3RXQA

Crystal structure of trypsin complexed with benzamide (f01 and f05, cocktail experiment)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxqA02
3LGVA 3MH4A 2VH6A 4U01A 1GBFA 1P03A 4B2CA 4X8VH 2FOMB 3MU5A 4WH6A 2TRMA 2P94A 3A82A 1ZYOA 2BYAX 2AEIH 3S9AA 3Q3XA 3TITA 1O2NA 3B9FH 1SGFA 1TPOA 2FDAA 1QB9A 5ESBA 1C5WB 1O3BA 3ZZCA 1DY8A 3E0PB 4CRCA 4XFQA 3QTVH 4KP0A 2V3OH 1EZXC 3ZVCA 3CP7A 4FU7A 4DW2U 2NU1E 1TNKA 2VIDA 1MU8B 2FO9A 3AAVA 4JK5A 1UTPA 1C2MA 3UPEA 2ZQ2A 1V2JT 1O2SA 2FLBH 4X1SU 4GVUA 3M5MA 1CBWB 1TRYA 1BJVA 1DDJA 1K9OE 1O2QA 1XUHA 2Y81A 3F9HA 4O3UA 1CGJE 1GMDF 5FCRA 2VB0A 3GICB 1EAIA 3B23B 4E05H 1LDTT 4YOGA 1OWJA 5T6FA 2V35A 3SO3A 1F5KU 4X1NU 1Y3YA 5HYOA 1OS8A 1HAVA 2C8YB 4OS4A 4NA8A 3SQEE 4O03A 1W2KH 4NZLA 1MKXH 1QBOA 3ZZ6A 3W95A 4DCDA 4JK6A 1C1SA 2AMPA 2SNVA 2ZHQH 3LGWA 3RMMH 4ISHH 3RXKA 4BAHB 1C5VA 3UQVA 1ZGIA 1KLTA 2P8OB 1NESE 2F9UA 4IGDA 5L6NH 1MBQA 1P0SH 3VFEA 2JH6D 3GISB 1GBLA 1T8OA 2FESH 2R0KA 4HFPB 3MNCA 3TJVA 1SOTA 5FAHA 3M35A 5FX5A 2I6SA 1O2HA 1TPPA 4Y6DA 3LJJA 2P3TB 2BDBA 2B8OH 2A5KA 4WMDA 4ABGA 3BG4B 3FP8E 1O31A 1O36A 2C3SA 3BEUA 1YLCA 2VINA 2GTBA 1KXCA 4ISOA 1ZSKA 4OS2A 5CMXH 1ZMLA 2GMTC 3SUDA 2OINA 1C2EA 4TWYA 1KTTB 1FN8A 1Z8JB 1UVTH 1GBEA 4BAQB 2AGEX 2C8ZB 1P2IA 1ETTH 4MPXA 1VGCC 3AASA 7LPRA 3Q00A 2BVRH 3EA8A 1GJ5H 2YNBA 1ANCA 2XBXA 5F8TA 1D6WA 1TAWA 4AOQA 3B8JA 3RXHA 3OY5U 1BTZA 1SGRE 2NU3E 1V6DA 1XUGA 2Y5FA 1CVWH 1UMAH 3M3SA 1HXFH 4YOIA 2R2MB 3BTHE 1D9IA 4MVNA 4DIIH 1UTMA 2EA3A 1UK3A 4YM9A 1SLWB 1ELVA 1P2JA 2ANWA 3RC6A 1W13U 3HGPA 1GMDG 4U2WA 2VIQA 2A1DB 1HUTH 1HB0B 4NG9H 4Z6AH 1V2TT 2A7CA 1P12E 1ZTJA 3ZZ4A 2JETB 1Y5BT 3UOUA 2PV9B 4QT8C 2HGTH 1TX6A 1C1RA 1K1OA 1HDTH 1LHDH 1PPBH 2PW8H 1P57B 5EW2H 5L30H 2ANMH 1IHTH 1O2GH 4WXIA 2BDHA 3A7YA 3S7KB 2FS8A 1NFWA 1H8IH 2QF0A 1A1RA 3PTBA 1HAGE 4JZDH 1GBMA 2XC4A 5FPTA 1TALA 1BDAA 1Y3WA 2ZFRH 5PTPA 3A7TA 1ELTA 1W8BH 2O8UA 3EGKH 3U9AH 1DWBH 2D1JA 1OXGA 2FMJA 2P93A 5C3NA 5AFZH 4A1XA 4MPVA 1PPHE 3MHWU 4DVAU 4AG2A 1DLKB 1D4PB 5LGOA 3NXPA 3M36A 2H1UA 2ZTZA 1KYNA 4TY7A 4ZKNU 4ZAEA 3L33A 3AW0A 2O8MA 2DE9A 1KY9A 3AW1A 3M3TA 1WCZA 2A2XH 1ZJKA 3DHKH 3DD2H 3GDSA 2C8WB 2FOCA 2ZDKA 3HATH 1P10A 3BTWE 4X2XA 2BVSH 1ZGVA 1HAVB 2VWMA 3A84A 1HYLA 1CA0C 1UCYE 5C1XA 4K3JA 1MTVA 1E36B 1Y5AT 5EODA 4Q7YA 2VWNA 4R0IA 2FS9A 3RMOH 3D49H 1GBDA 1YGCH 3SZNA 3SGAE 1UVOA 1QQ4A 4FU8A 1FV9A 4AORA 4O9VA 4NA9H 2FI5E 1AKSA 3UREA 2TGPZ 1MCVA 2J95A 1D6RA 1BMLA 3SI3H 1VJ9U 2C90B 4J1YA 4MQAA 1NM6A 5G4BA 1NRSH 2ZECA 2ZU3A 1SOZA 3VGCC 4AFUA 1J16A 2ODPA 4H42U 1Z71A 3EDXB 4DGJA 2CV3A 2ESTE 1GI4A 3F6UH 4MTBA 3KQBA 3ZVFA 1DLEA 5EG4A 3GY3A 3FVFB 1UVPA 1QURH 4WMEA 2V6NA 4IMZA 1LVMA 2WYGA 4K5ZA 1FI8A 2RG3A 3EE0B 3RLYH 3LU9B 1G3BA 1H4WA 2GVFA 2WPMS 3S9CA 2O8TA 1NU7B 5GIBA 4CRBA 1AZ8A 2VGCB 2FM2A 4X1PU 2ODYB 3A8DA 1FY3A 1GI8B 1TOMH 2ZDNA 3E8LA 4IN2A 2CF8H 3SV8A 1QGFA 3PYHA 1GI9B 1O2MA 5HXFA 1S83A 3TH4H 1L0ZA 4FUDA 3EYDA 1OSSA 5DGJA 1K1NA 1HAIH 5A0BA 2AIPA 3SNAA 1DICA 2VNTA 1JIRA 1ZPBA 3IWMA 4JZFH 3CS0A 1B7XB 1O32A 3V3MA 3UR9A 2ZHDA 1O2JA 3P70B 1O35A 1SC8U 3QZRA 3GYMA 3FZZA 4K2YA 5FBIA 2FP7B 3RUOA 2UWPA 2BOHB 2BX3A 1SSXA 1GG6C 1W0ZU 3PROA 4WF8A 1EPTA 1BTHH 4NWLA 3BIVH 1V2KT 1OP2A 3UY9A 2PKSC 1FAXA 3SUEA 5EQSA 4GHQA 1TPSA 3F9EA 3BEIB 2BXUH 3E3TA 4CRAA 2QF3A 5FX6A 1UK2A 4TYDA 5E8EH 5JB9S 2Z3DA 4CH8B 1Z8GA 3SORA 1WTGH 1BBRE 1MBMA 2WYJA 1JRSA 2ZZUH 2ZP0H 1T8LA 4DJZB 4LZ1H 3SHAH 4UONA 3BTTE 1FNIA 3R3GB 5GXPA 4GCHF 1TNIA 4ABHA 4I8GA 1DUEA 5GPIB 4A1VA 1EB2A 3RXDA 2FIRH 3VB7A 3F68H 1K1IA 1RTKA 2RA0A 2ZO3H 5EXLA 2OBQA 3GOVB 3VEQB 6GCHG 1LHFH 1TOCB 2TPIZ 3ITIA 2VVUA 1UK4A 2M5TA 1ESTA 1L1JA 3PWCA 1LQDB 3OU0A 4XBBA 1KSNA 4ZROA 1DUAA 1RS0A 2VWOA 3D23A 1EZQA 1T8MA 2ZFPH 2BY8X 1F92A 3TNSA 4KELA 1J17T 2DUCA 2VVCA 3MTYA 3ZVBA 2FXRA 1AKSB 2BLWA 2WPJS 1V2MT 5I46H 1FAKH 8KME2 1L4DA 2ZTXA 4VGCB 1UTQA 2OCVB 1NRPH 1TLDA 2XCFA 4B73A 1AFEH 1PPZA 2THFB 4KKDA 2CF9H 1NPMA 1SGPE 3ZVDA 1JBUH 1HJAC 2G00A 2H9TH 4X2WA 3RU4D 6LPRA 1AMHA 1FDPA 2VIVA 3RMNH 4CHAC 1AQ7A 3BTDE 1EOJA 4E7RG 1C5UA 4A7IB 4IC6A 1FJSA 1ZRKA 1P02A 3LT3A 4IN1A 1N6YA 3PO1B 2CHAC 1XVMA 4JZIA 1AFQB 3HKJB 4GPGA 1KLJH 4FUEA 1BRCE 2NU0E 1SLUB 3RXAA 2XWBI 3SJOA 5E2PA 1UO6A 3SU2A 2FYRA 3A83A 4RKJB 2FZZA 2SFAA 3JZ2B 2ZG0H 5E0GA 1XUFA 2NU4E 2BVXH 4BTUB 3MNBA 4Q2KA 5C5NA 5LPRA 1V3XA 3PV4A 3EQ0H 1PYTC 1OKXA 3NWUA 4THNH 3SBKA 2BDYA 2JKHA 4GCHG 2F9OA 2AFQB 5GWZA 1C5OH 1WU1A 2ZA5A 3TGIE 1C2FA 1HAPH 1OWKA 2ZQ1A 2UWOA 1ZR0A 1S5SA 1ID5H 2PUXB 1MQ5A 1KXAA 1EQ9A 3KQCA 4BXWA 1TNGA 4B76A 1VITF 3D62A 1AB9B 4FUIA 3PB1E 3PLPA 4B71A 1EKBB 1C1VH 1O5DH 1BRBE 1RD3B 3MO6A 4NFEA 3UIRA 2A2QH 3U8OH 2H2ZA 1EPTB 1OWIA 2ZU4A 1LKBA 3S0NA 2BLOA 5F8ZA 3DUXH 2GX4A 1YYY1 4Y79A 1W7XH 3M3VA 1BUIA 1C2LA 2Y82A 3SNEA 2EEKA 1MTSA 3SU3A 1DS2E 2GT7A 3GCHC 4Y7BA 2PGBB 3SI4H 2ZFQH 4AG1A 4FUCA 2WV4A 1CA8B 1HBTH 1O2IA 1CHOF 1ZHRA 1L4ZA 1BCUH 1V2PT 1LCYA 1TABE 2LNCA 1THSH 3MMGA 2BLVA 1HNEE 5E2OA 3UNSA 1H9IE 1U6QA 4Q80A 5GCHF 3EA7A 1P9UA 1F0SA 4H6SB 2DE8A 1B5GH 1QFKH 1E37B 3URDA 1DVAH 2WUBA 3SJKA 1MKXK 2F9VA 4JZ1A 1TRNA 4JCNA 1V2WT 6ESTA 1NY22 2CMYA 4B2AA 1D3PB 5DO4H 1FN6A 3QN7A 5EXMA 4GLYA 3M5NA 3BN9A 4AX9H 2I6QA 2ZGHA 1O5FH 3GY5A 4MG3A 1KXDA 3U98H 1ESAA 2VU8E 4LOYH 1E34B 1TMBH 2J2UA 1OYTH 3TJUA 4X8TH 1Q2WA 1AU8A 1ANBA 1TB6H 1VCWA 1PQ8A 2XC5A 2GCTC 1UTJA 1GMCF 2G52A 3TK5A 5A8YA 1E38B 4AGJA 1V2VT 1XVOA 1XXFA 2HLCA 2UUJB 1HAYB 2W26A 2H6MA 2H5DA 1YM0A 1E35B 1VITG 2Z9GA 1QL9A 4MNWA 1MKWK 4LXBH 3LONA 1GWAA 3QGNB 4INHA 2HNTC 1TPAE 4ABIA 2BMGB 3U8RH 1GL1A 1RRKA 2BTCE 1THRH 9LPRA 1PPGE 2Q6DA 4J2YB 5IDKA 1HV7A 1EZUC 1DWDH 1SGTA 3MNXA 4I7YH 1BZXE 3KEEA 4ZH8A 1SB1H 2ZDAH 4CRDA 2PHBA 1C4V2 1AY6H 1P2QA 1CHOG 2P59A 1X7AC 3OY6U 3K2UA 3PTNA 1IQLA 3O8DA 1HPGA 1AO5A 1CT0E 1C1TA 2ZTYA 3IITA 1PYTD 1TQ7B 3RU4T 1C1OA 2R0LA 4KTSA 5GCHG 4YTAA 2WUCA 1G3EA 3ZYEA 1EP6A 2OQ5A 4JYUH 3EAJA 2BQWB 2IN2A 4CRFA 2IPHA 2Z94A 1Y8TA 1BTXA 5GDSH 2A5IA 2FODA 2Y6TA 4O97A 3F9FA 2Z3CA 1FY4A 2JH0D 1DX5M 4WH8A 3S7HB 1GJ6A 3RXRA 1FUJA 2BD3A 1WSSH 1G37A 1SFIA 2XBVA 1ELDE 3ZZ9A 5F6MA 2UWLA 5JBBS 1A0JA 2Z9IA 1A46H 1LHCH 4AYYB 3BTQE 3E91A 2GGVB 1AWHB 3ZZDA 4AYVB 5JBAS 1BITA 2HPQH 2XBWA 3SUGA 1MKWH 4MPWA 5A8XA 4YESB 1GMCG 4FU9A 3MYWA 2ZIQH 5SGAE 4UE7H 1BRUP 2R3YA 1P3EA 4TY6A 2J94A 2WINI 4I8KA 1RXPA 1RIWB 1W7GH 1WQSA 7ESTE 2PLXA 2G81E 1GCTC 1KTSB 1ZJDA 5F03A 1UTOA 2ZGXH 1O38A 1KXFA 4ABDA 1MTNC 1C2IA 3TGKE 2QCYA 4FUBA 4Y7AA 3RXUA 1RFNA 1FPCH 1Y3VA 3BEFB 1MTWA 5GJ4B 3RP2A 1MAYA 1O3IA 1GDNA 3H5CB 1HJ8A 1XMNB 1KLIH 4OS1A 2OXSA 1Y3XA 1HXEH 2UUYA 3RXFA 1SHHB 2FLRH 3ATMA 3TH3H 1HFDA 1IQKA 4MNVA 1OX1A 5EPNA 2ZGCA 1O3KA 5AHGH 1HGTH 3RXIA 3GCTF 2CJIA 1EJAA 4ZKOU 1T4UH 1SQTA 3KGPA 2EC9H 1HJ9A 1W12U 3HPTB 3UWJH 3QLPH 1GCDA 1C5SA 2Z6BD 1Z8IB 2A31A 3T5FH 1YC0A 1XUIA 1Y5UT 4Y10E 3SJ9A 4MLFB 2R2WU 1WBGB 2ZWLH 2OP9A 1K1PA 1W3CA 5C1YA 1WV7H 5DG6A 3FZDA 3Q3YA 1C1NA 2G8TA 4U30A 1MU6B 4B2BA 3QWCH 3T26A 1CBWC 4D7FA 2J92A 3OX7U 2EI8A 2PTCE 3FANA 1O3AA 5HM9A 4FVBA 2BD2A 4YO9A 3A80A 1IQEA 3SU4A 3BTME 3MO3A 3ZZ7A 2ULLA 4INLA 1JWTA 1ORFA 2EI6A 2G4TA 1C1UH 1BHXF 2BY5X 3DFLA 3STIA 1SGCA 1Z6JH 2B0FA 4DOQA 1OWEA 1A5GH 1MMJN 5DP4A 2BDIA 2BQ6B 2F91A 1C5QA 3RLWH 2FOFA 1DM4B 2P8OC 2QXHA 4I8HA 3OYPA 3PMBB 4UFFH 2PFEA 1KXBA 3GCOA 5CE1A 1UVUH 2GDEH 3M37A 1QY6A 1GGDB 2HVXA 2QXGA 3GY6A 1QRWA 4WY3A 2WPKS 2ZHWH 1AI8H 2XW9A 4HI3A 2HOBA 1O2OA 1S82A 1UCYH 3BG4C 1B0EA 1SMFE 3NPSA 3MU0A 2J34A 2OQUA 1XUKA 1EXFA 4AB9A 1T8NA 1NFUA 2HNTF 1O5AB 4UFGH 2TGTA 2ZEBA 2TGAA 4MNXA 3UR6A 1NZQH 3QK1A 5HM2A 1L2EA 2FX6A 3UUZA 1MH0A 1ZLRA 5JBCS 1YPHC 1JIMA 3SOSA 3GCTG 4OS5A 2OBOA 3E0NB 5F8XA 5DP3A 6GCHF 4YZUA 3LGIA 4ABAA 2FOGA 1TQ0B 5C1UA 2O8WA 3GDVA 3I77A 1BBRK 1GI6A 5A0AE 1Y59T 1QR3E 2BZAA 1TX7A 3A8AA 4A6LA 4Z0KA 4RSPA 3QO6A 3P8GA 1OP0A 1GI7B 1OP8A 4IBLH 4RKOB 1GDQA 2FWWA 3K6YA 5C20A 2R9PA 2BD8A 1L1GA 2HNTE 1EOLA 1H1BA 3SNCA 3RXVA 1DE7H 4XBDA 2ZCKP 2YNAA 1OPHB 5LPEA 3TPIZ 5DP7A 1O2UA 1GBBA 2FOBA 1TGNA 1GL0E 2JETC 5E0JA 3ZZ8A 5B6OA 4YOJA 1O3CA 1LPKB 4K60A 3ATKA 4BOHA 1DSTA 2A7HA 3SJ8A 1ABIH 4BAOB 1S85A 3G01A 2BY9X 1F0UA 1IQGA 2AMDA 1GBHA 4TWWA 1YCPK 2P3UB 4X6MA 5JB8S 1BRAA 4Y8ZA 2SGAA 1A61H 2XXLA 3P92A 3URCA 3BG8A 1XM1A 1C9TA 4X2VA 4BNRA 1WTHD 2V3HH 4AZ2B 4CBOA 4X6PA 1IQIA 3RXQA 3S69A 1TRMA 2J9NA 1YP9A 1GJ4H 2CXVA 4NSVA 1P05A 3E16B 1GVLA 2GDDA 1O2RA 1V2ST 1S84A 1CSOE 1PPFE 3RXJA 5FPSA 4UFEH 1N8OB 1SGQE 3S9BA 1ELFA 1C4Y2 5LH8A 2CN0H 2F3CE 4NCYA 2GCHF 2PUQH 2W3IA 2F9NA 1S6HA 3VXEH 4XSKU 1P2KA 2AS9A 1BBRH 4DG4A 4AFSA 3T27A 1O37A 2FOHA 2A4GA 3NUMA 3R0FA 1NO9H 1O3PB 3NCLA 2H5CA 3SNBA 1XUJA 1F2SE 1G3CA 3VPKA 4D8NA 3LGYA 5BPEA 1BJUA 1DOJA 1A7SA 1GDUA 3PLBA 4D9RA 1ELEE 3NK8A 5DKMA 1V2RT 1QNJA 1P8VC 4HTCH 2BQ7B 3GY7A 3T29A 1O2LA 2Q6FA 1ELCA 2FOEA 4X1QU 1G2LA 1GJDB 3ZVGA 1UTLM 3BTKE 5EOKA 2STAE 3ZVEA 1A5HA 1GBKA 1QRZA 2AGIX 2ZFTA 1BMNH 2OC0A 1FLEE 1YCPH 1F5RA 3TK9A 4CBNA 6CHAB 4Y8XA 4RN6A 3BTFE 2GKVE 3ODFA 4ABJA 1QB1A 2VVVA 3UNRA 5DP6A 3KIDU 2RA3A 5J4SA 1GHVH 1N1LA 1C5PA 3A7VA 1KIGH 4WJG2 1BOQA 2PSXA 1TNHA 4Q7XA 1YPEH 4TPIZ 5E0HA 3MO9A 3TGJE 1CE5A 2J38A 2VGCC 1C5YB 3A81A 3AVZA 3CENA 5EQRA 3LH3A 3TH2H 4F49A 4ZMAH 3QX5H 1GHYH 1LVYA 1K1MA 1NROH 1SVPA 5EGMA 4NGAH 3LJOA 2OD3B 5CHAB 4B75A 1ZTLA 1FMGA 5K7RA 2BHGA 1GJ9B 4FXGH 1WAYB 1NS3A 1K22H 1TBQH 1A0LA 3GY8A 4Y11E 1JOUB 1YPMH 4IS5A 3STJA 1TYNA 3VB5A 1EJMA 2FYQA 1V2NT 5A0CA 1FIZA 1TIOA 2SGDE 4DURA 1SPJA 2GCHG 4DT7B 4IC5A 1ZSJA 1ZZZA 1TNJA 3UWIA 3GYLB 4KGAA 1K21H 3N7OA 2ZGBH 1EUFA 3A87A 3LPRA 2BY7X 2ZHEH 1FXYA 1O3JA 3E90B 1ANEA 3LC5A 2ZF0H 4A1TA 1SR5C 1C5LH 1O2YA 3W94A 3MI4A 1YLDA 1XXDA 1OOKB 1PQAA 1V2LT 1MZDA 4UFDH 3U8TH 1AWFH 3A8CA 1PJPA 3RXTA 4ZHLU 3SU0A 3RXCA 2A4RA 3K6ZA 1WYKA 1K1JA 1JMOH 4TPYA 4YT7H 2WPLS 3HK6B 1C4U2 1MZAA 3TJNA 5JDUB 1GJCB 2G51A 1V2QT 1O0DH 2TBSA 4I8LA 1NFXA 3GY4A 4NIXA 3VXFH 3CS7A 2NWNA 3BTEE 1D3TB 2OUAA 1CGIE 2SGEE 1HAXB 4R8TB 3RU4E 1JXPA 1FY5A 3A7XA 1NC6A 1Z8RA 3PMAB 2VJ1A 1FQ3A 1YPHE 2BZ6H 2TIOA 5ESTE 3P6ZB 1F0TA 1EB1H 1VITH 3Q3KA 1DXWA 2WPHS 2GMTB 2GZ7A 1P2NA 2A5AA 3UNQA 1BMAA 1V2OT 1O3GA 4XDEA 3SU5A 1XKBC 2BD7A 3ENSB 4I8JA 1TMTH 5DPAA 2FTMA 3TLOA 4WVPE 3HK3B 1VGCB 2AIQA 4VGCC 3TJOA 1UTNA 2P16A 2Y5GA 4I32A 4ISNA 1OWHA 1HAOH 1C9PA 2D8WA 2EI7A 4JYTA 2ZFSA 4SGAE 2ZU5A 2FX4A 5C67A 1HIAA 1ZOMA 1SGEE 3ZVAA 1E0FD 1GI5A 1ZSLA 4UEHH 1Z1JA 3BF6H 1O2TA 2BOKA 4BAKB 5AVDA 3GY2A 3V0XA 3LGUA 1GBAA 1TGTA 1P2OA 1GBTA 1O34A 1IQNA 2G4UA 2QAAA 3RDZA 2F83A 1ZHPA 1P11E 3PO1C 3FP7E 1LHEH 1AFQC 2GP9B 4Y0YE 3ZYDA 4ZHMU 2IOTA 1EAUA 3LDXH 4SGBE 2K1QA 8GCHF 3A7WA 4MDSA 3RM0H 4ZXXH 2H9EH 1AD8H 1SLXB 1NRNH 5J4QA 1TGCA 3KN2A 1P09A 2QXJA 3K9XB 1A4WH 3EA9A 3O8RA 1QJ6B 4GSOA 1TFXA 3IG6B 3ELAH 4O3TA 1G9IE 4X6OA 3SW2B 3Q77A 1KXEA 3TIUA 1SHYA 1ZRBA 5I25A 3RC4A 1V2UT 3QGJA 1YF4A 3JZ1B 1AB9C 2ZHFH 2Y7XA 3RMLH 1SGNE 4JYVH 1Y3UA 3ATLA 3TU7H 2BDAA 5L2YH 1C5NH 1BTPA 1EPTC 1YKTA 1ELGA 4ABFA 1SGIB 2XYAA 2ALVA 4ABBA 2AYWA 4F4OC 3P8OA 1AHTH 4NIYA 1YPKH 1T31A 5FBEA 2QIQA 2XCNA 4B74A 1O2VA 1P04A 1GBJA 1DXPA 1GVKB 1C5ZB 4NFFA 3UOPA 1DSUA 4GAWA 1IQHA 1CA0B 2XBYA 1S6FA 2BXTH 2ALPA 2PTNA 2BX4A 1SGFG 4E06H 3BTGE 3E6PH 1O3EA 2PR3A 4ZKRU 4NSYA 3SHCH 5FHTA 1T4VH 2HWLB 8ESTE 3U1JB 5AFYH 2BM2A 4K69A 4MPUA 4XE4A 1QJ7B 2Y5HA 3F1SB 1AUTC 4CREA 3QZQA 3RXPA 3T28A 1O5GH 1GPZA 1TA6A 3RXOA 1WUNH 1HAHH 2VIOA 1TA2A 3MU1A 1W10U 1S0RA 2R3UA 2WV5A 3RXMA 1LPGB 1CHGA 1O3MA 5EPYA 2BY6X 3I29A 3VGCB 1DY9A 3L6PA 2QXIA 1WOFA 4K8YA 3T25A 1EP5A 1ZMJA 3LC3A 1O2PA 4A92A 1EJNA 2H9HA 2B9LA 2RCEA 4KTUA 1LTOA 3OSYA 4H6TA 1ESBA 2GV7A 1BT7A 5FCKA 1J14A 3MH7A 5A09A 2QC2A 2ZCHP 3A88A 1PQ7A 1GHZA 2HALA 3L3TA 1O5CB 1O3FA 8GCHG 4D9QA 1J8AA 2ANYA 7GCHF 1O5EH 1ZHMA 1P9SA 2SNWA 1W14U 1A0HB 1C1PA 1NU9A 7KMEH 2Q6GA 1P3CA 3MOCA 2W7UA 3RXLA 3KHVA 1TGSZ 1W11U 3C1KA 1UCYK 4K1SA 3TNTA 1JRTA 1CQQA 3LH1A 3MH6A 2BD4A 2VIPA 8LPRA 1EAXA 3P8NA 3KNXA 5AF9H 2FEQH 3SV7A 1GJ8B 1HIAB 1MD8A 4Y0ZE 1Z1IA 2ZDVH 3DFJA 3RM2H 1AIXH 1L1NA 1TBRH 1HRTH 4ISLA 3RXBA 2A7JA 5DP5A 2ANKH 1ZPZA 1QJ1B 2G5NA 1F5LA 3LGTA 4AN7A 1WQVH 1CT2E 4OGXA 1FONA 1EAWA 1IQFA 1GJAB 2GV6A 3ZZBA 1KDQA 3E1XB 1K2I1 4YT6H 1ETSH 3OTJE 2ZCLP 2PGQB 4PROA 5BRRE 1QB6A 4U32A 1UHBA 1GHBF 4K8BA 5JYIA 3H7TA 2O9QA 1C5XB 1C5MD 3GDUA 2STBE 4NZQA 1THPB 5FPYA 1GG6B 1TONA 3AAUA 1RTLA 3BV9B 3ZZ3A 3SU1A 1MD7A 1AUJA 3KL6A 5DK1A 5A8ZA 3M61U 1QA7A 1O2XA 2PKSB 1GHAF 4WXVA 1EX3A 2QN5T 1G2MA 1O30A 2SGFE 1A3BH 2F9BH 1P2MA 4BTTB 1F0RA 3A8BA 3PM3A 4YLUA 1SG8B 2XNIA 1SI5H 2YOLA 3M7QA 3SN8A 3RXSA 1QQUA 4M7GA 1IAUA 1FPHH 2A32A 2BD5A 1Q3XA 1G30B 2BDGA 1G3DA 5T6GA 1IQMA 1J15A 1C1MA 2ZU1A 5C2ZA 3HGNA 1ZTKA 1SBWA 2WPIS 3DA9B 3SU6A 2BLQA 1ELAA 2XWAA 4D76A 3P95A 4AFQA 1BB0B 1Z7KA 2V0BA 1C2GA 1DANH 2J4IA 4Y8YA 3KF2A 7GCHG 1QBNA 1GHWH 2ZPSA 2GD4B 1GI2A 4ISIH 4Y76A 3ATWA 2LPRA 3SNDA 1ABJH 1LHGH 4FUJA 3LKWA 2GZ8A 1PQ5A 1A3EH 1TE0A 2XTTB 5EXNA 2JH5D 3ODDA 2ZC9H 1BMMH 1AE5A 2O8LA 2ZNKH 3PLKA 1QA0A 3VB6A 1O3HA 1GI0A 4CRGA 1A2CH 1GI1A 4XBCA 3SV9A 3KCGH 1RIWC 1AVGH 3C27B 2OLGA 4CH2B 1OWDA 2A45B 1TNLA 1QCPA 5H4IB 1CT4E 1GJ7B 1O5BB 2D2DA 3KQEA 2ODQA 3P17H 2ZI2H 1IOEA 2QYIA 3MU4A 1HJAB 1AVWA 3RC5A 2ZGJA 1H9HE 1UVSH 1J9CH 4FUFA 4BXSA 4X2YA 4CHAB 2ZFFH 1GHBG 1O2KA 1O3NA 4MNYA 1YPGH 3BSQA 2FOAA 1MAXA 1AE8H 1B0FA 4FUHA 3VB3A 1DWEH 2BD9A 1P01A 3SUFA 3PWBA 3MWIU 5DJ7A 4DY7B 1Q31A 2CHAB 1TMUH 1GHAG 3D65E 3T62A 1H9LB 1C1QA 1GJBB 1TX8A 2W3KA 3MU8A 1O3OA 5EW1H 1T7CA 2ZPRA 1LVBA 4ESTE 1VR1H 2D26C 4WWYA 4X6NA 1O3DA 1SQOA 2QY0B 1XKAC 5HGGA 4IMQA 4D7GA 1DITH 4YLQH 5C5OA 2Y7ZA 1UTKA 2A0QB 1QIXB 1FIWA 4ZKSU 1C1WH 1VZQH 4AB8A 1O2ZA 1LMWB 1BQYA 4X8UH 5A2MH 1GBCA 4Q7ZA 2Z9LA 1IHSH 1AZZA 1ARCA 1KDQB 1UJ1A 1QRXA 2TGDA 4NIWA 3T2NA 2OC8A 5TCCA 3TK6A 3GCNA 4JZEH 1HAZB 2VH0A 1UHBB 5IYTA 3V7TA 2GT8A 1NN6A 4K1TA 1EASA 1GMHF 4GUXA 3O8BA 1QBVH 2G55A 1SGDE 2ZPQA 2G5VA 3Q76A 1K28D 5EQQA 3SGQE 4CR9A 1C2HA 4K1EA 4UDWH 4ABEA 3I78A 4BTIB 3SGBE 4LZ4B 3GCHB 1GGDC 1YPLH 2A4QA 2ZDMA 1PPCE 3UFAA 1MQ6A 3VB4A 1MUEB 1C5TA 4CR5A 1MTUA 1QL7A 3NKKA 3QTOH 2GZ9A 1ACBE 1GBIA 3TVJB 1FY1A 2SGQE 4WMFA 1LPZB 3KQDA 1ANDA 4Y71A 1BTWA 5ETXA 1H8DH 1RGQA 3K65B 1HLTH 3ESTA 4ZUHA 4ZHAA 1VJAU 1M9UA 2SGPE 1LKAA 1PFXC 5TJXA 3MFJA 1ETRH 4I33A 2OTVA 5T3HA 4JMYA 3DT0H 3SJIA 1NT1A 4X8SH 1LO6A 3SV6A 1FY8E 2C4FH 2PSYA 1YCPM 2IJOB 4FVDA 3U1IB 2KAIA 1BHXB 4GHTA 2AMQA 3SV2H 1TBZH 1QL8A 2B7DH 4UD9H 2PKAA 1SGYE 2BDCA 1C2DA 1LQEA 1ZPCA 2ZDLA 1ARBA 1O2WA 4AFZA 2RDLA 3P8FA 2QA9E 3FP6E 3A86A 2C8XB 4LK4A 3MH5A 1ZMNA 2GCTB 3PMJA 2B5TB 1CO7E 3NZIA 3BIUH 2Z9KA 4NA7A 5DP9A 1PPEE 1G32B 2QV1A 4BANB 1NFYA 1NRRH 3U69H 4A5TS 2ILNA 1T32A 4DIHH 3QDZB 1Z6EA 4I31A 5JPMH 1QTFA 1GMHG 5JBTA 4ASHA 1AVXA 1D3DB 3M5LA 1DPOA 1YPJH 2W5EA 4E7NA 1RJXB 3MNSA 1TGBA 2AH4X 2F9PA 1CGHA 3FAOA 2XC0A 2AGGX 1DWCH 4NIVA 2PWXA 1SFQB 2ZKSA 4X1RU 1LVOA 2P95A 1BTYA 3UTUH 1S81A 1TWXB 3A85A 4ZXYH 3HKIB 3UQOA 1NTPA 4B1TA 3V13A 4KTCA 2VIWA 3A7ZA 1INCA 1G36A 5LPFA 9ESTA 3RXEA 2QGRA 1P06A 5K0HA 3FFGA 1N8OC 1O39A 4BAMB 3WY8A 2Y80A 1O3LA 5EU8A 1DT2A 4AGKA 2FI3E 1OYQA 4HGCA 2FI4E 2A4OA 4OGYA 3ATIA 3SQHE 2HPPH 2OC1A 3RXGA 3ZV8A 2Q1JA 1BTUA 1AN1E 2UUFB 4OS6A 2Z9JA 1W0YH 4IW4E 2C93B 2P3FH 5T6DA 1GI3A 4FUGA 4HZHA 4NWKA 1D3QB 1VCPA 1AGJA 4X0WU 3ZZAA 3QUMP 2NU2E 1SQAA 2W7SA 1RTFB 1VCQA 4INKA 1NRQH 2UUKB 2BB4A 5TCAA 2Z7FE 2ASUB 5FXLA 4XOJA 1DFPA 3H7OA 1QHRB 5L2ZH 1FZZA 1C2JA 5ABWA 2FPZA 1A5IA 3V12A 6CHAC 3M7UA 1N6XA 2ZU2A 5HMAA 1XX9A 2FTLE 1GCTB 2Z3EA 4H4FA 1IQJA 1GHXH 1MCTA 1EATA 1F7ZA 1MTNB 3A89A 1CU1A 5DP8A 1SL3A 1SLVB 1O33A 1YBWA 1S0QA 3O8CA 1ELBA 1GVZA 3ZV9A 2KAIB 2HRVA 2VWLA 2XRCA 1EZSC 1C5RA 3F9GA 3M7TA 3LOXA 3PMHB 1C2KA 3M5OA 1BA8B 1K1LA 5CHAC 4OS7A 2AERH 2CGAA 2OC7A 1HCGA 3LIWA 3ZZ5A 2PKAB 1BIOA
chains in the Genus database with same CATH superfamily
3LGVA 3MH4A 2VH6A 1W0KD 4U01A 1GBFA 1P03A 4B2CA 4X8VH 2FOMB 1E1RD 4M9FA 3MU5A 4WH6A 2TRMA 2P94A 3A82A 4Q63A 1UW7A 1ZYOA 2BYAX 2AEIH 3S9AA 3Q3XA 3TITA 1O2NA 3B9FH 1SGFA 1TPOA 2FDAA 1QB9A 5ESBA 1C5WB 1O3BA 3ZZCA 1DY8A 3E0PB 4CRCA 4XFQA 3QTVH 4KP0A 2V3OH 1EZXC 3ZVCA 4RI0A 3CP7A 4FU7A 4DW2U 2NU1E 1TNKA 2VIDA 1MU8B 3FOAA 2FO9A 2WV9A 3AAVA 4JK5A 1UTPA 1C2MA 3UPEA 2ZQ2A 1V2JT 1O2SA 2FLBH 4X1SU 4GVUA 3M5MA 1CBWB 1TRYA 1BJVA 1DDJA 1K9OE 1O2QA 1XUHA 2Y81A 3F9HA 4O3UA 1CGJE 1GMDF 5FCRA 2VB0A 3GICB 1EAIA 3B23B 4E05H 1LDTT 4YOGA 1OWJA 5T6FA 2V35A 3SO3A 1F5KU 4X1NU 1Y3YA 5HYOA 1OS8A 1HAVA 2C8YB 4OS4A 4NA8A 3SQEE 4O03A 1W2KH 4NZLA 1MKXH 1QBOA 3ZZ6A 3W95A 4DCDA 4JK6A 1C1SA 2AMPA 2SNVA 2ZHQH 3LGWA 3RMMH 4ISHH 3RXKA 4BAHB 1C5VA 3UQVA 1ZGIA 1KLTA 2P8OB 1NESE 2WZQA 2F9UA 4IGDA 5L6NH 1MBQA 1P0SH 3VFEA 2JH6D 3GISB 1GBLA 1T8OA 2FESH 2R0KA 4HFPB 3MNCA 3TJVA 1SOTA 5FAHA 3M35A 5FX5A 2I6SA 1O2HA 1TPPA 4Y6DA 3LJJA 2P3TB 2BDBA 2B8OH 2A5KA 4WMDA 4ABGA 3BG4B 3FP8E 1O31A 1O36A 2C3SA 3BEUA 1YLCA 2VINA 2GTBA 1KXCA 4ISOA 1ZSKA 4OS2A 5CMXH 1ZMLA 2GMTC 3SUDA 2OINA 1C2EA 4TWYA 1KTTB 1FN8A 1Z8JB 1UVTH 1GBEA 4BAQB 2AGEX 2C8ZB 1P2IA 1ETTH 4MPXA 1VGCC 3AASA 7LPRA 5F53A 3Q00A 2BVRH 3EA8A 1WXRA 1GJ5H 2YNBA 1ANCA 2XBXA 5F8TA 1D6WA 1TAWA 4AOQA 3B8JA 3RXHA 3OY5U 1BTZA 1SGRE 2NU3E 1V6DA 1XUGA 2Y5FA 1CVWH 1UMAH 3M3SA 1HXFH 4YOIA 2R2MB 3BTHE 3SYJA 1D9IA 4MVNA 4DIIH 1UTMA 2EA3A 1UK3A 4YM9A 1SLWB 1ELVA 1P2JA 2ANWA 3RC6A 1W13U 3HGPA 1GMDG 4U2WA 2VIQA 2A1DB 3KYGA 1HUTH 1HB0B 4NG9H 4Z6AH 1V2TT 2A7CA 1P12E 1ZTJA 3ZZ4A 2JETB 1Y5BT 3UOUA 2PV9B 4QT8C 2HGTH 1TX6A 1C1RA 1K1OA 1HDTH 1LHDH 1PPBH 2PW8H 1P57B 5EW2H 5L30H 2ANMH 1IHTH 1O2GH 4WXIA 2BDHA 1SQRA 3A7YA 2FS8A 3S7KB 1NFWA 1H8IH 2QF0A 1A1RA 3PTBA 1HAGE 4JZDH 1GBMA 2XC4A 5FPTA 4Q4LA 1TALA 1BDAA 1Y3WA 2ZFRH 5PTPA 3A7TA 1ELTA 1W8BH 2O8UA 3EGKH 3U9AH 1DWBH 2D1JA 1OXGA 2FMJA 2P93A 5C3NA 5AFZH 4A1XA 4MPVA 1PPHE 3MHWU 5HIYA 4DVAU 4AG2A 1DLKB 1D4PB 5LGOA 3NXPA 3M36A 2H1UA 1E1QD 2ZTZA 1KYNA 4TY7A 4ZKNU 4ZAEA 3L33A 3AW0A 2O8MA 2QF5A 2DE9A 1KY9A 2YMSD 3AW1A 3M3TA 1WCZA 2A2XH 5CHBA 1ZJKA 3DHKH 3DD2H 3GDSA 2C8WB 2FOCA 2J5UA 3CNRA 2ZDKA 3HATH 1P10A 3BTWE 4X2XA 2BVSH 1ZGVA 1HAVB 2VWMA 3A84A 2HVYB 1HYLA 1CA0C 2HLDD 3UAIC 1UCYE 5C1XA 4K3JA 1MTVA 1E36B 1Y5AT 5EODA 2M2AA 4Q7YA 2VWNA 4R0IA 2FS9A 3RMOH 3D49H 1GBDA 1YGCH 3SZNA 3SGAE 1UVOA 1QQ4A 4FU8A 1FV9A 4AORA 4O9VA 4NA9H 2FI5E 4TT3D 1AKSA 3UREA 2TGPZ 1MCVA 2J95A 1D6RA 1BMLA 3SI3H 1VJ9U 2C90B 4J1YA 4MQAA 1NM6A 5G4BA 1NRSH 2ZECA 2ZU3A 1SOZA 3VGCC 4AFUA 1J16A 2ODPA 4H42U 1Z71A 3EDXB 4DGJA 2CV3A 2ESTE 1GI4A 3F6UH 4MTBA 3KQBA 3ZVFA 1DLEA 5EG4A 3GY3A 3FVFB 1UVPA 1MABB 1QURH 4WMEA 2V6NA 5C0UA 4IMZA 1LVMA 2WYGA 4K5ZA 1FI8A 2RG3A 3EE0B 3RLYH 3LU9B 1G3BA 1H4WA 2GVFA 2WPMS 3S9CA 2O8TA 1NU7B 5GIBA 3OTPA 1NBME 4CRBA 1AZ8A 2VGCB 2FM2A 4X1PU 2ODYB 3A8DA 1FY3A 1GI8B 1TOMH 2ZDNA 3E8LA 4IN2A 2CF8H 3SV8A 1QGFA 3PYHA 1GI9B 1O2MA 5HXFA 1S83A 3F2FA 3TH4H 1L0ZA 4FUDA 3EYDA 1OSSA 5DGJA 1K1NA 1HAIH 5A0BA 2AIPA 3SNAA 1YY3A 1DICA 2VNTA 1JIRA 1ZPBA 3IWMA 4JZFH 3U28C 3CS0A 1B7XB 1O32A 3V3MA 3UR9A 2ZHDA 1O2JA 3P70B 1O35A 1SC8U 3QZRA 3GYMA 3FZZA 4K2YA 5FBIA 2FP7B 3DSPA 3RUOA 2UWPA 2BOHB 2BX3A 1SSXA 1GG6C 1W0ZU 2KCPA 3PROA 4WF8A 1EPTA 1BTHH 4NWLA 3BIVH 1V2KT 1OP2A 2J97A 3UY9A 2PKSC 1FAXA 3SUEA 5EQSA 4GHQA 1TPSA 3GS9A 3F9EA 3BEIB 2BXUH 3E3TA 4CRAA 2QF3A 5FX6A 1UK2A 4TYDA 5E8EH 5JB9S 2Z3DA 4XRNA 4CH8B 1Z8GA 3SORA 1WTGH 1BBRE 1YWUA 1MBMA 1WDIA 1JRSA 2WYJA 2ZZUH 3F0PA 2ZP0H 1T8LA 4DJZB 4LZ1H 3KQ5A 3SHAH 4UONA 3BTTE 1FNIA 3R3GB 5GXPA 4GCHF 1TNIA 4ABHA 4I8GA 1DUEA 5GPIB 2AHME 5KGOA 2EY4C 4A1VA 1EB2A 3F2GA 3RXDA 2FIRH 3VB7A 3F68H 1K1IA 1RTKA 2KCOA 2RA0A 2ZO3H 5EXLA 2OBQA 3GOVB 3VEQB 6GCHG 1LHFH 1TOCB 2TPIZ 5C17A 3ITIA 2VVUA 1UK4A 2M5TA 1ESTA 1L1JA 3PWCA 1LQDB 3OU0A 4XBBA 1KSNA 4ZROA 4B6EA 1DUAA 1RS0A 2VWOA 3D23A 1EZQA 1T8MA 2ZFPH 2BY8X 1F92A 3TNSA 4KELA 1J17T 2DUCA 2VVCA 3MTYA 3ZVBA 2FXRA 1AKSB 2BLWA 2WPJS 1V2MT 5I46H 1FAKH 2KR7A 8KME2 1L4DA 2ZTXA 4VGCB 1UTQA 2OCVB 1NRPH 1TLDA 2XCFA 4B73A 1AFEH 1PPZA 2THFB 4KKDA 2CF9H 1NPMA 4YXWD 1BMFD 1SGPE 3ZVDA 1JBUH 1HJAC 2G00A 2H9TH 4X2WA 3RU4D 6LPRA 1AMHA 1FDPA 2VIVA 3RMNH 4CHAC 1AQ7A 3BTDE 1EOJA 4E7RG 1C5UA 3DSOA 4A7IB 4IC6A 1FJSA 1ZRKA 1P02A 3LT3A 4IN1A 1N6YA 3PO1B 2CHAC 1XVMA 4JZIA 1AFQB 3HKJB 4GPGA 1KLJH 4FUEA 1BRCE 2NU0E 1SLUB 3RXAA 2XWBI 3SJOA 5E2PA 1UO6A 3SU2A 2FYRA 3A83A 4RKJB 2FZZA 2SFAA 3JZ2B 2IJD1 2ZG0H 5E0GA 1XUFA 2NU4E 2BVXH 4BTUB 3MNBA 4Q2KA 5C5NA 5LPRA 1V3XA 3F3BA 3PV4A 3EQ0H 1PYTC 1OKXA 3NWUA 4THNH 3SBKA 2BDYA 2JKHA 4GCHG 2F9OA 2AFQB 3N7EA 5GWZA 1C5OH 1WU1A 2ZA5A 3OEHD 1C2FA 3TGIE 1HAPH 1OWKA 2ZQ1A 2UWOA 1ZR0A 1S5SA 1ID5H 2PUXB 1MQ5A 1KXAA 1EQ9A 3KQCA 4BXWA 1TNGA 4B76A 1VITF 3D62A 1AB9B 4FUIA 3PB1E 3PLPA 4B71A 1EKBB 1C1VH 1O5DH 1BRBE 1RD3B 3MO6A 4NFEA 3UIRA 2A2QH 3U8OH 2H2ZA 1EPTB 1OWIA 2ZU4A 1LKBA 3S0NA 2BLOA 5F8ZA 3DUXH 2GX4A 1YYY1 4Y79A 1W7XH 3M3VA 1BUIA 1C2LA 2Y82A 3SNEA 2EEKA 1MTSA 3SU3A 1DS2E 2GT7A 3GCHC 4Y7BA 2PGBB 3SI4H 2ZFQH 4AG1A 4FUCA 2WV4A 1CA8B 1HBTH 1O2IA 1CHOF 1ZHRA 1L4ZA 1BCUH 1V2PT 1LCYA 1TABE 2LNCA 1THSH 3MMGA 2BLVA 1HNEE 5E2OA 3UNSA 1H9IE 2JJ1D 1U6QA 4Q80A 5GCHF 3EA7A 1P9UA 1F0SA 4H6SB 2DE8A 1B5GH 1QFKH 1E37B 3URDA 1DVAH 2WUBA 3SJKA 1MKXK 2F9VA 4JZ1A 1TRNA 4JCNA 1V2WT 6ESTA 1NY22 2CMYA 4B2AA 1D3PB 2RDEA 5DO4H 1FN6A 3QN7A 5EXMA 3AK5A 4GLYA 3M5NA 3BN9A 3FO8D 4AX9H 3PV5A 2I6QA 2ZGHA 1O5FH 1COWD 3GY5A 4MG3A 1KXDA 3U98H 1ESAA 2VU8E 4LOYH 1E34B 1TMBH 2J2UA 1OYTH 3TJUA 4X8TH 1Q2WA 1AU8A 1ANBA 2KCAA 1TB6H 1VCWA 1PQ8A 2XC5A 5B6LA 2GCTC 1UTJA 1GMCF 2G52A 3TK5A 3UB0A 5A8YA 1E38B 4AGJA 1V2VT 1XVOA 1XXFA 2HLCA 2UUJB 1HAYB 2W26A 2H6MA 2H5DA 1YM0A 1E35B 1VITG 2Z9GA 1QL9A 4MNWA 1MKWK 4LXBH 4P00A 3LONA 1GWAA 3QGNB 4INHA 2HNTC 1TPAE 4ABIA 2BMGB 3U8RH 1GL1A 1RRKA 2BTCE 1THRH 9LPRA 1PPGE 2Q6DA 4J2YB 5IDKA 1HV7A 1EZUC 1DWDH 1SGTA 3MNXA 4I7YH 1BZXE 3KEEA 4ZH8A 1SB1H 2ZDAH 2YMSC 4CRDA 2PHBA 1OHHD 1C4V2 1AY6H 1P2QA 1CHOG 2P59A 1X7AC 3OY6U 3K2UA 3PTNA 2QF4A 1IQLA 3O8DA 1HPGA 1AO5A 1CT0E 1C1TA 2ZTYA 3IITA 1PYTD 1TQ7B 3RU4T 1C1OA 2R0LA 4KTSA 5GCHG 4YTAA 2WUCA 1G3EA 3ZYEA 1EP6A 2OQ5A 4JYUH 3EAJA 2BQWB 5HIZA 2IN2A 4CRFA 2IPHA 2Z94A 1Y8TA 1BTXA 5GDSH 2A5IA 1SKYE 2FODA 2Y6TA 4O97A 3F9FA 2Z3CA 1FY4A 2JH0D 1DX5M 4WH8A 3S7HB 1GJ6A 3RXRA 3WWBA 1FUJA 2BD3A 1WSSH 1G37A 1SFIA 2XBVA 1ELDE 3ZZ9A 5F6MA 4ACAA 2UWLA 5JBBS 1A0JA 2Z9IA 1A46H 1LHCH 1W0JD 4AYYB 3BTQE 3E91A 2GGVB 1AWHB 3ZZDA 4AYVB 5JBAS 1BITA 2HPQH 2XBWA 3SUGA 1MKWH 4MPWA 5A8XA 4YESB 1GMCG 4FU9A 3MYWA 2L6OA 2ZIQH 5SGAE 4UE7H 1BRUP 2R3YA 1P3EA 2KX4A 4TY6A 2J94A 2WINI 4I8KA 2WHXA 1RXPA 1H8ED 1RIWB 1W7GH 1WQSA 7ESTE 2PLXA 2G81E 1GCTC 1KTSB 1ZJDA 5F03A 1UTOA 2ZGXH 1O38A 1KXFA 4ABDA 1MTNC 1C2IA 3TGKE 2QCYA 4FUBA 4Y7AA 3RXUA 1RFNA 1FPCH 1Y3VA 3BEFB 1MTWA 5GJ4B 3RP2A 1MAYA 1O3IA 1GDNA 3H5CB 4ASUD 1HJ8A 1XMNB 1KLIH 4OS1A 2OXSA 1Y3XA 1YLNA 1HXEH 2UUYA 2V3MA 3RXFA 1SHHB 2FLRH 3ATMA 3TH3H 1HFDA 1IQKA 4MNVA 1OX1A 5EPNA 2ZGCA 1O3KA 5AHGH 1HGTH 5EJ1A 3RXIA 3GCTF 2CJIA 1EJAA 4ZKOU 1T4UH 1SQTA 3KGPA 2EC9H 1HJ9A 1W12U 3HPTB 3UWJH 3QLPH 1GCDA 2W6ID 1VKYA 1C5SA 2Z6BD 1Z8IB 2A31A 3T5FH 1YC0A 3WWFA 1XUIA 1Y5UT 4Y10E 3SJ9A 4MLFB 2R2WU 1WBGB 2ZWLH 2OP9A 1K1PA 1W3CA 2K0QA 1WV7H 5C1YA 4ZCNA 5DG6A 3FZDA 3Q3YA 1C1NA 2G8TA 4U30A 1MU6B 4B2BA 3QWCH 1S6LA 3T26A 1CBWC 4D7FA 2J92A 3OX7U 2EI8A 2PTCE 3FANA 1KMHB 1O3AA 5HM9A 4FVBA 2BD2A 4YO9A 3A80A 1IQEA 3SU4A 3BTME 3MO3A 3ZZ7A 2ULLA 4INLA 1JWTA 2OK5A 1ORFA 2EI6A 2G4TA 1C1UH 1BHXF 2BY5X 3DFLA 3STIA 1SGCA 1Z6JH 2B0FA 4DOQA 1OWEA 5EIYA 1A5GH 1MMJN 5DP4A 2BDIA 2BQ6B 2F91A 1C5QA 3RLWH 2FOFA 1DM4B 2P8OC 4HG6A 2QXHA 4I8HA 3OYPA 2XOKD 3PMBB 4UFFH 2PFEA 1KXBA 3GCOA 5CE1A 1UVUH 2GDEH 3M37A 3PRDA 1QY6A 1GGDB 2HVXA 2QXGA 3GY6A 1QRWA 4WY3A 2WPKS 2ZHWH 1AI8H 2XW9A 4HI3A 2HOBA 1O2OA 1S82A 1UCYH 3BG4C 1B0EA 1SMFE 3NPSA 3MU0A 2J34A 2OQUA 1XUKA 1EXFA 4AB9A 1T8NA 1FX0B 1NFUA 2HNTF 1O5AB 4UFGH 2TGTA 4I86A 2ZEBA 2TGAA 4MNXA 3UR6A 1NZQH 3QK1A 5HM2A 1L2EA 2FX6A 3UUZA 1MH0A 1ZLRA 5JBCS 1YPHC 1JIMA 3SOSA 3GCTG 2JJ2D 4OS5A 2OBOA 3E0NB 5F8XA 5DP3A 6GCHF 4YZUA 3LGIA 4ABAA 2FOGA 1TQ0B 5C1UA 2O8WA 3GDVA 3I77A 1BBRK 1GI6A 5A0AE 1Y59T 1QR3E 2BZAA 1TX7A 3A8AA 4A6LA 4Z0KA 4RSPA 3QO6A 3P8GA 1OP0A 1GI7B 1OP8A 4IBLH 4RKOB 1GDQA 2FWWA 3K6YA 5C20A 2R9PA 2BD8A 1L1GA 2HNTE 1EOLA 1H1BA 3SNCA 2IPQX 3RXVA 1DE7H 4XBDA 2ZCKP 2YNAA 1OPHB 5LPEA 3TPIZ 5DP7A 1O2UA 1GBBA 2FOBA 1TGNA 1GL0E 2JETC 5E0JA 3ZZ8A 5B6OA 4YOJA 2KM0A 1O3CA 1LPKB 4K60A 3ATKA 4BOHA 1DSTA 2A7HA 3SJ8A 1ABIH 4BAOB 1S85A 3G01A 4B6FA 2BY9X 1F0UA 1IQGA 2AMDA 1GBHA 4TWWA 1YCPK 2P3UB 4X6MA 3W1EA 1BRAA 5JB8S 4Y8ZA 3OEED 2SGAA 1A61H 2XXLA 3P92A 3URCA 3BG8A 1XM1A 1C9TA 4X2VA 4BNRA 1WTHD 2V3HH 4AZ2B 4CBOA 4X6PA 1IQIA 3RXQA 3S69A 1TRMA 2J9NA 1YP9A 5C94A 1GJ4H 2CXVA 4NSVA 1P05A 3E16B 1GVLA 2GDDA 1O2RA 1V2ST 1S84A 1CSOE 1PPFE 3RXJA 5FPSA 4UFEH 1N8OB 1SGQE 3S9BA 1ELFA 5FL7D 1C4Y2 5LH8A 2CN0H 2F3CE 4NCYA 2GCHF 2PUQH 2W3IA 2F9NA 1S6HA 3VXEH 4XSKU 1P2KA 2AS9A 1BBRH 2F4LA 4DG4A 4AFSA 3T27A 1O37A 2FOHA 2A4GA 3NUMA 3R0FA 1NO9H 1O3PB 3NCLA 2H5CA 3SNBA 1XUJA 1F2SE 1G3CA 3VPKA 4D8NA 3LGYA 5BPEA 1BJUA 1DOJA 1A7SA 1GDUA 3PLBA 4D9RA 1ELEE 3NK8A 5DKMA 1V2RT 1QNJA 1P8VC 4HTCH 2BQ7B 3GY7A 3T29A 1O2LA 2Q6FA 1ELCA 2FOEA 4X1QU 1G2LA 1GJDB 3ZVGA 1UTLM 3BTKE 5EOKA 2STAE 3ZVEA 1A5HA 1GBKA 1QRZA 2AGIX 2ZFTA 1BMNH 2OC0A 1FLEE 1YCPH 1F5RA 3TK9A 4CBNA 6CHAB 4Y8XA 4RN6A 3BTFE 2GKVE 3ODFA 4ABJA 1QB1A 2VVVA 3UNRA 5DP6A 3KIDU 2RA3A 5J4SA 1GHVH 1N1LA 1C5PA 3A7VA 1KIGH 4WJG2 1BOQA 2PSXA 1TNHA 4Q7XA 1YPEH 4TPIZ 5E0HA 3MO9A 3TGJE 4P02A 1CE5A 2J38A 5EJZA 2VGCC 1C5YB 3A81A 3AVZA 3CENA 5EQRA 3LH3A 3TH2H 4F49A 4ZMAH 3QX5H 1GHYH 1LVYA 1K1MA 1NROH 1SVPA 5EGMA 4NGAH 3LJOA 2OD3B 5CHAB 4B75A 1ZTLA 1FMGA 5K7RA 2BHGA 1GJ9B 4FXGH 1WAYB 1NS3A 1K22H 1TBQH 1A0LA 3GY8A 4Y11E 1JOUB 1YPMH 4IS5A 3DSGA 3STJA 1TYNA 3VB5A 1EJMA 2FYQA 1V2NT 5A0CA 1FIZA 1TIOA 2SGDE 4DURA 1SPJA 2GCHG 4DT7B 4IC5A 1ZSJA 1ZZZA 1TNJA 3UWIA 3GYLB 4KGAA 2V7QD 1K21H 3N7OA 2ZGBH 1EUFA 3A87A 3LPRA 2BY7X 2ZHEH 1FXYA 1O3JA 3E90B 5EJLA 1ANEA 3LC5A 2ZF0H 4A1TA 1SR5C 4RT0A 1C5LH 1O2YA 3W94A 3MI4A 1YLDA 1XXDA 1OOKB 1PQAA 2VBCA 1V2LT 1MZDA 4UFDH 3U8TH 1AWFH 3A8CA 1PJPA 3RXTA 4ZHLU 3SU0A 3RXCA 2A4RA 4TSFD 3K6ZA 2RFKC 1WYKA 1K1JA 1JMOH 4TPYA 4YT7H 2WPLS 3HK6B 1C4U2 1MZAA 3TJNA 5JDUB 1GJCB 2G51A 1V2QT 1O0DH 5KEDA 2TBSA 4I8LA 1NFXA 3GY4A 2QE7D 4NIXA 3VXFH 3CS7A 2NWNA 3BTEE 1D3TB 2OUAA 1CGIE 4FOUC 2SGEE 1HAXB 4R8TB 3RU4E 1JXPA 1FY5A 3A7XA 1NC6A 1Z8RA 3PMAB 2VJ1A 1FQ3A 1YPHE 2BZ6H 2TIOA 5ESTE 3P6ZB 1F0TA 1EB1H 1VITH 3Q3KA 1DXWA 2WPHS 2GMTB 2GZ7A 1P2NA 2A5AA 3UNQA 1BMAA 1V2OT 1O3GA 4XDEA 3SU5A 1XKBC 2BD7A 3ENSB 4I8JA 1TMTH 5DPAA 1E79D 2FTMA 3TLOA 4WVPE 3HK3B 1VGCB 2AIQA 4VGCC 3TJOA 1UTNA 2P16A 2Y5GA 4I32A 4ISNA 1OWHA 1HAOH 2KFWA 1C9PA 2D8WA 2EI7A 4JYTA 3SZEA 2ZFSA 4SGAE 2ZU5A 2FX4A 5C67A 1HIAA 1ZOMA 1SGEE 3ZVAA 1E0FD 1GI5A 1ZSLA 4UEHH 1Z1JA 3BF6H 3VG8A 1O2TA 2BOKA 4BAKB 5AVDA 3GY2A 3V0XA 4DT4A 3LGUA 1GBAA 1TGTA 1P2OA 1GBTA 1O34A 1IQNA 2G4UA 2QAAA 3RDZA 2F83A 1ZHPA 2CK3D 1P11E 3PO1C 3FP7E 1LHEH 1AFQC 2GP9B 4Y0YE 3ZYDA 4ZHMU 2IOTA 1EAUA 3LDXH 4SGBE 2K1QA 2KZ4A 8GCHF 3A7WA 4MDSA 3RM0H 3PV2A 2H9EH 1AD8H 4ZXXH 2L74A 1SLXB 1NRNH 5J4QA 1TGCA 3KN2A 1P09A 2QXJA 3K9XB 1K0HA 1A4WH 3EA9A 3O8RA 1QJ6B 4GSOA 1TFXA 3IG6B 3ELAH 4O3TA 1G9IE 4X6OA 3SW2B 3Q77A 4Z1MD 1KXEA 3TIUA 1SHYA 1ZRBA 5I25A 3RC4A 1V2UT 3QGJA 1YF4A 3JZ1B 1AB9C 2ZHFH 3EE7A 2Y7XA 3RMLH 1SGNE 4JYVH 1Y3UA 3ATLA 5DSFA 3TU7H 2BDAA 2K8IA 1C5NH 1BTPA 1EPTC 1YKTA 5L2YH 1ELGA 4ABFA 1SGIB 2XYAA 2ALVA 4ABBA 2AYWA 4F4OC 3P8OA 1AHTH 4NIYA 1YPKH 1T31A 5FBEA 2QIQA 2XCNA 4B74A 1O2VA 1P04A 1GBJA 1DXPA 1GVKB 1C5ZB 4NFFA 3FKSD 1DSUA 4GAWA 3UOPA 1IQHA 1CA0B 2XBYA 1S6FA 2BXTH 2ALPA 2PTNA 2BX4A 1SGFG 4E06H 3BTGE 3E6PH 1O3EA 2PR3A 4ZKRU 4NSYA 3SHCH 2JDID 5FHTA 1T4VH 2HWLB 8ESTE 3U1JB 5AFYH 2BM2A 3NRLA 4K69A 4MPUA 4XE4A 1QJ7B 2Y5HA 3F1SB 1AUTC 4CREA 3QZQA 3RXPA 3T28A 1O5GH 1GPZA 1TA6A 3RXOA 1WUNH 4F48B 1HAHH 2VIOA 1TA2A 3MU1A 1W10U 3N99A 1S0RA 2R3UA 2WV5A 3RXMA 1LPGB 1CHGA 4F55A 1O3MA 5EPYA 2BY6X 3I29A 3VGCB 1DY9A 3L6PA 2QXIA 1WOFA 4K8YA 3T25A 1EP5A 1ZMJA 3LC3A 1O2PA 4A92A 1EJNA 2H9HA 2B9LA 2RCEA 4KTUA 1LTOA 3OSYA 4H6TA 1ESBA 2GV7A 1BT7A 5FCKA 1J14A 3MH7A 5A09A 2QC2A 2ZCHP 3A88A 1PQ7A 1GHZA 2HALA 3L3TA 1O5CB 3OFND 1O3FA 8GCHG 4D9QA 1J8AA 2ANYA 7GCHF 1O5EH 1ZHMA 1P9SA 2SNWA 1EFRD 1W14U 1A0HB 1C1PA 2LELA 1NU9A 7KMEH 2Q6GA 1P3CA 3MOCA 2W7UA 3RXLA 3KHVA 1TGSZ 1W11U 3C1KA 1UCYK 4K1SA 3TNTA 1JRTA 1CQQA 3LH1A 3MH6A 2BD4A 2VIPA 8LPRA 1EAXA 3P8NA 3KNXA 5AF9H 2FEQH 3SV7A 1GJ8B 1HIAB 1MD8A 4Y0ZE 1Z1IA 2ZDVH 3DFJA 3RM2H 1AIXH 1L1NA 1TBRH 1HRTH 4ISLA 3RXBA 2EQNA 2A7JA 5DP5A 2ANKH 1ZPZA 1QJ1B 2G5NA 1F5LA 3LGTA 4AN7A 1WQVH 1CT2E 4OGXA 1FONA 1EAWA 1IQFA 1GJAB 2GV6A 3ZZBA 1KDQA 3E1XB 1K2I1 4YT6H 1ETSH 3OTJE 2ZCLP 2PGQB 4PROA 3OAAD 5BRRE 1QB6A 4U32A 1UHBA 1GHBF 4K8BA 5JYIA 3H7TA 2O9QA 1C5XB 1C5MD 1NBMD 3GDUA 2STBE 4NZQA 1THPB 5FPYA 1GG6B 1TONA 3AAUA 1RTLA 3BV9B 3ZZ3A 3SU1A 1MD7A 1AUJA 3KL6A 5DK1A 5A8ZA 3M61U 1QA7A 1O2XA 2PKSB 1GHAF 4WXVA 1EX3A 2QN5T 1G2MA 1O30A 2SGFE 1A3BH 2F9BH 1P2MA 4BTTB 1F0RA 3A8BA 3PM3A 4OM9A 4YLUA 2J98A 1SG8B 2XNIA 1SI5H 2YOLA 3M7QA 3SN8A 3RXSA 1QQUA 4M7GA 1IAUA 1FPHH 2A32A 2BD5A 1Q3XA 1G30B 2BDGA 1G3DA 5T6GA 1IQMA 1J15A 1C1MA 2ZU1A 5C2ZA 3HGNA 1ZTKA 1SBWA 2WPIS 3DA9B 3SU6A 2KCYA 2BLQA 1ELAA 4FETA 2XWAA 4D76A 3P95A 4AFQA 1BB0B 1Z7KA 2V0BA 1C2GA 1DANH 2J4IA 4Y8YA 3KF2A 7GCHG 1QBNA 1GHWH 2ZPSA 2GD4B 1GI2A 4ISIH 4Y76A 3ATWA 2LPRA 3SNDA 5DN6D 4RT1A 1ABJH 1LHGH 4FUJA 3LKWA 2GZ8A 1PQ5A 1A3EH 1TE0A 2XTTB 5EXNA 2JH5D 3ODDA 2ZC9H 1BMMH 1AE5A 2O8LA 2ZNKH 3PLKA 1QA0A 3VB6A 1O3HA 1GI0A 4CRGA 1A2CH 1GI1A 4XBCA 3SV9A 3KCGH 1RIWC 3OE7D 1AVGH 3C27B 2OLGA 4CH2B 1OWDA 2A45B 2WPDD 1TNLA 1QCPA 5H4IB 1CT4E 1GJ7B 1O5BB 2D2DA 3KQEA 2ODQA 3P17H 2ZI2H 1IOEA 2QYIA 3MU4A 1HJAB 1AVWA 3RC5A 2ZGJA 1H9HE 1UVSH 1J9CH 4FUFA 4BXSA 4X2YA 4CHAB 2ZFFH 3PRBA 1GHBG 1O2KA 1O3NA 4MNYA 1YPGH 3BSQA 2FOAA 1MAXA 1AE8H 1B0FA 4FUHA 3VB3A 1DWEH 2BD9A 1P01A 3SUFA 3PWBA 3MWIU 5DJ7A 4DY7B 1Q31A 2CHAB 1TMUH 1GHAG 3D65E 3T62A 1H9LB 1C1QA 1GJBB 1TX8A 2W3KA 3MU8A 4ACBA 1O3OA 5EW1H 1T7CA 2ZPRA 1LVBA 4ESTE 1VR1H 2D26C 4WWYA 4X6NA 1O3DA 1SQOA 2QY0B 1XKAC 5HGGA 4IMQA 4D7GA 1DITH 4YLQH 5C5OA 2Y7ZA 1UTKA 2A0QB 1QIXB 1FIWA 4ZKSU 1C1WH 1VZQH 4AB8A 1O2ZA 1LMWB 1BQYA 4X8UH 5A2MH 1GBCA 4Q7ZA 1QZ8A 1IHSH 2Z9LA 1AZZA 1ARCA 1KDQB 1UJ1A 1QRXA 2TGDA 4NIWA 3MQKC 3T2NA 2OC8A 5TCCA 3TK6A 3GCNA 4JZEH 1HAZB 2VH0A 1UHBB 5IYTA 3V7TA 2GT8A 1NN6A 4K1TA 1EASA 1GMHF 4GUXA 3O8BA 1QBVH 2G55A 1SGDE 2ZPQA 3FN8A 2G5VA 3Q76A 1K28D 5EQQA 3SGQE 4CR9A 1C2HA 4K1EA 4UDWH 4ABEA 3I78A 4BTIB 3SGBE 4LZ4B 3GCHB 1GGDC 1YPLH 2A4QA 2ZDMA 1PPCE 3UFAA 1MQ6A 2J98B 3VB4A 1MUEB 1C5TA 3WW7A 4CR5A 1MTUA 1QL7A 3NKKA 3QTOH 2GZ9A 1ACBE 1GBIA 3TVJB 1FY1A 2SGQE 4WMFA 1LPZB 3KQDA 1ANDA 4Y71A 1BTWA 5ETXA 1H8DH 1RGQA 3K65B 1HLTH 3ESTA 4ZUHA 4ZHAA 1VJAU 1M9UA 2SGPE 1LKAA 1PFXC 5TJXA 3MFJA 1ETRH 4I33A 2OTVA 2GJGA 5T3HA 4JMYA 3DT0H 3SJIA 1NT1A 4X8SH 1LO6A 3SV6A 1FY8E 2C4FH 2PSYA 1YCPM 3F0OA 2IJOB 3N7DA 4FVDA 3U1IB 2KAIA 5HKKD 1BHXB 4GHTA 2XNDD 2AMQA 2WSSD 3SV2H 1TBZH 1QL8A 2B7DH 4UD9H 2PKAA 1SGYE 2BDCA 1C2DA 1LQEA 1ZPCA 2ZDLA 1ARBA 1O2WA 4AFZA 2RDLA 3P8FA 2QA9E 3FP6E 3A86A 2C8XB 4LK4A 3MH5A 1ZMNA 2GCTB 3PMJA 2B5TB 1CO7E 3NZIA 3BIUH 2Z9KA 4NA7A 5DP9A 1PPEE 1G32B 2QV1A 4BANB 1NFYA 1NRRH 3DCLA 3U69H 4A5TS 2ILNA 1T32A 4DIHH 3QDZB 1Z6EA 5GNDA 5KECA 4I31A 5JPMH 1QTFA 1GMHG 5JBTA 4ASHA 1AVXA 1D3DB 3M5LA 1DPOA 1YPJH 1H8HD 2W5EA 4E7NA 1RJXB 3H09A 3MNSA 1TGBA 2AH4X 2F9PA 1CGHA 3FAOA 2XC0A 2AGGX 1DWCH 4NIVA 2PWXA 1SFQB 2ZKSA 4X1RU 1LVOA 2YMSB 2P95A 1BTYA 3UTUH 1S81A 1TWXB 3A85A 4ZXYH 3F2HA 3HKIB 3UQOA 1NTPA 4B1TA 4AC9A 3V13A 4KTCA 2VIWA 3A7ZA 1INCA 5C0TA 1G36A 5LPFA 9ESTA 3RXEA 2QGRA 1P06A 5K0HA 3FFGA 5IK2D 1N8OC 1O39A 4BAMB 3WY8A 2Y80A 1O3LA 5EU8A 1DT2A 4AGKA 2FI3E 2JIZD 1OYQA 4HGCA 2FI4E 2A4OA 4OGYA 2F43B 3ATIA 3SQHE 2HPPH 2OC1A 2W6JD 2PP6A 3RXGA 3ZV8A 2Q1JA 1BTUA 1AN1E 2UUFB 4OS6A 2Z9JA 1W0YH 4IW4E 2C93B 2P3FH 5T6DA 1GI3A 4FUGA 4HZHA 4NWKA 1D3QB 1VCPA 1AGJA 4X0WU 3ZZAA 5CDFE 3QUMP 2NU2E 1SQAA 2W7SA 1RTFB 1VCQA 3KYFA 4INKA 1NRQH 5T1VA 2UUKB 2BB4A 5TCAA 2Z7FE 2ASUB 5FXLA 4XOJA 1DFPA 3H7OA 1QHRB 5L2ZH 1FZZA 1C2JA 5ABWA 2FPZA 1A5IA 3V12A 6CHAC 3M7UA 1N6XA 2ZU2A 5HMAA 1XX9A 2FTLE 1GCTB 2Z3EA 4H4FA 1IQJA 1GHXH 1MCTA 1EATA 1F7ZA 1MTNB 3A89A 1CU1A 5DP8A 1SL3A 1SLVB 1O33A 1YBWA 4XD7D 3ZIAD 1S0QA 3O8CA 1ELBA 1GVZA 3ZV9A 2LP6A 2KAIB 2HRVA 2VWLA 2XRCA 1EZSC 1C5RA 3F9GA 3M7TA 3LOXA 3PMHB 1C2KA 3M5OA 1BA8B 1K1LA 5CHAC 4OS7A 2AERH 2CGAA 2OC7A 1HCGA 3LIWA 3ZZ5A 2PKAB 1BIOA
chains in the Genus database with same CATH topology
3LGVA 3MH4A 2VH6A 4U01A 1GBFA 1P03A 4B2CA 4X8VH 2FOMB 3MU5A 4WH6A 2TRMA 2P94A 3A82A 1ZYOA 2BYAX 2AEIH 3S9AA 3Q3XA 3TITA 1O2NA 3B9FH 1SGFA 1TPOA 2FDAA 1QB9A 5ESBA 1C5WB 1O3BA 3ZZCA 1DY8A 3E0PB 4CRCA 4XFQA 3QTVH 4KP0A 2V3OH 1EZXC 3ZVCA 3CP7A 4FU7A 4DW2U 2NU1E 1TNKA 2VIDA 1MU8B 2FO9A 3AAVA 4JK5A 1UTPA 1C2MA 3UPEA 2ZQ2A 1V2JT 1O2SA 2FLBH 4X1SU 4GVUA 3M5MA 1CBWB 1TRYA 1BJVA 1DDJA 1K9OE 1O2QA 1XUHA 2Y81A 3F9HA 4O3UA 1CGJE 1GMDF 5FCRA 2VB0A 3GICB 1EAIA 3B23B 4E05H 1LDTT 4YOGA 1OWJA 5T6FA 2V35A 3SO3A 1F5KU 4X1NU 1Y3YA 5HYOA 1OS8A 1HAVA 2C8YB 4OS4A 4NA8A 3SQEE 4O03A 1W2KH 4NZLA 1MKXH 1QBOA 3ZZ6A 3W95A 4DCDA 4JK6A 1C1SA 2AMPA 2SNVA 2ZHQH 3LGWA 3RMMH 4ISHH 3RXKA 4BAHB 1C5VA 3UQVA 1ZGIA 1KLTA 2P8OB 1NESE 2F9UA 4IGDA 5L6NH 1MBQA 1P0SH 3VFEA 2JH6D 3GISB 1GBLA 1T8OA 2FESH 2R0KA 4HFPB 3MNCA 3TJVA 1SOTA 5FAHA 3M35A 5FX5A 2I6SA 1O2HA 1TPPA 4Y6DA 3LJJA 2P3TB 2BDBA 2B8OH 2A5KA 4WMDA 4ABGA 3BG4B 3FP8E 1O31A 1O36A 2C3SA 3BEUA 1YLCA 2VINA 2GTBA 1KXCA 4ISOA 1ZSKA 4OS2A 5CMXH 1ZMLA 2GMTC 3SUDA 2OINA 1C2EA 4TWYA 1KTTB 1FN8A 1Z8JB 1UVTH 1GBEA 4BAQB 2AGEX 2C8ZB 1P2IA 1ETTH 4MPXA 1VGCC 3AASA 7LPRA 3Q00A 2BVRH 3EA8A 1GJ5H 2YNBA 1ANCA 2XBXA 5F8TA 1D6WA 1TAWA 4AOQA 3B8JA 3RXHA 3OY5U 1BTZA 1SGRE 2NU3E 1V6DA 1XUGA 2Y5FA 1CVWH 1UMAH 3M3SA 1HXFH 4YOIA 2R2MB 3BTHE 1D9IA 4MVNA 4DIIH 1UTMA 2EA3A 1UK3A 4YM9A 1SLWB 1ELVA 1P2JA 2ANWA 3RC6A 1W13U 3HGPA 1GMDG 4U2WA 2VIQA 2A1DB 1HUTH 1HB0B 4NG9H 4Z6AH 1V2TT 2A7CA 1P12E 1ZTJA 3ZZ4A 2JETB 1Y5BT 3UOUA 2PV9B 4QT8C 2HGTH 1TX6A 1C1RA 1K1OA 1HDTH 1LHDH 1PPBH 2PW8H 1P57B 5EW2H 5L30H 2ANMH 1IHTH 1O2GH 4WXIA 2BDHA 3A7YA 3S7KB 2FS8A 1NFWA 1H8IH 2QF0A 1A1RA 3PTBA 1HAGE 4JZDH 1GBMA 2XC4A 5FPTA 1TALA 1BDAA 1Y3WA 2ZFRH 5PTPA 3A7TA 1ELTA 1W8BH 2O8UA 3EGKH 3U9AH 1DWBH 2D1JA 1OXGA 2FMJA 2P93A 5C3NA 5AFZH 4A1XA 4MPVA 1PPHE 3MHWU 4DVAU 4AG2A 1DLKB 1D4PB 5LGOA 3NXPA 3M36A 2H1UA 2ZTZA 1KYNA 4TY7A 4ZKNU 4ZAEA 3L33A 3AW0A 2O8MA 2DE9A 1KY9A 3AW1A 3M3TA 1WCZA 2A2XH 1ZJKA 3DHKH 3DD2H 3GDSA 2C8WB 2FOCA 2ZDKA 3HATH 1P10A 3BTWE 4X2XA 2BVSH 1ZGVA 1HAVB 2VWMA 3A84A 1HYLA 1CA0C 1UCYE 5C1XA 4K3JA 1MTVA 1E36B 1Y5AT 5EODA 4Q7YA 2VWNA 4R0IA 2FS9A 3RMOH 3D49H 1GBDA 1YGCH 3SZNA 3SGAE 1UVOA 1QQ4A 4FU8A 1FV9A 4AORA 4O9VA 4NA9H 2FI5E 1AKSA 3UREA 2TGPZ 1MCVA 2J95A 1D6RA 1BMLA 3SI3H 1VJ9U 2C90B 4J1YA 4MQAA 1NM6A 5G4BA 1NRSH 2ZECA 2ZU3A 1SOZA 3VGCC 4AFUA 1J16A 2ODPA 4H42U 1Z71A 3EDXB 4DGJA 2CV3A 2ESTE 1GI4A 3F6UH 4MTBA 3KQBA 3ZVFA 1DLEA 5EG4A 3GY3A 3FVFB 1UVPA 1QURH 4WMEA 2V6NA 4IMZA 1LVMA 2WYGA 4K5ZA 1FI8A 2RG3A 3EE0B 3RLYH 3LU9B 1G3BA 1H4WA 2GVFA 2WPMS 3S9CA 2O8TA 1NU7B 5GIBA 4CRBA 1AZ8A 2VGCB 2FM2A 4X1PU 2ODYB 3A8DA 1FY3A 1GI8B 1TOMH 2ZDNA 3E8LA 4IN2A 2CF8H 3SV8A 1QGFA 3PYHA 1GI9B 1O2MA 5HXFA 1S83A 3TH4H 1L0ZA 4FUDA 3EYDA 1OSSA 5DGJA 1K1NA 1HAIH 5A0BA 2AIPA 3SNAA 1DICA 2VNTA 1JIRA 1ZPBA 3IWMA 4JZFH 3CS0A 1B7XB 1O32A 3V3MA 3UR9A 2ZHDA 1O2JA 3P70B 1O35A 1SC8U 3QZRA 3GYMA 3FZZA 4K2YA 5FBIA 2FP7B 3RUOA 2UWPA 2BOHB 2BX3A 1SSXA 1GG6C 1W0ZU 3PROA 4WF8A 1EPTA 1BTHH 4NWLA 3BIVH 1V2KT 1OP2A 3UY9A 2PKSC 1FAXA 3SUEA 5EQSA 4GHQA 1TPSA 3F9EA 3BEIB 2BXUH 3E3TA 4CRAA 2QF3A 5FX6A 1UK2A 4TYDA 5E8EH 5JB9S 2Z3DA 4CH8B 1Z8GA 3SORA 1WTGH 1BBRE 1MBMA 2WYJA 1JRSA 2ZZUH 2ZP0H 1T8LA 4DJZB 4LZ1H 3SHAH 4UONA 3BTTE 1FNIA 3R3GB 5GXPA 4GCHF 1TNIA 4ABHA 4I8GA 1DUEA 5GPIB 4A1VA 1EB2A 3RXDA 2FIRH 3VB7A 3F68H 1K1IA 1RTKA 2RA0A 2ZO3H 5EXLA 2OBQA 3GOVB 3VEQB 6GCHG 1LHFH 1TOCB 2TPIZ 3ITIA 2VVUA 1UK4A 2M5TA 1ESTA 1L1JA 3PWCA 1LQDB 3OU0A 4XBBA 1KSNA 4ZROA 1DUAA 1RS0A 2VWOA 3D23A 1EZQA 1T8MA 2ZFPH 2BY8X 1F92A 3TNSA 4KELA 1J17T 2DUCA 2VVCA 3MTYA 3ZVBA 2FXRA 1AKSB 2BLWA 2WPJS 1V2MT 5I46H 1FAKH 8KME2 1L4DA 2ZTXA 4VGCB 1UTQA 2OCVB 1NRPH 1TLDA 2XCFA 4B73A 1AFEH 1PPZA 2THFB 4KKDA 2CF9H 1NPMA 1SGPE 3ZVDA 1JBUH 1HJAC 2G00A 2H9TH 4X2WA 3RU4D 6LPRA 1AMHA 1FDPA 2VIVA 3RMNH 4CHAC 1AQ7A 3BTDE 1EOJA 4E7RG 1C5UA 4A7IB 4IC6A 1FJSA 1ZRKA 1P02A 3LT3A 4IN1A 1N6YA 3PO1B 2CHAC 1XVMA 4JZIA 1AFQB 3HKJB 4GPGA 1KLJH 4FUEA 1BRCE 2NU0E 1SLUB 3RXAA 2XWBI 3SJOA 5E2PA 1UO6A 3SU2A 2FYRA 3A83A 4RKJB 2FZZA 2SFAA 3JZ2B 2ZG0H 5E0GA 1XUFA 2NU4E 2BVXH 4BTUB 3MNBA 4Q2KA 5C5NA 5LPRA 1V3XA 3PV4A 3EQ0H 1PYTC 1OKXA 3NWUA 4THNH 3SBKA 2BDYA 2JKHA 4GCHG 2F9OA 2AFQB 5GWZA 1C5OH 1WU1A 2ZA5A 3TGIE 1C2FA 1HAPH 1OWKA 2ZQ1A 2UWOA 1ZR0A 1S5SA 1ID5H 2PUXB 1MQ5A 1KXAA 1EQ9A 3KQCA 4BXWA 1TNGA 4B76A 1VITF 3D62A 1AB9B 4FUIA 3PB1E 3PLPA 4B71A 1EKBB 1C1VH 1O5DH 1BRBE 1RD3B 3MO6A 4NFEA 3UIRA 2A2QH 3U8OH 2H2ZA 1EPTB 1OWIA 2ZU4A 1LKBA 3S0NA 2BLOA 5F8ZA 3DUXH 2GX4A 1YYY1 4Y79A 1W7XH 3M3VA 1BUIA 1C2LA 2Y82A 3SNEA 2EEKA 1MTSA 3SU3A 1DS2E 2GT7A 3GCHC 4Y7BA 2PGBB 3SI4H 2ZFQH 4AG1A 4FUCA 2WV4A 1CA8B 1HBTH 1O2IA 1CHOF 1ZHRA 1L4ZA 1BCUH 1V2PT 1LCYA 1TABE 2LNCA 1THSH 3MMGA 2BLVA 1HNEE 5E2OA 3UNSA 1H9IE 1U6QA 4Q80A 5GCHF 3EA7A 1P9UA 1F0SA 4H6SB 2DE8A 1B5GH 1QFKH 1E37B 3URDA 1DVAH 2WUBA 3SJKA 1MKXK 2F9VA 4JZ1A 1TRNA 4JCNA 1V2WT 6ESTA 1NY22 2CMYA 4B2AA 1D3PB 5DO4H 1FN6A 3QN7A 5EXMA 4GLYA 3M5NA 3BN9A 4AX9H 2I6QA 2ZGHA 1O5FH 3GY5A 4MG3A 1KXDA 3U98H 1ESAA 2VU8E 4LOYH 1E34B 1TMBH 2J2UA 1OYTH 3TJUA 4X8TH 1Q2WA 1AU8A 1ANBA 1TB6H 1VCWA 1PQ8A 2XC5A 2GCTC 1UTJA 1GMCF 2G52A 3TK5A 5A8YA 1E38B 4AGJA 1V2VT 1XVOA 1XXFA 2HLCA 2UUJB 1HAYB 2W26A 2H6MA 2H5DA 1YM0A 1E35B 1VITG 2Z9GA 1QL9A 4MNWA 1MKWK 4LXBH 3LONA 1GWAA 3QGNB 4INHA 2HNTC 1TPAE 4ABIA 2BMGB 3U8RH 1GL1A 1RRKA 2BTCE 1THRH 9LPRA 1PPGE 2Q6DA 4J2YB 5IDKA 1HV7A 1EZUC 1DWDH 1SGTA 3MNXA 4I7YH 1BZXE 3KEEA 4ZH8A 1SB1H 2ZDAH 4CRDA 2PHBA 1C4V2 1AY6H 1P2QA 1CHOG 2P59A 1X7AC 3OY6U 3K2UA 3PTNA 1IQLA 3O8DA 1HPGA 1AO5A 1CT0E 1C1TA 2ZTYA 3IITA 1PYTD 1TQ7B 3RU4T 1C1OA 2R0LA 4KTSA 5GCHG 4YTAA 2WUCA 1G3EA 3ZYEA 1EP6A 2OQ5A 4JYUH 3EAJA 2BQWB 2IN2A 4CRFA 2IPHA 2Z94A 1Y8TA 1BTXA 5GDSH 2A5IA 2FODA 2Y6TA 4O97A 3F9FA 2Z3CA 1FY4A 2JH0D 1DX5M 4WH8A 3S7HB 1GJ6A 3RXRA 1FUJA 2BD3A 1WSSH 1G37A 1SFIA 2XBVA 1ELDE 3ZZ9A 5F6MA 2UWLA 5JBBS 1A0JA 2Z9IA 1A46H 1LHCH 4AYYB 3BTQE 3E91A 2GGVB 1AWHB 3ZZDA 4AYVB 5JBAS 1BITA 2HPQH 2XBWA 3SUGA 1MKWH 4MPWA 5A8XA 4YESB 1GMCG 4FU9A 3MYWA 2ZIQH 5SGAE 4UE7H 1BRUP 2R3YA 1P3EA 4TY6A 2J94A 2WINI 4I8KA 1RXPA 1RIWB 1W7GH 1WQSA 7ESTE 2PLXA 2G81E 1GCTC 1KTSB 1ZJDA 5F03A 1UTOA 2ZGXH 1O38A 1KXFA 4ABDA 1MTNC 1C2IA 3TGKE 2QCYA 4FUBA 4Y7AA 3RXUA 1RFNA 1FPCH 1Y3VA 3BEFB 1MTWA 5GJ4B 3RP2A 1MAYA 1O3IA 1GDNA 3H5CB 1HJ8A 1XMNB 1KLIH 4OS1A 2OXSA 1Y3XA 1HXEH 2UUYA 3RXFA 1SHHB 2FLRH 3ATMA 3TH3H 1HFDA 1IQKA 4MNVA 1OX1A 5EPNA 2ZGCA 1O3KA 5AHGH 1HGTH 3RXIA 3GCTF 2CJIA 1EJAA 4ZKOU 1T4UH 1SQTA 3KGPA 2EC9H 1HJ9A 1W12U 3HPTB 3UWJH 3QLPH 1GCDA 1C5SA 2Z6BD 1Z8IB 2A31A 3T5FH 1YC0A 1XUIA 1Y5UT 4Y10E 3SJ9A 4MLFB 2R2WU 1WBGB 2ZWLH 2OP9A 1K1PA 1W3CA 5C1YA 1WV7H 5DG6A 3FZDA 3Q3YA 1C1NA 2G8TA 4U30A 1MU6B 4B2BA 3QWCH 3T26A 1CBWC 4D7FA 2J92A 3OX7U 2EI8A 2PTCE 3FANA 1O3AA 5HM9A 4FVBA 2BD2A 4YO9A 3A80A 1IQEA 3SU4A 3BTME 3MO3A 3ZZ7A 2ULLA 4INLA 1JWTA 1ORFA 2EI6A 2G4TA 1C1UH 1BHXF 2BY5X 3DFLA 3STIA 1SGCA 1Z6JH 2B0FA 4DOQA 1OWEA 1A5GH 1MMJN 5DP4A 2BDIA 2BQ6B 2F91A 1C5QA 3RLWH 2FOFA 1DM4B 2P8OC 2QXHA 4I8HA 3OYPA 3PMBB 4UFFH 2PFEA 1KXBA 3GCOA 5CE1A 1UVUH 2GDEH 3M37A 1QY6A 1GGDB 2HVXA 2QXGA 3GY6A 1QRWA 4WY3A 2WPKS 2ZHWH 1AI8H 2XW9A 4HI3A 2HOBA 1O2OA 1S82A 1UCYH 3BG4C 1B0EA 1SMFE 3NPSA 3MU0A 2J34A 2OQUA 1XUKA 1EXFA 4AB9A 1T8NA 1NFUA 2HNTF 1O5AB 4UFGH 2TGTA 2ZEBA 2TGAA 4MNXA 3UR6A 1NZQH 3QK1A 5HM2A 1L2EA 2FX6A 3UUZA 1MH0A 1ZLRA 5JBCS 1YPHC 1JIMA 3SOSA 3GCTG 4OS5A 2OBOA 3E0NB 5F8XA 5DP3A 6GCHF 4YZUA 3LGIA 4ABAA 2FOGA 1TQ0B 5C1UA 2O8WA 3GDVA 3I77A 1BBRK 1GI6A 5A0AE 1Y59T 1QR3E 2BZAA 1TX7A 3A8AA 4A6LA 4Z0KA 4RSPA 3QO6A 3P8GA 1OP0A 1GI7B 1OP8A 4IBLH 4RKOB 1GDQA 2FWWA 3K6YA 5C20A 2R9PA 2BD8A 1L1GA 2HNTE 1EOLA 1H1BA 3SNCA 3RXVA 1DE7H 4XBDA 2ZCKP 2YNAA 1OPHB 5LPEA 3TPIZ 5DP7A 1O2UA 1GBBA 2FOBA 1TGNA 1GL0E 2JETC 5E0JA 3ZZ8A 5B6OA 4YOJA 1O3CA 1LPKB 4K60A 3ATKA 4BOHA 1DSTA 2A7HA 3SJ8A 1ABIH 4BAOB 1S85A 3G01A 2BY9X 1F0UA 1IQGA 2AMDA