHEH 4WJG2 1AQ7A 2BQ6B 3PROA 1YPEH 1ELAA 3VXEH 2F9NA 4CBOA 1GI8B 1Y5BT 4DCDA 1BMNH 5DP6A 1V2JT 2WPMS 2FIRH 3SBKA 4ABHA 1YBWA 1ZGVA 3E90B 4JZIA 1BTUA 2CV3A 1QURH 1ZPBA 1LMWB 1O39A 4Y71A 1P09A 1SL3A 1GDNA 4X6NA 1OWJA 1YKTA 2UUFB 2R2WU 1IQEA 1XKAC 3GY4A 3SJIA 1HPGA 1XX9A 4ZHAA 3ZZBA 1NFXA 2QXJA 2AGIX 1T4UH 3VPKA 3DUXH 2ZGBH 4VGCC 1EP5A 1K22H 1LPKB 4AYYB 3F68H 2JH0D 3BTTE 1AKSA 1ETSH 4BAKB 1D3TB 1AGJA 1O31A 1O5AB 3VGCB 1P2KA 2FOBA 3SU3A 3Q3YA 1BTYA 2XC4A 1PPBH 1SGIB 6CHAB 2OQUA 1GJBB 1P01A 3GCTF 1GCTC 1Q3XA 4TPYA 1DXWA 1GHVH 1L2EA 1EB1H 1Z8JB 1ZOMA 1SGRE 4WH8A 3ZVFA 3QX5H 3SHCH 2QYIA 3FANA 4NSYA 2BDBA 1UVTH 1O2GH 2AMDA 1HAIH 5A2MH 3SUFA 2RA3A 5C1YA 1L1JA 2C8WB 1D3PB 1UVPA 2IOTA 5LPRA 2ZFQH 1C5MD 1AB9C 1LQEA 2A7CA 3SOSA 2XC0A 4LZ4B 2SNVA 4OS2A 2EI6A 1ZTLA 4I8LA 1P9SA 2WPLS 1FN6A 3I77A 4Q7YA 2B5TB 2FP7B 1LVOA 1V2QT 4A1VA 2C4FH 2H5DA 2ZGJA 2G5NA 4TYDA 3FZZA 1G2LA 5GCHF 3SNAA 4CHAC 1O34A 3ZVBA 3GICB 1C5PA 3NXPA 1ZMJA 2ZHQH 5HM9A 1HJAC 1ARCA 2GT7A 1QY6A 2FX6A 2THFB 1C5YB 3H7TA 4Y7BA 1GJ8B 3EE0B 2QV1A 3AASA 2RDLA 2HNTF 1TALA 4K2YA 1OOKB 2ZQ2A 1FY1A 5EXLA 5K0HA 2A2XH 3GCTG 4UFGH 1O3LA 3FP6E 1P2IA 1O2HA 4WXIA 1NRSH 2AS9A 1XXFA 2QY0B 1YPHC 2G4TA 1MH0A 5HMAA 5DKMA 2AMQA 1MTSA 1GHYH 4DJZB 1Z6JH 2BM2A 1ZGIA 1FY8E 1A3BH 1VGCB 5DP4A 2FOMB 4CREA 1J9CH 3M37A 1XKBC 4CR5A 3OYPA 2SGFE 1GBBA 3PMAB 1EJMA 1A3EH 3KGPA 4MPXA 4ISHH 3F9FA 1SGPE 3LGUA 1OWEA 1ZSJA 4I8KA 2G4UA 1HAGE 1O3PB 1JOUB 2BY6X 1E38B 1DUAA 4Q2KA 4CRBA 4NA7A 3T26A 4X8TH 1V2NT 4U2WA 3BG8A 2H1UA 2VVCA 1QJ7B 3GCHB 3EDXB 4E7RG 5JB9S 2BB4A 3LPRA 1W3CA 2OBQA 2SGQE 1E0FD 1V3XA 1JBUH 1UVOA 4DVAU 2ZWLH 1EB2A 1GBDA 2BD3A 3A88A 4B2CA 2BXTH 3PWBA 2HNTC 1W7XH 1YP9A 4TWYA 1TBQH 3M5MA 2SGAA 4KKDA 5CMXH 2ILNA 3TH2H 1GBJA 1UJ1A 4KGAA 3S9BA 2JETC 2GZ9A 1GJDB 4BXWA 2H2ZA 4MNXA 2Q6DA 3LOXA 1DITH 1FY3A 1BRUP 4D8NA 3GDUA 4BAOB 3CP7A 4X0WU 1C4U2 1HAVA 3URCA 1UMAH 4O97A 1PQAA 4SGBE 4O3TA 3M3VA 3TK6A 1IQFA 5JBBS 1EZQA 2GZ7A 3QO6A 1TOCB 1VR1H 4B74A 1BBRH 3E6PH 1XVOA 1Y3XA 3UOUA 1ZHMA 2FLRH 5IYTA 5H4IB 4FU9A 5GIBA 5EU8A 1WTGH 5HGGA 1SC8U 1PPGE 2FM2A 1GI7B 2F83A 2BQ7B 1FV9A 1QRWA 3P8NA 4VGCB 1BOQA 1SGFA 1THPB 4YOJA 3RLWH 4D7FA 1C1TA 1D9IA 3RXSA 4JYVH 3S9AA 4I8JA 2VIOA 1ELEE 1H8DH 5FXLA 1VZQH 1RTFB 2YNAA 3GYLB 1RXPA 4IN2A 5GXPA 4AFQA 2OLGA 1BTZA 3TPIZ 5FCRA 4CH2B 3BEFB 4KELA 1FZZA 1MCTA 3E0NB 1Q31A 1SB1H 4X2WA 1KDQB 3RC5A 3DHKH 1V2RT 1B7XB 1DANH 1KXBA 1MTNB 2ULLA 4Y76A 3TLOA 1O3IA 2DE9A 2TIOA 1C5ZB 1K1IA 3P6ZB 2OC8A 3T62A 1A2CH 4HTCH 4BAMB 2ZTYA 4QT8C 1WBGB 5C2ZA 1A5IA 1SSXA 1TB6H 4R8TB 1ZMNA 2OINA 4INLA 1K21H 3QN7A 1D3QB 4ABJA 1FUJA 1ELBA 1GHAG 1H9LB 1YPMH 3K9XB 1GVLA 1GCTB 1O5EH 1TX7A 4UONA 1Y3VA 1IQNA 1HAYB 1K1PA 1THSH 2TGDA 3UNQA 4ZHLU 2TGPZ 1C4Y2 1FAXA 3JZ2B 3KQEA 4ABFA 2DUCA 3UR9A 1O5DH 4THNH 4WMEA 1H9IE 5E0HA 2BQWB 4K1SA 2H6MA 1MAYA 1O2XA 3RXRA 3U9AH 3K6YA 1G3CA 2ZPRA 1QA7A 3UY9A 5FBEA 1U6QA 3ZVGA 1BCUH 1SLUB 1BTWA 1TQ7B 3RXFA 1O5FH 3RXAA 2UUYA 5FHTA 3HGPA 2F9VA 1V2KT 2JETB 1C5UA 1JRTA 3FP8E 1GMCG 2C8XB 3FFGA 1OWKA 4ZHMU 1SFIA 5GJ4B 1C5NH 2BDIA 4BANB 4GAWA 1GBEA 1LVYA 2FX4A 1G3DA 3RXIA 1BJUA 3QGNB 1K28D 3M3SA 4I7YH 3SUGA 1TA2A 4MLFB 2PSXA 2GTBA 1DSUA 4BAHB 1LHGH 1MMJN 2O9QA 2CGAA 8LPRA 4O03A 4XBBA 3HKJB 1DPOA 1F0RA 1C1WH 3OTJE 3BN9A 1HAVB 3V0XA 4ZKOU 3LGVA 2ODYB 3PO1B 3M3TA 3HPTB 4XBDA 4GUXA 2OC1A 1TX8A 3M7QA 2G00A 4OGXA 1GBHA 1SGTA 3RMLH 1A46H 1NTPA 1S82A 3PB1E 5JDUB 1J17T 1SQAA 3BG4B 1NFWA 1S84A 1PYTD 1GJ9B 5I46H 1IHTH 1VJ9U 1GHBF 1GG6B 2BXUH 3TGKE 1J15A 3Q77A 3PLPA 2ZDLA 3UPEA 3GDVA 5DPAA 4WWYA 3MI4A 2GGVB 5FPTA 1O3NA 3VB4A 3UR6A 1Z8GA 3TJVA 3E0PB 5AHGH 3RXGA 4DURA 3S69A 1C1OA 2ZTXA 1EPTC 3FVFB 4Z0KA 4BNRA 4FUIA 5HXFA 3A8CA 1O2QA 2GVFA 4BTTB 5L6NH 3MOCA 3A82A 2W7SA 1O2KA 1BA8B 2PV9B 3C1KA 1GBAA 3RXKA 1MQ6A 1GJ5H 5PTPA 1MTUA 1AMHA 1TNHA 1TNKA 3E16B 2J34A 2BHGA 1DDJA 4E05H 4Y8ZA 3RDZA 1NROH 1AU8A 1DE7H 1KSNA 4DOQA 5EXNA 1YPGH 1E35B 1DWEH 4K8YA 2ZF0H 3FP7E 3ENSB 2G5VA 2FODA 2J9NA 3A89A 1UK2A 3RXMA 1MKXH 1SGYE 2A5AA 4Y6DA 1G37A 1EX3A 1O3FA 4MG3A 4X6MA 3ATWA 1ELFA 1SLWB 1XUGA 1P3EA 1QB6A 1UTKA 4TY7A 2AGGX 3MNBA 2KAIA 1GHBG 1JIMA 1O2SA 3RXQA 4YT7H 1D4PB 2TPIZ 1OP8A 5F03A 1TGNA 3BF6H 1ACBE 4IC6A 1ZSKA 1C5SA 3K2UA 2R2MB 2CJIA 2ZDVH 1QTFA 2I6SA 3L3TA 2ZFSA 2GZ8A 3UOPA 3SN8A 2Z9GA 2XTTB 4TPIZ 2FOHA 1ZHPA 1DM4B 1P9UA 3NKKA 2ZCHP 4X1SU 4B2AA 3ZVAA 2QCYA 2PUQH 1YPHE 1V6DA 2ZO3H 4AB8A 3BG4C 4NFFA 3A84A 1O3MA 1HJ9A 2UUKB 4NG9H 4INHA 5ABWA 1O2PA 1QBNA 3T29A 3RP2A 3SJ8A 4I33A 1SI5H 1C1QA 3VB3A 3LONA 1V2UT 1PPHE 2R9PA 2ZPQA 1KLIH 2O8MA 4IC5A 4IMQA 1Y5UT 4ISOA 3RXOA 1NFUA 2F9OA 1NZQH 1UTQA 1FIZA 1C1NA 4K1EA 2ZU1A 5C5OA 1HAXB 1Y3YA 4ABIA 4YZUA 3MO9A 1FIWA 5IDKA 4NFEA 5HYOA 2FOAA 1P2NA 1O2YA 1BRAA 5GPIB 4CR9A 2VNTA 4HI3A 1HFDA 1UTPA 1ZJDA 5BRRE 2WV4A 3A8AA 1K9OE 1ZLRA 4B2BA 1AKSB 1XUKA 3HATH 1Z8RA 2A1DB 3KN2A 3TGIE 1SQOA 4H4FA 4ZKSU 5LPEA 1CGHA 2ODQA 2HNTE 4RKJB 1SG8B 2FOFA 1N1LA 1FJSA 2OC7A 1G3EA 1O2UA 1ESTA 4GVUA 4X2YA 2BX3A 1AIXH 1W13U 4FUFA 2AEIH 2R3YA 2BVRH 3SV6A 2ZIQH 2WPKS 3MNXA 5DP7A 3P8FA 1HRTH 2W26A 3PLBA 3DFJA 4CRAA 4ABAA 1RIWB 1TE0A 3ZZAA 2BDCA 1OSSA 3RM2H 3CS0A 4ISLA 1HAPH 2KAIB 1CA0B 5F6MA 1F0UA 1X7AC 4B76A 2J94A 1RRKA 2O8UA 2XWBI 4WVPE 3RM0H 3VB6A 1EASA 3TH3H 6GCHF 3MH7A 2ZNKH 1WOFA 2JH5D 5CE1A 1BUIA 1SGDE 3TGJE 4FVBA 1AD8H 3RXUA 5DO4H 1LO6A 1EP6A 2CMYA 3LC3A 1F5RA 1LCYA 1BB0B 1TLDA 3MNSA 1SMFE 2Y5GA 1HXEH 4GPGA 1OX1A 3ATIA 3MYWA 3OX7U 4X1NU 3PYHA 4Q7ZA 2WPJS 4K8BA 1MTVA 1TGSZ 7KMEH 3V13A 1UTLM 3BIUH 7GCHG 2FESH 1MKWH 1XUIA 2VWNA 3B8JA