3T27A

Orthorhombic trypsin (bovine) in the presence of betaine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t27A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t27A02
4X1NU 3OY5U 2B0FA 1ZMNA 1C1NA 2Z7FE 2FOMB 1XKAC 1DE7H 2STBE 3KQEA 4GCHG 1GBCA 2VNTA 2A2QH 3T29A 6LPRA 5K7RA 3TGJE 5A0BA 4ESTE 1SHYA 1QHRB 1T8LA 2VVUA 2W7SA 1TNJA 2R3YA 2HPPH 3RMMH 1GVKB 2BXUH 1O37A 1G3CA 3RC4A 4A5TS 3FAOA 1O5CB 1GI2A 1AFQB 4ABAA 1GHZA 3GISB 4DCDA 5SGAE 2CXVA 1LVYA 1RGQA 1KIGH 1YCPM 4M7GA 4X6MA 2XWBI 1F0TA 1ZSKA 4CBOA 3KQBA 3GDVA 3I29A 4YT7H 3ESTA 5L6NH 4UFFH 1XXDA 1BTHH 3AVZA 1BHXF 5F6MA 4K1EA 3TLOA 3SU5A 1O3EA 3PWCA 1EKBB 3RU4D 2AEIH 1UTJA 3SHCH 2PGBB 2ANYA 3SV9A 3UFAA 1YPJH 1KDQA 4D76A 1MU8B 3JZ2B 2NU4E 1UTPA 3VFEA 2C93B 1ELBA 3VXEH 2BLVA 3Q3KA 3RXTA 2TGDA 5FX5A 3TH4H 3A7VA 2F9BH 3FP7E 3LOXA 4WH8A 1KLIH 2GCTC 1PPZA 5C1XA 1OX1A 5AFZH 3SV6A 2W5EA 2BQWB 3I78A 4GLYA 3BV9B 5CMXH 5A8YA 1FUJA 2ZI2H 8LPRA 1AGJA 1O3HA 1C5WB 1C1PA 5ABWA 4BNRA 2FDAA 3D23A 2ZTZA 4WH6A 5TCCA 3V7TA 4J2YB 1UTLM 1MKWK 1AKSB 1LO6A 1O3GA 3SUFA 5DP6A 1CA0C 5F03A 6CHAB 1V2ST 2BD8A 1O3FA 1SG8B 4F4OC 4JK6A 2ZPQA 2ZU2A 1MAXA 1GI0A 3VGCB 1JBUH 3GY4A 3M7UA 4CH2B 3LGWA 1K1NA 5DGJA 2NWNA 5E0HA 1B7XB 3TVJB 1THRH 3RXCA 1V6DA 1NC6A 1PPGE 2ZEBA 1W10U 3RXAA 1EPTA 8ESTE 1OXGA 1S0RA 1EAUA 3SJIA 3LGYA 3P95A 4H6SB 4X8TH 2I6SA 5EXNA 1O2QA 1YGCH 2F9VA 4CR9A 1PPBH 3LKWA 1YPGH 2FO9A 1C5TA 1W3CA 4GHQA 2GCHG 1WQVH 2B5TB 2AMPA 2P16A 4IC6A 1O2ZA 3M5LA 3SW2B 3M7QA 2A45B 1LQEA 1ARBA 3SNAA 3T62A 2PUQH 3EQ0H 1H8DH 4MTBA 4X8SH 2Z3CA 1SMFE 1BTWA 1NRSH 1C2KA 1TGSZ 1EJAA 1C4V2 3R0FA 1KLJH 1O3JA 2BVRH 5A2MH 5J4QA 3S0NA 2C8ZB 1F92A 3QTVH 1GJ5H 3PO1C 2ALPA 2VIQA 1CHOG 4NSVA 3S9CA 1C5RA 1UK4A 2CHAB 3K6ZA 5BRRE 3O8RA 1IQFA 1A4WH 1JMOH 4JYUH 1FY3A 2HPQH 1TPAE 5GPIB 3ODFA 2A7HA 2Z9JA 1D4PB 1LHGH 1MCTA 1SGRE 1QBNA 2NU0E 3NUMA 2ODPA 1NZQH 1LHEH 1NRRH 1SOTA 2Y5FA 1G9IE 1Y3YA 3CS0A 4Y6DA 4WVPE 1Z8RA 3A89A 3H7TA 2ZU5A 5L30H 2D8WA 3NCLA 3P17H 4TPIZ 2ZA5A 4Y0YE 2EEKA 2GT7A 1TPPA 4ZKOU 1Z8JB 2GMTB 2FP7B 1HDTH 1HCGA 4K8BA 3OTJE 2GP9B 1EAIA 1FQ3A 1GBHA 3URCA 1ZTKA 1ZPBA 1C1TA 1NRNH 1VGCC 2DE9A 1OS8A 2VGCC 4IN1A 4J1YA 2BQ6B 4B1TA 1O3NA 4H4FA 1L1JA 3A86A 3HATH 3KGPA 4RN6A 4Y10E 1LHDH 1O3CA 5JYIA 2Y7XA 3DFLA 1J8AA 4FUBA 1NU9A 1ZPZA 5JBBS 3RXPA 3MNCA 1KYNA 1SSXA 4FU7A 3MH7A 1O5DH 1AVWA 5FCRA 2P93A 2C8XB 4VGCB 4H6TA 1EASA 3S7HB 1BUIA 4IC5A 4K2YA 4AN7A 3URDA 2XTTB 1G30B 4OGYA 3VB4A 1S0QA 3QDZB 1GI1A 2H2ZA 1AU8A 1PPCE 5FAHA 2ZU1A 2O9QA 4IS5A 3ZZDA 1TQ0B 1TWXB 4CRDA 2GDEH 1BTXA 1N6XA 4ABJA 1YCPK 3RXLA 3HPTB 3SN8A 1F2SE 2UUKB 1BTPA 1HJ9A 1LPZB 1P2KA 1P3CA 3GY5A 2GGVB 4BAKB 1HAZB 1FIZA 1RTFB 5C2ZA 5C5OA 3V12A 5PTPA 1QRXA 3TU7H 2IN2A 3RC5A 3O8CA 2CF8H 4BTTB 1ZSJA 4CHAC 3BTEE 3EYDA 1HAVA 1HNEE 1T8MA 3A7TA 2FEQH 1BHXB 1IHSH 4ABGA 1GVLA 2O8TA 4IMQA 1J16A 1JWTA 5C1UA 3Q77A 1AWHB 2PTNA 1XUKA 1EPTC 4Y0ZE 5DK1A 1NS3A 1A3EH 4IN2A 1G3EA 2IPHA 1OYTH 4ZXXH 2ZQ1A 3T5FH 1BDAA 1QBVH 1QRWA 2G55A 4BXSA 3ATIA 1BBRE 5T6FA 1UTOA 6ESTA 1C2FA 3CENA 3P92A 1D3QB 3A8BA 2PKAA 2PKSC 1TBQH 1ANDA 3UR6A 4YOIA 1L2EA 1DWEH 3H5CB 4UFDH 1BJUA 4GPGA 2VJ1A 3ZVGA 1PPHE 1YPLH 1LPGB 3NPSA 4U01A 3GDSA 2ZCLP 2D26C 1HFDA 4FUFA 5HGGA 1O5BB 5FPTA 3JZ1B 4WJG2 1DPOA 1LMWB 4IGDA 1SLWB 5DP9A 2V35A 1VITH 1OWIA 4K5ZA 2SGDE 1GGDB 3MOCA 2H5CA 1O35A 1TB6H 2ZDAH 3K9XB 2P8OB 5C20A 5FBEA 4ASHA 3E0PB 4KP0A 3BTHE 2WUBA 4DVAU 4YESB 1MKWH 3E6PH 4U2WA 3ZVBA 1TPOA 3SGAE 3AW1A 3BEUA 4O97A 4X8UH 4QT8C 3MU0A 3UQVA 1UO6A 1O2MA 1QNJA 1O33A 4O3UA 1DLEA 1HYLA 7ESTE 1ABIH 3QZRA 1CBWB 3ZZ5A 1ZMLA 1GCTC 3Q3YA 1SFQB 2GVFA 1BA8B 5GIBA 1MMJN 4YLUA 1IQNA 3I77A 1O2NA 1ZSLA 1GJAB 1FN6A 1GHBF 2UWOA 1G3BA 3C27B 4KELA 3UUZA 1MBQA 3LGUA 3CS7A 1AD8H 1S6FA 1GBFA 1C9TA 1HPGA 1VJ9U 5E2PA 1C2JA 1JIRA 1TA6A 1C2DA 2VIPA 3SJ8A 2H9TH 2FODA 2XBWA 2DE8A 2Z3DA 1LVMA 3F9GA 6GCHF 4DJZB 4OS5A 1P04A 2ZC9H 1ESAA 3QN7A 1EOLA 1IHTH 2ESTE 3DHKH 4NWKA 4AB8A 1T4VH 3SQHE 4X2YA 4AFUA 5EW2H 2Z9IA 3MI4A 4F49A 5C3NA 3SGBE 3Q76A 5EQQA 4XE4A 1GG6C 1FY5A 2G5VA 2ASUB 5T6DA 4FUCA 1O2VA 3U8OH 2G4TA 1DSUA 1QURH 2B7DH 1D6WA 2G4UA 3E1XB 2A5IA 4YOGA 1L4ZA 4X6OA 3DA9B 3RXFA 3SZNA 3ZZ7A 1TRYA 3HK3B 1BB0B 1BTUA 1ZMJA 2WUCA 5F8XA 1O32A 3BTWE 1BMLA 2I6QA 1RTLA 2BDHA 3GOVB 4YTAA 2VU8E 2J38A 1UVUH 4ZHAA 4D8NA 3QUMP 2LNCA 1K1PA 2J9NA 2TPIZ 1FY1A 2OXSA 4HFPB 1C9PA 2WPLS 4WWYA 3VPKA 3VB7A 2FS9A 2THFB 1O39A 2ZPRA 1AKSA 1KY9A 1Z8GA 2AGEX 2B8OH 4WXVA 1KXEA 1W13U 5DP4A 4IMZA 4XBCA 3KIDU 1XVMA 1GJBB 1ZYOA 1TNGA 3RMLH 1GBDA 4R0IA 4TY6A 1TE0A 1FV9A 1BBRH 1EQ9A 1P9SA 1MTNC 4H42U 1GJDB 8GCHG 1O30A 1E38B 1EX3A 1DFPA 1O5EH 1A5HA 1GBIA 2ZDNA 1BCUH 3GDUA 1O2IA 3SGQE 1ZLRA 5E8EH 3QO6A 3RXIA 3TGIE 5GDSH 5EG4A 2G52A 2YNBA 3E8LA 5LGOA 2CN0H 1O38A 2ZDKA 3MO3A 3RMNH 2WV5A 1B5GH 2UWPA 1VCWA 3LIWA 5EPYA 4BXWA 1HB0B 1HXEH 1AE8H 2ZFPH 2ZNKH 1C5OH 2WINI 1S83A 2J34A 2ZTYA 2ZU4A 1O0DH 1P2OA 4I31A 2WV4A 2FX6A 3UPEA 1THPB 4K1SA 1UHBB 2LPRA 4LXBH 5FX6A 2BY5X 1HAPH 2TIOA 1QCPA 1GDQA 1P2IA 2VIWA 3U8TH 3VB3A 1GMCF 1VJAU 4X6PA 5DP5A 1F7ZA 1C2IA 1H8IH 1OYQA 2CMYA 1GL0E 1V2QT 1G2MA 2HOBA 3NWUA 4ISOA 2GZ7A 1F5KU 3FP8E 3TGKE 1C5MD 4KGAA 4R8TB 1A61H 2BD2A 1ZGIA 1ELVA 3AW0A 1CGIE 1W12U 3VXFH 1Z1IA 2VH0A 3VB6A 2Z3EA 1DWBH 1AFEH 4X0WU 2ZHFH 2ANWA 4B75A 3SU6A 4XOJA 1C5LH 2BD4A 1AHTH 2ZPSA 1TIOA 2Q6DA 4ISIH 4I8KA 3B9FH 2ZDVH 1SGFA 4X1SU 1QJ1B 3SBKA 1GHWH 1F5RA 1GDUA 2FOBA 5LH8A 1E34B 1QR3E 1EUFA 1L4DA 1J17T 4DIIH 4E7NA 2AFQB 2ZP0H 4DIHH 1MD8A 3W95A 1O2PA 2C8WB 3SV8A 3ZZ8A 4AFQA 5JBTA 1HLTH 3F9EA 3S9BA 1DICA 1PYTC 2ZGHA 3SO3A 1SQTA 1OOKB 2Q6GA 1ELCA 3LDXH 3VEQB 4K60A 2HNTC 1V2WT 1A0LA 1GJ8B 1DY8A 1ELEE 3SQEE 3OSYA 1OSSA 2V3OH 4WXIA 1GBKA 1A1RA 4B73A 1JRTA 1S84A 3AAUA 4SGAE 3FZDA 3RMOH 4CR5A 3ZVDA 1YPMH 2Z9LA 3F68H 2QIQA 3MFJA 2ZQ2A 1YPKH 2FIRH 2JH5D 2PSXA 1HJAB 2FWWA 4GUXA 1MTWA 2W26A 4KKDA 3UNQA 1S82A 1Z6EA 1OP0A 2ZHDA 3TJNA 3M3VA 1SHHB 2C8YB 4GAWA 1GHVH 2RA0A 2C90B 1GI3A 3VGCC 3GCHC 1RS0A 2FXRA 4JYTA 2QYIA 3RLWH 1NFWA 4UFEH 2XRCA 5HMAA 1TNKA 4X1RU 3BTKE 2ULLA 4A1TA 4B76A 3GCTF 1T31A 1GBJA 1OWJA 2FOGA 1P57B 1H9LB 1TRMA 4MPUA 1INCA 1UK2A 2D1JA 2FI3E 3LC3A 2HVXA 4PROA 1VCQA 1BZXE 1AIXH 1C1WH 1ANBA 1V2MT 2A4OA 2XBVA 3SNCA 2P59A 2BX3A 1XUJA 1Y3WA 1T7CA 5EQRA 4XBDA 3KHVA 5C1YA 1IAUA 1O34A 1CGHA 1F0SA 1DWCH 1T4UH 2ZKSA 1KXFA 2ZWLH 4X6NA 1Q2WA 1DUAA 1JXPA 1EOJA 4FUGA 4HZHA 2R0KA 3VB5A 3SUGA 1O5FH 1TQ7B 1SQOA 1C4U2 4D9RA 4E7RG 1O2WA 1V2RT 1Z8IB 1SGIB 3ZYEA 1AI8H 2QA9E 4D7FA 4DURA 1GHXH 4Y79A 5EOKA 3SU1A 3M5OA 4ABEA 4UD9H 1S6HA 1K2I1 3MMGA 1QL7A 5JB8S 4ZMAH 1ZTLA 4WF8A 1NRPH 3QX5H 3RDZA 3GICB 3SI4H 4B2BA 1CT2E 5GCHF 1TRNA 3PLKA 1H9HE 2KAIB 1P3EA 4FUEA 4JK5A 4NIWA 3A82A 1N8OC 4Y7BA 1IQGA 2A0QB 4BAQB 2QAAA 1G37A 4JMYA 1P09A 1V3XA 2C3SA 4NFEA 3RP2A 1DS2E 1CHGA 1GVZA 1SL3A 1P05A 2BDYA 2V3HH 1MTVA 1O3DA 1C2LA 1O2SA 2JH6D 4NWLA 2W7UA 2D2DA 3TH3H 1NTPA 3F9FA 5DG6A 1AVXA 4A92A 2SGAA 3TK5A 2XW9A 2VH6A 4JZEH 1ESTA 1A5GH 1FAKH 2BVSH 3N7OA 4A1XA 1KXCA 2AGIX 2ZHWH 1T32A 1YPEH 2ZO3H 1WCZA 5DP8A 3GCOA 4TWWA 1HAXB 1MD7A 4B74A 1ZZZA 1MZDA 1TNIA 4YO9A 4MPWA 2VINA 2GMTC 4AYVB 4BOHA 5HYOA 5FXLA 2AMDA 1A7SA 5JB9S 2QN5T 1W0ZU 1G32B 1GHBG 1Y5AT 2OD3B 1C1VH 2QY0B 2QF0A 3M5MA 1V2KT 1XUHA 3SU3A 1F0RA 3EE0B 1MKXK 2A1DB 5EXLA 1AVGH 1HAGE 3EAJA 5DPAA 4NIVA 2P3UB 1K28D 1IQKA 3ENSB 4NFFA 1O2JA 3NKKA 4TPYA 5ETXA 2ZDMA 4FU8A 4UONA 4K3JA 6GCHG 1BBRK 1OP2A 1IQHA 2ZHQH 3G01A 3U69H 1Y3UA 5L2YH 1K1OA 1ZR0A 1AO5A 3RXGA 1TONA 1N6YA 1UCYK 2HALA 3E91A 5BPEA 3FVFB 1G2LA 1P01A 1KSNA 2ZFTA 2QXHA 3S69A 4FUIA 4AB9A 3IG6B 1C5VA 2TBSA 3K65B 2H5DA 2NU2E 5K0HA 1YPHE 4OS6A 5TCAA 1GBAA 3MNSA 1ZHPA 1C2GA 4OS1A 1LCYA 4ISNA 4HGCA 1NN6A 5E2OA 2PGQB 4SGBE 1NY22 4NZQA 1O2XA 1YYY1 2C4FH 2G8TA 2GV6A 1KXBA 4MQAA 3T26A 2RG3A 2VVVA 5LPEA 3S9AA 1Y3VA 3UNSA 4BAHB 1GBBA 1P8VC 3BSQA 2ZGBH 2XBYA 2VGCB 3D65E 4I8LA 4IW4E 1HAHH 4A6LA 1O3BA 2Z6BD 1BT7A 4D9QA 3EA9A 2F9NA 2O8WA 1W2KH 3AAVA 1A3BH 5T3HA 2WPKS 1BJVA 4I8JA 4AORA 3OU0A 5AF9H 2V6NA 1PQ8A 2CF9H 2HWLB 4X2VA 3STIA 2FOFA 3A87A 2GX4A 2BVXH 4RKOB 5AVDA 2R2MB 1D3PB 1J9CH 1EJMA 1AUTC 1RRKA 3DFJA 4AYYB 3GYLB 4WMFA 2AIPA 1FN8A 3HK6B 4JZFH 7GCHG 1YKTA 2EI6A 4AFZA 3SUDA 1XVOA 3ZYDA 4ABDA 3E90B 1O2TA 1SB1H 3P8OA 1VITF 1EXFA 1WBGB 1Y3XA 1AUJA 1HAYB 1K1JA 3FFGA 1AQ7A 1GI4A 2F83A 3C1KA 3ITIA 3M61U 4UDWH 1UJ1A 5DKMA 1UCYE 2QXIA 3ZZ3A 4ZAEA 1Q3XA 1K21H 1XX9A 1ARCA 3PMHB 3RXEA 2TRMA 3SU2A 4K1TA 4AG2A 2PLXA 3GY7A 1TMTH 3TJUA 2P8OC 1MUEB 4CHAB 5HXFA 3CP7A 4MNXA 1EAWA 1UHBA 2GZ8A 5LPFA 1VCPA 1CO7E 2ZECA 5E0GA 2FTMA 3OYPA 2OQUA 1OWDA 5CHAC 2XCFA 1EPTB 1SI5H 1UVSH 4CRBA 2OINA 3RXBA 3EGKH 3KCGH 4FXGH 4K69A 1EZXC 2GCHF 1D3DB 1DWDH 3RUOA 1WYKA 1CBWC 2UUYA 3BTGE 1UVPA 3MWIU 3T27A 2FOCA 2ZCKP 4OS7A 1LQDB 1MTUA 4MPVA 5B6OA 1EP6A 1FMGA 5DO4H 2R3UA 2NU1E 1GL1A 1MTSA 1PFXC 1AB9C 2WPJS 1PYTD 4I7YH 1WTGH 2OCVB 2G5NA 1SVPA 4ZXYH 3E16B 4ZROA 9ESTA 1K1LA 1FDPA 4LZ1H 2BDCA 3T28A 2OQ5A 3PTBA 4Y8ZA 4K8YA 3UNRA 3PLBA 1GI7B 3DD2H 1O3KA 1SGNE 2BY9X 1O2HA 2V0BA 5EXMA 1EJNA 1P0SH 1RFNA 3BG4B 3L6PA 3MNXA 1GI6A 1ZGVA 3T2NA 4TYDA 2GD4B 1WOFA 3UY9A 2XXLA 2PWXA 2VB0A 4E05H 3RXRA 2A31A 4MVNA 3RM0H 4YM9A 3Q00A 1K1IA 1C5UA 3PYHA 1LHFH 1BMMH 3P8FA 4CREA 1E0FD 2RDLA 4B71A 1A0HB 2HNTF 2XC5A 2AIQA 1O2KA 3TJOA 1JRSA 2OC8A 1UTMA 5ESBA 3ATLA 4Z0KA 2AS9A 1L1GA 2Y5HA 1SGPE 2SNVA 1GMHF 1MBMA 2XNIA 3BEIB 3A7WA 2OP9A 1TX7A 3A8AA 3U1IB 2FM2A 2ANMH 2OC7A 3MH5A 4MNWA 4CRCA 2VWOA 2JETB 1YLCA 3H7OA 5I25A 1CGJE 3LU9B 2AYWA 3A81A 2BD3A 2ZF0H 1GBMA 2VIOA 2FOEA 4Y11E 4UE7H 3SU4A 1GHYH 2J95A 2Q1JA 4Y76A 1QQUA 1P10A 2A4GA 5A8ZA 1LTOA 3T25A 2BTCE 4OS2A 3SNEA 5A0AE 2HGTH 1HJ8A 4NIYA 1ID5H 3RXOA 1W14U 4Y8YA 2GZ9A 1SGYE 4I8GA 3U98H 1O3IA 3RXKA 1Y59T 1GJ6A 3P8NA 1TOMH 4GSOA 3O8DA 4ABBA 5L2ZH 2EC9H 2J2UA 4OS4A 1XXFA 1GG6B 3HGNA 2P3TB 3UWJH 1MKXH 4DW2U 1ZRKA 1FLEE 1EATA 3SI3H 3MNBA 2A32A 3GCTG 3A84A 3LPRA 3U8RH 1ETTH 3LJOA 3TK6A 2O8MA 1SPJA 1CE5A 2PUXB 5EQSA 3ZVCA 3ZV9A 1Q31A 1AN1E 1GBTA 2Y82A 3AASA 4AGKA 2R2WU 1UCYH 3RU4T 5A0CA 4XSKU 1ANCA 1TMUH 1HUTH 4MDSA 3BTTE 1ELDE 2PTCE 3RXUA 1TBRH 4AG1A 1K1MA 3O8BA 1UTKA 4AFSA 4CBNA 4INKA 4UEHH 3FZZA 4TY7A 5IYTA 1AWFH 3SOSA 3HGPA 2TGPZ 5EGMA 1XKBC 2KAIA 1V2UT 9LPRA 4Q7XA 4NIXA 1QB9A 1A5IA 2ZG0H 3M37A 1W8BH 1GI5A 1PQ5A 3SUEA 1C1OA 2A5KA 2BD7A 1MTNB 1XUIA 3RU4E 3DUXH 1ELFA 1RIWC 2XWAA 1LVBA 1MQ6A 1CU1A 1XUFA 1GHAF 3TH2H 5EW1H 2F9UA 4FUJA 3RM2H 1E37B 4Y7AA 5EODA 1EB1H 1O3LA 3MU4A 1O3OA 3ZZ4A 2PR3A 2PKAB 2A5AA 3ATWA 1TLDA 1C5NH 3ZV8A 1ZHMA 4ZHLU 5E0JA 2BZAA 4BAOB 2J92A 1PPEE 4ABHA 1XUGA 7LPRA 1P9UA 2UUFB 5A09A 3F9HA 4HI3A 2OUAA 1P2JA 2WYJA 3PV4A 3M7TA 1C5QA 2BY6X 2BLWA 1YBWA 1P2QA 1AFQC 1S85A 3TNSA 2QGRA 1C2HA 3PLPA 1CQQA 1W0YH 4ZUHA 1FPCH 7KMEH 1KXAA 5AHGH 4YT6H 2O8UA 1QIXB 1KLTA 1ZJKA 3M35A 1FJSA 3HKIB 1ZTJA 3UWIA 3U1JB 1DM4B 1QQ4A 5FHTA 4ZKSU 4YZUA 1BTZA 2WPIS 1A2CH 4JCNA 4HTCH 4NA9H 1YPHC 1B0EA 1ETRH 2VWLA 3U9AH 1SOZA 2FYQA 2BX4A 3PROA 2FI4E 2M5TA 5FPSA 2A4RA 4Z6AH 1GMDF 3ODDA 2IOTA 1TNHA 1GCDA 1LPKB 4ISLA 3UR9A 4CH8B 3PM3A 2A7CA 4THNH 4DGJA 1NPMA 3E3TA 1HJAC 1BITA 1V2PT 1FXYA 2W3KA 2AH4X 1QJ7B 2SNWA 1TA2A 2ZFFH 2VIDA 4CRFA 1EAXA 3KNXA 1A46H 1TBZH 3EA7A 2ZIQH 2BQ7B 3NZIA 3SU0A 1WSSH 3MH4A 1GJ9B 1MQ5A 1C5YB 1NFYA 1ZOMA 2PV9B 3M5NA 1MAYA 1AZ8A 4INLA 6CHAC 3D49H 3GYMA 2AMQA 2J94A 3A7XA 3KF2A 1DVAH 1Y8TA 2GDDA 2BB4A 3SV7A 3BIVH 1NFXA 1C4Y2 1KXDA 1FY8E 5JBAS 3SORA 1HAIH 1LKBA 2PW8H 5G4BA 5DP3A 4MPXA 5ESTE 1ETSH 1O2RA 1LDTT 4UFGH 1YP9A 1SGEE 1FAXA 1LVOA 3A88A 2R9PA 1QB1A 3LT3A 3GY6A 1FPHH 2ODQA 1P03A 1GJ4H 3S7KB 1UK3A 1SGCA 2AGGX 2BLOA 4JZ1A 2EI8A 4MG3A 1OKXA 2GCTB 3PWBA 1HBTH 1NM6A 1ZHRA 5H4IB 1F0UA 1ORFA 5JPMH 4CRGA 2A7JA 3EDXB 1S5SA 1VITG 4ABFA 4KTUA 1OPHB 3BG8A 8GCHF 1UMAH 4FU9A 2Y7ZA 3GCHB 4NCYA 1O3AA 3SJ9A 1GWAA 1O3MA 2BDBA 4BAMB 3K6YA 1HIAB 2ILNA 3SJKA 3MYWA 1OWEA 2F3CE 1CA0B 2W3IA 3GY3A 3STJA 3LH3A 2PSYA 2SGFE 1QJ6B 2ZGJA 4AGJA 1JIMA 1QGFA 4WMDA 2H9EH 1DOJA 1SQAA 2CHAC 3LONA 4I32A 1V2NT 1HGTH 2P3FH 4NZLA 3ZVAA 2SGQE 4I33A 2OBQA 3RXVA 2ZFSA 3BEFB 3ZZAA 1Y5UT 2FOHA 1FIWA 1FI8A 2OC0A 1O2LA 3EA8A 3MTYA 2VVCA 2XC0A 4Y71A 4X2WA 5JBCS 2ANKH 1CA8B 2J4IA 2P94A 2UUJB 4B2CA 1GJCB 1IOEA 2BY7X 1TPSA 1SGQE 1EP5A 2QCYA 1QA0A 1QFKH 4U32A 2CGAA 2FZZA 5DP7A 5JDUB 4XFQA 2ZFQH 1V2OT 1N8OB 1THSH 3WY8A 3P6ZB 2RCEA 3MU5A 1P06A 1CT0E 2Y81A 3HKJB 1AZZA 5LPRA 1EZSC 1IQIA 1IQJA 3MO6A 1BOQA 3LGVA 4GCHF 1C1MA 4ABIA 4MNYA 4DG4A 1GJ7B 1DUEA 3KN2A 3PO1B 1GI8B 4YLQH 4O3TA 2UWLA 1W7XH 2FLRH 2F9OA 3KQDA 1EB2A 3QTOH 1L1NA 3UIRA 3KEEA 1FZZA 1NESE 1QBOA 4VGCC 2IJOB 1FNIA 3SNDA 1GMHG 1WQSA 2VWNA 4NA7A 5T6GA 3ATKA 5F8ZA 4LZ4B 1O2UA 2OBOA 1Z1JA 1N1LA 1SGDE 3TJVA 2RA3A 2H1UA 1DANH 2GV7A 1TYNA 3QLPH 2WPHS 3ZZBA 2EI7A 4RKJB 3P70B 1C1QA 3A85A 1DX5M 2F9PA 3QGNB 3MU1A 2BD9A 1NFUA 4X8VH 1AMHA 4O9VA 3UQOA 1T8NA 3BF6H 4ZKRU 1O2YA 1EZUC 1C1UH 3TITA 1ELGA 1AE5A 1P2MA 1NU7B 2FMJA 1F5LA 4MLFB 1DLKB 2SGPE 3UOUA 2H6MA 1SLUB 1VGCB 3MH6A 3PMAB 2ZGCA 1TNLA 1WU1A 1ZPCA 2DUCA 1RJXB 2ZFRH 3M3SA 2FX4A 1IQMA 1D3TB 2Q6FA 2BDIA 3SNBA 4OGXA 4JYVH 1B0FA 1KDQB 3M36A 1ANEA 1O5AB 1GBLA 1E35B 4JZIA 5I46H 2BOHB 4AX9H 3FP6E 1O3PB 1ZJDA 2HNTE 2STAE 3FANA 4GHTA 1K9OE 2FESH 3MU8A 5DJ7A 4A1VA 1ACBE 4FUDA 1C5XB 3RXJA 3ZVFA 4AZ2B 1DXPA 2XC4A 3ATMA 4I8HA 4BANB 3TIUA 2R0LA 2GT8A 5HM9A 4GVUA 1BTYA 1P02A 2A2XH 1CVWH 2G51A 1A0JA 1TOCB 1WV7H 1BMNH 3GCNA 4IBLH 2NU3E 1HV7A 3A8DA 1ELAA 3QGJA 4LOYH 3RC6A 2K1QA 1C5PA 1DDJA 4DT7B 4LK4A 1S81A 5C5NA 1GPZA 2ZCHP 2BDAA 5EPNA 3IITA 1GGDC 2QXJA 1YF4A 1P2NA 1MH0A 1HRTH 1MU6B 2FS8A 1SC8U 1OWKA 1L0ZA 2QC2A 3M3TA 5A8XA 3IWMA 3PMJA 1QY6A 1BIOA 1H9IE 2ZDLA 3B8JA 4Q80A 2BOKA 1XMNB 4X1QU 1TGBA 2G81E 1GHAG 5GWZA 1SLVB 2P95A 1NROH 3SHAH 3KL6A 1TALA 2BZ6H 2Y5GA 3TK9A 1GMCG 1QL8A 3ZZCA 4INHA 2CJIA 4ISHH 1GI9B 5FBIA 5TJXA 1PPFE 5FCKA 3RXSA 2VWMA 2ZU3A 4NA8A 2PKSB 1OP8A 2BD5A 1X7AC 1WUNH 1NO9H 3BG4C 3LGIA 4X2XA 3UOPA 1SGFG 3ZZ9A 4KTSA 4JZDH 3OY6U 1D6RA 3BTDE 3QZQA 1CHOF 1E36B 1O2OA 3RXDA 4NGAH 2ZGXH 1TMBH 2FPZA 5CHAB 1AY6H 3A80A 3TNTA 1RD3B 2O8LA 1OWHA 4XBBA 1ELTA 3D62A 1DT2A 3UREA 1IQLA 2ALVA 2Z9KA 2Y6TA 1YM0A 1CT4E 1TABE 1AB9B 1V2LT 2JETC 1GDNA 1RXPA 2HLCA 3B23B 1T8OA 1NRQH 4FVBA 4D7GA 1LHCH 4MNVA 4ZKNU 1GCTB 2XYAA 3BIUH 4XDEA 1EZQA 4TWYA 1P11E 1QL9A 3L33A 3BTQE 1GMDG 1Z71A 1HXFH 2ZTXA 2EA3A 3RXMA 4YOJA 2BHGA 3V3MA 1VZQH 3F1SB 1TFXA 1WAYB 1G36A 1V2TT 5EU8A 5J4SA 2BM2A 4Q2KA 1SGTA 1QB6A 1LKAA 1HAOH 1BRBE 2Y80A 1D9IA 2BXTH 2Z94A 4NSYA 3E0NB 3GY2A 1KTTB 2JKHA 1C1RA 2BYAX 1QA7A 1UTNA 1KTSB 2WYGA 2FI5E 2TGTA 2BMGB 2G00A 2F91A 5GXPA 1TGTA 1YC0A 1SFIA 2FOAA 4CRAA 3BN9A 3PMBB 3DT0H 3GY8A 1G3DA 2VIVA 1MCVA 3F6UH 2ZHEH 2GKVE 2QXGA 1J15A 1TGNA 1Z7KA 3A7YA 2PHBA 4E06H 1WTHD 2TGAA 2WPMS 1RTKA 1P12E 2CV3A 3MHWU 1PJPA 1C5SA 1IQEA 1ESBA 1VR1H 3A7ZA 4B2AA 1Y5BT 3LH1A 4O03A 3A8CA 3OX7U 1CSOE 3L3TA 1DITH 3Q3XA 1QTFA 1C1SA 2XBXA 3LC5A 2FTLE 3SJOA 2BLQA 1YLDA 1C2EA 2YNAA 2YOLA 4WY3A 2H9HA 4NG9H 1H1BA 1J14A 1O2GH 1U6QA 4FUHA 3R3GB 1NT1A 4RSPA 1UVOA 3V13A 1TX6A 2JH0D 3BTFE 3QWCH 4KTCA 3NXPA 1DY9A 4A7IB 1V2VT 2OTVA 4DOQA 1H4WA 1QRZA 2QV1A 3MO9A 1HIAA 1BRAA 1O31A 1C5ZB 4X1PU 2AERH 1V2JT 4Q7YA 4FVDA 1HAVB 1ZRBA 2B9LA 7GCHF 1JOUB 3A83A 4ZH8A 5CE1A 3PTNA 1W7GH 3ZVEA 1FY4A 1DSTA 1DXWA 3KQCA 3ELAH 1TAWA 4WMEA 2PFEA 4BTUB 2A4QA 4ZHMU 2GTBA 1TX8A 5GCHG 1GBEA 5GJ4B 3SV2H 5HM2A 4BTIB 1ABJH 2XCNA 3RXQA 2BDGA 1C2MA 2ZZUH 1SR5C 4AOQA 4DY7B 1SLXB 2FLBH 3QK1A 2HRVA 4U30A 5AFYH 3PB1E 4Q7ZA 1O36A 1FONA 2FYRA 3NK8A 1BRUP 3ZZ6A 2OLGA 1BMAA 2SGEE 3LJJA 3RLYH 1O5GH 3V0XA 8KME2 3K2UA 3UTUH 2BY8X 1BQYA 3RXHA 1YCPH 1BRCE 1W11U 5IDKA 1MZAA 2OC1A 1TGCA 3P8GA 2Z9GA 1XM1A 1PQ7A 4Y8XA 5FPYA 1PQAA 1UTQA 5F8TA 2SFAA 1UVTH 5C67A 3LGTA 3W94A 1M9UA 1SBWA 3BTME 1Z6JH 2QF3A 1K22H 1RIWB 3TPIZ 2ODYB
chains in the Genus database with same CATH superfamily
2KZ4A 3OY5U 4X1NU 2RDEA 4TSFD 2B0FA 1ZMNA 1C1NA 2Z7FE 2FOMB 1XKAC 1DE7H 2STBE 3KQEA 4GCHG 1GBCA 2VNTA 2A2QH 3T29A 6LPRA 5K7RA 3TGJE 5A0BA 4ESTE 1SHYA 1QHRB 1T8LA 2VVUA 2W7SA 1TNJA 2R3YA 2HPPH 3RMMH 1GVKB 3CNRA 2BXUH 1O37A 1G3CA 3RC4A 4A5TS 2XNDD 3FAOA 1O5CB 1GI2A 1AFQB 4ABAA 1GHZA 3GISB 4DCDA 5SGAE 2CXVA 1LVYA 1RGQA 1KIGH 1YCPM 4M7GA 4X6MA 2XWBI 1F0TA 1ZSKA 4CBOA 3KQBA 3GDVA 3I29A 4YT7H 3ESTA 5L6NH 4UFFH 1XXDA 2VBCA 1BTHH 3AVZA 1BHXF 5F6MA 4K1EA 3TLOA 3SU5A 1O3EA 3PWCA 1EKBB 3RU4D 2AEIH 3OAAD 4OM9A 1UTJA 3SHCH 2PGBB 2ANYA 3SV9A 2WHXA 3UFAA 1YPJH 1KDQA 4D76A 1MU8B 3JZ2B 2NU4E 1UTPA 3VFEA 2C93B 1ELBA 3VXEH 2BLVA 3Q3KA 3RXTA 2TGDA 5FX5A 3TH4H 3A7VA 2F9BH 3FP7E 3LOXA 4WH8A 1KLIH 2GCTC 1PPZA 5C1XA 1OX1A 5AFZH 3SV6A 2W5EA 2BQWB 3I78A 4GLYA 3BV9B 5CMXH 5A8YA 1FUJA 2KFWA 5GNDA 2ZI2H 8LPRA 1AGJA 1O3HA 1C5WB 1C1PA 5ABWA 4BNRA 2FDAA 3D23A 2ZTZA 4WH6A 5TCCA 2F4LA 4HG6A 3V7TA 4J2YB 1UTLM 1MKWK 1AKSB 1LO6A 1O3GA 3SUFA 1FX0B 1CA0C 5DP6A 5F03A 6CHAB 1V2ST 2BD8A 1O3FA 1SG8B 4F4OC 4JK6A 2ZPQA 2ZU2A 1MAXA 1GI0A 3VGCB 1JBUH 3GY4A 3M7UA 4CH2B 3LGWA 1K1NA 5DGJA 2NWNA 5E0HA 1B7XB 3TVJB 1THRH 3RXCA 1V6DA 1NC6A 1PPGE 2ZEBA 1W10U 3RXAA 1EPTA 4RT0A 8ESTE 1OXGA 3FOAA 3NRLA 1S0RA 1EAUA 3SJIA 3LGYA 3P95A 4H6SB 4X8TH 2I6SA 5EXNA 1O2QA 1YGCH 2F9VA 4CR9A 1PPBH 3LKWA 1YPGH 2FO9A 1C5TA 1W3CA 4GHQA 2GCHG 1WQVH 2B5TB 1WXRA 2AMPA 3KYFA 2P16A 4IC6A 1O2ZA 3M5LA 3SW2B 3M7QA 2A45B 1LQEA 1ARBA 3SNAA 3T62A 2PUQH 3EQ0H 1H8DH 4MTBA 4X8SH 2Z3CA 1SMFE 1BTWA 1NRSH 1C2KA 1TGSZ 1EJAA 1C4V2 2RFKC 3R0FA 1KLJH 1O3JA 2BVRH 5A2MH 5J4QA 3S0NA 2C8ZB 1F92A 4P00A 3QTVH 1GJ5H 3PO1C 2ALPA 2VIQA 1CHOG 4NSVA 3S9CA 1C5RA 1UK4A 2CHAB 3K6ZA 5BRRE 3O8RA 1IQFA 1A4WH 1JMOH 4JYUH 1FY3A 2HPQH 1TPAE 2K8IA 5GPIB 3ODFA 2A7HA 2Z9JA 1D4PB 1LHGH 2EQNA 1MCTA 1SGRE 1QBNA 3F0OA 2NU0E 3NUMA 2ODPA 1NZQH 1LHEH 1NRRH 1SOTA 2Y5FA 1G9IE 1Y3YA 3CS0A 4Y6DA 4WVPE 1Z8RA 3A89A 3H7TA 2ZU5A 5L30H 2D8WA 3NCLA 3P17H 4TPIZ 2ZA5A 4Y0YE 2EEKA 2GT7A 1TPPA 4ZKOU 1Z8JB 2GMTB 2FP7B 1HDTH 1HCGA 4K8BA 3OTJE 2GP9B 1EAIA 1FQ3A 1GBHA 3URCA 1ZTKA 5T1VA 1ZPBA 1C1TA 1NRNH 1VGCC 2DE9A 1OS8A 2VGCC 4IN1A 4J1YA 2BQ6B 4B1TA 1O3NA 4H4FA 1L1JA 3A86A 3HATH 3KGPA 4RN6A 4Y10E 1LHDH 1O3CA 5JYIA 2Y7XA 3DFLA 1J8AA 4FUBA 1NU9A 1ZPZA 5JBBS 3RXPA 3MNCA 1KYNA 1SSXA 4FU7A 3MH7A 1O5DH 1AVWA 5FCRA 2P93A 2C8XB 4VGCB 4H6TA 1EASA 3S7HB 1BUIA 4IC5A 4K2YA 4AN7A 3URDA 5CDFE 2XTTB 1G30B 4OGYA 3VB4A 1S0QA 3QDZB 1GI1A 2H2ZA 1AU8A 1PPCE 3SYJA 5FAHA 2ZU1A 2O9QA 4IS5A 3ZZDA 1TQ0B 1TWXB 4CRDA 2GDEH 1BTXA 1N6XA 4ABJA 1YCPK 3RXLA 3HPTB 3SN8A 1F2SE 2UUKB 1BTPA 1HJ9A 1LPZB 1P2KA 1P3CA 3DSOA 3GY5A 5EJLA 2GGVB 4BAKB 1HAZB 1FIZA 1RTFB 5C2ZA 5C5OA 3V12A 5PTPA 1QRXA 3TU7H 2IN2A 3RC5A 3O8CA 2CF8H 3OE7D 4BTTB 1ZSJA 4CHAC 3BTEE 3EYDA 1HAVA 1HNEE 1T8MA 3A7TA 2JIZD 2HVYB 2FEQH 4F48B 1BHXB 1IHSH 4ABGA 1GVLA 2O8TA 4IMQA 1J16A 1JWTA 5C1UA 3Q77A 1AWHB 2PTNA 1XUKA 1EPTC 4Y0ZE 5DK1A 5FL7D 1NS3A 1A3EH 4IN2A 1G3EA 2IPHA 1OYTH 4ZXXH 1NBMD 2ZQ1A 3T5FH 1BDAA 1QBVH 1QRWA 2G55A 4BXSA 3ATIA 1BBRE 5T6FA 3PV5A 1UTOA 6ESTA 1C2FA 3CENA 3P92A 1D3QB 3A8BA 2PKAA 2PKSC 1TBQH 1ANDA 3N7DA 4YOIA 3UR6A 1L2EA 1DWEH 3H5CB 4UFDH 1BJUA 4GPGA 2VJ1A 3ZVGA 1PPHE 1YPLH 5HIYA 3N99A 1LPGB 3NPSA 4U01A 3GDSA 2ZCLP 1E1RD 2D26C 1HFDA 4FUFA 5HGGA 1O5BB 5FPTA 3JZ1B 4WJG2 1DPOA 1LMWB 4IGDA 1SLWB 5DP9A 2V35A 1VITH 1OWIA 4K5ZA 2SGDE 1GGDB 3MOCA 2H5CA 1O35A 1TB6H 2QE7D 2ZDAH 3K9XB 2P8OB 5C20A 5FBEA 4ASHA 3E0PB 4KP0A 3BTHE 2WUBA 4DVAU 4YESB 1MKWH 3E6PH 4U2WA 3ZVBA 1TPOA 3SGAE 3UB0A 3AW1A 4F55A 3BEUA 4O97A 4X8UH 4QT8C 3MU0A 3UQVA 1UO6A 1O2MA 1QNJA 1O33A 4O3UA 1DLEA 1HYLA 7ESTE 1ABIH 3QZRA 1CBWB 3ZZ5A 1ZMLA 1GCTC 3Q3YA 1SFQB 2GVFA 2L74A 1BA8B 5GIBA 1MMJN 4YLUA 1IQNA 3I77A 1O2NA 1ZSLA 1GJAB 1FN6A 1GHBF 2UWOA 1G3BA 5CHBA 3C27B 4KELA 3UUZA 1MBQA 3LGUA 3CS7A 1AD8H 1S6FA 1GBFA 1C9TA 1HPGA 1VJ9U 5E2PA 1C2JA 1JIRA 1TA6A 1C2DA 2VIPA 3SJ8A 2H9TH 2FODA 2XBWA 2DE8A 2Z3DA 1LVMA 3F9GA 6GCHF 4DJZB 4OS5A 1P04A 2ZC9H 1ESAA 3QN7A 1EOLA 1IHTH 2ESTE 3DHKH 4NWKA 4AB8A 1T4VH 3OEHD 3SQHE 4X2YA 4AFUA 5EW2H 2Z9IA 3MI4A 4F49A 5C3NA 3SGBE 3Q76A 5EQQA 4XE4A 3UAIC 1GG6C 1FY5A 2G5VA 2ASUB 3FKSD 3PRBA 5T6DA 4FUCA 1O2VA 3U8OH 2G4TA 1DSUA 1QURH 2B7DH 2KCAA 1D6WA 2G4UA 3E1XB 2A5IA 4YOGA 1W0KD 1L4ZA 4X6OA 3DA9B 3RXFA 3SZNA 3ZZ7A 1TRYA 3HK3B 1BB0B 1BTUA 1ZMJA 2IJD1 2WUCA 5F8XA 1O32A 3BTWE 1BMLA 2I6QA 1RTLA 2BDHA 3GOVB 4YTAA 2VU8E 5HIZA 2J38A 1UVUH 4ZHAA 4D8NA 3QUMP 2LNCA 1K1PA 2J9NA 2TPIZ 1FY1A 2OXSA 4HFPB 1C9PA 3OTPA 2WPLS 4WWYA 3VPKA 3VB7A 2FS9A 2THFB 1O39A 2ZPRA 1OHHD 1AKSA 1KY9A 1Z8GA 2AGEX 2B8OH 4WXVA 1KXEA 1W13U 4M9FA 5DP4A 4IMZA 4XBCA 2KCPA 3KIDU 2EY4C 5EJZA 1XVMA 1GJBB 1ZYOA 1TNGA 3RMLH 1GBDA 4R0IA 4Q4LA 4TY6A 1TE0A 2LP6A 1FV9A 5HKKD 1BBRH 1EQ9A 1P9SA 1MTNC 4H42U 1GJDB 8GCHG 1O30A 1E38B 1EX3A 1DFPA 1O5EH 4B6FA 1A5HA 2YMSB 1GBIA 1KMHB 2ZDNA 1BCUH 3GDUA 1O2IA 3SGQE 1ZLRA 5E8EH 3QO6A 2WPDD 3RXIA 3TGIE 5GDSH 5EG4A 2G52A 2YNBA 3E8LA 5LGOA 2CN0H 1O38A 2PP6A 2ZDKA 3MO3A 2WV5A 1B5GH 2UWPA 3RMNH 1VCWA 3LIWA 5EPYA 4BXWA 1HB0B 1HXEH 1AE8H 2ZFPH 2ZNKH 1C5OH 2WINI 1S83A 2J34A 2ZTYA 2ZU4A 1O0DH 1P2OA 4I31A 2WV4A 2FX6A 3UPEA 2W6JD 1THPB 4K1SA 1UHBB 2LPRA 4LXBH 5FX6A 2BY5X 1HAPH 2TIOA 1QCPA 1GDQA 1P2IA 2VIWA 3U8TH 3VB3A 1GMCF 1VJAU 4X6PA 5DP5A 1F7ZA 1C2IA 1H8IH 1OYQA 2CMYA 1GL0E 1V2QT 1G2MA 2HOBA 3NWUA 4ISOA 1VKYA 2GZ7A 1F5KU 3FP8E 3TGKE 1C5MD 1UW7A 4KGAA 4R8TB 1A61H 2BD2A 1ZGIA 1ELVA 3AW0A 5C94A 1CGIE 1W12U 3VXFH 1Z1IA 2VH0A 3VB6A 2Z3EA 1DWBH 1AFEH 4X0WU 2ZHFH 2ANWA 4B75A 3SU6A 4XOJA 1C5LH 2BD4A 1AHTH 2ZPSA 1TIOA 2Q6DA 4XRNA 4ISIH 4I8KA 3B9FH 2ZDVH 1SGFA 4X1SU 1QJ1B 3SBKA 1GHWH 1F5RA 1GDUA 2FOBA 5LH8A 1E34B 1QR3E 1EUFA 1L4DA 1J17T 4DIIH 4E7NA 2AFQB 2ZP0H 4DIHH 1MD8A 3W95A 1O2PA 2C8WB 3SV8A 3ZZ8A 4AFQA 5JBTA 1HLTH 3F9EA 3S9BA 1DICA 1PYTC 2ZGHA 3SO3A 1SQTA 5C17A 1OOKB 2Q6GA 1ELCA 3LDXH 3VEQB 4K60A 2HNTC 1V2WT 1A0LA 1GJ8B 1DY8A 1ELEE 3SQEE 3OSYA 1OSSA 2V3OH 4WXIA 1GBKA 1A1RA 2J97A 4B73A 1JRTA 1S84A 3AAUA 4SGAE 3FZDA 3RMOH 4CR5A 3ZVDA 1YPMH 2Z9LA 3F68H 2QIQA 3MFJA 2ZQ2A 1YPKH 2FIRH 2JH5D 2PSXA 1HJAB 2FWWA 4GUXA 1MTWA 2W26A 4KKDA 3UNQA 1S82A 1Z6EA 1OP0A 2ZHDA 3TJNA 3M3VA 1SHHB 2C8YB 4GAWA 1GHVH 2L6OA 3EE7A 2RA0A 2C90B 1GI3A 3VGCC 3GCHC 1RS0A 2FXRA 4JYTA 2QYIA 3RLWH 1NFWA 4UFEH 2XRCA 2KM0A 5HMAA 1TNKA 4X1RU 3BTKE 2ULLA 4A1TA 4B76A 3GCTF 1T31A 1GBJA 1OWJA 2FOGA 1P57B 1H9LB 1TRMA 4MPUA 1INCA 1UK2A 2D1JA 2FI3E 3LC3A 2HVXA 4PROA 1VCQA 1BZXE 1AIXH 1C1WH 1ANBA 1V2MT 2A4OA 2XBVA 3SNCA 4ACAA 2P59A 2BX3A 1XUJA 1Y3WA 1T7CA 5EQRA 4XBDA 3KHVA 5C1YA 1IAUA 1O34A 1CGHA 1F0SA 1DWCH 1T4UH 2ZKSA 1KXFA 2ZWLH 4X6NA 1Q2WA 2QF5A 1DUAA 1JXPA 1EOJA 4FUGA 4HZHA 2R0KA 3VB5A 3SUGA 1O5FH 1TQ7B 1SQOA 1C4U2 4D9RA 4E7RG 1O2WA 1V2RT 1Z8IB 1SGIB 3ZYEA 1AI8H 2QA9E 3DSPA 4D7FA 4DURA 1GHXH 4Y79A 5EOKA 3SU1A 3M5OA 4ABEA 4UD9H 1S6HA 1K2I1 3MMGA 1QL7A 5JB8S 4ZMAH 1ZTLA 4WF8A 1NRPH 3QX5H 3RDZA 3GICB 3SI4H 4B2BA 1CT2E 5GCHF 1TRNA 3PLKA 1H9HE 2KAIB 1P3EA 4FUEA 4JK5A 4NIWA 3A82A 1N8OC 4Y7BA 1IQGA 2A0QB 4ACBA 4BAQB 1YWUA 2QAAA 1G37A 4JMYA 1P09A 1V3XA 2C3SA 4NFEA 3RP2A 1DS2E 1CHGA 1GVZA 1SL3A 1P05A 2BDYA 2V3HH 1MTVA 1O3DA 1C2LA 1O2SA 2JH6D 4NWLA 2W7UA 2D2DA 3TH3H 1NTPA 3F9FA 5DG6A 1AVXA 4A92A 2SGAA 3TK5A 2XW9A 2VH6A 4JZEH 1ESTA 1A5GH 1FAKH 2BVSH 3F2FA 3N7OA 4A1XA 1KXCA 2AGIX 2ZHWH 1T32A 1YPEH 2ZO3H 1WCZA 5DP8A 3GCOA 4TWWA 5C0TA 1HAXB 1MD7A 4B74A 1ZZZA 1MZDA 1TNIA 4YO9A 4MPWA 2VINA 2GMTC 4AYVB 4BOHA 5HYOA 5FXLA 2AMDA 1A7SA 5JB9S 2QN5T 1W0ZU 1G32B 1GHBG 4XD7D 1Y5AT 2OD3B 1C1VH 2QY0B 2QF0A 3M5MA 1V2KT 1XUHA 3SU3A 1F0RA 3EE0B 1MKXK 2A1DB 5EXLA 1AVGH 1HAGE 3EAJA 5DPAA 4NIVA 2P3UB 1K28D 2V3MA 3MQKC 1IQKA 3ENSB 4NFFA 1O2JA 3NKKA 3PV2A 4TPYA 5ETXA 2ZDMA 4FU8A 4UONA 4K3JA 6GCHG 1BBRK 1OP2A 1IQHA 2ZHQH 3G01A 3U69H 1Y3UA 5L2YH 1K1OA 1ZR0A 1AO5A 3RXGA 1TONA 1N6YA 3F3BA 1UCYK 2HALA 3E91A 5BPEA 3FVFB 4FETA 1G2LA 1P01A 1KSNA 2ZFTA 2QXHA 3S69A 4FUIA 4AB9A 3IG6B 1C5VA 2TBSA 3K65B 2H5DA 2NU2E 5K0HA 1YPHE 4OS6A 5TCAA 1GBAA 3MNSA 1ZHPA 1C2GA 4OS1A 1LCYA 4ISNA 4HGCA 1NN6A 5E2OA 2PGQB 4SGBE 1NY22 4NZQA 1O2XA 1YYY1 1SQRA 3F2HA 2C4FH 2G8TA 4YXWD 2GV6A 1KXBA 4MQAA 3T26A 2K0QA 2RG3A 2VVVA 5LPEA 3S9AA 1Y3VA 3UNSA 4BAHB 1GBBA 1P8VC 3BSQA 2ZGBH 2XBYA 2VGCB 3D65E 4I8LA 4IW4E 1HAHH 3WWFA 4A6LA 1O3BA 2Z6BD 1BT7A 4D9QA 3EA9A 2F9NA 2O8WA 1W2KH 3AAVA 1A3BH 5T3HA 2WPKS 1BJVA 4I8JA 4AORA 3OU0A 5AF9H 2V6NA 1PQ8A 2CF9H 2HWLB 4X2VA 3STIA 2FOFA 3A87A 2GX4A 2BVXH 4RKOB 5AVDA 2R2MB 1D3PB 1J9CH 1EJMA 1AUTC 1QZ8A 1RRKA 3DFJA 4AYYB 3GYLB 4WMFA 2AIPA 1FN8A 3HK6B 4JZFH 7GCHG 1YKTA 2EI6A 4AC9A 4AFZA 3SUDA 1XVOA 3ZYDA 4ABDA 2XOKD 3E90B 1O2TA 1SB1H 1MABB 3P8OA 1VITF 1EXFA 1WBGB 1Y3XA 1AUJA 1HAYB 1K1JA 3FFGA 1AQ7A 1GI4A 2F83A 3C1KA 3ITIA 3M61U 4UDWH 1UJ1A 5DKMA 1UCYE 2QXIA 3ZZ3A 4ZAEA 1Q3XA 1K21H 1XX9A 1ARCA 3PMHB 3RXEA 2TRMA 3SU2A 4K1TA 4AG2A 2PLXA 3GY7A 1TMTH 3TJUA 2P8OC 1MUEB 4CHAB 5HXFA 3CP7A 4MNXA 1EAWA 1UHBA 2GZ8A 5LPFA 1VCPA 1CO7E 2ZECA 5E0GA 2FTMA 3OFND 3OYPA 2OQUA 1OWDA 5CHAC 2XCFA 1EPTB 1SI5H 1UVSH 4CRBA 2OINA 3RXBA 3EGKH 4ZCNA 3KCGH 4FXGH 4K69A 1EZXC 2GCHF 1D3DB 2F43B 1DWDH 3RUOA 1WYKA 1CBWC 2UUYA 3BTGE 1UVPA 3MWIU 3T27A 2FOCA 2ZCKP 4OS7A 1LQDB 1MTUA 4MPVA 5IK2D 5B6OA 1EP6A 1FMGA 5DO4H 2R3UA 2NU1E 1GL1A 1YY3A 1MTSA 1PFXC 1AB9C 2WPJS 1PYTD 4I7YH 1WTGH 2OCVB 2G5NA 1SVPA 4ZXYH 3E16B 4ZROA 9ESTA 3GS9A 1K1LA 1FDPA 4LZ1H 1H8HD 2BDCA 3T28A 2OQ5A 3PTBA 2J5UA 4Y8ZA 4K8YA 3UNRA 3PLBA 1GI7B 3DD2H 1O3KA 1SGNE 2BY9X 1O2HA 2V0BA 5EXMA 1EJNA 1P0SH 1RFNA 3BG4B 3L6PA 3MNXA 4P02A 1GI6A 1ZGVA 3T2NA 4TYDA 3SZEA 2GD4B 1WOFA 2QF4A 3UY9A 2XXLA 2PWXA 2VB0A 4E05H 3RXRA 2A31A 4MVNA 3RM0H 4YM9A 3Q00A 1K1IA 1C5UA 3PYHA 1LHFH 1BMMH 3P8FA 4CREA 2J98B 1E0FD 2RDLA 4B71A 1A0HB 2HNTF 2XC5A 2AIQA 1O2KA 3TJOA 1JRSA 2OC8A 1UTMA 5ESBA 3ATLA 4Z0KA 2AS9A 1L1GA 2Y5HA 1SGPE 2SNVA 1GMHF 1MBMA 2XNIA 3BEIB 2HLDD 3A7WA 2OP9A 1TX7A 3A8AA 3U1IB 2FM2A 2ANMH 2OC7A 3MH5A 4MNWA 4CRCA 2VWOA 2JETB 2JJ1D 1YLCA 3H7OA 5I25A 1CGJE 3LU9B 2AYWA 3A81A 2BD3A 2ZF0H 1GBMA 2VIOA 2FOEA 4Y11E 4UE7H 3SU4A 1GHYH 2J95A 2Q1JA 4Y76A 5KGOA 1QQUA 1P10A 2A4GA 5A8ZA 1LTOA 3T25A 2BTCE 4OS2A 3SNEA 5A0AE 2HGTH 1HJ8A 1WDIA 4NIYA 1ID5H 3RXOA 1W14U 4Y8YA 2GZ9A 1SGYE 4I8GA 3U98H 1O3IA 3RXKA 1Y59T 1GJ6A 3P8NA 1TOMH 4GSOA 3O8DA 4ABBA 5L2ZH 2EC9H 2J2UA 4OS4A 1XXFA 1GG6B 3HGNA 2P3TB 3UWJH 1MKXH 4DW2U 4FOUC 1ZRKA 1FLEE 2KCYA 1EATA 3SI3H 2YMSC 3MNBA 2A32A 3GCTG 3A84A 3LPRA 3U8RH 1ETTH 3LJOA 3TK6A 2O8MA 1SPJA 1CE5A 2PUXB 5EQSA 3ZVCA 3ZV9A 1Q31A 5EJ1A 1AN1E 1GBTA 2Y82A 3AASA 4AGKA 2R2WU 1UCYH 2LELA 3RU4T 5A0CA 4XSKU 1ANCA 1TMUH 1HUTH 4MDSA 3BTTE 1ELDE 2PTCE 3RXUA 1TBRH 4AG1A 1K1MA 3O8BA 1UTKA 4AFSA 5C0UA 4CBNA 4INKA 4UEHH 3FZZA 4RI0A 4TY7A 5IYTA 1AWFH 3SOSA 3HGPA 2TGPZ 5EGMA 1XKBC 2KAIA 1V2UT 9LPRA 3KYGA 4Q7XA 4NIXA 1QB9A 1A5IA 2WV9A 2ZG0H 5KECA 3M37A 1W8BH 1SKYE 1GI5A 1PQ5A 3SUEA 1C1OA 2A5KA 2BD7A 1MTNB 1XUIA 3RU4E 3DUXH 1ELFA 1RIWC 2XWAA 1LVBA 1MQ6A 1CU1A 1XUFA 1GHAF 3TH2H 5EW1H 2F9UA 4FUJA 3RM2H 1E37B 4Y7AA 5EODA 1EB1H 1O3LA 3MU4A 1O3OA 3ZZ4A 2PR3A 2PKAB 2A5AA 3ATWA 1TLDA 1C5NH 3ZV8A 1ZHMA 4ZHLU 5E0JA 2BZAA 4BAOB 2J92A 1PPEE 4ABHA 1XUGA 7LPRA 1P9UA 2UUFB 5A09A 3F9HA 4HI3A 2OUAA 1P2JA 2WYJA 3PV4A 3M7TA 1C5QA 2BY6X 2BLWA 1YBWA 1P2QA 1AFQC 1S85A 3TNSA 2QGRA 1C2HA 3PLPA 1CQQA 1W0YH 4ZUHA 1FPCH 7KMEH 1KXAA 5AHGH 4YT6H 2O8UA 1QIXB 1KLTA 1ZJKA 3M35A 1FJSA 3HKIB 1ZTJA 3UWIA 3U1JB 1DM4B 1QQ4A 5FHTA 4ZKSU 4I86A 4YZUA 1BTZA 2WPIS 1A2CH 4JCNA 4HTCH 1EFRD 4NA9H 1YPHC 1B0EA 1ETRH 2VWLA 3U9AH 1SOZA 2FYQA 2BX4A 3PROA 2FI4E 2M5TA 5FPSA 2A4RA 4Z6AH 1S6LA 1GMDF 3ODDA 2IOTA 3FN8A 1TNHA 1GCDA 1LPKB 4ISLA 3UR9A 4CH8B 3PM3A 2A7CA 4THNH 4DGJA 1NPMA 3E3TA 1HJAC 1BITA 1V2PT 1FXYA 2W3KA 3N7EA 2AH4X 1QJ7B 2SNWA 1TA2A 2ZFFH 2VIDA 4CRFA 1EAXA 3PRDA 3KNXA 3AK5A 1A46H 3W1EA 1TBZH 3EA7A 2ZIQH 2BQ7B 3NZIA 3SU0A 1WSSH 3MH4A 1GJ9B 1MQ5A 1C5YB 1NFYA 1ZOMA 2PV9B 3M5NA 1MAYA 1AZ8A 4INLA 6CHAC 3D49H 3GYMA 2AMQA 2J94A 3A7XA 3KF2A 1DVAH 1Y8TA 2GDDA 2BB4A 3SV7A 3BIVH 1NFXA 1C4Y2 1KXDA 1FY8E 5JBAS 3SORA 1HAIH 1LKBA 2PW8H 5G4BA 5DP3A 4MPXA 5ESTE 1ETSH 1O2RA 1LDTT 4UFGH 1YP9A 1SGEE 1FAXA 1LVOA 3A88A 2R9PA 1QB1A 3LT3A 3GY6A 1FPHH 2ODQA 1P03A 1GJ4H 3S7KB 1UK3A 1SGCA 2AGGX 2BLOA 4JZ1A 2EI8A 4MG3A 1OKXA 2GCTB 3PWBA 1HBTH 1NM6A 1ZHRA 5H4IB 1F0UA 1ORFA 1E1QD 5JPMH 4CRGA 2A7JA 3EDXB 4Q63A 1S5SA 1VITG 4ABFA 4KTUA 1OPHB 3BG8A 8GCHF 1UMAH 4FU9A 2Y7ZA 3GCHB 4NCYA 1O3AA 3SJ9A 1GWAA 1O3MA 2BDBA 2KX4A 4BAMB 3K6YA 1HIAB 2ILNA 3SJKA 3MYWA 1OWEA 3WW7A 2F3CE 1CA0B 2W3IA 3GY3A 3STJA 3LH3A 2PSYA 2SGFE 1QJ6B 2ZGJA 4AGJA 2AHME 1JIMA 1QGFA 4WMDA 2H9EH 1DOJA 1SQAA 2CHAC 3LONA 4I32A 1V2NT 1HGTH 2P3FH 4NZLA 3DSGA 3ZVAA 2SGQE 4I33A 2OBQA 3RXVA 2ZFSA 3BEFB 3ZZAA 1Y5UT 2FOHA 1FIWA 1FI8A 2OC0A 1O2LA 3EA8A 3MTYA 2VVCA 2XC0A 3H09A 4Y71A 4X2WA 5JBCS 4RT1A 2ANKH 1CA8B 2J4IA 2P94A 2UUJB 4B2CA 1GJCB 1IOEA 2BY7X 1TPSA 1SGQE 1EP5A 2JJ2D 2QCYA 1QA0A 1QFKH 4U32A 2CGAA 2FZZA 5DP7A 5JDUB 5KEDA 4ASUD 4XFQA 2ZFQH 1V2OT 1N8OB 1THSH 3WY8A 3P6ZB 2RCEA 3MU5A 1P06A 1CT0E 2Y81A 3HKJB 1AZZA 5LPRA 1EZSC 1IQIA 1H8ED 1IQJA 3MO6A 1BOQA 2J98A 3LGVA 4GCHF 1C1MA 4ABIA 4MNYA 4DG4A 1GJ7B 1DUEA 3KN2A 3PO1B 1GI8B 4YLQH 4O3TA 2UWLA 1W7XH 5DN6D 2FLRH 1NBME 2F9OA 3KQDA 1EB2A 3QTOH 1L1NA 3UIRA 3KEEA 4DT4A 1FZZA 1NESE 1QBOA 2GJGA 4VGCC 2IJOB 1FNIA 3SNDA 1GMHG 1WQSA 2VWNA 4NA7A 5T6GA 2YMSD 3ATKA 5F8ZA 4LZ4B 1O2UA 2OBOA 1Z1JA 1N1LA 1SGDE 3TJVA 2RA3A 2KR7A 2H1UA 1DANH 2GV7A 1TYNA 3QLPH 2WPHS 3ZZBA 1K0HA 2EI7A 4RKJB 3P70B 1C1QA 3A85A 1DX5M 2F9PA 3QGNB 3MU1A 2BD9A 1NFUA 4X8VH 1AMHA 4O9VA 3UQOA 1T8NA 3BF6H 4ZKRU 1O2YA 1EZUC 3WWBA 1C1UH 3TITA 1ELGA 1AE5A 1P2MA 1NU7B 2FMJA 3FO8D 1F5LA 4MLFB 3U28C 1DLKB 2SGPE 3UOUA 2H6MA 1SLUB 4TT3D 1VGCB 3MH6A 3PMAB 2ZGCA 1TNLA 1WU1A 1ZPCA 2DUCA 2CK3D 1RJXB 2ZFRH 3M3SA 2FX4A 1IQMA 3VG8A 1D3TB 2Q6FA 2BDIA 3SNBA 4OGXA 4JYVH 1B0FA 1KDQB 3M36A 1ANEA 1O5AB 1GBLA 1E35B 4JZIA 5I46H 2BOHB 4AX9H 3FP6E 1O3PB 1ZJDA 2HNTE 2STAE 3FANA 4GHTA 1K9OE 2FESH 1YLNA 3MU8A 5DJ7A 4A1VA 1ACBE 4FUDA 1C5XB 3RXJA 3ZVFA 4AZ2B 1DXPA 2XC4A 3ATMA 2OK5A 4I8HA 4BANB 3TIUA 2R0LA 2GT8A 5HM9A 4GVUA 1BTYA 1P02A 2A2XH 1CVWH 2G51A 1A0JA 1TOCB 1WV7H 1BMNH 1BMFD 3GCNA 4IBLH 2NU3E 1HV7A 3A8DA 1ELAA 3QGJA 4LOYH 3RC6A 2K1QA 1C5PA 1DDJA 4DT7B 4LK4A 1S81A 5C5NA 1GPZA 2ZCHP 2BDAA 5EPNA 3IITA 1GGDC 2QXJA 1YF4A 1P2NA 1MH0A 1HRTH 1MU6B 4B6EA 2FS8A 1SC8U 1OWKA 1L0ZA 2QC2A 3M3TA 5A8XA 3IWMA 3PMJA 1QY6A 1BIOA 1H9IE 2ZDLA 3B8JA 4Q80A 2BOKA 1XMNB 4X1QU 2V7QD 1TGBA 2G81E 1GHAG 5GWZA 1SLVB 2P95A 1NROH 3SHAH 3KL6A 1TALA 2BZ6H 2Y5GA 3TK9A 1GMCG 1QL8A 3ZZCA 4INHA 2CJIA 4ISHH 1GI9B 5FBIA 5TJXA 1PPFE 5FCKA 3RXSA 2VWMA 2ZU3A 4NA8A 2PKSB 1OP8A 2BD5A 1X7AC 1WUNH 1NO9H 3BG4C 3LGIA 4X2XA 3UOPA 1SGFG 3ZZ9A 4KTSA 4JZDH 5B6LA 3OY6U 1D6RA 3BTDE 3QZQA 1CHOF 1E36B 1O2OA 3RXDA 4NGAH 2ZGXH 2JDID 1TMBH 2FPZA 5CHAB 1AY6H 3A80A 3TNTA 1RD3B 2O8LA 1OWHA 2IPQX 4XBBA 5EIYA 2KCOA 1ELTA 2M2AA 3D62A 1DT2A 3UREA 1IQLA 2ALVA 2WZQA 2Z9KA 2Y6TA 1YM0A 1CT4E 1TABE 1AB9B 1V2LT 2JETC 1GDNA 1RXPA 2HLCA 3B23B 1T8OA 2WSSD 1NRQH 4FVBA 4D7GA 1LHCH 4MNVA 4ZKNU 1GCTB 2XYAA 3BIUH 4XDEA 1EZQA 4TWYA 1P11E 1QL9A 3L33A 3BTQE 5F53A 1GMDG 1Z71A 1HXFH 2ZTXA 3KQ5A 2EA3A 3RXMA 4YOJA 2BHGA 3V3MA 1VZQH 3F1SB 1TFXA 1WAYB 1G36A 1V2TT 5EU8A 5J4SA 2BM2A 4Q2KA 1SGTA 1QB6A 1LKAA 1HAOH 1BRBE 2Y80A 1D9IA 2BXTH 2Z94A 4NSYA 3E0NB 3GY2A 1KTTB 2JKHA 1C1RA 2BYAX 1QA7A 1UTNA 4Z1MD 1KTSB 2WYGA 2FI5E 2TGTA 2BMGB 2G00A 2F91A 5GXPA 1W0JD 1TGTA 1YC0A 1SFIA 2FOAA 4CRAA 3BN9A 3PMBB 3DT0H 3GY8A 1G3DA 2VIVA 1MCVA 3F6UH 2ZHEH 2GKVE 2QXGA 1J15A 1TGNA 1Z7KA 3A7YA 2PHBA 4E06H 1WTHD 2TGAA 2WPMS 1RTKA 5DSFA 1P12E 2CV3A 3MHWU 1PJPA 1C5SA 3F2GA 1IQEA 1ESBA 1VR1H 3A7ZA 4B2AA 1Y5BT 3LH1A 4O03A 3A8CA 3OX7U 1CSOE 3L3TA 1DITH 3Q3XA 1QTFA 1C1SA 2XBXA 3LC5A 2FTLE 3SJOA 2BLQA 1YLDA 1C2EA 2YNAA 2YOLA 4WY3A 2H9HA 4NG9H 1H1BA 1J14A 1O2GH 1U6QA 4FUHA 3DCLA 3R3GB 1NT1A 4RSPA 1UVOA 3V13A 3F0PA 1TX6A 2JH0D 1E79D 3BTFE 3QWCH 4KTCA 3NXPA 1COWD 1DY9A 4A7IB 1V2VT 2OTVA 4DOQA 1H4WA 1QRZA 2QV1A 3MO9A 1HIAA 1BRAA 1O31A 1C5ZB 4X1PU 2AERH 1V2JT 4Q7YA 4FVDA 1HAVB 1ZRBA 2B9LA 7GCHF 1JOUB 3A83A 4ZH8A 5CE1A 2W6ID 1W7GH 3PTNA 1FY4A 3ZVEA 1DSTA 1DXWA 3KQCA 3ELAH 1TAWA 4WMEA 2PFEA 4BTUB 2A4QA 4ZHMU 2GTBA 1TX8A 5GCHG 1GBEA 5GJ4B 3SV2H 5HM2A 4BTIB 1ABJH 2XCNA 3RXQA 2BDGA 1C2MA 2ZZUH 1SR5C 4AOQA 4DY7B 1SLXB 2FLBH 3QK1A 2HRVA 4U30A 5AFYH 3PB1E 4Q7ZA 1O36A 1FONA 2FYRA 3NK8A 1BRUP 3ZZ6A 2OLGA 1BMAA 2SGEE 3LJJA 3RLYH 1O5GH 3V0XA 8KME2 3K2UA 3OEED 3ZIAD 3UTUH 2BY8X 1BQYA 3RXHA 1YCPH 1BRCE 1W11U 5IDKA 1MZAA 2OC1A 1TGCA 3P8GA 2Z9GA 1XM1A 1PQ7A 4Y8XA 5FPYA 1PQAA 1UTQA 5F8TA 2SFAA 1UVTH 5C67A 3LGTA 3W94A 1M9UA 1SBWA 3BTME 1Z6JH 2QF3A 1K22H 1RIWB 3TPIZ 2ODYB
chains in the Genus database with same CATH topology
4X1NU 3OY5U 2B0FA 1ZMNA 1C1NA 2Z7FE 2FOMB 1XKAC 1DE7H 2STBE 3KQEA 4GCHG 1GBCA 2VNTA 2A2QH 3T29A 6LPRA 5K7RA 3TGJE 5A0BA 4ESTE 1SHYA 1QHRB 1T8LA 2VVUA 2W7SA 1TNJA 2R3YA 2HPPH 3RMMH 1GVKB 2BXUH 1O37A 1G3CA 3RC4A 4A5TS 3FAOA 1O5CB 1GI2A 1AFQB 4ABAA 1GHZA 3GISB 4DCDA 5SGAE 2CXVA 1LVYA 1RGQA 1KIGH 1YCPM 4M7GA 4X6MA 2XWBI 1F0TA 1ZSKA 4CBOA 3KQBA 3GDVA 3I29A 4YT7H 3ESTA 5L6NH 4UFFH 1XXDA 1BTHH 3AVZA 1BHXF 5F6MA 4K1EA 3TLOA 3SU5A 1O3EA 3PWCA 1EKBB 3RU4D 2AEIH 1UTJA 3SHCH 2PGBB 2ANYA 3SV9A 3UFAA 1YPJH 1KDQA 4D76A 1MU8B 3JZ2B 2NU4E 1UTPA 3VFEA 2C93B 1ELBA 3VXEH 2BLVA 3Q3KA 3RXTA 2TGDA 5FX5A 3TH4H 3A7VA 2F9BH 3FP7E 3LOXA 4WH8A 1KLIH 2GCTC 1PPZA 5C1XA 1OX1A 5AFZH 3SV6A 2W5EA 2BQWB 3I78A 4GLYA 3BV9B 5CMXH 5A8YA 1FUJA 2ZI2H 8LPRA 1AGJA 1O3HA 1C5WB 1C1PA 5ABWA 4BNRA 2FDAA 3D23A 2ZTZA 4WH6A 5TCCA 3V7TA 4J2YB 1UTLM 1MKWK 1AKSB 1LO6A 1O3GA 3SUFA 5DP6A 1CA0C 5F03A 6CHAB 1V2ST 2BD8A 1O3FA 1SG8B 4F4OC 4JK6A 2ZPQA 2ZU2A 1MAXA 1GI0A 3VGCB 1JBUH 3GY4A 3M7UA 4CH2B 3LGWA 1K1NA 5DGJA 2NWNA 5E0HA 1B7XB 3TVJB 1THRH 3RXCA 1V6DA 1NC6A 1PPGE 2ZEBA 1W10U 3RXAA 1EPTA 8ESTE 1OXGA 1S0RA 1EAUA 3SJIA 3LGYA 3P95A 4H6SB 4X8TH 2I6SA 5EXNA 1O2QA 1YGCH 2F9VA 4CR9A 1PPBH 3LKWA 1YPGH 2FO9A 1C5TA 1W3CA 4GHQA 2GCHG 1WQVH 2B5TB 2AMPA 2P16A 4IC6A 1O2ZA 3M5LA 3SW2B 3M7QA 2A45B 1LQEA 1ARBA 3SNAA 3T62A 2PUQH 3EQ0H 1H8DH 4MTBA 4X8SH 2Z3CA 1SMFE 1BTWA 1NRSH 1C2KA 1TGSZ 1EJAA 1C4V2 3R0FA 1KLJH 1O3JA 2BVRH 5A2MH 5J4QA 3S0NA 2C8ZB 1F92A 3QTVH 1GJ5H 3PO1C 2ALPA 2VIQA 1CHOG 4NSVA 3S9CA 1C5RA 1UK4A 2CHAB 3K6ZA 5BRRE 3O8RA 1IQFA 1A4WH 1JMOH 4JYUH 1FY3A 2HPQH 1TPAE 5GPIB 3ODFA 2A7HA 2Z9JA 1D4PB 1LHGH 1MCTA 1SGRE 1QBNA 2NU0E 3NUMA 2ODPA 1NZQH 1LHEH 1NRRH 1SOTA 2Y5FA 1G9IE 1Y3YA 3CS0A 4Y6DA 4WVPE 1Z8RA 3A89A 3H7TA 2ZU5A 5L30H 2D8WA 3NCLA 3P17H 4TPIZ 2ZA5A 4Y0YE 2EEKA 2GT7A 1TPPA 4ZKOU 1Z8JB 2GMTB 2FP7B 1HDTH 1HCGA 4K8BA 3OTJE 2GP9B 1EAIA 1FQ3A 1GBHA 3URCA 1ZTKA 1ZPBA 1C1TA 1NRNH 1VGCC 2DE9A 1OS8A 2VGCC 4IN1A 4J1YA 2BQ6B 4B1TA 1O3NA 4H4FA 1L1JA 3A86A 3HATH 3KGPA 4RN6A 4Y10E 1LHDH 1O3CA 5JYIA 2Y7XA 3DFLA 1J8AA 4FUBA 1NU9A 1ZPZA 5JBBS 3RXPA 3MNCA 1KYNA 1SSXA 4FU7A 3MH7A 1O5DH 1AVWA 5FCRA 2P93A 2C8XB 4VGCB 4H6TA 1EASA 3S7HB 1BUIA 4IC5A 4K2YA 4AN7A 3URDA 2XTTB 1G30B 4OGYA 3VB4A 1S0QA 3QDZB 1GI1A 2H2ZA 1AU8A 1PPCE 5FAHA 2ZU1A 2O9QA 4IS5A 3ZZDA 1TQ0B 1TWXB 4CRDA 2GDEH 1BTXA 1N6XA 4ABJA 1YCPK 3RXLA 3HPTB 3SN8A 1F2SE 2UUKB 1BTPA 1HJ9A 1LPZB 1P2KA 1P3CA 3GY5A 2GGVB 4BAKB 1HAZB 1FIZA 1RTFB 5C2ZA 5C5OA 3V12A 5PTPA 1QRXA 3TU7H 2IN2A 3RC5A 3O8CA 2CF8H 4BTTB 1ZSJA 4CHAC 3BTEE 3EYDA 1HAVA 1HNEE 1T8MA 3A7TA 2FEQH 1BHXB 1IHSH 4ABGA 1GVLA 2O8TA 4IMQA 1J16A 1JWTA 5C1UA 3Q77A 1AWHB 2PTNA 1XUKA 1EPTC 4Y0ZE 5DK1A 1NS3A 1A3EH 4IN2A 1G3EA 2IPHA 1OYTH 4ZXXH 2ZQ1A 3T5FH 1BDAA 1QBVH 1QRWA 2G55A 4BXSA 3ATIA 1BBRE 5T6FA 1UTOA 6ESTA 1C2FA 3CENA 3P92A 1D3QB 3A8BA 2PKAA 2PKSC 1TBQH 1ANDA 3UR6A 4YOIA 1L2EA 1DWEH 3H5CB 4UFDH 1BJUA 4GPGA 2VJ1A 3ZVGA 1PPHE 1YPLH 1LPGB 3NPSA 4U01A 3GDSA 2ZCLP 2D26C 1HFDA 4FUFA 5HGGA 1O5BB 5FPTA 3JZ1B 4WJG2 1DPOA 1LMWB 4IGDA 1SLWB 5DP9A 2V35A 1VITH 1OWIA 4K5ZA 2SGDE 1GGDB 3MOCA 2H5CA 1O35A 1TB6H 2ZDAH 3K9XB 2P8OB 5C20A 5FBEA 4ASHA 3E0PB 4KP0A 3BTHE 2WUBA 4DVAU 4YESB 1MKWH 3E6PH 4U2WA 3ZVBA 1TPOA 3SGAE 3AW1A 3BEUA 4O97A 4X8UH 4QT8C 3MU0A 3UQVA 1UO6A 1O2MA 1QNJA 1O33A 4O3UA 1DLEA 1HYLA 7ESTE 1ABIH 3QZRA 1CBWB 3ZZ5A 1ZMLA 1GCTC 3Q3YA 1SFQB 2GVFA 1BA8B 5GIBA 1MMJN 4YLUA 1IQNA 3I77A 1O2NA 1ZSLA 1GJAB 1FN6A 1GHBF 2UWOA 1G3BA 3C27B 4KELA 3UUZA 1MBQA 3LGUA 3CS7A 1AD8H 1S6FA 1GBFA 1C9TA 1HPGA 1VJ9U 5E2PA 1C2JA 1JIRA 1TA6A 1C2DA 2VIPA 3SJ8A 2H9TH 2FODA 2XBWA 2DE8A 2Z3DA 1LVMA 3F9GA 6GCHF 4DJZB 4OS5A 1P04A 2ZC9H 1ESAA 3QN7A 1EOLA 1IHTH 2ESTE 3DHKH 4NWKA 4AB8A 1T4VH 3SQHE 4X2YA 4AFUA 5EW2H 2Z9IA 3MI4A 4F49A 5C3NA 3SGBE 3Q76A 5EQQA 4XE4A 1GG6C 1FY5A 2G5VA 2ASUB 5T6DA 4FUCA 1O2VA 3U8OH 2G4TA 1DSUA 1QURH 2B7DH 1D6WA 2G4UA 3E1XB 2A5IA 4YOGA 1L4ZA 4X6OA 3DA9B 3RXFA 3SZNA 3ZZ7A 1TRYA 3HK3B 1BB0B 1BTUA 1ZMJA 2WUCA 5F8XA 1O32A 3BTWE 1BMLA 2I6QA 1RTLA 2BDHA 3GOVB 4YTAA 2VU8E 2J38A 1UVUH 4ZHAA 4D8NA 3QUMP 2LNCA 1K1PA 2J9NA 2TPIZ 1FY1A 2OXSA 4HFPB 1C9PA 2WPLS 4WWYA 3VPKA 3VB7A 2FS9A 2THFB 1O39A 2ZPRA 1AKSA 1KY9A 1Z8GA 2AGEX 2B8OH 4WXVA 1KXEA 1W13U 5DP4A 4IMZA 4XBCA 3KIDU 1XVMA 1GJBB 1ZYOA 1TNGA 3RMLH 1GBDA 4R0IA 4TY6A 1TE0A 1FV9A 1BBRH 1EQ9A 1P9SA 1MTNC 4H42U 1GJDB 8GCHG 1O30A 1E38B 1EX3A 1DFPA 1O5EH 1A5HA 1GBIA 2ZDNA 1BCUH 3GDUA 1O2IA 3SGQE 1ZLRA 5E8EH 3QO6A 3RXIA 3TGIE 5GDSH 5EG4A 2G52A 2YNBA 3E8LA 5LGOA 2CN0H 1O38A 2ZDKA 3MO3A 3RMNH 2WV5A 1B5GH 2UWPA 1VCWA 3LIWA 5EPYA 4BXWA 1HB0B 1HXEH 1AE8H 2ZFPH 2ZNKH 1C5OH 2WINI 1S83A 2J34A 2ZTYA 2ZU4A 1O0DH 1P2OA 4I31A 2WV4A 2FX6A 3UPEA 1THPB 4K1SA 1UHBB 2LPRA 4LXBH 5FX6A 2BY5X 1HAPH 2TIOA 1QCPA 1GDQA 1P2IA 2VIWA 3U8TH 3VB3A 1GMCF 1VJAU 4X6PA 5DP5A 1F7ZA 1C2IA 1H8IH 1OYQA 2CMYA 1GL0E 1V2QT 1G2MA 2HOBA 3NWUA 4ISOA 2GZ7A 1F5KU 3FP8E 3TGKE 1C5MD 4KGAA 4R8TB 1A61H 2BD2A 1ZGIA 1ELVA 3AW0A 1CGIE 1W12U 3VXFH 1Z1IA 2VH0A 3VB6A 2Z3EA 1DWBH 1AFEH 4X0WU 2ZHFH 2ANWA 4B75A 3SU6A 4XOJA 1C5LH 2BD4A 1AHTH 2ZPSA 1TIOA 2Q6DA 4ISIH 4I8KA 3B9FH 2ZDVH 1SGFA 4X1SU 1QJ1B 3SBKA 1GHWH 1F5RA 1GDUA 2FOBA 5LH8A 1E34B 1QR3E 1EUFA 1L4DA 1J17T 4DIIH 4E7NA 2AFQB 2ZP0H 4DIHH 1MD8A 3W95A 1O2PA 2C8WB 3SV8A 3ZZ8A 4AFQA 5JBTA 1HLTH 3F9EA 3S9BA 1DICA 1PYTC 2ZGHA 3SO3A 1SQTA 1OOKB 2Q6GA 1ELCA 3LDXH 3VEQB 4K60A 2HNTC 1V2WT 1A0LA 1GJ8B 1DY8A 1ELEE 3SQEE 3OSYA 1OSSA 2V3OH 4WXIA 1GBKA 1A1RA 4B73A 1JRTA 1S84A 3AAUA 4SGAE 3FZDA 3RMOH 4CR5A 3ZVDA 1YPMH 2Z9LA 3F68H 2QIQA 3MFJA 2ZQ2A 1YPKH 2FIRH 2JH5D 2PSXA 1HJAB 2FWWA 4GUXA 1MTWA 2W26A 4KKDA 3UNQA 1S82A 1Z6EA 1OP0A 2ZHDA 3TJNA 3M3VA 1SHHB 2C8YB 4GAWA 1GHVH 2RA0A 2C90B 1GI3A 3VGCC 3GCHC 1RS0A 2FXRA 4JYTA 2QYIA 3RLWH 1NFWA 4UFEH 2XRCA 5HMAA 1TNKA 4X1RU 3BTKE 2ULLA 4A1TA 4B76A 3GCTF 1T31A 1GBJA 1OWJA 2FOGA 1P57B 1H9LB 1TRMA 4MPUA 1INCA 1UK2A 2D1JA 2FI3E 3LC3A 2HVXA 4PROA 1VCQA 1BZXE 1AIXH 1C1WH 1ANBA 1V2MT 2A4OA 2XBVA 3SNCA 2P59A 2BX3A 1XUJA 1Y3WA 1T7CA 5EQRA 4XBDA 3KHVA 5C1YA 1IAUA 1O34A 1CGHA 1F0SA 1DWCH 1T4UH 2ZKSA 1KXFA 2ZWLH 4X6NA 1Q2WA 1DUAA 1JXPA 1EOJA 4FUGA 4HZHA 2R0KA 3VB5A 3SUGA 1O5FH 1TQ7B 1SQOA 1C4U2 4D9RA 4E7RG 1O2WA 1V2RT 1Z8IB 1SGIB 3ZYEA 1AI8H 2QA9E 4D7FA 4DURA 1GHXH 4Y79A 5EOKA 3SU1A 3M5OA 4ABEA 4UD9H 1S6HA 1K2I1 3MMGA 1QL7A 5JB8S 4ZMAH 1ZTLA 4WF8A 1NRPH 3QX5H 3RDZA 3GICB 3SI4H 4B2BA 1CT2E 5GCHF 1TRNA 3PLKA 1H9HE 2KAIB 1P3EA 4FUEA 4JK5A 4NIWA 3A82A 1N8OC 4Y7BA 1IQGA 2A0QB 4BAQB 2QAAA 1G37A 4JMYA 1P09A 1V3XA 2C3SA 4NFEA 3RP2A 1DS2E 1CHGA 1GVZA 1SL3A 1P05A 2BDYA 2V3HH 1MTVA 1O3DA 1C2LA 1O2SA 2JH6D 4NWLA 2W7UA 2D2DA 3TH3H 1NTPA 3F9FA 5DG6A 1AVXA 4A92A 2SGAA 3TK5A 2XW9A 2VH6A 4JZEH 1ESTA 1A5GH 1FAKH 2BVSH 3N7OA 4A1XA 1KXCA 2AGIX 2ZHWH 1T32A 1YPEH 2ZO3H 1WCZA 5DP8A 3GCOA 4TWWA 1HAXB 1MD7A 4B74A 1ZZZA 1MZDA 1TNIA 4YO9A 4MPWA 2VINA 2GMTC 4AYVB 4BOHA 5HYOA 5FXLA 2AMDA 1A7SA 5JB9S 2QN5T 1W0ZU 1G32B 1GHBG 1Y5AT 2OD3B 1C1VH 2QY0B 2QF0A 3M5MA 1V2KT 1XUHA 3SU3A 1F0RA 3EE0B 1MKXK 2A1DB 5EXLA 1AVGH 1HAGE 3EAJA 5DPAA 4NIVA 2P3UB 1K28D 1IQKA 3ENSB 4NFFA 1O2JA 3NKKA 4TPYA 5ETXA 2ZDMA 4FU8A 4UONA 4K3JA 6GCHG 1BBRK 1OP2A 1IQHA 2ZHQH 3G01A 3U69H 1Y3UA 5L2YH 1K1OA 1ZR0A 1AO5A 3RXGA 1TONA 1N6YA 1UCYK 2HALA 3E91A 5BPEA 3FVFB 1G2LA 1P01A 1KSNA 2ZFTA 2QXHA 3S69A 4FUIA 4AB9A 3IG6B 1C5VA 2TBSA 3K65B 2H5DA 2NU2E 5K0HA 1YPHE 4OS6A 5TCAA 1GBAA 3MNSA 1ZHPA 1C2GA 4OS1A 1LCYA 4ISNA 4HGCA 1NN6A 5E2OA 2PGQB 4SGBE 1NY22 4NZQA 1O2XA 1YYY1 2C4FH 2G8TA 2GV6A 1KXBA 4MQAA 3T26A 2RG3A 2VVVA 5LPEA 3S9AA 1Y3VA 3UNSA 4BAHB 1GBBA 1P8VC 3BSQA 2ZGBH 2XBYA 2VGCB 3D65E 4I8LA 4IW4E 1HAHH 4A6LA 1O3BA 2Z6BD 1BT7A 4D9QA 3EA9A 2F9NA 2O8WA 1W2KH 3AAVA 1A3BH 5T3HA 2WPKS 1BJVA 4I8JA 4AORA 3OU0A 5AF9H 2V6NA 1PQ8A 2CF9H 2HWLB 4X2VA 3STIA 2FOFA 3A87A 2GX4A 2BVXH 4RKOB 5AVDA 2R2MB 1D3PB 1J9CH 1EJMA 1AUTC 1RRKA 3DFJA 4AYYB 3GYLB 4WMFA 2AIPA 1FN8A 3HK6B 4JZFH