3T27A

Orthorhombic trypsin (bovine) in the presence of betaine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t27A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t27A02
1AY6H 1PFXC 4LK4A 2GMTB 2GV7A 1UK3A 1C9TA 1GBEA 1H9HE 1TPSA 3TH4H 3E1XB 3QTOH 3U8RH 1YPJH 2XW9A 2HPQH 3MTYA 3AASA 5L2ZH 1NU9A 2CV3A 1AWFH 1CHOF 2NU2E 3K65B 1C1QA 5JBBS 1IQLA 2PTNA 1QBOA 4RSPA 2Z9LA 2FDAA 4CRFA 1KTTB 1ACBE 2SGDE 1AVWA 1QNJA 4RKOB 5C67A 1ZR0A 4B75A 1C5UA 3ZZ3A 4FVDA 1ZJDA 1GI2A 1TNLA 2STAE 1F0RA 4INHA 2G8TA 3IITA 4JZDH 1P2QA 4ABBA 5JB8S 2J4IA 2C90B 1ZHMA 4KTSA 1FN6A 3PO1C 9LPRA 4Y8XA 1EAWA 4Q7ZA 1O2HA 4UONA 1IQEA 5DPAA 3RM0H 2ZHQH 1FQ3A 3PB1E 2LPRA 3M5NA 2GCHG 2ASUB 1CGHA 3DFJA 1TGTA 1DM4B 1WUNH 2C93B 2XBYA 1CU1A 3UR9A 1ZOMA 2QY0B 1F2SE 1FY3A 1P8VC 4X6OA 2FOGA 1UTOA 1ANDA 3VB7A 1P02A 2J9NA 2A4OA 3S9BA 2ZTYA 1LPKB 2K1QA 2W5EA 3PMAB 4H4FA 1G9IE 1S6FA 3PMHB 3MWIU 1LHCH 3GY4A 1DLEA 1O36A 1O2KA 1O3BA 1GMCG 1D6RA 3HK6B 2Q1JA 3QK1A 1BMMH 2A45B 2ZHWH 5T6GA 1GHWH 1SGPE 4E05H 2VIDA 2ANMH 1BTYA 1SB1H 3BTDE 4GHTA 4INLA 2FI4E 3MH5A 1O3DA 1GBAA 1U6QA 1HGTH 1SLWB 4XDEA 5EW2H 3WY8A 3R0FA 1O3EA 2W7UA 4TY7A 4I32A 2EEKA 4UFEH 1UTLM 2BD8A 3PYHA 3MU4A 4DURA 1ELBA 1GBMA 2P3UB 3A82A 1BTHH 3DA9B 2WPMS 1EP5A 2ZO3H 1D9IA 3GCHB 3ZYDA 1YP9A 4ABGA 1DY8A 2SGPE 3T5FH 3LC5A 1IHSH 1Y5AT 1V2QT 1RTKA 4OS1A 4DW2U 2H9EH 2A4GA 4B74A 1E0FD 3GCOA 4X8VH 1UK2A 2TPIZ 3S9CA 3E90B 1C1VH 3RXDA 4AN7A 1DPOA 2FXRA 1HYLA 2C4FH 5DP7A 1GBLA 1P2IA 1TOCB 5AFYH 5F8XA 1SQAA 4CRDA 4NG9H 2BQ7B 1AIXH 1Z1IA 2O8MA 1MTNC 2BD7A 1G3EA 3QTVH 2F9NA 2Z9GA 1HXFH 2Z9KA 1ARBA 1VGCC 1BHXF 1T8NA 1DFPA 2OTVA 2P95A 3A85A 1DWBH 1UTMA 1J16A 2F9OA 3EYDA 2GT7A 5JYIA 1KDQB 3SNBA 2HWLB 3U1JB 4X1PU 4DVAU 2Z6BD 1ELAA 5FAHA 1XXDA 2H5CA 1L1JA 3CS7A 1DVAH 5DK1A 4I33A 3SU6A 1MBQA 1THSH 1GDUA 1ZMNA 1WQVH 3SNCA 2OLGA 1Z6EA 2WYGA 5E0JA 2CJIA 3SW2B 2GZ7A 3MHWU 4ABFA 1HJAB 4I8HA 4U01A 5E2PA 1QL8A 3P8FA 1ZRKA 3BG4C 3SJ9A 3SORA 3ZVBA 1TX6A 3LKWA 1EAUA 3MMGA 3LH1A 2ZI2H 1UTPA 1HAYB 1NS3A 1O3OA 1GJDB 4MPUA 1BMAA 2J38A 2BYAX 1GPZA 2ZDAH 1WYKA 1PJPA 3P8GA 1O3CA 3S0NA 1KY9A 1ZHRA 1O34A 1XKAC 2BD4A 3H7TA 1O2XA 1T4UH 1SGYE 4Y6DA 5DP3A 4ABEA 4MPWA 3B23B 3VEQB 1SGFG 1FDPA 2PGBB 1L1GA 1NFWA 4K8YA 4CRBA 1IOEA 2IOTA 1EB1H 1S5SA 1YF4A 2HRVA 3SZNA 2STBE 1OOKB 5A2MH 1LQDB 2YNBA 1PPCE 1AN1E 1NFUA 1EUFA 1AVXA 2ILNA 3U1IB 2AS9A 1V2TT 2Z9IA 1ESAA 2XWBI 1T31A 4WH6A 2VVUA 4AORA 1H1BA 2HALA 2PKAB 1DXPA 1OYTH 2VIQA 3GDSA 1OX1A 1LHGH 1MTSA 3DFLA 2ZU4A 3SI3H 1DANH 3V12A 3RXBA 4Q80A 1BBRH 2Y5GA 1V2JT 1GVLA 3T27A 3DHKH 1LHFH 2GKVE 2ANWA 4K1EA 5K7RA 1CHOG 1A4WH 3FP6E 1K1LA 4O3UA 3RLYH 1KXFA 4AG1A 2G5NA 1EX3A 2KAIA 2CGAA 4DT7B 3FAOA 4BAOB 1BIOA 1C1UH 1TIOA 5GPIB 2A7HA 1DOJA 1GI5A 2O8TA 1BTXA 1V2KT 1KLTA 2RA0A 3ODDA 1NRQH 1BQYA 4CREA 2ZDMA 2FOFA 4AFSA 2SFAA 4OS7A 1FMGA 1G37A 1NRPH 5EXMA 3A87A 7ESTE 1IHTH 1GL0E 3F9FA 1O3JA 2XC4A 1D3DB 1A61H 5CE1A 4BAQB 2AGIX 2VIWA 4LZ4B 2ZCKP 1RS0A 3PLBA 5JBCS 5C2ZA 2UUYA 4X2VA 3DT0H 3RXTA 4OS6A 2BTCE 1K1MA 4FU8A 1ZSLA 1NC6A 4B2CA 2BQWB 3UNQA 2G4TA 5GCHF 2W7SA 1O2RA 4X1RU 3TGJE 1JXPA 2F3CE 3VB5A 5EPNA 2W3IA 2BXUH 2BY9X 4IN2A 5T6FA 1MTNB 4O3TA 1FY8E 1ETSH 3UWIA 2XBXA 1VGCB 5DKMA 4A92A 4Q7YA 2A4QA 1N8OC 1DLKB 2OP9A 3SQEE 3LONA 4TWWA 1UCYE 1BBRK 2XYAA 1QURH 2XBWA 4DJZB 5FX5A 1SHYA 2FIRH 3M5OA 4MQAA 2AERH 5I46H 2IPHA 1WTGH 1CE5A 2W26A 1AWHB 4K69A 6CHAC 3RXHA 3SHAH 5ABWA 2BY5X 3SU1A 2BQ6B 3SBKA 1A3BH 1F5RA 4A5TS 1CT0E 1GBBA 2ALVA 4B76A 1C5WB 1O39A 3UUZA 3P6ZB 1QJ7B 4YT6H 1GI0A 1P11E 3U8TH 5C5OA 1S85A 3LOXA 5FCKA 1KLIH 3BG4B 2OD3B 3E0PB 3M3TA 2QGRA 3FFGA 3P8OA 1C5YB 3RU4E 4M7GA 1GDQA 5H4IB 3TIUA 1GBFA 5FXLA 4K2YA 3B8JA 3TH3H 1PQ8A 2EC9H 1GBIA 1DY9A 2R2WU 1Z8RA 1TALA 2G51A 3KQCA 1NESE 1P9UA 1QY6A 3IWMA 1YGCH 2XC5A 3M3SA 5AF9H 1LO6A 3RXGA 1HDTH 5F8TA 4UDWH 1LDTT 1GI4A 1OPHB 4FUEA 4AFQA 4WH8A 5DP9A 3ELAH 1HRTH 1Y5BT 2ZWLH 1V2WT 1XUKA 2O8LA 2TGAA 4JZFH 4MNWA 1M9UA 1Z71A 1MKXK 2PW8H 4NZQA 5C1XA 2OQ5A 5JB9S 2BDBA 1GL1A 1O2YA 2OC7A 2Z3EA 1P03A 3ZVCA 4OGYA 4H6TA 3S9AA 5GJ4B 1H9LB 1KIGH 1W0ZU 1DUEA 5GIBA 5HM9A 1F5LA 3K6YA 3TGKE 1C2FA 1NO9H 1TMUH 3MO6A 4FU7A 1C1SA 1SGIB 2GDEH 2Y6TA 1DWDH 1IQNA 3ATLA 4UFDH 2PLXA 2CF8H 3A84A 3SGBE 5A8YA 3ZZDA 1K1JA 3UY9A 1EJAA 4K8BA 2ZDLA 2Q6GA 4B2BA 3STIA 4Y7BA 1DWCH 3BV9B 4NFEA 1K1OA 1Q2WA 2ZFFH 2BY7X 2ZFQH 1LCYA 4JZIA 3M61U 4DG4A 2B7DH 3Q00A 3SV6A 3K9XB 2ZC9H 3ZVGA 1HNEE 3S7KB 1V2NT 4BTIB 2R0LA 2RDLA 1O32A 2O9QA 4NA8A 3LGYA 1FIWA 1QHRB 1SBWA 2P16A 3FANA 1P12E 3V7TA 3TNTA 8LPRA 3SN8A 4MNVA 1PYTC 3F9GA 1Z8GA 3C27B 1ZYOA 4AYYB 1WBGB 3N7OA 1FUJA 1KYNA 3A81A 1E34B 4X6PA 1LKAA 1IQJA 2R0KA 1BRUP 3SUDA 3HGPA 2XCFA 2FX6A 4ZHAA 4K60A 1G32B 1O31A 3UOPA 1YYY1 4WXVA 1TBQH 1AE5A 2VWLA 3CP7A 3B9FH 2EI7A 3KCGH 1RRKA 4OS2A 1TNKA 1O3FA 3M7QA 1C2MA 3TLOA 1GHBF 2VWNA 2ZP0H 3L3TA 1BCUH 1G3BA 1A0HB 1B0FA 2AYWA 1C4U2 2NU0E 4J1YA 3TK6A 5TCCA 1Q3XA 1ZPZA 4KKDA 2ANKH 1OYQA 2Y80A 4F4OC 3OX7U 1Y8TA 1TQ0B 2C3SA 4XFQA 1N8OB 2HLCA 1MU6B 1QBNA 2DE8A 2XBVA 3A7ZA 3OTJE 1D4PB 2J94A 3JZ1B 1GMHF 1IQHA 3GY6A 1TMTH 1C1OA 1TNIA 1ARCA 2XC0A 1H8IH 4WY3A 1BRAA 3RDZA 4WF8A 1S82A 1VCPA 2ZDKA 6CHAB 1K1NA 1V2ST 5FBEA 1X7AC 1P2NA 3H5CB 3RXJA 1XUFA 1DICA 2KAIB 1O5FH 1O0DH 5SGAE 3GY8A 1TABE 5EPYA 1K9OE 5J4SA 4MNXA 3RXKA 4AOQA 2BVRH 2D1JA 1D6WA 3QUMP 5EQSA 1ESBA 2AGEX 3LGUA 4AG2A 3LU9B 1ZLRA 3T62A 1EASA 5ESBA 4ZH8A 4HFPB 1BMLA 1W14U 3PROA 1S6HA 5FHTA 1ZSKA 3BIVH 3RMMH 4ZHMU 4BAMB 1MAXA 3ZZ4A 3TU7H 1QL9A 4X2YA 4LOYH 1HJAC 2J34A 4XBCA 1AQ7A 1MQ5A 3EAJA 2BLOA 5HM2A 3BTEE 1F5KU 4B1TA 2RA3A 4BOHA 1Y3WA 5GCHG 3VB4A 2A5IA 3I78A 5FX6A 2ESTE 3BG8A 1KXAA 1SGFA 1C2JA 4X2WA 1HCGA 1T32A 4ISLA 1NPMA 1MU8B 1YPLH 1ELCA 1A1RA 1HAGE 4YOJA 1C2LA 3AVZA 5E0HA 1TMBH 4FUHA 3O8CA 1NTPA 3MNCA 1NN6A 1T4VH 4IC6A 1ZJKA 4ESTE 3RU4D 4CBNA 2ZHEH 2FTLE 1O5BB 4NWKA 2DUCA 1O38A 2XXLA 3OYPA 1FAKH 1Z8IB 2QXJA 2SGAA 1TGSZ 3F68H 3GY3A 3ZV8A 1P2OA 1NU7B 1KLJH 3A8AA 3UNSA 5EXNA 1A5HA 2CF9H 2JH5D 4Y8YA 1TGNA 4ZKNU 4Y0ZE 4IN1A 5PTPA 4R8TB 3K6ZA 2ZGBH 4JZEH 4F49A 1VITH 2BD3A 4X1QU 1V3XA 4RKJB 1LKBA 2VGCC 2BD5A 1O2MA 2HPPH 3M36A 2GZ9A 5BRRE 1C2EA 3RXRA 2OXSA 1SLUB 4DCDA 1LVYA 2BB4A 3VB3A 1CBWC 1V2MT 2NU4E 4AB8A 1JIRA 1FXYA 3MI4A 1A5GH 5EGMA 3LPRA 3MU1A 1V2PT 1FV9A 1O3AA 3M7UA 2A2QH 3QO6A 4MTBA 4U30A 1HFDA 3GYLB 2QN5T 3UREA 2VWOA 3EGKH 4UFFH 1TAWA 1A7SA 2V3HH 1OP0A 3RLWH 2TGTA 4D76A 1C5NH 2QV1A 1CVWH 4FUGA 1O2PA 4NSYA 4AX9H 2F9BH 2ZKSA 2F83A 5A0AE 1XKBC 1S81A 1IQMA 1J15A 1WAYB 3ATIA 1OP8A 1EJMA 2FI3E 2H9TH 5FPTA 1ZMLA 2QF3A 2P93A 5F03A 4IC5A 1UK4A 2P8OC 1MTUA 2FEQH 1GI7B 1SFIA 3V3MA 1TLDA 1SMFE 3Q76A 1ZPCA 4BNRA 3NPSA 2ZGCA 1KXCA 1AKSB 3V0XA 3A7VA 4GPGA 4YM9A 2WUCA 4IMQA 1T8LA 2ZFPH 2ZQ1A 1YPKH 1SGCA 1EOLA 1JIMA 4B73A 2WV5A 4BTUB 1BJUA 4NWLA 3SU3A 4IMZA 2VVCA 1HJ9A 2GVFA 1C5QA 1VR1H 1GI1A 2THFB 1GWAA 3KL6A 4FUCA 4ASHA 1W7GH 1TRMA 1C4Y2 3NUMA 1O5EH 1MMJN 4WMDA 1PQ5A 1GHBG 3RXFA 3TJOA 1WOFA 1TE0A 1AUTC 4GLYA 1YCPH 3MNXA 3PM3A 4UD9H 1K21H 1OP2A 1MCTA 2PFEA 2PR3A 6GCHG 3VXFH 3ZVEA 2GGVB 2BY6X 2GT8A 3AW1A 4SGBE 2HNTF 1H9IE 1CGJE 1S0RA 2BOKA 2H6MA 5GDSH 4MLFB 4Y10E 5A0BA 1GMHG 4WMFA 1Q31A 1O3HA 4THNH 1WQSA 1SGRE 2ZPSA 4YZUA 2ZTXA 1HBTH 3KHVA 1HB0B 1GHYH 2AEIH 8GCHG 1SFQB 3SNAA 1YLCA 1O3KA 1GJCB 4J2YB 3TH2H 2FX4A 1TA6A 1UVSH 1GG6C 5EG4A 4MPXA 2PSXA 2NWNA 3RC6A 4ABAA 2ZGXH 3ZZ9A 4ISHH 2J2UA 1MD8A 3T26A 2GV6A 1TBZH 4NGAH 2HGTH 3SNEA 2VGCB 4TPYA 4ZKOU 1C2DA 4X1NU 1HAPH 5FCRA 1EQ9A 1P09A 1EZUC 3I77A 4H42U 1EAIA 1GMDF 1QL7A 4ZXXH 1ELEE 3RC4A 3MO9A 1N1LA 1ZZZA 3TVJB 2R3YA 1P0SH 3FZZA 1CBWB 1C1PA 2VU8E 3ATMA 2BM2A 1GDNA 1O2SA 2FOHA 2BOHB 5EODA 1GI6A 1XVOA 3ESTA 2PGQB 4QT8C 5K0HA 1YCPK 3T29A 2ULLA 4GCHF 8ESTE 1DXWA 5LPEA 1SC8U 1K22H 1ELGA 1XXFA 4HI3A 3UTUH 1FLEE 2QF0A 4A1XA 3LGTA 1W7XH 3QX5H 3L6PA 2BDAA 2BLVA 4MG3A 5DP4A 1AB9B 2F9VA 1QB6A 5JBTA 3MU0A 1LHEH 1C5LH 1PQ7A 3MOCA 4XOJA 2UWOA 4ABDA 5C1UA 1GJ8B 3SU0A 3JZ2B 2Z94A 4K1SA 3VPKA 3MU8A 1YLDA 1SI5H 3T2NA 2G55A 4O97A 2VH6A 1TRYA 4PROA 1QA0A 3SJIA 5HYOA 3Q3XA 3TITA 5C3NA 1MKXH 3BTTE 3GY5A 1MBMA 5HMAA 1ELDE 1XVMA 1G2LA 2P8OB 4ABIA 1C5ZB 5CHAB 2QXIA 4ISIH 1MUEB 1P04A 1YC0A 1MD7A 1EPTB 1TONA 1GCTC 2H9HA 1SG8B 1CA8B 2ZPQA 3SQHE 1GBDA 3BTME 3OSYA 1O3GA 1QJ1B 1P05A 3SOSA 1GJ9B 2TIOA 1DDJA 3FVFB 2JKHA 1NRRH 3M35A 3RXCA 1BA8B 3S7HB 1C5MD 1RTLA 1SQOA 3PMBB 3Q3YA 3SU4A 2FPZA 4BAKB 4MDSA 5C20A 4GUXA 1V2VT 1KTSB 3SUGA 4AB9A 3LC3A 1SOTA 1V2RT 1W8BH 1EKBB 1GCDA 2NU3E 2O8WA 3CENA 1QJ6B 3P17H 4B71A 2Y82A 3P70B 3RMNH 4NIXA 1E38B 3UWJH 1L4DA 1WV7H 1LPGB 3E3TA 3O8DA 1O3LA 4FVBA 5EU8A 3GDUA 2ODPA 4WJG2 1MTVA 3EE0B 1PPZA 3IG6B 3TK9A 1CSOE 1PPGE 1ZGVA 3MFJA 2B0FA 2BDIA 2FOAA 2WPIS 2YOLA 1D3PB 2P94A 3ENSB 1ABJH 2ZGHA 1G30B 1WCZA 2WV4A 2A4RA 2OBQA 1ZSJA 4DIIH 1BJVA 1VJ9U 1NZQH 1KXEA 1HAXB 3RU4T 3A80A 4X8TH 1FNIA 1TPAE 1UVPA 1YPGH 3SUEA 2ZHFH 2IN2A 2FOMB 1EXFA 1HAVB 3W94A 3NXPA 1GG6B 2AGGX 1N6YA 4CHAC 1OS8A 2BMGB 2VH0A 4FU9A 2FOEA 4NIYA 3M5LA 1SGQE 2J92A 2UWPA 1OWKA 2BDYA 3UNRA 1MKWH 1KXBA 3A89A 1GJBB 4Y11E 2ZECA 1DSUA 4HTCH 4SGAE 1Z8JB 4JCNA 4BAHB 2P3FH 4AGKA 2C8XB 1NT1A 2ZF0H 1GVKB 4CR9A 1TPOA 3A8DA 1BUIA 3GDVA 4FXGH 1TGCA 1AO5A 4D9QA 1ANEA 3GYMA 4YO9A 1Y3YA 2XNIA 1OWJA 2BY8X 2JH6D 2R3UA 3URCA 1EZQA 1TA2A 4MNYA 4X6NA 3F9EA 5DGJA 3E6PH 5J4QA 5IYTA 1AKSA 5DG6A 3TPIZ 1GHXH 1OWEA 1P2JA 1BTWA 1SGEE 1F7ZA 1GJ6A 2ZDNA 4AFUA 3CS0A 2RG3A 1EB2A 1L0ZA 1RXPA 4HGCA 4K5ZA 1QBVH 3MH4A 3MU5A 4ZMAH 1A5IA 1GGDC 2ZQ2A 1C5OH 2PKSC 2FP7B 1BHXB 3AAVA 5AVDA 2FESH 5TCAA 2GX4A 1O5DH 2FOCA 3LGWA 1UTKA 2OINA 3UOUA 3SHCH 1FIZA 3UFAA 1QGFA 2QCYA 1SLVB 3RXEA 3UQVA 2FLRH 3MNSA 1UTQA 1VITF 1H8DH 3TJVA 3BEUA 2ZNKH 2FMJA 5A09A 1V6DA 1SGNE 3V13A 1LPZB 4ZKRU 3BTHE 3UPEA 4MVNA 6GCHF 7LPRA 4XSKU 1MKWK 1KSNA 3BTFE 1BBRE 3DD2H 1P3EA 1DUAA 2D8WA 3DUXH 3ODFA 1TX8A 2R9PA 1GMDG 1GCTB 1THPB 2EA3A 1C2HA 3Q77A 3GY2A 4DIHH 2QC2A 2BD2A 1EJNA 5A8XA 4HZHA 4A1VA 3UIRA 2PUQH 1C1TA 1IQIA 1OWDA 8GCHF 3RXSA 4ZXYH 1C2KA 1D3QB 2JETB 3RMOH 2EI8A 3KN2A 1A3EH 2A1DB 4GCHG 1SOZA 2BX4A 2SNWA 4KTUA 5LH8A 1CT4E 1C5TA 1XMNB 5DP5A 1BRBE 2OBOA 1BMNH 1C1MA 4NA7A 4JMYA 3D65E 3A7YA 1BB0B 1H4WA 1P2MA 2F9UA 1AD8H 2ZG0H 4YTAA 3RXAA 1DITH 4X2XA 2WYJA 1EZSC 1IQFA 1RD3B 2HOBA 2SGEE 4ZKSU 3K2UA 1YKTA 2C8ZB 3LDXH 2UUKB 2BDHA 1AZ8A 5A8ZA 1O2NA 3ZZ5A 3URDA 1ZHPA 2CXVA 1O3PB 2OUAA 4YT7H 4U2WA 4NFFA 5ESTE 5JPMH 1HIAA 3TNSA 1HAZB 2VVVA 1AU8A 4IGDA 4UE7H 3OU0A 5FPSA 3NCLA 2TRMA 1O2QA 3SV7A 4U32A 3VXEH 4O03A 2XTTB 1AMHA 2PSYA 5EOKA 1BITA 1FAXA 2BD9A 3RP2A 3RXPA 5CMXH 3SJ8A 4D7FA 2QXGA 2WPLS 2ZDVH 2AIPA 4E06H 2HNTE 4CHAB 4DGJA 3NWUA 2ZU2A 3QGJA 4NCYA 1MTWA 3E0NB 5AHGH 3UQOA 8KME2 1SHHB 2ZFSA 4AFZA 1F0SA 3LJJA 2A32A 4ZAEA 1QB9A 1XUJA 3A7WA 1A0JA 3LGIA 4ABHA 3E8LA 1K28D 1L2EA 2VB0A 4KP0A 4YOIA 1J9CH 1V2UT 2I6QA 2FYRA 2GZ8A 3LGVA 1O30A 5I25A 1JRTA 2VINA 1GI8B 2A2XH 3S69A 4I8GA 2AMDA 3ZZ7A 1NFXA 1W10U 1O5AB 2FI5E 1F0TA 3SU2A 2TGDA 2Q6DA 3ATKA 1W11U 1ZRBA 2Q6FA 1Y3UA 3VGCB 1EPTA 3ZZBA 2B5TB 1ELFA 1ABIH 2HVXA 3A7TA 1ELVA 3SI4H 1N6XA 1TFXA 1O2UA 1O2VA 3FP8E 3ZYEA 5F6MA 2FS8A 5ETXA 1O35A 3SUFA 1UVOA 3RXQA 2GCTC 3RXIA 3QN7A 1LHDH 2VIVA 2WINI 1B5GH 1QB1A 3PTNA 1GGDB 5AFZH 1UVTH 2PKSB 3D62A 3HK3B 2FLBH 3MH6A 2DE9A 1OWIA 1XM1A 1Y3XA 5HGGA 3U98H 3VFEA 1PQAA 5FPYA 2RCEA 4FUBA 1T8OA 3GICB 3VB6A 4X8UH 1NM6A 1TPPA 3HGNA 1UCYH 3ZVFA 2ZU3A 2Y81A 2YNAA 3NK8A 1SL3A 1W13U 3MNBA 1J8AA 1DT2A 2C8YB 2CN0H 3G01A 1ZTLA 2M5TA 3EQ0H 3QWCH 3R3GB 3D49H 1AB9C 1CA0C 1P9SA 1XX9A 4JYUH 2CHAC 1C2IA 2IJOB 2AIQA 1AFQC 1NY22 3KNXA 1HPGA 2VWMA 4Y71A 1QRZA 1GHAF 3RC5A 3SNDA 2F91A 1PPBH 2BZ6H 2W3KA 1BT7A 1G36A 2PWXA 2WPKS 4AGJA 1GBHA 2FM2A 1YPHE 1GJ5H 1HAVA 3KEEA 4BANB 1MQ6A 5B6OA 1FPCH 1RIWC 2AH4X 4OGXA 4X6MA 1EATA 2H2ZA 1LVMA 1NRNH 6ESTA 2XWAA 2ZU5A 2G81E 2V35A 3HATH 4X0WU 5CHAC 1BDAA 4ABJA 2OCVB 1P2KA 1WSSH 1A46H 1EPTC 2Z3DA 1S0QA 1C1WH 1CQQA 2GD4B 2AMQA 1SVPA 2I6SA 1J17T 1P01A 4ISNA 1O3NA 1AVGH 2ZGJA 3LJOA 3SV8A 2H5DA 1ELTA 1EP6A 2F9PA 3P8NA 1OSSA 1P57B 2BDGA 3QZRA 3ZZ8A 1L1NA 1E36B 1E35B 1TQ7B 1C9PA 4VGCC 3BIUH 2VNTA 3W95A 1ZTJA 1LQEA 1W3CA 2ZFRH 4A6LA 2FOBA 2VJ1A 3U9AH 4AYVB 1LTOA 4JYTA 1VITG 2FWWA 3KGPA 1UCYK 3LIWA 1O3MA 1PPFE 5BPEA 4INKA 3LT3A 1P06A 5LGOA 3ITIA 1HUTH 1C5PA 1C5XB 1XUIA 2ZA5A 4NIVA 3GISB 4XE4A 2OC8A 1UHBA 4CH2B 1T8MA 1GI3A 1G3CA 1V2OT 2PTCE 3QZQA 3RXVA 3HKIB 2FS9A 4CRGA 3STJA 2FYQA 2GP9B 2ZZUH 3RXLA 2GDDA 2Y7ZA 2O8UA 3KQDA 4BXWA 1LVBA 4ZROA 2QYIA 1TYNA 3GY7A 3AW0A 1OKXA 1TBRH 1CGIE 1YCPM 4WXIA 2OC0A 4GVUA 7GCHF 3D23A 4Q7XA 4DY7B 1E37B 3P92A 2ZU1A 1O3IA 3RMLH 4RN6A 1FN8A 6LPRA 1AHTH 3M3VA 2BLWA 1DX5M 1O5CB 4IS5A 2Y5FA 3SV9A 1QFKH 3M7TA 4NSVA 2ZCLP 1A2CH 1CO7E 3PO1B 2QA9E 1AFEH 1HXEH 2ODQA 4IBLH 4AZ2B 3KQBA 1TNHA 3A88A 3T28A 1DE7H 1Z6JH 1JWTA 1QRWA 4WVPE 2ZIQH 1UJ1A 2EI6A 1SR5C 2Z9JA 1P3CA 1S83A 1EOJA 2LNCA 4O9VA 1THRH 1JRSA 1QCPA 2GCTB 2A7CA 1RGQA 4H6SB 3I29A 1AE8H 5IDKA 1K1PA 1TRNA 1QR3E 1S84A 3P95A 1GVZA 2XCNA 2ZCHP 4I8LA 3A7XA 1HIAB 1CT2E 3SJKA 1MH0A 4BTTB 1TGBA 3GCTF 1O2GH 5FBIA 3EDXB 3SV2H 3MYWA 3TGIE 1GBCA 3ZVAA 1TNGA 1ANBA 4TWYA 1O37A 3RXOA 1AUJA 3F6UH 2PV9B 2ANYA 4BXSA 3TJUA 3MO3A 1HJ8A 4KGAA 1GHVH 3T25A 1F0UA 3M37A 1BTUA 1NROH 1CA0B 3QLPH 4KTCA 1ANCA 2CHAB 1JOUB 2OQUA 3C1KA 5T6DA 4Y8ZA 2A0QB 2ZPRA 2WPJS 3L33A 4GHQA 1XUGA 5EXLA 1AFQB 2C8WB 2D26C 2B9LA 2SGQE 1GJAB 2A31A 4IW4E 1HAOH 2ALPA 3E16B 4YLQH 4Y76A 3PV4A 1V2LT 1OWHA 5JDUB 4Y0YE 3AAUA 2FZZA 1HLTH 2G00A 4CRCA 3ZZAA 3ZZCA 4CR5A 3M5MA 4A7IB 1RIWB 4I31A 4E7NA 4A1TA 1GBJA 4D8NA 2UWLA 1ORFA 1UTJA 4CRAA 5DO4H 1QQUA 3EA8A 1IAUA 4Q2KA 4B2AA 1SPJA 2ZEBA 2G5VA 1IQKA 2FO9A 4ZHLU 3TJNA 4FUJA 2A5AA 4CH8B 1NFYA 1O2TA 3SU5A 3BTQE 5T3HA 5L2YH 4WMEA 1DS2E 4X8SH 1SGTA 5LPRA 2D2DA 5C5NA 1K1IA 5JBAS 2HNTC 2BVSH 2WUBA 4ISOA 5GXPA 4E7RG 3UR6A 1ESTA 1DWEH 2JETC 3A86A 4TPIZ 4Y79A 1SQTA 1Z7KA 2UUFB 2BXTH 4VGCB 1O2JA 4WWYA 3PMJA 3PTBA 4NZLA 2V3OH 2ZFTA 3O8BA 1A0LA 1FI8A 2NU1E 5L30H 1KXDA 1ETRH 3U8OH 3MH7A 2GTBA 1VZQH 3SJOA 2BDCA 2CMYA 2JH0D 1GHZA 1GJ4H 2PUXB 5EQQA 4OS5A 1EAXA 1TX7A 1J14A 1JBUH 2PHBA 1LMWB 2AMPA 1YM0A 4Z6AH 2GCHF 4FUFA 3SGQE 3TK5A 5A0CA 2SGFE 1O2IA 1PPHE 1WTHD 1ZPBA 1FJSA 1O33A 1GHAG 1FONA 4I8JA 2J95A 1C5RA 3NKKA 3F1SB 3BSQA 4CBOA 1RJXB 1C5VA 3BEFB 5HXFA 1FZZA 1PYTD 3OY6U 4XBBA 1T7CA 2BLQA 2QXHA 1QRXA 1G2MA 2GMTC 1Y59T 4ZUHA 1SSXA 1L4ZA 2Y7XA 3PWCA 4K3JA 4FUDA 4D7GA 1YPEH 1UTNA 1ZMJA 1GMCF 3GCNA 1C1NA 3A8BA 3BN9A 4YLUA 4I8KA 3SGAE 1O2LA 4Y7AA 3QGNB 3QDZB 1BTPA 3KF2A 4JYVH 4YESB 1BTZA 2P3TB 2TGPZ 1HAHH 1GBTA 1O2ZA 2FODA 2UUJB 2ODYB 4MPVA 5E2OA 9ESTA 1HV7A 1YBWA 5E8EH 5E0GA 3HKJB 1CHGA 4GAWA 3BF6H 1XUHA 1P10A 2QIQA 4KELA 2XRCA 2V6NA 2Y5HA 3Q3KA 4JK5A 1BOQA 1GBKA 1BZXE 1OXGA 1ID5H 3VGCC 1QA7A 3KIDU 2AFQB 1RFNA 4I7YH 1INCA 1GI9B 1TWXB 3ZZ6A 3GOVB 1PPEE 1QIXB 1FY1A 2BHGA 1UVUH 1YPHC 3F9HA 1TOMH 1WU1A 1MZDA 4NA9H 3FZDA 1VCWA 1UHBB 1C1RA 2TBSA 5DJ7A 1ETTH 1B7XB 1YPMH 2BVXH 1ZTKA 7GCHG 4UEHH 1GJ7B 2QAAA 1KDQA 1HAIH 4D9RA 2VIOA 4XBDA 4JK6A 2A7JA 4YOGA 1W0YH 1ZGIA 3BTWE 1Y5UT 5DP6A 3RXUA 4OS4A 1C4V2 2FTMA 1AGJA 1JMOH 1VCQA 1O5GH 3HPTB 4X1SU 3A83A 1SLXB 3O8RA 3OY5U 2H1UA 3H7OA 4TY6A 5C1YA 3E91A 2R2MB 5DP8A 3RXMA 1MCVA 2ZHDA 1K2I1 1FY5A 1F92A 3LH3A 5EW1H 1IQGA 5GWZA 1BRCE 2SNVA 3U69H 1RTFB 1TB6H 4GSOA 1O2OA 5F8ZA 2G4UA 4LXBH 3PWBA 5G4BA 4Z0KA 1SGDE 2V0BA 3PLPA 1C2GA 2Z7FE 3SO3A 1Y3VA 2ZTZA 3GCHC 1MAYA 4UFGH 1FY4A 2G52A 3GCTG 4JZ1A 4K1TA 3BTKE 5LPFA 1AI8H 1EZXC 3RUOA 1D3TB 1W12U 3EA7A 2BZAA 3A8CA 5TJXA 3PLKA 2Z3CA 1AZZA 1B0EA 4LZ1H 5EQRA 2OC1A 3BEIB 1O2WA 3RM2H 2VIPA 1MZAA 3ZV9A 4DOQA 1G3DA 1QTFA 3ZVDA 4TYDA 2A5KA 3ATWA 4R0IA 1LVOA 2BX3A 7KMEH 4NIWA 5L6NH 3KQEA 2PKAA 1TNJA 1UO6A 3BTGE 1VJAU 3FP7E 1C5SA 1W2KH 3NZIA 2P59A 3EA9A 2B8OH 1QQ4A 1DSTA 1FPHH 4FUIA 1Z1JA 1NRSH 2WPHS 1UMAH
chains in the Genus database with same CATH superfamily
1AY6H 1PFXC 3OEHD 4LK4A 2GMTB 2GV7A 1UK3A 1C9TA 1GBEA 1H9HE 1TPSA 3TH4H 3E1XB 3QTOH 3U8RH 1YPJH 2XW9A 2HPQH 3MTYA 3AASA 5L2ZH 1NU9A 2CV3A 1AWFH 1CHOF 5CHBA 2NU2E 3K65B 2WZQA 1C1QA 5JBBS 1IQLA 2PTNA 1QBOA 4RSPA 2Z9LA 2FDAA 4CRFA 1KTTB 5FL7D 1ACBE 2SGDE 2KCPA 3SYJA 1AVWA 1QNJA 4RKOB 5C67A 1ZR0A 4B75A 1C5UA 3ZZ3A 4FVDA 1ZJDA 1GI2A 2QF5A 1TNLA 2STAE 1F0RA 4INHA 2G8TA 3IITA 4JZDH 1P2QA 5DN6D 4ABBA 5JB8S 2J4IA 2C90B 1ZHMA 4KTSA 1FN6A 3PO1C 9LPRA 4Y8XA 4OM9A 1EAWA 4Q7ZA 1O2HA 4UONA 1IQEA 5DPAA 3RM0H 2ZHQH 1FQ3A 3PB1E 2LPRA 3M5NA 2GCHG 3VG8A 2ASUB 1CGHA 3DFJA 1TGTA 1DM4B 1WUNH 2C93B 2XBYA 1CU1A 3UR9A 1ZOMA 2QY0B 1F2SE 1FY3A 1P8VC 4X6OA 2FOGA 1UTOA 1ANDA 3VB7A 1P02A 2J9NA 2A4OA 3S9BA 2ZTYA 3OFND 1LPKB 2K1QA 2W5EA 3PMAB 4H4FA 1G9IE 1S6FA 3PMHB 3MWIU 1LHCH 3GY4A 1DLEA 4F48B 1O36A 1O2KA 1O3BA 1GMCG 1D6RA 3HK6B 2Q1JA 3QK1A 1BMMH 2A45B 2ZHWH 5T6GA 1GHWH 1SGPE 4E05H 2VIDA 2ANMH 1BTYA 1SB1H 3BTDE 4GHTA 4INLA 2FI4E 3MH5A 1O3DA 1GBAA 1U6QA 1HGTH 1SLWB 4XDEA 5EW2H 3WY8A 3R0FA 1O3EA 2EQNA 2W7UA 4TY7A 4I32A 2EEKA 4UFEH 1UTLM 2BD8A 3PYHA 3MU4A 4DURA 1ELBA 2RDEA 1GBMA 2P3UB 3A82A 1BTHH 3DA9B 2WPMS 1EP5A 2ZO3H 1D9IA 1VKYA 3GCHB 2LP6A 1YP9A 3ZYDA 4ABGA 1DY8A 3N7EA 2SGPE 3T5FH 3LC5A 1IHSH 1Y5AT 1V2QT 1RTKA 4OS1A 4DW2U 2H9EH 2A4GA 4B74A 1E0FD 3GCOA 4X8VH 1UK2A 2TPIZ 1EFRD 3S9CA 3E90B 1C1VH 3RXDA 4AN7A 1DPOA 2FXRA 1HYLA 2C4FH 5DP7A 1GBLA 1P2IA 1TOCB 5AFYH 5F8XA 1SQAA 4CRDA 4NG9H 2BQ7B 1AIXH 1Z1IA 2O8MA 1MTNC 2BD7A 1G3EA 3QTVH 2F9NA 2Z9GA 1HXFH 2Z9KA 1ARBA 1VGCC 1BHXF 1T8NA 1DFPA 2OTVA 2P95A 3A85A 1DWBH 1UTMA 1J16A 2F9OA 3EYDA 3KYGA 2GT7A 5JYIA 1KDQB 3SNBA 2HWLB 3U1JB 4X1PU 4DVAU 2Z6BD 1ELAA 5FAHA 1XXDA 2H5CA 1L1JA 3CS7A 1DVAH 5DK1A 4I33A 3SU6A 1MBQA 1THSH 1GDUA 1ZMNA 1WQVH 3SNCA 3PV2A 2OLGA 1Z6EA 2WYGA 5E0JA 2CJIA 3SW2B 2GZ7A 3MHWU 4ABFA 1HJAB 4I8HA 4U01A 5E2PA 1QL8A 3P8FA 1ZRKA 3BG4C 3SJ9A 3SORA 4ASUD 3ZVBA 1TX6A 3LKWA 3F3BA 1EAUA 3MMGA 3LH1A 2ZI2H 1UTPA 1HAYB 1KMHB 1NS3A 1O3OA 1GJDB 2J97A 4MPUA 1BMAA 2J38A 2BYAX 1GPZA 2ZDAH 1WYKA 1PJPA 3P8GA 1O3CA 3S0NA 1KY9A 1ZHRA 1O34A 1XKAC 2BD4A 3H7TA 1O2XA 1T4UH 1SGYE 4Y6DA 5DP3A 4ABEA 2W6JD 2M2AA 4MPWA 3B23B 3VEQB 1SGFG 1FDPA 2PGBB 1L1GA 1NFWA 4K8YA 4CRBA 1IOEA 2IOTA 1EB1H 1S5SA 1YF4A 2HRVA 3SZNA 2STBE 1OOKB 5A2MH 4ACBA 1LQDB 2YNBA 1PPCE 1AN1E 1NFUA 1EUFA 1AVXA 2ILNA 3U1IB 2AS9A 1V2TT 2Z9IA 4ZCNA 1ESAA 2XWBI 1T31A 4WH6A 2VVUA 4AORA 1MABB 1H1BA 2HALA 2PKAB 1DXPA 1OYTH 2VIQA 3GDSA 1OX1A 1LHGH 1MTSA 3GS9A 3DFLA 2ZU4A 3SI3H 1DANH 3V12A 3RXBA 4Q80A 1BBRH 2Y5GA 4P02A 1V2JT 1GVLA 3T27A 3DHKH 1LHFH 4ACAA 2GKVE 3UAIC 2ANWA 4K1EA 5K7RA 1CHOG 1A4WH 3FP6E 1K1LA 4O3UA 3RLYH 1KXFA 4AG1A 2G5NA 1EX3A 2WHXA 2KAIA 2CGAA 4DT7B 3FAOA 4BAOB 1BIOA 1C1UH 1TIOA 5GPIB 2A7HA 1DOJA 1GI5A 2O8TA 1BTXA 1V2KT 1KLTA 1COWD 2RA0A 3ODDA 1NRQH 1BQYA 4CREA 2ZDMA 2FOFA 4AFSA 2SFAA 4OS7A 1FMGA 1G37A 1NRPH 5EXMA 3A87A 7ESTE 1IHTH 1GL0E 3F9FA 1O3JA 2XC4A 1D3DB 1A61H 5CE1A 4BAQB 2AGIX 2VIWA 4LZ4B 2ZCKP 1RS0A 3PLBA 5JBCS 5C2ZA 2UUYA 4X2VA 3DT0H 3RXTA 4OS6A 2BTCE 1K1MA 4FU8A 1ZSLA 1NC6A 4B2CA 2BQWB 3UNQA 2G4TA 5GCHF 2CK3D 2W7SA 1O2RA 4X1RU 3TGJE 1JXPA 2F3CE 3VB5A 5EPNA 2W3IA 2BXUH 2BY9X 4IN2A 5T6FA 1MTNB 4O3TA 1FY8E 1ETSH 3UWIA 2XBXA 1VGCB 5DKMA 4A92A 4Q7YA 2A4QA 1N8OC 1DLKB 2OP9A 3SQEE 3LONA 4TWWA 1UCYE 1BBRK 2XYAA 1QURH 2XBWA 4DJZB 5FX5A 1SHYA 2FIRH 3M5OA 4MQAA 2AERH 4HG6A 5I46H 2IPHA 1WTGH 1CE5A 2W26A 1AWHB 3W1EA 4K69A 6CHAC 3RXHA 3SHAH 5ABWA 5KECA 5C17A 2BY5X 3UB0A 3SU1A 2BQ6B 3SBKA 1A3BH 1F5RA 4A5TS 1CT0E 1GBBA 2ALVA 4TT3D 4B76A 1C5WB 1O39A 3UUZA 3P6ZB 1QJ7B 4YT6H 1GI0A 1P11E 3U8TH 5C5OA 4RT0A 1S85A 3LOXA 5FCKA 1KLIH 3BG4B 2OD3B 3E0PB 3M3TA 2QGRA 3FFGA 3P8OA 1C5YB 3RU4E 2HVYB 4M7GA 1GDQA 5H4IB 3TIUA 1GBFA 1YY3A 5FXLA 4K2YA 3B8JA 3TH3H 1PQ8A 2EC9H 1GBIA 1DY9A 2R2WU 1Z8RA 1TALA 2G51A 3KQCA 1NESE 1P9UA 1QY6A 3IWMA 1YGCH 2XC5A 3M3SA 5AF9H 1LO6A 3RXGA 1HDTH 5F8TA 4UDWH 1LDTT 1GI4A 1OPHB 4FUEA 4AFQA 4WH8A 5DP9A 3ELAH 1HRTH 1Y5BT 2ZWLH 1V2WT 1XUKA 2O8LA 2TGAA 3N7DA 1SQRA 4JZFH 1M9UA 4MNWA 1Z71A 1MKXK 2PW8H 4NZQA 5C1XA 2OQ5A 5JB9S 2BDBA 1GL1A 1O2YA 2OC7A 2Z3EA 1P03A 3ZVCA 4OGYA 4H6TA 3S9AA 5GJ4B 1H9LB 1KIGH 1W0ZU 1DUEA 5GIBA 5HM9A 1F5LA 3K6YA 2KFWA 3TGKE 1C2FA 1NO9H 1TMUH 3MO6A 4FU7A 1C1SA 1SGIB 2GDEH 2Y6TA 1DWDH 1IQNA 3ATLA 4UFDH 2PLXA 2CF8H 3A84A 3SGBE 5A8YA 3ZZDA 1K1JA 3UY9A 3MQKC 1EJAA 1W0JD 4K8BA 2ZDLA 2Q6GA 4B2BA 3STIA 4Y7BA 1DWCH 3BV9B 4NFEA 2XNDD 1K1OA 1Q2WA 1E1QD 2ZFFH 2BY7X 2ZFQH 1LCYA 4JZIA 3M61U 4DG4A 2B7DH 3Q00A 3SV6A 3K9XB 2ZC9H 3ZVGA 1HNEE 3S7KB 1V2NT 4BTIB 2R0LA 2RDLA 1O32A 2O9QA 4NA8A 3FO8D 3LGYA 1FIWA 1QHRB 1SBWA 2P16A 3FANA 1P12E 3V7TA 3TNTA 8LPRA 3SN8A 4MNVA 1PYTC 3F9GA 1Z8GA 3C27B 1ZYOA 4AYYB 1WBGB 3N7OA 1FUJA 1KYNA 3A81A 1E34B 4X6PA 1LKAA 1IQJA 2R0KA 1BRUP 3SUDA 3HGPA 2XCFA 2FX6A 4ZHAA 4K60A 1G32B 1O31A 3UOPA 1YYY1 4WXVA 5CDFE 1TBQH 1AE5A 2VWLA 3CP7A 3B9FH 2EI7A 3KCGH 1RRKA 4OS2A 1TNKA 1O3FA 3M7QA 1C2MA 3TLOA 1GHBF 2VWNA 2ZP0H 3L3TA 4FOUC 1BCUH 1G3BA 1A0HB 1B0FA 2AYWA 1C4U2 2NU0E 4J1YA 3TK6A 5TCCA 1Q3XA 1ZPZA 4KKDA 1E1RD 2ANKH 1OYQA 2Y80A 4F4OC 3OE7D 3OX7U 1Y8TA 1TQ0B 2C3SA 4XFQA 1N8OB 2HLCA 1MU6B 1QBNA 2DE8A 2XBVA 3A7ZA 3OTJE 1D4PB 2J94A 3JZ1B 1GMHF 1IQHA 3GY6A 1TMTH 1C1OA 1TNIA 1ARCA 2XC0A 1H8IH 4WY3A 1BRAA 3RDZA 4WF8A 1S82A 1VCPA 2ZDKA 6CHAB 1K1NA 1V2ST 5FBEA 1X7AC 1P2NA 3H5CB 4FETA 3RXJA 1XUFA 1DICA 2KAIB 1O5FH 1O0DH 5SGAE 3GY8A 1TABE 5EPYA 1K9OE 5J4SA 4MNXA 3RXKA 4RT1A 4AOQA 2BVRH 2D1JA 1D6WA 3QUMP 5EQSA 1ESBA 2AGEX 3LGUA 4AG2A 3LU9B 1ZLRA 3T62A 1EASA 5ESBA 4ZH8A 1NBMD 3NRLA 4HFPB 1BMLA 1W14U 3PROA 1S6HA 3FOAA 5FHTA 1ZSKA 3BIVH 3RMMH 4ZHMU 4BAMB 1MAXA 3ZZ4A 3TU7H 1QL9A 4X2YA 4LOYH 1HJAC 2J34A 4XBCA 1AQ7A 1MQ5A 3EAJA 2BLOA 5HM2A 3BTEE 1F5KU 4B1TA 4F55A 2RA3A 4BOHA 1Y3WA 5GCHG 2EY4C 3VB4A 2A5IA 3I78A 5FX6A 2ESTE 3BG8A 1KXAA 1SGFA 1C2JA 4X2WA 1HCGA 1T32A 4ISLA 1NPMA 2RFKC 1MU8B 1YPLH 1ELCA 1A1RA 1HAGE 4YOJA 2KM0A 1C2LA 3AVZA 5E0HA 3DCLA 1TMBH 4FUHA 3O8CA 1NTPA 3MNCA 1NN6A 1T4VH 4IC6A 1ZJKA 4ESTE 3RU4D 4CBNA 2ZHEH 1YWUA 2FTLE 1O5BB 4NWKA 2DUCA 1O38A 2XXLA 3OYPA 1FAKH 1Z8IB 2QXJA 2SGAA 1TGSZ 3F68H 3GY3A 3ZV8A 1P2OA 1NU7B 1KLJH 3A8AA 3UNSA 5EXNA 1A5HA 2CF9H 2JH5D 4Y8YA 1TGNA 4ZKNU 4Y0ZE 4IN1A 5PTPA 4R8TB 3K6ZA 2ZGBH 4JZEH 4F49A 1VITH 2BD3A 4X1QU 5B6LA 1V3XA 4RKJB 1LKBA 2VGCC 2BD5A 1O2MA 2HPPH 3M36A 2GZ9A 5BRRE 1C2EA 3RXRA 2OXSA 1SLUB 4DCDA 1LVYA 2BB4A 3VB3A 1CBWC 1V2MT 2NU4E 4AB8A 1JIRA 1FXYA 3MI4A 1A5GH 5EGMA 3LPRA 3MU1A 1V2PT 1FV9A 1O3AA 3M7UA 2A2QH 3QO6A 1S6LA 4MTBA 4U30A 1HFDA 3GYLB 2QN5T 3UREA 2VWOA 3EGKH 4UFFH 1TAWA 1A7SA 2V3HH 1OP0A 3RLWH 2TGTA 4D76A 1C5NH 2QV1A 1CVWH 4FUGA 1O2PA 4NSYA 4AX9H 2F9BH 2ZKSA 2F83A 5A0AE 1XKBC 1S81A 1IQMA 1J15A 1WAYB 3ATIA 1OP8A 1EJMA 2FI3E 2H9TH 5FPTA 1ZMLA 2QF3A 2P93A 5F03A 4IC5A 1UK4A 2P8OC 1MTUA 2FEQH 1GI7B 1SFIA 1QZ8A 3V3MA 1TLDA 1SMFE 3Q76A 1ZPCA 4BNRA 3NPSA 2ZGCA 1KXCA 1AKSB 3V0XA 3A7VA 4GPGA 3ZIAD 4YM9A 2WUCA 4IMQA 1T8LA 2ZFPH 2ZQ1A 1YPKH 1SGCA 1EOLA 1JIMA 4B73A 2WV5A 4BTUB 1BJUA 4NWLA 3SU3A 4IMZA 2VVCA 1HJ9A 2GVFA 5EJLA 1C5QA 4Q4LA 1VR1H 1GI1A 2THFB 1GWAA 3KL6A 4FUCA 4ASHA 1W7GH 1TRMA 1C4Y2 3NUMA 3WWBA 1O5EH 3CNRA 1MMJN 4WMDA 1PQ5A 1GHBG 3RXFA 3TJOA 2XOKD 1WOFA 1TE0A 1AUTC 4GLYA 1YCPH 3MNXA 3PM3A 4UD9H 1K21H 1OP2A 1MCTA 2PFEA 2PR3A 6GCHG 3VXFH 3ZVEA 2GGVB 2BY6X 2GT8A 5IK2D 3AW1A 4SGBE 2HNTF 1H9IE 1CGJE 1S0RA 2BOKA 2H6MA 5GDSH 2GJGA 3F2FA 4MLFB 4Y10E 5A0BA 1GMHG 4WMFA 3F2GA 1Q31A 1O3HA 1FX0B 1WQSA 4THNH 1SGRE 2ZPSA 4YZUA 4B6EA 2ZTXA 1HBTH 3KHVA 1HB0B 1GHYH 2AEIH 8GCHG 1SFQB 3SNAA 1YLCA 5KEDA 1O3KA 1GJCB 4J2YB 3TH2H 2FX4A 1TA6A 1UVSH 3AK5A 1GG6C 5EG4A 4MPXA 2PSXA 2NWNA 3RC6A 4ABAA 2ZGXH 4RI0A 3ZZ9A 4ISHH 2J2UA 1MD8A 3T26A 2GV6A 1TBZH 4NGAH 2HGTH 3SNEA 2VGCB 4TPYA 3N99A 4ZKOU 1C2DA 4X1NU 1HAPH 5FCRA 1EQ9A 3SZEA 1P09A 1EZUC 3I77A 4H42U 1EAIA 1GMDF 1QL7A 4ZXXH 1ELEE 3EE7A 3RC4A 3MO9A 1N1LA 1OHHD 1ZZZA 3TVJB 2R3YA 3WW7A 1P0SH 3FZZA 1CBWB 1C1PA 2VU8E 3ATMA 2BM2A 1GDNA 1O2SA 2FOHA 2BOHB 5EODA 1WXRA 1GI6A 1XVOA 3ESTA 2PGQB 4QT8C 5K0HA 1YCPK 3T29A 2ULLA 4GCHF 8ESTE 1DXWA 5LPEA 1SC8U 1K22H 1ELGA 1XXFA 4HI3A 3UTUH 1FLEE 2QF0A 4A1XA 3LGTA 1W7XH 3QX5H 3L6PA 2BDAA 2BLVA 4MG3A 5DP4A 1AB9B 2F9VA 1QB6A 5JBTA 3MU0A 1LHEH 1C5LH 1PQ7A 3MOCA 4XOJA 2UWOA 4ABDA 5C1UA 1GJ8B 3SU0A 3JZ2B 2Z94A 4K1SA 3VPKA 3MU8A 1YLDA 1SI5H 3T2NA 2G55A 4O97A 2VH6A 1TRYA 4PROA 1QA0A 3SJIA 5HYOA 4DT4A 3Q3XA 3TITA 5C3NA 1MKXH 3BTTE 3GY5A 1MBMA 1NBME 4P00A 5HMAA 1ELDE 1XVMA 1G2LA 2P8OB 4ABIA 1C5ZB 5CHAB 2QXIA 4ISIH 1MUEB 1P04A 1YC0A 1MD7A 1EPTB 1TONA 1GCTC 2H9HA 1SG8B 1CA8B 2ZPQA 3SQHE 1GBDA 3BTME 3OSYA 1O3GA 3DSGA 1QJ1B 1P05A 3SOSA 5C0TA 1GJ9B 2TIOA 1DDJA 3FVFB 2JKHA 1NRRH 3M35A 3RXCA 1BA8B 3S7HB 1C5MD 1RTLA 1SQOA 3PMBB 3Q3YA 3SU4A 2FPZA 4BAKB 4MDSA 5C20A 4GUXA 1V2VT 1KTSB 3U28C 3SUGA 4AB9A 3LC3A 1SOTA 1V2RT 1W8BH 1EKBB 1GCDA 2NU3E 2O8WA 5EJZA 3CENA 1QJ6B 3P17H 4B71A 2Y82A 3OEED 3P70B 3RMNH 4NIXA 1E38B 3UWJH 1L4DA 1WV7H 1LPGB 3E3TA 3O8DA 3F2HA 1O3LA 4FVBA 5EU8A 3GDUA 2ODPA 2W6ID 4WJG2 1MTVA 3EE0B 1PPZA 4XD7D 3IG6B 3TK9A 2V7QD 1CSOE 1PPGE 1ZGVA 3MFJA 2B0FA 2BDIA 2FOAA 1BMFD 2WPIS 1D3PB 2YOLA 4B6FA 2P94A 3ENSB 1ABJH 2ZGHA 1G30B 1WCZA 2WV4A 2A4RA 2OBQA 1ZSJA 4DIIH 1BJVA 1VJ9U 1NZQH 1KXEA 1HAXB 3RU4T 3A80A 4X8TH 1FNIA 1TPAE 1UVPA 1YPGH 3SUEA 2ZHFH 2IN2A 2FOMB 1EXFA 1HAVB 3W94A 3NXPA 3FN8A 1GG6B 2AGGX 1N6YA 4CHAC 1OS8A 3PRBA 2BMGB 2VH0A 4FU9A 2FOEA 4NIYA 3M5LA 1SGQE 2J92A 2UWPA 1OWKA 2BDYA 3UNRA 1MKWH 1KXBA 3A89A 1GJBB 4Y11E 2ZECA 1DSUA 3OAAD 4HTCH 4SGAE 1Z8JB 4JCNA 4BAHB 2P3FH 4AGKA 2C8XB 1NT1A 2ZF0H 2J5UA 1GVKB 4CR9A 1TPOA 3A8DA 1BUIA 3GDVA 4FXGH 1TGCA 5C0UA 1AO5A 4D9QA 4XRNA 1ANEA 3GYMA 4YO9A 1Y3YA 2XNIA 1OWJA 2BY8X 2JH6D 2R3UA 3URCA 1EZQA 1TA2A 4MNYA 4X6NA 3F9EA 5DGJA 3E6PH 5J4QA 5IYTA 1AKSA 5DG6A 3TPIZ 1GHXH 3DSPA 1OWEA 1P2JA 1BTWA 1SGEE 1F7ZA 1GJ6A 2ZDNA 4AFUA 5F53A 3CS0A 2RG3A 1EB2A 1L0ZA 1RXPA 4HGCA 4K5ZA 1QBVH 3MH4A 3MU5A 4ZMAH 1A5IA 1GGDC 2ZQ2A 1C5OH 2PKSC 2FP7B 1BHXB 3AAVA 5AVDA 2FESH 5TCAA 2F4LA 2GX4A 1O5DH 2FOCA 3LGWA 1UTKA 2J98A 2OINA 3UOUA 3SHCH 1FIZA 3UFAA 1QGFA 2QCYA 1SLVB 3RXEA 3UQVA 2FLRH 3MNSA 1UTQA 5T1VA 1VITF 4AC9A 1H8DH 3TJVA 3BEUA 2ZNKH 2FMJA 5A09A 1V6DA 1SGNE 3V13A 1LPZB 4ZKRU 3BTHE 3UPEA 4MVNA 1W0KD 6GCHF 7LPRA 4XSKU 1MKWK 1KSNA 3BTFE 1BBRE 3DD2H 1P3EA 1DUAA 2IPQX 2D8WA 3DUXH 3ODFA 1TX8A 2R9PA 1GMDG 2WPDD 1GCTB 1THPB 2EA3A 1C2HA 3Q77A 3GY2A 4DIHH 2QC2A 2BD2A 1EJNA 5A8XA 4HZHA 4I86A 4A1VA 3UIRA 2PUQH 1C1TA 1IQIA 1E79D 1OWDA 8GCHF 3RXSA 4ZXYH 1C2KA 1D3QB 2JETB 3RMOH 2EI8A 3KN2A 1A3EH 2A1DB 4GCHG 1SOZA 2BX4A 2SNWA 4KTUA 5LH8A 1CT4E 1C5TA 1XMNB 5DP5A 1BRBE 2OBOA 1BMNH 1C1MA 4NA7A 4JMYA 3D65E 3A7YA 1BB0B 1H4WA 1P2MA 2F9UA 1AD8H 2ZG0H 4YTAA 3RXAA 1DITH 4X2XA 2WYJA 1EZSC 1IQFA 1RD3B 2HOBA 2SGEE 4ZKSU 3K2UA 1YKTA 2C8ZB 3LDXH 2UUKB 2BDHA 1AZ8A 5A8ZA 1O2NA 3ZZ5A 3URDA 1ZHPA 2CXVA 1O3PB 2OUAA 4YT7H 4U2WA 4NFFA 5ESTE 5JPMH 1HIAA 3TNSA 1HAZB 2VVVA 1AU8A 4IGDA 4UE7H 3OU0A 5FPSA 3NCLA 2TRMA 1O2QA 3SV7A 4U32A 3VXEH 4O03A 2XTTB 1AMHA 2PSYA 5EOKA 1BITA 1FAXA 2BD9A 3RP2A 3RXPA 5CMXH 4TSFD 3SJ8A 4D7FA 2QXGA 2WPLS 2ZDVH 2AIPA 4E06H 2HNTE 4CHAB 4DGJA 3NWUA 2ZU2A 3QGJA 4NCYA 1MTWA 3E0NB 5AHGH 5HIYA 3UQOA 8KME2 1SHHB 2ZFSA 4AFZA 1YLNA 1F0SA 3LJJA 2A32A 4Z1MD 4ZAEA 1QB9A 1XUJA 3A7WA 1A0JA 3LGIA 4ABHA 3E8LA 1K28D 1L2EA 2VB0A 4KP0A 4YOIA 1J9CH 1V2UT 2AHME 2I6QA 2FYRA 2V3MA 2GZ8A 3LGVA 1O30A 5I25A 5C94A 1JRTA 2VINA 1GI8B 3FKSD 2A2XH 3S69A 4I8GA 2AMDA 3ZZ7A 1NFXA 1W10U 1O5AB 2FI5E 1F0TA 3SU2A 2TGDA 2Q6DA 3ATKA 1W11U 1ZRBA 2Q6FA 1Y3UA 3VGCB 1EPTA 3ZZBA 2B5TB 1ELFA 1ABIH 2HVXA 3A7TA 1ELVA 3SI4H 1N6XA 1TFXA 1O2UA 1O2VA 3FP8E 3ZYEA 5F6MA 2FS8A 5ETXA 1O35A 3SUFA 1UVOA 3RXQA 2GCTC 2KCYA 3RXIA 3QN7A 1LHDH 1WDIA 2VIVA 2WINI 3WWFA 1B5GH 1QB1A 3PTNA 1GGDB 5AFZH 1UVTH 2PKSB 5GNDA 3D62A 3HK3B 2FLBH 3MH6A 2DE9A 1OWIA 1XM1A 1Y3XA 5HGGA 3U98H 3VFEA 1PQAA 5FPYA 2RCEA 4FUBA 1T8OA 2L74A 3GICB 3VB6A 4X8UH 1NM6A 1TPPA 3HGNA 1UCYH 3ZVFA 5DSFA 2ZU3A 2Y81A 2YNAA 3NK8A 1SL3A 1W13U 3MNBA 1J8AA 1DT2A 2C8YB 2CN0H 3G01A 5HIZA 1ZTLA 2M5TA 3EQ0H 3QWCH 3R3GB 3D49H 1AB9C 1CA0C 1P9SA 1XX9A 4JYUH 2QE7D 2CHAC 1C2IA 2IJOB 2AIQA 1AFQC 1NY22 3KNXA 1HPGA 2VWMA 4Y71A 1QRZA 1GHAF 3RC5A 3SNDA 2F91A 1PPBH 2BZ6H 2W3KA 1BT7A 1G36A 2PWXA 2WPKS 4AGJA 1GBHA 2FM2A 5EJ1A 1YPHE 1GJ5H 1HAVA 3KEEA 4BANB 1MQ6A 5B6OA 1FPCH 1RIWC 2AH4X 4OGXA 4X6MA 1EATA 2H2ZA 1LVMA 1NRNH 6ESTA 2XWAA 2ZU5A 2G81E 2V35A 3HATH 4X0WU 5CHAC 1BDAA 4ABJA 1P2KA 2OCVB 1WSSH 1A46H 1EPTC 2Z3DA 1S0QA 1C1WH 1CQQA 2L6OA 2GD4B 2AMQA 1SVPA 2I6SA 1J17T 1P01A 4ISNA 1O3NA 1AVGH 2ZGJA 3LJOA 3SV8A 2H5DA 1ELTA 1EP6A 2F9PA 3P8NA 1OSSA 1P57B 2BDGA 3QZRA 3ZZ8A 1L1NA 1E36B 1E35B 1TQ7B 1UW7A 1C9PA 4VGCC 3BIUH 2VNTA 3W95A 1ZTJA 1LQEA 2J98B 1W3CA 2ZFRH 4A6LA 2F43B 2FOBA 2VJ1A 3U9AH 4AYVB 1LTOA 4JYTA 1VITG 2FWWA 3KGPA 1UCYK 3LIWA 1O3MA 1PPFE 3PRDA 5BPEA 4INKA 3LT3A 1P06A 5LGOA 3ITIA 1HUTH 1C5PA 1C5XB 1XUIA 2ZA5A 4NIVA 3GISB 4XE4A 2OC8A 2IJD1 2KCOA 1UHBA 4CH2B 1T8MA 1GI3A 1G3CA 1V2OT 2PTCE 3QZQA 3RXVA 3HKIB 2FS9A 4CRGA 3STJA 2FYQA 2GP9B 2ZZUH 3RXLA 2GDDA 2Y7ZA 2O8UA 3KQDA 4BXWA 1LVBA 4ZROA 2QYIA 1TYNA 3GY7A 3AW0A 1OKXA 1TBRH 1CGIE 1YCPM 4WXIA 2OC0A 4GVUA 7GCHF 3D23A 4Q7XA 4DY7B 1E37B 3P92A 2ZU1A 1O3IA 3RMLH 4RN6A 1FN8A 6LPRA 2JDID 1AHTH 3M3VA 2BLWA 1DX5M 1O5CB 4IS5A 2Y5FA 3SV9A 1QFKH 3M7TA 4NSVA 2ZCLP 1A2CH 1CO7E 3PO1B 2QA9E 1AFEH 1HXEH 2ODQA 2JIZD 4IBLH 4AZ2B 3KQBA 1TNHA 3A88A 3T28A 1DE7H 1Z6JH 1JWTA 1QRWA 4WVPE 2ZIQH 1UJ1A 2EI6A 1SR5C 2Z9JA 1P3CA 1S83A 1EOJA 2LNCA 4O9VA 1THRH 1JRSA 1QCPA 2GCTB 2KX4A 2K8IA 2A7CA 1RGQA 4H6SB 3I29A 1AE8H 5IDKA 1K1PA 1TRNA 2YMSD 1QR3E 1S84A 3P95A 1GVZA 4M9FA 2XCNA 2ZCHP 4I8LA 3A7XA 2QF4A 1HIAB 1CT2E 3SJKA 1MH0A 4BTTB 1TGBA 3GCTF 1O2GH 5FBIA 3EDXB 3SV2H 3MYWA 3TGIE 1GBCA 3ZVAA 1TNGA 1ANBA 4TWYA 2KZ4A 1O37A 3RXOA 1AUJA 3F6UH 2PV9B 2ANYA 4BXSA 3TJUA 3MO3A 1HJ8A 4KGAA 2K0QA 1GHVH 3T25A 1F0UA 3M37A 1BTUA 1NROH 1CA0B 3QLPH 4KTCA 1ANCA 2CHAB 1JOUB 2OQUA 3C1KA 5T6DA 4Y8ZA 2A0QB 2ZPRA 2WPJS 3KYFA 3L33A 1XUGA 4GHQA 5EXLA 1AFQB 2C8WB 2D26C 2B9LA 2SGQE 1GJAB 2A31A 4IW4E 5HKKD 2ALPA 1HAOH 3E16B 4YLQH 4Y76A 3PV4A 1V2LT 3PV5A 5KGOA 1OWHA 5JDUB 4Y0YE 3AAUA 2FZZA 1HLTH 2G00A 4CRCA 3ZZAA 3ZZCA 4CR5A 3M5MA 4A7IB 1RIWB 4I31A 4E7NA 4A1TA 1GBJA 4D8NA 2UWLA 1ORFA 1UTJA 2WV9A 4CRAA 5DO4H 1QQUA 3EA8A 1IAUA 4Q2KA 1K0HA 4B2AA 1SPJA 2ZEBA 2G5VA 1IQKA 2FO9A 4ZHLU 3TJNA 4FUJA 2A5AA 4CH8B 1NFYA 1O2TA 3SU5A 3BTQE 5T3HA 5L2YH 4WMEA 1DS2E 4X8SH 1SGTA 5LPRA 2D2DA 3KQ5A 5C5NA 1K1IA 5JBAS 2HNTC 4YXWD 2BVSH 2WUBA 4ISOA 5GXPA 4E7RG 2JJ1D 3UR6A 1ESTA 1DWEH 2JETC 2YMSC 3A86A 4TPIZ 4Y79A 1SQTA 1Z7KA 2UUFB 2BXTH 2KCAA 4VGCB 1O2JA 4WWYA 3PMJA 3PTBA 4NZLA 2V3OH 2ZFTA 3O8BA 1A0LA 1FI8A 2NU1E 5L30H 1KXDA 1ETRH 3U8OH 3MH7A 2GTBA 2VBCA 1VZQH 3SJOA 2BDCA 2CMYA 2JH0D 1GHZA 1GJ4H 2PUXB 5EQQA 4OS5A 1EAXA 1TX7A 1J14A 1JBUH 2PHBA 1LMWB 2AMPA 1YM0A 4Z6AH 2GCHF 4FUFA 3SGQE 3TK5A 5A0CA 2SGFE 1O2IA 1PPHE 1WTHD 2LELA 1ZPBA 1FJSA 1O33A 1GHAG 1FONA 3OTPA 4I8JA 2J95A 1C5RA 3NKKA 3F1SB 3BSQA 4CBOA 1RJXB 1C5VA 3BEFB 5HXFA 1FZZA 1PYTD 3OY6U 4XBBA 1T7CA 2BLQA 2QXHA 1QRXA 1G2MA 2GMTC 1Y59T 4ZUHA 1SSXA 1L4ZA 2Y7XA 3PWCA 4K3JA 4FUDA 4D7GA 1YPEH 1UTNA 1ZMJA 1GMCF 3GCNA 1C1NA 3A8BA 3BN9A 4YLUA 4I8KA 3SGAE 1O2LA 4Y7AA 3QGNB 3QDZB 1BTPA 3KF2A 4JYVH 4YESB 1BTZA 2P3TB 2TGPZ 1HAHH 1GBTA 1O2ZA 2FODA 2UUJB 2ODYB 4MPVA 1H8HD 5E2OA 9ESTA 1HV7A 1YBWA 5E8EH 5E0GA 3HKJB 1CHGA 4GAWA 3BF6H 1XUHA 1P10A 2QIQA 4KELA 2XRCA 2V6NA 2WSSD 2Y5HA 3Q3KA 4JK5A 1BOQA 1GBKA 1BZXE 1OXGA 1ID5H 3VGCC 1QA7A 3KIDU 2AFQB 1RFNA 4I7YH 1INCA 1GI9B 1TWXB 3ZZ6A 3GOVB 1PPEE 1QIXB 1FY1A 2BHGA 1UVUH 1YPHC 3F9HA 1TOMH 1WU1A 1MZDA 4NA9H 3FZDA 1VCWA 1UHBB 1C1RA 2TBSA 5DJ7A 1ETTH 1B7XB 1YPMH 2BVXH 1ZTKA 7GCHG 4UEHH 1GJ7B 3DSOA 2QAAA 1KDQA 1HAIH 4D9RA 2VIOA 4XBDA 4JK6A 2A7JA 4YOGA 1W0YH 1ZGIA 3BTWE 3F0OA 1Y5UT 5DP6A 3RXUA 4OS4A 1C4V2 2FTMA 1AGJA 2HLDD 1JMOH 1VCQA 1O5GH 1SKYE 3HPTB 4X1SU 3A83A 1SLXB 2PP6A 3O8RA 3OY5U 2H1UA 3H7OA 4TY6A 5C1YA 3E91A 2R2MB 5DP8A 3RXMA 1MCVA 2ZHDA 1K2I1 1FY5A 1F92A 3LH3A 5EW1H 1IQGA 5GWZA 1BRCE 2SNVA 3U69H 1H8ED 1RTFB 1TB6H 4GSOA 1O2OA 5F8ZA 2G4UA 4LXBH 3PWBA 5G4BA 4Z0KA 1SGDE 2V0BA 3PLPA 1C2GA 2Z7FE 3SO3A 1Y3VA 2ZTZA 3GCHC 1MAYA 4UFGH 1FY4A 2G52A 3GCTG 4JZ1A 2YMSB 4K1TA 3BTKE 5LPFA 1AI8H 2OK5A 5EIYA 1EZXC 3RUOA 1D3TB 1W12U 3EA7A 2BZAA 3A8CA 5TJXA 3PLKA 3F0PA 2Z3CA 1AZZA 1B0EA 4Q63A 4LZ1H 5EQRA 2OC1A 2JJ2D 3BEIB 1O2WA 3RM2H 2VIPA 1MZAA 3ZV9A 4DOQA 1G3DA 1QTFA 3ZVDA 4TYDA 2A5KA 3ATWA 4R0IA 1LVOA 2BX3A 7KMEH 4NIWA 5L6NH 3KQEA 2KR7A 2PKAA 1TNJA 1UO6A 3BTGE 1VJAU 3FP7E 1C5SA 1W2KH 3NZIA 2P59A 3EA9A 2B8OH 1QQ4A 3H09A 1DSTA 1FPHH 4FUIA 1Z1JA 1NRSH 2WPHS 1UMAH
chains in the Genus database with same CATH topology
1AY6H 1PFXC 4LK4A 2GMTB 2GV7A 1UK3A 1C9TA 1GBEA 1H9HE 1TPSA 3TH4H 3E1XB 3QTOH 3U8RH 1YPJH 2XW9A 2HPQH 3MTYA 3AASA 5L2ZH 1NU9A 2CV3A 1AWFH 1CHOF 2NU2E 3K65B 1C1QA 5JBBS 1IQLA 2PTNA 1QBOA 4RSPA 2Z9LA 2FDAA 4CRFA 1KTTB 1ACBE 2SGDE 1AVWA 1QNJA 4RKOB 5C67A 1ZR0A 4B75A 1C5UA 3ZZ3A 4FVDA 1ZJDA 1GI2A 1TNLA 2STAE 1F0RA 4INHA 2G8TA 3IITA 4JZDH 1P2QA 4ABBA 5JB8S 2J4IA 2C90B 1ZHMA 4KTSA 1FN6A 3PO1C 9LPRA 4Y8XA 1EAWA 4Q7ZA 1O2HA 4UONA 1IQEA 5DPAA 3RM0H 2ZHQH 1FQ3A 3PB1E 2LPRA 3M5NA 2GCHG 2ASUB 1CGHA 3DFJA 1TGTA 1DM4B 1WUNH 2C93B 2XBYA 1CU1A 3UR9A 1ZOMA 2QY0B 1F2SE 1FY3A 1P8VC 4X6OA 2FOGA 1UTOA 1ANDA 3VB7A 1P02A 2J9NA 2A4OA 3S9BA 2ZTYA 1LPKB 2K1QA 2W5EA 3PMAB 4H4FA 1G9IE 1S6FA 3PMHB 3MWIU 1LHCH 3GY4A 1DLEA 1O36A 1O2KA 1O3BA 1GMCG 1D6RA 3HK6B 2Q1JA 3QK1A 1BMMH 2A45B 2ZHWH 5T6GA 1GHWH 1SGPE 4E05H 2VIDA 2ANMH 1BTYA 1SB1H 3BTDE 4GHTA 4INLA 2FI4E 3MH5A 1O3DA 1GBAA 1U6QA 1HGTH 1SLWB 4XDEA 5EW2H 3WY8A 3R0FA 1O3EA 2W7UA 4TY7A 4I32A 2EEKA 4UFEH 1UTLM 2BD8A 3PYHA 3MU4A 4DURA 1ELBA 1GBMA 2P3UB 3A82A 1BTHH 3DA9B 2WPMS 1EP5A 2ZO3H 1D9IA 3GCHB 3ZYDA 1YP9A 4ABGA 1DY8A 2SGPE 3T5FH 3LC5A 1IHSH 1Y5AT 1V2QT 1RTKA 4OS1A 4DW2U 2H9EH 2A4GA 4B74A 1E0FD 3GCOA 4X8VH 1UK2A 2TPIZ 3S9CA 3E90B 1C1VH 3RXDA 4AN7A 1DPOA 2FXRA 1HYLA 2C4FH 5DP7A 1GBLA 1P2IA 1TOCB 5AFYH 5F8XA 1SQAA 4CRDA 4NG9H 2BQ7B 1AIXH 1Z1IA 2O8MA 1MTNC 2BD7A 1G3EA 3QTVH 2F9NA 2Z9GA 1HXFH 2Z9KA 1ARBA 1VGCC 1BHXF 1T8NA 1DFPA 2OTVA 2P95A 3A85A 1DWBH 1UTMA 1J16A 2F9OA 3EYDA 2GT7A 5JYIA 1KDQB 3SNBA 2HWLB 3U1JB 4X1PU 4DVAU 2Z6BD 1ELAA 5FAHA 1XXDA 2H5CA 1L1JA 3CS7A 1DVAH 5DK1A 4I33A 3SU6A 1MBQA 1THSH 1GDUA 1ZMNA 1WQVH 3SNCA 2OLGA 1Z6EA 2WYGA 5E0JA 2CJIA 3SW2B 2GZ7A 3MHWU 4ABFA 1HJAB 4I8HA 4U01A 5E2PA 1QL8A 3P8FA 1ZRKA 3BG4C 3SJ9A 3SORA 3ZVBA 1TX6A 3LKWA 1EAUA 3MMGA 3LH1A 2ZI2H 1UTPA 1HAYB 1NS3A 1O3OA 1GJDB 4MPUA 1BMAA 2J38A 2BYAX 1GPZA 2ZDAH 1WYKA 1PJPA 3P8GA 1O3CA 3S0NA 1KY9A 1ZHRA 1O34A 1XKAC 2BD4A 3H7TA 1O2XA 1T4UH 1SGYE 4Y6DA 5DP3A 4ABEA 4MPWA 3B23B 3VEQB 1SGFG 1FDPA 2PGBB 1L1GA 1NFWA 4K8YA 4CRBA 1IOEA 2IOTA 1EB1H 1S5SA 1YF4A 2HRVA 3SZNA 2STBE 1OOKB 5A2MH 1LQDB 2YNBA 1PPCE 1AN1E 1NFUA 1EUFA 1AVXA 2ILNA 3U1IB 2AS9A 1V2TT 2Z9IA 1ESAA 2XWBI 1T31A 4WH6A 2VVUA 4AORA 1H1BA 2HALA 2PKAB 1DXPA 1OYTH 2VIQA 3GDSA 1OX1A 1LHGH 1MTSA 3DFLA 2ZU4A 3SI3H 1DANH 3V12A 3RXBA 4Q80A 1BBRH 2Y5GA 1V2JT 1GVLA 3T27A 3DHKH 1LHFH 2GKVE 2ANWA 4K1EA 5K7RA 1CHOG 1A4WH 3FP6E 1K1LA 4O3UA 3RLYH 1KXFA 4AG1A 2G5NA 1EX3A 2KAIA 2CGAA 4DT7B 3FAOA 4BAOB 1BIOA 1C1UH 1TIOA 5GPIB 2A7HA 1DOJA 1GI5A 2O8TA 1BTXA 1V2KT 1KLTA 2RA0A 3ODDA 1NRQH 1BQYA 4CREA 2ZDMA 2FOFA 4AFSA 2SFAA 4OS7A 1FMGA 1G37A 1NRPH 5EXMA 3A87A 7ESTE 1IHTH 1GL0E 3F9FA 1O3JA 2XC4A 1D3DB 1A61H 5CE1A 4BAQB 2AGIX 2VIWA 4LZ4B 2ZCKP 1RS0A 3PLBA 5JBCS 5C2ZA 2UUYA 4X2VA 3DT0H 3RXTA 4OS6A 2BTCE 1K1MA 4FU8A 1ZSLA 1NC6A 4B2CA 2BQWB 3UNQA 2G4TA 5GCHF 2W7SA 1O2RA 4X1RU 3TGJE 1JXPA 2F3CE 3VB5A 5EPNA 2W3IA 2BXUH 2BY9X 4IN2A 5T6FA 1MTNB 4O3TA 1FY8E 1ETSH 3UWIA 2XBXA 1VGCB 5DKMA 4A92A 4Q7YA 2A4QA 1N8OC 1DLKB 2OP9A 3SQEE 3LONA 4TWWA 1UCYE 1BBRK 2XYAA 1QURH 2XBWA 4DJZB 5FX5A 1SHYA 2FIRH 3M5OA 4MQAA 2AERH 5I46H 2IPHA 1WTGH 1CE5A 2W26A 1AWHB 4K69A 6CHAC 3RXHA 3SHAH 5ABWA 2BY5X 3SU1A 2BQ6B 3SBKA 1A3BH 1F5RA 4A5TS 1CT0E 1GBBA 2ALVA 4B76A 1C5WB 1O39A 3UUZA 3P6ZB 1QJ7B 4YT6H 1GI0A 1P11E 3U8TH 5C5OA 1S85A 3LOXA 5FCKA 1KLIH 3BG4B 2OD3B 3E0PB 3M3TA 2QGRA 3FFGA 3P8OA 1C5YB 3RU4E 4M7GA 1GDQA 5H4IB 3TIUA 1GBFA 5FXLA 4K2YA 3B8JA 3TH3H 1PQ8A 2EC9H 1GBIA 1DY9A 2R2WU 1Z8RA 1TALA 2G51A 3KQCA 1NESE 1P9UA 1QY6A 3IWMA 1YGCH 2XC5A 3M3SA 5AF9H 1LO6A 3RXGA 1HDTH 5F8TA 4UDWH 1LDTT 1GI4A 1OPHB 4FUEA 4AFQA 4WH8A 5DP9A 3ELAH 1HRTH 1Y5BT 2ZWLH 1V2WT 1XUKA 2O8LA 2TGAA 4JZFH 4MNWA 1M9UA 1Z71A 1MKXK 2PW8H 4NZQA 5C1XA 2OQ5A 5JB9S 2BDBA 1GL1A 1O2YA 2OC7A 2Z3EA 1P03A 3ZVCA 4OGYA 4H6TA 3S9AA 5GJ4B 1H9LB 1KIGH 1W0ZU 1DUEA 5GIBA 5HM9A 1F5LA 3K6YA 3TGKE 1C2FA 1NO9H 1TMUH 3MO6A 4FU7A 1C1SA 1SGIB 2GDEH 2Y6TA 1DWDH 1IQNA 3ATLA 4UFDH 2PLXA 2CF8H 3A84A 3SGBE 5A8YA 3ZZDA 1K1JA 3UY9A 1EJAA 4K8BA 2ZDLA 2Q6GA 4B2BA 3STIA 4Y7BA 1DWCH 3BV9B 4NFEA 1K1OA 1Q2WA 2ZFFH 2BY7X 2ZFQH 1LCYA 4JZIA 3M61U 4DG4A 2B7DH 3Q00A 3SV6A 3K9XB 2ZC9H 3ZVGA 1HNEE 3S7KB 1V2NT 4BTIB 2R0LA 2RDLA 1O32A 2O9QA 4NA8A 3LGYA 1FIWA 1QHRB 1SBWA 2P16A 3FANA 1P12E 3V7TA 3TNTA 8LPRA 3SN8A 4MNVA 1PYTC 3F9GA 1Z8GA 3C27B 1ZYOA 4AYYB 1WBGB 3N7OA 1FUJA 1KYNA 3A81A 1E34B 4X6PA 1LKAA 1IQJA 2R0KA 1BRUP 3SUDA 3HGPA 2XCFA 2FX6A 4ZHAA 4K60A 1G32B 1O31A 3UOPA 1YYY1 4WXVA 1TBQH 1AE5A 2VWLA 3CP7A 3B9FH 2EI7A 3KCGH 1RRKA 4OS2A 1TNKA 1O3FA 3M7QA 1C2MA 3TLOA 1GHBF 2VWNA 2ZP0H 3L3TA 1BCUH 1G3BA 1A0HB 1B0FA 2AYWA 1C4U2 2NU0E 4J1YA 3TK6A 5TCCA 1Q3XA 1ZPZA 4KKDA 2ANKH 1OYQA 2Y80A 4F4OC 3OX7U 1Y8TA 1TQ0B 2C3SA 4XFQA 1N8OB 2HLCA 1MU6B 1QBNA 2DE8A 2XBVA 3A7ZA 3OTJE 1D4PB 2J94A 3JZ1B 1GMHF 1IQHA 3GY6A 1TMTH 1C1OA 1TNIA 1ARCA 2XC0A 1H8IH 4WY3A 1BRAA 3RDZA 4WF8A 1S82A 1VCPA 2ZDKA 6CHAB 1K1NA 1V2ST 5FBEA 1X7AC 1P2NA 3H5CB 3RXJA 1XUFA 1DICA 2KAIB 1O5FH 1O0DH 5SGAE 3GY8A 1TABE 5EPYA 1K9OE 5J4SA 4MNXA 3RXKA 4AOQA 2BVRH 2D1JA 1D6WA 3QUMP 5EQSA 1ESBA 2AGEX 3LGUA 4AG2A 3LU9B 1ZLRA 3T62A 1EASA 5ESBA 4ZH8A 4HFPB 1BMLA 1W14U 3PROA 1S6HA 5FHTA 1ZSKA 3BIVH 3RMMH 4ZHMU 4BAMB 1MAXA 3ZZ4A 3TU7H 1QL9A 4X2YA 4LOYH 1HJAC 2J34A 4XBCA 1AQ7A 1MQ5A 3EAJA 2BLOA 5HM2A 3BTEE 1F5KU 4B1TA 2RA3A 4BOHA 1Y3WA 5GCHG 3VB4A 2A5IA 3I78A 5FX6A 2ESTE 3BG8A 1KXAA 1SGFA 1C2JA 4X2WA 1HCGA 1T32A 4ISLA 1NPMA 1MU8B 1YPLH 1ELCA 1A1RA 1HAGE 4YOJA 1C2LA 3AVZA 5E0HA 1TMBH 4FUHA 3O8CA 1NTPA 3MNCA 1NN6A 1T4VH 4IC6A 1ZJKA 4ESTE 3RU4D 4CBNA 2ZHEH 2FTLE 1O5BB 4NWKA 2DUCA 1O38A 2XXLA 3OYPA 1FAKH 1Z8IB 2QXJA 2SGAA 1TGSZ 3F68H 3GY3A 3ZV8A 1P2OA 1NU7B 1KLJH 3A8AA 3UNSA 5EXNA 1A5HA 2CF9H 2JH5D 4Y8YA 1TGNA 4ZKNU 4Y0ZE 4IN1A 5PTPA 4R8TB 3K6ZA 2ZGBH 4JZEH 4F49A 1VITH 2BD3A 4X1QU 1V3XA 4RKJB 1LKBA 2VGCC 2BD5A 1O2MA 2HPPH 3M36A 2GZ9A 5BRRE 1C2EA 3RXRA 2OXSA 1SLUB 4DCDA 1LVYA 2BB4A 3VB3A 1CBWC 1V2MT 2NU4E 4AB8A 1JIRA 1FXYA 3MI4A 1A5GH 5EGMA 3LPRA 3MU1A 1V2PT 1FV9A 1O3AA 3M7UA 2A2QH 3QO6A 4MTBA 4U30A 1HFDA 3GYLB 2QN5T 3UREA 2VWOA 3EGKH 4UFFH 1TAWA 1A7SA 2V3HH 1OP0A 3RLWH 2TGTA 4D76A 1C5NH 2QV1A 1CVWH 4FUGA 1O2PA 4NSYA 4AX9H 2F9BH 2ZKSA 2F83A 5A0AE 1XKBC 1S81A 1IQMA 1J15A 1WAYB 3ATIA 1OP8A 1EJMA 2FI3E 2H9TH 5FPTA 1ZMLA 2QF3A 2P93A 5F03A 4IC5A 1UK4A 2P8OC 1MTUA 2FEQH 1GI7B 1SFIA 3V3MA 1TLDA 1SMFE 3Q76A 1ZPCA 4BNRA 3NPSA 2ZGCA 1KXCA 1AKSB 3V0XA 3A7VA 4GPGA 4YM9A 2WUCA 4IMQA 1T8LA 2ZFPH 2ZQ1A 1YPKH 1SGCA 1EOLA 1JIMA 4B73A 2WV5A 4BTUB 1BJUA 4NWLA 3SU3A 4IMZA 2VVCA 1HJ9A 2GVFA 1C5QA 1VR1H 1GI1A 2THFB 1GWAA 3KL6A 4FUCA 4ASHA 1W7GH 1TRMA 1C4Y2 3NUMA 1O5EH 1MMJN 4WMDA 1PQ5A 1GHBG 3RXFA 3TJOA 1WOFA 1TE0A 1AUTC 4GLYA 1YCPH 3MNXA 3PM3A 4UD9H 1K21H 1OP2A 1MCTA 2PFEA 2PR3A 6GCHG 3VXFH 3ZVEA 2GGVB 2BY6X 2GT8A 3AW1A 4SGBE 2HNTF 1H9IE 1CGJE 1S0RA 2BOKA 2H6MA 5GDSH 4MLFB 4Y10E 5A0BA 1GMHG 4WMFA 1Q31A 1O3HA 4THNH 1WQSA 1SGRE 2ZPSA 4YZUA 2ZTXA 1HBTH 3KHVA 1HB0B 1GHYH 2AEIH 8GCHG 1SFQB 3SNAA 1YLCA 1O3KA 1GJCB 4J2YB 3TH2H 2FX4A 1TA6A 1UVSH 1GG6C 5EG4A 4MPXA 2PSXA 2NWNA 3RC6A 4ABAA 2ZGXH 3ZZ9A 4ISHH 2J2UA 1MD8A 3T26A 2GV6A 1TBZH 4NGAH 2HGTH 3SNEA 2VGCB 4TPYA 4ZKOU 1C2DA 4X1NU 1HAPH 5FCRA 1EQ9A 1P09A 1EZUC 3I77A 4H42U 1EAIA 1GMDF 1QL7A 4ZXXH 1ELEE 3RC4A 3MO9A 1N1LA 1ZZZA 3TVJB 2R3YA 1P0SH 3FZZA 1CBWB 1C1PA 2VU8E 3ATMA 2BM2A 1GDNA 1O2SA 2FOHA 2BOHB 5EODA 1GI6A 1XVOA 3ESTA 2PGQB 4QT8C 5K0HA 1YCPK 3T29A 2ULLA 4GCHF 8ESTE 1DXWA 5LPEA 1SC8U 1K22H 1ELGA 1XXFA 4HI3A 3UTUH 1FLEE 2QF0A 4A1XA 3LGTA 1W7XH 3QX5H 3L6PA 2BDAA 2BLVA 4MG3A 5DP4A 1AB9B 2F9VA 1QB6A 5JBTA 3MU0A 1LHEH 1C5LH 1PQ7A 3MOCA 4XOJA 2UWOA 4ABDA 5C1UA 1GJ8B 3SU0A 3JZ2B 2Z94A 4K1SA 3VPKA 3MU8A 1YLDA 1SI5H 3T2NA 2G55A 4O97A 2VH6A 1TRYA 4PROA 1QA0A 3SJIA 5HYOA 3Q3XA 3TITA 5C3NA 1MKXH 3BTTE 3GY5A 1MBMA 5HMAA 1ELDE 1XVMA 1G2LA 2P8OB 4ABIA 1C5ZB 5CHAB 2QXIA 4ISIH 1MUEB 1P04A 1YC0A 1MD7A