3T27A

Orthorhombic trypsin (bovine) in the presence of betaine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t27A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t27A02
3F9HA 1TLDA 3I78A 2PKSB 1O2PA 1TNHA 1SLWB 1FNIA 2VVCA 1VGCB 1AVWA 2AMDA 2EI6A 1Z6JH 2FLBH 1WYKA 4A1TA 1XUHA 3UR9A 2ZFPH 3TIUA 1TNKA 3SU3A 1RRKA 2LNCA 4TPYA 1SVPA 3RU4E 1GHBF 1C2IA 3ATWA 1HAGE 4AORA 1C9TA 4DY7B 1GL0E 1O2GH 1ZSJA 3L6PA 2GD4B 1VJAU 2BDGA 2VNTA 4CR9A 1ELAA 3T26A 1LHEH 3GY5A 5J4QA 3PYHA 5FBEA 3TJOA 1AZZA 3MI4A 2FOCA 3PO1C 2IJOB 5JPMH 4AGKA 4DCDA 4YT7H 4OGXA 3SUDA 4YLQH 2PWXA 1LTOA 1ZLRA 1Z8IB 3ZZ7A 5DG6A 4B2CA 4CRAA 2GMTC 4SGAE 5GXPA 3RXEA 4LZ1H 5FAHA 1RTLA 2ZDVH 2SGFE 1G9IE 1ZMJA 4UD9H 2QIQA 1CVWH 1K1OA 2RG3A 1P2MA 1EAIA 2HRVA 2FODA 3A7VA 4GCHF 3SNBA 3E16B 3PTBA 5ABWA 4IN2A 4XSKU 1DT2A 3LKWA 2BY5X 1T4UH 3Q76A 3QDZB 4OGYA 2Q6FA 4DW2U 1UO6A 1ZMNA 4MPUA 1J8AA 1ANEA 1MBMA 1C5LH 2D26C 1C5TA 1WOFA 2VWNA 2VWOA 1P06A 4MNVA 5FCKA 3NUMA 4LZ4B 2ZHDA 1DSUA 1ZTLA 3F9GA 3MHWU 4CRGA 1AN1E 3RXCA 1P9UA 5JBCS 2Z9JA 2F9VA 1KXAA 1SGRE 3S9CA 1JBUH 1UTKA 2C4FH 3ESTA 4KKDA 1ABJH 3ZV9A 4KP0A 1GHAF 4X2XA 3RXRA 3OX7U 3KQDA 6LPRA 4ZKOU 1T8NA 4K1TA 3SN8A 5FPYA 1SGEE 2W3IA 3RXDA 3BTDE 1OX1A 2D8WA 1HIAB 4X8TH 1MKWH 4GVUA 4IS5A 5CHAC 1P57B 1GBLA 3DA9B 1NROH 2BHGA 2B0FA 1VR1H 1YP9A 2JKHA 1HLTH 5E0GA 3QUMP 3RXPA 2DUCA 3TNSA 1DPOA 2H1UA 2BTCE 3QZQA 1FZZA 3U1JB 1MTNB 1QRXA 1OP8A 1Z7KA 3LGIA 4JZDH 4TY7A 3ZVEA 1FY5A 2ASUB 3M5NA 1FJSA 3SJ9A 1O3FA 1ZPBA 2ZPSA 3BSQA 1TGSZ 3SGQE 3TK6A 3A7XA 3U69H 4DIHH 1S0QA 3GICB 3QN7A 4HZHA 2AIQA 4X8SH 5FPSA 1AUTC 5DKMA 4B75A 1GMDG 1P11E 3P17H 5GIBA 5FX5A 2TGPZ 2C8WB 1WUNH 1TWXB 1LMWB 3SO3A 1KXFA 1EJNA 3FFGA 3OU0A 3VB4A 1G37A 5GCHF 1GDUA 2H5DA 3SU4A 1TPSA 4KELA 1P03A 2I6SA 2Z94A 4AG1A 2YNBA 2GZ7A 3SV9A 4FU8A 1GHYH 5EW1H 1AHTH 2ZA5A 1P02A 2QXJA 3KN2A 2FMJA 1A7SA 1F92A 1W13U 2VIOA 1SHHB 1T31A 3ITIA 1UVPA 2AFQB 1BA8B 2SNVA 1VITH 1PPHE 4XBCA 4DJZB 3SNCA 2GDDA 1TNJA 3E6PH 2P3UB 5GWZA 2KAIB 3R3GB 2P95A 4YOJA 1OOKB 2XBXA 5EXLA 2ZKSA 4JYTA 2J94A 1CHOF 4ZAEA 1AD8H 2NU1E 2FEQH 3V12A 1YCPM 4WF8A 5J4SA 1LHCH 1W12U 1O2TA 1UTOA 1WU1A 4GUXA 1DY8A 2H6MA 2GCHG 1AVXA 3EQ0H 1BZXE 4J2YB 1AWHB 4H4FA 4YLUA 4ABGA 3NWUA 1HJAB 1O3PB 1WV7H 2PR3A 3UY9A 1UCYK 2BD8A 2PTCE 1OP2A 3K6YA 3ZZDA 1A3BH 1GJ5H 2A4QA 1PQ8A 2CGAA 4RKOB 3A7YA 5JBTA 1UMAH 7GCHF 4B76A 2C8ZB 3UIRA 1EB2A 4BTUB 4D7GA 3FVFB 1BBRK 2FZZA 4X2VA 5JBBS 4ISOA 5HMAA 1XUJA 1BRUP 1HAHH 3T27A 2DE9A 1DSTA 3ZVCA 1SGTA 2VWMA 1GBMA 2GMTB 3LGTA 4CREA 1O3EA 3SU6A 4FUDA 1EOJA 2OC7A 3KIDU 2BY8X 1O2XA 4U32A 8ESTE 4ASHA 3EA7A 3KQCA 2ZZUH 1NRSH 1OWIA 4O3TA 1ELVA 5C5NA 1PPEE 1MU8B 1Z6EA 1CSOE 2GKVE 3AVZA 2SGQE 2I6QA 3MH5A 4BNRA 3RXLA 5FXLA 3TJUA 2BD4A 3BIVH 2PHBA 1KTSB 4WMDA 2O9QA 5EPNA 1A46H 3SBKA 2QCYA 1D6RA 1EZUC 2ZDNA 2OC0A 4WH8A 2XBVA 2ANWA 1AB9C 3RU4D 1O3BA 3DD2H 1C1MA 5EQSA 3TJVA 3AAUA 1P9SA 4Y0ZE 2FI5E 2W3KA 3U9AH 1O2HA 3T62A 3S7HB 2ZGHA 3SGBE 2AGIX 4NFFA 1GHWH 2R3UA 3GCTF 1CGJE 1BTPA 1HNEE 1Y3XA 4Y8XA 1V3XA 1MQ5A 1SGPE 4RSPA 4I8LA 1O3OA 1SGFA 5DP4A 2PLXA 1QBVH 2HLCA 1P12E 4K60A 1GWAA 1KIGH 1LPGB 1LVYA 2QAAA 1UK3A 1MTNC 2ZGCA 1C5RA 2P3FH 1TABE 3RC5A 3SNAA 2G5VA 1GBBA 1O38A 1PPGE 2G00A 3RXVA 1EAUA 3BTKE 4BAMB 1HAOH 1YLDA 3MFJA 1E38B 4FVDA 1NT1A 3KNXA 3B9FH 2UUYA 1X7AC 1C1UH 5FBIA 1D9IA 1FDPA 2J4IA 1NFUA 4NSVA 2KAIA 1O5GH 2ZTZA 4H6TA 2H9EH 1O2IA 1VJ9U 1XXDA 1ABIH 1VZQH 2PGQB 3UREA 4ZMAH 5JDUB 8KME2 2BB4A 4WMEA 6ESTA 1OWHA 2GZ9A 1DVAH 1SC8U 3AAVA 1BBRH 1BTYA 1CT2E 3GDSA 2XWAA 1SGFG 1MD7A 4ABIA 5DJ7A 4D8NA 1W7GH 1EUFA 1QCPA 2ANMH 3A7WA 1YKTA 2G81E 3EA8A 1OYQA 5FCRA 1XX9A 4X1NU 4BAQB 3RMLH 3VGCC 1L1NA 2SGDE 2NU2E 4XE4A 1P2QA 5LPFA 1NRQH 4IC6A 1O35A 4UDWH 1LVOA 1KXDA 4YESB 1E0FD 3S0NA 4NA8A 2F9OA 2XTTB 2PKAA 1O3LA 1KDQA 2Z7FE 4WJG2 3STJA 1FAXA 1FN6A 1O2ZA 4HFPB 1D3DB 1SLVB 4IN1A 4WY3A 5BRRE 1NC6A 1QY6A 3E90B 1QRZA 2GDEH 4YTAA 1MZAA 1H8DH 1LHDH 4MDSA 1O2SA 2B9LA 3HKIB 4OS5A 1TA2A 5FHTA 1LVBA 1O3GA 1ELDE 3AW0A 1BOQA 1HRTH 1ELTA 1QA7A 4AG2A 2WUBA 1O2WA 1KDQB 2HPPH 9ESTA 1SI5H 2JH6D 1V2QT 1TNIA 4IMQA 4DT7B 3RLWH 1O36A 2Y81A 1J16A 4BOHA 1Z1IA 4I31A 3H7OA 1IQIA 3EGKH 3A82A 4D7FA 4X6PA 3V3MA 1HCGA 6GCHF 1MAYA 4FUGA 1EJAA 1SGDE 3GISB 1XVMA 1YPHC 2XC0A 4MLFB 1UVSH 4XFQA 3A87A 3OTJE 1HGTH 2Z3DA 5GPIB 5GCHG 3LC5A 1GMHF 2AEIH 1W11U 1QBOA 1VITG 2ANYA 3C27B 4E7NA 3U98H 3SJOA 2J38A 4B2BA 1DWBH 1KSNA 1SQTA 1TYNA 4BTIB 1LPKB 3KL6A 2WV4A 2Y80A 2BDCA 4GSOA 2ZPQA 5L2ZH 1C5SA 1SB1H 4ISNA 1BHXF 5C5OA 2BDBA 3LGUA 2V6NA 4Q7YA 2G8TA 4Z0KA 4UFDH 5HXFA 3RXUA 3P6ZB 1N6YA 5EXMA 2OC1A 1THPB 1TQ7B 1SSXA 4B1TA 1UCYE 1FV9A 3PMJA 2FOMB 1O32A 4AGJA 3AASA 4WVPE 5IYTA 2GX4A 3VB7A 1P0SH 5E0HA 4MPWA 1LKAA 2Y7ZA 3E1XB 2SNWA 5C1YA 2ODQA 4KTUA 1AVGH 2UWLA 3SUFA 4Q2KA 2ZCKP 1Q3XA 2BQ7B 1G3CA 1BJVA 3PTNA 1HAPH 4K1EA 3ZVBA 5B6OA 1Y3YA 4NZQA 1BDAA 1SOTA 1G3BA 1CT0E 2ZDKA 1TPAE 4O03A 1DICA 5A8ZA 3GCHC 1O5BB 4NIWA 1ID5H 4D9QA 1OWJA 3A8BA 1SGNE 1DUAA 1Z8JB 4NIXA 1LQDB 1GHBG 2FWWA 3F9EA 5DGJA 1H9LB 1C5UA 2GV7A 4HGCA 2ZCLP 1SOZA 1O2JA 2G52A 1ELCA 1UHBB 2TRMA 1GMCF 3SJ8A 1GI9B 4ESTE 1OPHB 1BRCE 1D3TB 2FXRA 3RXJA 4Q80A 1F7ZA 1G32B 1FAKH 1ZHRA 4E7RG 1GJ4H 1RS0A 1W0ZU 1EAWA 4Y79A 2ZU4A 3KCGH 5DP6A 1OWKA 4LK4A 8GCHG 3LJJA 2P8OB 5EPYA 2ZDAH 1K1MA 2P59A 2W5EA 5G4BA 3MH4A 5TCCA 1B0EA 3BG4C 2VVVA 4I33A 2VIWA 5EQRA 2TPIZ 1ZTJA 1GVKB 3MTYA 2OQ5A 1SGCA 4MNYA 1QR3E 1AUJA 3OSYA 5F8TA 1QHRB 4JZ1A 3GY7A 3DT0H 2IOTA 3SORA 3MO6A 2RCEA 1DWEH 1HUTH 1AIXH 2FP7B 3LGWA 2P3TB 1EOLA 3TNTA 2ZIQH 1C1VH 2ANKH 2AS9A 3M37A 3RXHA 3RXFA 4CRDA 4R8TB 4CRCA 2F9UA 2GCTB 1AFEH 4FUHA 2TBSA 3HKJB 2YOLA 4INKA 5F03A 1O3AA 2F9NA 1TGTA 1GCDA 1BUIA 2VWLA 4K8BA 2ZHFH 3BIUH 2P16A 2BXTH 3T25A 2WPKS 4JK6A 3AW1A 4JMYA 5LPEA 2AMQA 3MU5A 1HPGA 4K69A 1GG6B 4THNH 3QX5H 3TH2H 1P3CA 4MNXA 2NU4E 4MPXA 1JRTA 4I8KA 1BBRE 3H5CB 2QY0B 1HFDA 4BANB 1MTWA 2A1DB 2P8OC 4JYVH 4TY6A 1GI1A 2THFB 1UTQA 2ZFQH 2FYRA 1O3MA 4LXBH 2ZP0H 3A81A 5T3HA 1V2LT 1RGQA 1V2PT 1WAYB 3RXQA 1S5SA 2GV6A 1CBWB 1ZGIA 3QTOH 1TOMH 3UNQA 1GI8B 2ZEBA 3HK6B 4ISIH 3RLYH 1YPEH 1BITA 4MQAA 1TRMA 2VIDA 5AF9H 1OWDA 1T7CA 2BX4A 2O8WA 2W26A 2AYWA 1GHAG 2Y6TA 1A2CH 6GCHG 5TCAA 1DDJA 2XRCA 3MNCA 3A7ZA 4IMZA 1VITF 3RXTA 2VGCC 4X1QU 3SNDA 1UTNA 1GMCG 2VGCB 5A09A 5PTPA 2VIPA 2JH0D 3M3VA 3ZVDA 2A45B 3P95A 2FTLE 3RXGA 4Y0YE 3SQEE 4FUEA 5E2PA 1TQ0B 2B5TB 2HPQH 2F3CE 1O2YA 1YPHE 1C5MD 1S6HA 3M3SA 1CU1A 2FTMA 1TBQH 3MOCA 2BQ6B 1CA0C 3ZZ3A 2PTNA 2FI3E 1C5YB 2WPJS 2XNIA 1MD8A 3FP7E 3PV4A 4A1XA 2Q6DA 2ZF0H 2K1QA 3UNRA 3BTWE 1C4U2 5C3NA 3FANA 1PQ5A 3ATLA 1OKXA 3S69A 1CQQA 1XKBC 1S0RA 3C1KA 1NESE 2GT7A 2Z6BD 3UR6A 3ZZ5A 4UFEH 3E8LA 4DIIH 3GCOA 2QYIA 2FOEA 2ZHQH 4ABHA 5LGOA 1K9OE 4CHAC 1YCPK 4ZKNU 2F91A 2NU3E 1V2ST 4X0WU 5GDSH 4U2WA 1Y5BT 1DOJA 1MAXA 2AERH 4IW4E 2PV9B 5CHAB 4GLYA 5JYIA 2ZDMA 1ZRBA 1BTWA 1DE7H 1EZSC 2FO9A 2BM2A 2HNTE 2ZO3H 4BAOB 3V7TA 1TNLA 2O8LA 1YPGH 2VH6A 1MKWK 1ESBA 5EOKA 2GT8A 1TB6H 1A1RA 4IGDA 3FZZA 1MKXK 2VIVA 5ESBA 1IQFA 1Y59T 3RXBA 5HM9A 1S84A 3RM0H 1SR5C 2QC2A 3ENSB 4NIVA 2Y5HA 1SPJA 4NG9H 1N1LA 3UFAA 4ABAA 4Y7BA 1IHTH 1EZXC 1ORFA 1G3DA 1ZRKA 3K65B 3GCNA 2Z9GA 1J15A 1T8LA 3VB3A 1O2RA 1SQAA 4NA7A 2NU0E 5AVDA 2A0QB 1WTHD 1C5PA 1PQ7A 1FQ3A 3U8OH 1DLEA 1S81A 3MMGA 1FY8E 5AHGH 4ABJA 3MH7A 2A31A 3PROA 3RU4T 1C2EA 2ZFRH 2W7UA 3U1IB 2VU8E 1SG8B 1TPPA 3LIWA 3PLBA 3A88A 3E0PB 1YPKH 1GJ8B 1HIAA 5K0HA 1C4Y2 1LPZB 3P8OA 3K6ZA 3TK5A 1JWTA 3RM2H 1G2MA 4I8GA 1P01A 3M36A 1HAVB 1D3QB 1JOUB 5DO4H 1DWCH 2QF0A 3KQBA 4A5TS 2AGEX 3NZIA 3DFLA 3D23A 2FDAA 1GJDB 3K2UA 5I46H 1C4V2 2ZFSA 8GCHF 3M7TA 3OY5U 3ZZ9A 1LHGH 3O8CA 1Y8TA 1FY1A 1SQOA 3SW2B 1O2MA 3LU9B 2GP9B 2XYAA 4BXSA 1RJXB 1SLUB 2H9HA 2J2UA 2TGTA 1O2UA 4ZHAA 1GBFA 2UUFB 4OS7A 3K9XB 2PUQH 3B8JA 1XUKA 3MWIU 1UK4A 2WYGA 2FOHA 4NFEA 1T32A 1SFIA 1JIMA 1BRBE 1TGCA 2VB0A 1W14U 3FZDA 1W2KH 1MH0A 4CH8B 3QWCH 1Y3UA 4K1SA 2XBWA 3QZRA 1C5WB 1LQEA 2R9PA 3RMMH 2GZ8A 2UWOA 3PWBA 4H6SB 1EKBB 1FN8A 2H5CA 3CS7A 1P8VC 3LC3A 1TRYA 1TRNA 2QA9E 2HNTF 5CMXH 5A8YA 1O37A 2GCTC 1TE0A 2CMYA 2FPZA 1A4WH 3A80A 4AFUA 2TGAA 4X8VH 4BAHB 4AB8A 3TGIE 1QQUA 2OQUA 2EEKA 4Y11E 4UFFH 5L30H 2A7CA 3GY3A 1C2HA 1WSSH 1YGCH 2FOBA 1IQEA 1C5XB 2OXSA 1PYTC 1EP5A 2GCHF 2PKAB 2G4TA 2IPHA 3I77A 3ZYEA 1MTSA 1CGIE 2OCVB 1GI7B 1VCQA 3LOXA 4K3JA 1DY9A 4ISHH 3PMHB 2STAE 2OBOA 1LKBA 3MU8A 2B7DH 1L0ZA 1SLXB 1UTPA 3SJKA 1W7XH 1YPMH 1C1PA 4K5ZA 1ZTKA 1OS8A 3ODDA 3QGJA 1TX7A 2BDAA 3PM3A 4KGAA 1IQGA 4UE7H 4MVNA 3RUOA 3A85A 1MCTA 3TU7H 1TPOA 1INCA 1DS2E 1ESTA 1O39A 3Q3YA 4WXVA 1O2NA 5A2MH 1QL7A 5AFYH 2FX6A 1A61H 3RXMA 1TFXA 2TGDA 3I29A 1ZZZA 5HGGA 2FS9A 3BEUA 3U8RH 1GBTA 1BT7A 3Q3XA 4CHAB 4FUBA 5CE1A 1GCTC 1QBNA 2JETB 4UEHH 4CRBA 1BRAA 3UPEA 4O3UA 1MZDA 1O5CB 2A32A 1NY22 3ZZ4A 1O2KA 1ZGVA 1L4DA 4JZFH 3GCHB 4O9VA 2Z9IA 3SU1A 4ZHMU 2Z9KA 1HYLA 1ZJDA 3SI3H 4GHQA 2CN0H 3VGCB 1IQJA 1L1JA 1SL3A 3WY8A 7LPRA 1YBWA 3T5FH 1AWFH 2SFAA 1K1PA 1ZHPA 1K1IA 1T8OA 1ANBA 1QJ1B 1GDNA 1D4PB 2OLGA 1V2KT 3HGPA 4ZKRU 3BTME 1MU6B 3PMAB 4IBLH 4Q7XA 1AFQB 3ZZBA 2C3SA 1L2EA 7KMEH 1B5GH 1OYTH 2V3OH 2F9BH 5TJXA 1Z71A 1SBWA 3M7UA 4WWYA 1BTUA 5HYOA 2PSXA 1FI8A 3ATMA 1O3HA 1JRSA 4TWYA 3O8BA 4ZUHA 1GJBB 2HNTC 1GJ7B 1ANCA 1UVUH 3SZNA 4TWWA 2ZECA 3A89A 3Q77A 1A0JA 2J9NA 5JBAS 2D2DA 1V6DA 3URCA 4B73A 3LDXH 1V2OT 3P8GA 4ABEA 4DGJA 2P93A 3VFEA 1B7XB 1C5VA 1V2WT 2A7JA 1GJ9B 4X2WA 1JMOH 3RXAA 3PLPA 3TJNA 2HWLB 5E0JA 1Y5UT 1HAZB 4Y76A 1TALA 3UTUH 1AO5A 1GI5A 4UFGH 1GVZA 1KXCA 1GGDC 2A7HA 4A1VA 3SV6A 1WQVH 2H9TH 3PB1E 1LHFH 5C67A 4AOQA 5I25A 4XBBA 1F0SA 1ZOMA 1AB9B 1EJMA 5IDKA 4U30A 1V2MT 1QIXB 3GDVA 1ARCA 1F2SE 1P09A 2R2WU 1NS3A 3SQHE 2OD3B 2J95A 2WINI 3TK9A 1ELBA 1H9IE 1EPTC 5DP7A 3SGAE 2CJIA 3LPRA 1BMLA 5EU8A 4ZH8A 3W95A 4Y10E 3MO9A 1O31A 1O5AB 4CH2B 1E34B 2XXLA 4FUFA 2R2MB 2FOFA 3A8CA 3BTHE 5C2ZA 1GMDF 2ZFTA 3MYWA 4JK5A 2HOBA 2A4OA 3MNSA 3LGVA 1BQYA 4AZ2B 2OBQA 1UTLM 3RP2A 4VGCC 1QTFA 3RXKA 1NPMA 3UQVA 4AFZA 1DUEA 1CBWC 5ESTE 4B74A 1U6QA 1ETRH 2ZNKH 1TIOA 2BLWA 3E91A 4PROA 1LVMA 3P8FA 3UOUA 5JB9S 1K28D 1AI8H 1NFYA 4YZUA 3LT3A 1NRNH 5E2OA 3EDXB 4AYVB 2C90B 1K21H 1HJ8A 2QXIA 1XXFA 3MU1A 2QGRA 1TAWA 2VINA 4B71A 3P8NA 2GGVB 4Q7ZA 2XCNA 3PLKA 1NRRH 1XUGA 4MNWA 4BTTB 1AKSA 2BD3A 3M3TA 2RDLA 1HV7A 3S9AA 2BY9X 1K22H 4I32A 1HXEH 4AB9A 1O30A 1GPZA 3RC6A 3RXOA 3BF6H 3NK8A 3M5MA 2ZTYA 2ZHEH 4IC5A 1FIWA 2G4UA 2ZGXH 1C5NH 1MQ6A 1KXBA 3IG6B 1FPCH 4GPGA 1C1OA 1EPTB 1XM1A 3MNXA 1BIOA 1SFQB 1PFXC 3BG8A 3BTEE 1NFXA 1XMNB 1YF4A 4X1SU 1FUJA 1YM0A 4NSYA 2XW9A 1F0RA 2OUAA 2PSYA 1DANH 4HI3A 2C8XB 1PPBH 4INHA 1BJUA 3KGPA 2BOKA 5FX6A 1PQAA 1A0HB 1K2I1 1WTGH 1S82A 3LJOA 2ZGJA 1DLKB 3RXIA 1QL9A 5AFZH 6CHAC 1P2IA 2LPRA 1WQSA 5DP8A 3A83A 1FPHH 1PPFE 1ZHMA 3QK1A 2RA3A 4X2YA 4ZKSU 3NXPA 2GTBA 3F6UH 1QFKH 1TOCB 1BTHH 1EXFA 1MTVA 3CS0A 3HK3B 2G55A 2XCFA 3A8DA 3G01A 2FI4E 3GOVB 1T8MA 1FY3A 2R0KA 1EAXA 1LCYA 1NFWA 4K8YA 2BY6X 2D1JA 4MG3A 1V2TT 1IAUA 1YLCA 4GAWA 1B0FA 1TBRH 2ZU3A 1J9CH 1IQKA 1P2OA 4WMFA 3ZV8A 1UTJA 1G3EA 1C5OH 2A4GA 3TH4H 3RMOH 2SGEE 1O3CA 1AE5A 5SGAE 1C2MA 2UUJB 3EYDA 4CBOA 1UHBA 3KQEA 3UUZA 1GBHA 2A2QH 3URDA 2PUXB 3HPTB 1NU9A 1GI2A 1ANDA 4FU7A 1AFQC 3NCLA 1Z8GA 1Q31A 4GHTA 3SHAH 4WH6A 2WPLS 2STBE 1G36A 1MKXH 2A4RA 3UWIA 2ZDLA 3SU0A 2WPHS 4CR5A 2HALA 1NRPH 2BX3A 4NWKA 1TONA 4OS6A 4JZEH 3ZYDA 4AFQA 3LH1A 4ZXYH 1W8BH 3W94A 1NN6A 3PWCA 3D62A 3GY2A 5EODA 1FY4A 4Y71A 4JCNA 2ULLA 4Y8YA 2QV1A 1A3EH 1KY9A 3R0FA 3O8RA 1UCYH 1CGHA 4BAKB 1BHXB 1O3NA 1C9PA 2JH5D 4YOIA 3SV7A 4BXWA 1O2LA 3BEFB 1IQNA 1TGNA 1P2KA 4OS1A 4B2AA 2H2ZA 4WXIA 2AGGX 2C93B 1QNJA 1MMJN 1GBJA 4OS2A 3FP8E 1LO6A 5HM2A 1P05A 1GBEA 1RIWB 2NWNA 3MU4A 4ABBA 5L6NH 2O8MA 3L33A 5DP5A 1AU8A 1C1NA 1HB0B 2ALPA 1GJAB 1T4VH 1IQMA 2QN5T 1V2NT 2EC9H 3QGNB 4YO9A 1V2VT 3UNSA 2F9PA 2V3HH 2AH4X 4Z6AH 1C5QA 3ZZ6A 2R0LA 3OY6U 3S9BA 4MPVA 1GI4A 1C1WH 1DXPA 2ZGBH 2ZU5A 1A5GH 3OYPA 1KXEA 1W3CA 3Q00A 1EZQA 1H4WA 4FUJA 2V0BA 2FLRH 1S85A 3QO6A 1AZ8A 2XC5A 1IHSH 2ODYB 2F83A 4NA9H 2SGPE 2PFEA 1OP0A 3BG4B 1DXWA 1F5RA 3M61U 1NO9H 1A5IA 1ETSH 1G2LA 2YNAA 4E05H 3ZVGA 1SGYE 1C2KA 1GJ6A 2GVFA 1TMTH 4X1PU 4SGBE 3TH3H 3MO3A 3SJIA 1O33A 3KF2A 4HTCH 1AQ7A 3TGJE 2UUKB 5F8ZA 2RA0A 3T29A 4K2YA 1NZQH 4ABDA 1BCUH 1CHGA 1QB9A 1MTUA 2OTVA 3A8AA 1Y3WA 4INLA 1E37B 1XUFA 1E36B 5F6MA 3P70B 1GHVH 2OC8A 1QL8A 3BN9A 1KLJH 3S7KB 3A86A 1ARBA 3GY6A 4UONA 1Q2WA 1RTKA 5A0AE 5LH8A 1C2DA 1UVTH 1F5LA 1CO7E 2CHAC 5C20A 7GCHG 1P10A 1TNGA 2FS8A 2XBYA 2SGAA 3ATKA 4X6NA 1JXPA 3NKKA 1GI0A 2ZQ2A 1OWEA 1QURH 4KTCA 2ZTXA 3ZZCA 3KHVA 3M5LA 4M7GA 3SUEA 2OINA 3O8DA 2BMGB 4KTSA 5GJ4B 1G30B 1F0UA 3VB5A 1V2JT 2ZC9H 4CRFA 3MU0A 2WPMS 2BXUH 1GHZA 1TGBA 2CHAB 2JETC 1TA6A 1GHXH 3ELAH 3F9FA 3TGKE 2Z3CA 1K1JA 1ZPZA 1O5FH 1SHYA 3LGYA 1P04A 4ZROA 1O2VA 4I8HA 1E35B 5K7RA 3IITA 2QXHA 1THSH 3E0NB 2BY7X 1F0TA 3BTTE 3F68H 3GCTG 2G5NA 1Z8RA 1FXYA 1O5DH 2AIPA 2FX4A 2BD9A 4XDEA 3ODFA 1TBZH 1EASA 4O97A 1KLIH 1NU7B 1C2GA 4TYDA 2CF9H 3QLPH 2FIRH 3BTFE 4MTBA 1O3IA 2FOGA 3MH6A 1PPCE 4AN7A 1GL1A 1Y5AT 2FYQA 1EQ9A 1BTZA 1F5KU 3A7TA 5ETXA 3UQOA 4E06H 3SU5A 1EX3A 2ZWLH 2A2XH 3BEIB 1C2JA 3VXEH 1NM6A 2BD2A 3SV8A 1RXPA 1V2RT 2BZ6H 1O3DA 1RFNA 5A0CA 3DFJA 3U8TH 1ZMLA 3KEEA 4FXGH 1IOEA 1GI3A 4X1RU 4JZIA 1AY6H 4NWLA 3V13A 1O3JA 5T6GA 3M5OA 4YOGA 1EP6A 3FAOA 2Q1JA 3LH3A 3TVJB 1YCPH 5LPRA 1UVOA 2ESTE 3UWJH 3SNEA 2VIQA 1H9HE 1DX5M 1MUEB 4NGAH 5EW2H 4DOQA 1RIWC 4X6MA 1VGCC 1THRH 1WBGB 1QRWA 2WPIS 2BQWB 2VJ1A 4QT8C 2BDYA 2J34A 2M5TA 4X6OA 3BTQE 1GDQA 2HGTH 1C2LA 1ESAA 4OS4A 3E3TA 3VXFH 5BPEA 3TITA 1QJ6B 1P2JA 2BDHA 2BVSH 3ZZ8A 5A8XA 1BTXA 2BVRH 2CV3A 2Y5FA 1J14A 5H4IB 3H7TA 1OSSA 1HAVA 3M7QA 1H1BA 1QQ4A 5F8XA 1ZSKA 2ALVA 1AMHA 2IN2A 4AYYB 1HAXB 4FUIA 5T6DA 1EATA 1SGQE 3L3TA 1C1QA 4F4OC 1QB1A 1Y3VA 5E8EH 3JZ1B 1N8OC 1O2OA 2BLOA 2PW8H 2ZQ1A 1ELGA 2FOAA 3GYLB 5DP3A 4JYUH 1UJ1A 1D3PB 2BD5A 1KTTB 1YYY1 2ZU2A 1CE5A 1K1NA 2CXVA 1QA0A 1BMAA 3SU2A 3EE0B 4VGCB 1ACBE 1FLEE 2ZG0H 2ZU1A 4Y8ZA 1V2UT 2ODPA 1A5HA 3DHKH 2J92A 4XBDA 2OP9A 4FU9A 3SHCH 1W0YH 4DG4A 1ETTH 1QJ7B 2ILNA 3SI4H 5DP9A 1D6WA 1HAIH 1MCVA 3GY8A 3STIA 1M9UA 1PJPA 4NZLA 1KLTA 1HXFH 4X8UH 3T2NA 2XC4A 1UTMA 3N7OA 2O8TA 4H42U 5DPAA 1UK2A 1GJCB 3A84A 1N8OB 4NIYA 2BD7A 4FUCA 1W10U 1ZPCA 1GBAA 1K1LA 2CF8H 2Y7XA 5T6FA 3TPIZ 2A5IA 1HDTH 1HAYB 9LPRA 3EA9A 1C5ZB 1S6FA 2QF3A 1L4ZA 4U01A 8LPRA 1GBIA 3V0XA 4A7IB 1HJ9A 1XUIA 2O8UA 3JZ2B 1O3KA 1CHOG 3GDUA 3VEQB 3RMNH 1PPZA 6CHAB 1O2QA 1ZR0A 2EA3A 2Z9LA 3HATH 4J1YA 3TLOA 3SOSA 3F1SB 1TX8A 5EG4A 2BOHB 4RKJB 1S83A 1JIRA 4ABFA 3DUXH 3ZVFA 1GBCA 1DITH 2V35A 1CT4E 3GY4A 2A5AA 1VCWA 2ZHWH 2BLQA 1O5EH 1TMBH 1TMUH 4NCYA 2BVXH 2EI7A 3VPKA 1O0DH 4TPIZ 4RN6A 1DWDH 4D9RA 4CBNA 5EXNA 2WV5A 2W7SA 2XWBI 5FPTA 1L1GA 3HGNA 1KYNA 3UOPA 4A6LA 2Z3EA 3PO1B 3ZVAA 1GBDA 2Y5GA 4LOYH 2R3YA 2Q6GA 1HJAC 1ELEE 2AMPA 1P2NA 2A5KA 1P3EA 4DURA 2HVXA 4YT6H 5DK1A 1C1SA 2PGBB 1RD3B 2BDIA 5EGMA 1GGDB 1AKSB 3B23B 1RTFB 4I8JA 3RC4A 1QB6A 3BTGE 1TX6A 4A92A 1H8IH 1GG6C 1IQHA 2WUCA 1FIZA 1EPTA 1GMHG 1GCTB 1ZJKA 3VB6A 3QTVH 1CA8B 3GYMA 2VH0A 3RDZA 3CP7A 4R0IA 5L2YH 3ATIA 1VCPA 2FESH 2P94A 4ISLA 2PKSC 3FP6E 3D65E 1C2FA 4DVAU 5JB8S 1A0LA 4D76A 1EB1H 2QXGA 4XOJA 3BV9B 1Z1JA 1YC0A 1N6XA 4FVBA 1ZYOA 1GI6A 3D49H 1AE8H 2BZAA 1BB0B 2BYAX 4Y6DA 1YPJH 1SMFE 1BMNH 2DE8A 3PMBB 5C1XA 3IWMA 1DM4B 3CENA 1BMMH 2WYJA 2B8OH 4F49A 2VVUA 1GVLA 2BLVA 2ZPRA 1QGFA 1OXGA 3SUGA 2UWPA 7ESTE 4AFSA 3NPSA 1ZSLA 1DFPA 2G51A 1SGIB 1GBKA 1CA0B 4GCHG 1HBTH 1J17T 2EI8A 5C1UA 1IQLA 2ZI2H 5A0BA 2C8YB 3M35A 1O34A 4I7YH 2ZCHP 1PYTD 1ELFA 4ZHLU 1AGJA 2ZFFH 1FONA 3RXSA 1XVOA 1LDTT 3P92A 2TIOA 4ZXXH 1NTPA 2FM2A 4Y7AA 3LONA 5EQQA 3SV2H 1MBQA 1C1TA 3Q3KA 1WCZA 4YM9A 3EAJA 1FMGA 3MNBA 3ZZAA 2Y82A 4AX9H 1XKAC 1YPLH 3T28A 1C1RA
chains in the Genus database with same CATH superfamily
3F9HA 1TLDA 3I78A 2PKSB 1O2PA 1TNHA 2KR7A 3U28C 1SLWB 1FNIA 2VVCA 1VGCB 1AVWA 2AMDA 2EI6A 1Z6JH 2FLBH 1WYKA 4A1TA 1XUHA 3UR9A 2ZFPH 5F53A 3TIUA 1TNKA 3SU3A 1RRKA 2LNCA 4TPYA 1SVPA 3RU4E 1GHBF 2KCOA 1C2IA 3ATWA 1HAGE 4AORA 1C9TA 4DY7B 1GL0E 1O2GH 1ZSJA 3L6PA 2GD4B 1VJAU 2BDGA 2VNTA 4CR9A 1ELAA 3T26A 1LHEH 3GY5A 5J4QA 3PYHA 5FBEA 3TJOA 1H8ED 1AZZA 3F2HA 3MI4A 2FOCA 3PO1C 2IJOB 5JPMH 4AGKA 4DCDA 4YT7H 4OGXA 3SUDA 4YLQH 2PWXA 1LTOA 1ZLRA 1Z8IB 3ZZ7A 5DG6A 4B2CA 4CRAA 2GMTC 4SGAE 5GXPA 3RXEA 4LZ1H 5FAHA 1RTLA 2ZDVH 2SGFE 1G9IE 1ZMJA 4UD9H 2QIQA 1CVWH 1K1OA 2RG3A 1P2MA 1EAIA 2HRVA 2FODA 3KQ5A 3A7VA 4GCHF 3SNBA 3E16B 3PTBA 5ABWA 2GJGA 4IN2A 4XSKU 1DT2A 3LKWA 2BY5X 1T4UH 3Q76A 3QDZB 4OGYA 2Q6FA 4DW2U 1UO6A 1ZMNA 4MPUA 1J8AA 1ANEA 1MBMA 1C5LH 2D26C 1C5TA 1WOFA 2VWNA 2VWOA 1P06A 4MNVA 5FCKA 2WSSD 3NUMA 4LZ4B 2ZHDA 1DSUA 1ZTLA 3F9GA 3MHWU 4CRGA 1AN1E 3RXCA 1P9UA 5JBCS 2Z9JA 2F9VA 1KXAA 1SGRE 3S9CA 1JBUH 1UTKA 2C4FH 3ESTA 4KKDA 1ABJH 3ZV9A 4KP0A 1GHAF 4X2XA 3RXRA 3OX7U 3KQDA 6LPRA 4ZKOU 1T8NA 4K1TA 3SN8A 5FPYA 1SGEE 2W3IA 3RXDA 3BTDE 1OX1A 2D8WA 1HIAB 4X8TH 1MKWH 4GVUA 4IS5A 5CHAC 2OK5A 1P57B 1GBLA 3DA9B 1NROH 5EJ1A 2BHGA 5HIYA 2B0FA 1VR1H 1YP9A 2JKHA 1HLTH 5E0GA 3QUMP 3RXPA 2DUCA 3F0PA 3TNSA 1DPOA 2H1UA 2EY4C 2BTCE 3QZQA 1FZZA 3U1JB 1MTNB 1QRXA 1OP8A 1Z7KA 3LGIA 4JZDH 4TY7A 3ZVEA 1FY5A 2ASUB 3M5NA 1FJSA 3SJ9A 4AC9A 1O3FA 1ZPBA 2ZPSA 3BSQA 1TGSZ 3SGQE 3TK6A 3A7XA 3U69H 4DIHH 1S0QA 3GICB 3QN7A 4HZHA 2AIQA 4X8SH 5FPSA 1AUTC 5DKMA 4B75A 1GMDG 1P11E 3P17H 5GIBA 5FX5A 2TGPZ 2C8WB 1WUNH 1OHHD 1TWXB 1LMWB 3SO3A 1KXFA 1EJNA 3CNRA 3FFGA 3OU0A 3VB4A 1G37A 5GCHF 1GDUA 2H5DA 3SU4A 1TPSA 4KELA 1P03A 2I6SA 2Z94A 4AG1A 2YNBA 2GZ7A 3SV9A 4FU8A 1GHYH 5EW1H 1AHTH 2ZA5A 1P02A 2KM0A 2QXJA 3KN2A 2FMJA 1A7SA 1F92A 1W13U 2KFWA 1SHHB 2VIOA 1T31A 3ITIA 1UVPA 2AFQB 1BA8B 2SNVA 1VITH 1PPHE 4XBCA 3NRLA 4DJZB 3SNCA 2GDDA 1TNJA 3E6PH 2P3UB 5GWZA 2KAIB 3R3GB 2P95A 4YOJA 1OOKB 2XBXA 5EXLA 2ZKSA 3FN8A 4JYTA 2J94A 1CHOF 4ZAEA 1AD8H 2NU1E 2FEQH 3V12A 1YCPM 4WF8A 5J4SA 1LHCH 1W12U 1O2TA 1UTOA 1WU1A 4GUXA 1DY8A 3FO8D 2H6MA 2GCHG 1AVXA 3EQ0H 1BZXE 4J2YB 1COWD 1AWHB 4H4FA 4YLUA 4ABGA 3NWUA 1HJAB 1O3PB 1WV7H 2PR3A 3UY9A 1UCYK 2BD8A 2PTCE 1OP2A 3K6YA 3ZZDA 1A3BH 1GJ5H 2A4QA 2LELA 1PQ8A 2CGAA 4RKOB 3A7YA 5JBTA 1UMAH 7GCHF 4B76A 2C8ZB 3UIRA 1EB2A 4F55A 4BTUB 1YWUA 2WZQA 4D7GA 3FVFB 1BBRK 2FZZA 4X2VA 5JBBS 4ISOA 5HMAA 1XUJA 1BRUP 1HAHH 3T27A 2DE9A 1DSTA 3ZVCA 1SGTA 2VWMA 1GBMA 2GMTB 3LGTA 4CREA 1O3EA 3SU6A 4FUDA 1EOJA 2OC7A 1SQRA 2BY8X 1O2XA 3KIDU 4U32A 8ESTE 4ASHA 3EA7A 3KQCA 2ZZUH 1NRSH 1OWIA 4O3TA 1ELVA 5C5NA 1PPEE 1MU8B 1Z6EA 1CSOE 2GKVE 3AVZA 2SGQE 2I6QA 3OEED 3MH5A 5CHBA 4BNRA 3RXLA 5FXLA 3TJUA 2BD4A 3BIVH 2PHBA 1KTSB 4WMDA 2O9QA 5EPNA 3WW7A 3PRBA 1A46H 3SBKA 2QCYA 1D6RA 1EZUC 2ZDNA 2OC0A 4WH8A 2XNDD 2XBVA 2ANWA 1AB9C 3RU4D 1O3BA 3DD2H 1C1MA 5EQSA 3TJVA 3AAUA 1P9SA 4Y0ZE 2FI5E 2W3KA 3U9AH 1O2HA 3T62A 2J5UA 3S7HB 2ZGHA 3SGBE 1MABB 2AGIX 4NFFA 1GHWH 2R3UA 3GCTF 1CGJE 1BTPA 1HNEE 1Y3XA 4Y8XA 1V3XA 1MQ5A 1SGPE 4OM9A 5FL7D 4RSPA 4I8LA 1O3OA 1SGFA 5DP4A 2PLXA 1QBVH 2HLCA 1P12E 4K60A 5C17A 1GWAA 1KIGH 1LPGB 1LVYA 2QAAA 1UK3A 1MTNC 2ZGCA 1C5RA 2P3FH 1TABE 3RC5A 3SNAA 2G5VA 1GBBA 1O38A 1PPGE 2G00A 3RXVA 1EAUA 3BTKE 5DN6D 4BAMB 1HAOH 1YLDA 3MFJA 1E38B 4FVDA 1NT1A 3KNXA 3B9FH 2UUYA 1X7AC 1C1UH 5FBIA 1D9IA 1FDPA 2J4IA 1NFUA 4NSVA 2KAIA 1O5GH 2ZTZA 4H6TA 2H9EH 1O2IA 1VJ9U 1XXDA 1ABIH 1VZQH 5C0UA 2PGQB 3UREA 4ZMAH 5JDUB 8KME2 2BB4A 4WMEA 6ESTA 1OWHA 2GZ9A 1DVAH 1SC8U 3AAVA 1BBRH 1BTYA 1CT2E 3GDSA 2XWAA 1SGFG 1MD7A 4ABIA 5DJ7A 4D8NA 1W7GH 1EUFA 2J98A 1QCPA 2ANMH 3A7WA 1YKTA 2G81E 3EA8A 1OYQA 2RDEA 5FCRA 1XX9A 4X1NU 4BAQB 3RMLH 3VGCC 5EJZA 1L1NA 2SGDE 2NU2E 4XE4A 1P2QA 5LPFA 1NRQH 4IC6A 1O35A 4UDWH 1LVOA 1KXDA 4YESB 1E0FD 3S0NA 4NA8A 3F0OA 2F9OA 2XTTB 2PKAA 1O3LA 1KDQA 2VBCA 2Z7FE 4WJG2 3STJA 1FAXA 1FN6A 1O2ZA 4HFPB 1D3DB 1SLVB 4IN1A 4WY3A 5BRRE 1NC6A 1QY6A 3E90B 1QRZA 2GDEH 4YTAA 1MZAA 1H8DH 1LHDH 4MDSA 1O2SA 2B9LA 3HKIB 4OS5A 1TA2A 5FHTA 1LVBA 1O3GA 1K0HA 1ELDE 3AW0A 1BOQA 1HRTH 1ELTA 1QA7A 4AG2A 2WUBA 1O2WA 1KDQB 2HPPH 9ESTA 1SI5H 2JH6D 1V2QT 1TNIA 4IMQA 4DT7B 3RLWH 1O36A 2Y81A 1J16A 4BOHA 1Z1IA 4I31A 3H7OA 1IQIA 3EGKH 3A82A 4D7FA 4X6PA 3V3MA 3PRDA 1HCGA 6GCHF 1MAYA 4FUGA 1EJAA 1SGDE 3GISB 1XVMA 1YPHC 2XC0A 4MLFB 1UVSH 4XFQA 3A87A 3OTJE 1HGTH 2Z3DA 5GPIB 5GCHG 3LC5A 1GMHF 2AEIH 1W11U 1QBOA 1VITG 2ANYA 3C27B 4E7NA 3U98H 3SJOA 2J38A 4B2BA 1DWBH 3KYGA 1KSNA 1SQTA 1TYNA 4BTIB 1LPKB 3KL6A 2WV4A 2Y80A 2BDCA 4GSOA 2ZPQA 5L2ZH 1C5SA 1SB1H 4ISNA 1BHXF 5C5OA 2BDBA 3LGUA 2V6NA 4Q7YA 2G8TA 4Z0KA 4UFDH 5HXFA 3RXUA 3P6ZB 1N6YA 5EXMA 2OC1A 1THPB 1TQ7B 1SSXA 4B1TA 1UCYE 4B6FA 2KCAA 1FV9A 3PMJA 2FOMB 1O32A 4AGJA 3AASA 4WVPE 5IYTA 2GX4A 2KZ4A 3VB7A 1P0SH 5E0HA 2V3MA 4MPWA 1LKAA 2Y7ZA 2PP6A 3E1XB 2SNWA 5C1YA 2ODQA 4KTUA 1AVGH 2UWLA 3SUFA 4Q2KA 2ZCKP 3OEHD 1Q3XA 2BQ7B 1G3CA 1BJVA 3PTNA 1HAPH 4K1EA 3ZVBA 5B6OA 1Y3YA 4NZQA 1BDAA 1SOTA 1G3BA 1CT0E 2ZDKA 1TPAE 4O03A 1DICA 5A8ZA 3GCHC 1O5BB 4NIWA 1ID5H 4D9QA 4ACAA 1OWJA 3A8BA 1SGNE 1DUAA 1Z8JB 4NIXA 1LQDB 1GHBG 2FWWA 3F9EA 5DGJA 1H9LB 1C5UA 2GV7A 4HGCA 2ZCLP 1SOZA 2W6ID 1O2JA 2G52A 3SZEA 1ELCA 1UHBB 2TRMA 1GMCF 3SJ8A 1GI9B 4ESTE 1OPHB 1BRCE 1D3TB 2FXRA 3RXJA 4Q80A 1F7ZA 1G32B 1FAKH 1ZHRA 4E7RG 1GJ4H 1RS0A 1W0ZU 1EAWA 4Y79A 2ZU4A 3KCGH 5DP6A 1OWKA 4LK4A 8GCHG 1W0KD 3LJJA 2P8OB 5EPYA 2ZDAH 1K1MA 2P59A 2W5EA 5G4BA 3MH4A 5TCCA 3GS9A 1B0EA 3BG4C 2VVVA 4I33A 2VIWA 5EQRA 2TPIZ 1ZTJA 1GVKB 3MTYA 2OQ5A 1SGCA 4MNYA 1QR3E 5CDFE 1AUJA 3OSYA 5F8TA 1QHRB 4JZ1A 3GY7A 4FETA 3DT0H 2IOTA 3SORA 3MO6A 2RCEA 1DWEH 1HUTH 1AIXH 5KECA 2FP7B 3LGWA 2P3TB 1EOLA 3TNTA 3DCLA 2ZIQH 5HIZA 1C1VH 2ANKH 2AS9A 3M37A 3RXHA 3RXFA 4CRDA 1E1RD 4R8TB 4CRCA 2F9UA 2GCTB 4FOUC 1AFEH 4FUHA 2TBSA 3PV2A 3HKJB 2YOLA 4INKA 5F03A 1O3AA 2F9NA 1TGTA 1GCDA 1BUIA 2VWLA 4K8BA 2ZHFH 2AHME 3BIUH 2P16A 2BXTH 3T25A 2WPKS 4JK6A 3AW1A 4JMYA 5LPEA 2AMQA 3MU5A 1HPGA 4K69A 1GG6B 4THNH 3QX5H 3TH2H 1P3CA 4MNXA 2NU4E 4MPXA 1JRTA 4I8KA 1BBRE 3H5CB 2QY0B 1HFDA 4BANB 1MTWA 2A1DB 2P8OC 3F3BA 4JYVH 4TT3D 4TY6A 1GI1A 2THFB 1UTQA 2ZFQH 2FYRA 1O3MA 4LXBH 2ZP0H 3A81A 5T3HA 1V2LT 1RGQA 1V2PT 1WAYB 3RXQA 1S5SA 2GV6A 1CBWB 1ZGIA 3QTOH 1TOMH 3UNQA 1GI8B 2ZEBA 3HK6B 4ISIH 3RLYH 1YPEH 1BITA 4MQAA 1TRMA 2VIDA 5AF9H 1OWDA 1T7CA 2BX4A 2O8WA 2W26A 2AYWA 1GHAG 2Y6TA 1A2CH 6GCHG 5TCAA 1DDJA 2XRCA 3MNCA 3A7ZA 4IMZA 1VITF 3RXTA 2VGCC 4X1QU 3SNDA 1UTNA 1GMCG 2VGCB 5A09A 5KEDA 5PTPA 2VIPA 2JH0D 3M3VA 3ZVDA 2A45B 3P95A 2IJD1 2FTLE 3RXGA 1KMHB 4Y0YE 3SQEE 4FUEA 5E2PA 1TQ0B 2B5TB 2HPQH 2F3CE 1O2YA 1YPHE 1C5MD 5DSFA 1S6HA 3M3SA 1CU1A 2FTMA 1TBQH 3MOCA 2BQ6B 1CA0C 3ZZ3A 2PTNA 2FI3E 1C5YB 2WPJS 2XNIA 1MD8A 3FP7E 3PV4A 4A1XA 2Q6DA 2ZF0H 2K1QA 3UNRA 3BTWE 1C4U2 5C3NA 3FANA 1PQ5A 3ATLA 1OKXA 3S69A 1CQQA 2WV9A 1XKBC 1S0RA 3C1KA 1NESE 2GT7A 2Z6BD 3UR6A 3ZZ5A 4UFEH 3E8LA 4DIIH 3GCOA 2QYIA 2FOEA 2ZHQH 4ABHA 5LGOA 1K9OE 4CHAC 1YCPK 4ZKNU 2F91A 2NU3E 1V2ST 4X0WU 5GDSH 4U2WA 1Y5BT 1DOJA 1MAXA 2AERH 4IW4E 2PV9B 5CHAB 4GLYA 5JYIA 2ZDMA 1ZRBA 1BTWA 1DE7H 1EZSC 2FO9A 2BM2A 2HNTE 2ZO3H 4BAOB 3V7TA 2K0QA 1TNLA 2O8LA 2JIZD 1YPGH 2VH6A 1MKWK 1ESBA 5EOKA 2GT8A 1TB6H 1A1RA 4IGDA 3FZZA 1MKXK 2VIVA 5ESBA 1IQFA 1Y59T 3RXBA 5HM9A 1S84A 2QF5A 3RM0H 1SR5C 2QC2A 3ENSB 4NIVA 2Y5HA 1SPJA 4NG9H 1N1LA 3UFAA 4ABAA 4Y7BA 1IHTH 1EZXC 1ORFA 1G3DA 1ZRKA 3K65B 5IK2D 3GCNA 2Z9GA 1J15A 1T8LA 3VB3A 1O2RA 1SQAA 4NA7A 2NU0E 3OTPA 5AVDA 3VG8A 2A0QB 1WTHD 1C5PA 1PQ7A 1FQ3A 3U8OH 1DLEA 1S81A 3MMGA 4YXWD 1FY8E 5AHGH 4ABJA 3MH7A 2L74A 2A31A 3PROA 3RU4T 1C2EA 2ZFRH 2KCPA 2W7UA 3U1IB 2VU8E 1SG8B 1TPPA 3LIWA 3PLBA 3A88A 3E0PB 1YPKH 1GJ8B 1HIAA 5K0HA 1C4Y2 1LPZB 3P8OA 3K6ZA 3TK5A 1JWTA 3RM2H 1G2MA 4I8GA 1P01A 2QF4A 3M36A 5KGOA 1HAVB 1D3QB 1JOUB 5DO4H 1DWCH 2QF0A 3KQBA 4A5TS 2AGEX 3NZIA 3DFLA 3D23A 2FDAA 1GJDB 3K2UA 3PV5A 5I46H 1C4V2 2ZFSA 8GCHF 3M7TA 3OY5U 3ZZ9A 1LHGH 3O8CA 1Y8TA 1FY1A 1SQOA 3SW2B 1O2MA 3LU9B 2GP9B 2XYAA 4BXSA 1RJXB 3F2FA 1SLUB 2H9HA 2J2UA 2TGTA 1O2UA 4ZHAA 1GBFA 2UUFB 3DSOA 4OS7A 3K9XB 2PUQH 3B8JA 1XUKA 3MWIU 1UK4A 2WYGA 2FOHA 4NFEA 1T32A 1SFIA 1JIMA 1BRBE 1TGCA 2VB0A 1W14U 3FZDA 1W2KH 1MH0A 4CH8B 3QWCH 1Y3UA 4K1SA 2XBWA 3QZRA 1C5WB 1LQEA 2R9PA 3RMMH 2GZ8A 2UWOA 3PWBA 4H6SB 1EKBB 1FN8A 2H5CA 3CS7A 1P8VC 3LC3A 1TRYA 1TRNA 2QA9E 2HNTF 5CMXH 5A8YA 1O37A 2GCTC 1TE0A 2CMYA 2FPZA 1A4WH 3A80A 4AFUA 2TGAA 4X8VH 4BAHB 4AB8A 3TGIE 1QQUA 2OQUA 2EEKA 4Y11E 4UFFH 5L30H 2A7CA 3GY3A 1C2HA 1WSSH 1YGCH 2FOBA 1IQEA 1C5XB 2OXSA 1PYTC 1EP5A 2GCHF 2PKAB 2G4TA 2IPHA 3I77A 3ZYEA 1MTSA 1CGIE 2OCVB 1GI7B 1VCQA 3LOXA 4K3JA 1DY9A 4ISHH 3PMHB 2STAE 2OBOA 1LKBA 3MU8A 2B7DH 1L0ZA 1SLXB 1UTPA 3SJKA 1W7XH 1YPMH 1C1PA 4K5ZA 1ZTKA 1OS8A 3ODDA 3QGJA 1TX7A 2BDAA 3PM3A 1EFRD 4KGAA 1IQGA 4UE7H 4MVNA 3RUOA 3A85A 1MCTA 3TU7H 1TPOA 1INCA 1DS2E 1ESTA 1O39A 3Q3YA 4WXVA 1O2NA 5A2MH 1QL7A 5AFYH 2FX6A 1A61H 3RXMA 1TFXA 2TGDA 3I29A 1ZZZA 5HGGA 2FS9A 3BEUA 3U8RH 1GBTA 1BT7A 3Q3XA 4CHAB 4FUBA 5CE1A 1GCTC 1QBNA 2JETB 4UEHH 4CRBA 1BRAA 3UPEA 4O3UA 1MZDA 1O5CB 2A32A 1NY22 4RT1A 3ZZ4A 1O2KA 1ZGVA 1L4DA 4JZFH 3GCHB 4O9VA 2Z9IA 3SU1A 4ZHMU 2Z9KA 1HYLA 1ZJDA 3SI3H 4GHQA 2CN0H 3VGCB 1IQJA 4XRNA 1L1JA 1SL3A 3WY8A 7LPRA 1YBWA 3T5FH 1AWFH 2SFAA 1K1PA 1ZHPA 1K1IA 1T8OA 1ANBA 1QJ1B 1GDNA 1D4PB 2OLGA 1V2KT 3HGPA 4ZKRU 3BTME 1MU6B 3PMAB 4IBLH 4Q7XA 1AFQB 3ZZBA 2C3SA 1L2EA 4B6EA 7KMEH 1B5GH 1OYTH 2V3OH 2F9BH 5TJXA 1Z71A 1SBWA 3M7UA 4WWYA 1BTUA 5HYOA 2PSXA 1FI8A 3ATMA 1O3HA 1JRSA 4TWYA 3O8BA 4ZUHA 1GJBB 2HNTC 1GJ7B 1ANCA 1UVUH 3SZNA 4TWWA 2ZECA 3A89A 3Q77A 4I86A 1A0JA 2J9NA 5JBAS 2D2DA 1V6DA 3URCA 4B73A 3LDXH 1V2OT 4HG6A 3P8GA 4ABEA 4DGJA 2P93A 3VFEA 1B7XB 1C5VA 1V2WT 2A7JA 1GJ9B 4X2WA 1JMOH 3RXAA 3PLPA 3TJNA 2HWLB 5E0JA 1Y5UT 1HAZB 4Y76A 1TALA 3UTUH 1AO5A 1GI5A 4UFGH 1GVZA 2CK3D 1KXCA 2LP6A 1GGDC 2A7HA 4A1VA 3SV6A 1WQVH 2H9TH 3PB1E 3F2GA 1LHFH 5C67A 4AOQA 5I25A 4XBBA 1F0SA 1ZOMA 1AB9B 1EJMA 5IDKA 4U30A 1V2MT 1QIXB 3GDVA 1ARCA 4DT4A 1F2SE 1P09A 2R2WU 1NS3A 3SQHE 2OD3B 2J95A 2WINI 3TK9A 1ELBA 1H9IE 1EPTC 5DP7A 3SGAE 2CJIA 1H8HD 1WXRA 3LPRA 1BMLA 5EU8A 4ZH8A 3W95A 4Y10E 2F4LA 3MO9A 1O31A 1O5AB 4CH2B 1E34B 2XXLA 4FUFA 2JJ2D 2R2MB 2FOFA 3A8CA 3BTHE 5C2ZA 1GMDF 2ZFTA 3MYWA 4JK5A 2HOBA 2A4OA 3MNSA 2HLDD 3LGVA 1BQYA 5HKKD 4AZ2B 2OBQA 1UTLM 3RP2A 4VGCC 1QTFA 4RI0A 1NPMA 3RXKA 4AFZA 3UQVA 2HVYB 1DUEA 1CBWC 5ESTE 4B74A 1U6QA 1ETRH 2ZNKH 1TIOA 2BLWA 3E91A 4PROA 1LVMA 3P8FA 3UOUA 5JB9S 1K28D 1AI8H 1NFYA 4YZUA 3LT3A 1NRNH 5E2OA 3EDXB 4AYVB 2C90B 1K21H 1HJ8A 1YY3A 2QXIA 1XXFA 3MU1A 3WWFA 2QGRA 1TAWA 1YLNA 2VINA 4B71A 3P8NA 2GGVB 4Q7ZA 2XCNA 3PLKA 1NRRH 1XUGA 4MNWA 4BTTB 1AKSA 2BD3A 3M3TA 2RDLA 1HV7A 3S9AA 2BY9X 1K22H 4I32A 1HXEH 4AB9A 1O30A 1GPZA 3RC6A 3RXOA 3BF6H 2L6OA 3NK8A 3M5MA 2ZTYA 2ZHEH 4IC5A 1FIWA 2G4UA 2ZGXH 1C5NH 1MQ6A 1KXBA 3IG6B 3N7EA 1FPCH 4GPGA 1C1OA 1EPTB 1XM1A 3MNXA 1BIOA 1SFQB 4P02A 4ACBA 1PFXC 3BG8A 3BTEE 1NFXA 1XMNB 1YF4A 4X1SU 1FUJA 1YM0A 4NSYA 2XW9A 1F0RA 2OUAA 2PSYA 1DANH 4HI3A 2C8XB 1PPBH 4INHA 1BJUA 2YMSC 3KGPA 2BOKA 5FX6A 1PQAA 1UW7A 1A0HB 1K2I1 1WTGH 1S82A 3LJOA 2ZGJA 1DLKB 4ZCNA 3RXIA 1QL9A 5AFZH 3SYJA 6CHAC 1P2IA 2LPRA 1WQSA 5DP8A 3A83A 1FPHH 1PPFE 5C94A 1ZHMA 3QK1A 2RA3A 4X2YA 4ZKSU 3NXPA 2GTBA 3F6UH 1QFKH 1TOCB 1BTHH 3FKSD 1EXFA 4M9FA 1MTVA 3CS0A 3WWBA 3HK3B 2G55A 2XCFA 3A8DA 3G01A 2FI4E 3GOVB 1T8MA 1FY3A 2R0KA 1EAXA 1LCYA 1NFWA 4K8YA 2BY6X 2D1JA 4MG3A 1V2TT 1IAUA 1YLCA 4GAWA 1B0FA 3N99A 1TBRH 1WDIA 1J9CH 2ZU3A 1IQKA 1E79D 1P2OA 2EQNA 4WMFA 3ZV8A 4Q4LA 1UTJA 1G3EA 1C5OH 2A4GA 3TH4H 3RMOH 2SGEE 1O3CA 1AE5A 5SGAE 1C2MA 2UUJB 3EYDA 4CBOA 1UHBA 3KQEA 3UUZA 1GBHA 2A2QH 3URDA 2PUXB 3HPTB 1NU9A 1GI2A 1ANDA 4FU7A 2K8IA 1AFQC 3NCLA 1Z8GA 1Q31A 4GHTA 3SHAH 4WH6A 2WPLS 2STBE 1G36A 1MKXH 2A4RA 3UWIA 2ZDLA 3SU0A 2WPHS 4CR5A 2HALA 1NRPH 2BX3A 4NWKA 2KX4A 1TONA 4OS6A 4JZEH 3ZYDA 4AFQA 3LH1A 4ZXYH 1NBME 1W8BH 3W94A 1NN6A 3PWCA 3D62A 3GY2A 5EODA 3W1EA 1FY4A 4Y71A 4JCNA 2M2AA 2ULLA 3EE7A 4Y8YA 2QV1A 1A3EH 1KY9A 3R0FA 3O8RA 1UCYH 1CGHA 4BAKB 4Z1MD 1BHXB 1O3NA 1C9PA 2JH5D 4YOIA 3SV7A 4BXWA 1O2LA 3BEFB 1IQNA 1TGNA 1P2KA 4OS1A 4B2AA 2H2ZA 4WXIA 2AGGX 2C93B 1QNJA 1MMJN 1GBJA 4OS2A 3FP8E 1LO6A 3OAAD 5HM2A 1P05A 1GBEA 1RIWB 2NWNA 3MU4A 4Q63A 4ABBA 5L6NH 2O8MA 3L33A 5DP5A 1AU8A 1C1NA 1HB0B 2ALPA 1GJAB 1T4VH 1IQMA 2QN5T 1V2NT 2EC9H 3QGNB 4YO9A 1V2VT 3UNSA 2F9PA 2V3HH 2AH4X 1VKYA 4Z6AH 1C5QA 3ZZ6A 3UAIC 2R0LA 3OY6U 3S9BA 4MPVA 1GI4A 3AK5A 1C1WH 1DXPA 2ZGBH 2ZU5A 1A5GH 3OYPA 1KXEA 1W3CA 3Q00A 1EZQA 1H4WA 4FUJA 2V0BA 2FLRH 1S85A 3QO6A 5C0TA 1AZ8A 2XC5A 1S6LA 1IHSH 2ODYB 2F83A 4NA9H 2SGPE 2PFEA 1OP0A 3BG4B 4P00A 1DXWA 1F5RA 2W6JD 3M61U 1NO9H 1A5IA 1ETSH 1G2LA 2YNAA 4E05H 3DSGA 3ZVGA 1SGYE 1C2KA 1GJ6A 2GVFA 1TMTH 4X1PU 4SGBE 3TH3H 3MO3A 3SJIA 1O33A 3KF2A 4HTCH 1AQ7A 4F48B 2UUKB 3TGJE 5F8ZA 2RA0A 3T29A 4K2YA 1NZQH 4ABDA 1BCUH 1CHGA 1QB9A 1MTUA 2OTVA 3A8AA 1Y3WA 4INLA 1E37B 1XUFA 1E36B 5F6MA 3P70B 1GHVH 2OC8A 1QL8A 3BN9A 1KLJH 3S7KB 3A86A 1ARBA 3GY6A 4UONA 1Q2WA 1RTKA 5A0AE 5LH8A 1C2DA 1UVTH 1F5LA 1CO7E 2CHAC 5C20A 7GCHG 1P10A 1TNGA 2FS8A 2XBYA 2SGAA 3ATKA 4X6NA 1JXPA 1E1QD 3NKKA 1GI0A 2ZQ2A 1OWEA 1QURH 4KTCA 2ZTXA 3FOAA 3ZZCA 3KHVA 3M5LA 4M7GA 3SUEA 2OINA 3O8DA 2BMGB 4KTSA 5GJ4B 1G30B 1F0UA 3VB5A 4TSFD 1V2JT 2ZC9H 4CRFA 3MU0A 2WPMS 2BXUH 3OE7D 1GHZA 1TGBA 2CHAB 2JETC 1TA6A 1GHXH 3ELAH 3F9FA 3TGKE 2Z3CA 1K1JA 1ZPZA 1O5FH 1SHYA 3LGYA 1P04A 4ZROA 1O2VA 4I8HA 1E35B 5K7RA 3IITA 2QXHA 1THSH 3E0NB 2BY7X 1F0TA 3BTTE 3F68H 3GCTG 2G5NA 1Z8RA 1FXYA 1O5DH 2AIPA 2FX4A 2BD9A 3DSPA 4XDEA 4ASUD 3ODFA 1TBZH 1EASA 4O97A 1KLIH 1NU7B 1C2GA 4TYDA 2CF9H 3QLPH 2FIRH 3BTFE 4MTBA 1O3IA 2FOGA 2WHXA 1PPCE 3MH6A 4AN7A 1GL1A 1Y5AT 2FYQA 1EQ9A 1BTZA 1F5KU 2J97A 3A7TA 5ETXA 3UQOA 2JJ1D 3SU5A 4E06H 1EX3A 2ZWLH 2A2XH 3BEIB 2XOKD 1C2JA 3VXEH 1NM6A 2BD2A 3SV8A 1RXPA 1V2RT 2BZ6H 1O3DA 1RFNA 5A0CA 3DFJA 3U8TH 1ZMLA 3KEEA 4FXGH 1IOEA 1GI3A 4X1RU 4JZIA 1AY6H 4NWLA 3V13A 1O3JA 5T6GA 3M5OA 4YOGA 1EP6A 3FAOA 2Q1JA 3LH3A 3TVJB 1YCPH 5LPRA 1UVOA 2ESTE 3UWJH 3SNEA 2VIQA 1H9HE 1DX5M 1MUEB 4NGAH 5EW2H 4DOQA 1RIWC 2YMSD 4X6MA 1VGCC 1THRH 1WBGB 1QRWA 2WPIS 2BQWB 2VJ1A 4QT8C 2BDYA 2J34A 2M5TA 4X6OA 3BTQE 1GDQA 2HGTH 5B6LA 1C2LA 1ESAA 4OS4A 4XD7D 3E3TA 3VXFH 5BPEA 3TITA 1QJ6B 1P2JA 2BDHA 2BVSH 3ZZ8A 5A8XA 1BTXA 2BVRH 2CV3A 2Y5FA 1J14A 5H4IB 3H7TA 1OSSA 1HAVA 3M7QA 1H1BA 1QQ4A 5F8XA 1ZSKA 2ALVA 1AMHA 2IN2A 4AYYB 1HAXB 4FUIA 5T6DA 1EATA 1SGQE 3L3TA 1C1QA 4F4OC 1QB1A 1Y3VA 5E8EH 3JZ1B 1N8OC 1O2OA 2BLOA 2PW8H 2ZQ1A 1ELGA 2FOAA 3ZIAD 3GYLB 5DP3A 4JYUH 1UJ1A 1D3PB 2BD5A 1KTTB 1YYY1 2ZU2A 1CE5A 1K1NA 2CXVA 1QA0A 1BMAA 3SU2A 3EE0B 4VGCB 1ACBE 1FLEE 2ZG0H 2ZU1A 4Y8ZA 1V2UT 2ODPA 1A5HA 3DHKH 2J92A 4XBDA 2OP9A 4FU9A 3SHCH 1W0YH 4DG4A 1ETTH 1QJ7B 2ILNA 3SI4H 5DP9A 1D6WA 1HAIH 1MCVA 3GY8A 1BMFD 3STIA 1M9UA 1PJPA 4NZLA 1KLTA 1HXFH 4X8UH 3T2NA 2XC4A 1UTMA 3N7OA 2O8TA 4H42U 5DPAA 1UK2A 2QE7D 1GJCB 1NBMD 1N8OB 3A84A 4NIYA 2BD7A 3H09A 4FUCA 1W10U 1ZPCA 1GBAA 1K1LA 2CF8H 2Y7XA 5T6FA 3TPIZ 2A5IA 1HDTH 1HAYB 9LPRA 3EA9A 1C5ZB 1S6FA 2QF3A 1L4ZA 5T1VA 4U01A 8LPRA 1GBIA 3V0XA 4A7IB 2JDID 1HJ9A 1XUIA 2O8UA 3JZ2B 1O3KA 4RT0A 1CHOG 3GDUA 3VEQB 3RMNH 1PPZA 6CHAB 1O2QA 1ZR0A 2EA3A 2Z9LA 3HATH 4J1YA 3TLOA 2RFKC 3SOSA 3F1SB 1TX8A 5EG4A 2BOHB 2V7QD 4RKJB 1S83A 1JIRA 4ABFA 3DUXH 2YMSB 3ZVFA 1GBCA 1DITH 2V35A 1CT4E 3GY4A 2A5AA 1VCWA 2J98B 2BLQA 2ZHWH 1O5EH 1TMBH 1TMUH 4NCYA 2BVXH 1FX0B 2EI7A 3N7DA 1O0DH 3VPKA 4TPIZ 4RN6A 1DWDH 4D9RA 4CBNA 5EXNA 2WV5A 2KCYA 2W7SA 2XWBI 5FPTA 1L1GA 3HGNA 1KYNA 3UOPA 1SKYE 4A6LA 5GNDA 1QZ8A 2Z3EA 3PO1B 3ZVAA 1GBDA 2Y5GA 4LOYH 2R3YA 2Q6GA 1HJAC 1ELEE 2AMPA 1P2NA 2A5KA 1P3EA 4DURA 2HVXA 4YT6H 5DK1A 1C1SA 2PGBB 1RD3B 2BDIA 5EGMA 1GGDB 1AKSB 3OFND 3MQKC 3B23B 1RTFB 4I8JA 3RC4A 1QB6A 3BTGE 1TX6A 4A92A 1H8IH 2IPQX 1GG6C 1IQHA 2WUCA 1FIZA 1EPTA 1GMHG 1GCTB 1ZJKA 3VB6A 3QTVH 1CA8B 3GYMA 2VH0A 3RDZA 3CP7A 4R0IA 5L2YH 3ATIA 1VCPA 2FESH 2P94A 4ISLA 2PKSC 3FP6E 3D65E 1C2FA 4DVAU 5JB8S 1A0LA 4D76A 1EB1H 2QXGA 1W0JD 3BV9B 4XOJA 2WPDD 1Z1JA 1YC0A 1N6XA 4FVBA 1ZYOA 1GI6A 3D49H 1AE8H 2BZAA 1BB0B 2BYAX 4Y6DA 1YPJH 1SMFE 1BMNH 2DE8A 3PMBB 5C1XA 3IWMA 1DM4B 3CENA 1BMMH 2WYJA 2B8OH 4F49A 3KYFA 2VVUA 1GVLA 2BLVA 2ZPRA 3UB0A 1QGFA 1OXGA 3SUGA 2UWPA 7ESTE 4AFSA 3NPSA 1ZSLA 1DFPA 2G51A 1SGIB 5EIYA 1GBKA 1CA0B 4GCHG 1HBTH 1J17T 2EI8A 5C1UA 1IQLA 2ZI2H 5A0BA 2C8YB 3M35A 1O34A 4I7YH 2ZCHP 1PYTD 1ELFA 4ZHLU 1AGJA 2ZFFH 1FONA 3RXSA 1XVOA 1LDTT 3P92A 2TIOA 4ZXXH 1NTPA 2FM2A 4Y7AA 3LONA 5EQQA 3SV2H 1MBQA 5EJLA 1C1TA 3Q3KA 1WCZA 4YM9A 3EAJA 1FMGA 2F43B 3MNBA 3ZZAA 2Y82A 4AX9H 1XKAC 1YPLH 3T28A 1C1RA
chains in the Genus database with same CATH topology
3F9HA 1TLDA 3I78A 2PKSB 1O2PA 1TNHA 1SLWB 1FNIA 2VVCA 1VGCB 1AVWA 2AMDA 2EI6A 1Z6JH 2FLBH 1WYKA 4A1TA 1XUHA 3UR9A 2ZFPH 3TIUA 1TNKA 3SU3A 1RRKA 2LNCA 4TPYA 1SVPA 3RU4E 1GHBF 1C2IA 3ATWA 1HAGE 4AORA 1C9TA 4DY7B 1GL0E 1O2GH 1ZSJA 3L6PA 2GD4B 1VJAU 2BDGA 2VNTA 4CR9A 1ELAA 3T26A 1LHEH 3GY5A 5J4QA 3PYHA 5FBEA 3TJOA 1AZZA 3MI4A 2FOCA 3PO1C 2IJOB 5JPMH 4AGKA 4DCDA 4YT7H 4OGXA 3SUDA 4YLQH 2PWXA 1LTOA 1ZLRA 1Z8IB 3ZZ7A 5DG6A 4B2CA 4CRAA 2GMTC 4SGAE 5GXPA 3RXEA 4LZ1H 5FAHA 1RTLA 2ZDVH 2SGFE 1G9IE 1ZMJA 4UD9H 2QIQA 1CVWH 1K1OA 2RG3A 1P2MA 1EAIA 2HRVA 2FODA 3A7VA 4GCHF 3SNBA 3E16B 3PTBA 5ABWA 4IN2A 4XSKU 1DT2A 3LKWA 2BY5X 1T4UH 3Q76A 3QDZB 4OGYA 2Q6FA 4DW2U 1UO6A 1ZMNA 4MPUA 1J8AA 1ANEA 1MBMA 1C5LH 2D26C 1C5TA 1WOFA 2VWNA 2VWOA 1P06A 4MNVA 5FCKA 3NUMA 4LZ4B 2ZHDA 1DSUA 1ZTLA 3F9GA 3MHWU 4CRGA 1AN1E 3RXCA 1P9UA 5JBCS 2Z9JA 2F9VA 1KXAA 1SGRE 3S9CA 1JBUH 1UTKA 2C4FH 3ESTA 4KKDA 1ABJH 3ZV9A 4KP0A 1GHAF 4X2XA 3RXRA 3OX7U 3KQDA 6LPRA 4ZKOU 1T8NA 4K1TA 3SN8A 5FPYA 1SGEE 2W3IA 3RXDA 3BTDE 1OX1A 2D8WA 1HIAB 4X8TH 1MKWH 4GVUA 4IS5A 5CHAC 1P57B 1GBLA 3DA9B 1NROH 2BHGA 2B0FA 1VR1H 1YP9A 2JKHA 1HLTH 5E0GA 3QUMP 3RXPA 2DUCA 3TNSA 1DPOA 2H1UA 2BTCE 3QZQA 1FZZA 3U1JB 1MTNB 1QRXA 1OP8A 1Z7KA 3LGIA 4JZDH 4TY7A 3ZVEA 1FY5A 2ASUB 3M5NA 1FJSA 3SJ9A 1O3FA 1ZPBA 2ZPSA 3BSQA 1TGSZ 3SGQE 3TK6A 3A7XA 3U69H 4DIHH 1S0QA 3GICB 3QN7A 4HZHA 2AIQA 4X8SH 5FPSA 1AUTC 5DKMA 4B75A 1GMDG 1P11E 3P17H 5GIBA 5FX5A 2TGPZ 2C8WB 1WUNH 1TWXB 1LMWB 3SO3A 1KXFA 1EJNA 3FFGA 3OU0A 3VB4A 1G37A 5GCHF 1GDUA 2H5DA 3SU4A 1TPSA 4KELA 1P03A 2I6SA 2Z94A 4AG1A 2YNBA 2GZ7A 3SV9A 4FU8A 1GHYH 5EW1H 1AHTH 2ZA5A 1P02A 2QXJA 3KN2A 2FMJA 1A7SA 1F92A 1W13U 2VIOA 1SHHB 1T31A 3ITIA 1UVPA 2AFQB 1BA8B 2SNVA 1VITH 1PPHE 4XBCA 4DJZB 3SNCA 2GDDA 1TNJA 3E6PH 2P3UB 5GWZA 2KAIB 3R3GB 2P95A 4YOJA 1OOKB 2XBXA 5EXLA 2ZKSA 4JYTA 2J94A 1CHOF 4ZAEA 1AD8H 2NU1E 2FEQH 3V12A 1YCPM 4WF8A 5J4SA 1LHCH 1W12U 1O2TA 1UTOA 1WU1A 4GUXA 1DY8A 2H6MA 2GCHG 1AVXA 3EQ0H 1BZXE 4J2YB 1AWHB 4H4FA 4YLUA 4ABGA 3NWUA 1HJAB 1O3PB 1WV7H 2PR3A 3UY9A 1UCYK 2BD8A 2PTCE 1OP2A 3K6YA 3ZZDA 1A3BH 1GJ5H 2A4QA 1PQ8A 2CGAA 4RKOB 3A7YA 5JBTA 1UMAH 7GCHF 4B76A 2C8ZB 3UIRA 1EB2A 4BTUB 4D7GA 3FVFB 1BBRK 2FZZA 4X2VA 5JBBS 4ISOA 5HMAA 1XUJA 1BRUP 1HAHH 3T27A 2DE9A 1DSTA 3ZVCA 1SGTA 2VWMA 1GBMA 2GMTB 3LGTA 4CREA 1O3EA 3SU6A 4FUDA 1EOJA 2OC7A 3KIDU 2BY8X 1O2XA 4U32A 8ESTE 4ASHA 3EA7A 3KQCA 2ZZUH 1NRSH 1OWIA 4O3TA 1ELVA 5C5NA 1PPEE 1MU8B 1Z6EA 1CSOE 2GKVE 3AVZA 2SGQE 2I6QA 3MH5A 4BNRA 3RXLA 5FXLA 3TJUA 2BD4A 3BIVH 2PHBA 1KTSB 4WMDA 2O9QA 5EPNA 1A46H 3SBKA 2QCYA 1D6RA 1EZUC 2ZDNA 2OC0A 4WH8A 2XBVA 2ANWA 1AB9C 3RU4D 1O3BA 3DD2H 1C1MA 5EQSA 3TJVA 3AAUA 1P9SA 4Y0ZE 2FI5E 2W3KA 3U9AH 1O2HA 3T62A 3S7HB 2ZGHA 3SGBE 2AGIX 4NFFA 1GHWH 2R3UA 3GCTF 1CGJE 1BTPA 1HNEE 1Y3XA 4Y8XA 1V3XA 1MQ5A 1SGPE 4RSPA 4I8LA 1O3OA 1SGFA 5DP4A 2PLXA 1QBVH 2HLCA 1P12E 4K60A 1GWAA 1KIGH 1LPGB 1LVYA 2QAAA 1UK3A 1MTNC 2ZGCA 1C5RA 2P3FH 1TABE 3RC5A 3SNAA 2G5VA 1GBBA 1O38A 1PPGE 2G00A 3RXVA 1EAUA 3BTKE 4BAMB 1HAOH 1YLDA 3MFJA 1E38B 4FVDA 1NT1A 3KNXA 3B9FH 2UUYA 1X7AC 1C1UH 5FBIA 1D9IA 1FDPA 2J4IA 1NFUA 4NSVA 2KAIA 1O5GH 2ZTZA 4H6TA 2H9EH 1O2IA 1VJ9U 1XXDA 1ABIH 1VZQH 2PGQB 3UREA 4ZMAH 5JDUB 8KME2 2BB4A 4WMEA 6ESTA 1OWHA 2GZ9A 1DVAH 1SC8U 3AAVA 1BBRH 1BTYA 1CT2E 3GDSA 2XWAA 1SGFG 1MD7A 4ABIA 5DJ7A 4D8NA 1W7GH 1EUFA 1QCPA 2ANMH 3A7WA 1YKTA 2G81E 3EA8A 1OYQA 5FCRA 1XX9A 4X1NU 4BAQB 3RMLH 3VGCC 1L1NA 2SGDE 2NU2E 4XE4A 1P2QA 5LPFA 1NRQH 4IC6A 1O35A 4UDWH 1LVOA 1KXDA 4YESB 1E0FD 3S0NA 4NA8A 2F9OA 2XTTB 2PKAA 1O3LA 1KDQA 2Z7FE 4WJG2 3STJA 1FAXA 1FN6A 1O2ZA 4HFPB 1D3DB 1SLVB 4IN1A 4WY3A 5BRRE 1NC6A 1QY6A 3E90B 1QRZA 2GDEH 4YTAA 1MZAA 1H8DH 1LHDH 4MDSA 1O2SA 2B9LA 3HKIB 4OS5A 1TA2A 5FHTA 1LVBA 1O3GA 1ELDE 3AW0A 1BOQA 1HRTH 1ELTA 1QA7A 4AG2A 2WUBA 1O2WA 1KDQB 2HPPH 9ESTA 1SI5H 2JH6D 1V2QT 1TNIA 4IMQA 4DT7B 3RLWH 1O36A 2Y81A 1J16A 4BOHA 1Z1IA 4I31A 3H7OA 1IQIA 3EGKH 3A82A 4D7FA 4X6PA 3V3MA 1HCGA 6GCHF 1MAYA 4FUGA 1EJAA 1SGDE 3GISB 1XVMA 1YPHC 2XC0A 4MLFB 1UVSH 4XFQA 3A87A 3OTJE 1HGTH 2Z3DA 5GPIB 5GCHG 3LC5A 1GMHF 2AEIH 1W11U 1QBOA 1VITG 2ANYA 3C27B 4E7NA 3U98H 3SJOA 2J38A 4B2BA 1DWBH 1KSNA 1SQTA 1TYNA 4BTIB 1LPKB 3KL6A 2WV4A 2Y80A 2BDCA 4GSOA 2ZPQA 5L2ZH 1C5SA 1SB1H 4ISNA 1BHXF 5C5OA 2BDBA 3LGUA 2V6NA 4Q7YA 2G8TA 4Z0KA 4UFDH 5HXFA 3RXUA 3P6ZB 1N6YA 5EXMA 2OC1A 1THPB 1TQ7B 1SSXA 4B1TA 1UCYE 1FV9A 3PMJA 2FOMB 1O32A 4AGJA 3AASA 4WVPE 5IYTA 2GX4A 3VB7A 1P0SH 5E0HA 4MPWA 1LKAA 2Y7ZA 3E1XB 2SNWA 5C1YA 2ODQA 4KTUA 1AVGH 2UWLA 3SUFA 4Q2KA 2ZCKP 1Q3XA 2BQ7B 1G3CA 1BJVA 3PTNA 1HAPH 4K1EA 3ZVBA 5B6OA 1Y3YA 4NZQA 1BDAA 1SOTA 1G3BA 1CT0E 2ZDKA 1TPAE 4O03A 1DICA 5A8ZA 3GCHC 1O5BB 4NIWA 1ID5H 4D9QA 1OWJA 3A8BA 1SGNE 1DUAA 1Z8JB 4NIXA 1LQDB 1GHBG 2FWWA 3F9EA 5DGJA 1H9LB 1C5UA 2GV7A 4HGCA 2ZCLP 1SOZA 1O2JA 2G52A 1ELCA 1UHBB 2TRMA 1GMCF 3SJ8A 1GI9B 4ESTE 1OPHB 1BRCE 1D3TB 2FXRA 3RXJA 4Q80A 1F7ZA 1G32B 1FAKH 1ZHRA 4E7RG 1GJ4H 1RS0A 1W0ZU 1EAWA 4Y79A 2ZU4A 3KCGH 5DP6A 1OWKA 4LK4A 8GCHG 3LJJA 2P8OB 5EPYA 2ZDAH 1K1MA 2P59A 2W5EA 5G4BA 3MH4A 5TCCA 1B0EA 3BG4C 2VVVA 4I33A 2VIWA 5EQRA 2TPIZ 1ZTJA 1GVKB 3MTYA 2OQ5A 1SGCA 4MNYA 1QR3E 1AUJA 3OSYA 5F8TA 1QHRB 4JZ1A 3GY7A 3DT0H 2IOTA 3SORA 3MO6A 2RCEA 1DWEH 1HUTH 1AIXH 2FP7B 3LGWA 2P3TB 1EOLA 3TNTA 2ZIQH 1C1VH 2ANKH 2AS9A 3M37A 3RXHA 3RXFA 4CRDA 4R8TB 4CRCA 2F9UA 2GCTB 1AFEH 4FUHA 2TBSA 3HKJB 2YOLA 4INKA 5F03A 1O3AA 2F9NA 1TGTA 1GCDA 1BUIA 2VWLA 4K8BA 2ZHFH 3BIUH 2P16A 2BXTH 3T25A 2WPKS 4JK6A 3AW1A 4JMYA 5LPEA 2AMQA 3MU5A 1HPGA 4K69A 1GG6B 4THNH 3QX5H 3TH2H 1P3CA 4MNXA 2NU4E 4MPXA 1JRTA 4I8KA 1BBRE 3H5CB 2QY0B 1HFDA 4BANB 1MTWA 2A1DB 2P8OC 4JYVH 4TY6A 1GI1A 2THFB 1UTQA 2ZFQH 2FYRA 1O3MA 4LXBH 2ZP0H 3A81A 5T3HA 1V2LT 1RGQA 1V2PT 1WAYB 3RXQA 1S5SA 2GV6A 1CBWB 1ZGIA 3QTOH 1TOMH 3UNQA 1GI8B 2ZEBA 3HK6B 4ISIH 3RLYH 1YPEH 1BITA 4MQAA 1TRMA 2VIDA 5AF9H 1OWDA 1T7CA 2BX4A 2O8WA 2W26A 2AYWA 1GHAG 2Y6TA 1A2CH 6GCHG 5TCAA 1DDJA 2XRCA 3MNCA 3A7ZA 4IMZA 1VITF 3RXTA 2VGCC 4X1QU 3SNDA 1UTNA 1GMCG 2VGCB 5A09A 5PTPA 2VIPA 2JH0D 3M3VA 3ZVDA 2A45B 3P95A 2FTLE 3RXGA 4Y0YE 3SQEE 4FUEA 5E2PA 1TQ0B 2B5TB 2HPQH 2F3CE 1O2YA 1YPHE 1C5MD 1S6HA 3M3SA 1CU1A 2FTMA 1TBQH 3MOCA 2BQ6B 1CA0C 3ZZ3A 2PTNA 2FI3E 1C5YB 2WPJS 2XNIA 1MD8A 3FP7E 3PV4A 4A1XA 2Q6DA 2ZF0H 2K1QA 3UNRA 3BTWE 1C4U2 5C3NA 3FANA 1PQ5A 3ATLA 1OKXA 3S69A 1CQQA 1XKBC 1S0RA 3C1KA 1NESE 2GT7A 2Z6BD 3UR6A 3ZZ5A 4UFEH 3E8LA 4DIIH 3GCOA 2QYIA 2FOEA 2ZHQH 4ABHA 5LGOA 1K9OE 4CHAC 1YCPK 4ZKNU 2F91A 2NU3E 1V2ST 4X0WU 5GDSH 4U2WA 1Y5BT 1DOJA 1MAXA 2AERH 4IW4E 2PV9B 5CHAB 4GLYA 5JYIA 2ZDMA 1ZRBA 1BTWA 1DE7H 1EZSC 2FO9A 2BM2A 2HNTE 2ZO3H 4BAOB 3V7TA 1TNLA 2O8LA 1YPGH 2VH6A 1MKWK 1ESBA 5EOKA 2GT8A 1TB6H 1A1RA 4IGDA 3FZZA 1MKXK 2VIVA 5ESBA 1IQFA 1Y59T 3RXBA 5HM9A 1S84A 3RM0H 1SR5C 2QC2A 3ENSB 4NIVA 2Y5HA 1SPJA 4NG9H 1N1LA 3UFAA 4ABAA 4Y7BA 1IHTH 1EZXC 1ORFA 1G3DA 1ZRKA 3K65B 3GCNA 2Z9GA 1J15A 1T8LA 3VB3A 1O2RA 1SQAA 4NA7A 2NU0E 5AVDA 2A0QB 1WTHD 1C5PA 1PQ7A 1FQ3A 3U8OH 1DLEA 1S81A 3MMGA 1FY8E 5AHGH 4ABJA 3MH7A 2A31A 3PROA 3RU4T 1C2EA 2ZFRH 2W7UA 3U1IB 2VU8E 1SG8B 1TPPA 3LIWA 3PLBA 3A88A 3E0PB 1YPKH 1GJ8B 1HIAA 5K0HA 1C4Y2 1LPZB 3P8OA 3K6ZA 3TK5A 1JWTA 3RM2H 1G2MA 4I8GA 1P01A 3M36A 1HAVB 1D3QB 1JOUB 5DO4H 1DWCH 2QF0A 3KQBA 4A5TS 2AGEX 3NZIA 3DFLA 3D23A 2FDAA 1GJDB 3K2UA 5I46H 1C4V2 2ZFSA 8GCHF 3M7TA 3OY5U 3ZZ9A 1LHGH 3O8CA 1Y8TA 1FY1A 1SQOA 3SW2B 1O2MA 3LU9B 2GP9B 2XYAA 4BXSA 1RJXB 1SLUB 2H9HA 2J2UA 2TGTA 1O2UA 4ZHAA 1GBFA 2UUFB 4OS7A 3K9XB 2PUQH 3B8JA 1XUKA 3MWIU 1UK4A 2WYGA 2FOHA 4NFEA 1T32A 1SFIA 1JIMA 1BRBE 1TGCA 2VB0A 1W14U 3FZDA 1W2KH 1MH0A 4CH8B 3QWCH 1Y3UA 4K1SA 2XBWA 3QZRA 1C5WB 1LQEA 2R9PA 3RMMH 2GZ8A 2UWOA 3PWBA 4H6SB 1EKBB 1FN8A 2H5CA 3CS7A 1P8VC 3LC3A 1TRYA 1TRNA 2QA9E 2HNTF 5CMXH 5A8YA 1O37A 2GCTC 1TE0A 2CMYA 2FPZA 1A4WH 3A80A 4AFUA 2TGAA 4X8VH 4BAHB 4AB8A 3TGIE 1QQUA 2OQUA 2EEKA 4Y11E 4UFFH