3RXQA

Crystal structure of trypsin complexed with benzamide (f01 and f05, cocktail experiment)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxqA02
1AKSA 3O8RA 4X2YA 2VVVA 2A32A 3M36A 1SGFG 3ATWA 1W11U 1C2IA 1S0RA 1O5GH 3LGUA 1ZR0A 4NSYA 3B23B 4YTAA 1ELEE 1EZXC 4UD9H 2P94A 2B0FA 3CS0A 2HWLB 3ZZ5A 1Q2WA 1EB1H 2GT8A 4WH8A 3SW2B 2RDLA 1PYTD 1GBKA 1QBNA 2PTNA 4AYYB 1SHYA 1YPMH 4X6MA 2PKSC 3FANA 1D6WA 4B2BA 3H5CB 1GJDB 4JCNA 3UNRA 1SI5H 2EEKA 5JPMH 2UWPA 2C90B 2BVRH 4NZQA 4BAOB 1HFDA 2OQUA 1XKBC 3MU0A 4ZHLU 2ODYB 2QXIA 4RN6A 1Y5UT 5CHAC 1DSUA 1V6DA 3GY6A 4IC6A 1YGCH 1IQEA 1BT7A 1TRNA 2BHGA 4Y0YE 4ABBA 4I8HA 4KTCA 3LGYA 2XCNA 2ZU4A 2I6SA 2BQWB 2VNTA 3O8BA 1LCYA 4MNWA 5FCRA 3IITA 1MBMA 2OBOA 3SU2A 4A7IB 1V2QT 1LHEH 8ESTE 2ZI2H 2ZGBH 4E06H 2ODPA 2VIWA 2KAIB 2VINA 2Z3DA 1YPJH 1JIMA 2A4GA 3RXBA 4B74A 1Y3XA 3BIVH 1UTPA 1PPGE 1MKXK 1BJVA 3M3VA 4K5ZA 3TU7H 3ATLA 4UFEH 2FX6A 1P0SH 1DOJA 1RJXB 1J9CH 2Z3CA 2ZQ1A 2ZGXH 4RSPA 2VIOA 1SGFA 1UTJA 3ZVGA 4U30A 1IQNA 2O8UA 1C5QA 1GI6A 4MNYA 1ETSH 1ELGA 3GY8A 3TGKE 2C8ZB 5I25A 1V2JT 1V2TT 1MU6B 4FU8A 5C3NA 5TCCA 3RXTA 1Q3XA 4ISIH 1YP9A 2ZFSA 4NFEA 5F03A 3LT3A 4B73A 1WV7H 1ZTKA 2NU1E 3P8OA 4MVNA 4CHAC 3QK1A 2AH4X 1CA0B 3AAVA 1SGQE 3GDSA 1OP0A 1H8IH 4DVAU 2Q1JA 2BD3A 4XSKU 1G9IE 2LNCA 2QF3A 3P92A 1BMAA 1RGQA 1CT2E 1AI8H 4ISHH 1WTHD 1UVPA 3VB4A 1LPGB 3RXRA 2ZDNA 3PLBA 5A8ZA 2GV7A 4INLA 2D1JA 2STAE 1O30A 3GICB 2BD5A 4FVBA 3GCHB 1P2MA 5A8YA 2YNBA 3GOVB 1V2RT 4WWYA 1AMHA 2QXHA 4Q7YA 3F1SB 2Z3EA 2GKVE 4CREA 1KLJH 4CR9A 2ZFQH 4CRCA 5EXNA 2VB0A 3UFAA 1K1IA 1HAVA 1ETTH 4OGYA 1MCTA 4FUEA 3A86A 3SO3A 5E0HA 3MO3A 3JZ2B 4ZKRU 4HZHA 4GVUA 1V2MT 2JH5D 2BY9X 3SZNA 1TAWA 2CGAA 4YM9A 4GHQA 2BQ7B 3MOCA 1L4DA 1G3CA 2OTVA 4NWLA 3P6ZB 1MTNC 1O2IA 1O2VA 3SV9A 1J14A 1C5XB 1CHOF 2B9LA 4BAQB 1GBHA 1P8VC 1TX8A 3T5FH 5EXMA 3SI4H 5ESBA 3TNSA 2GMTB 2VJ1A 2ZFRH 2BDBA 3NKKA 2V0BA 5C1XA 2Y5HA 1AB9B 1O2UA 4IMZA 1S0QA 2A2XH 1MZAA 1TBRH 2OLGA 5DG6A 1YCPK 4IN2A 4IC5A 1GBBA 1E35B 2BD4A 1IQGA 3NXPA 3VEQB 3FP8E 4D76A 1O38A 2FIRH 3SV7A 4F49A 1PPFE 1BHXB 3VB6A 1GMDF 1XUKA 3RM2H 1BMLA 1NRPH 1S85A 2O8LA 3LJOA 4K2YA 1P9UA 1YF4A 3ZVCA 1HJAB 5LGOA 1P01A 1DXPA 3LU9B 1BBRH 3ZZ7A 1V2WT 3D49H 3FVFB 1MUEB 2ZFPH 4MNVA 1BTHH 3VPKA 4OS2A 1UVSH 1EJMA 1HYLA 1ZLRA 4H4FA 3TK6A 1MH0A 1ESTA 1GI1A 1QBOA 3LGWA 2BM2A 3LJJA 3P8GA 2LPRA 3A84A 1QURH 1C5SA 2BLVA 3GISB 1P3CA 2R0KA 3ENSB 4OS5A 3SUFA 1GHVH 1MAXA 3UIRA 2WV5A 3ZZDA 1FMGA 1KY9A 4Y10E 1IHSH 3UQVA 3MNCA 4DIIH 1ANCA 1SBWA 5DPAA 1A3EH 1G3BA 1S83A 1HRTH 1P2NA 1UHBA 1LQDB 3WY8A 2DUCA 1SLUB 2A2QH 4ASHA 2XW9A 2F9PA 1FJSA 1MBQA 5L6NH 1AO5A 3SBKA 1NROH 3ZVAA 3RC6A 1VITG 4UFFH 2CJIA 4RKOB 1ZYOA 5GCHF 5SGAE 4B76A 2PSYA 5HMAA 4ABGA 3MWIU 4NIWA 2BXUH 1C9TA 2HLCA 2QN5T 2ZU3A 1ABIH 1TOMH 1WAYB 4X8UH 2J38A 1FAXA 4NWKA 1F0RA 3LC3A 2A4RA 3M5MA 4X6NA 2ZGJA 1EAXA 1V2VT 2D2DA 1HAOH 3QTVH 4FUHA 3OU0A 4YESB 1BTPA 4DIHH 2WPKS 1E36B 3RUOA 2XWBI 2OC8A 1HIAA 3UQOA 1GHAF 3LKWA 4AX9H 1C1RA 2EI8A 3UOPA 2ZDAH 1QL8A 3GY5A 1NU7B 2GX4A 1QQ4A 2GDDA 3MU4A 4IMQA 4MLFB 1LO6A 1SGEE 3PMHB 4CH8B 1HAPH 5JB8S 1GI9B 1H4WA 1NC6A 3RXSA 2WPIS 1TNKA 4E7RG 1GCTC 1Y3VA 3PYHA 1C5RA 4A6LA 1JRSA 1ZJDA 3H7OA 4DCDA 3TLOA 1TPPA 4X0WU 3RC4A 1N6YA 4O3TA 5GDSH 2G52A 3PM3A 5C5NA 1CSOE 1GWAA 1XXFA 3STIA 1K1LA 2FI5E 3BTWE 4XBCA 1HAHH 3SU1A 4X6OA 4AGJA 4FUIA 4HI3A 2F9NA 2W3KA 1P2QA 3FZDA 4FUCA 4BOHA 1CA0C 4CBNA 4INKA 3A7WA 1AVGH 1P03A 1W13U 1UO6A 1IQKA 1O3AA 3MYWA 1IOEA 1TALA 2J95A 1MMJN 3ZV9A 4YT6H 4B75A 3QN7A 1A61H 2WPHS 1F0TA 1TGCA 3ZVFA 2XBXA 3GCHC 1GBJA 1A5IA 3RC5A 1UCYK 1FI8A 4MPUA 1GJCB 2R2MB 4KTUA 2GV6A 3ODDA 3MNSA 1QNJA 4Y7AA 2F3CE 1MKWH 3E0NB 4FUDA 2BY7X 4ZH8A 3SNCA 1ELBA 2Z9KA 2R3YA 1UTNA 1GI8B 1TRMA 2TGAA 1D3DB 3L6PA 3DUXH 1WCZA 2B8OH 1CHOG 3MH4A 3Q3KA 2BDYA 4ESTE 3A8DA 3DFJA 1Q31A 4Q7ZA 4ABEA 2G4TA 1RIWB 1SGNE 2OBQA 1SFQB 2ZPSA 3GY3A 1C2EA 3PLKA 2HGTH 1DT2A 5HM9A 4E05H 1KXCA 5JBAS 3V3MA 4X8VH 3BV9B 2ZHDA 3PMJA 1TGTA 3SQHE 1OOKB 4UEHH 1YPHC 2GMTC 3RXOA 5DP3A 4AG1A 3EA9A 1JMOH 3F9FA 2O8WA 3VB7A 4B1TA 2RA0A 1AB9C 1C1TA 3UY9A 1KLIH 1GBLA 4NA9H 1O2QA 1YPKH 1FV9A 1C5VA 2FP7B 3A8AA 4AFUA 3O8CA 2ZPQA 3LONA 3HGPA 2J9NA 1SLWB 1QA0A 1LPKB 1OWIA 3E1XB 3STJA 4X2WA 1TX7A 5FCKA 1LVMA 3T2NA 2J2UA 5C1UA 1ARBA 6CHAC 3ZVBA 1RRKA 1G36A 3M61U 1AWFH 3KQBA 2JH0D 3K65B 4NFFA 1ZHPA 2G51A 2WYGA 7ESTE 1LDTT 4OS1A 2ZA5A 4WMDA 5C20A 1D9IA 1WBGB 2BY5X 2C8XB 1XUJA 1FONA 2A45B 1BA8B 1Z1IA 1QJ7B 1QRZA 1QJ1B 1S81A 2BVXH 1AU8A 1K1JA 1H8DH 2VWNA 2BTCE 2J94A 3RXQA 1OWHA 4AYVB 2G55A 4BNRA 2A7JA 1ZGIA 3DT0H 3ESTA 1WYKA 1JWTA 1NFWA 2BD7A 3F9EA 1L1NA 1O33A 3TH2H 1Z8IB 3MHWU 3UWJH 2GZ9A 1IQFA 3RU4E 3W94A 1FPCH 2QF0A 3URDA 4WH6A 3Q00A 2IPHA 3Q3XA 4NA8A 2ZU5A 4NZLA 1GHYH 1O3EA 2O8TA 2SFAA 1A3BH 2FI3E 3SJKA 4D7GA 1FY4A 1KXBA 5FX6A 4JYVH 2BDHA 2NU3E 1GHAG 2XXLA 4Y0ZE 3ZZAA 1P11E 3RXFA 1SQTA 1O3FA 2A5AA 2ALPA 1GJ4H 1SFIA 2HNTE 4Y8XA 3A7ZA 1O2KA 2HVXA 5EPNA 1YBWA 2H2ZA 4AB8A 3T28A 3DD2H 1Y8TA 1O2HA 4NIYA 2ZDKA 1T8OA 4BAMB 4A5TS 5BRRE 1ETRH 1RS0A 1OS8A 5GPIB 2BOKA 1QY6A 1T4UH 2FM2A 1F7ZA 1VCPA 4WF8A 3RM0H 1NT1A 4K1SA 1ACBE 2FOHA 1AGJA 2ANWA 1C1SA 4JYTA 3LIWA 2A1DB 5A09A 5LPFA 3S7KB 1K1NA 1WU1A 4GSOA 1O2XA 1VR1H 4MQAA 5T6GA 1CGHA 1XUFA 5AFYH 2Z9GA 2QIQA 1YCPM 1HAXB 8LPRA 2V3OH 4DGJA 3E16B 3SU5A 1OX1A 3BTFE 1C2FA 4DOQA 1C5ZB 1KDQB 1LHGH 1O31A 2ZF0H 1AFEH 3SU6A 2BY8X 1BTUA 1AHTH 1CHGA 4WY3A 1O3BA 1THRH 1GBAA 1O2JA 4ZMAH 1W2KH 2FOFA 3UNQA 2C93B 3UR9A 3E6PH 2ZWLH 2H5DA 1C2JA 1UK4A 1C1MA 1EQ9A 1P2OA 1TMUH 1ZSKA 3BF6H 3B8JA 4ISOA 1J15A 2C3SA 1K1PA 2RCEA 3GCTF 1AFQC 3LGVA 1TBQH 4Y7BA 3KHVA 3MTYA 2W3IA 1GCTB 1T32A 2GVFA 1D3PB 1ZSJA 3PWBA 1ELDE 2P8OB 2FYQA 1EUFA 4JK6A 1ANDA 6GCHF 1KTSB 5DKMA 2OP9A 1H9LB 2PGBB 1CGIE 1O2NA 1A7SA 5FPSA 2ZEBA 2HNTF 2NWNA 1OYTH 1F5KU 1GPZA 3MMGA 1HCGA 1P10A 1G3DA 5EG4A 4A1TA 1RIWC 2FOBA 1O35A 2ALVA 2PGQB 3M7QA 3BN9A 4YZUA 2XC4A 4UDWH 1LHCH 3SU3A 4NA7A 1FNIA 2BB4A 1IQJA 1PPHE 1GJ9B 3PLPA 4YOGA 1E38B 1LTOA 3KN2A 1ZGVA 3IWMA 4GCHF 1DITH 3NK8A 1O3DA 1DM4B 4FU9A 1O3OA 1IQMA 4QT8C 1FAKH 1BIOA 5E8EH 1HLTH 4TWWA 4CBOA 2WINI 3M35A 2ZO3H 2ZNKH 2SGAA 1C5UA 3VB3A 1THSH 1L0ZA 3ZZ4A 3D65E 4X6PA 1V3XA 3DHKH 2PTCE 1SGRE 3SUDA 3UOUA 3TGJE 4JZDH 2W7UA 4U2WA 4FUBA 1GDQA 1PPCE 2A31A 3RXDA 1ZOMA 2ANYA 1GHBF 2C4FH 3BTTE 1YM0A 2VH0A 2EC9H 2V6NA 6ESTA 1WQSA 3RLYH 3ZYEA 2ZECA 2FXRA 1O39A 4Q2KA 1EXFA 1KXAA 3KQCA 1HAZB 3SU4A 5C67A 1C1QA 4KTSA 2VIQA 3ATIA 2ZU1A 4JZ1A 2PFEA 1A0LA 4YOJA 1FIZA 4CR5A 4Y8ZA 3L3TA 2R2WU 1Z8JB 1PPZA 1Z6JH 1TX6A 1YPLH 5EQSA 1O2MA 3OY5U 4J2YB 3U8RH 5A0BA 2FLRH 3SJ9A 3MNBA 2GD4B 3M5NA 1WSSH 1GBEA 1CT4E 2VWOA 3BIUH 1BBRK 3QUMP 2GZ8A 1A1RA 2UWOA 1AUJA 1NFUA 1O36A 3IG6B 8GCHF 1PYTC 3PTNA 4PROA 1W0YH 1SQOA 1C2GA 1TPAE 3BTDE 1J8AA 3M5LA 2A5KA 1QJ6B 2GCHG 2Q6DA 1GMCF 2PW8H 5CMXH 3LC5A 3W95A 1MD7A 3N7OA 3GCNA 4MG3A 4UFGH 1TNJA 6CHAB 3F68H 4B2AA 2ANMH 1UK2A 1N1LA 1RD3B 2ULLA 1EP5A 1KXFA 2FESH 1O0DH 1FQ3A 1GJ6A 2H1UA 1K1OA 2F91A 3VGCB 4AOQA 2BDGA 4BANB 2UUYA 3NUMA 4NCYA 3RXHA 4WJG2 4KGAA 3PO1B 4KP0A 2G5NA 1TABE 5EPYA 2AFQB 2BDIA 2FOGA 2FOCA 2QY0B 4O9VA 2QC2A 1ANBA 1QQUA 2Y7XA 2HPQH 2M5TA 1EPTC 2PKAB 1P3EA 1YCPH 4X2VA 1BDAA 1MQ6A 2VWLA 3UR6A 1UVOA 2VIDA 1G3EA 3T29A 1ZMLA 2XWAA 3QGNB 1HDTH 5L2ZH 3HGNA 3AW1A 1Y3YA 3RXJA 3ZZ6A 2QYIA 1X7AC 1NRRH 1WUNH 3EAJA 1YPGH 3NZIA 7GCHF 4WXIA 3H7TA 1GI0A 3SOSA 2UWLA 1ZPCA 3ZZCA 3TGIE 2NU2E 3GY4A 4Y6DA 1ORFA 2FI4E 1NRQH 3RXGA 3U1IB 1YKTA 2BYAX 3MO9A 1C1WH 4BTUB 3FP6E 3LDXH 5HM2A 1BMNH 1DY8A 1ESBA 2A0QB 3RDZA 1P02A 2VVUA 1AD8H 2ZHQH 3TJVA 2VGCC 1NPMA 2Z9LA 2CF9H 5DP9A 3URCA 5E2OA 2BLQA 1TGSZ 2Z9IA 1V2OT 1T4VH 4DG4A 2ZZUH 1D3QB 5GWZA 3GY7A 2FOEA 1UVTH 1N8OB 1AZZA 3GCTG 1HB0B 2JETB 4K69A 1FY5A 4Y11E 3C1KA 2Y80A 1GGDC 4MPXA 2YNAA 1DDJA 3ELAH 3T26A 1AE8H 1ZPBA 1UTQA 1BZXE 4VGCB 3SUEA 3A83A 1W10U 2AERH 2BZ6H 2OCVB 1P2JA 2ODQA 2QA9E 6GCHG 2IN2A 1DX5M 1DSTA 4RKJB 4Q7XA 1O34A 1C4Y2 2J92A 3U9AH 1W14U 1EPTA 2P8OC 2A7CA 5GJ4B 1OWJA 4SGBE 2F9UA 5F6MA 2TGDA 5FAHA 1OWEA 5J4SA 1HAGE 3O8DA 1Y5BT 3A87A 1SOTA 1QRXA 1VCQA 2ZCLP 3T25A 4I7YH 4H6TA 2P3FH 2P93A 4M7GA 3MNXA 1ZRBA 3M3SA 2GP9B 5A0CA 2XRCA 1FPHH 4ZKNU 4BXSA 4DW2U 1ZTJA 2CV3A 3ZZBA 1A5GH 2VWMA 2XC0A 1O2LA 2VU8E 2GZ7A 1EAIA 1BCUH 1G30B 5DP5A 1SGYE 5E2PA 1ELFA 2FS8A 5HYOA 5GXPA 1NRSH 2H9HA 5EOKA 2A5IA 2EI7A 2H9EH 2QXGA 2GTBA 4YLUA 2ZGCA 1QB9A 3VB5A 3PMAB 3MU5A 3SGBE 4J1YA 1TGNA 3PTBA 1BB0B 1QGFA 2PV9B 1V2LT 1SG8B 1Y3UA 1THPB 2P95A 1Y59T 1OKXA 2SGQE 2UUJB 3VXFH 1OWKA 4TYDA 2FO9A 2A4QA 4BAKB 1VZQH 1BRBE 1KDQA 1O2SA 3ATMA 1A2CH 3QO6A 1EZUC 5C5OA 5FPYA 3TIUA 1TQ0B 3U69H 1KSNA 1BMMH 1GI4A 5K0HA 1GHBG 1CA8B 2PR3A 3U98H 4X1QU 1W12U 4Y79A 1RTFB 7KMEH 2CHAB 1F0UA 1P06A 1PQ8A 2BLWA 2FPZA 3AW0A 1G32B 3ZYDA 1AFQB 1C5NH 1P12E 1ELVA 3TVJB 1BUIA 1HAIH 1QL7A 3P70B 2F9BH 2FS9A 4ZKSU 3E90B 3QX5H 1SGIB 2QCYA 2BX3A 4BAHB 2R0LA 1V2UT 3DFLA 4DY7B 1DICA 1BRAA 2H9TH 1GVLA 3RMMH 3T27A 1J17T 1TMBH 5FXLA 1O2TA 1Z7KA 1GCDA 2GGVB 3SJOA 2AGIX 6LPRA 2AYWA 1XM1A 1MU8B 1BTXA 1XUIA 2AIQA 2EA3A 3A82A 3EE0B 1UVUH 2ANKH 3MH5A 1AVXA 1K28D 1MTWA 1VJAU 3RXEA 1O32A 3PWCA 4K60A 2C8YB 2JH6D 1A0HB 3F9GA 2Y82A 2ZDMA 2G4UA 2HALA 1NRNH 3K6ZA 1OSSA 3K2UA 4XBDA 1IQIA 4AZ2B 3TJNA 1LVOA 1GMCG 1GMDG 2Q6GA 2BQ6B 1TA6A 1N6XA 1H1BA 2FYRA 4JZEH 3GYLB 3QGJA 3AAUA 1LPZB 3OTJE 1UJ1A 1XXDA 5DP4A 4AGKA 1UCYE 3QDZB 5AF9H 2ZGHA 3MU1A 1EKBB 2ZP0H 1C4V2 1GJBB 3SV6A 1OPHB 4CRGA 1AIXH 1C1OA 3NWUA 3RXMA 4BXWA 3KNXA 2OC1A 4NIVA 2GCTB 1KYNA 1HJ9A 1CU1A 1SQAA 3VGCC 1DY9A 3VFEA 4CH2B 5JBTA 2CN0H 5I46H 1J16A 3A7VA 4AN7A 1KXEA 2Z7FE 5JDUB 1PPBH 4AB9A 1EAUA 2SGDE 3PO1C 4GLYA 1KTTB 1DLEA 4IBLH 1EZSC 3HKIB 3L33A 3MH7A 5DP7A 4SGAE 3EA7A 2ZFTA 1TQ7B 3SORA 1SMFE 2EI6A 1MTUA 2R9PA 3BG4B 5AHGH 1XX9A 3A8CA 2WUBA 3RMOH 3S69A 5AVDA 3Q77A 3BEFB 2ZDVH 4ZAEA 3EDXB 3U1JB 4A92A 2BXTH 1DFPA 5GCHG 5T6FA 4B71A 7GCHG 2ZCHP 3V7TA 4GUXA 4DURA 1Z1JA 2FLBH 1ZPZA 4MDSA 3U8TH 1C5TA 1F5RA 2O8MA 2ZTXA 2B5TB 1NFYA 2OC7A 3RXCA 2GDEH 1TMTH 1CQQA 2H6MA 4LXBH 2BVSH 2PUQH 4JYUH 3LH1A 4XDEA 2C8WB 4INHA 1W7GH 3MI4A 4I8GA 1IHTH 1BOQA 1TPOA 2ZG0H 1GI2A 1CO7E 1GHXH 1Z71A 3SHAH 1V2ST 4LZ4B 2F9OA 3BTEE 4TY6A 3ODFA 1O3CA 2HRVA 4AFSA 4K8YA 1DLKB 2D8WA 1L1GA 5LPRA 1T8NA 1GDNA 3PV4A 4X8SH 3T62A 4TPIZ 2BX4A 3KF2A 3A7XA 4E7NA 1EJAA 1N8OC 2JETC 2G8TA 1TOCB 3HK3B 4O97A 1L2EA 3UWIA 4VGCC 3GDUA 3GY2A 4XFQA 1YC0A 3SV2H 5LPEA 1BTWA 2SNVA 1C5LH 2TIOA 2ZTZA 1NZQH 2FWWA 3LGIA 1HXFH 1EPTB 3RU4T 5C1YA 1O2OA 4H6SB 2SGFE 1TA2A 2PKAA 3DA9B 4FU7A 1CGJE 4AORA 3A7TA 3I78A 5FBIA 1TE0A 1JBUH 3BTME 4CRFA 1DVAH 3BTQE 1C1UH 2OUAA 4X1RU 3TK5A 1EOLA 1SSXA 1FIWA 1GBDA 1KXDA 4K3JA 4DT7B 5E0JA 1DPOA 4XBBA 3S0NA 1MQ5A 5DP8A 1ZHRA 4XE4A 4I8KA 1B0FA 1P09A 2SGPE 1ZMJA 2ZHFH 1C1VH 3RMLH 2TGTA 1NY22 3G01A 1UK3A 4WVPE 1GI3A 3E91A 3E3TA 1ZTLA 1GI7B 1GJ7B 1Z8RA 1ZSLA 1GG6C 2OC0A 5EQRA 1YLDA 3M7UA 3PB1E 1DS2E 2VGCB 3MFJA 1BRUP 3D23A 1VITF 2UUKB 2I6QA 3D62A 1TWXB 2V35A 4I33A 1A4WH 1D6RA 4NSVA 3R3GB 3M5OA 4WMFA 1SGCA 1HNEE 1TRYA 1A46H 3PMBB 5FBEA 2ZFFH 5FPTA 1GGDB 2R3UA 1DUEA 3EA8A 2CHAC 1F5LA 2K1QA 2XNIA 4WXVA 4K8BA 2QAAA 3BG8A 4HTCH 1V2NT 3Q76A 1ELCA 1MD8A 2ZQ2A 3OYPA 2O9QA 3E0PB 5G4BA 2WPJS 3HPTB 1XVMA 1NESE 2BDAA 1GBTA 2XBYA 4XOJA 1GDUA 4X2XA 1NFXA 2Q6FA 3LPRA 2B7DH 1SHHB 3HK6B 1FZZA 9LPRA 1MTSA 4WMEA 1WQVH 2Z6BD 3BSQA 5AFZH 1AZ8A 1GJAB 4IN1A 1ABJH 2DE8A 4GHTA 3U8OH 3RXVA 4ABJA 1GHZA 1RFNA 1P04A 1O3MA 3NPSA 1P05A 3LOXA 1EX3A 1LMWB 1O37A 2Y5FA 2OQ5A 1ELTA 5JBBS 1OXGA 2SGEE 3GCOA 1F2SE 1YPHE 1DUAA 1C5PA 2F83A 1ZJKA 1HAYB 1MTVA 2AGEX 3TJOA 1ZZZA 4IS5A 4X1PU 1L1JA 3RU4D 1FUJA 1C9PA 1B7XB 1L4ZA 1P9SA 3SV8A 1MKXH 1FN6A 5B6OA 4U01A 2G5VA 2IOTA 1UTOA 3E8LA 2CXVA 3QZQA 4MNXA 4R0IA 2PUXB 1SGDE 1T8LA 4X8TH 1P2IA 1A0JA 2OD3B 4OS4A 1MAYA 1C2DA 1NO9H 3SGQE 1U6QA 4B2CA 5ESTE 3GDVA 1SB1H 2WUCA 1QB6A 2GCTC 5EQQA 1O5DH 2FTLE 3SI3H 4ABHA 5IYTA 2F9VA 2AS9A 3C27B 1TB6H 1RTKA 3I77A 3M3TA 4GAWA 1GL1A 1LQEA 1QHRB 1K2I1 2IJOB 4O3UA 1O3HA 3BG4C 3S9AA 4NGAH 2A7HA 2ZU2A 4A1XA 1HXEH 4U32A 1O5EH 1ESAA 1OP8A 3MO6A 1LHFH 3A81A 4HFPB 4UONA 1HGTH 1VGCC 3RMNH 3NCLA 1O5BB 1EASA 1Z8GA 5JYIA 1O2RA 1VCWA 5DP6A 1K1MA 3BEUA 3SHCH 1C2HA 4LK4A 3RXAA 1G37A 3A7YA 1Y5AT 5ETXA 3MH6A 1NS3A 1JRTA 5FHTA 4ABDA 2VIPA 2ZCKP 4FXGH 2ASUB 4I8JA 5EU8A 2BY6X 1JXPA 1TYNA 3P8NA 3V12A 1C2LA 2W5EA 2WPMS 1M9UA 1GJ5H 3ZZ3A 8KME2 1AQ7A 1V2KT 2XC5A 3SNAA 1QFKH 9ESTA 1YYY1 1UMAH 4IW4E 5LH8A 5EGMA 4NG9H 1T8MA 2NU4E 1XMNB 5BPEA 3A80A 4FUGA 1W0ZU 2ZPRA 3S9BA 3BEIB 2XYAA 1SOZA 1GVKB 4KELA 5DO4H 4O03A 1BHXF 3S7HB 3P8FA 1ANEA 2FDAA 3RLWH 4X1NU 1OWDA 4OGXA 1E37B 1NN6A 4AFQA 1SL3A 2JKHA 3S9CA 1O2WA 1FY1A 4YO9A 1CT0E 1FN8A 3HKJB 1LKBA 2XTTB 1P2KA 1EOJA 2SNWA 1BITA 1AKSB 4BTIB 3B9FH 1O2PA 5K7RA 5JB9S 4HGCA 3VXEH 2BMGB 1AWHB 5L2YH 1GBCA 4MPWA 2H5CA 2J4IA 1NTPA 1BBRE 1F0SA 2TRMA 1D4PB 1MZDA 2PWXA 3KEEA 4Y8YA 3EYDA 1FDPA 4THNH 3SUGA 1DWDH 1HPGA 1Z6EA 1S6FA 3EQ0H 2D26C 1IAUA 1O3IA 1QRWA 1CVWH 2Y5GA 1AVWA 3SNEA 3I29A 1LHDH 1LVYA 3Q3YA 5FX5A 5DJ7A 3SN8A 1EP6A 5TCAA 4K1TA 1TIOA 2DE9A 3KL6A 5CE1A 1BTYA 1C2KA 3RXIA 1O5FH 3TNTA 2G81E 1GMHF 4LZ1H 4IGDA 2Y7ZA 2ZHEH 5A8XA 1XKAC 5DGJA 2XBWA 4JZFH 1FXYA 2VVCA 1AN1E 1CBWB 4MPVA 4Q80A 4BTTB 1S82A 4Y71A 5EW2H 1O3LA 3RXPA 1QCPA 3RXUA 1IQLA 2ILNA 4I32A 4H42U 2WYJA 1XUHA 3SNDA 2ZTYA 4Y76A 1XVOA 3UUZA 5J4QA 4ABAA 1H9IE 1NU9A 2VIVA 5E0GA 1GBFA 4JMYA 2AMDA 1O3JA 4UE7H 3QZRA 2HNTC 1GHWH 1TNHA 4GPGA 1IQHA 5C2ZA 1VJ9U 5A0AE 1AUTC 1GL0E 1S6HA 4GCHG 4ISNA 3BTGE 2ZC9H 5EODA 1T7CA 3SQEE 4ZHAA 4ZXXH 2AMPA 5EXLA 2RG3A 1SLVB 1PPEE 3K9XB 1EATA 1B0EA 1HV7A 2BLOA 1O3KA 3BTKE 3K6YA 3TJUA 2QGRA 2THFB 3TH4H 5HXFA 5IDKA 1XUGA 2W7SA 1MKWK 4D9RA 2PKSB 5ABWA 1B5GH 3A85A 1KIGH 1EZQA 3A88A 1DWCH 1GG6B 1W7XH 3EGKH 2FTMA 3BTHE 1C4U2 4F4OC 1OP2A 1EJNA 1ELAA 1D3TB 3QLPH 2AIPA 1QL9A 2P16A 3OY6U 3SU0A 1AE5A 5CHAB 4D9QA 2ZIQH 5DK1A 1SPJA 1C5OH 1QR3E 2OINA 1O5CB 2BD2A 4AG2A 1C5YB 1UTMA 4YOIA 2FZZA 1WTGH 3QTOH 2XCFA 1W3CA 4UFDH 1HUTH 4KKDA 1DANH 1PJPA 1Y3WA 3ITIA 2FEQH 1K21H 4JZIA 1C5WB 2ZDLA 1KLTA 1TFXA 1AY6H 1BJUA 1TLDA 3SGAE 4CRAA 2A4OA 4ZUHA 5F8ZA 4NIXA 2QV1A 1JOUB 2XBVA 2AGGX 1K9OE 5JBCS 3TITA 4ZROA 4Z6AH 3QWCH 3TK9A 2AMQA 5F8XA 1HAVB 1SGPE 3TH3H 1O2GH 1HJ8A 1P57B 2KAIA 2ZHWH 3GYMA 1CE5A 4MTBA 1TNIA 2UUFB 3CS7A 5HGGA 4OS7A 2TGPZ 3AVZA 3HATH 2VH6A 5A2MH 3A8BA 1G2MA 3CENA 1K22H 1C5MD 3FZZA 1MCVA 3UPEA 2GT7A 2FMJA 2BOHB 8GCHG 1UCYH 4ZHMU 3KGPA 1QA7A 2FODA 2WPLS 1O2YA 1W8BH 3MU8A 2AEIH 1F92A 1H9HE 3A89A 4AFZA 1YLCA 1BTZA 1FY8E 1TNLA 4A1VA 1FY3A 5F8TA 1O5AB 3FFGA 2CF8H 4FUJA 1BRCE 4OS6A 4CHAB 1ID5H 1SR5C 3UTUH 3V0XA 4Z0KA 4D8NA 2FX4A 2HOBA 1C1PA 1INCA 1GBMA 1PQ7A 3KQEA 3R0FA 1O3GA 5H4IB 1DWBH 3P95A 4TWYA 1ZMNA 2NU0E 2FOAA 3SJIA 3UREA 3ZZ9A 3M7TA 3PROA 3KQDA 2Z94A 2QXJA 3ZZ8A 2PLXA 1SVPA 2TPIZ 4CRBA 3ZVEA 2PSXA 1GI5A 4FVDA 1JIRA 2V3HH 3FAOA 4DJZB 3UNSA 1T31A 2BZAA 1HJAC 3OSYA 3TPIZ 1O3PB 1TONA 4FUFA 4CRDA 3RXLA 1SLXB 3KIDU 4YLQH 1SC8U 1O3NA 2Y81A 1OYQA 1V2PT 1PFXC 2BDCA 2Y6TA 1VITH 2BD8A 2J34A 1GJ8B 2ZKSA 3FP7E 1VGCB 1BQYA 4ABIA 4ABFA 2PHBA 5PTPA 4D7FA 5TJXA 4JK5A 1G2LA 1YPEH 2FOMB 1DE7H 4ZKOU 1HBTH 1QTFA 3RP2A 1MTNB 1GBIA 1TNGA 1PQ5A 4X1SU 1PQAA 1TBZH 3OX7U 2ESTE 2STBE 4ISLA 4ZXYH 1UHBB 1LVBA 1TGBA 1EAWA 5GIBA 3LH3A 2P59A 2P3TB 1GMHG 5T3HA 1C2MA 3LGTA 1LKAA 3F9HA 2HPPH 3SNBA 3KCGH 1GVZA 4LOYH 1E34B 5EW1H 4I8LA 1UTLM 3ATKA 1O2ZA 2P3UB 2OXSA 1C1NA 1RTLA 1ZHMA 2Z9JA 3V13A 3P17H 3SJ8A 5T6DA 2TBSA 1S5SA 1QIXB 2WV4A 4R8TB 1A5HA 3AASA 1FLEE 1ARCA 1CBWC 1QB1A 3ZV8A 4I31A 2G00A 2RA3A 1DWEH 1EB2A 1DXWA 3JZ1B 4YT7H 1ZRKA 1QBVH 2GCHF 3RXKA 1TPSA 1UTKA 1SGTA 3M37A 1NM6A 4K1EA 3ZVDA 1RXPA 1HIAB 2YOLA 1WOFA 7LPRA 5L30H 2CMYA 3F6UH 2W26A 4TY7A 3CP7A 1S84A 2BD9A 1E0FD 4TPYA
chains in the Genus database with same CATH superfamily
1AKSA 3O8RA 4X2YA 2VVVA 2A32A 3M36A 1SGFG 5EJ1A 3ATWA 1W11U 1C2IA 1S0RA 1O5GH 3LGUA 1ZR0A 4NSYA 3B23B 4YTAA 1ELEE 1EZXC 4UD9H 2P94A 2B0FA 3CS0A 2V3MA 2HWLB 3ZZ5A 1Q2WA 1EB1H 2GT8A 4WH8A 3SW2B 2RDLA 1PYTD 1GBKA 1QBNA 2PTNA 4AYYB 1SHYA 1YPMH 4X6MA 2PKSC 3FANA 1D6WA 4B2BA 3H5CB 2V7QD 1GJDB 4JCNA 3UNRA 1SI5H 2EEKA 5JPMH 2UWPA 2C90B 2BVRH 4NZQA 4BAOB 1HFDA 2OQUA 1XKBC 3MU0A 4ZHLU 2ODYB 2QXIA 4RN6A 1Y5UT 5CHAC 1DSUA 1V6DA 3GY6A 4IC6A 1YGCH 1IQEA 1BT7A 1TRNA 2BHGA 4Y0YE 4ABBA 4I8HA 4KTCA 3LGYA 2XCNA 2ZU4A 2I6SA 2BQWB 2VNTA 3O8BA 1LCYA 4MNWA 5FCRA 3IITA 1MBMA 2OBOA 2GJGA 3SU2A 4A7IB 1V2QT 1LHEH 8ESTE 2ZI2H 2ZGBH 4E06H 2ODPA 2VIWA 2F43B 2KAIB 2VINA 2Z3DA 1YPJH 1JIMA 1E1RD 2A4GA 3RXBA 4B74A 1Y3XA 3BIVH 1UTPA 1PPGE 1MKXK 1BJVA 3M3VA 4K5ZA 3TU7H 3ATLA 4UFEH 2FX6A 1P0SH 1DOJA 1RJXB 1J9CH 2Z3CA 2ZQ1A 2ZGXH 4RSPA 2VIOA 1SGFA 1UTJA 3ZVGA 4U30A 1IQNA 2O8UA 1C5QA 1GI6A 4MNYA 1ETSH 1ELGA 3GY8A 3TGKE 2C8ZB 5I25A 1V2JT 1V2TT 1MU6B 4FU8A 5C3NA 5TCCA 3RXTA 1Q3XA 4ISIH 1YP9A 2ZFSA 4NFEA 5F03A 3LT3A 4B73A 1WV7H 1ZTKA 2NU1E 3P8OA 4MVNA 4CHAC 3QK1A 2AH4X 1CA0B 3AAVA 1SGQE 3GDSA 1OP0A 1H8IH 4DVAU 2Q1JA 2BD3A 4XSKU 1G9IE 2LNCA 2QF3A 3NRLA 3P92A 1BMAA 1RGQA 1CT2E 1AI8H 4ISHH 1WTHD 1UVPA 3VB4A 1LPGB 2JIZD 3RXRA 2ZDNA 3PLBA 5A8ZA 2GV7A 4INLA 2D1JA 2STAE 1O30A 3GICB 2BD5A 4FVBA 3GCHB 1P2MA 5A8YA 2YNBA 3F2HA 3GOVB 1V2RT 4WWYA 3FN8A 4DT4A 1AMHA 2QXHA 4Q7YA 3F1SB 2Z3EA 2GKVE 4CREA 1KLJH 4CR9A 2ZFQH 4CRCA 5EXNA 2VB0A 3UFAA 1K1IA 3GS9A 1HAVA 1ETTH 2KM0A 4OGYA 1MCTA 4FUEA 3A86A 3SO3A 5E0HA 2J5UA 3MO3A 3JZ2B 4ZKRU 4HZHA 4GVUA 1V2MT 2JH5D 2BY9X 3SZNA 1TAWA 2CGAA 4YM9A 4GHQA 2BQ7B 3MOCA 1L4DA 3DSPA 1G3CA 2OTVA 4NWLA 3P6ZB 1MTNC 1O2IA 1O2VA 3SV9A 1J14A 1C5XB 1CHOF 2B9LA 4BAQB 1GBHA 1P8VC 1TX8A 3FKSD 3T5FH 5EXMA 3SI4H 5ESBA 3TNSA 2GMTB 2VJ1A 2ZFRH 2BDBA 3NKKA 2V0BA 5C1XA 1H8ED 2Y5HA 2JDID 1AB9B 1O2UA 4IMZA 1S0QA 2A2XH 1MZAA 1TBRH 2OLGA 5DG6A 1YCPK 4IN2A 4IC5A 1GBBA 1E35B 2BD4A 1IQGA 3NXPA 3VEQB 3FP8E 4D76A 1O38A 2FIRH 3SV7A 4F49A 1PPFE 1BHXB 3VB6A 1GMDF 1XUKA 3RM2H 1BMLA 1NRPH 4ASUD 1S85A 2O8LA 3LJOA 4K2YA 1P9UA 1YF4A 3ZVCA 1HJAB 5LGOA 1P01A 1DXPA 3LU9B 1BBRH 3ZZ7A 1V2WT 3D49H 3FVFB 1MUEB 2ZFPH 1H8HD 4MNVA 1BTHH 3VPKA 4OS2A 4Q4LA 1UVSH 2KCYA 1EJMA 1HYLA 1ZLRA 4H4FA 3TK6A 1MH0A 1ESTA 1GI1A 1QBOA 5HIYA 3LGWA 2BM2A 3LJJA 3P8GA 2LPRA 4RI0A 3A84A 1QURH 1C5SA 2BLVA 3GISB 1P3CA 2R0KA 3ENSB 3W1EA 4OS5A 3SUFA 1GHVH 1MAXA 3UIRA 2WV5A 4FETA 3ZZDA 1FMGA 1KY9A 4Y10E 1IHSH 2L74A 3UQVA 3MNCA 3EE7A 4DIIH 1ANCA 1SBWA 5DPAA 1A3EH 1G3BA 1S83A 1HRTH 1P2NA 1UHBA 1LQDB 3WY8A 2DUCA 1SLUB 2A2QH 4ASHA 2XW9A 2F9PA 1FJSA 1MBQA 3PRBA 5L6NH 1AO5A 3SBKA 1NROH 3ZVAA 3RC6A 1VITG 4FOUC 4UFFH 2CJIA 4RKOB 1ZYOA 5GCHF 5SGAE 4B76A 2PSYA 5HMAA 4ABGA 3MWIU 4NIWA 2BXUH 1C9TA 2HLCA 2QN5T 2ZU3A 1ABIH 1TOMH 5DSFA 1WAYB 4X8UH 3PV5A 2J38A 1FAXA 4NWKA 1F0RA 3LC3A 2A4RA 3M5MA 4X6NA 2ZGJA 1EAXA 1V2VT 2XOKD 2D2DA 1HAOH 3QTVH 4FUHA 3OU0A 4YESB 2VBCA 1BTPA 4XRNA 4DIHH 2WPKS 1COWD 1E36B 3RUOA 2XWBI 2OC8A 1HIAA 3UQOA 1GHAF 3LKWA 4AX9H 4YXWD 1C1RA 2EI8A 3UOPA 2ZDAH 1QL8A 2WPDD 3GY5A 1NU7B 5GNDA 2GX4A 1QQ4A 2GDDA 3MU4A 4IMQA 4MLFB 1LO6A 1SGEE 3PMHB 4CH8B 1HAPH 5JB8S 1GI9B 1H4WA 1NC6A 3RXSA 2WPIS 1TNKA 4E7RG 1GCTC 1Y3VA 3PYHA 1C5RA 4A6LA 1JRSA 1YY3A 1ZJDA 3H7OA 4DCDA 3TLOA 1TPPA 4X0WU 3RC4A 1N6YA 4O3TA 5GDSH 2G52A 3PM3A 5C5NA 1CSOE 1GWAA 1XXFA 3STIA 1K1LA 2FI5E 3BTWE 4XBCA 1HAHH 3SU1A 4X6OA 4AGJA 4FUIA 4HI3A 2F9NA 2W3KA 4ACAA 1P2QA 3FZDA 3OFND 4FUCA 4BOHA 1CA0C 4CBNA 4INKA 3A7WA 1AVGH 1P03A 1W13U 1UO6A 1IQKA 1O3AA 3MYWA 1IOEA 1TALA 2J95A 1MMJN 3ZV9A 4YT6H 4B75A 3QN7A 1A61H 2WPHS 1F0TA 1TGCA 3ZVFA 2XBXA 3GCHC 1GBJA 1A5IA 3RC5A 1UCYK 1FI8A 4MPUA 1GJCB 2R2MB 4KTUA 2GV6A 3ODDA 3MNSA 1QNJA 4Y7AA 2F3CE 1MKWH 3E0NB 4FUDA 2BY7X 4ZH8A 3SNCA 1ELBA 2Z9KA 2R3YA 1UTNA 1GI8B 1TRMA 2WV9A 2TGAA 1D3DB 3L6PA 3DUXH 4TSFD 1WCZA 2B8OH 1CHOG 3MH4A 3Q3KA 2BDYA 4ESTE 3A8DA 3DFJA 2YMSB 1Q31A 4Q7ZA 4ABEA 2G4TA 1RIWB 1SGNE 3OAAD 2OBQA 1SFQB 2ZPSA 3GY3A 2QF4A 1C2EA 3PLKA 2HGTH 1DT2A 5HM9A 4E05H 1KXCA 5JBAS 3V3MA 4X8VH 3BV9B 2ZHDA 3PMJA 1TGTA 3SQHE 1OOKB 4UEHH 1YPHC 2GMTC 3RXOA 5DP3A 3UAIC 4AG1A 3EA9A 1JMOH 3F9FA 2O8WA 3VB7A 4B1TA 3DSOA 2RA0A 1AB9C 1C1TA 3UY9A 1KLIH 1GBLA 4NA9H 1O2QA 1YPKH 1FV9A 1C5VA 2FP7B 3A8AA 4AFUA 3O8CA 4I86A 2ZPQA 3LONA 3HGPA 2J9NA 1SLWB 1QA0A 1LPKB 1OWIA 3E1XB 3STJA 4X2WA 1TX7A 5FCKA 1LVMA 3T2NA 2J2UA 5C1UA 1ARBA 6CHAC 3ZVBA 1YWUA 1RRKA 1G36A 3M61U 1AWFH 3KQBA 2JH0D 3K65B 4NFFA 1ZHPA 2G51A 2WYGA 7ESTE 1LDTT 4OS1A 2ZA5A 4WMDA 5C20A 1D9IA 1WBGB 2BY5X 2C8XB 1XUJA 1FONA 2A45B 1BA8B 1Z1IA 1QJ7B 1QRZA 1QJ1B 1S81A 2BVXH 1AU8A 1K1JA 1H8DH 2VWNA 2BTCE 2J94A 1E79D 3RXQA 1OWHA 4AYVB 2G55A 4BNRA 2A7JA 1ZGIA 3N7DA 3DT0H 3ESTA 1WYKA 3PRDA 1JWTA 1NFWA 2BD7A 5IK2D 3F9EA 1L1NA 1O33A 3TH2H 1Z8IB 3MHWU 3UWJH 2GZ9A 1IQFA 3RU4E 3W94A 1FPCH 2QF0A 3URDA 4WH6A 3Q00A 3F0OA 2IPHA 3Q3XA 4NA8A 2ZU5A 4NZLA 1GHYH 1O3EA 2O8TA 2SFAA 1A3BH 2FI3E 3SJKA 4D7GA 1FY4A 4P02A 4ACBA 1KXBA 5FX6A 4JYVH 2BDHA 2NU3E 1GHAG 2XXLA 4Y0ZE 3ZZAA 1P11E 2EQNA 1SQTA 3RXFA 1O3FA 1SQRA 1WXRA 1EFRD 2A5AA 2ALPA 1GJ4H 1SFIA 2HNTE 4Y8XA 3A7ZA 5T1VA 1O2KA 2HVXA 5EJZA 5EPNA 1YBWA 2H2ZA 4AB8A 3T28A 3DD2H 1Y8TA 1O2HA 4NIYA 2ZDKA 1T8OA 4BAMB 4A5TS 5BRRE 1ETRH 1RS0A 1OS8A 5GPIB 2BOKA 1QY6A 1T4UH 2FM2A 1F7ZA 1VCPA 4WF8A 3RM0H 1NT1A 4K1SA 1ACBE 2FOHA 1AGJA 2ANWA 1C1SA 4JYTA 3LIWA 2A1DB 5A09A 5EIYA 5LPFA 3S7KB 1K1NA 1WU1A 4GSOA 1O2XA 1VR1H 4MQAA 5T6GA 1CGHA 1XUFA 5AFYH 2Z9GA 2QIQA 1YCPM 1HAXB 8LPRA 2V3OH 4DGJA 3E16B 3SU5A 1OX1A 3BTFE 1C2FA 4DOQA 1C5ZB 1KDQB 4B6EA 1LHGH 1O31A 2ZF0H 1AFEH 3SU6A 2BY8X 1BTUA 1AHTH 1CHGA 4F55A 4WY3A 1O3BA 3N7EA 1THRH 1GBAA 1O2JA 4ZMAH 1W2KH 2FOFA 3UNQA 2C93B 3UR9A 3E6PH 2ZWLH 5EJLA 2H5DA 1C2JA 1UK4A 1C1MA 1EQ9A 1P2OA 1TMUH 1ZSKA 3BF6H 3B8JA 4ISOA 1J15A 2C3SA 1VKYA 3SZEA 1K1PA 2RCEA 2WHXA 3GCTF 1AFQC 3LGVA 1TBQH 4Y7BA 3KHVA 3MTYA 2W3IA 1GCTB 1T32A 2GVFA 1D3PB 1ZSJA 3PWBA 1ELDE 2JJ2D 2FYQA 2P8OB 1EUFA 4JK6A 1ANDA 6GCHF 1KTSB 5DKMA 1H9LB 2OP9A 2PGBB 1CGIE 1O2NA 1A7SA 5FPSA 2ZEBA 2HNTF 2NWNA 1OYTH 1F5KU 1GPZA 3MMGA 1HCGA 1WDIA 3MQKC 1P10A 1G3DA 2YMSC 5EG4A 1NBMD 4A1TA 1RIWC 2FOBA 1O35A 2ALVA 2PGQB 3M7QA 3BN9A 4YZUA 2XC4A 4UDWH 1LHCH 3SU3A 4NA7A 1FNIA 2BB4A 1IQJA 1PPHE 1W0KD 2WZQA 1GJ9B 3PLPA 4YOGA 1E38B 1LTOA 3KN2A 1ZGVA 3IWMA 4GCHF 1DITH 3NK8A 1O3DA 1DM4B 4FU9A 1O3OA 1IQMA 4TT3D 4QT8C 1FAKH 1BIOA 5E8EH 1HLTH 4TWWA 4CBOA 2KCOA 2WINI 3M35A 2ZO3H 2ZNKH 2SGAA 1C5UA 3VB3A 1THSH 4Z1MD 1L0ZA 3ZZ4A 3D65E 5CHBA 4X6PA 1V3XA 3DHKH 1BMFD 2PTCE 1SGRE 3SUDA 3UOUA 3TGJE 4JZDH 2W7UA 4U2WA 4ZCNA 4FUBA 1GDQA 1PPCE 2WSSD 2A31A 3RXDA 1ZOMA 2ANYA 1GHBF 2C4FH 3BTTE 1YM0A 2VH0A 2EC9H 2V6NA 5C17A 6ESTA 1WQSA 3RLYH 3ZYEA 2ZECA 2FXRA 1O39A 4Q2KA 1EXFA 2W6ID 1KXAA 3KQCA 1HAZB 3SU4A 5C67A 1C1QA 4KTSA 2VIQA 3ATIA 2ZU1A 4JZ1A 2PFEA 1A0LA 4YOJA 1FIZA 4CR5A 4Y8ZA 3L3TA 2R2WU 1Z8JB 1PPZA 1Z6JH 1TX6A 1YPLH 5EQSA 1O2MA 3PV2A 3OY5U 4J2YB 2CK3D 3U8RH 5A0BA 5C0TA 2FLRH 3SJ9A 1FX0B 3MNBA 2GD4B 3M5NA 1WSSH 1GBEA 1CT4E 2VWOA 3BIUH 1BBRK 3QUMP 2GZ8A 1A1RA 2UWOA 1AUJA 1NFUA 1O36A 3IG6B 8GCHF 1PYTC 3PTNA 4PROA 1W0YH 5C0UA 1SQOA 1C2GA 1TPAE 3BTDE 1J8AA 3M5LA 2A5KA 1QJ6B 2GCHG 2Q6DA 1GMCF 2PW8H 5CMXH 3LC5A 3W95A 1MD7A 3N7OA 3GCNA 4MG3A 4UFGH 1TNJA 6CHAB 3F68H 4B2AA 2ANMH 1UK2A 1N1LA 1RD3B 2ULLA 1EP5A 1KXFA 2FESH 1O0DH 1FQ3A 1GJ6A 2H1UA 1K1OA 2F91A 3VGCB 4AOQA 5F53A 2BDGA 4BANB 2PP6A 2UUYA 3NUMA 4NCYA 3RXHA 4WJG2 4KGAA 3PO1B 4KP0A 2G5NA 1TABE 5EPYA 2AFQB 2BDIA 2FOGA 2FOCA 2QY0B 4O9VA 2QC2A 1ANBA 1QQUA 2Y7XA 2HPQH 2M5TA 1EPTC 2PKAB 1P3EA 1YCPH 4X2VA 3SYJA 1BDAA 1MQ6A 2VWLA 3UR6A 1UVOA 2VIDA 1G3EA 3T29A 1ZMLA 2XWAA 3QGNB 2L6OA 1HDTH 5L2ZH 3HGNA 3AW1A 1Y3YA 3RXJA 3ZZ6A 2QYIA 1X7AC 1NRRH 1WUNH 3EAJA 1YPGH 3NZIA 7GCHF 4WXIA 3H7TA 1GI0A 3SOSA 2UWLA 1ZPCA 3ZZCA 3TGIE 2NU2E 3GY4A 4Y6DA 1ORFA 4AC9A 2FI4E 1NRQH 3RXGA 3U1IB 4OM9A 1YKTA 2BYAX 3MO9A 1C1WH 4BTUB 3FP6E 3LDXH 5HM2A 1BMNH 1DY8A 1ESBA 2KZ4A 2A0QB 3KYGA 1OHHD 3RDZA 1P02A 2VVUA 1AD8H 2ZHQH 3TJVA 2VGCC 1NPMA 2Z9LA 2CF9H 5DP9A 3URCA 5E2OA 2F4LA 2BLQA 1TGSZ 2Z9IA 1V2OT 3F2FA 1T4VH 4DG4A 2ZZUH 1D3QB 5GWZA 3GY7A 2FOEA 1UVTH 1N8OB 1AZZA 3GCTG 1HB0B 2JETB 4K69A 1FY5A 4Y11E 3C1KA 2Y80A 1GGDC 4MPXA 5HKKD 2KCAA 2YNAA 1DDJA 3ELAH 3T26A 1AE8H 1ZPBA 1UTQA 1BZXE 4VGCB 3SUEA 5KECA 3A83A 1W10U 2AERH 2BZ6H 2OCVB 1P2JA 2ODQA 2QA9E 6GCHG 2IN2A 1DX5M 1DSTA 4RKJB 4Q7XA 1O34A 5DN6D 1C4Y2 2J92A 5KGOA 3U9AH 1W14U 1EPTA 2P8OC 2A7CA 5GJ4B 1OWJA 4SGBE 2F9UA 5F6MA 2TGDA 5FAHA 1OWEA 5J4SA 1HAGE 3O8DA 1Y5BT 3A87A 1SOTA 1QRXA 3OEHD 1VCQA 2ZCLP 3T25A 4I7YH 4H6TA 2P3FH 2P93A 4M7GA 3MNXA 1ZRBA 3M3SA 2GP9B 5A0CA 2RDEA 2XRCA 1FPHH 4ZKNU 4BXSA 4DW2U 1ZTJA 2CV3A 4M9FA 3ZZBA 1A5GH 2VWMA 2K0QA 2KX4A 2XC0A 1O2LA 2VU8E 2GZ7A 1EAIA 1BCUH 1G30B 5DP5A 1SGYE 5E2PA 1ELFA 2FS8A 5HYOA 5GXPA 1NRSH 2H9HA 5EOKA 2A5IA 2EI7A 2H9EH 2QXGA 2GTBA 4YLUA 2ZGCA 1QB9A 3VB5A 3PMAB 3MU5A 3SGBE 4J1YA 1TGNA 3PTBA 1BB0B 1QGFA 2PV9B 1V2LT 1SG8B 1Y3UA 1THPB 2P95A 1Y59T 1OKXA 4XD7D 2SGQE 2UUJB 3VXFH 1OWKA 4TYDA 2FO9A 2A4QA 4BAKB 1VZQH 1BRBE 1KDQA 1O2SA 3ATMA 1A2CH 3QO6A 1EZUC 5C5OA 5FPYA 3TIUA 3DSGA 2KFWA 1TQ0B 3U69H 1KSNA 1KMHB 1BMMH 1GI4A 5K0HA 1GHBG 1CA8B 2PR3A 3U98H 2AHME 4X1QU 1W12U 4Y79A 1RTFB 2OK5A 7KMEH 2CHAB 1F0UA 1P06A 1PQ8A 2BLWA 2FPZA 3WWBA 3AW0A 1G32B 3ZYDA 1AFQB 1C5NH 1P12E 1ELVA 3TVJB 1BUIA 1HAIH 5CDFE 1QL7A 3P70B 2F9BH 2FS9A 4ZKSU 3E90B 3QX5H 1SGIB 2QCYA 2BX3A 4BAHB 2R0LA 1V2UT 3DFLA 4DY7B 1DICA 1BRAA 3ZIAD 2H9TH 1GVLA 3RMMH 5HIZA 3T27A 1J17T 4P00A 1TMBH 5FXLA 1O2TA 1Z7KA 1GCDA 2GGVB 3SJOA 2AGIX 6LPRA 2AYWA 1XM1A 1MU8B 1BTXA 1XUIA 2AIQA 2EA3A 3A82A 3EE0B 1UVUH 2ANKH 3MH5A 1AVXA 1K28D 1MTWA 1VJAU 3RXEA 1O32A 3PWCA 4K60A 2C8YB 2JH6D 1A0HB 3F9GA 2Y82A 2ZDMA 2G4UA 2HALA 1NRNH 3K6ZA 1OSSA 3K2UA 4XBDA 1IQIA 4AZ2B 3TJNA 1LVOA 1GMCG 1GMDG 2Q6GA 2BQ6B 1TA6A 1N6XA 1SKYE 2M2AA 1H1BA 2FYRA 4JZEH 3GYLB 3QGJA 3AAUA 1LPZB 3OTJE 1UJ1A 1XXDA 5DP4A 4AGKA 1UCYE 3QDZB 5AF9H 2ZGHA 3MU1A 1EKBB 2ZP0H 1C4V2 1GJBB 3SV6A 1OPHB 4CRGA 1AIXH 2LELA 1C1OA 3NWUA 4RT0A 3RXMA 4BXWA 3KNXA 2OC1A 4NIVA 2GCTB 1KYNA 5C94A 1HJ9A 1CU1A 1SQAA 3VGCC 1DY9A 3VFEA 1S6LA 4CH2B 2CN0H 5I46H 5JBTA 1J16A 3A7VA 4AN7A 1KXEA 2Z7FE 5JDUB 1PPBH 4AB9A 1EAUA 2SGDE 3PO1C 4GLYA 1KTTB 1DLEA 4IBLH 1EZSC 3HKIB 3L33A 2XNDD 3MH7A 4B6FA 5DP7A 4SGAE 3EA7A 2ZFTA 1TQ7B 3SORA 1SMFE 2EI6A 3VG8A 1MTUA 2R9PA 3BG4B 5AHGH 1XX9A 3A8CA 2WUBA 3RMOH 3S69A 5AVDA 3Q77A 3BEFB 2ZDVH 4ZAEA 3EDXB 3U1JB 4A92A 2BXTH 1DFPA 5GCHG 5T6FA 4B71A 7GCHG 2ZCHP 3V7TA 3FO8D 4GUXA 4DURA 1Z1JA 2FLBH 1ZPZA 4MDSA 3U8TH 1C5TA 1F5RA 2O8MA 2ZTXA 2B5TB 1NFYA 2OC7A 3RXCA 2GDEH 1TMTH 1CQQA 3DCLA 2H6MA 4LXBH 2BVSH 3N99A 2PUQH 4JYUH 3LH1A 4XDEA 2C8WB 4INHA 1W7GH 3MI4A 4I8GA 1IHTH 1BOQA 2KR7A 1TPOA 2ZG0H 1GI2A 1CO7E 1GHXH 1Z71A 3SHAH 1V2ST 4LZ4B 2F9OA 3BTEE 4TY6A 3ODFA 1O3CA 2HRVA 4AFSA 4K8YA 1DLKB 3WWFA 2D8WA 1L1GA 5LPRA 1T8NA 1GDNA 3PV4A 4X8SH 3T62A 4TPIZ 2BX4A 3KF2A 3A7XA 4E7NA 1EJAA 1N8OC 2JETC 2G8TA 1TOCB 3HK3B 4O97A 1L2EA 3UWIA 4VGCC 3GDUA 3GY2A 4XFQA 1YC0A 3SV2H 5LPEA 1BTWA 2SNVA 1C5LH 2TIOA 2ZTZA 1NZQH 2FWWA 3LGIA 1HXFH 1EPTB 3RU4T 5C1YA 3OTPA 1O2OA 4H6SB 2SGFE 1TA2A 2PKAA 3DA9B 4FU7A 1CGJE 4AORA 3A7TA 3I78A 5FBIA 1TE0A 1JBUH 3BTME 1YLNA 4CRFA 1DVAH 3BTQE 1C1UH 2OUAA 4X1RU 3TK5A 1EOLA 1SSXA 1FIWA 1GBDA 1KXDA 4K3JA 4DT7B 5E0JA 1DPOA 4XBBA 3S0NA 1MQ5A 5DP8A 1ZHRA 2KCPA 4XE4A 4I8KA 1B0FA 1P09A 2SGPE 1ZMJA 2ZHFH 1C1VH 3RMLH 2TGTA 1NY22 3G01A 1UK3A 4WVPE 1GI3A 3E91A 3E3TA 1ZTLA 1GI7B 1GJ7B 1Z8RA 1ZSLA 1GG6C 2OC0A 5EQRA 1YLDA 3M7UA 3PB1E 1DS2E 2VGCB 3MFJA 1BRUP 3D23A 1VITF 2UUKB 2I6QA 3D62A 1TWXB 2V35A 4I33A 1A4WH 1D6RA 4NSVA 3R3GB 3M5OA 4WMFA 2J98B 1SGCA 1HNEE 1TRYA 1A46H 3PMBB 5FBEA 2ZFFH 5FPTA 5B6LA 1GGDB 2R3UA 1DUEA 3EA8A 2CHAC 1F5LA 2K1QA 2XNIA 4WXVA 4K8BA 2QAAA 3BG8A 4HTCH 1V2NT 3Q76A 1ELCA 1MD8A 2ZQ2A 3OYPA 2O9QA 3E0PB 5G4BA 2WPJS 3HPTB 1XVMA 1NESE 2BDAA 1GBTA 2XBYA 4XOJA 1GDUA 4X2XA 1NFXA 2Q6FA 3LPRA 2B7DH 1SHHB 3HK6B 5FL7D 1FZZA 9LPRA 1MTSA 4WMEA 1WQVH 2Z6BD 3BSQA 5AFZH 1AZ8A 1GJAB 4IN1A 1ABJH 2DE8A 4GHTA 3U8OH 3RXVA 4ABJA 1GHZA 1RFNA 1P04A 1O3MA 3NPSA 1P05A 3LOXA 5KEDA 1EX3A 1LMWB 1O37A 2Y5FA 2OQ5A 1ELTA 5JBBS 1OXGA 3AK5A 2SGEE 3GCOA 1F2SE 1YPHE 1DUAA 1C5PA 2F83A 1ZJKA 1HAYB 1MTVA 2AGEX 3TJOA 1ZZZA 4IS5A 4X1PU 1L1JA 3RU4D 1FUJA 1C9PA 1B7XB 1L4ZA 1P9SA 3SV8A 1MKXH 1FN6A 5B6OA 4U01A 2G5VA 2IOTA 1UTOA 3E8LA 2CXVA 3QZQA 2LP6A 4MNXA 4R0IA 2PUXB 3F2GA 1SGDE 1T8LA 4X8TH 3H09A 1P2IA 1A0JA 2OD3B 4OS4A 1MAYA 1C2DA 1NO9H 3SGQE 2QF5A 1U6QA 4B2CA 5ESTE 3GDVA 1SB1H 2WUCA 1QB6A 2GCTC 5EQQA 1O5DH 2FTLE 3SI3H 4ABHA 5IYTA 2F9VA 2AS9A 3C27B 1TB6H 1RTKA 3I77A 3M3TA 4GAWA 1GL1A 1LQEA 1QHRB 1K2I1 2IJOB 4O3UA 1O3HA 3BG4C 3S9AA 4NGAH 2A7HA 1QZ8A 2ZU2A 4A1XA 1HXEH 4U32A 1O5EH 1ESAA 1OP8A 3MO6A 1LHFH 3A81A 4HFPB 4UONA 1HGTH 1VGCC 3RMNH 3NCLA 1O5BB 1EASA 1Z8GA 5JYIA 1O2RA 1VCWA 5DP6A 1K1MA 3BEUA 3SHCH 1C2HA 4LK4A 3RXAA 1G37A 3A7YA 1Y5AT 5ETXA 3MH6A 1NS3A 1JRTA 5FHTA 4ABDA 2VIPA 2ZCKP 4FXGH 2ASUB 4I8JA 5EU8A 2BY6X 1JXPA 1TYNA 3P8NA 3V12A 1C2LA 2W5EA 2WPMS 1M9UA 1GJ5H 3ZZ3A 8KME2 1AQ7A 1V2KT 2XC5A 3SNAA 1QFKH 9ESTA 1YYY1 1UMAH 4IW4E 5LH8A 5EGMA 4NG9H 1T8MA 2NU4E 1XMNB 5BPEA 3A80A 4FUGA 1W0ZU 2ZPRA 3S9BA 3BEIB 2W6JD 1SOZA 1GVKB 2XYAA 4KELA 4O03A 5DO4H 1BHXF 3S7HB 3P8FA 1ANEA 2FDAA 3RLWH 4X1NU 1OWDA 4Q63A 4OGXA 1E37B 1NN6A 4AFQA 1SL3A 2JKHA 3S9CA 1O2WA 1FY1A 4YO9A 1CT0E 3OE7D 1FN8A 3HKJB 1LKBA 2XTTB 1P2KA 1EOJA 2SNWA 1BITA 1AKSB 4BTIB 3B9FH 1W0JD 1O2PA 5K7RA 5JB9S 4HGCA 3VXEH 2BMGB 1AWHB 5L2YH 1GBCA 4MPWA 2H5CA 2J4IA 1NTPA 1BBRE 1F0SA 2TRMA 1D4PB 1MZDA 2PWXA 3KEEA 4Y8YA 3EYDA 1FDPA 4THNH 3SUGA 1DWDH 1HPGA 1Z6EA 1S6FA 2IJD1 3EQ0H 2D26C 1IAUA 1O3IA 1QRWA 1CVWH 2Y5GA 1AVWA 3SNEA 3I29A 1LHDH 1LVYA 3Q3YA 5FX5A 5DJ7A 3SN8A 1EP6A 5TCAA 4K1TA 1TIOA 2DE9A 3KL6A 5CE1A 1BTYA 1C2KA 3RXIA 3WW7A 1O5FH 3TNTA 2G81E 1GMHF 4LZ1H 4IGDA 2Y7ZA 2ZHEH 5A8XA 1XKAC 5DGJA 2XBWA 4JZFH 1K0HA 1FXYA 2VVCA 1AN1E 1CBWB 4MPVA 4Q80A 4BTTB 1S82A 4Y71A 5EW2H 1O3LA 3RXPA 2RFKC 1QCPA 3RXUA 1IQLA 2ILNA 4I32A 4H42U 2WYJA 1XUHA 3SNDA 2ZTYA 4Y76A 1XVOA 3UUZA 3KQ5A 5J4QA 4ABAA 1H9IE 1NU9A 2VIVA 5E0GA 1GBFA 4JMYA 2AMDA 1O3JA 4UE7H 3QZRA 2HNTC 1GHWH 1TNHA 4GPGA 1IQHA 3F3BA 5C2ZA 1VJ9U 5A0AE 1AUTC 1GL0E 1S6HA 4GCHG 4ISNA 3BTGE 2ZC9H 5EODA 1T7CA 3SQEE 4ZHAA 4ZXXH 2AMPA 5EXLA 2RG3A 1SLVB 1PPEE 3K9XB 1EATA 1B0EA 1HV7A 3F0PA 2BLOA 1O3KA 3BTKE 3K6YA 3TJUA 2QGRA 2THFB 3TH4H 5HXFA 5IDKA 1XUGA 2W7SA 1MKWK 4D9RA 2PKSB 5ABWA 1B5GH 3A85A 1KIGH 1EZQA 3A88A 2J97A 1DWCH 1GG6B 1W7XH 3EGKH 4HG6A 2FTMA 3BTHE 3CNRA 1C4U2 4F4OC 1OP2A 1EJNA 1MABB 4F48B 1ELAA 1D3TB 3QLPH 2AIPA 1QL9A 2P16A 3OY6U 3SU0A 1AE5A 5CHAB 4D9QA 2ZIQH 5DK1A 1SPJA 1C5OH 1QR3E 2OINA 1O5CB 2BD2A 2J98A 4AG2A 1C5YB 1UTMA 4YOIA 2FZZA 1WTGH 4RT1A 3QTOH 2XCFA 1W3CA 4UFDH 1HUTH 4KKDA 1DANH 1PJPA 1Y3WA 3ITIA 2FEQH 1K21H 4JZIA 1C5WB 2ZDLA 1KLTA 1TFXA 1AY6H 1BJUA 1TLDA 3SGAE 4CRAA 2A4OA 4ZUHA 5F8ZA 4NIXA 2QV1A 1JOUB 2XBVA 2AGGX 1K9OE 5JBCS 1UW7A 3TITA 4ZROA 4Z6AH 3QWCH 3TK9A 2AMQA 5F8XA 1HAVB 1SGPE 3TH3H 1O2GH 1HJ8A 1P57B 2KAIA 2ZHWH 3GYMA 1E1QD 1CE5A 4MTBA 2K8IA 1TNIA 2UUFB 3CS7A 5HGGA 4OS7A 2TGPZ 3AVZA 3HATH 2VH6A 5A2MH 3A8BA 1G2MA 3CENA 1K22H 1C5MD 3FZZA 1MCVA 3UPEA 2HLDD 2GT7A 2FMJA 2BOHB 8GCHG 1UCYH 4ZHMU 3KGPA 1QA7A 2QE7D 2FODA 2WPLS 1O2YA 1W8BH 3MU8A 2AEIH 1F92A 1H9HE 3A89A 4AFZA 1YLCA 1BTZA 1FY8E 1TNLA 4A1VA 1FY3A 3U28C 5F8TA 1O5AB 2HVYB 3FFGA 2CF8H 4FUJA 1BRCE 4OS6A 4CHAB 1ID5H 1SR5C 3UTUH 3V0XA 4Z0KA 4D8NA 2FX4A 2HOBA 1C1PA 1INCA 1GBMA 1PQ7A 3KQEA 3OEED 3R0FA 1O3GA 5H4IB 1DWBH 2IPQX 3P95A 4TWYA 1ZMNA 2NU0E 2FOAA 3SJIA 3UREA 3ZZ9A 3M7TA 3PROA 3KQDA 2Z94A 2QXJA 3ZZ8A 2PLXA 1SVPA 2TPIZ 4CRBA 3ZVEA 2PSXA 1GI5A 4FVDA 1JIRA 2V3HH 3FAOA 4DJZB 3UNSA 1T31A 2BZAA 1HJAC 3OSYA 3TPIZ 1O3PB 1TONA 4FUFA 4CRDA 3RXLA 1SLXB 3KIDU 4YLQH 1SC8U 1O3NA 2Y81A 1OYQA 1V2PT 1PFXC 2BDCA 2Y6TA 1VITH 2BD8A 2J34A 1GJ8B 2JJ1D 2ZKSA 3FP7E 1VGCB 1BQYA 2YMSD 4ABIA 4ABFA 2PHBA 5PTPA 4D7FA 5TJXA 4JK5A 1G2LA 1YPEH 2FOMB 1DE7H 4ZKOU 1HBTH 1QTFA 3RP2A 1MTNB 1GBIA 1TNGA 3FOAA 1NBME 2EY4C 1PQ5A 4X1SU 1PQAA 1TBZH 3OX7U 2ESTE 2STBE 4ISLA 4ZXYH 1UHBB 1LVBA 1TGBA 1EAWA 5GIBA 3LH3A 2P59A 2P3TB 1GMHG 5T3HA 1C2MA 3LGTA 1LKAA 3F9HA 2HPPH 3SNBA 3KCGH 1GVZA 4LOYH 1E34B 5EW1H 4I8LA 1UTLM 3ATKA 1O2ZA 2P3UB 2OXSA 1C1NA 1RTLA 1ZHMA 2Z9JA 3V13A 3P17H 3SJ8A 5T6DA 3UB0A 2TBSA 1S5SA 1QIXB 2WV4A 4R8TB 3KYFA 1A5HA 3AASA 1FLEE 1ARCA 1CBWC 1QB1A 3ZV8A 4I31A 2G00A 2RA3A 1DWEH 1EB2A 1DXWA 3JZ1B 4YT7H 1ZRKA 1QBVH 2GCHF 3RXKA 1TPSA 1UTKA 1SGTA 3M37A 1NM6A 4K1EA 3ZVDA 1RXPA 1HIAB 2YOLA 1WOFA 7LPRA 5L30H 2CMYA 3F6UH 2W26A 4TY7A 3CP7A 1S84A 2BD9A 1E0FD 4TPYA
chains in the Genus database with same CATH topology
1AKSA 3O8RA 4X2YA 2VVVA 2A32A 3M36A 1SGFG 3ATWA 1W11U 1C2IA 1S0RA 1O5GH 3LGUA 1ZR0A 4NSYA 3B23B 4YTAA 1ELEE 1EZXC 4UD9H 2P94A 2B0FA 3CS0A 2HWLB 3ZZ5A 1Q2WA 1EB1H 2GT8A 4WH8A 3SW2B 2RDLA 1PYTD 1GBKA 1QBNA 2PTNA 4AYYB 1SHYA 1YPMH 4X6MA 2PKSC 3FANA 1D6WA 4B2BA 3H5CB 1GJDB 4JCNA 3UNRA 1SI5H 2EEKA 5JPMH 2UWPA 2C90B 2BVRH 4NZQA 4BAOB 1HFDA 2OQUA 1XKBC 3MU0A 4ZHLU 2ODYB 2QXIA 4RN6A 1Y5UT 5CHAC 1DSUA 1V6DA 3GY6A 4IC6A 1YGCH 1IQEA 1BT7A 1TRNA 2BHGA 4Y0YE 4ABBA 4I8HA 4KTCA 3LGYA 2XCNA 2ZU4A 2I6SA 2BQWB 2VNTA 3O8BA 1LCYA 4MNWA 5FCRA 3IITA 1MBMA 2OBOA 3SU2A 4A7IB 1V2QT 1LHEH 8ESTE 2ZI2H 2ZGBH 4E06H 2ODPA 2VIWA 2KAIB 2VINA 2Z3DA 1YPJH 1JIMA 2A4GA 3RXBA 4B74A 1Y3XA 3BIVH 1UTPA 1PPGE 1MKXK 1BJVA 3M3VA 4K5ZA 3TU7H 3ATLA 4UFEH 2FX6A 1P0SH 1DOJA 1RJXB 1J9CH 2Z3CA 2ZQ1A 2ZGXH 4RSPA 2VIOA 1SGFA 1UTJA 3ZVGA 4U30A 1IQNA 2O8UA 1C5QA 1GI6A 4MNYA 1ETSH 1ELGA 3GY8A 3TGKE 2C8ZB 5I25A 1V2JT 1V2TT 1MU6B 4FU8A 5C3NA 5TCCA 3RXTA 1Q3XA 4ISIH 1YP9A 2ZFSA 4NFEA 5F03A 3LT3A 4B73A 1WV7H 1ZTKA 2NU1E 3P8OA 4MVNA 4CHAC 3QK1A 2AH4X 1CA0B 3AAVA 1SGQE 3GDSA 1OP0A 1H8IH 4DVAU 2Q1JA 2BD3A 4XSKU 1G9IE 2LNCA 2QF3A 3P92A 1BMAA 1RGQA 1CT2E 1AI8H 4ISHH 1WTHD 1UVPA 3VB4A 1LPGB 3RXRA 2ZDNA 3PLBA 5A8ZA 2GV7A 4INLA 2D1JA 2STAE 1O30A 3GICB 2BD5A 4FVBA 3GCHB 1P2MA 5A8YA 2YNBA 3GOVB 1V2RT 4WWYA 1AMHA 2QXHA 4Q7YA 3F1SB 2Z3EA 2GKVE 4CREA 1KLJH 4CR9A 2ZFQH 4CRCA 5EXNA 2VB0A 3UFAA 1K1IA 1HAVA 1ETTH 4OGYA 1MCTA 4FUEA 3A86A 3SO3A 5E0HA 3MO3A 3JZ2B 4ZKRU 4HZHA 4GVUA 1V2MT 2JH5D 2BY9X 3SZNA 1TAWA 2CGAA 4YM9A 4GHQA 2BQ7B 3MOCA 1L4DA 1G3CA 2OTVA 4NWLA 3P6ZB 1MTNC 1O2IA 1O2VA 3SV9A 1J14A 1C5XB 1CHOF 2B9LA 4BAQB 1GBHA 1P8VC 1TX8A 3T5FH 5EXMA 3SI4H 5ESBA 3TNSA 2GMTB 2VJ1A 2ZFRH 2BDBA 3NKKA 2V0BA 5C1XA 2Y5HA 1AB9B 1O2UA 4IMZA 1S0QA 2A2XH 1MZAA 1TBRH 2OLGA 5DG6A 1YCPK 4IN2A 4IC5A 1GBBA 1E35B 2BD4A 1IQGA 3NXPA 3VEQB 3FP8E 4D76A 1O38A 2FIRH 3SV7A 4F49A 1PPFE 1BHXB 3VB6A 1GMDF 1XUKA 3RM2H 1BMLA 1NRPH 1S85A 2O8LA 3LJOA 4K2YA 1P9UA 1YF4A 3ZVCA 1HJAB 5LGOA 1P01A 1DXPA 3LU9B 1BBRH 3ZZ7A 1V2WT 3D49H 3FVFB 1MUEB 2ZFPH 4MNVA 1BTHH 3VPKA 4OS2A 1UVSH 1EJMA 1HYLA 1ZLRA 4H4FA 3TK6A 1MH0A 1ESTA 1GI1A 1QBOA 3LGWA 2BM2A 3LJJA 3P8GA 2LPRA 3A84A 1QURH 1C5SA 2BLVA 3GISB 1P3CA 2R0KA 3ENSB 4OS5A 3SUFA 1GHVH 1MAXA 3UIRA 2WV5A 3ZZDA 1FMGA 1KY9A 4Y10E 1IHSH 3UQVA 3MNCA 4DIIH 1ANCA 1SBWA 5DPAA 1A3EH 1G3BA 1S83A 1HRTH 1P2NA 1UHBA 1LQDB 3WY8A 2DUCA 1SLUB 2A2QH 4ASHA 2XW9A 2F9PA 1FJSA 1MBQA 5L6NH 1AO5A 3SBKA 1NROH 3ZVAA 3RC6A 1VITG 4UFFH 2CJIA 4RKOB 1ZYOA 5GCHF 5SGAE 4B76A 2PSYA 5HMAA 4ABGA 3MWIU 4NIWA 2BXUH 1C9TA 2HLCA 2QN5T 2ZU3A 1ABIH 1TOMH 1WAYB 4X8UH 2J38A 1FAXA 4NWKA 1F0RA 3LC3A 2A4RA 3M5MA 4X6NA 2ZGJA 1EAXA 1V2VT 2D2DA 1HAOH 3QTVH 4FUHA 3OU0A 4YESB 1BTPA 4DIHH 2WPKS 1E36B 3RUOA 2XWBI 2OC8A 1HIAA 3UQOA 1GHAF 3LKWA 4AX9H 1C1RA 2EI8A 3UOPA 2ZDAH 1QL8A 3GY5A 1NU7B 2GX4A 1QQ4A 2GDDA 3MU4A 4IMQA 4MLFB 1LO6A 1SGEE 3PMHB 4CH8B 1HAPH 5JB8S 1GI9B 1H4WA 1NC6A 3RXSA 2WPIS 1TNKA 4E7RG 1GCTC 1Y3VA 3PYHA 1C5RA 4A6LA 1JRSA 1ZJDA 3H7OA 4DCDA 3TLOA 1TPPA 4X0WU 3RC4A 1N6YA 4O3TA 5GDSH 2G52A 3PM3A 5C5NA 1CSOE 1GWAA 1XXFA 3STIA 1K1LA 2FI5E 3BTWE 4XBCA 1HAHH 3SU1A 4X6OA 4AGJA 4FUIA 4HI3A 2F9NA 2W3KA 1P2QA 3FZDA 4FUCA 4BOHA 1CA0C 4CBNA 4INKA 3A7WA 1AVGH 1P03A 1W13U 1UO6A 1IQKA 1O3AA 3MYWA 1IOEA 1TALA 2J95A 1MMJN 3ZV9A 4YT6H 4B75A 3QN7A 1A61H 2WPHS 1F0TA 1TGCA 3ZVFA 2XBXA 3GCHC 1GBJA 1A5IA 3RC5A 1UCYK 1FI8A 4MPUA 1GJCB 2R2MB 4KTUA 2GV6A 3ODDA 3MNSA 1QNJA 4Y7AA 2F3CE 1MKWH 3E0NB 4FUDA 2BY7X 4ZH8A 3SNCA 1ELBA 2Z9KA 2R3YA 1UTNA 1GI8B 1TRMA 2TGAA 1D3DB 3L6PA 3DUXH 1WCZA 2B8OH 1CHOG 3MH4A 3Q3KA 2BDYA 4ESTE 3A8DA 3DFJA 1Q31A 4Q7ZA 4ABEA 2G4TA 1RIWB 1SGNE 2OBQA 1SFQB 2ZPSA 3GY3A 1C2EA 3PLKA 2HGTH 1DT2A 5HM9A 4E05H 1KXCA 5JBAS 3V3MA 4X8VH 3BV9B 2ZHDA 3PMJA 1TGTA 3SQHE 1OOKB 4UEHH 1YPHC 2GMTC 3RXOA 5DP3A 4AG1A 3EA9A 1JMOH 3F9FA 2O8WA 3VB7A 4B1TA 2RA0A 1AB9C 1C1TA 3UY9A 1KLIH 1GBLA 4NA9H 1O2QA 1YPKH 1FV9A 1C5VA 2FP7B 3A8AA 4AFUA 3O8CA 2ZPQA 3LONA 3HGPA 2J9NA 1SLWB 1QA0A 1LPKB 1OWIA 3E1XB 3STJA 4X2WA 1TX7A 5FCKA 1LVMA 3T2NA 2J2UA 5C1UA 1ARBA 6CHAC 3ZVBA 1RRKA 1G36A 3M61U 1AWFH 3KQBA 2JH0D 3K65B 4NFFA 1ZHPA 2G51A 2WYGA 7ESTE 1LDTT 4OS1A 2ZA5A 4WMDA 5C20A 1D9IA 1WBGB 2BY5X 2C8XB 1XUJA 1FONA 2A45B 1BA8B 1Z1IA 1QJ7B 1QRZA 1QJ1B 1S81A 2BVXH 1AU8A 1K1JA 1H8DH 2VWNA 2BTCE 2J94A 3RXQA 1OWHA 4AYVB 2G55A 4BNRA 2A7JA 1ZGIA 3DT0H 3ESTA 1WYKA 1JWTA 1NFWA 2BD7A 3F9EA 1L1NA 1O33A 3TH2H 1Z8IB 3MHWU 3UWJH 2GZ9A 1IQFA 3RU4E 3W94A 1FPCH 2QF0A 3URDA 4WH6A 3Q00A 2IPHA 3Q3XA 4NA8A 2ZU5A 4NZLA 1GHYH 1O3EA 2O8TA 2SFAA 1A3BH 2FI3E 3SJKA 4D7GA 1FY4A 1KXBA 5FX6A 4JYVH 2BDHA 2NU3E 1GHAG 2XXLA 4Y0ZE 3ZZAA 1P11E 3RXFA 1SQTA 1O3FA 2A5AA 2ALPA 1GJ4H 1SFIA 2HNTE 4Y8XA 3A7ZA 1O2KA 2HVXA 5EPNA 1YBWA 2H2ZA 4AB8A 3T28A 3DD2H 1Y8TA 1O2HA 4NIYA 2ZDKA 1T8OA 4BAMB 4A5TS 5BRRE 1ETRH 1RS0A 1OS8A 5GPIB 2BOKA 1QY6A 1T4UH 2FM2A 1F7ZA 1VCPA 4WF8A 3RM0H 1NT1A 4K1SA 1ACBE 2FOHA 1AGJA 2ANWA 1C1SA 4JYTA 3LIWA 2A1DB 5A09A 5LPFA 3S7KB 1K1NA 1WU1A 4GSOA 1O2XA 1VR1H 4MQAA 5T6GA 1CGHA 1XUFA 5AFYH 2Z9GA 2QIQA 1YCPM 1HAXB 8LPRA 2V3OH 4DGJA 3E16B 3SU5A 1OX1A 3BTFE 1C2FA 4DOQA 1C5ZB 1KDQB 1LHGH 1O31A 2ZF0H 1AFEH 3SU6A 2BY8X 1BTUA 1AHTH 1CHGA 4WY3A 1O3BA 1THRH 1GBAA 1O2JA 4ZMAH 1W2KH 2FOFA 3UNQA 2C93B 3UR9A 3E6PH 2ZWLH 2H5DA 1C2JA 1UK4A 1C1MA 1EQ9A 1P2OA 1TMUH 1ZSKA 3BF6H 3B8JA 4ISOA 1J15A 2C3SA 1K1PA 2RCEA 3GCTF 1AFQC 3LGVA 1TBQH 4Y7BA 3KHVA 3MTYA 2W3IA 1GCTB 1T32A 2GVFA 1D3PB 1ZSJA 3PWBA 1ELDE 2P8OB 2FYQA 1EUFA 4JK6A 1ANDA 6GCHF 1KTSB 5DKMA 2OP9A 1H9LB 2PGBB 1CGIE 1O2NA 1A7SA 5FPSA 2ZEBA 2HNTF 2NWNA 1OYTH 1F5KU 1GPZA 3MMGA 1HCGA 1P10A 1G3DA 5EG4A 4A1TA 1RIWC 2FOBA 1O35A 2ALVA 2PGQB 3M7QA 3BN9A 4YZUA 2XC4A 4UDWH 1LHCH 3SU3A 4NA7A 1FNIA 2BB4A 1IQJA 1PPHE 1GJ9B 3PLPA 4YOGA 1E38B 1LTOA 3KN2A 1ZGVA 3IWMA 4GCHF 1DITH 3NK8A 1O3DA 1DM4B 4FU9A 1O3OA 1IQMA 4QT8C 1FAKH 1BIOA 5E8EH 1HLTH 4TWWA 4CBOA 2WINI 3M35A 2ZO3H 2ZNKH 2SGAA 1C5UA 3VB3A 1THSH 1L0ZA 3ZZ4A 3D65E 4X6PA 1V3XA 3DHKH 2PTCE 1SGRE 3SUDA 3UOUA 3TGJE 4JZDH 2W7UA 4U2WA 4FUBA 1GDQA 1PPCE 2A31A 3RXDA 1ZOMA 2ANYA 1GHBF 2C4FH 3BTTE 1YM0A 2VH0A 2EC9H 2V6NA 6ESTA 1WQSA 3RLYH 3ZYEA 2ZECA 2FXRA 1O39A 4Q2KA 1EXFA 1KXAA 3KQCA 1HAZB 3SU4A 5C67A 1C1QA 4KTSA 2VIQA 3ATIA 2ZU1A 4JZ1A 2PFEA 1A0LA 4YOJA 1FIZA 4CR5A 4Y8ZA 3L3TA 2R2WU 1Z8JB 1PPZA 1Z6JH 1TX6A 1YPLH 5EQSA 1O2MA 3OY5U 4J2YB 3U8RH 5A0BA 2FLRH 3SJ9A 3MNBA 2GD4B 3M5NA 1WSSH 1GBEA 1CT4E 2VWOA 3BIUH 1BBRK 3QUMP 2GZ8A 1A1RA 2UWOA 1AUJA 1NFUA 1O36A 3IG6B 8GCHF 1PYTC 3PTNA 4PROA 1W0YH 1SQOA 1C2GA 1TPAE 3BTDE 1J8AA 3M5LA 2A5KA 1QJ6B 2GCHG 2Q6DA 1GMCF 2PW8H 5CMXH 3LC5A 3W95A 1MD7A 3N7OA 3GCNA 4MG3A 4UFGH 1TNJA 6CHAB 3F68H 4B2AA 2ANMH 1UK2A 1N1LA 1RD3B 2ULLA 1EP5A 1KXFA 2FESH 1O0DH 1FQ3A 1GJ6A 2H1UA 1K1OA 2F91A 3VGCB 4AOQA 2BDGA 4BANB 2UUYA 3NUMA 4NCYA 3RXHA 4WJG2 4KGAA 3PO1B 4KP0A 2G5NA 1TABE 5EPYA 2AFQB 2BDIA 2FOGA 2FOCA 2QY0B 4O9VA 2QC2A 1ANBA 1QQUA 2Y7XA 2HPQH 2M5TA 1EPTC 2PKAB 1P3EA 1YCPH 4X2VA 1BDAA 1MQ6A 2VWLA 3UR6A 1UVOA 2VIDA 1G3EA 3T29A 1ZMLA 2XWAA 3QGNB 1HDTH 5L2ZH 3HGNA 3AW1A 1Y3YA 3RXJA 3ZZ6A 2QYIA 1X7AC 1NRRH 1WUNH 3EAJA 1YPGH 3NZIA 7GCHF 4WXIA 3H7TA 1GI0A 3SOSA 2UWLA 1ZPCA 3ZZCA 3TGIE 2NU2E 3GY4A 4Y6DA 1ORFA 2FI4E 1NRQH 3RXGA 3U1IB 1YKTA 2BYAX 3MO9A 1C1WH 4BTUB 3FP6E 3LDXH 5HM2A 1BMNH 1DY8A 1ESBA 2A0QB 3RDZA 1P02A 2VVUA 1AD8H 2ZHQH 3TJVA 2VGCC 1NPMA 2Z9LA 2CF9H 5DP9A 3URCA 5E2OA 2BLQA 1TGSZ 2Z9IA 1V2OT 1T4VH 4DG4A 2ZZUH 1D3QB 5GWZA 3GY7A 2FOEA 1UVTH 1N8OB 1AZZA 3GCTG 1HB0B 2JETB 4K69A 1FY5A 4Y11E 3C1KA 2Y80A 1GGDC 4MPXA 2YNAA 1DDJA 3ELAH 3T26A 1AE8H 1ZPBA 1UTQA 1BZXE 4VGCB 3SUEA 3A83A 1W10U 2AERH 2BZ6H 2OCVB 1P2JA 2ODQA 2QA9E 6GCHG 2IN2A 1DX5M 1DSTA 4RKJB 4Q7XA 1O34A 1C4Y2 2J92A 3U9AH 1W14U 1EPTA 2P8OC 2A7CA 5GJ4B 1OWJA 4SGBE 2F9UA 5F6MA 2TGDA 5FAHA 1OWEA 5J4SA 1HAGE 3O8DA 1Y5BT 3A87A 1SOTA 1QRXA 1VCQA 2ZCLP 3T25A 4I7YH 4H6TA 2P3FH 2P93A 4M7GA 3MNXA 1ZRBA