3T27A

Orthorhombic trypsin (bovine) in the presence of betaine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t27A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t27A02
5FHTA 1LTOA 2AIQA 3S0NA 4NSVA 5FBEA 1BRBE 1THRH 2Y5HA 3ZZ3A 1P8VC 3DA9B 4ABJA 3E6PH 1S0QA 4DIIH 2ZHWH 3K9XB 2FOAA 4KELA 4GSOA 3MHWU 3RDZA 3OY5U 2WUBA 5EPNA 2ZDLA 3SZNA 1DT2A 5DP3A 1TBQH 5DP6A 5EG4A 1YM0A 1B7XB 1FZZA 3SN8A 6GCHF 1LMWB 2J34A 3FP7E 4A7IB 1W0ZU 2BLOA 1CA0B 1ZZZA 2ANYA 2ZI2H 2CJIA 1K2I1 2GT7A 2H5DA 2HPQH 1PPFE 3GDUA 3LH1A 5EQQA 1KDQB 1DPOA 1O3JA 3UUZA 1UMAH 4THNH 1THPB 1HB0B 3PROA 4IBLH 2P3FH 4Y71A 2QCYA 1S85A 1KY9A 4QT8C 4IN1A 5L2ZH 1NS3A 1HXFH 2ZA5A 4U01A 3BTWE 3B9FH 4I8JA 3UOPA 3RP2A 8GCHG 2ZEBA 5JDUB 4AOQA 2A5KA 1O3FA 1H8DH 2WPKS 4MVNA 1GI1A 4X2WA 1QGFA 4JK6A 5A0BA 4X6MA 3K65B 1Z1JA 1M9UA 2HWLB 2AYWA 2ZHFH 3QK1A 5EPYA 1NU9A 1NN6A 1ZJDA 2P16A 4FUHA 4D8NA 6ESTA 2QXIA 3W94A 1ETRH 2J2UA 4CRCA 1C1OA 4ZHMU 3P8GA 4LZ1H 1N6XA 1F0UA 3ZZ6A 4D9QA 3GICB 2XC0A 3SHAH 3SU6A 2BDCA 3FP8E 1DY8A 1LDTT 1GBKA 1SGCA 1Y3XA 1YLDA 1ANBA 1DWCH 2R0LA 2ZF0H 3QUMP 1KXDA 3I77A 1GI3A 1AUJA 4K8BA 1INCA 1GL1A 2XWAA 3LGUA 1NFYA 1W7GH 3SU3A 3EQ0H 2ESTE 2FX6A 2BQWB 2STBE 4MTBA 2OTVA 1CBWB 3SUEA 1E35B 1BIOA 1GHAG 1BTHH 1QL9A 2PLXA 4B2CA 3RXFA 4KTUA 5F03A 4MDSA 3QWCH 1NRPH 5EODA 2OC0A 4FU8A 4CBOA 2BY7X 3BTTE 3KQCA 1IHTH 4FXGH 2BD4A 1F0RA 2VWNA 1QRZA 1WQVH 3KHVA 3BTFE 1AO5A 1QB9A 2BYAX 2ZFQH 4XE4A 5FBIA 1KIGH 2BQ6B 1GJ6A 4CREA 3P92A 2Y82A 2R2WU 1GI9B 1FMGA 1O2IA 2EI7A 2ZHQH 4AFZA 2ZWLH 4DG4A 2C8YB 3PO1B 3VB4A 2FLRH 3LH3A 3HPTB 1YPKH 3RXIA 1SR5C 3RU4E 1C5ZB 4K69A 5LGOA 2Z94A 3S9AA 4UE7H 1ELFA 2CMYA 1HJ9A 3BEUA 5L6NH 3M7UA 1UCYE 3LGWA 5EXLA 3ATKA 5J4QA 1OWDA 2ZDNA 3BG8A 2G5VA 2Q6GA 3F6UH 4NIYA 4NIXA 2OBQA 2SNVA 1Z7KA 1W11U 1G2MA 1O5GH 1Z8GA 5JBAS 2O8TA 1FAXA 1EZQA 1GBHA 1ZGVA 1A0HB 1IOEA 4D9RA 2JH5D 3L33A 5EU8A 1GJ5H 2ZDVH 4MPXA 6GCHG 1MKXK 1DICA 1AQ7A 3SUDA 4AB9A 2FOFA 2ILNA 1GI8B 1U6QA 3MU0A 1K9OE 4H6SB 5AFZH 2G4TA 4CRGA 2Q1JA 5HM2A 3E90B 3T27A 1A5IA 2O8WA 4Q7XA 2GMTC 3DHKH 1YKTA 1CT2E 5FCKA 1Q3XA 2ZZUH 4MLFB 1YPMH 2R3YA 2C8ZB 3AAVA 4WWYA 1WAYB 2ZQ2A 3VB3A 3DFLA 2P3TB 2JETB 1O2RA 3HK3B 2OP9A 2KAIA 1HFDA 1BTYA 3MWIU 4I7YH 1PYTD 2GCTB 2OINA 1G3BA 1AY6H 1SGTA 4LXBH 1AFQB 1LQDB 3A7VA 4KKDA 2G5NA 1C4Y2 4TPIZ 3M5LA 2KAIB 1GJAB 1WTHD 1HXEH 2BLWA 2F83A 2ZFSA 2FTMA 3RXCA 1BTUA 1C2FA 3LC3A 4AZ2B 3HATH 1TMUH 3NKKA 1HLTH 1HAXB 1Z6JH 2ZHEH 3T5FH 1LHDH 2A4OA 3PMJA 3RC4A 2F9UA 2OBOA 3MTYA 4JYUH 1UTNA 3U8OH 1MAXA 4NIWA 1MTNB 3U69H 2Z9GA 3ZZ4A 5ESTE 1DXPA 1D6RA 1EXFA 3BEIB 1PPGE 1MCTA 1KXCA 4NA9H 2DE9A 4JZFH 2BDHA 2BZAA 1O5BB 3ZVBA 1C1RA 5FPTA 4HFPB 1EPTC 2FOEA 4MNVA 4TWYA 1P0SH 4B2AA 5JB8S 1UTPA 3NWUA 4K2YA 4NZQA 2Z9KA 1JXPA 3P8FA 1C5XB 4ABFA 2HNTC 3VGCC 3SO3A 1KYNA 3FP6E 3MH4A 2BLQA 1C5PA 4VGCC 6CHAC 1EP6A 1NRRH 1QQUA 1HUTH 4XBDA 5PTPA 1C4V2 2H9TH 2SNWA 2PKAA 4IGDA 3SU0A 1GHAF 2FIRH 1NFXA 5IYTA 5AF9H 1AMHA 1L0ZA 1QQ4A 1XKBC 1MZDA 1L1GA 1YPHE 2GZ7A 1RGQA 3OX7U 1ZHMA 2PKAB 2ZPRA 3HGNA 1VR1H 3HK6B 3KQBA 1YF4A 1ETSH 2TGTA 1RIWC 1L1NA 2CN0H 3D23A 1NFWA 3SQHE 4Z6AH 1VITF 1OP2A 2XWBI 3MH5A 1HIAB 2XRCA 1CQQA 1O3AA 2A2XH 3EDXB 1D3PB 3RXAA 1HAGE 1Y3WA 3RU4D 3SBKA 4KGAA 2ZGHA 1HYLA 2BDBA 1P2JA 2R0KA 1MD8A 1AWFH 4NA8A 4UFGH 2ZHDA 1D4PB 1J16A 1GBBA 2XCNA 5C1XA 3SV9A 2JETC 1G3DA 2GCHF 2GV7A 1QA7A 1UTMA 2BD9A 4I33A 3NK8A 4MQAA 1GI4A 2D8WA 3B8JA 1O0DH 1C1PA 1ZRBA 1SOTA 1QBOA 2UUFB 3FZDA 2A5AA 3OYPA 1NZQH 1CT0E 4TY6A 1Y3UA 3SW2B 4LOYH 1JBUH 1KXFA 4I32A 1GJDB 3FZZA 3DFJA 1C2IA 1MU8B 2D26C 3NZIA 1DSUA 4K1TA 1BRAA 1VZQH 2G52A 9ESTA 5FPSA 2Z9IA 1FY4A 1VCQA 1GPZA 4XSKU 2FS8A 4A92A 1BHXB 5AFYH 2CF8H 2Z3CA 4K8YA 3P8OA 1IQIA 2G81E 1C1WH 3K6YA 3R3GB 4Y0ZE 1DM4B 2BB4A 2TGDA 1K1NA 1NROH 1ZLRA 2B9LA 2QYIA 2TPIZ 5FX5A 2XC5A 1CA0C 3RUOA 3TGIE 3PLKA 2PTCE 3T28A 4FUGA 3ZVDA 1K1OA 2K1QA 1SLVB 1BOQA 4INLA 4DT7B 2AMQA 2A45B 2VB0A 2HGTH 3ZYDA 1V2VT 2BDGA 1J17T 2BMGB 2BX3A 3A86A 3A8DA 4MNYA 3Q3KA 1EOJA 2D1JA 1O3OA 3VGCB 4TPYA 1C2DA 4IC6A 3TNSA 3AW0A 3T62A 1PPEE 1J14A 2B5TB 5AVDA 1ORFA 1QRWA 3ZZ5A 3ATLA 1TIOA 2OXSA 5LPFA 1PQ5A 2W3KA 3BEFB 2TRMA 1C5UA 1RTFB 3P95A 1A1RA 2VH6A 1GG6C 4A5TS 3U1JB 3A7TA 1C5YB 3UOUA 1BMMH 3F9GA 1ZHRA 3EA9A 1DSTA 2GD4B 1T8LA 1GHBG 2QAAA 1A4WH 5TCCA 4Y0YE 1VJ9U 1DWBH 4D76A 1S5SA 1AB9B 4ZXYH 1XKAC 3BG4C 3MNBA 1GDQA 2STAE 4AG2A 5EXMA 1FAKH 1CE5A 1NY22 4BTUB 2AS9A 1DLKB 1ZPCA 2Q6FA 2ODPA 3O8DA 2A7HA 4DCDA 1ZPBA 3UQVA 3UWIA 1GMDG 3V13A 4K60A 6LPRA 5G4BA 4X2XA 1OX1A 1EB1H 1TYNA 3T2NA 4ABDA 1C9PA 3RXSA 3VB5A 1HAZB 1SI5H 2HNTF 1GMHG 1SVPA 5F6MA 2ZU3A 1O38A 1SOZA 2A5IA 3ODDA 3SJ9A 2XW9A 3GY4A 1O5AB 1S82A 4O97A 1O2HA 4IW4E 1BTZA 1O33A 3OY6U 3T26A 4U2WA 2GDEH 2V3OH 1P9SA 1A5GH 1GL0E 2A7JA 1PFXC 1KLTA 1GHWH 4Y79A 5C20A 4HI3A 1PPBH 1T8MA 1C1MA 4J2YB 2FOGA 4SGAE 1E37B 2A31A 1JIRA 3GCTF 3FANA 1LVOA 1O37A 3GCNA 2BTCE 4ABEA 2HOBA 4AGKA 3O8CA 1QA0A 4Y8YA 4WH8A 1NRSH 1MTSA 1N8OB 3ZVFA 1HAIH 1XUGA 1PPZA 3E8LA 3SJOA 1EAIA 2QXJA 1O5CB 1BB0B 4ZKSU 4NSYA 3TVJB 3DD2H 4MG3A 4ZKOU 4E7RG 1C2JA 4AFQA 1FIWA 1O30A 4F49A 1TONA 1EB2A 4J1YA 3QZQA 4GVUA 1HCGA 1ZGIA 4H6TA 1N8OC 4Y7BA 1F0SA 2BM2A 1P57B 1K1PA 1C1NA 1BQYA 4IN2A 1C5SA 1VITH 1BMNH 5EOKA 4ZXXH 4X6NA 3KF2A 2QXHA 3VXFH 4X2YA 3OU0A 2BOHB 2P3UB 1GJCB 1LHFH 5DP4A 1TNKA 3TITA 2PGQB 3SV6A 3MU1A 2HALA 2OC7A 1Z8RA 3PMBB 3F68H 5DPAA 2PUQH 3D49H 3TJOA 1HBTH 1FXYA 1NU7B 1BCUH 1D3QB 4ASHA 1HJAC 2PV9B 3TGKE 3RMMH 4NG9H 2C4FH 1DDJA 2VWOA 1NC6A 3V0XA 3GY6A 4UDWH 1AE8H 4WMFA 1G9IE 2F3CE 4INHA 2Q6DA 3BTQE 1EZUC 4H42U 2M5TA 3LKWA 1ELEE 4XOJA 4Q80A 1SGEE 4MPWA 1EQ9A 1QJ6B 2PKSB 2UUJB 2Y80A 3AW1A 2HRVA 5HGGA 1QCPA 1YCPM 2G55A 4ISOA 2GCTC 2VVVA 1Z71A 1H8IH 1LCYA 3UNRA 3O8BA 5GCHF 1UK2A 2R2MB 4YOJA 2EEKA 3F9HA 2ZU1A 1EAXA 1T7CA 2ALVA 1UHBB 2BDIA 4NWLA 1A7SA 1G2LA 1GHVH 2P95A 3PWCA 1DOJA 1P06A 1WQSA 1B0EA 3BIUH 3PO1C 1NO9H 1DANH 3AASA 4X1NU 5C1YA 1P09A 3SHCH 2WV5A 1SG8B 1K21H 1ZHPA 3ZVCA 2H5CA 1TGSZ 2ZU4A 1YCPH 3ZZCA 1O3NA 2C90B 4IMZA 2J92A 2SGFE 1O2LA 2QF3A 5T3HA 1LVYA 1GI2A 2ZCLP 1UCYK 4FUIA 3M7TA 1O36A 1DY9A 4CR9A 8LPRA 1TLDA 2NU3E 3URDA 5SGAE 1C2GA 1DLEA 1MTVA 3KEEA 1CVWH 1NESE 1RTKA 3S9BA 5A8ZA 2P8OB 4YESB 3UPEA 4U32A 3EYDA 3SNAA 5IDKA 3PB1E 3PTNA 1IQJA 1O3CA 1OYTH 3G01A 4H4FA 1YPJH 2CXVA 3Q76A 1RIWB 4DVAU 4BXWA 5E2PA 3SNCA 1FUJA 3M5NA 2WPIS 4A1VA 2BOKA 5LH8A 1MQ6A 1XVOA 1Z8IB 4JZ1A 2HLCA 1B0FA 1IQKA 2TGPZ 1O2NA 3JZ1B 3TH3H 3E1XB 1TPOA 4IC5A 4BANB 3RXGA 5EQSA 1TGTA 2Z7FE 2FZZA 3TJNA 1QHRB 4X2VA 1MBMA 1YC0A 4O3TA 1NM6A 3PTBA 2Z9LA 1GMCF 1TALA 2WUCA 3A7ZA 3UWJH 2BVSH 1O3PB 1EP5A 1HAPH 2I6SA 3URCA 3H5CB 1XVMA 2QIQA 1F92A 1TNIA 3SOSA 2RA3A 3SV2H 3QTOH 2BX4A 3M3TA 3NUMA 5CHAC 8GCHF 1SB1H 5FXLA 1L4DA 2FS9A 2BDAA 3U8RH 2BDYA 2TGAA 1HPGA 1V2QT 4OS6A 3P17H 3E0PB 1ZMNA 1GI0A 1GHZA 1GJ4H 2AERH 3RXVA 1TNHA 3RXQA 1TQ7B 5EQRA 1UTQA 4JZEH 1GBMA 5TJXA 1JMOH 4X6OA 5JPMH 3ZZAA 3KL6A 3LGIA 1P02A 3MO3A 4WH6A 2JH0D 3KQEA 2QV1A 5GXPA 3QGNB 1TNJA 3TNTA 1C5LH 8KME2 2A32A 1T8OA 1A0LA 2RDLA 4X8SH 2GMTB 3RXOA 3F1SB 1KLJH 3A80A 1MUEB 1A3BH 1WUNH 3C27B 1V2KT 5FAHA 4BAMB 1WSSH 3ZYEA 1FY1A 2XYAA 3OSYA 2BY5X 3OTJE 1WV7H 3P8NA 5I25A 2QXGA 4FUDA 1XMNB 4MNWA 4R0IA 3M36A 3V3MA 3CS0A 4ABBA 2FEQH 3Q3XA 2FMJA 1XX9A 5LPRA 2OQ5A 5EGMA 2NU1E 1NT1A 3BTME 3L6PA 1AE5A 2BLVA 3F9EA 2WINI 2VGCB 1BRUP 1ACBE 1FQ3A 5GDSH 2VIWA 2ZFPH 1MBQA 3LT3A 1MCVA 2ZGXH 2ULLA 1GBFA 1TX8A 4AFUA 1DFPA 3GY8A 3A8CA 1LVMA 4NFFA 1JRSA 2XBXA 2EI8A 4U30A 1CT4E 3WY8A 1BHXF 2FDAA 2UWOA 1CA8B 3TGJE 5DP7A 4FUEA 4JCNA 1ELBA 1P04A 2VIQA 1QNJA 1W8BH 4HGCA 1SFQB 4ISNA 2V6NA 4F4OC 3C1KA 3UREA 5BRRE 3PMAB 2RCEA 4AFSA 1LHGH 4FUJA 3LOXA 1OWKA 4I8HA 4K1SA 4ZHLU 4A1TA 4NA7A 4SGBE 1O3IA 4ZAEA 5L30H 4X1QU 3UIRA 1T4VH 1H9LB 1MZAA 3I29A 1ELAA 1GCDA 1RRKA 2ZPQA 5F8ZA 1V3XA 4FU7A 1OWEA 5C5NA 3KGPA 2ZO3H 1UTJA 1QB1A 3SU2A 1GBTA 1MD7A 4UEHH 1C2HA 1YYY1 3A82A 1UTKA 1SPJA 1O3EA 2J9NA 1TGCA 1V2UT 2FO9A 3A8AA 2VIOA 1GBDA 1QB6A 1SL3A 2EC9H 1GHYH 1SGFA 1MKXH 2FOHA 2AIPA 1TA6A 4Y8XA 1TB6H 3K6ZA 5CMXH 3AAUA 1O5FH 3H7OA 1X7AC 1W0YH 1RXPA 1BBRK 5DG6A 3MI4A 2UWLA 4M7GA 1RD3B 2HNTE 2OC1A 2FOCA 2OLGA 1HAHH 1KLIH 1G37A 4OS7A 3LIWA 1BMAA 1OP0A 1TNLA 2G51A 3RXPA 3T29A 2FTLE 2OD3B 1AKSB 1OOKB 5A2MH 1SGIB 4Y6DA 5T6GA 3RXBA 1K22H 1T32A 3QDZB 1V2NT 1AGJA 3RXRA 1L2EA 2VIDA 5EXNA 2SGAA 1WYKA 1V2OT 1QL8A 2XCFA 2G00A 1DX5M 3ZV8A 3LJJA 3IWMA 5DJ7A 5FCRA 2I6QA 1WBGB 1F2SE 3ESTA 1TPAE 3P6ZB 4O9VA 2Z9JA 4X1SU 4LK4A 4X0WU 3EA8A 2GDDA 2P93A 2LPRA 3LPRA 2ANKH 3BIVH 1EJAA 1YLCA 3MO6A 2A2QH 1BRCE 1H4WA 2VNTA 1O5EH 3ZZDA 1YPHC 3UFAA 3BTHE 3Q00A 1P01A 2VU8E 4A6LA 1ANCA 1E34B 1EJNA 2VJ1A 1AN1E 1BUIA 5H4IB 2BXTH 1Y3VA 3QGJA 1SGNE 2ZGBH 4NFEA 4OS4A 1UVTH 4UFDH 1ANEA 1TA2A 1CU1A 3FVFB 3QTVH 1ABJH 1O34A 3SI3H 1P3EA 1XUIA 3SUGA 1IAUA 2F9BH 3A89A 1DS2E 4GPGA 1GHBF 4I31A 1ELTA 3QLPH 3SJKA 3VFEA 3FFGA 4DW2U 4BAKB 1SQTA 1KXEA 1W3CA 2UWPA 3RXKA 1IQGA 2LNCA 1YBWA 1V2PT 1C5QA 4Q2KA 3UNQA 4IS5A 4YT7H 1VITG 1ETTH 1PJPA 1GMHF 2DUCA 2SGPE 1GVLA 1MTUA 4E05H 3VB7A 3TK5A 1O2WA 1AWHB 3RM2H 1SFIA 1AVWA 4VGCB 1NRQH 1UTOA 4BTIB 4ISIH 2FODA 5FPYA 2FLBH 2FOBA 4DGJA 2ZTXA 3SUFA 5C3NA 4FUFA 1DWEH 1AB9C 2PW8H 4X8TH 1P2OA 1Q31A 1NTPA 1W12U 1QFKH 1E36B 2W7SA 3ZVGA 1S6HA 2Y7XA 2B7DH 3A87A 2P8OC 4CRBA 3BN9A 3KCGH 1V6DA 5GPIB 2QGRA 4KTCA 2P59A 3A8BA 4CRFA 4ZH8A 1DXWA 1O5DH 1C1VH 9LPRA 1ZSLA 1GI7B 3EGKH 2FP7B 1P2KA 4CRAA 3RMOH 2O9QA 2PWXA 2GTBA 1P3CA 1V2MT 3M61U 4MPVA 5B6OA 1O3GA 3E0NB 1H1BA 3BTGE 4OGXA 1KDQA 3ITIA 5JYIA 4WJG2 1C5RA 2AH4X 1PQAA 1AFEH 1AU8A 3NXPA 1J15A 5C2ZA 1YPLH 2FI5E 1D6WA 1OS8A 1CGJE 2VIPA 2ZTYA 2OCVB 2FX4A 1GI5A 2NU4E 2VWLA 1ELCA 1D3TB 2JKHA 2ZDMA 2WPMS 2QC2A 1AFQC 1AZ8A 3MO9A 1TNGA 2ZU5A 5BPEA 3GOVB 1PPCE 3ZV9A 5J4SA 1LPZB 4LZ4B 1Y5UT 3ZZ9A 1VCPA 3MU4A 1C5WB 1THSH 3A88A 3ELAH 4BTTB 3A81A 1HNEE 3SU5A 1SGYE 1C5OH 1BA8B 1WTGH 4XBCA 3HGPA 1TRYA 4DURA 1O32A 1TMTH 1LVBA 2FPZA 2ZQ1A 2H2ZA 3L3TA 2ZFFH 4YO9A 4GCHF 4X1RU 3HKIB 4R8TB 1GBLA 2A1DB 1OSSA 5DKMA 3ZZ8A 2QA9E 2CHAB 1BBRE 2PGBB 4Z0KA 5GCHG 1C1UH 1ZMLA 2BD2A 1O3DA 1A61H 1H9IE 1V2JT 4TY7A 1GJ7B 2GZ9A 5ESBA 1GMDF 1P2NA 4K1EA 4AYYB 1WCZA 2VIVA 7LPRA 5F8XA 3GCHC 4INKA 2THFB 1TRMA 3SGAE 3SGQE 2V3HH 3PWBA 1TMBH 1V2LT 1CHOF 3PV4A 1ELVA 1ZRKA 2XXLA 4JYVH 1OPHB 2BVXH 2QF0A 2ZCHP 3BTDE 1ARBA 2C93B 3A7YA 1TX7A 3MNSA 5E2OA 3TPIZ 4JYTA 2RG3A 1CGHA 3BG4B 4E06H 1EKBB 3CP7A 4GCHG 3Q3YA 1HIAA 1S83A 1DUEA 1BBRH 2BXUH 3O8RA 1O35A 3TJVA 4ZHAA 3V7TA 4Y76A 1ZSKA 3SV8A 3RU4T 1LHCH 3M3VA 4JZIA 5GJ4B 2GP9B 3TK9A 1SBWA 4K5ZA 1O2JA 4XBBA 4X8UH 1ELDE 4TYDA 1KTSB 1BITA 1VGCB 3TLOA 2PUXB 3DUXH 1C1TA 1T8NA 1QBNA 3SNDA 1AKSA 2A4QA 1V2ST 3TK6A 1EPTB 1DUAA 4BAHB 3RXMA 2SGDE 2H9HA 2PHBA 3ZZBA 5C67A 1O3MA 2ZIQH 1YGCH 2F9VA 5TCAA 3UNSA 1S81A 1EZSC 1CO7E 5DK1A 1QR3E 4RKOB 2QY0B 4Y7AA 4B76A 1W2KH 5JBTA 3A7XA 5A8YA 2EA3A 4CHAB 2PSXA 2ASUB 3RLWH 4RN6A 1P10A 1O3HA 1TE0A 1AHTH 5EW1H 3ATWA 2XBVA 1C1SA 4WMDA 1YPEH 3GISB 1D9IA 1L4ZA 3MFJA 4XFQA 3GYLB 4NIVA 3QX5H 4XDEA 1FN8A 2P94A 1S0RA 1PQ8A 1PPHE 1QURH 4UD9H 1RFNA 3QZRA 3LONA 1NFUA 3VPKA 4NWKA 4ZMAH 2IPHA 3VEQB 1XUKA 1GG6B 2ZC9H 1SMFE 1W13U 2GVFA 1P11E 2AGIX 7KMEH 2SGEE 1FY5A 3SNEA 1P2IA 2Y5FA 2HVXA 1FPCH 4WY3A 1EAWA 1KXBA 3MH7A 4YOIA 1FLEE 1C2KA 3U1IB 1B5GH 3RM0H 5CHAB 1Y3YA 2WV4A 2ZECA 3KN2A 4DOQA 5DP5A 3I78A 2XNIA 1GGDB 1MKWH 2OQUA 2SGQE 3P70B 4YZUA 1F5RA 1O39A 2WPLS 1QY6A 2FXRA 2FOMB 1OKXA 5JBBS 5DO4H 2FM2A 1CHGA 3S9CA 1N1LA 1PYTC 1TGNA 1Q2WA 1GCTC 4X1PU 5ETXA 5E0GA 7GCHG 3S7KB 3RMNH 3LDXH 4JMYA 2OC8A 1D3DB 3UTUH 4ZKNU 3ATIA 3KNXA 3SJ8A 1P2MA 1SGPE 8ESTE 1IQFA 1DVAH 1SLWB 2UUKB 1C5VA 1HAOH 1W10U 1JWTA 2GCHG 2R3UA 1W7XH 1IQEA 3UY9A 2F91A 4ISHH 2ALPA 2YNAA 2IJOB 6CHAB 1ESBA 1O2OA 2W5EA 1ZPZA 2O8LA 2Z3EA 1UVUH 1BTXA 3MU5A 1V2TT 2ZPSA 1UVPA 3SORA 2YOLA 2J95A 4Y8ZA 1T31A 4DY7B 2BD8A 3M3SA 1RTLA 3LU9B 4D7FA 3S7HB 1DE7H 1K1IA 4JK5A 1LKBA 3UR6A 2ZNKH 2BY9X 1K1LA 2CHAC 1BT7A 4FU9A 3M7QA 4HTCH 1XXFA 1YPGH 4A1XA 1O2VA 1QTFA 1GBCA 2GT8A 2GX4A 2Y7ZA 1FPHH 1FN6A 3MU8A 1HGTH 1QJ7B 2PFEA 2A4RA 4O03A 3RXTA 2PSYA 3BTKE 1QJ1B 3FAOA 1O2TA 1EUFA 1GBJA 2BVRH 4I8KA 3UQOA 5E0JA 4YM9A 3RLYH 2B0FA 2FYQA 3GDSA 1TOCB 1H9HE 2W7UA 1BJUA 1MKWK 4PROA 2ODYB 2C3SA 3VXEH 3RXLA 1TBRH 2ZKSA 3IG6B 1O2ZA 3BTEE 4AGJA 3RXHA 4WVPE 3RMLH 1FDPA 4X8VH 1SGQE 1FI8A 4YLUA 2CV3A 1QRXA 1GGDC 1UK3A 3DT0H 3NPSA 4B73A 2H9EH 2WYGA 3SU1A 5GWZA 1MMJN 1HV7A 1FIZA 1P9UA 2W3IA 1TGBA 1UVOA 3KIDU 3TU7H 1AVXA 4CRDA 3JZ2B 5E0HA 1F5KU 1C5TA 5E8EH 2NU2E 1ESAA 1O2UA 5K7RA 1F5LA 2B8OH 1MTNC 2ZP0H 4ZKRU 3SGBE 2Y5GA 1TWXB 5DP8A 1FNIA 2FESH 1AVGH 1C2MA 1MAYA 5C1UA 1O2GH 4B2BA 3LGVA 3MNXA 4FUCA 1XUFA 3ODFA 3F9FA 2AEIH 2PKSC 3D65E 1GBAA 1ELGA 1OWIA 4CHAC 1ESTA 2AGGX 1MU6B 3CS7A 2ZDAH 1LPKB 4B75A 2ZU2A 2C8XB 3Q77A 1BTPA 2FWWA 4Q7ZA 4BAOB 1TOMH 1J8AA 1SGDE 3S69A 1LQEA 3SV7A 1EASA 4CH8B 1C2LA 2O8MA 1EZXC 1S84A 3A7WA 4DJZB 3U8TH 1WOFA 4AORA 4OS2A 2NU0E 4YOGA 1GBIA 4E7NA 4MPUA 3EA7A 2ANMH 1F0TA 4NZLA 1UK4A 5CE1A 4RKJB 3V12A 3GY7A 4ZUHA 3VB6A 2WYJA 3M35A 1OXGA 2FI4E 1ID5H 2J4IA 1PQ7A 4MNXA 3RXEA 7GCHF 1GJ9B 1VCWA 2BD7A 2O8UA 4BOHA 3PMHB 2F9NA 4BAQB 1L1JA 2AMPA 2D2DA 4X6PA 5K0HA 1S6FA 2J94A 4KP0A 3MYWA 1P03A 4UONA 3T25A 1UJ1A 3GCHB 1MTWA 4RSPA 4AN7A 2ANWA 2V35A 2XC4A 1A2CH 3STJA 1FY3A 2VWMA 1GCTB 4CR5A 4OS1A 3W95A 1GDNA 5A8XA 1EATA 1O3KA 1G3EA 1HAVA 2XBWA 5AHGH 1TRNA 2XTTB 4TWWA 4GAWA 1XXDA 2C8WB 3ATMA 4UFFH 5HYOA 5F8TA 1TABE 1SC8U 3RXJA 1Z1IA 2FI3E 5T6FA 1TFXA 3CENA 1GHXH 3MOCA 1XM1A 2GGVB 3LC5A 5EW2H 2EI6A 3KQDA 2W26A 4B71A 4BXSA 2A4GA 4ISLA 5DP9A 4ABHA 1ZR0A 1O3LA 3ZVAA 1G3CA 1ZTKA 4NGAH 1OYQA 3MH6A 1EAUA 1JOUB 2H1UA 4WXVA 1T4UH 1IQMA 1E38B 1ANDA 2WPJS 3UR9A 1LPGB 1Z6EA 3LGTA 3SU4A 1XUHA 4Q7YA 1J9CH 1OWJA 3RC5A 3RXDA 1GJ8B 1A46H 2Y81A 4O3UA 1GJBB 3ZVEA 1CBWC 2ZDKA 3N7OA 3SNBA 5L2YH 4I8LA 2Y6TA 1WU1A 2GZ8A 3GDVA 4ABIA 4OGYA 3BF6H 1K1JA 2VGCC 3TH2H 2VVCA 5I46H 2Z3DA 1SQOA 5A0AE 1E0FD 2DE8A 1GDUA 1SHYA 1SSXA 4WMEA 2BHGA 4YTAA 1O2KA 3H7TA 3LJOA 1A3EH 1RS0A 1C4U2 1G32B 3A83A 1C2EA 4CBNA 2VINA 3GY5A 2HPPH 3SI4H 2BY6X 1G36A 1ZTLA 2F9PA 2V0BA 1SLXB 1VGCC 3M5OA 4B1TA 4ABAA 1YP9A 3HKJB 3PM3A 1Y5AT 1BZXE 3MMGA 5A09A 1OP8A 1HJAB 1IQNA 2AGEX 1GBEA 4GHQA 2IN2A 2J38A 2VVUA 1P2QA 1QL7A 3ZZ7A 4DIHH 1QIXB 1UHBA 1ZMJA 5GIBA 1ZOMA 4OS5A 1GWAA 4Y10E 1GMCG 1BDAA 1HDTH 1UO6A 2BQ7B 1DITH 2NWNA 2WPHS 4I8GA 4IMQA 4GUXA 1TPPA 3LGYA 1Y5BT 3STIA 3MNCA 1ZJKA 4GLYA 1CHOG 1N6YA 1ABIH 1KSNA 1UVSH 2BD5A 4AB8A 2JH6D 1ZSJA 4K3JA 1O2QA 1OWHA 1AD8H 4WXIA 4WF8A 3E3TA 1BJVA 2ZFTA 5LPEA 1YCPK 4AYVB 1LKAA 1LO6A 2YNBA 5ABWA 2TIOA 2A0QB 2R9PA 3U9AH 3SQEE 3B23B 4B74A 1O3BA 3M5MA 1Y8TA 5DGJA 5A0CA 1ARCA 1CSOE 4YLQH 1FONA 1AZZA 1O2SA 2ODQA 2VH0A 3A85A 3EE0B 1QBVH 1TBZH 4NCYA 3A84A 5T6DA 1LHEH 1K1MA 2ZTZA 1KXAA 1K28D 3GCTG 1C9TA 3GY3A 3E16B 1FV9A 1V2WT 1C5NH 1SHHB 1O2XA 2AFQB 2RA0A 3QN7A 4ESTE 3E91A 1SQAA 2PTNA 1ZTJA 5JBCS 2QN5T 2BY8X 2H6MA 1BMLA 1TX6A 1TQ0B 1GI6A 4FUBA 1EPTA 2GKVE 3BV9B 3IITA 3K2UA 2XBYA 1FY8E 2ZFRH 4YT6H 1A5HA 2CGAA 2ZG0H 1CGIE 1AUTC 1G30B 1FJSA 4KTSA 3TH4H 1O2YA 1KTTB 3D62A 2G8TA 2PR3A 1EJMA 3RC6A 1IQLA 2G4UA 1JIMA 1MQ5A 3TIUA 2A7CA 2AMDA 1SLUB 2GV6A 3R0FA 1DWDH 1SGRE 3U98H 2IOTA 5HM9A 4HZHA 1O2MA 1AI8H 2BZ6H 2Z6BD 1HJ8A 4BNRA 2SFAA 2OUAA 4AX9H 1ZYOA 1F7ZA 1P12E 3RXUA 4CH2B 1UTLM 1VJAU 1TPSA 4D7GA 4ZROA 1BTWA 1GVZA 1HRTH 2TBSA 3ENSB 3QO6A 3NCLA 3TJUA 1AIXH 4FVBA 4JZDH 1P05A 3AVZA 5C5OA 4ABGA 1JRTA 1NRNH 4GHTA 1TAWA 1GVKB 1W14U 4FVDA 3EAJA 2CF9H 2BD3A 5HXFA 1XUJA 2FYRA 1IHSH 1IQHA 1A0JA 3M37A 1C1QA 1O2PA 5JB9S 1C5MD 1MH0A 1Y59T 3BSQA 3PLPA 1HAYB 3SJIA 7ESTE 1SGFG 1Z8JB 3GYMA 1UCYH 2UUYA 1HAVB 2ZGCA 2ZGJA 4UFEH 4AG1A 3PYHA 3GCOA 1O31A 1V2RT 4Y11E 1EOLA 1EX3A 1RJXB 2F9OA 5FX6A 5HMAA 1NPMA 3GY2A 3PLBA 2ZCKP
chains in the Genus database with same CATH superfamily
5FHTA 1LTOA 2AIQA 3S0NA 4NSVA 5FBEA 1BRBE 1THRH 2Y5HA 3ZZ3A 1P8VC 3DA9B 4ABJA 3E6PH 1S0QA 5C0TA 4DIIH 2ZHWH 3K9XB 2FOAA 4KELA 4GSOA 3MHWU 3RDZA 3OY5U 2WUBA 5EPNA 2ZDLA 3SZNA 1DT2A 5DP3A 1TBQH 5DP6A 3UB0A 5EG4A 1YM0A 3OEED 1B7XB 1FZZA 3SN8A 6GCHF 1LMWB 2J34A 1SKYE 3FP7E 4A7IB 1W0ZU 2BLOA 1CA0B 1ZZZA 2ANYA 2ZI2H 2CJIA 1K2I1 2GT7A 2H5DA 2HPQH 1PPFE 3GDUA 3LH1A 4AC9A 5EQQA 3MQKC 1KDQB 1DPOA 1O3JA 3UUZA 1YLNA 1UMAH 4THNH 2WV9A 1THPB 1HB0B 3PROA 4IBLH 3N7EA 2P3FH 4Y71A 2QCYA 1S85A 1KY9A 4QT8C 4IN1A 1E1QD 5L2ZH 1NS3A 1HXFH 2ZA5A 4U01A 3BTWE 3B9FH 4I8JA 3UOPA 3RP2A 8GCHG 2ZEBA 5JDUB 4AOQA 2A5KA 1O3FA 1H8DH 2WPKS 4MVNA 1GI1A 4X2WA 1QGFA 4JK6A 5A0BA 4X6MA 3K65B 1Z1JA 1M9UA 2HWLB 2XNDD 2AYWA 2ZHFH 3QK1A 5EPYA 1NU9A 1NN6A 1ZJDA 2P16A 4FUHA 4D8NA 6ESTA 2QXIA 3W94A 1ETRH 2J2UA 4CRCA 1C1OA 4ZHMU 3P8GA 4LZ1H 1N6XA 3GS9A 1F0UA 3ZZ6A 4D9QA 3GICB 2XC0A 3SHAH 3SU6A 2BDCA 3FP8E 1DY8A 1LDTT 1GBKA 1SGCA 1Y3XA 1YLDA 1ANBA 1DWCH 2R0LA 2ZF0H 3QUMP 1KXDA 3I77A 1GI3A 1AUJA 4K8BA 1INCA 1GL1A 2XWAA 3LGUA 1QZ8A 1H8ED 1NFYA 3F2GA 1W7GH 3SU3A 3EQ0H 2ESTE 2FX6A 2BQWB 2STBE 4MTBA 2OTVA 1CBWB 3SUEA 1E35B 1BIOA 1GHAG 1BTHH 1QL9A 4ACAA 2PLXA 4B2CA 3RXFA 4KTUA 5F03A 4MDSA 3QWCH 1NRPH 5EODA 2OC0A 4FU8A 4CBOA 2BY7X 3BTTE 3KQCA 1IHTH 4FXGH 2BD4A 1F0RA 2VWNA 1EFRD 1QRZA 1WQVH 3KHVA 3BTFE 1AO5A 1QB9A 2BYAX 2ZFQH 4XE4A 5FBIA 1KIGH 2BQ6B 1GJ6A 2J98A 3P92A 3U28C 4CREA 2Y82A 2R2WU 4TSFD 1GI9B 1FMGA 1O2IA 2EI7A 2ZHQH 4AFZA 5DSFA 2ZWLH 4DG4A 2C8YB 3PO1B 3VB4A 4ACBA 2FLRH 3LH3A 3HPTB 1YPKH 3RXIA 1SR5C 3RU4E 1C5ZB 4K69A 5LGOA 2Z94A 3S9AA 4UE7H 1E1RD 1ELFA 2CMYA 1HJ9A 2IJD1 3BEUA 5L6NH 3M7UA 1UCYE 3LGWA 5EXLA 3ATKA 5J4QA 1OWDA 2ZDNA 3BG8A 2G5VA 2Q6GA 3PV2A 3F6UH 2J97A 4NIYA 4NIXA 2OBQA 2SNVA 1Z7KA 1W11U 1G2MA 1O5GH 1Z8GA 5JBAS 2O8TA 1FAXA 1EZQA 1GBHA 1ZGVA 1A0HB 1IOEA 4D9RA 2JH5D 3L33A 5EU8A 1GJ5H 2ZDVH 4MPXA 6GCHG 1MKXK 1DICA 1AQ7A 3CNRA 3SUDA 4AB9A 2FOFA 2ILNA 1GI8B 1U6QA 3MU0A 1K9OE 4H6SB 5AFZH 2G4TA 4CRGA 5C94A 2Q1JA 5HM2A 3E90B 3T27A 4RT1A 1A5IA 2O8WA 4Q7XA 2GMTC 3DHKH 1YKTA 1CT2E 5FCKA 1Q3XA 2ZZUH 4MLFB 1YPMH 2R3YA 2C8ZB 3AAVA 4WWYA 3F3BA 1WAYB 2ZQ2A 3VB3A 3DFLA 2P3TB 2JETB 1O2RA 3HK3B 2OP9A 2KAIA 1HFDA 1BTYA 3MWIU 4I7YH 1PYTD 2GCTB 2OINA 1G3BA 1AY6H 1SGTA 4LXBH 1AFQB 1LQDB 3A7VA 4KKDA 2G5NA 1C4Y2 4TPIZ 3M5LA 2KAIB 1GJAB 1WTHD 1HXEH 2BLWA 2F83A 2ZFSA 2FTMA 3RXCA 1BTUA 1C2FA 3LC3A 4AZ2B 3HATH 1TMUH 3NKKA 1HLTH 1HAXB 1Z6JH 2ZHEH 3T5FH 1LHDH 2W6JD 2A4OA 3PMJA 3RC4A 2F9UA 2OBOA 3MTYA 4JYUH 1UTNA 3U8OH 1MAXA 5KGOA 4NIWA 1MTNB 3U69H 2Z9GA 3ZZ4A 5ESTE 4M9FA 1DXPA 1D6RA 1EXFA 3BEIB 1PPGE 1MCTA 1KXCA 4NA9H 2DE9A 4JZFH 2BDHA 2BZAA 1O5BB 3ZVBA 1C1RA 5FPTA 4HFPB 1EPTC 2FOEA 4MNVA 4TWYA 1P0SH 4B2AA 3F2FA 5JB8S 1UTPA 3NWUA 4K2YA 4NZQA 2Z9KA 1JXPA 3P8FA 1C5XB 4ABFA 2HNTC 3VGCC 3SO3A 1KYNA 3FP6E 3MH4A 2BLQA 1C5PA 3EE7A 4VGCC 1EP6A 1NRRH 6CHAC 1QQUA 1MABB 1HUTH 4XBDA 5PTPA 1C4V2 2H9TH 2SNWA 2PKAA 4IGDA 3SU0A 1GHAF 2FIRH 1NFXA 5IYTA 5AF9H 1AMHA 1L0ZA 1QQ4A 1XKBC 1MZDA 1L1GA 1YPHE 2GZ7A 1RGQA 3OX7U 1ZHMA 2PKAB 2ZPRA 3HGNA 1VR1H 3HK6B 3KQBA 1YF4A 1ETSH 2TGTA 1RIWC 1L1NA 2CN0H 3D23A 1NFWA 3SQHE 3WW7A 4Z6AH 1VITF 1OP2A 2XWBI 3MH5A 1HIAB 3F0OA 2XRCA 1CQQA 1O3AA 2A2XH 3EDXB 1D3PB 3RXAA 1HAGE 1Y3WA 3RU4D 3SBKA 4KGAA 2ZGHA 1HYLA 2BDBA 1P2JA 2R0KA 1MD8A 1AWFH 4NA8A 4UFGH 2ZHDA 1D4PB 1J16A 1GBBA 2XCNA 5C1XA 3SV9A 2JETC 1G3DA 2GCHF 2GV7A 1QA7A 1UTMA 2BD9A 4I33A 3NK8A 4MQAA 1GI4A 2D8WA 3B8JA 1O0DH 1C1PA 1ZRBA 1SOTA 1QBOA 2UUFB 3FZDA 2A5AA 3OYPA 1NZQH 1CT0E 4TY6A 1Y3UA 3SW2B 4LOYH 2CK3D 1JBUH 1KXFA 4I32A 1GJDB 3FZZA 3DFJA 1C2IA 1MU8B 2D26C 3NZIA 1DSUA 4K1TA 1BRAA 1VZQH 2G52A 9ESTA 5FPSA 2Z9IA 1FY4A 1VCQA 1W0KD 1GPZA 4XSKU 2FS8A 4A92A 1KMHB 5CDFE 5HIZA 1BHXB 5AFYH 2CF8H 2Z3CA 4K8YA 3P8OA 1IQIA 2G81E 1C1WH 3K6YA 3R3GB 4Y0ZE 1DM4B 2BB4A 2TGDA 1K1NA 1NROH 1ZLRA 2B9LA 2QYIA 2TPIZ 5FX5A 2XC5A 1CA0C 3RUOA 3TGIE 3PLKA 2PTCE 3T28A 4FUGA 3ZVDA 1K1OA 2K1QA 1SLVB 1BOQA 4INLA 4DT7B 2AMQA 2A45B 2VB0A 2HGTH 3ZYDA 1V2VT 2BDGA 1J17T 2BMGB 2BX3A 3A86A 3A8DA 4MNYA 3Q3KA 1EOJA 2D1JA 1O3OA 3VGCB 4TPYA 1C2DA 4IC6A 3TNSA 3AW0A 3T62A 1PPEE 1J14A 2B5TB 5AVDA 1ORFA 1QRWA 2EY4C 3ZZ5A 3ATLA 1TIOA 2OXSA 5LPFA 1PQ5A 2W3KA 3BEFB 2TRMA 1C5UA 2KR7A 2W6ID 1RTFB 3P95A 1A1RA 2VH6A 1GG6C 4A5TS 3U1JB 3A7TA 1C5YB 3UOUA 1BMMH 3F9GA 1ZHRA 3EA9A 1DSTA 2GD4B 1T8LA 1GHBG 2QAAA 1A4WH 5TCCA 4Y0YE 1VJ9U 1DWBH 4D76A 1S5SA 1AB9B 4ZXYH 1XKAC 3BG4C 3MNBA 1GDQA 2STAE 4AG2A 5EXMA 1FAKH 2IPQX 3KQ5A 1CE5A 1NY22 4BTUB 2AS9A 1DLKB 1ZPCA 2Q6FA 2ODPA 3O8DA 2A7HA 4DCDA 1ZPBA 2KCYA 3UQVA 3UWIA 1GMDG 3V13A 4K60A 6LPRA 5G4BA 4X2XA 1OX1A 1EB1H 2JIZD 1TYNA 3T2NA 4ABDA 1C9PA 3RXSA 3VB5A 1HAZB 1SI5H 2HNTF 1GMHG 1SVPA 5F6MA 2ZU3A 1O38A 1SOZA 2A5IA 3ODDA 3SJ9A 2XW9A 3GY4A 1O5AB 1S82A 4O97A 1O2HA 4IW4E 1BTZA 1O33A 3OY6U 3T26A 4U2WA 2GDEH 2V3OH 1P9SA 1A5GH 1GL0E 2A7JA 1PFXC 1KLTA 1GHWH 4Y79A 5C20A 4HI3A 1PPBH 1T8MA 1C1MA 4J2YB 2FOGA 4SGAE 1E37B 1WDIA 3PRDA 2A31A 1JIRA 3GCTF 3FANA 2KCAA 1LVOA 1O37A 3GCNA 2BTCE 4ABEA 2HOBA 4AGKA 3N7DA 3O8CA 1QA0A 4Y8YA 4WH8A 1NRSH 1MTSA 1N8OB 3ZVFA 1HAIH 1XUGA 1PPZA 3E8LA 3SJOA 1EAIA 2QXJA 1O5CB 1BB0B 4ZKSU 4NSYA 3TVJB 3DD2H 4MG3A 4ZKOU 4E7RG 1C2JA 4AFQA 1FIWA 1O30A 4F49A 1TONA 1EB2A 4J1YA 3QZQA 4GVUA 1HCGA 1ZGIA 4H6TA 1N8OC 4Y7BA 1F0SA 2BM2A 1P57B 1K1PA 1C1NA 1BQYA 4IN2A 1C5SA 1VITH 1BMNH 5EOKA 4ZXXH 4X6NA 3KF2A 2QXHA 3VXFH 4X2YA 3OU0A 2BOHB 2P3UB 1GJCB 1LHFH 5DP4A 1TNKA 3TITA 2QF5A 2PGQB 3SV6A 3MU1A 2HALA 2OC7A 1Z8RA 3PV5A 3PMBB 3F68H 5DPAA 2PUQH 3D49H 3TJOA 1HBTH 1FXYA 1NU7B 5KEDA 1BCUH 1D3QB 4ASHA 1HJAC 2PV9B 3TGKE 3RMMH 4NG9H 2C4FH 1DDJA 2VWOA 4ZCNA 1NC6A 3V0XA 3GY6A 4UDWH 1AE8H 4WMFA 1G9IE 2F3CE 4INHA 2Q6DA 3BTQE 1EZUC 4H42U 2M5TA 3LKWA 1ELEE 4XOJA 4Q80A 1SGEE 4MPWA 1EQ9A 1QJ6B 2PKSB 2UUJB 2V7QD 2Y80A 3AW1A 2HRVA 5HGGA 1QCPA 1YCPM 2G55A 4ISOA 2GCTC 2VVVA 1Z71A 1H8IH 1LCYA 3UNRA 3O8BA 5GCHF 1UK2A 2R2MB 4YOJA 2EEKA 3F9HA 2ZU1A 1EAXA 1T7CA 2ALVA 1UHBB 2BDIA 4NWLA 1A7SA 1G2LA 1GHVH 2P95A 3PWCA 1DOJA 1P06A 1WQSA 1B0EA 3BIUH 3PO1C 1NO9H 1DANH 3AASA 4X1NU 5C1YA 1P09A 3SHCH 2WV5A 1SG8B 1K21H 1ZHPA 3ZVCA 2H5CA 1TGSZ 2ZU4A 1YCPH 3ZZCA 1O3NA 2C90B 4IMZA 2J92A 4TT3D 2SGFE 1O2LA 2QF3A 5T3HA 1LVYA 1GI2A 2ZCLP 1UCYK 4FUIA 3M7TA 1O36A 1DY9A 4CR9A 8LPRA 1TLDA 2NU3E 3URDA 5SGAE 1C2GA 3NRLA 1DLEA 1MTVA 3KEEA 1CVWH 4FOUC 1NESE 1RTKA 3S9BA 5A8ZA 2P8OB 4YESB 3UPEA 4U32A 3EYDA 3SNAA 5IDKA 3PB1E 3PTNA 1IQJA 1O3CA 1OYTH 3G01A 4H4FA 1YPJH 2CXVA 3Q76A 1RIWB 4DVAU 4BXWA 5E2PA 3SNCA 1FUJA 3H09A 3M5NA 2WPIS 4A1VA 2BOKA 5LH8A 1MQ6A 1XVOA 1Z8IB 4JZ1A 2HLCA 1B0FA 1IQKA 2TGPZ 1O2NA 3JZ1B 5FL7D 3TH3H 3F0PA 3E1XB 1TPOA 4IC5A 5EJZA 3RXGA 5EQSA 1TGTA 2Z7FE 4BANB 2FZZA 3TJNA 2J98B 1QHRB 4X2VA 1MBMA 1YC0A 4O3TA 1NM6A 3PTBA 2Z9LA 1GMCF 1TALA 2WUCA 3A7ZA 3UWJH 2BVSH 1O3PB 1EP5A 1HAPH 1K0HA 2I6SA 3URCA 3H5CB 1XVMA 2QIQA 1F92A 1TNIA 3SOSA 2RA3A 3SV2H 3QTOH 2BX4A 3WWFA 3M3TA 3NUMA 5CHAC 8GCHF 1SB1H 5FXLA 1L4DA 2FS9A 2BDAA 3U8RH 5DN6D 2BDYA 2TGAA 1HPGA 1V2QT 4OS6A 3P17H 3E0PB 1ZMNA 1GI0A 1GHZA 1GJ4H 2AERH 3RXVA 1TNHA 3RXQA 1TQ7B 5EQRA 1UTQA 4JZEH 1GBMA 5TJXA 1JMOH 4X6OA 5JPMH 3ZZAA 3KL6A 3LGIA 1P02A 3MO3A 4WH6A 2JH0D 3KQEA 2QV1A 5GXPA 3QGNB 1TNJA 3TNTA 1C5LH 8KME2 2A32A 1T8OA 1A0LA 2RDLA 4X8SH 4P02A 2GMTB 3ZIAD 3RXOA 3F1SB 1BMFD 1KLJH 3A80A 1MUEB 1A3BH 1WUNH 3C27B 1V2KT 5FAHA 4BAMB 1WSSH 3ZYEA 1FY1A 2XYAA 3OSYA 2BY5X 3OTJE 1WV7H 3P8NA 5I25A 2QXGA 3KYGA 2GJGA 4FUDA 1XMNB 4MNWA 4R0IA 3M36A 3V3MA 3CS0A 3KYFA 4ABBA 2XOKD 2FEQH 3Q3XA 2FMJA 1XX9A 5LPRA 2OQ5A 5EGMA 2NU1E 1NT1A 3BTME 3L6PA 1AE5A 2BLVA 3F9EA 2WINI 2VGCB 1BRUP 1ACBE 1FQ3A 5GDSH 2VIWA 2ZFPH 1MBQA 3LT3A 1MCVA 2ZGXH 2ULLA 1GBFA 1TX8A 4AFUA 1DFPA 3GY8A 3A8CA 1LVMA 4NFFA 1JRSA 2XBXA 2EI8A 4U30A 1CT4E 5HIYA 3WY8A 1BHXF 2FDAA 2UWOA 1CA8B 3TGJE 5DP7A 4FUEA 4JCNA 1ELBA 1P04A 2VIQA 1QNJA 1W8BH 4HGCA 1SFQB 4ISNA 2V6NA 4F4OC 3C1KA 3UREA 5BRRE 3PMAB 2RCEA 4AFSA 1LHGH 4FUJA 3LOXA 1OWKA 4I8HA 4K1SA 4ZHLU 4A1TA 4NA7A 4SGBE 1O3IA 4ZAEA 5L30H 4X1QU 3UIRA 1T4VH 1H9LB 1MZAA 3I29A 1ELAA 1GCDA 1RRKA 2HLDD 2ZPQA 5F8ZA 1V3XA 4FU7A 1OWEA 5C5NA 3KGPA 2ZO3H 1UTJA 1QB1A 3SU2A 1GBTA 1MD7A 4UEHH 1C2HA 1YYY1 3A82A 1UTKA 1SPJA 1O3EA 2J9NA 1TGCA 1V2UT 2FO9A 3A8AA 2VIOA 1GBDA 1QB6A 1SL3A 2EC9H 1GHYH 1SGFA 1MKXH 2FOHA 2AIPA 1TA6A 4Y8XA 1TB6H 3K6ZA 5CMXH 3AAUA 1O5FH 3H7OA 1X7AC 1W0YH 1RXPA 1BBRK 5DG6A 3MI4A 2UWLA 4M7GA 1RD3B 2HNTE 2OC1A 2FOCA 2OLGA 2OK5A 1HAHH 1KLIH 1G37A 4OS7A 3LIWA 1BMAA 1OP0A 1TNLA 2G51A 3RXPA 3T29A 3SYJA 2FTLE 2OD3B 1AKSB 1OOKB 5A2MH 1SGIB 4Y6DA 5T6GA 3RXBA 1K22H 1T32A 3QDZB 1V2NT 1AGJA 3RXRA 1L2EA 2VIDA 5EXNA 2SGAA 1WYKA 1S6LA 1QL8A 1V2OT 2XCFA 2G00A 1DX5M 3ZV8A 3LJJA 3IWMA 5DJ7A 5FCRA 2I6QA 1WBGB 1F2SE 3ESTA 1TPAE 3P6ZB 4O9VA 2Z9JA 4X1SU 4LK4A 4X0WU 3EA8A 2GDDA 2P93A 2LPRA 3LPRA 2ANKH 3BIVH 1EJAA 1YLCA 3MO6A 2A2QH 1BRCE 1H4WA 2VNTA 1O5EH 3ZZDA 1YPHC 3UFAA 3BTHE 3Q00A 1P01A 1YY3A 2VU8E 4A6LA 1ANCA 1E34B 1EJNA 2VJ1A 1AN1E 1BUIA 5H4IB 2BXTH 1Y3VA 3QGJA 1SGNE 3OFND 2ZGBH 4NFEA 4OS4A 1UVTH 2J5UA 4UFDH 1ANEA 1TA2A 3DSGA 1CU1A 3FVFB 3QTVH 1ABJH 2V3MA 2EQNA 1O34A 3SI3H 1P3EA 1XUIA 3SUGA 1IAUA 2F9BH 3A89A 1DS2E 4GPGA 1GHBF 4I31A 1ELTA 3QLPH 1NBMD 3SJKA 3VFEA 3FFGA 4DW2U 4BAKB 1SQTA 1KXEA 1W3CA 2UWPA 3RXKA 1IQGA 2LNCA 1YBWA 1V2PT 1C5QA 4Q2KA 3UNQA 4RI0A 4IS5A 4YT7H 1VITG 1ETTH 1PJPA 1GMHF 2DUCA 2SGPE 1GVLA 1MTUA 4E05H 3VB7A 3TK5A 1O2WA 1AWHB 3RM2H 1SFIA 3FOAA 1AVWA 4VGCB 1NRQH 1UTOA 4BTIB 4ISIH 2FODA 5FPYA 2FLBH 2FOBA 4DGJA 2ZTXA 3SUFA 5C3NA 4FUFA 1DWEH 1AB9C 2PW8H 4X8TH 1P2OA 1Q31A 4Q63A 1NTPA 1W12U 1QFKH 1E36B 2W7SA 3ZVGA 1S6HA 2Y7XA 2B7DH 3A87A 2P8OC 4CRBA 3BN9A 3KCGH 1V6DA 5GPIB 2QGRA 4KTCA 2P59A 3A8BA 4CRFA 4ZH8A 1DXWA 1O5DH 1C1VH 9LPRA 1ZSLA 1GI7B 3EGKH 2FP7B 2K0QA 5T1VA 1P2KA 4CRAA 3RMOH 2O9QA 2PWXA 2GTBA 1P3CA 1V2MT 3M61U 4MPVA 5B6OA 1O3GA 3E0NB 1H8HD 1H1BA 3BTGE 4OGXA 3SZEA 1KDQA 3ITIA 5JYIA 4WJG2 1C5RA 2AH4X 1PQAA 1AFEH 1AU8A 3NXPA 1J15A 5C2ZA 1YPLH 2FI5E 1D6WA 1OS8A 4FETA 1CGJE 2VIPA 2ZTYA 2OCVB 2FX4A 1GI5A 2NU4E 2VWLA 1ELCA 1D3TB 2JKHA 2ZDMA 2WPMS 5EIYA 2QC2A 1AFQC 1AZ8A 3MO9A 1TNGA 2ZU5A 5BPEA 3GOVB 1PPCE 3ZV9A 5J4SA 1LPZB 4LZ4B 1Y5UT 3ZZ9A 1VCPA 3MU4A 1C5WB 1THSH 3A88A 3ELAH 4BTTB 3A81A 1HNEE 3SU5A 1SGYE 1C5OH 1BA8B 1WTGH 4XBCA 3HGPA 1TRYA 4DURA 1O32A 1TMTH 1LVBA 2FPZA 1COWD 2ZQ1A 2H2ZA 3FN8A 3L3TA 2ZFFH 4YO9A 4GCHF 4X1RU 3HKIB 4R8TB 1GBLA 2A1DB 1OSSA 5DKMA 3ZZ8A 2QA9E 2CHAB 1BBRE 2PGBB 4Z0KA 5GCHG 2RFKC 1C1UH 1ZMLA 2BD2A 1O3DA 2LELA 1A61H 1H9IE 1V2JT 4TY7A 1GJ7B 2GZ9A 5ESBA 1GMDF 1P2NA 4K1EA 4AYYB 1WCZA 2VIVA 7LPRA 5F8XA 3W1EA 3OTPA 3GCHC 4INKA 2THFB 1TRMA 3SGAE 3SGQE 2V3HH 3PWBA 1TMBH 1V2LT 5B6LA 2JJ2D 1CHOF 3PV4A 1ELVA 1ZRKA 2XXLA 4JYVH 1OPHB 2BVXH 2QF0A 5GNDA 2ZCHP 3BTDE 1ARBA 2C93B 3A7YA 1TX7A 3MNSA 5E2OA 3TPIZ 4JYTA 2RG3A 1CGHA 3BG4B 4E06H 1EKBB 3CP7A 4GCHG 3Q3YA 1HIAA 1S83A 1DUEA 1BBRH 2BXUH 3O8RA 1O35A 3TJVA 4ZHAA 3V7TA 2JDID 4Y76A 1ZSKA 3SV8A 3RU4T 1LHCH 3M3VA 4JZIA 5GJ4B 2GP9B 3TK9A 1SBWA 4K5ZA 1O2JA 4XBBA 4X8UH 1ELDE 4TYDA 2KCOA 1KTSB 1BITA 1VGCB 3TLOA 2PUXB 2KZ4A 3DUXH 1C1TA 1T8NA 1QBNA 3SNDA 1AKSA 2A4QA 1V2ST 3TK6A 1EPTB 1DUAA 4BAHB 3RXMA 2SGDE 2H9HA 2PHBA 3ZZBA 5C67A 1O3MA 2ZIQH 1YGCH 2F9VA 2L6OA 5TCAA 5C0UA 3UNSA 1S81A 1EZSC 3FKSD 1CO7E 5DK1A 1QR3E 4RKOB 2QY0B 4Y7AA 4B76A 1W2KH 5JBTA 3A7XA 5A8YA 2EA3A 4CHAB 2PSXA 2ASUB 3RLWH 4RN6A 1P10A 1O3HA 1TE0A 1AHTH 5EW1H 3ATWA 2XBVA 1C1SA 4WMDA 4XRNA 1YPEH 3GISB 1D9IA 1L4ZA 3MFJA 4XFQA 5EJLA 4Z1MD 3GYLB 4NIVA 3QX5H 4XDEA 1FN8A 2P94A 1S0RA 1PQ8A 1PPHE 1QURH 3VG8A 4UD9H 1RFNA 3QZRA 3LONA 4YXWD 1NFUA 3VPKA 4NWKA 2KFWA 4ZMAH 2IPHA 3VEQB 1XUKA 1GG6B 2ZC9H 1SMFE 3OEHD 1W13U 2GVFA 1P11E 2AGIX 7KMEH 2SGEE 1FY5A 3SNEA 1P2IA 2Y5FA 2HVXA 1FPCH 4WY3A 1EAWA 1KXBA 3MH7A 4YOIA 1FLEE 1C2KA 3U1IB 1B5GH 3RM0H 5CHAB 1Y3YA 2WV4A 2ZECA 4DT4A 3KN2A 4DOQA 5DP5A 3I78A 2XNIA 3WWBA 1GGDB 1MKWH 2OQUA 2SGQE 3P70B 4YZUA 1F5RA 1O39A 2WPLS 1QY6A 2FXRA 2FOMB 1OKXA 5JBBS 5DO4H 2KCPA 2FM2A 1CHGA 3S9CA 1N1LA 3DSOA 1PYTC 1TGNA 1Q2WA 1GCTC 4X1PU 5ETXA 1NBME 4F55A 5E0GA 7GCHG 3S7KB 3RMNH 3LDXH 4JMYA 2OC8A 1D3DB 3UTUH 4ZKNU 4OM9A 3ATIA 3KNXA 3SJ8A 1P2MA 1SGPE 8ESTE 1IQFA 4I86A 2YMSB 1DVAH 1SLWB 2UUKB 1C5VA 1HAOH 1W10U 1JWTA 2GCHG 2R3UA 1W7XH 1IQEA 3UY9A 2F91A 4ISHH 2ALPA 2YNAA 2F4LA 2IJOB 6CHAB 1ESBA 1O2OA 2W5EA 1ZPZA 2O8LA 1UW7A 3DCLA 2Z3EA 1UVUH 1FX0B 1BTXA 3MU5A 1V2TT 2WHXA 2ZPSA 1UVPA 3SORA 2YOLA 2J95A 4Y8ZA 1T31A 4DY7B 2BD8A 3M3SA 1RTLA 3LU9B 4D7FA 4ASUD 3S7HB 1DE7H 1K1IA 3OE7D 4JK5A 1LKBA 3UR6A 2ZNKH 2BY9X 1K1LA 2CHAC 1BT7A 4FU9A 3M7QA 4HTCH 1XXFA 1YPGH 4A1XA 1O2VA 1QTFA 1GBCA 2GT8A 2GX4A 2Y7ZA 1FPHH 1FN6A 3MU8A 1HGTH 1QJ7B 2PFEA 2A4RA 4O03A 3RXTA 2PSYA 3BTKE 1QJ1B 5IK2D 3FAOA 1O2TA 1EUFA 1GBJA 2BVRH 4I8KA 2WZQA 3UQOA 5E0JA 4YM9A 3RLYH 2B0FA 2FYQA 3GDSA 1TOCB 1H9HE 2W7UA 1BJUA 1MKWK 4PROA 2ODYB 2C3SA 3VXEH 3RXLA 1TBRH 2ZKSA 3IG6B 1O2ZA 3BTEE 4AGJA 3RXHA 4WVPE 3RMLH 1FDPA 2WPDD 4X8VH 5CHBA 1WXRA 1SGQE 1FI8A 4B6EA 4YLUA 2CV3A 1QRXA 1GGDC 2L74A 1UK3A 3DT0H 3NPSA 4B73A 2H9EH 2WYGA 3SU1A 5GWZA 1MMJN 1HV7A 1FIZA 1P9UA 2W3IA 1TGBA 1UVOA 3KIDU 3TU7H 1AVXA 4CRDA 3JZ2B 5E0HA 1F5KU 2F43B 1C5TA 5E8EH 2NU2E 1ESAA 1O2UA 5K7RA 1F5LA 2B8OH 1MTNC 2ZP0H 4ZKRU 3SGBE 2Y5GA 1TWXB 5DP8A 1FNIA 2FESH 1AVGH 1C2MA 1MAYA 2M2AA 5C1UA 1YWUA 1O2GH 4B2BA 3LGVA 3MNXA 4FUCA 1XUFA 3ODFA 3F9FA 2AEIH 2PKSC 2QE7D 2JJ1D 3D65E 1GBAA 1ELGA 1OWIA 2WSSD 4CHAC 1ESTA 2HVYB 2AGGX 1MU6B 3CS7A 2ZDAH 4Q4LA 1LPKB 4B75A 2ZU2A 2C8XB 3Q77A 1BTPA 2FWWA 4Q7ZA 4BAOB 1TOMH 1J8AA 1SGDE 3OAAD 1LQEA 3S69A 1EASA 3SV7A 4CH8B 1C2LA 2O8MA 1EZXC 1S84A 3A7WA 4DJZB 3U8TH 1WOFA 4AORA 4OS2A 2NU0E 4YOGA 1GBIA 4E7NA 4MPUA 3EA7A 2ANMH 1F0TA 4NZLA 1UK4A 5CE1A 4RKJB 3V12A 5HKKD 3GY7A 4ZUHA 3VB6A 2WYJA 3M35A 1OXGA 2FI4E 1ID5H 2J4IA 1PQ7A 4MNXA 3RXEA 7GCHF 1GJ9B 1VCWA 2BD7A 2O8UA 4BOHA 3PMHB 2F9NA 4BAQB 1L1JA 2AMPA 2D2DA 4X6PA 5K0HA 1S6FA 2J94A 4KP0A 3MYWA 1P03A 4UONA 3T25A 1UJ1A 3GCHB 1MTWA 4RSPA 4AN7A 2ANWA 2V35A 2XC4A 1A2CH 3STJA 2LP6A 1FY3A 2VWMA 1GCTB 4CR5A 4OS1A 4B6FA 3W95A 1GDNA 5A8XA 1EATA 1O3KA 1G3EA 1HAVA 2XBWA 5AHGH 1TRNA 2XTTB 4TWWA 2QF4A 3F2HA 4GAWA 1XXDA 2C8WB 3ATMA 4UFFH 5HYOA 5F8TA 1TABE 1SC8U 3RXJA 1Z1IA 2FI3E 5T6FA 1TFXA 3CENA 1GHXH 3MOCA 1XM1A 2GGVB 3LC5A 5EW2H 2EI6A 3KQDA 2W26A 4B71A 4BXSA 2A4GA 1OHHD 4ISLA 5DP9A 4ABHA 1ZR0A 1O3LA 3ZVAA 1G3CA 1ZTKA 4NGAH 1OYQA 3MH6A 1EAUA 1JOUB 2H1UA 4WXVA 1W0JD 3FO8D 1T4UH 1IQMA 1E38B 1ANDA 2WPJS 3UR9A 1LPGB 4F48B 1Z6EA 3LGTA 3SU4A 1XUHA 4Q7YA 1J9CH 1OWJA 3RC5A 1E79D 3RXDA 1GJ8B 1A46H 3UAIC 2Y81A 4O3UA 1GJBB 3ZVEA 1CBWC 2ZDKA 3N7OA 3SNBA 5L2YH 4I8LA 2Y6TA 1WU1A 2GZ8A 3GDVA 3PRBA 4OGYA 4ABIA 5KECA 3BF6H 1K1JA 2VGCC 3TH2H 2VVCA 5I46H 2Z3DA 1SQOA 5A0AE 1E0FD 2DE8A 1GDUA 1SHYA 1SSXA 4WMEA 2BHGA 4XD7D 4YTAA 1O2KA 3H7TA 3LJOA 1A3EH 1RS0A 1C4U2 1G32B 3A83A 1C2EA 5F53A 2K8IA 4CBNA 2VINA 3GY5A 2HPPH 3SI4H 2BY6X 1G36A 1ZTLA 2F9PA 2V0BA 1VKYA 1SLXB 1VGCC 3M5OA 4B1TA 4ABAA 1YP9A 3HKJB 3PM3A 1Y5AT 1BZXE 3MMGA 5A09A 1OP8A 1HJAB 2AHME 1IQNA 2AGEX 1GBEA 4GHQA 2IN2A 2J38A 2VVUA 1P2QA 1QL7A 3ZZ7A 4DIHH 1QIXB 1UHBA 1ZMJA 5GIBA 1ZOMA 4OS5A 2VBCA 1GWAA 4Y10E 1GMCG 1BDAA 1HDTH 1UO6A 2BQ7B 1DITH 2NWNA 2WPHS 4I8GA 4IMQA 4GUXA 1TPPA 3LGYA 1Y5BT 3STIA 3MNCA 1ZJKA 4GLYA 1CHOG 1N6YA 1ABIH 1KSNA 1UVSH 2BD5A 4AB8A 2JH6D 1ZSJA 4K3JA 1O2QA 1OWHA 1AD8H 4WXIA 4WF8A 3E3TA 1BJVA 2ZFTA 5LPEA 1YCPK 4AYVB 1LKAA 1LO6A 2YNBA 5ABWA 2TIOA 2A0QB 2R9PA 3U9AH 3SQEE 3B23B 4B74A 1O3BA 3M5MA 1Y8TA 5DGJA 5A0CA 1ARCA 1CSOE 4YLQH 1FONA 1AZZA 1O2SA 2ODQA 2VH0A 3A85A 3EE0B 1QBVH 1TBZH 4NCYA 3A84A 5T6DA 4P00A 1LHEH 3AK5A 1K1MA 2ZTZA 1KXAA 1K28D 3GCTG 1C9TA 3GY3A 3E16B 1FV9A 1V2WT 3N99A 1C5NH 1SHHB 1O2XA 2AFQB 2RA0A 3QN7A 4ESTE 3E91A 1SQAA 1SQRA 2PTNA 1ZTJA 5JBCS 2QN5T 2BY8X 2H6MA 1BMLA 1TX6A 1TQ0B 1GI6A 4FUBA 1EPTA 2GKVE 3BV9B 3IITA 3K2UA 1FY8E 2XBYA 2ZFRH 4YT6H 1A5HA 2CGAA 5EJ1A 2ZG0H 1CGIE 1AUTC 1G30B 1FJSA 4KTSA 3TH4H 1O2YA 1KTTB 3D62A 2G8TA 2PR3A 1EJMA 3RC6A 1IQLA 2G4UA 1JIMA 1MQ5A 3TIUA 2A7CA 2AMDA 1SLUB 2GV6A 5C17A 3R0FA 1DWDH 1SGRE 3U98H 2IOTA 5HM9A 4HZHA 1O2MA 3DSPA 1AI8H 4RT0A 2BZ6H 2Z6BD 1HJ8A 4BNRA 2SFAA 2KX4A 2OUAA 4AX9H 1ZYOA 1F7ZA 1P12E 3RXUA 4CH2B 1UTLM 1VJAU 1TPSA 4D7GA 4ZROA 1BTWA 1GVZA 1HRTH 2TBSA 3ENSB 2YMSC 3NCLA 3QO6A 3TJUA 1AIXH 4FVBA 4HG6A 4JZDH 1P05A 3AVZA 5C5OA 4ABGA 1JRTA 1NRNH 4GHTA 1TAWA 1GVKB 2RDEA 1W14U 4FVDA 3EAJA 2CF9H 2BD3A 5HXFA 1XUJA 2FYRA 1IHSH 1IQHA 1A0JA 3M37A 1C1QA 1O2PA 5JB9S 1C5MD 1MH0A 1Y59T 3BSQA 3PLPA 1HAYB 3SJIA 7ESTE 1SGFG 1Z8JB 3GYMA 1UCYH 2UUYA 1HAVB 2PP6A 2ZGCA 2KM0A 2ZGJA 4UFEH 4AG1A 3PYHA 2YMSD 3GCOA 1O31A 1V2RT 4Y11E 1EOLA 1EX3A 1RJXB 2F9OA 5FX6A 5HMAA 1NPMA 3GY2A 3PLBA 2ZCKP
chains in the Genus database with same CATH topology
5FHTA 1LTOA 2AIQA 3S0NA 4NSVA 5FBEA 1BRBE 1THRH 2Y5HA 3ZZ3A 1P8VC 3DA9B 4ABJA 3E6PH 1S0QA 4DIIH 2ZHWH 3K9XB 2FOAA 4KELA 4GSOA 3MHWU 3RDZA 3OY5U 2WUBA 5EPNA 2ZDLA 3SZNA 1DT2A 5DP3A 1TBQH 5DP6A 5EG4A 1YM0A 1B7XB 1FZZA 3SN8A 6GCHF 1LMWB 2J34A 3FP7E 4A7IB 1W0ZU 2BLOA 1CA0B 1ZZZA 2ANYA 2ZI2H 2CJIA 1K2I1 2GT7A 2H5DA 2HPQH 1PPFE 3GDUA 3LH1A 5EQQA 1KDQB 1DPOA 1O3JA 3UUZA 1UMAH 4THNH 1THPB 1HB0B 3PROA 4IBLH 2P3FH 4Y71A 2QCYA 1S85A 1KY9A 4QT8C 4IN1A 5L2ZH 1NS3A 1HXFH 2ZA5A 4U01A 3BTWE 3B9FH 4I8JA 3UOPA 3RP2A 8GCHG 2ZEBA 5JDUB 4AOQA 2A5KA 1O3FA 1H8DH 2WPKS 4MVNA 1GI1A 4X2WA 1QGFA 4JK6A 5A0BA 4X6MA 3K65B 1Z1JA 1M9UA 2HWLB 2AYWA 2ZHFH 3QK1A 5EPYA 1NU9A 1NN6A 1ZJDA 2P16A 4FUHA 4D8NA 6ESTA 2QXIA 3W94A 1ETRH 2J2UA 4CRCA 1C1OA 4ZHMU 3P8GA 4LZ1H 1N6XA 1F0UA 3ZZ6A 4D9QA 3GICB 2XC0A 3SHAH 3SU6A 2BDCA 3FP8E 1DY8A 1LDTT 1GBKA 1SGCA 1Y3XA 1YLDA 1ANBA 1DWCH 2R0LA 2ZF0H 3QUMP 1KXDA 3I77A 1GI3A 1AUJA 4K8BA 1INCA 1GL1A 2XWAA 3LGUA 1NFYA 1W7GH 3SU3A 3EQ0H 2ESTE 2FX6A 2BQWB 2STBE 4MTBA 2OTVA 1CBWB 3SUEA 1E35B 1BIOA 1GHAG 1BTHH 1QL9A 2PLXA 4B2CA 3RXFA 4KTUA 5F03A 4MDSA 3QWCH 1NRPH 5EODA 2OC0A 4FU8A 4CBOA 2BY7X 3BTTE 3KQCA 1IHTH 4FXGH 2BD4A 1F0RA 2VWNA 1QRZA 1WQVH 3KHVA 3BTFE 1AO5A 1QB9A 2BYAX 2ZFQH 4XE4A 5FBIA 1KIGH 2BQ6B 1GJ6A 4CREA 3P92A 2Y82A 2R2WU 1GI9B 1FMGA 1O2IA 2EI7A 2ZHQH 4AFZA 2ZWLH 4DG4A 2C8YB 3PO1B 3VB4A 2FLRH 3LH3A 3HPTB 1YPKH 3RXIA 1SR5C 3RU4E 1C5ZB 4K69A 5LGOA 2Z94A 3S9AA 4UE7H 1ELFA 2CMYA 1HJ9A 3BEUA 5L6NH 3M7UA 1UCYE 3LGWA 5EXLA 3ATKA 5J4QA 1OWDA 2ZDNA 3BG8A 2G5VA 2Q6GA 3F6UH 4NIYA 4NIXA 2OBQA 2SNVA 1Z7KA 1W11U 1G2MA 1O5GH 1Z8GA 5JBAS 2O8TA 1FAXA 1EZQA 1GBHA 1ZGVA 1A0HB 1IOEA 4D9RA 2JH5D 3L33A 5EU8A 1GJ5H 2ZDVH 4MPXA 6GCHG 1MKXK 1DICA 1AQ7A 3SUDA 4AB9A 2FOFA 2ILNA 1GI8B 1U6QA 3MU0A 1K9OE 4H6SB 5AFZH 2G4TA 4CRGA 2Q1JA 5HM2A 3E90B 3T27A 1A5IA 2O8WA 4Q7XA 2GMTC 3DHKH 1YKTA 1CT2E 5FCKA 1Q3XA 2ZZUH 4MLFB 1YPMH 2R3YA 2C8ZB 3AAVA 4WWYA 1WAYB 2ZQ2A 3VB3A 3DFLA 2P3TB 2JETB 1O2RA 3HK3B 2OP9A 2KAIA 1HFDA 1BTYA 3MWIU 4I7YH 1PYTD 2GCTB 2OINA 1G3BA 1AY6H 1SGTA 4LXBH 1AFQB 1LQDB 3A7VA 4KKDA 2G5NA 1C4Y2 4TPIZ 3M5LA 2KAIB 1GJAB 1WTHD 1HXEH 2BLWA 2F83A 2ZFSA 2FTMA 3RXCA 1BTUA 1C2FA 3LC3A 4AZ2B 3HATH 1TMUH 3NKKA 1HLTH 1HAXB 1Z6JH 2ZHEH 3T5FH 1LHDH 2A4OA 3PMJA 3RC4A 2F9UA 2OBOA 3MTYA 4JYUH 1UTNA 3U8OH 1MAXA 4NIWA 1MTNB 3U69H 2Z9GA 3ZZ4A 5ESTE 1DXPA 1D6RA 1EXFA 3BEIB 1PPGE 1MCTA 1KXCA 4NA9H 2DE9A 4JZFH 2BDHA 2BZAA 1O5BB 3ZVBA 1C1RA 5FPTA 4HFPB 1EPTC 2FOEA 4MNVA 4TWYA 1P0SH 4B2AA 5JB8S 1UTPA 3NWUA 4K2YA 4NZQA 2Z9KA 1JXPA 3P8FA 1C5XB 4ABFA 2HNTC 3VGCC 3SO3A 1KYNA 3FP6E 3MH4A 2BLQA 1C5PA 4VGCC 6CHAC 1EP6A 1NRRH 1QQUA 1HUTH 4XBDA 5PTPA 1C4V2 2H9TH 2SNWA 2PKAA 4IGDA 3SU0A 1GHAF 2FIRH 1NFXA 5IYTA 5AF9H 1AMHA 1L0ZA 1QQ4A 1XKBC 1MZDA 1L1GA 1YPHE 2GZ7A 1RGQA 3OX7U 1ZHMA 2PKAB 2ZPRA 3HGNA 1VR1H 3HK6B 3KQBA 1YF4A 1ETSH 2TGTA 1RIWC 1L1NA 2CN0H 3D23A 1NFWA 3SQHE 4Z6AH 1VITF 1OP2A 2XWBI 3MH5A 1HIAB 2XRCA 1CQQA 1O3AA 2A2XH 3EDXB 1D3PB 3RXAA 1HAGE 1Y3WA 3RU4D 3SBKA 4KGAA 2ZGHA 1HYLA 2BDBA 1P2JA 2R0KA 1MD8A 1AWFH 4NA8A 4UFGH 2ZHDA 1D4PB 1J16A 1GBBA 2XCNA 5C1XA 3SV9A 2JETC 1G3DA 2GCHF 2GV7A 1QA7A 1UTMA 2BD9A 4I33A 3NK8A 4MQAA 1GI4A 2D8WA 3B8JA 1O0DH 1C1PA 1ZRBA 1SOTA 1QBOA 2UUFB 3FZDA 2A5AA 3OYPA 1NZQH 1CT0E 4TY6A 1Y3UA 3SW2B 4LOYH 1JBUH 1KXFA 4I32A 1GJDB 3FZZA 3DFJA 1C2IA 1MU8B 2D26C 3NZIA 1DSUA 4K1TA 1BRAA 1VZQH 2G52A 9ESTA 5FPSA 2Z9IA 1FY4A 1VCQA 1GPZA 4XSKU 2FS8A 4A92A 1BHXB 5AFYH 2CF8H 2Z3CA 4K8YA 3P8OA 1IQIA 2G81E 1C1WH 3K6YA 3R3GB 4Y0ZE 1DM4B 2BB4A 2TGDA 1K1NA 1NROH 1ZLRA 2B9LA 2QYIA 2TPIZ 5FX5A 2XC5A 1CA0C 3RUOA 3TGIE 3PLKA 2PTCE 3T28A 4FUGA 3ZVDA 1K1OA 2K1QA 1SLVB 1BOQA 4INLA 4DT7B 2AMQA 2A45B 2VB0A 2HGTH 3ZYDA 1V2VT 2BDGA 1J17T 2BMGB 2BX3A 3A86A 3A8DA 4MNYA 3Q3KA 1EOJA 2D1JA 1O3OA 3VGCB 4TPYA 1C2DA 4IC6A 3TNSA 3AW0A 3T62A 1PPEE 1J14A 2B5TB 5AVDA 1ORFA 1QRWA 3ZZ5A 3ATLA 1TIOA 2OXSA 5LPFA 1PQ5A 2W3KA 3BEFB 2TRMA 1C5UA 1RTFB 3P95A 1A1RA 2VH6A 1GG6C 4A5TS 3U1JB 3A7TA 1C5YB 3UOUA 1BMMH 3F9GA 1ZHRA 3EA9A 1DSTA 2GD4B 1T8LA 1GHBG 2QAAA 1A4WH 5TCCA 4Y0YE 1VJ9U 1DWBH 4D76A 1S5SA 1AB9B 4ZXYH 1XKAC 3BG4C 3MNBA 1GDQA 2STAE 4AG2A 5EXMA 1FAKH 1CE5A 1NY22 4BTUB 2AS9A 1DLKB 1ZPCA 2Q6FA 2ODPA 3O8DA 2A7HA 4DCDA 1ZPBA 3UQVA 3UWIA 1GMDG 3V13A 4K60A 6LPRA 5G4BA 4X2XA 1OX1A 1EB1H 1TYNA 3T2NA 4ABDA 1C9PA 3RXSA 3VB5A 1HAZB 1SI5H 2HNTF 1GMHG 1SVPA 5F6MA 2ZU3A 1O38A 1SOZA 2A5IA 3ODDA 3SJ9A 2XW9A 3GY4A 1O5AB 1S82A 4O97A 1O2HA 4IW4E 1BTZA 1O33A 3OY6U 3T26A 4U2WA 2GDEH 2V3OH 1P9SA 1A5GH 1GL0E 2A7JA 1PFXC 1KLTA 1GHWH 4Y79A 5C20A 4HI3A 1PPBH 1T8MA 1C1MA 4J2YB 2FOGA 4SGAE 1E37B 2A31A 1JIRA 3GCTF 3FANA 1LVOA 1O37A 3GCNA 2BTCE 4ABEA 2HOBA 4AGKA 3O8CA 1QA0A 4Y8YA 4WH8A 1NRSH 1MTSA 1N8OB 3ZVFA 1HAIH 1XUGA 1PPZA 3E8LA 3SJOA 1EAIA 2QXJA 1O5CB 1BB0B 4ZKSU 4NSYA 3TVJB 3DD2H 4MG3A 4ZKOU 4E7RG 1C2JA 4AFQA 1FIWA 1O30A 4F49A 1TONA 1EB2A 4J1YA 3QZQA 4GVUA 1HCGA 1ZGIA 4H6TA 1N8OC 4Y7BA 1F0SA 2BM2A 1P57B 1K1PA 1C1NA 1BQYA 4IN2A 1C5SA 1VITH 1BMNH 5EOKA 4ZXXH 4X6NA 3KF2A 2QXHA 3VXFH 4X2YA 3OU0A 2BOHB 2P3UB 1GJCB 1LHFH 5DP4A 1TNKA 3TITA 2PGQB 3SV6A 3MU1A 2HALA 2OC7A 1Z8RA 3PMBB 3F68H 5DPAA 2PUQH 3D49H 3TJOA 1HBTH 1FXYA 1NU7B 1BCUH 1D3QB 4ASHA 1HJAC 2PV9B 3TGKE 3RMMH 4NG9H 2C4FH 1DDJA 2VWOA 1NC6A 3V0XA 3GY6A 4UDWH 1AE8H 4WMFA 1G9IE 2F3CE 4INHA 2Q6DA 3BTQE 1EZUC 4H42U 2M5TA 3LKWA 1ELEE 4XOJA 4Q80A 1SGEE 4MPWA 1EQ9A 1QJ6B 2PKSB 2UUJB 2Y80A 3AW1A 2HRVA 5HGGA 1QCPA 1YCPM 2G55A 4ISOA 2GCTC 2VVVA 1Z71A 1H8IH 1LCYA 3UNRA 3O8BA 5GCHF 1UK2A 2R2MB 4YOJA 2EEKA 3F9HA 2ZU1A 1EAXA 1T7CA 2ALVA 1UHBB 2BDIA 4NWLA 1A7SA 1G2LA 1GHVH 2P95A 3PWCA 1DOJA 1P06A 1WQSA 1B0EA 3BIUH 3PO1C 1NO9H 1DANH 3AASA 4X1NU 5C1YA 1P09A 3SHCH 2WV5A 1SG8B 1K21H 1ZHPA 3ZVCA 2H5CA 1TGSZ 2ZU4A 1YCPH 3ZZCA 1O3NA 2C90B 4IMZA 2J92A 2SGFE 1O2LA 2QF3A 5T3HA 1LVYA 1GI2A 2ZCLP 1UCYK 4FUIA 3M7TA 1O36A 1DY9A 4CR9A 8LPRA 1TLDA 2NU3E 3URDA 5SGAE 1C2GA 1DLEA 1MTVA 3KEEA 1CVWH 1NESE 1RTKA 3S9BA 5A8ZA 2P8OB 4YESB 3UPEA 4U32A 3EYDA 3SNAA 5IDKA 3PB1E 3PTNA 1IQJA 1O3CA 1OYTH 3G01A 4H4FA 1YPJH 2CXVA 3Q76A 1RIWB 4DVAU 4BXWA 5E2PA 3SNCA 1FUJA 3M5NA 2WPIS 4A1VA 2BOKA 5LH8A 1MQ6A 1XVOA 1Z8IB 4JZ1A 2HLCA 1B0FA 1IQKA 2TGPZ 1O2NA 3JZ1B 3TH3H 3E1XB 1TPOA 4IC5A 4BANB 3RXGA 5EQSA 1TGTA 2Z7FE 2FZZA 3TJNA 1QHRB 4X2VA 1MBMA 1YC0A 4O3TA 1NM6A 3PTBA 2Z9LA 1GMCF 1TALA 2WUCA 3A7ZA 3UWJH 2BVSH 1O3PB 1EP5A 1HAPH 2I6SA 3URCA 3H5CB 1XVMA 2QIQA 1F92A 1TNIA 3SOSA 2RA3A 3SV2H 3QTOH 2BX4A 3M3TA 3NUMA 5CHAC 8GCHF 1SB1H 5FXLA 1L4DA 2FS9A 2BDAA 3U8RH 2BDYA 2TGAA 1HPGA 1V2QT 4OS6A 3P17H 3E0PB 1ZMNA 1GI0A 1GHZA 1GJ4H 2AERH 3RXVA 1TNHA 3RXQA 1TQ7B 5EQRA 1UTQA 4JZEH 1GBMA 5TJXA 1JMOH 4X6OA 5JPMH 3ZZAA 3KL6A 3LGIA 1P02A 3MO3A 4WH6A 2JH0D 3KQEA 2QV1A 5GXPA 3QGNB 1TNJA 3TNTA 1C5LH 8KME2 2A32A 1T8OA 1A0LA 2RDLA 4X8SH 2GMTB 3RXOA 3F1SB 1KLJH 3A80A 1MUEB 1A3BH 1WUNH 3C27B 1V2KT 5FAHA 4BAMB 1WSSH 3ZYEA 1FY1A 2XYAA 3OSYA 2BY5X 3OTJE 1WV7H 3P8NA 5I25A 2QXGA 4FUDA 1XMNB 4MNWA 4R0IA 3M36A 3V3MA 3CS0A 4ABBA 2FEQH 3Q3XA 2FMJA 1XX9A 5LPRA 2OQ5A 5EGMA 2NU1E 1NT1A 3BTME 3L6PA 1AE5A 2BLVA 3F9EA 2WINI 2VGCB 1BRUP 1ACBE 1FQ3A 5GDSH 2VIWA 2ZFPH 1MBQA 3LT3A 1MCVA 2ZGXH 2ULLA 1GBFA 1TX8A 4AFUA 1DFPA 3GY8A 3A8CA 1LVMA 4NFFA 1JRSA 2XBXA 2EI8A 4U30A 1CT4E 3WY8A 1BHXF 2FDAA 2UWOA 1CA8B 3TGJE 5DP7A 4FUEA 4JCNA 1ELBA 1P04A 2VIQA 1QNJA 1W8BH 4HGCA 1SFQB 4ISNA 2V6NA 4F4OC 3C1KA 3UREA 5BRRE 3PMAB 2RCEA 4AFSA 1LHGH 4FUJA 3LOXA 1OWKA 4I8HA 4K1SA 4ZHLU 4A1TA 4NA7A 4SGBE 1O3IA 4ZAEA 5L30H 4X1QU 3UIRA 1T4VH 1H9LB 1MZAA 3I29A 1ELAA 1GCDA 1RRKA 2ZPQA 5F8ZA 1V3XA 4FU7A 1OWEA 5C5NA 3KGPA 2ZO3H 1UTJA 1QB1A 3SU2A 1GBTA 1MD7A 4UEHH 1C2HA 1YYY1 3A82A 1UTKA 1SPJA 1O3EA 2J9NA 1TGCA 1V2UT 2FO9A 3A8AA 2VIOA 1GBDA 1QB6A 1SL3A 2EC9H 1GHYH 1SGFA 1MKXH 2FOHA 2AIPA 1TA6A 4Y8XA 1TB6H 3K6ZA 5CMXH 3AAUA 1O5FH 3H7OA 1X7AC 1W0YH 1RXPA 1BBRK 5DG6A 3MI4A 2UWLA 4M7GA 1RD3B 2HNTE 2OC1A 2FOCA 2OLGA 1HAHH 1KLIH