2FTMA

Crystal structure of trypsin complexed with the bpti variant (tyr35->gly)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Rigidification of a Flexible Protease Inhibitor Variant upon Binding to Trypsin.
pubmed doi rcsb
source organism Bos taurus
total genus 56
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ftmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ftmA02
1ZMNA 2BD5A 1WUNH 2PW8H 2O8MA 1TOMH 3SQHE 2CXVA 4AOQA 3EQ0H 4FXGH 3D65E 3RXRA 2WPLS 4AORA 1GI3A 2AMDA 1ZRKA 4O03A 3OY5U 3UOPA 1HJ9A 1C5RA 2ZEBA 1GI4A 2PV9B 1TFXA 1GBIA 3TH3H 5LPFA 1O34A 1A1RA 4NA9H 3TGIE 4OS4A 1L1NA 1H4WA 1GI6A 1CBWC 1CQQA 2GV7A 1MQ6A 1C5VA 1QL8A 3OY6U 3U8TH 1LMWB 2OBOA 1C9PA 1P3EA 2PGQB 3AAVA 4ZMAH 3RXLA 1C5MD 4YM9A 3UY9A 1XUHA 4M7GA 3TPIZ 1NFXA 3GY7A 4FUFA 2H1UA 2H5CA 5F03A 2ANMH 1KIGH 1A61H 5F8TA 1O5FH 3NUMA 4X6MA 1O3FA 1E34B 4UEHH 1JBUH 1EZUC 3BIUH 1A5GH 3GY8A 1TQ0B 3RXGA 2P16A 4BTUB 2H9EH 1F0RA 4ABGA 1Q31A 3F9EA 1P01A 1TBQH 3UPEA 1IQHA 1O3PB 2XC0A 3L3TA 2ODQA 1E37B 1FNIA 4O9VA 3SU1A 1FXYA 1BMAA 1O33A 1GJBB 2SGEE 2TGAA 4K8BA 2XCNA 1Y3WA 3GCNA 4KELA 4NIYA 3H7OA 4GPGA 2C4FH 3GOVB 1AVWA 2XRCA 4AB9A 4Y71A 3GDSA 2A7JA 1SL3A 2FM2A 1V3XA 2UWOA 2A7HA 2OCVB 1DOJA 2W7UA 1MTVA 4JYTA 4RN6A 1A2CH 2GP9B 1P2NA 1GMHF 1AQ7A 4WY3A 2BDCA 1HAOH 2ALPA 1L1GA 1ZGVA 1AMHA 2Q1JA 5ESTE 4XBCA 3V0XA 4GCHG 1IHSH 5DP3A 1EASA 2G4TA 1KSNA 1KY9A 5FPTA 1MU8B 2GCTB 4NIVA 5GXPA 3SHCH 2QYIA 1P12E 2FPZA 4BTIB 3E90B 2R3UA 5ETXA 1SG8B 4GLYA 1ARBA 2TPIZ 1ANEA 1W11U 1UCYH 2P3TB 1UO6A 2A1DB 5TCCA 1K1PA 8KME2 3S0NA 1XUJA 3EA8A 5C67A 1QRXA 1AUJA 1ELAA 4O97A 2ZWLH 4JZEH 1J14A 1C5UA 5FX5A 2TGTA 1SGCA 2XWBI 1MTNB 1AI8H 2Y81A 1L4ZA 2VB0A 1WBGB 2OC1A 3A81A 1O37A 1AD8H 4IN2A 2ZTZA 1PYTD 1FIWA 2VIVA 1HAPH 4KTUA 2Y6TA 5FXLA 1C5WB 5A8ZA 1INCA 1RTLA 1AU8A 1C4U2 4DY7B 1A0HB 1BZXE 1SQTA 2HWLB 1DM4B 1MKWH 2VH6A 1NC6A 1YC0A 4X2WA 4AB8A 1AZZA 2D8WA 2FESH 4X1SU 3LDXH 1NU9A 2J4IA 1W12U 1ZHMA 4TWWA 1FONA 2AGIX 4MDSA 1J17T 4ZHMU 3LH1A 1O32A 1QHRB 4XDEA 1LTOA 1CA8B 3SUGA 3GY5A 2LPRA 2D26C 1SOTA 3LGTA 3NZIA 1O5DH 2V6NA 1BTHH 1ACBE 3BG4C 2D2DA 4Q7YA 1EQ9A 3RLYH 1SHHB 2XW9A 1YF4A 1ZZZA 3TIUA 3FANA 1GCTB 2I6SA 3O8RA 1HBTH 1FY5A 3PO1B 4ABHA 3P95A 3RXKA 2YOLA 4B2BA 3RXIA 2DE9A 5DKMA 1ZSKA 5HXFA 3RXPA 2H5DA 1KLIH 1K28D 1NZQH 2FOAA 2GCHF 3LC3A 1GI7B 3VGCB 1QIXB 3QTVH 5DPAA 3H5CB 1TX7A 3KL6A 5GDSH 3AASA 3DUXH 4B2CA 2VWNA 2ZHEH 4GAWA 1C5NH 4WH8A 1MD8A 2BZ6H 4E05H 4CRBA 2TGPZ 1ZPBA 1H8IH 3LJJA 2IJOB 4HGCA 1QR3E 3RM0H 3RM2H 5EOKA 2M5TA 1ETRH 1W13U 3MFJA 1QBOA 1EJNA 3E1XB 2NU2E 1QB6A 2ALVA 5FX6A 1G30B 2OTVA 3I29A 1KXFA 2A2QH 3CS7A 3ZV9A 3A85A 5IYTA 1GMDF 5JBCS 5JB9S 2WINI 1Y59T 1Y3YA 1THPB 1AO5A 1GDQA 3A89A 4B1TA 1VGCC 3MMGA 4MG3A 3RMMH 1KXBA 3IITA 1O2PA 1F2SE 4MPWA 2F9NA 2W7SA 1O2GH 1YLCA 4E7RG 4VGCC 3BEIB 5FCRA 2PLXA 1O3MA 3L33A 1ZOMA 5C5OA 3VB6A 1SQOA 2ZHWH 1C5XB 1WCZA 1C5PA 2V3HH 3U9AH 2Y5FA 5H4IB 3V7TA 1O3HA 3SU5A 1O31A 2ZHFH 2ZU1A 1O2LA 1C2FA 3E3TA 9LPRA 2FI4E 2GMTC 2BXUH 1AB9B 1O2RA 1MKXK 2OC7A 5E8EH 1QCPA 1TAWA 1THSH 2WPHS 3ITIA 1ZGIA 1GHZA 1YPKH 3NKKA 1C5LH 1S5SA 3BTEE 3T2NA 5JBAS 3MNBA 3ZZ3A 1O2ZA 3SGAE 4H4FA 1Z71A 1UTMA 1YYY1 5E2PA 2GGVB 2VWMA 3SORA 4X8UH 2QY0B 4GVUA 1W7GH 3NPSA 4HFPB 4U01A 2BM2A 2CHAC 4I8GA 1OYTH 4UFGH 2ZPRA 1KTTB 2BHGA 1XVOA 4U32A 5DGJA 1MTUA 1AN1E 1HV7A 4UFFH 2GKVE 4A1XA 1NS3A 1HXFH 2WPKS 4UDWH 1P9UA 1W7XH 5JBTA 3Q3XA 5FAHA 1OWJA 2F3CE 2BOKA 4NZQA 1V2QT 4B73A 1AKSB 1VCQA 2SGAA 3V3MA 1BTZA 1ORFA 3LOXA 3URDA 2JETC 3BEFB 2VINA 1O2NA 4YLQH 4CRGA 1HJ8A 3UTUH 1V2OT 5FCKA 1GGDC 1DXPA 1CA0B 1LVYA 1AFQC 3BIVH 1V2ST 1GJ5H 2GZ9A 3PMAB 1BJVA 1NN6A 1HRTH 2ILNA 5DG6A 1CHGA 1SGQE 4WWYA 1XXFA 1G37A 4ABIA 3RU4D 4D9RA 1GVKB 5EXMA 3KN2A 2VIOA 1BBRH 2EA3A 1OSSA 5FBEA 3E0PB 1DANH 1EB2A 2OP9A 1T8OA 3FP6E 1O39A 2BLWA 3BV9B 3FFGA 4WMFA 1NM6A 3SI4H 5EXLA 1S83A 2BLOA 3MWIU 3SU3A 2H6MA 4BTTB 1P06A 2PSYA 3TNSA 4Y10E 1GJCB 3LGUA 1TBZH 4Y8XA 1TX6A 1GJ8B 5K7RA 2PKAB 7GCHF 3K6YA 4AG2A 3PTNA 1GCDA 1FY4A 1Y3XA 1EB1H 3ZZ5A 2SGFE 1MD7A 4MQAA 2QCYA 1OYQA 2B9LA 5CHAB 1GBTA 4BAQB 1FQ3A 3FP7E 3G01A 2UUJB 4MPVA 1GBMA 1ANDA 1AIXH 3PLKA 1GL1A 2FWWA 1BA8B 1C4Y2 1EJMA 1G32B 2UUKB 3ENSB 1AWHB 3DHKH 3S9AA 3SU2A 2BQWB 3TH4H 1O2HA 1L2EA 4X8TH 3A7ZA 1HFDA 4X0WU 4BOHA 1QJ7B 5C1XA 1GBKA 1GBLA 4U2WA 1GL0E 2BB4A 1QBNA 1DVAH 2ZFQH 4HTCH 1DLKB 1IAUA 2QXJA 3MU5A 1UTKA 1PPZA 2XWAA 3MH4A 4FUGA 4UE7H 4IN1A 5CE1A 2GD4B 3VB7A 3SNDA 5AF9H 1TGCA 1GDUA 1FV9A 3DFLA 1QB9A 1D3QB 2BQ7B 1EUFA 2Z3CA 3GDUA 3DD2H 4Y7BA 4ISLA 3MOCA 1BTYA 3BTFE 2QXHA 1DY9A 2PWXA 1OS8A 1W0ZU 1ZJDA 1CHOF 1GJ7B 1LVBA 2QIQA 4RKJB 4I31A 1Y3UA 4WMDA 3KF2A 4ZXXH 4FUCA 4DGJA 5DP7A 1SGNE 1AGJA 2NU1E 4KGAA 3M5NA 4R8TB 3A83A 3UQVA 1AZ8A 3OTJE 2RA3A 1P2KA 4NZLA 1H1BA 1Z1JA 1C5TA 1K1MA 1SMFE 3TITA 1T4UH 1LVOA 3LGYA 2PSXA 1DY8A 4MPUA 2BDIA 3TK9A 4GHTA 2G4UA 1PQAA 1LCYA 5EW2H 3HKIB 1TMBH 1YCPH 2IPHA 3NCLA 1EXFA 2BDYA 1TRNA 1OP0A 5T6GA 1G3EA 4THNH 1LPZB 2V0BA 2FOFA 3T26A 2VWLA 2P95A 2FTLE 2VGCC 3P17H 2Z9GA 4UONA 3L6PA 2Z9KA 3SJKA 4TPYA 3RXMA 1KDQA 1DDJA 1O2VA 4Q2KA 4JK5A 5EXNA 2ZQ2A 2F9PA 7ESTE 3AVZA 2J34A 1ELDE 5JPMH 3QZQA 2CMYA 1HAGE 3SUEA 3BTWE 3M36A 3VPKA 2P59A 2A2XH 1O3KA 1F5LA 4UFEH 1MU6B 1BIOA 4OS6A 3TH2H 1BCUH 2FOHA 2WPJS 3OX7U 2FP7B 1EAWA 1Y3VA 3ZZ9A 1SPJA 4J2YB 3KQBA 2F9VA 4X2YA 1LPGB 1A0JA 1GBJA 2A4GA 2QF3A 4UFDH 4OGYA 3PTBA 2A5KA 3SJ9A 1HDTH 1ELVA 4FUIA 1XKAC 1DWEH 3K9XB 2PKSB 2V3OH 5L6NH 3ZZ8A 2FIRH 4DJZB 3UUZA 3RDZA 1XUKA 3P8GA 2VVCA 1RXPA 3A80A 3UOUA 4CRFA 1G3CA 1LHFH 1NY22 3T62A 1T31A 2ZDVH 1YPHC 2FI5E 2QXIA 4BANB 3W95A 4I8KA 2J2UA 2BY5X 2FTMA 3SV2H 3LPRA 3E91A 3PWCA 2GDEH 3RXAA 3MO3A 1NRPH 1C1VH 2BDGA 3BF6H 2ZG0H 1GMHG 2QV1A 2A32A 1PYTC 4MTBA 2HLCA 1LHEH 3RXFA 1EATA 3E16B 1M9UA 2O8LA 5A0CA 1O30A 1OPHB 3MH6A 1J16A 5F6MA 3LONA 4AYYB 4SGAE 1GBDA 2R0LA 2ZU5A 2XBWA 1C5YB 1CT2E 1VCWA 1DITH 3JZ2B 3M37A 1BJUA 1PPHE 1BMLA 1BTWA 5GCHF 1S6HA 1QB1A 2Z9JA 1B5GH 1KYNA 1HAYB 1HIAB 2BD4A 2ZF0H 4DIHH 4CBOA 3VFEA 3M7UA 2EEKA 1C2GA 2A7CA 2EI7A 4NWKA 5A8YA 5SGAE 3GICB 1JRTA 1FAXA 1L4DA 5HGGA 1A5IA 3S9BA 4NSVA 1GDNA 2P8OC 1ZSJA 1ZTKA 2TIOA 2AMPA 3UWJH 1FPHH 3QWCH 2WPIS 1CO7E 3F9GA 3SZNA 2W3IA 1B0EA 3R0FA 3EA9A 4IGDA 3TVJB 2UUYA 8LPRA 5FHTA 3SU4A 1SQAA 3BTKE 4BAKB 3UFAA 3A86A 1V2JT 5EODA 4F49A 3OYPA 5FPYA 4D7GA 2CF8H 2CGAA 1GJ9B 3T29A 2A45B 1A46H 3VB3A 2FOEA 2IOTA 3TJVA 5AFZH 1JXPA 2FEQH 4ABJA 1BHXB 1Z1IA 2OUAA 1SGPE 2GTBA 1MUEB 1MBMA 3GCHB 2ZU4A 1GBBA 3AW0A 1OWIA 1TX8A 3ATWA 2FMJA 2CV3A 2KAIA 2VU8E 1K1IA 1EAUA 1ELCA 1RIWC 1LKAA 1QFKH 1YBWA 2IN2A 5GPIB 1TRMA 5T3HA 1SGTA 2Z6BD 1K9OE 4BXSA 1GHBF 1RGQA 3GY2A 2R2WU 1ZSLA 3SOSA 6GCHF 3K6ZA 4OS5A 3ODFA 2P94A 1PQ7A 2JH0D 1FY8E 2J38A 1F5RA 8GCHF 3EA7A 2A31A 2A4OA 4YT7H 3T5FH 1GHXH 1O3EA 1V2PT 4NFEA 5A0AE 2W3KA 1O2OA 2GX4A 5C20A 3ATIA 1ETSH 4Y8ZA 3PMJA 1SLVB 4NA7A 2WPMS 3TGJE 4ABFA 4NA8A 5K0HA 4WXIA 1CSOE 3MI4A 1LHDH 2C8WB 1TNKA 3ZZCA 4RKOB 4ABEA 2ZU2A 2GCHG 2Y7XA 1SSXA 1D9IA 1H9LB 4ZUHA 3A7WA 1WOFA 3E8LA 1O2JA 1IQKA 1P9SA 2HRVA 3KQCA 4KP0A 2GZ8A 3ZVEA 1F0UA 1SGEE 4O3TA 2FOBA 3N7OA 3KCGH 1O3CA 1N8OC 1CGJE 1JIMA 1ID5H 1TE0A 1YCPM 1FIZA 1CU1A 6CHAB 1QJ6B 3CP7A 5JBBS 3O8DA 1LDTT 2BOHB 1NFUA 1EP6A 1HXEH 1KXDA 4H42U 1FY3A 2BVXH 2O9QA 4MNWA 3BEUA 5EQSA 1Z8RA 3ZYDA 3P92A 1UVTH 2HPQH 3EDXB 1XXDA 1ZHPA 1HCGA 3ATKA 4KKDA 1GMDG 4K8YA 1D6WA 2ZP0H 2XBVA 2SGQE 1ZLRA 1OOKB 3A8AA 1VITF 4GHQA 5PTPA 3SNEA 5L2ZH 4ABBA 1HJAB 1UVOA 4J1YA 3BTGE 5EQRA 5BPEA 3ZYEA 4TY6A 1VZQH 4B76A 4DIIH 4FUBA 1CGHA 5DJ7A 4AFZA 5HM9A 1HYLA 1G2LA 1P03A 4JZDH 5I25A 2QAAA 3RXHA 1AUTC 1TGTA 3PM3A 1Y5AT 4K1TA 3HK6B 2FO9A 1MH0A 6LPRA 3ZVGA 1ABIH 4B74A 3EAJA 3RC5A 3S69A 2QC2A 2C8YB 3ODDA 3STIA 4TYDA 1QBVH 2SGPE 4INKA 4ZKSU 4CHAB 1TNIA 1G3BA 1GG6C 4Z0KA 2AEIH 4IS5A 2EI8A 1DICA 1V2VT 4D76A 2Z3DA 4WF8A 2F9UA 4DVAU 1S82A 1IQMA 5E0HA 2ASUB 2FOCA 1C5OH 3HKJB 4AFUA 1DXWA 4K2YA 2F91A 4CH8B 3QO6A 1SB1H 1IQEA 4X8SH 3RXQA 1UMAH 2ZPQA 3JZ1B 2GT8A 1GHYH 2ODPA 3QX5H 4ABDA 3MTYA 3RP2A 2P93A 1QNJA 1VJ9U 1DWDH 4X6PA 2PUXB 3QUMP 4CRAA 1S0RA 2R9PA 2G5NA 4LZ1H 1HAXB 4FUJA 1BTPA 2HNTE 2ZFRH 2I6QA 3LGVA 3U1IB 3UREA 1PQ8A 2ZDAH 2Z9LA 1F7ZA 4AGJA 1V2WT 1G9IE 1QA7A 1GHAF 4DG4A 3PB1E 2G5VA 1ZMJA 4Y11E 3MH5A 1YGCH 2ZGCA 1TALA 1A7SA 3RXDA 2BY8X 1O5GH 3RXTA 3M5MA 1O3DA 3SU6A 1TGSZ 4I8HA 2HGTH 2BX3A 1GI2A 5G4BA 1SVPA 1O3GA 1C4V2 4YOJA 2GV6A 5C1YA 2BZAA 1PQ5A 3BN9A 2LNCA 2WV4A 1CBWB 1CE5A 1QQ4A 1XKBC 4WVPE 3STJA 2HNTF 3ZVBA 1Z6JH 1HAVA 3UNRA 1ZTJA 3FVFB 4CREA 1C1QA 1BITA 3M61U 4H6SB 3ZZDA 4D8NA 4IMZA 2O8TA 1TPOA 3ZZBA 2BDBA 1JIRA 2AMQA 4ABAA 1PFXC 5DK1A 1XM1A 2ZCKP 4CRDA 4JZ1A 4JCNA 4NGAH 3U69H 1QQUA 1DUAA 1YP9A 2C8XB 1ZJKA 1G2MA 3GY6A 2WUBA 1O2MA 2ZFPH 1FN6A 2QA9E 1V2UT 4AG1A 3SHAH 3OSYA 1X7AC 3W94A 1TMUH 2RG3A 1UTLM 4D9QA 3E6PH 4YOGA 1Q3XA 2RA0A 1SGIB 1ZPZA 5E2OA 4B75A 1WU1A 2R0KA 1EP5A 3A8BA 2FI3E 1T8NA 2F9OA 1RD3B 1RTFB 3RXSA 3O8CA 4CR9A 3RMOH 2FS9A 1BUIA 4INLA 5DP6A 2J92A 3UR9A 2Q6FA 2W26A 5FPSA 3TLOA 4NFFA 2ZECA 2A5IA 3ELAH 1ABJH 1T32A 1AY6H 1RS0A 4HI3A 3PMBB 1GI1A 1O2XA 3D62A 3QLPH 2ZDNA 1BDAA 1D6RA 4ZKOU 3LGWA 5A8XA 1CHOG 1TPPA 3A88A 4UD9H 1D3DB 4INHA 3UNQA 2HVXA 2QF0A 3SUFA 4AYVB 1SLWB 4D7FA 1YPGH 4NSYA 4Y6DA 1KXAA 4FUDA 1S85A 2GCTC 2VIQA 1AWFH 4KTCA 1SGDE 1EZXC 4ISHH 4CH2B 4X6NA 5GJ4B 1O38A 2FZZA 1NU7B 3SV7A 1ANBA 1GPZA 1GBFA 3MO6A 2VJ1A 3S7KB 4SGBE 3SI3H 1KXCA 1OWDA 3DA9B 3U8RH 3MU8A 4DCDA 2ZHDA 1C1WH 4X2XA 1A0LA 2O8UA 4XOJA 1DSTA 1LKBA 4ASHA 2A0QB 1NFWA 1UCYE 3KNXA 2C93B 1QJ1B 1E38B 2ZDLA 3A84A 4PROA 3LH3A 4MNYA 3SGBE 1G3DA 4X1QU 3RXBA 3SQEE 2B8OH 1GMCG 1F0TA 4IC5A 1T7CA 1UCYK 2VIDA 4K3JA 1TWXB 1K1NA 2FYQA 5JB8S 3LGIA 2NU4E 2Z9IA 3F6UH 1VITH 4X1NU 1P0SH 1YPJH 2VWOA 2ZFFH 1LQDB 1OWEA 3SNCA 1YLDA 1THRH 1DX5M 4LXBH 1C2LA 2ANYA 3T27A 5L2YH 3KQEA 2BDAA 1EZSC 2Q6GA 2FLBH 1JWTA 2ZTYA 1MCTA 1UVUH 3UQOA 1LPKB 1WV7H 4MNVA 3UIRA 1AE5A 5T6DA 4DW2U 3Q3KA 4NWLA 1O3LA 4A1TA 4Y0ZE 1Y5BT 9ESTA 3BTME 1K22H 3PV4A 1MKWK 4AZ2B 3GCTF 1JMOH 1Z8IB 2JKHA 3EE0B 1ESAA 2STAE 5AVDA 1P2OA 1A3EH 3C27B 3P6ZB 2BVRH 1UVSH 4HZHA 1UTQA 1C5SA 3BG4B 3LT3A 1HNEE 1TYNA 2V35A 1O2KA 3V13A 3SO3A 5C1UA 1UK2A 1XUFA 1YPMH 4ZHLU 1IQNA 1GI5A 1IQIA 4IW4E 5JYIA 3SV6A 2ESTE 1NT1A 3PO1C 1C1UH 1GBEA 1Z8JB 3PLPA 1N6XA 5IDKA 3TGKE 1HB0B 5C5NA 2OQUA 4FVDA 1ELFA 1QA0A 2ZO3H 3SNBA 1GI8B 2WYGA 4FU9A 1C1MA 4JYVH 3LC5A 4XSKU 3A7VA 1EZQA 2OINA 1NRNH 2XC5A 3VGCC 1BRAA 3O8BA 3OU0A 2VNTA 2ZIQH 1T8MA 2AGGX 1K1JA 1HAIH 4Q7ZA 2J95A 2XYAA 1O3NA 3SJIA 2OD3B 2ZPSA 1V2KT 3MHWU 5AHGH 1O3BA 1PPCE 1UK4A 2XNIA 4JYUH 1LVMA 1IHTH 3UR6A 2B0FA 1OX1A 1KLTA 3A7XA 3LJOA 3RC6A 3AW1A 1O3AA 2ZCHP 1QY6A 1SFQB 2A4QA 4DOQA 4FU8A 4K5ZA 1H8DH 2GT7A 2ZTXA 1C9TA 2GZ7A 1PPEE 4YTAA 1UTNA 1QRWA 4ZAEA 2BY6X 1B7XB 1NRRH 1VGCB 1H9IE 1MAXA 3QTOH 5J4QA 1SGYE 1MZDA 1XX9A 1P8VC 4VGCB 1P11E 4AGKA 3A87A 3WY8A 5JDUB 1V2RT 1MKXH 4U30A 4K1SA 1C5ZB 2HOBA 1DUEA 1O2YA 2VH0A 5T6FA 1RFNA 3M3TA 4A92A 2F83A 1OP2A 5HMAA 4MVNA 2OC0A 3TK6A 4ISNA 2GMTB 1AB9C 3S7HB 3F9HA 2QXGA 4NIWA 1O5AB 3SU0A 4IMQA 2BLQA 2J94A 2ZZUH 2HNTC 1WYKA 1FUJA 1GBAA 1TA6A 1ZYOA 2BD7A 3SV8A 1W0YH 3TJOA 3RLWH 2CHAB 3HGPA 1KDQB 1MAYA 1Z8GA 2BMGB 2CN0H 1GHBG 3HPTB 1S6FA 1XUIA 1O5CB 1W10U 2DUCA 1QTFA 4JMYA 4BAOB 6GCHG 1P02A 3Q00A 8GCHG 5LPEA 1O2TA 3MO9A 3DFJA 4E06H 1ETTH 1WTGH 3K2UA 2OC8A 5EPNA 3I78A 1UVPA 1UTPA 3B23B 2W5EA 2JETB 1OWHA 3P70B 2PTCE 3V12A 1D4PB 2TRMA 5TJXA 1EOJA 1TA2A 1BOQA 1SBWA 2UUFB 4A7IB 1TRYA 1GGDB 1CA0C 3Q77A 1UHBA 3NK8A 1NRSH 1AFQB 1QURH 1DWCH 2YNAA 1O3IA 3ZVCA 5LH8A 3UWIA 4I33A 2ZGXH 3CENA 2G55A 2WV5A 3ATLA 3LU9B 1JRSA 3HATH 4GSOA 4B2AA 4BXWA 3A7YA 2FS8A 4H6TA 1QL7A 1DPOA 2J9NA 1KLJH 2BLVA 5GIBA 1SFIA 1EPTC 3Q3YA 1O3OA 2PTNA 1J15A 1A4WH 4YOIA 1FZZA 2G81E 2C90B 3BSQA 3TJUA 1BBRE 1D3TB 1O35A 1SR5C 3MYWA 1D3PB 4XBDA 1BHXF 5J4SA 1GBHA 2O8WA 3SN8A 1UTOA 1BBRK 4Y8YA 4X1RU 5DO4H 4YLUA 3SNAA 1KXEA 1Q2WA 4TWYA 1YKTA 3U1JB 2H9HA 4MNXA 1VITG 1Z6EA 1O5EH 1NRQH 3PWBA 3MH7A 2FOGA 3M5OA 4XBBA 1C1SA 1UK3A 3AAUA 1W3CA 4ISIH 1S81A 1IOEA 5CHAC 1LQEA 5E0JA 1AVXA 3GY3A 1CGIE 1FPCH 2Y80A 3P8OA 4OGXA 2BY7X 1C2JA 3URCA 1TLDA 2G00A 5B6OA 1YM0A 1FN8A 3M7QA 2ZGJA 1C1OA 3SJ8A 1K1OA 3M3SA 2SNWA 2ZGHA 3BTHE 1WSSH 2VIPA 3F9FA 4CBNA 5TCAA 4E7NA 4Y79A 1U6QA 2B7DH 1O2UA 2BY9X 2H2ZA 2ZC9H 4ESTE 2BDHA 4AFQA 1YPEH 1T8LA 3C1KA 4OS1A 4X6OA 3SGQE 1DWBH 1TOCB 1O2SA 2YNBA 1NTPA 3LKWA 3BG8A 3F68H 1CT0E 1UHBB 1YPLH 2R3YA 3RXEA 1CT4E 1IQLA 1WTHD 8ESTE 3PMHB 2C8ZB 4GUXA 1DT2A 2G51A 4B71A 1AE8H 2Q6DA 2Z3EA 1TQ7B 2ZHQH 4A1VA 1SGRE 4DT7B 3FZDA 1TNHA 4GCHF 4ISOA 3ESTA 4FVBA 5GWZA 3S9CA 1GBCA 2AS9A 2VVUA 1TONA 1P3CA 1K2I1 4I8LA 2KAIB 1NPMA 3I77A 4Y76A 3ZZ7A 1MMJN 1GVLA 1W14U 4QT8C 1L0ZA 1E35B 2OLGA 3RXCA 1ZR0A 2PGBB 2QN5T 3P8FA 2ODYB 5DP4A 3QDZB 2AFQB 2FLRH 4RSPA 3QGJA 3PLBA 1V2MT 2P3FH 4LOYH 4WJG2 3ZZ4A 3K65B 4I8JA 4IBLH 2BVSH 5EPYA 7KMEH 1K1LA 1GJ4H 1GHWH 4ZHAA 2ZFTA 1GHAG 6ESTA 7LPRA 1OKXA 4I7YH 1HPGA 4X1PU 3ZVFA 4Y0YE 5FBIA 1EKBB 3A8DA 5A09A 1QGFA 3M5LA 3TU7H 4JZFH 2GDDA 1TABE 2VGCB 2BYAX 4F4OC 1GWAA 4OS7A 2ZI2H 4JK6A 1FJSA 1QRZA 1P2IA 1Y8TA 3GDVA 1P2QA 1YCPK 1V2NT 2SNVA 4FUEA 2BTCE 3TJNA 5A2MH 2EC9H 4YESB 3HK3B 1J9CH 1Z7KA 4OS2A 4A5TS 2AERH 1A5HA 5ABWA 1RRKA 1RTKA 1UJ1A 1BMNH 1AKSA 1VR1H 2THFB 1E0FD 4BAMB 3SBKA 1VCPA 1A3BH 5EU8A 1TNGA 3M3VA 3A8CA 3B9FH 5L30H 1O2IA 1BRBE 4I32A 3EYDA 3KHVA 4CRCA 3VXEH 2AIPA 2NWNA 1YPHE 3QN7A 1XVMA 2AIQA 4MPXA 4XE4A 5EGMA 4ZH8A 3GYMA 4Z6AH 2NU0E 3VEQB 1ZMLA 3KGPA 2RDLA 2PKSC 3ZV8A 4NIXA 1LHCH 3MU0A 2PFEA 4LZ4B 2BD8A 2Y82A 2FDAA 1IQJA 2ANWA 3BTDE 3T28A 1LHGH 2B5TB 4Q80A 1C2EA 2ZGBH 5ESBA 1TIOA 3KEEA 1EPTA 2JH5D 1OWKA 3NXPA 1ZRBA 4Y7AA 4ZKRU 4BNRA 1MTWA 2FX4A 1BRUP 1P57B 1BT7A 2TGDA 1TB6H 3SW2B 2A5AA 2HALA 2H9TH 2ZQ1A 1NFYA 5CMXH 2ZNKH 2PKAA 5DP8A 3F1SB 7GCHG 2AYWA 1L1JA 1MZAA 1ZHRA 1J8AA 4K69A 3VB5A 1ANCA 1BTXA 2VIWA 1AFEH 4FU7A 2Z7FE 3QGNB 2PR3A 4DURA 1GJAB 3D23A 3RUOA 3U98H 1H9HE 1O5BB 1K21H 2XBXA 2ZA5A 5BRRE 3GYLB 4MLFB 1DFPA 1DLEA 1S0QA 3UNSA 1FLEE 1EX3A 2CJIA 2ANKH 2D1JA 4WH6A 2XC4A 3P8NA 2WUCA 1BRCE 2P8OB 4WMEA 1SOZA 4JZIA 1F0SA 1MTSA 3ZVAA 1OP8A 1MQ5A 1ESBA 2P3UB 2ZKSA 4X8VH 1FDPA 1ARCA 2UWLA 4AN7A 2FYRA 3M35A 2AGEX 2K1QA 3ZZAA 1C2DA 1JOUB 4CR5A 3M7TA 1TPAE 4TPIZ 3Q76A 1PJPA 2BD3A 1C2MA 2PUQH 1P05A 5AFYH 5EG4A 1NESE 2ULLA 2Z94A 3SJOA 3TK5A 3GY4A 2ZFSA 3SUDA 1P04A 1P10A 3GCHC 2VVVA 3LIWA 1AHTH 3RXUA 4ZROA 1XMNB 1EPTB 1IQFA 1C2HA 2G8TA 1O2QA 1SLUB 3U8OH 1F92A 3FZZA 1RIWB 2XBYA 2BQ6B 1P2MA 4BAHB 2A4RA 1EOLA 1SLXB 1IQGA 1BMMH 3T25A 3GCTG 3RXVA 1HGTH 3D49H 3ZVDA 5C2ZA 3H7TA 1HAVB 2Y7ZA 1ESTA 5DP9A 2NU3E 2PHBA 3MNSA 1WQSA 1HAHH 2R2MB 2Y5HA 3CS0A 1SI5H 4TY7A 3QK1A 4ZXYH 2FXRA 1QL9A 2EI6A 4ZKNU 1C1PA 1Y5UT 2WYJA 1ELEE 3IWMA 1TPSA 1O36A 3FP8E 1DE7H 3FAOA 1HAZB 2UWPA 5LPRA 1GI9B 1PPFE 1MTNC 1TBRH 2STBE 4WXVA 4LK4A 3RMLH 3R3GB 4NG9H 3RXOA 1GHVH 4R0IA 1P2JA 1ELGA 1O2WA 2QGRA 1EAIA 1F5KU 2BD2A 3TNTA 4IC6A 2XXLA 2TBSA 2XTTB 1C1NA 1UTJA 1N8OB 1DS2E 3VXFH 1CVWH 1BB0B 1ZPCA 1NROH 2CF9H 4K1EA 1O0DH 1V6DA 6CHAC 1MBQA 1O3JA 1B0FA 2C3SA 1TGNA 2ZDKA 4AFSA 3NWUA 4Q7XA 3RU4T 2RCEA 1P09A 1VJAU 3VB4A 5F8ZA 1FI8A 1C5QA 1TMTH 2Y5GA 1W2KH 1C1TA 3A7TA 1G36A 2AH4X 1SGFA 3PROA 2FX6A 2ZDMA 4YO9A 1V2LT 3RMNH 3MU4A 1FMGA 1SHYA 1GJ6A 2FODA 5A0BA 5C3NA 3KQDA 3KIDU 3BTTE 1HJAC 3SV9A 1BTUA 3GISB 1N1LA 4FUHA 1OXGA 3QZRA 5E0GA 1TNLA 5EQQA 1GCTC 2GVFA 3E0NB 1SC8U 3RXJA 3RU4E 1SGFG 4AX9H 2F9BH 5I46H 1PPBH 1PPGE 1XUGA 3ATMA 1WAYB 1DSUA 1HLTH 1ZTLA 3HGNA 5HM2A 1T4VH 2BD9A 1W8BH 4KTSA 1E36B 2XCFA 1V2TT 1RJXB 1ELTA 3EGKH 1GI0A 3ZZ6A 5EW1H 1C1RA 1MCVA 4A6LA 2SFAA 1GMCF 5LGOA 2OQ5A 2OXSA 3MNCA 1GJDB 2SGDE 3B8JA 1C2KA 3MNXA 4CHAC 1GG6B 3MU1A 2ZCLP 2FOMB 4X2VA 2HPPH 5GCHG 2JH6D 2DE8A 1AVGH 1HIAA 1TNJA 1C2IA 4XFQA 2G52A 1EJAA 2BXTH 1TGBA 1BQYA 1S84A 2ZU3A 4YT6H 3RC4A 3A82A 5DP5A 4K60A 3GCOA 3PYHA 2OBQA 1FAKH 3DT0H 1N6YA 1FY1A 3IG6B 1KTSB 4O3UA 1GVZA 3BTQE 1HUTH 1EAXA 5HYOA 4YZUA 1WQVH 5F8XA 4NCYA 1NO9H 1LO6A 1ELBA 2BX4A
chains in the Genus database with same CATH superfamily
1ZMNA 2BD5A 1WUNH 2PW8H 2O8MA 1TOMH 3SQHE 5KEDA 2CXVA 4AOQA 3EQ0H 4FXGH 3D65E 3RXRA 2WPLS 4AORA 1GI3A 2AMDA 1ZRKA 4O03A 3OY5U 5HIZA 3UOPA 1HJ9A 1C5RA 2ZEBA 1GI4A 2PV9B 1TFXA 1GBIA 3TH3H 5LPFA 1O34A 1A1RA 4NA9H 3TGIE 4OS4A 1L1NA 1H4WA 1GI6A 1CBWC 1CQQA 2GV7A 1MQ6A 1C5VA 1QL8A 3OY6U 3U8TH 1LMWB 2OBOA 1C9PA 1P3EA 2PGQB 3AAVA 4ZMAH 3RXLA 1C5MD 4YM9A 3UY9A 1XUHA 4M7GA 3TPIZ 1NFXA 3GY7A 4FUFA 2H1UA 2H5CA 5F03A 2ANMH 1KIGH 1A61H 5F8TA 1O5FH 3NUMA 4X6MA 1O3FA 2IPQX 1E34B 4UEHH 1JBUH 1EZUC 3BIUH 1A5GH 3GY8A 1TQ0B 3RXGA 2P16A 4BTUB 2H9EH 1F0RA 3MQKC 4ABGA 2WHXA 1Q31A 3F9EA 1P01A 1TBQH 2W6ID 4TT3D 3UPEA 1IQHA 1O3PB 2XC0A 3L3TA 2ODQA 1E37B 1FNIA 4O9VA 3SU1A 2M2AA 1FXYA 1BMAA 1O33A 1GJBB 2SGEE 2TGAA 1NBME 4K8BA 2XCNA 1Y3WA 3GCNA 4KELA 4NIYA 3H7OA 4GPGA 2C4FH 3GOVB 1AVWA 2XRCA 4AB9A 4Y71A 3GDSA 2A7JA 1SL3A 2FM2A 1V3XA 2UWOA 2A7HA 2OCVB 1DOJA 2W7UA 1MTVA 4JYTA 4RN6A 1A2CH 2GP9B 1P2NA 1GMHF 1AQ7A 5EJLA 4WY3A 2BDCA 3F2GA 4TSFD 1HAOH 2ALPA 1L1GA 1ZGVA 1AMHA 2Q1JA 3OFND 5ESTE 2KCAA 4XBCA 3V0XA 4GCHG 1IHSH 5DP3A 1EASA 2VBCA 2G4TA 3DSGA 1KSNA 1KY9A 5FPTA 1MU8B 2GCTB 4NIVA 5GXPA 3SHCH 2QYIA 1P12E 2FPZA 4BTIB 3E90B 2R3UA 5ETXA 1SG8B 4GLYA 1ARBA 2TPIZ 1ANEA 1W11U 4FOUC 1UCYH 5C94A 2P3TB 1UO6A 2A1DB 5TCCA 3PRDA 1K1PA 8KME2 3S0NA 1XUJA 3EA8A 5C67A 1QRXA 1AUJA 1ELAA 4O97A 2ZWLH 4JZEH 1J14A 1C5UA 5FX5A 2TGTA 1SGCA 2XWBI 1MTNB 4ACAA 1AI8H 2Y81A 1L4ZA 2VB0A 1WBGB 2OC1A 3A81A 1O37A 1AD8H 4IN2A 2ZTZA 1PYTD 1FIWA 2VIVA 2RDEA 1HAPH 4KTUA 2Y6TA 5FXLA 1C5WB 5A8ZA 1INCA 1RTLA 1AU8A 1C4U2 4DY7B 1A0HB 2V7QD 1BZXE 1SQTA 2HWLB 2L6OA 1DM4B 1MKWH 4P02A 2VH6A 1NC6A 1YC0A 4X2WA 4AB8A 1AZZA 2D8WA 2FESH 4X1SU 3LDXH 1NU9A 2J4IA 1W12U 1ZHMA 4TWWA 1FONA 2AGIX 4MDSA 1J17T 4ZHMU 3LH1A 1O32A 1QHRB 4XDEA 1LTOA 1CA8B 1S6LA 3SUGA 3GY5A 2LPRA 2D26C 1SOTA 3LGTA 3NZIA 1O5DH 2V6NA 1BTHH 2HVYB 1ACBE 3BG4C 2D2DA 4Q7YA 1EQ9A 2J97A 3RLYH 1SHHB 2XW9A 1YF4A 1ZZZA 3TIUA 3WWBA 3FANA 1GCTB 2I6SA 3O8RA 1HBTH 1FY5A 3PO1B 4ABHA 3P95A 3RXKA 2L74A 2YOLA 4B2BA 3RXIA 2DE9A 5DKMA 1ZSKA 5HXFA 3RXPA 2H5DA 1KLIH 1K28D 1NZQH 2FOAA 2GCHF 3LC3A 1GI7B 3VGCB 1QIXB 3QTVH 5DPAA 3H5CB 1MABB 1TX7A 2J98A 3KL6A 5GDSH 3AASA 3DUXH 4B2CA 2VWNA 2ZHEH 1VKYA 4GAWA 1C5NH 4WH8A 1MD8A 2BZ6H 3N99A 4E05H 4CRBA 2TGPZ 1ZPBA 1H8IH 3LJJA 2IJOB 3KYFA 4HGCA 1QR3E 3KYGA 3RM0H 3RM2H 5EOKA 2M5TA 1ETRH 1W13U 3MFJA 1QBOA 1EJNA 3E1XB 2NU2E 1QB6A 2ALVA 5FX6A 1G30B 2OTVA 3I29A 1KXFA 2A2QH 3CS7A 3ZV9A 3A85A 5IYTA 1GMDF 5JBCS 5JB9S 2WINI 1Y59T 2QF5A 1Y3YA 1THPB 1AO5A 1GDQA 3A89A 4B1TA 1VGCC 3MMGA 4MG3A 3RMMH 1KXBA 3IITA 1O2PA 1F2SE 4MPWA 2F9NA 2W7SA 1O2GH 1YLCA 4E7RG 1YWUA 4VGCC 3BEIB 5FCRA 2PLXA 1O3MA 3L33A 1ZOMA 5C5OA 3VB6A 1SQOA 2ZHWH 1C5XB 1WCZA 1C5PA 2V3HH 3U9AH 2Y5FA 5H4IB 5F53A 3V7TA 1O3HA 3SU5A 1O31A 2ZHFH 2ZU1A 1O2LA 1C2FA 3E3TA 9LPRA 2FI4E 2GMTC 2BXUH 1AB9B 1O2RA 1MKXK 2OC7A 5E8EH 1QCPA 1TAWA 1THSH 2WPHS 3ITIA 1ZGIA 2YMSC 1GHZA 1YPKH 3NKKA 1C5LH 1EFRD 1S5SA 3BTEE 3T2NA 5JBAS 3MNBA 3ZZ3A 1O2ZA 3SGAE 2WSSD 4H4FA 1Z71A 1UTMA 1YYY1 5E2PA 2GGVB 2VWMA 3SORA 4X8UH 2QY0B 4GVUA 1W7GH 3NPSA 4HFPB 4U01A 2BM2A 2CHAC 4I8GA 4ACBA 1OYTH 4UFGH 2ZPRA 1KTTB 2BHGA 1XVOA 4U32A 5DGJA 1MTUA 1AN1E 1HV7A 4UFFH 2GKVE 4A1XA 1NS3A 1HXFH 2WPKS 4UDWH 1P9UA 1W7XH 3KQ5A 5JBTA 3Q3XA 5FAHA 1OWJA 2F3CE 2BOKA 4NZQA 1V2QT 4B73A 1AKSB 1VCQA 2SGAA 3V3MA 1BTZA 1ORFA 3F0OA 3LOXA 3URDA 2JETC 3BEFB 2VINA 1O2NA 4YLQH 4CRGA 1HJ8A 3UTUH 1V2OT 5FCKA 1GGDC 1DXPA 1CA0B 1LVYA 1AFQC 3BIVH 1V2ST 1GJ5H 2GZ9A 3PMAB 1BJVA 1NN6A 1HRTH 2ILNA 5DG6A 1CHGA 1SGQE 4WWYA 1XXFA 1G37A 4ABIA 3RU4D 4D9RA 1GVKB 5EXMA 3KN2A 2VIOA 1BBRH 2EA3A 1OSSA 5FBEA 3E0PB 1DANH 1EB2A 2OP9A 1T8OA 3FP6E 1O39A 2BLWA 3BV9B 3FFGA 4WMFA 1NM6A 3SI4H 5EXLA 1S83A 2BLOA 3MWIU 3SU3A 2H6MA 4BTTB 1E1QD 1P06A 2PSYA 3TNSA 4Y10E 1GJCB 3LGUA 1TBZH 4Y8XA 1TX6A 1GJ8B 5K7RA 2PKAB 7GCHF 3K6YA 2K8IA 4AG2A 3PTNA 1GCDA 1FY4A 1Y3XA 1EB1H 3ZZ5A 2SGFE 1MD7A 4MQAA 2QCYA 1OYQA 2B9LA 5CHAB 1GBTA 4BAQB 1FQ3A 3FP7E 3G01A 2UUJB 4MPVA 1GBMA 1ANDA 1AIXH 3PLKA 1GL1A 2FWWA 1BA8B 1C4Y2 1EJMA 1G32B 2UUKB 3ENSB 1AWHB 3DHKH 3S9AA 3SU2A 2BQWB 3TH4H 1O2HA 1YY3A 1L2EA 4X8TH 3A7ZA 1HFDA 4X0WU 4BOHA 1QJ7B 5C1XA 1GBKA 1GBLA 4U2WA 1GL0E 2BB4A 1QBNA 1DVAH 2ZFQH 4HTCH 1DLKB 1IAUA 2QXJA 3MU5A 2IJD1 1UTKA 1PPZA 2XWAA 3MH4A 4FUGA 4UE7H 4IN1A 5CE1A 2GD4B 3VB7A 1BMFD 3SNDA 5AF9H 1TGCA 1GDUA 1FV9A 3DFLA 1QB9A 1D3QB 2BQ7B 1EUFA 2Z3CA 3GDUA 3DD2H 4Y7BA 4ISLA 3MOCA 1BTYA 3BTFE 2QXHA 1DY9A 2PWXA 1OS8A 1W0ZU 1ZJDA 1CHOF 1GJ7B 1LVBA 2QIQA 4RKJB 4I31A 1Y3UA 4WMDA 3KF2A 4ZXXH 4FUCA 4DGJA 5DP7A 1SGNE 1W0JD 1AGJA 2NU1E 4KGAA 3M5NA 4R8TB 3A83A 3UQVA 1AZ8A 3OTJE 2RA3A 1P2KA 4NZLA 1H1BA 1Z1JA 1C5TA 1K1MA 1SMFE 3TITA 1T4UH 1LVOA 3LGYA 2PSXA 1DY8A 4MPUA 2BDIA 3OEHD 3TK9A 4GHTA 2G4UA 1PQAA 1LCYA 5EW2H 3HKIB 1TMBH 1YCPH 2IPHA 3NCLA 1EXFA 2BDYA 1TRNA 1OP0A 5T6GA 1G3EA 4THNH 1LPZB 2V0BA 2FOFA 3T26A 2VWLA 2P95A 2FTLE 2VGCC 3P17H 2Z9GA 4UONA 3L6PA 1NBMD 2J5UA 2Z9KA 3SJKA 4TPYA 3RXMA 1KDQA 1DDJA 1O2VA 4Q2KA 4JK5A 5EXNA 2ZQ2A 2F9PA 7ESTE 3AVZA 2J34A 1ELDE 3F0PA 5JPMH 3QZQA 2CMYA 1HAGE 3SUEA 3BTWE 3M36A 3VPKA 2P59A 2A2XH 1O3KA 1F5LA 4UFEH 1MU6B 1BIOA 4OS6A 3TH2H 1BCUH 2FOHA 2WPJS 2KFWA 3OX7U 2FP7B 1EAWA 1Y3VA 3ZZ9A 2AHME 1SPJA 4J2YB 3KQBA 2F9VA 4X2YA 1LPGB 1A0JA 1GBJA 2A4GA 2QF3A 4UFDH 4OGYA 3PTBA 2A5KA 3SJ9A 1HDTH 1ELVA 4FUIA 1XKAC 1DWEH 3K9XB 2PKSB 2V3OH 5L6NH 3ZZ8A 2FIRH 4DJZB 3UUZA 3RDZA 1XUKA 3P8GA 2VVCA 2PP6A 1RXPA 3A80A 3UOUA 4CRFA 1G3CA 1LHFH 1NY22 3T62A 1T31A 2ZDVH 1YPHC 2FI5E 2QXIA 4BANB 3W95A 4M9FA 4I8KA 2J2UA 3UAIC 2BY5X 2FTMA 3SV2H 3LPRA 3E91A 3PWCA 2GDEH 3RXAA 3MO3A 4Q63A 1NRPH 1C1VH 2BDGA 3BF6H 2ZG0H 1GMHG 2QV1A 2A32A 1PYTC 4MTBA 2HLCA 1LHEH 3RXFA 1EATA 3E16B 1M9UA 2O8LA 5A0CA 1O30A 1OPHB 3MH6A 1J16A 5F6MA 3LONA 4AYYB 4SGAE 1GBDA 2R0LA 2ZU5A 2XBWA 1C5YB 1CT2E 1VCWA 1DITH 3JZ2B 3M37A 1BJUA 1PPHE 1BMLA 1BTWA 5GCHF 1S6HA 1QB1A 2Z9JA 1B5GH 1KYNA 1HAYB 1HIAB 2BD4A 2ZF0H 4DIHH 4CBOA 3VFEA 3M7UA 2EEKA 1C2GA 2A7CA 2EI7A 4NWKA 5A8YA 5SGAE 3GICB 1JRTA 1FAXA 1L4DA 5HGGA 3OAAD 1A5IA 3S9BA 4NSVA 1GDNA 2P8OC 1ZSJA 1ZTKA 2TIOA 2AMPA 3UWJH 1FPHH 3QWCH 2WPIS 1CO7E 3EE7A 3F9GA 3SZNA 2W3IA 1B0EA 3R0FA 3EA9A 4IGDA 3TVJB 2UUYA 8LPRA 5FHTA 3SU4A 1SQAA 3BTKE 4BAKB 3UFAA 3A86A 1V2JT 5EODA 3SYJA 4F49A 3OYPA 5FPYA 4D7GA 2CF8H 2CGAA 1GJ9B 3T29A 2A45B 1A46H 3VB3A 2EY4C 2FOEA 2IOTA 3N7EA 5AFZH 3TJVA 1JXPA 2FEQH 4ABJA 1BHXB 1Z1IA 2OUAA 1SGPE 2GTBA 1MUEB 1MBMA 3GCHB 2ZU4A 1GBBA 3AW0A 3PV5A 1OWIA 1TX8A 3ATWA 2FMJA 2CV3A 2KAIA 2VU8E 1K1IA 1EAUA 1K0HA 1ELCA 1RIWC 5DN6D 1LKAA 1QFKH 1YBWA 2IN2A 5GPIB 1TRMA 5T3HA 1SGTA 2Z6BD 1K9OE 4BXSA 1GHBF 1RGQA 3GY2A 2R2WU 1ZSLA 3DSOA 3SOSA 6GCHF 3K6ZA 4OS5A 3ODFA 2P94A 1PQ7A 2JH0D 2KX4A 1FY8E 2J38A 1F5RA 8GCHF 3EA7A 2A31A 2A4OA 4YT7H 3T5FH 1GHXH 1O3EA 1V2PT 4NFEA 5A0AE 2W3KA 1O2OA 2GX4A 1SQRA 5C20A 3ATIA 1ETSH 4Y8ZA 3PMJA 1SLVB 4NA7A 2WPMS 3TGJE 4ABFA 4NA8A 5K0HA 4WXIA 1CSOE 3MI4A 1LHDH 2C8WB 1TNKA 3ZZCA 4RKOB 4ABEA 2ZU2A 2GCHG 2Y7XA 1SSXA 1D9IA 1H9LB 4ZUHA 3A7WA 1WOFA 3E8LA 1O2JA 1IQKA 1P9SA 2HRVA 3KQCA 4KP0A 2GZ8A 3ZVEA 1F0UA 1SGEE 4O3TA 2FOBA 3N7OA 3KCGH 1O3CA 1N8OC 1CGJE 1JIMA 1ID5H 1TE0A 1YCPM 1FIZA 2KR7A 4YXWD 1CU1A 6CHAB 1QJ6B 3CP7A 5JBBS 3O8DA 1LDTT 2BOHB 1NFUA 1EP6A 1HXEH 1KXDA 4H42U 1FY3A 2BVXH 2KCOA 2O9QA 4MNWA 3BEUA 5EQSA 1Z8RA 3ZYDA 3P92A 1UVTH 2HPQH 3EDXB 1XXDA 1ZHPA 1HCGA 3ATKA 4KKDA 1GMDG 4K8YA 1D6WA 2ZP0H 5T1VA 2XBVA 2SGQE 1ZLRA 1OOKB 3A8AA 1VITF 4GHQA 5PTPA 3SNEA 5L2ZH 4ABBA 1HJAB 1UVOA 4J1YA 3BTGE 5EQRA 5BPEA 3ZYEA 4TY6A 1VZQH 4B76A 4DIIH 4FUBA 3AK5A 1CGHA 5DJ7A 4AFZA 5HM9A 1HYLA 1G2LA 1P03A 4JZDH 5I25A 2QAAA 3RXHA 1AUTC 1TGTA 3PM3A 1Y5AT 4K1TA 3HK6B 2FO9A 1MH0A 6LPRA 3ZVGA 1ABIH 4B74A 3EAJA 3RC5A 3S69A 2QC2A 2C8YB 4AC9A 3ODDA 3STIA 4TYDA 1QBVH 5B6LA 2SGPE 4INKA 4ZKSU 4CHAB 5GNDA 1TNIA 1G3BA 1GG6C 3WWFA 4Z0KA 2AEIH 4IS5A 2EI8A 1DICA 5EJ1A 1V2VT 4D76A 2Z3DA 4WF8A 2F9UA 4DVAU 1S82A 1IQMA 5E0HA 2ASUB 2FOCA 1C5OH 3HKJB 4AFUA 1DXWA 4K2YA 2F91A 4CH8B 3QO6A 1SB1H 5KECA 1IQEA 4X8SH 3F2HA 3RXQA 1UMAH 2ZPQA 3JZ1B 2GT8A 1GHYH 2ODPA 3QX5H 4ABDA 3MTYA 3RP2A 2P93A 1QNJA 1VJ9U 1DWDH 4X6PA 2PUXB 3QUMP 4CRAA 1S0RA 2R9PA 2G5NA 4LZ1H 1HAXB 4FUJA 1BTPA 2HNTE 2ZFRH 2I6QA 3LGVA 3U1IB 3UREA 1PQ8A 1H8HD 2ZDAH 2Z9LA 1F7ZA 4AGJA 4RT1A 1V2WT 1G9IE 1QA7A 1GHAF 4DG4A 3PB1E 2G5VA 5KGOA 1ZMJA 4Y11E 3MH5A 1YGCH 2ZGCA 1TALA 1A7SA 3RXDA 2BY8X 1O5GH 3RXTA 3M5MA 1O3DA 3SU6A 2JDID 1TGSZ 4I8HA 2HGTH 2BX3A 3PRBA 1GI2A 5G4BA 1SVPA 1O3GA 1C4V2 4YOJA 2GV6A 5C1YA 2BZAA 1PQ5A 3BN9A 2LNCA 2WV4A 2KM0A 1CBWB 1CE5A 1QQ4A 1XKBC 4WVPE 3STJA 2HNTF 3ZVBA 1Z6JH 1HAVA 3UNRA 1ZTJA 3FVFB 2J98B 4CREA 1C1QA 1BITA 3M61U 4H6SB 3ZZDA 4D8NA 4IMZA 2O8TA 1TPOA 3ZZBA 2BDBA 1JIRA 2AMQA 4ABAA 1PFXC 5DK1A 1XM1A 2ZCKP 4CRDA 4JZ1A 4JCNA 4NGAH 3U69H 1QQUA 3FO8D 1DUAA 1YP9A 2C8XB 1ZJKA 1G2MA 3GY6A 2WUBA 1O2MA 2ZFPH 1FN6A 2QA9E 1V2UT 4AG1A 3SHAH 1FX0B 3OSYA 1E79D 1X7AC 3W94A 1TMUH 3W1EA 2RG3A 1UTLM 4D9QA 3E6PH 4YOGA 1Q3XA 2RA0A 3OTPA 1SGIB 1OHHD 1ZPZA 5E2OA 4B75A 1WU1A 2R0KA 1EP5A 3A8BA 2FI3E 1T8NA 2F9OA 1RD3B 1RTFB 3RXSA 3O8CA 4CR9A 3RMOH 2FS9A 1BUIA 4INLA 5DP6A 2J92A 3UR9A 2Q6FA 2W26A 5FPSA 3TLOA 4NFFA 2ZECA 2A5IA 3ELAH 1ABJH 1T32A 1AY6H 1RS0A 4HI3A 3PMBB 1GI1A 1O2XA 3D62A 3QLPH 2ZDNA 1BDAA 1D6RA 4ZKOU 3LGWA 5A8XA 1CHOG 1TPPA 3A88A 4UD9H 1D3DB 4INHA 3UNQA 2HVXA 2QF0A 3SUFA 4AYVB 1SLWB 4D7FA 1YPGH 4NSYA 4Y6DA 1KXAA 4FUDA 1S85A 2GCTC 2VIQA 1AWFH 4KTCA 1SGDE 1EZXC 4ISHH 4CH2B 2V3MA 4X6NA 5GJ4B 1O38A 2FZZA 1NU7B 3SV7A 1ANBA 1GPZA 4HG6A 1GBFA 3MO6A 2VJ1A 3S7KB 4SGBE 3SI3H 1KXCA 1OWDA 3DA9B 3U8RH 3MU8A 4DCDA 2ZHDA 1C1WH 4X2XA 1A0LA 4ASUD 2O8UA 4XOJA 1DSTA 1LKBA 2WZQA 4ASHA 2A0QB 1NFWA 1UCYE 3KNXA 2C93B 1QJ1B 1E38B 2ZDLA 3A84A 4PROA 3LH3A 4MNYA 3SGBE 1G3DA 4X1QU 3RXBA 3SQEE 2B8OH 1GMCG 1F0TA 5CHBA 4IC5A 1T7CA 1UCYK 2VIDA 4K3JA 1TWXB 1K1NA 2FYQA 5JB8S 3LGIA 2NU4E 2Z9IA 3F6UH 2QE7D 1VITH 4X1NU 1P0SH 1YPJH 2VWOA 2ZFFH 1LQDB 1OWEA 3SNCA 1YLDA 1THRH 1DX5M 4LXBH 1C2LA 2ANYA 3T27A 1WDIA 5L2YH 3KQEA 2BDAA 1EZSC 2Q6GA 2FLBH 1JWTA 2ZTYA 1MCTA 1UVUH 3UQOA 1LPKB 1WV7H 4MNVA 3UIRA 1AE5A 5T6DA 4DW2U 3Q3KA 4NWLA 1O3LA 4A1TA 4Y0ZE 1Y5BT 9ESTA 3BTME 3FN8A 1K22H 3PV4A 1MKWK 3DCLA 4AZ2B 3GCTF 5CDFE 2KCPA 1JMOH 1Z8IB 2JKHA 3EE0B 1ESAA 3WW7A 2STAE 5AVDA 1P2OA 1A3EH 3C27B 3P6ZB 2BVRH 1UVSH 4HZHA 1UTQA 1C5SA 3BG4B 3LT3A 1HNEE 1TYNA 2V35A 1O2KA 3V13A 3SO3A 5C1UA 1UK2A 1XUFA 1YPMH 4ZHLU 1IQNA 1GI5A 1IQIA 3PV2A 4IW4E 5JYIA 3SV6A 2ESTE 1NT1A 3PO1C 1C1UH 1GBEA 1Z8JB 3PLPA 1N6XA 5IDKA 3TGKE 1HB0B 5C5NA 2OQUA 4FVDA 1ELFA 1QA0A 2ZO3H 3SNBA 1GI8B 2WYGA 4FU9A 1C1MA 4JYVH 1E1RD 3LC5A 4XSKU 3A7VA 1EZQA 2OINA 1NRNH 2XC5A 4XD7D 3VGCC 1BRAA 3O8BA 3OU0A 2VNTA 2ZIQH 1T8MA 2AGGX 1K1JA 1HAIH 4Q7ZA 3OE7D 2J95A 2XYAA 1O3NA 3SJIA 2OD3B 5IK2D 2ZPSA 1V2KT 3MHWU 5AHGH 1O3BA 1PPCE 1UK4A 2XNIA 4JYUH 1LVMA 1IHTH 3UR6A 2B0FA 1OX1A 1KLTA 3A7XA 3LJOA 3RC6A 3AW1A 1O3AA 2ZCHP 1QY6A 1SFQB 2A4QA 4DOQA 4FU8A 4K5ZA 1H8DH 2GT7A 2ZTXA 1C9TA 2GZ7A 1PPEE 4YTAA 1UTNA 1QRWA 4ZAEA 2BY6X 1B7XB 1NRRH 1VGCB 1H9IE 1MAXA 3QTOH 5J4QA 1SGYE 3CNRA 1MZDA 1XX9A 1P8VC 4VGCB 1P11E 4AGKA 3A87A 3WY8A 5JDUB 1V2RT 1MKXH 4U30A 4K1SA 1C5ZB 2HOBA 1DUEA 1O2YA 2VH0A 5T6FA 1RFNA 3M3TA 4A92A 2F83A 1OP2A 5HMAA 3UB0A 4MVNA 2OC0A 3TK6A 4ISNA 2GMTB 1AB9C 3S7HB 3F9HA 2QXGA 4NIWA 1O5AB 3SU0A 4IMQA 2BLQA 2J94A 2YMSB 2ZZUH 2HNTC 1WYKA 1FUJA 1GBAA 1TA6A 1ZYOA 2BD7A 3SV8A 1W0YH 3TJOA 2GJGA 3RLWH 2CHAB 3HGPA 1KDQB 1MAYA 1Z8GA 4F48B 2CK3D 2BMGB 2CN0H 1GHBG 3HPTB 1S6FA 1XUIA 1O5CB 1W10U 2DUCA 1QTFA 4JMYA 4BAOB 6GCHG 1P02A 3Q00A 8GCHG 5LPEA 1O2TA 3MO9A 3DFJA 4E06H 1ETTH 1WTGH 3K2UA 2OC8A 5EPNA 3I78A 1UVPA 1UTPA 3B23B 2W5EA 2JETB 1OWHA 3P70B 2PTCE 3V12A 1D4PB 2TRMA 1WXRA 4F55A 5TJXA 1EOJA 1TA2A 1BOQA 1SBWA 2UUFB 4A7IB 1TRYA 1GGDB 1CA0C 3Q77A 1UHBA 3NK8A 1NRSH 1AFQB 1QURH 1DWCH 2YNAA 1O3IA 3ZVCA 5LH8A 3UWIA 1H8ED 4I33A 2ZGXH 3CENA 2G55A 2WV5A 3ATLA 3LU9B 1JRSA 3HATH 4GSOA 4B2AA 4BXWA 3A7YA 2FS8A 4H6TA 1QL7A 1DPOA 2J9NA 1KLJH 2BLVA 5GIBA 2EQNA 1SFIA 1EPTC 3Q3YA 1O3OA 2PTNA 1J15A 1A4WH 4YOIA 1FZZA 2G81E 2C90B 3BSQA 3TJUA 1BBRE 4Z1MD 1D3TB 1O35A 1SR5C 3MYWA 1D3PB 4XBDA 1BHXF 5J4SA 1GBHA 2O8WA 3SN8A 1UTOA 1BBRK 4Y8YA 4OM9A 4X1RU 3ZIAD 5DO4H 4YLUA 3SNAA 1KXEA 1Q2WA 4TWYA 1YKTA 3U1JB 2H9HA 4MNXA 1VITG 1Z6EA 1O5EH 1NRQH 3PWBA 3MH7A 2FOGA 3M5OA 4XBBA 1C1SA 1UK3A 3AAUA 1W3CA 4ISIH 5EIYA 1S81A 1IOEA 2XNDD 5CHAC 1LQEA 5E0JA 1AVXA 2WV9A 3GY3A 1CGIE 1UW7A 1FPCH 2Y80A 3P8OA 4OGXA 2BY7X 1C2JA 3URCA 1TLDA 2G00A 5B6OA 1YM0A 1FN8A 3M7QA 2ZGJA 4Q4LA 1C1OA 3SJ8A 1K1OA 3M3SA 2SNWA 2ZGHA 3BTHE 1WSSH 2VIPA 3F9FA 4CBNA 5TCAA 4E7NA 4Y79A 1U6QA 2B7DH 1O2UA 2BY9X 2H2ZA 2ZC9H 4ESTE 2BDHA 4AFQA 1YPEH 1T8LA 3C1KA 4OS1A 4X6OA 3SGQE 2KCYA 1DWBH 1TOCB 1O2SA 2YNBA 1NTPA 3LKWA 3BG8A 3F68H 1CT0E 1UHBB 1YPLH 2R3YA 3RXEA 1CT4E 1IQLA 4FETA 1WTHD 8ESTE 3PMHB 2C8ZB 4GUXA 1DT2A 2G51A 4B71A 1AE8H 2K0QA 2Q6DA 2Z3EA 1TQ7B 2ZHQH 4A1VA 1SGRE 4DT7B 3FZDA 2OK5A 1TNHA 4GCHF 4ISOA 3ESTA 4FVBA 5GWZA 3S9CA 1GBCA 2AS9A 2VVUA 1TONA 1P3CA 1K2I1 4I8LA 2KAIB 1NPMA 3I77A 4Y76A 3ZZ7A 1MMJN 1GVLA 1W14U 4QT8C 1L0ZA 1E35B 2OLGA 3RXCA 1ZR0A 2PGBB 2QN5T 3P8FA 2ODYB 3N7DA 4I86A 5DP4A 3QDZB 2AFQB 5DSFA 2FLRH 4RSPA 3QGJA 3PLBA 1V2MT 2P3FH 4LOYH 4WJG2 3ZZ4A 3K65B 4I8JA 4IBLH 2BVSH 5EPYA 7KMEH 1K1LA 1GJ4H 1GHWH 4ZHAA 2ZFTA 1GHAG 6ESTA 7LPRA 1OKXA 4I7YH 1HPGA 4X1PU 3ZVFA 4Y0YE 5FBIA 1EKBB 3A8DA 5A09A 1QGFA 3M5LA 2LP6A 3TU7H 4JZFH 2GDDA 1TABE 2VGCB 2BYAX 4F4OC 1GWAA 4OS7A 2ZI2H 4JK6A 1FJSA 1QRZA 1P2IA 1W0KD 1Y8TA 3GDVA 1P2QA 2WPDD 1YCPK 1V2NT 2SNVA 4FUEA 2F4LA 2BTCE 3TJNA 3VG8A 5A2MH 2EC9H 4YESB 3HK3B 1J9CH 1Z7KA 4OS2A 4A5TS 2AERH 1A5HA 2JJ2D 5ABWA 1RRKA 1RTKA 1UJ1A 1BMNH 1AKSA 1VR1H 2THFB 4RI0A 1E0FD 4BAMB 3SBKA 1VCPA 1A3BH 5EU8A 1TNGA 3M3VA 3A8CA 3B9FH 5L30H 1O2IA 1BRBE 4I32A 3EYDA 3KHVA 4CRCA 3VXEH 2LELA 2AIPA 2NWNA 1YPHE 3QN7A 1XVMA 2AIQA 4MPXA 4XE4A 5EGMA 4ZH8A 3GYMA 3F2FA 4Z6AH 2NU0E 3VEQB 1ZMLA 3KGPA 2RDLA 2PKSC 3NRLA 3ZV8A 4NIXA 1LHCH 3MU0A 2PFEA 4LZ4B 2BD8A 2Y82A 2FDAA 1IQJA 2ANWA 3BTDE 3T28A 1LHGH 2B5TB 4Q80A 2XOKD 1C2EA 2ZGBH 5ESBA 1TIOA 3KEEA 1EPTA 2JH5D 1OWKA 3NXPA 1ZRBA 4Y7AA 4ZKRU 4BNRA 1MTWA 2FX4A 1BRUP 1P57B 2KZ4A 4B6FA 1BT7A 3OEED 2TGDA 1QZ8A 3FKSD 1TB6H 3SW2B 2A5AA 2HALA 2H9TH 2ZQ1A 4XRNA 1NFYA 1SKYE 5CMXH 2ZNKH 2PKAA 5DP8A 2F43B 3U28C 3F1SB 7GCHG 2AYWA 1L1JA 1MZAA 1ZHRA 1J8AA 4K69A 3H09A 3VB5A 1ANCA 1BTXA 2VIWA 1AFEH 4FU7A 4ZCNA 2Z7FE 3QGNB 2PR3A 4DURA 5EJZA 1GJAB 3D23A 3RUOA 3U98H 1H9HE 1O5BB 1K21H 2XBXA 2ZA5A 5BRRE 3GYLB 4MLFB 1DFPA 1DLEA 1S0QA 3UNSA 1FLEE 1EX3A 2CJIA 2ANKH 2D1JA 2QF4A 4WH6A 2XC4A 3P8NA 2WUCA 1BRCE 2P8OB 4WMEA 1SOZA 4JZIA 3FOAA 1F0SA 1MTSA 3ZVAA 1OP8A 1MQ5A 1ESBA 2P3UB 2ZKSA 4X8VH 1FDPA 4B6EA 1ARCA 2UWLA 4AN7A 2FYRA 3M35A 2AGEX 2K1QA 3ZZAA 1C2DA 1JOUB 4CR5A 3M7TA 1TPAE 4TPIZ 3Q76A 1PJPA 2BD3A 1C2MA 2PUQH 1P05A 5AFYH 5EG4A 1NESE 2ULLA 2Z94A 3SJOA 3TK5A 3GY4A 2ZFSA 3SUDA 1P04A 1P10A 3GCHC 2VVVA 3LIWA 1AHTH 3RXUA 4ZROA 1XMNB 1EPTB 1IQFA 1C2HA 2G8TA 4DT4A 1O2QA 1SLUB 3U8OH 1F92A 3FZZA 1RIWB 2XBYA 5FL7D 2BQ6B 5HKKD 1P2MA 4BAHB 2A4RA 1EOLA 1SLXB 1IQGA 1BMMH 3T25A 3GCTG 3RXVA 1HGTH 3D49H 3ZVDA 5C2ZA 3H7TA 1HAVB 2Y7ZA 1ESTA 5DP9A 2NU3E 2PHBA 3MNSA 1WQSA 1HAHH 2R2MB 2Y5HA 3CS0A 1SI5H 4TY7A 3QK1A 4ZXYH 2FXRA 1QL9A 2JJ1D 2EI6A 4ZKNU 1C1PA 1Y5UT 2WYJA 1ELEE 3IWMA 1TPSA 1O36A 3FP8E 1DE7H 3FAOA 1HAZB 2UWPA 5LPRA 3DSPA 1GI9B 1PPFE 1MTNC 1TBRH 2STBE 4WXVA 4LK4A 3RMLH 3R3GB 4NG9H 3RXOA 1GHVH 4R0IA 1P2JA 1ELGA 1O2WA 2QGRA 2YMSD 1EAIA 1F5KU 2BD2A 3TNTA 4IC6A 2XXLA 2TBSA 2XTTB 1C1NA 1UTJA 1N8OB 1DS2E 3VXFH 1CVWH 1BB0B 3GS9A 1ZPCA 1NROH 2CF9H 4K1EA 1O0DH 1V6DA 6CHAC 1MBQA 1O3JA 1B0FA 2JIZD 2C3SA 1TGNA 2ZDKA 4AFSA 3NWUA 4Q7XA 3RU4T 2RCEA 1P09A 1VJAU 3VB4A 5C17A 5F8ZA 1FI8A 1C5QA 1TMTH 2Y5GA 1W2KH 1C1TA 3A7TA 1G36A 2AH4X 1SGFA 3PROA 2FX6A 2ZDMA 4YO9A 1V2LT 3RMNH 3MU4A 2W6JD 1FMGA 1SHYA 1GJ6A 2FODA 5A0BA 5C3NA 3KQDA 3KIDU 4RT0A 3BTTE 1HJAC 3SV9A 1BTUA 4P00A 3GISB 1N1LA 4FUHA 3SZEA 1OXGA 5HIYA 3QZRA 5E0GA 1TNLA 5EQQA 1GCTC 2GVFA 3E0NB 1SC8U 3RXJA 3RU4E 1SGFG 4AX9H 2F9BH 2RFKC 5C0TA 5I46H 1PPBH 1PPGE 1XUGA 3ATMA 1WAYB 1DSUA 1HLTH 1ZTLA 3HGNA 5HM2A 1T4VH 2BD9A 1W8BH 4KTSA 1E36B 2XCFA 1V2TT 1RJXB 1ELTA 3EGKH 1GI0A 3ZZ6A 5EW1H 1C1RA 1MCVA 4A6LA 2SFAA 1GMCF 5LGOA 2OQ5A 2OXSA 3MNCA 1GJDB 2SGDE 3B8JA 1C2KA 3MNXA 4CHAC 5C0UA 1GG6B 3MU1A 2ZCLP 2FOMB 4X2VA 2HPPH 5GCHG 2JH6D 2DE8A 1AVGH 1HIAA 1YLNA 1TNJA 1C2IA 4XFQA 2G52A 1EJAA 2BXTH 1TGBA 1BQYA 1COWD 1S84A 2ZU3A 4YT6H 3RC4A 3A82A 2HLDD 5DP5A 4K60A 3GCOA 3F3BA 3PYHA 2OBQA 1FAKH 3DT0H 1N6YA 1FY1A 3IG6B 1KTSB 4O3UA 1GVZA 3BTQE 1HUTH 1EAXA 5HYOA 4YZUA 1WQVH 5F8XA 1KMHB 4NCYA 1NO9H 1LO6A 1ELBA 2BX4A
chains in the Genus database with same CATH topology
1ZMNA 2BD5A 1WUNH 2PW8H 2O8MA 1TOMH 3SQHE 2CXVA 4AOQA 3EQ0H 4FXGH 3D65E 3RXRA 2WPLS 4AORA 1GI3A 2AMDA 1ZRKA 4O03A 3OY5U 3UOPA 1HJ9A 1C5RA 2ZEBA 1GI4A 2PV9B 1TFXA 1GBIA 3TH3H 5LPFA 1O34A 1A1RA 4NA9H 3TGIE 4OS4A 1L1NA 1H4WA 1GI6A 1CBWC 1CQQA 2GV7A 1MQ6A 1C5VA 1QL8A 3OY6U 3U8TH 1LMWB 2OBOA 1C9PA 1P3EA 2PGQB 3AAVA 4ZMAH 3RXLA 1C5MD 4YM9A 3UY9A 1XUHA 4M7GA 3TPIZ 1NFXA 3GY7A 4FUFA 2H1UA 2H5CA 5F03A 2ANMH 1KIGH 1A61H 5F8TA 1O5FH 3NUMA 4X6MA 1O3FA 1E34B 4UEHH 1JBUH 1EZUC 3BIUH 1A5GH 3GY8A 1TQ0B 3RXGA 2P16A 4BTUB 2H9EH 1F0RA 4ABGA 1Q31A 3F9EA 1P01A 1TBQH 3UPEA 1IQHA 1O3PB 2XC0A 3L3TA 2ODQA 1E37B 1FNIA 4O9VA 3SU1A 1FXYA 1BMAA 1O33A 1GJBB 2SGEE 2TGAA 4K8BA 2XCNA 1Y3WA 3GCNA 4KELA 4NIYA 3H7OA 4GPGA 2C4FH 3GOVB 1AVWA 2XRCA 4AB9A 4Y71A 3GDSA 2A7JA 1SL3A 2FM2A 1V3XA 2UWOA 2A7HA 2OCVB 1DOJA 2W7UA 1MTVA 4JYTA 4RN6A 1A2CH 2GP9B 1P2NA 1GMHF 1AQ7A 4WY3A 2BDCA 1HAOH 2ALPA 1L1GA 1ZGVA 1AMHA 2Q1JA 5ESTE 4XBCA 3V0XA 4GCHG 1IHSH 5DP3A 1EASA 2G4TA 1KSNA 1KY9A 5FPTA 1MU8B 2GCTB 4NIVA 5GXPA 3SHCH 2QYIA 1P12E 2FPZA 4BTIB 3E90B 2R3UA 5ETXA 1SG8B 4GLYA 1ARBA 2TPIZ 1ANEA 1W11U 1UCYH 2P3TB 1UO6A 2A1DB 5TCCA 1K1PA 8KME2 3S0NA 1XUJA 3EA8A 5C67A 1QRXA 1AUJA 1ELAA 4O97A 2ZWLH 4JZEH 1J14A 1C5UA 5FX5A 2TGTA 1SGCA 2XWBI 1MTNB 1AI8H 2Y81A 1L4ZA 2VB0A 1WBGB 2OC1A 3A81A 1O37A 1AD8H 4IN2A 2ZTZA 1PYTD 1FIWA 2VIVA 1HAPH 4KTUA 2Y6TA 5FXLA 1C5WB 5A8ZA 1INCA 1RTLA 1AU8A 1C4U2 4DY7B 1A0HB 1BZXE 1SQTA 2HWLB 1DM4B 1MKWH 2VH6A 1NC6A 1YC0A 4X2WA 4AB8A 1AZZA 2D8WA 2FESH 4X1SU 3LDXH 1NU9A 2J4IA 1W12U 1ZHMA 4TWWA 1FONA 2AGIX 4MDSA 1J17T 4ZHMU 3LH1A 1O32A 1QHRB 4XDEA 1LTOA 1CA8B 3SUGA 3GY5A 2LPRA 2D26C 1SOTA 3LGTA 3NZIA 1O5DH 2V6NA 1BTHH 1ACBE 3BG4C 2D2DA 4Q7YA 1EQ9A 3RLYH 1SHHB 2XW9A 1YF4A 1ZZZA 3TIUA 3FANA 1GCTB 2I6SA 3O8RA 1HBTH 1FY5A 3PO1B 4ABHA 3P95A 3RXKA 2YOLA 4B2BA 3RXIA 2DE9A 5DKMA 1ZSKA 5HXFA 3RXPA 2H5DA 1KLIH 1K28D 1NZQH 2FOAA 2GCHF 3LC3A 1GI7B 3VGCB 1QIXB 3QTVH 5DPAA 3H5CB 1TX7A 3KL6A 5GDSH 3AASA 3DUXH 4B2CA 2VWNA 2ZHEH 4GAWA 1C5NH 4WH8A 1MD8A 2BZ6H 4E05H 4CRBA 2TGPZ 1ZPBA 1H8IH 3LJJA 2IJOB 4HGCA 1QR3E 3RM0H 3RM2H 5EOKA 2M5TA 1ETRH 1W13U 3MFJA 1QBOA 1EJNA 3E1XB 2NU2E 1QB6A 2ALVA 5FX6A 1G30B 2OTVA 3I29A 1KXFA 2A2QH 3CS7A 3ZV9A 3A85A 5IYTA 1GMDF 5JBCS 5JB9S 2WINI 1Y59T 1Y3YA 1THPB 1AO5A 1GDQA 3A89A 4B1TA 1VGCC 3MMGA 4MG3A 3RMMH 1KXBA 3IITA 1O2PA 1F2SE 4MPWA 2F9NA 2W7SA 1O2GH 1YLCA 4E7RG 4VGCC 3BEIB 5FCRA 2PLXA 1O3MA 3L33A 1ZOMA 5C5OA 3VB6A 1SQOA 2ZHWH 1C5XB 1WCZA 1C5PA 2V3HH 3U9AH 2Y5FA 5H4IB 3V7TA 1O3HA 3SU5A 1O31A 2ZHFH 2ZU1A 1O2LA 1C2FA 3E3TA 9LPRA 2FI4E 2GMTC 2BXUH 1AB9B 1O2RA 1MKXK 2OC7A 5E8EH 1QCPA 1TAWA 1THSH 2WPHS 3ITIA 1ZGIA 1GHZA 1YPKH 3NKKA 1C5LH 1S5SA 3BTEE 3T2NA 5JBAS 3MNBA 3ZZ3A 1O2ZA 3SGAE 4H4FA 1Z71A 1UTMA 1YYY1 5E2PA 2GGVB 2VWMA 3SORA 4X8UH 2QY0B 4GVUA 1W7GH 3NPSA 4HFPB 4U01A 2BM2A 2CHAC 4I8GA 1OYTH 4UFGH 2ZPRA 1KTTB 2BHGA 1XVOA 4U32A 5DGJA 1MTUA 1AN1E 1HV7A 4UFFH 2GKVE 4A1XA 1NS3A 1HXFH 2WPKS 4UDWH 1P9UA 1W7XH 5JBTA 3Q3XA 5FAHA 1OWJA 2F3CE 2BOKA 4NZQA 1V2QT 4B73A 1AKSB 1VCQA 2SGAA 3V3MA 1BTZA 1ORFA 3LOXA 3URDA 2JETC 3BEFB 2VINA 1O2NA 4YLQH 4CRGA 1HJ8A 3UTUH 1V2OT 5FCKA 1GGDC 1DXPA 1CA0B 1LVYA 1AFQC 3BIVH 1V2ST 1GJ5H 2GZ9A 3PMAB 1BJVA 1NN6A 1HRTH 2ILNA 5DG6A 1CHGA 1SGQE 4WWYA 1XXFA 1G37A 4ABIA 3RU4D 4D9RA 1GVKB 5EXMA 3KN2A 2VIOA 1BBRH 2EA3A 1OSSA 5FBEA 3E0PB 1DANH 1EB2A 2OP9A 1T8OA 3FP6E 1O39A 2BLWA 3BV9B 3FFGA 4WMFA 1NM6A 3SI4H 5EXLA 1S83A 2BLOA 3MWIU 3SU3A 2H6MA 4BTTB 1P06A 2PSYA 3TNSA 4Y10E 1GJCB 3LGUA 1TBZH 4Y8XA 1TX6A 1GJ8B 5K7RA 2PKAB 7GCHF 3K6YA 4AG2A 3PTNA 1GCDA 1FY4A 1Y3XA 1EB1H 3ZZ5A 2SGFE 1MD7A 4MQAA 2QCYA 1OYQA 2B9LA 5CHAB 1GBTA 4BAQB 1FQ3A 3FP7E 3G01A 2UUJB 4MPVA 1GBMA 1ANDA 1AIXH 3PLKA 1GL1A 2FWWA 1BA8B 1C4Y2 1EJMA 1G32B 2UUKB 3ENSB 1AWHB 3DHKH 3S9AA 3SU2A 2BQWB 3TH4H 1O2HA 1L2EA 4X8TH 3A7ZA 1HFDA 4X0WU 4BOHA 1QJ7B 5C1XA 1GBKA 1GBLA 4U2WA 1GL0E 2BB4A 1QBNA 1DVAH 2ZFQH 4HTCH 1DLKB 1IAUA 2QXJA 3MU5A 1UTKA 1PPZA 2XWAA 3MH4A 4FUGA 4UE7H 4IN1A 5CE1A 2GD4B 3VB7A 3SNDA 5AF9H 1TGCA 1GDUA 1FV9A 3DFLA 1QB9A 1D3QB 2BQ7B 1EUFA 2Z3CA 3GDUA 3DD2H 4Y7BA 4ISLA 3MOCA 1BTYA 3BTFE 2QXHA 1DY9A 2PWXA 1OS8A 1W0ZU 1ZJDA 1CHOF 1GJ7B 1LVBA 2QIQA 4RKJB 4I31A 1Y3UA 4WMDA 3KF2A 4ZXXH 4FUCA 4DGJA 5DP7A 1SGNE 1AGJA 2NU1E 4KGAA 3M5NA 4R8TB 3A83A 3UQVA 1AZ8A 3OTJE 2RA3A 1P2KA 4NZLA 1H1BA 1Z1JA 1C5TA 1K1MA 1SMFE 3TITA 1T4UH 1LVOA 3LGYA 2PSXA 1DY8A 4MPUA 2BDIA 3TK9A 4GHTA 2G4UA 1PQAA 1LCYA 5EW2H 3HKIB 1TMBH 1YCPH 2IPHA 3NCLA 1EXFA 2BDYA 1TRNA 1OP0A 5T6GA 1G3EA 4THNH 1LPZB 2V0BA 2FOFA 3T26A 2VWLA 2P95A 2FTLE 2VGCC 3P17H 2Z9GA 4UONA 3L6PA 2Z9KA 3SJKA 4TPYA 3RXMA 1KDQA 1DDJA 1O2VA 4Q2KA 4JK5A 5EXNA 2ZQ2A 2F9PA 7ESTE 3AVZA 2J34A 1ELDE 5JPMH 3QZQA 2CMYA 1HAGE 3SUEA 3BTWE 3M36A 3VPKA 2P59A 2A2XH 1O3KA 1F5LA 4UFEH 1MU6B 1BIOA 4OS6A 3TH2H 1BCUH 2FOHA 2WPJS 3OX7U 2FP7B 1EAWA 1Y3VA 3ZZ9A 1SPJA 4J2YB 3KQBA 2F9VA 4X2YA 1LPGB 1A0JA 1GBJA 2A4GA 2QF3A 4UFDH 4OGYA 3PTBA 2A5KA 3SJ9A 1HDTH 1ELVA 4FUIA 1XKAC 1DWEH 3K9XB 2PKSB 2V3OH 5L6NH 3ZZ8A 2FIRH 4DJZB 3UUZA 3RDZA 1XUKA 3P8GA 2VVCA 1RXPA 3A80A 3UOUA 4CRFA 1G3CA 1LHFH 1NY22 3T62A 1T31A 2ZDVH 1YPHC 2FI5E 2QXIA 4BANB 3W95A 4I8KA 2J2UA 2BY5X 2FTMA 3SV2H 3LPRA 3E91A 3PWCA 2GDEH 3RXAA 3MO3A 1NRPH 1C1VH 2BDGA 3BF6H 2ZG0H 1GMHG 2QV1A 2A32A 1PYTC 4MTBA 2HLCA 1LHEH 3RXFA 1EATA 3E16B 1M9UA 2O8LA 5A0CA 1O30A 1OPHB 3MH6A 1J16A 5F6MA 3LONA 4AYYB 4SGAE 1GBDA 2R0LA 2ZU5A 2XBWA 1C5YB 1CT2E 1VCWA 1DITH 3JZ2B 3M37A 1BJUA 1PPHE 1BMLA 1BTWA 5GCHF 1S6HA 1QB1A 2Z9JA 1B5GH 1KYNA 1HAYB 1HIAB 2BD4A 2ZF0H 4DIHH 4CBOA 3VFEA 3M7UA 2EEKA 1C2GA 2A7CA 2EI7A 4NWKA 5A8YA 5SGAE 3GICB 1JRTA 1FAXA 1L4DA 5HGGA 1A5IA 3S9BA 4NSVA 1GDNA 2P8OC 1ZSJA 1ZTKA 2TIOA 2AMPA 3UWJH 1FPHH 3QWCH 2WPIS 1CO7E 3F9GA 3SZNA 2W3IA 1B0EA 3R0FA 3EA9A 4IGDA 3TVJB 2UUYA 8LPRA 5FHTA 3SU4A 1SQAA 3BTKE 4BAKB 3UFAA 3A86A 1V2JT 5EODA 4F49A 3OYPA 5FPYA 4D7GA 2CF8H 2CGAA 1GJ9B 3T29A 2A45B 1A46H 3VB3A 2FOEA 2IOTA 3TJVA 5AFZH 1JXPA 2FEQH 4ABJA 1BHXB 1Z1IA 2OUAA 1SGPE 2GTBA 1MUEB 1MBMA 3GCHB 2ZU4A 1GBBA 3AW0A 1OWIA 1TX8A 3ATWA 2FMJA 2CV3A 2KAIA 2VU8E 1K1IA 1EAUA 1ELCA 1RIWC 1LKAA 1QFKH 1YBWA 2IN2A 5GPIB 1TRMA 5T3HA 1SGTA 2Z6BD 1K9OE 4BXSA 1GHBF 1RGQA 3GY2A 2R2WU 1ZSLA 3SOSA 6GCHF 3K6ZA 4OS5A 3ODFA 2P94A 1PQ7A 2JH0D 1FY8E 2J38A 1F5RA 8GCHF 3EA7A 2A31A 2A4OA 4YT7H 3T5FH 1GHXH 1O3EA 1V2PT 4NFEA 5A0AE 2W3KA 1O2OA 2GX4A 5C20A 3ATIA 1ETSH 4Y8ZA 3PMJA 1SLVB 4NA7A 2WPMS 3TGJE 4ABFA 4NA8A 5K0HA 4WXIA 1CSOE 3MI4A 1LHDH 2C8WB 1TNKA 3ZZCA 4RKOB 4ABEA 2ZU2A 2GCHG 2Y7XA 1SSXA 1D9IA 1H9LB 4ZUHA 3A7WA 1WOFA 3E8LA 1O2JA 1IQKA 1P9SA 2HRVA 3KQCA 4KP0A 2GZ8A 3ZVEA 1F0UA 1SGEE 4O3TA 2FOBA 3N7OA 3KCGH 1O3CA 1N8OC 1CGJE 1JIMA 1ID5H 1TE0A 1YCPM 1FIZA 1CU1A 6CHAB 1QJ6B 3CP7A 5JBBS 3O8DA 1LDTT 2BOHB 1NFUA 1EP6A 1HXEH 1KXDA 4H42U 1FY3A 2BVXH 2O9QA 4MNWA 3BEUA 5EQSA 1Z8RA 3ZYDA 3P92A 1UVTH 2HPQH 3EDXB 1XXDA 1ZHPA 1HCGA 3ATKA 4KKDA 1GMDG 4K8YA 1D6WA 2ZP0H 2XBVA 2SGQE 1ZLRA 1OOKB 3A8AA 1VITF 4GHQA 5PTPA 3SNEA 5L2ZH 4ABBA 1HJAB 1UVOA 4J1YA 3BTGE 5EQRA 5BPEA 3ZYEA 4TY6A 1VZQH 4B76A 4DIIH 4FUBA 1CGHA 5DJ7A 4AFZA 5HM9A 1HYLA 1G2LA 1P03A 4JZDH 5I25A 2QAAA 3RXHA 1AUTC 1TGTA 3PM3A 1Y5AT 4K1TA 3HK6B 2FO9A 1MH0A 6LPRA 3ZVGA 1ABIH 4B74A 3EAJA 3RC5A 3S69A 2QC2A 2C8YB 3ODDA 3STIA 4TYDA 1QBVH 2SGPE 4INKA 4ZKSU 4CHAB 1TNIA 1G3BA 1GG6C 4Z0KA 2AEIH 4IS5A 2EI8A 1DICA 1V2VT 4D76A 2Z3DA 4WF8A 2F9UA 4DVAU 1S82A 1IQMA 5E0HA 2ASUB 2FOCA 1C5OH 3HKJB 4AFUA 1DXWA 4K2YA 2F91A 4CH8B 3QO6A 1SB1H 1IQEA 4X8SH 3RXQA 1UMAH 2ZPQA 3JZ1B 2GT8A 1GHYH 2ODPA 3QX5H 4ABDA 3MTYA 3RP2A 2P93A 1QNJA 1VJ9U 1DWDH 4X6PA 2PUXB 3QUMP 4CRAA 1S0RA 2R9PA 2G5NA 4LZ1H 1HAXB 4FUJA 1BTPA 2HNTE 2ZFRH 2I6QA 3LGVA 3U1IB 3UREA 1PQ8A 2ZDAH 2Z9LA 1F7ZA 4AGJA 1V2WT 1G9IE 1QA7A 1GHAF 4DG4A 3PB1E 2G5VA 1ZMJA 4Y11E 3MH5A 1YGCH 2ZGCA 1TALA 1A7SA 3RXDA 2BY8X 1O5GH 3RXTA 3M5MA 1O3DA 3SU6A 1TGSZ 4I8HA 2HGTH 2BX3A 1GI2A 5G4BA 1SVPA