2FTMA

Crystal structure of trypsin complexed with the bpti variant (tyr35->gly)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rigidification of a Flexible Protease Inhibitor Variant upon Binding to Trypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 56
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ftmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ftmA02
2OC1A 1CHOF 5HGGA 1EPTA 2FYQA 6ESTA 1O39A 4XSKU 2WPHS 3BV9B 2RA0A 1EJNA 1UTPA 3ZZ3A 2QXGA 1WUNH 1K28D 1FY8E 1OXGA 6CHAB 2XCNA 4UFGH 5E8EH 1GMHF 3UPEA 2QXHA 1QRZA 1DT2A 1S0RA 2RA3A 1A5GH 1ETRH 2J94A 4TY6A 4Y71A 1RIWC 2FOAA 3E3TA 1SGQE 3EGKH 4GLYA 4OS1A 1VITG 2A4QA 1PPEE 1S85A 3DFJA 1TNKA 2AEIH 2GZ9A 3TNSA 3ITIA 4U30A 2LPRA 1ZMJA 2FYRA 3VXEH 1PYTD 1GBHA 3UQVA 1AE8H 2H5DA 3LC3A 4CRGA 4OS2A 3S9CA 3QO6A 1TQ7B 2PR3A 2OC7A 1GI1A 4B74A 2PTCE 1BT7A 3GY5A 2IJOB 1J9CH 2UUKB 3RXFA 3S9AA 2EC9H 1GVZA 4WMFA 3OX7U 5T6DA 1GG6C 3T28A 1E34B 4LOYH 2CN0H 3GY3A 3RXJA 2FOCA 1ELBA 1GBLA 1ANDA 3A85A 2UWLA 2ZU1A 4K69A 4M7GA 5E2PA 2M5TA 5L6NH 1W13U 1L1GA 1GHAG 1SGCA 2ODYB 4ASHA 1P2KA 3TGKE 3ZZ6A 2D1JA 1OX1A 1GJ8B 3Q00A 3BTHE 8GCHF 1C5VA 1NRQH 3ZZ8A 1TNIA 3SU2A 3M36A 4WMDA 1DY9A 1HAVB 4JMYA 2ASUB 1SC8U 1F5RA 2ZFPH 3E6PH 4CR5A 4FU8A 1EZQA 1QL8A 4D7GA 5DP9A 5EPYA 1AVXA 4SGAE 2BDBA 2FLRH 3BG4C 3F9EA 1HB0B 1OSSA 3H7OA 5JBTA 1GVKB 2C4FH 4ABHA 4FUJA 1CA0C 1D6RA 1JIMA 1F2SE 1QBVH 1A4WH 4YM9A 1BIOA 7ESTE 3U8TH 1KY9A 1VITH 1QCPA 2BVSH 4ZHLU 1S84A 1DLEA 1NRRH 3ZZDA 1V2VT 1P57B 1GGDC 1ESTA 3E8LA 2BLOA 1ACBE 2J38A 3PWCA 1O5BB 1GBIA 2A1DB 4AYYB 1FAXA 1OWKA 4ABBA 3NUMA 3VPKA 1TONA 4NFFA 3KNXA 1FMGA 1K1MA 1L1JA 2GVFA 3RXSA 1BDAA 1X7AC 3QX5H 2FWWA 1QIXB 3LJOA 3QN7A 3SJIA 1KSNA 1CSOE 1FUJA 3HK3B 5LPRA 2TGPZ 4JK5A 3S69A 4AB9A 1IQLA 2WYJA 3K6ZA 1P9UA 4WH8A 1G3DA 4Z0KA 3KL6A 3U69H 2CGAA 1JWTA 4NIVA 1C1OA 3O8RA 4TWYA 1MUEB 1O3GA 2WPLS 2Z3DA 3G01A 1LHEH 2ZO3H 3EE0B 1YPKH 1DDJA 3N7OA 3RXPA 3SQEE 1GG6B 4B2AA 1C1QA 1THSH 1A7SA 3HK6B 5FAHA 3GCHC 1C1PA 3P92A 3A82A 4FUCA 2SFAA 3MH7A 1VGCB 1Y3UA 4BAQB 1EPTC 2A4RA 2ZF0H 5JBBS 1LCYA 1QNJA 2PKSB 5HM2A 1NPMA 1SG8B 3D65E 3VB4A 1C5YB 1GCTB 2AS9A 4JYVH 3LGIA 1S0QA 1DX5M 2AIPA 5A8ZA 1TMTH 2FX6A 2G00A 3M61U 4UDWH 3SI4H 3V13A 3WY8A 3KHVA 1W0YH 1TGCA 2HOBA 4K1EA 4YOIA 2IPHA 1DSUA 1DPOA 2BDIA 3ZZBA 1Z6JH 4AFUA 2A2XH 3EQ0H 1F92A 1GI8B 1GJ7B 3W95A 1GBFA 1O33A 4YOJA 1EAUA 3NKKA 1AB9B 2ZDAH 1BTPA 2F9VA 4GAWA 2G4UA 1ZJDA 4I8LA 1Z7KA 1TOCB 3UNSA 1W7GH 1DWBH 4UFDH 4Q7ZA 2ZC9H 1DXWA 3F9FA 1O2QA 1FN6A 1ZJKA 1H8IH 3S7HB 1P2MA 3LDXH 1NTPA 2VGCB 1ELDE 3KGPA 1SOZA 3GCHB 1O36A 1O5AB 3SNAA 4HGCA 2XC0A 4IN2A 2CHAC 2FO9A 1GMDF 3SI3H 1CA8B 5C3NA 1ZSLA 1M9UA 4AGJA 1EATA 1C1VH 1H9LB 1HV7A 1V2RT 2HALA 3DT0H 1GMCG 1W0ZU 1MAXA 2VWOA 1AZZA 2OBOA 1EOLA 1ZHRA 1BTXA 2PSXA 4ZXYH 1UTKA 2ZEBA 3DHKH 2TGAA 2ZHWH 1MZDA 2FOGA 3AVZA 4DVAU 2VINA 1MZAA 2SGAA 2BVXH 1OOKB 3LT3A 1V2ST 4Y79A 1DWDH 1YPHE 1TMUH 2OXSA 3OY5U 1SFQB 2FLBH 2BXTH 4Y8YA 3ZV9A 1XVOA 1GJAB 1KXBA 2HNTE 2OD3B 2GDEH 4ISHH 1MTNC 1DXPA 1NM6A 1O3DA 2O9QA 2STBE 1K1PA 4B2CA 3LKWA 4K3JA 3SNDA 4HTCH 1TIOA 2ZPRA 2GMTB 1V2UT 1JRTA 3O8BA 4NIYA 4Q7YA 2PUXB 5A0CA 3M7QA 4I33A 1Y5BT 3BEIB 5FCRA 4WMEA 4K1TA 5DJ7A 2GX4A 5F03A 1GBJA 3T25A 1BJVA 2ZZUH 2AGGX 1UK4A 4AG2A 1YLDA 2PUQH 2GGVB 4AYVB 1SGYE 3MO6A 1F5LA 1GHZA 1O2SA 1C9PA 1RJXB 3UTUH 4ZXXH 4ZKOU 5K7RA 4B71A 1EB1H 3UQOA 1T7CA 3RMNH 1KDQA 1TB6H 2J95A 3PMAB 1BHXB 1TBZH 1TNLA 4UD9H 2AIQA 2FESH 4GCHG 4X1RU 4SGBE 4NZLA 4KELA 2GT8A 2J92A 4NZQA 3ZVAA 4F4OC 1GBBA 1Z6EA 4NWLA 2A4GA 5C5OA 1O35A 3GYLB 5C1YA 4KGAA 2C8XB 3E1XB 4NA7A 2G8TA 4AFSA 2Q6DA 5LGOA 1AGJA 2ZFQH 1QHRB 1PYTC 5FHTA 2BD9A 5EU8A 1UK3A 5JBAS 1TX8A 4ZH8A 4MNWA 1SPJA 2BLWA 2ODPA 1TX7A 4DG4A 5HMAA 2OP9A 2BLQA 4TY7A 1ZPBA 1PQ8A 2ZU2A 4WJG2 1ZPZA 4I31A 1XX9A 3GCOA 2GV7A 2IN2A 1HRTH 7GCHF 4IMZA 1YPJH 3T2NA 1SB1H 4ESTE 3QLPH 1GCTC 3RC5A 1ESAA 1UTQA 2A32A 1AZ8A 1ZHPA 3HGPA 1RIWB 1C1SA 2GCTC 1O5EH 5AVDA 1C2IA 1SL3A 1OWIA 1XUJA 4DCDA 1OKXA 1C5LH 4WH6A 1AKSB 1PQ5A 1GMDG 3GCNA 2G5NA 2PTNA 1O2PA 3ATMA 2QV1A 4JZEH 1FXYA 4O9VA 2QF0A 1LKAA 1QB9A 1UVUH 3D62A 3I78A 1LDTT 1IQHA 4FXGH 1P8VC 1VITF 3LONA 3UREA 1B0FA 2FI5E 5JDUB 2UUJB 1YM0A 3TK9A 2GP9B 3PWBA 1C5QA 4IN1A 2Z9KA 3BTDE 3VGCB 3DA9B 5C67A 2XC4A 1DLKB 5DGJA 2FOEA 2AYWA 2B9LA 4BTTB 1W3CA 3HPTB 4D9QA 2ANMH 4JZFH 1C5WB 1HAYB 1N8OC 3V7TA 3FP6E 1PPHE 3KN2A 1C2KA 1BRBE 3UOPA 1HAXB 2BB4A 1G32B 1G2MA 1N8OB 1ABIH 3TNTA 1HAOH 4XE4A 5DP8A 5C5NA 2C3SA 1LVOA 4YTAA 1TNJA 2BY8X 1BB0B 1VZQH 4THNH 1WQVH 3VXFH 1UO6A 1DUEA 3BTWE 3SUEA 3SJ9A 1FAKH 2ZG0H 1IHTH 3O8DA 1NRSH 1HIAA 1SGIB 1MH0A 1P0SH 4WWYA 2B0FA 3UR9A 1BMLA 1XXFA 4LK4A 1DANH 5FBIA 3SU0A 2BDGA 2R0KA 4A6LA 1NO9H 2AGEX 2P59A 3ODDA 3RXGA 1G3BA 3B23B 1IAUA 1J8AA 1TA6A 1AVWA 3QTOH 3A88A 1ZR0A 3TGIE 3PB1E 3SOSA 4A7IB 2XXLA 1ETSH 4MPUA 1BMAA 3BN9A 1C1RA 5GWZA 2Y82A 2J4IA 1HNEE 1CVWH 3RM2H 3V12A 4AOQA 3UY9A 2A31A 1G9IE 1RRKA 4FUBA 2W7SA 3STIA 1YBWA 2P8OC 2G52A 1K1NA 1F5KU 5EQQA 1CBWC 1DFPA 1A0HB 1QFKH 1DWEH 4DT7B 1TPSA 3E90B 4IGDA 4MPXA 3EAJA 1RTLA 5E0JA 2Z9IA 3HKJB 2QAAA 1OYTH 3RC6A 1O2GH 4I8KA 1CT4E 2H5CA 4JK6A 3MMGA 2HNTC 5J4QA 1A3BH 2EI6A 1LPZB 1EUFA 1O2NA 5BPEA 1C2MA 2ILNA 2W7UA 1G36A 1KXDA 3HATH 3GISB 1BRUP 1EASA 1DOJA 2CXVA 8KME2 4ZHMU 3DUXH 3E0NB 1QBOA 2QGRA 3RU4T 1GJ4H 1C5UA 3EA9A 3PMBB 1O3CA 3EDXB 2QYIA 2ZGCA 1O30A 3TH2H 1C2JA 4O97A 4JZDH 1CGHA 2ZDVH 2XYAA 2EEKA 3B9FH 1E38B 1K21H 2Y6TA 3RXCA 5JB9S 1HPGA 2F9PA 2BY5X 1C5OH 3FANA 5L2YH 4CRDA 2PSYA 4BANB 3GDSA 4LZ4B 1O5FH 3BF6H 1AKSA 4Y0YE 2Y81A 4E05H 2VIDA 1P11E 2O8TA 3NZIA 3RMMH 1O2XA 2GTBA 2H9HA 2OUAA 3M7TA 3EYDA 4AX9H 1EZSC 5DKMA 1TX6A 5DP4A 3A87A 4B1TA 1T4UH 3K65B 3SZNA 5FCKA 2JH5D 1OP0A 2ZU4A 5IDKA 4BTIB 1XUFA 3KQCA 1TGTA 1LQDB 1C2DA 3BTME 5EODA 5EW2H 3ZYEA 4U32A 1MCTA 2WUBA 1PPZA 1EB2A 4AG1A 1JOUB 3GDUA 3ZZAA 1MQ5A 3SUDA 2Q6GA 1HYLA 4FUFA 4X2VA 3H7TA 2I6QA 3VGCC 1IQJA 3ZVFA 1HAPH 1P2OA 1O3HA 2PFEA 2A45B 4GPGA 1NFYA 3A83A 3E16B 2OQUA 3P8NA 1EXFA 3TGJE 2QA9E 3RXRA 3RXTA 5AFYH 2G55A 1UTLM 3S7KB 2V0BA 2C8YB 8GCHG 1O3PB 2ZCKP 2SGDE 2BZ6H 2TPIZ 1G2LA 4O3UA 5DO4H 1O31A 4D76A 1F0TA 3L3TA 1TRMA 4NFEA 2JKHA 3A8DA 1NRNH 1PPBH 1BTYA 2NU0E 2HPQH 2W3KA 4Q2KA 3BEFB 1CBWB 1AWHB 4BNRA 1HCGA 5AFZH 2XW9A 2ODQA 3HKIB 2Z3CA 3R0FA 1NFXA 5LH8A 2HVXA 1GHYH 2ZU3A 1P2IA 2SNWA 5DG6A 4D9RA 1RTKA 1SHYA 5TCCA 5L30H 4X1NU 1C2GA 4X1PU 1MBMA 1UVPA 2GMTC 2JETC 4KTUA 1HAVA 3SUFA 3RXLA 1FY4A 3SHAH 3MNCA 2DE8A 1ZYOA 2FTMA 4NA9H 4NGAH 4B76A 1LHFH 3M3SA 1BTWA 1UTJA 1C4V2 1IQGA 5FBEA 1MTNB 1O38A 2ZGHA 1MAYA 1XVMA 2OLGA 4DIIH 1L4DA 3FVFB 3ATWA 4F49A 1AHTH 1SHHB 1PPGE 2FOHA 1UTMA 3PROA 1KXAA 2BOKA 1ZSJA 3ZZ7A 2AMDA 5K0HA 2ZECA 3SJOA 2Z7FE 4WXIA 5HXFA 5FPSA 3LU9B 1V6DA 1EAIA 1FPCH 4NSVA 2VH0A 4OS7A 1O2YA 1KTSB 1UVOA 5LPFA 2VVVA 3BTEE 3SBKA 3FZDA 3T26A 1GJBB 2BY6X 3TH4H 1GBMA 3ZVBA 1SGRE 3S0NA 2XBVA 2ANYA 1G30B 1ZTJA 4X1QU 1RTFB 4K5ZA 1P2JA 1O2TA 1SOTA 1TNHA 3TJVA 3RXDA 2FZZA 3CS0A 2R0LA 3LJJA 1C4Y2 4RN6A 4OGXA 1XKAC 2EA3A 4CRAA 4OS6A 1MTVA 3C27B 4CR9A 4AN7A 1LTOA 2TBSA 3SV2H 4Q80A 1YKTA 3IITA 3RLYH 4XBBA 3UUZA 3F1SB 1ANCA 5B6OA 1XUIA 1UJ1A 4NIWA 1MKWK 1SQOA 4A1VA 1O0DH 1A3EH 2QN5T 1P12E 4MDSA 1V2QT 4HI3A 1GI3A 4A5TS 1BZXE 1OWEA 1QL7A 1XUKA 4BXWA 5BRRE 2OQ5A 1MBQA 1Z8RA 1RFNA 2BD8A 4IC6A 3PO1C 4CBOA 3OTJE 1K1JA 2EI8A 2ZGXH 1O2MA 1FV9A 1K1OA 1EAWA 1VGCC 1PJPA 4Y7AA 4PROA 4BAHB 1GGDB 1GDQA 2F9OA 2R9PA 3TJNA 2GCTB 1FIWA 3SU6A 1O3JA 2VIPA 5GIBA 1GBTA 1MKXK 1TMBH 1LVYA 1WSSH 3Q3XA 1FNIA 4BAOB 1V2TT 1QGFA 5FXLA 3SV7A 4INHA 1QB1A 2A2QH 1TQ0B 1GHBG 2H6MA 5E0GA 2R2MB 3Q76A 4CREA 4E06H 2QC2A 1H9HE 1C5NH 2JH0D 4Y8XA 4NCYA 4IW4E 5T6FA 3ZZ5A 3AAUA 1KTTB 1S5SA 5EPNA 3UFAA 1BBRE 4CRCA 4Y76A 3SO3A 3P8FA 4INKA 3EA8A 1S81A 1TYNA 1G3CA 1EAXA 1VJ9U 3FP7E 3IG6B 2ZPQA 3PM3A 3ELAH 4NWKA 1XKBC 3NK8A 1V2WT 3SV9A 1GL1A 1O5GH 4X6MA 1DITH 2BY7X 3F6UH 1TGNA 2BDYA 1BRAA 3PMHB 3SN8A 3STJA 2GCHG 3F9HA 3CS7A 1Y3VA 1GWAA 2RG3A 5AHGH 3P17H 4JYTA 2ANWA 5CHAB 2H9EH 2JH6D 4Y10E 3SNBA 1TBQH 2BLVA 1FZZA 1O3AA 1LQEA 1HAZB 1ELVA 4R0IA 1QURH 1WQSA 2XNIA 2ZU5A 4XFQA 6CHAC 2ZHDA 4K8YA 3AW0A 4RKOB 1UMAH 3SORA 3PTNA 3A8CA 1LHGH 3PO1B 3M35A 1ELFA 5JPMH 4ZKRU 4BAMB 2P3FH 3RXOA 1V2KT 1QRXA 5GDSH 4AORA 1V2NT 3SHCH 5EOKA 3F68H 1P2NA 1IQEA 3OU0A 5T3HA 3SJKA 2P8OB 4NA8A 3T29A 1KIGH 3JZ2B 4X6OA 1GHVH 1LVBA 3MNBA 4Q7XA 5C1XA 3ZYDA 1A61H 1HAGE 2K1QA 2VWMA 1S83A 3QTVH 1TAWA 4XBDA 5F8ZA 5DK1A 1C2HA 1K1IA 1LKBA 1MKXH 2A7HA 2H9TH 4KTCA 2ZP0H 4OS4A 4DOQA 1ZTKA 1CGIE 1GHXH 2FODA 4MNXA 2ZQ1A 1ARCA 5I46H 4X8SH 1AB9C 3NCLA 4ISLA 4Y6DA 2W5EA 2HNTF 4MPWA 2F83A 4MLFB 1SSXA 1T8LA 1FJSA 1GJ5H 3U1JB 3ZVCA 3A8AA 1YCPH 1JRSA 1S6FA 1UVTH 2HWLB 1AUTC 3LGUA 1QJ6B 4HFPB 4IBLH 1O2HA 1TWXB 4H42U 5EG4A 1NC6A 1VR1H 4U2WA 1GJDB 4MTBA 4UONA 1Y3YA 3BIVH 1F7ZA 2FIRH 1EZXC 4FUDA 5EXMA 1UTNA 2BQ7B 4CHAB 3BTQE 1BMMH 2DE9A 1P05A 1W14U 2THFB 3QGJA 1EX3A 8LPRA 2KAIB 5ESBA 1C1WH 2ESTE 3RMLH 3MFJA 2C93B 5F6MA 7KMEH 3O8CA 1NFWA 4DGJA 5GPIB 5A8XA 2BD7A 1SLVB 1V2JT 2GZ7A 1ELAA 1AD8H 1J15A 2QY0B 1IOEA 2FXRA 1A1RA 1SQAA 3GDVA 1GI7B 1Z1IA 2ZGJA 3OY6U 5EXLA 1SGFA 2BYAX 1O2KA 9ESTA 1YPHC 2SGQE 4OGYA 1DWCH 1SMFE 4HZHA 4BAKB 3PYHA 2Y5FA 3MO3A 2H2ZA 5FPYA 5JBCS 1BRCE 2FM2A 1BJUA 3U98H 2QXIA 3PLPA 1FY3A 3M5MA 1FN8A 1GI2A 3AASA 3BIUH 4XDEA 1C9TA 1BTHH 1ZTLA 3VB6A 2O8WA 4VGCB 1ZMLA 1QRWA 2H1UA 1O3BA 3OSYA 1P3CA 2JETB 2F9BH 5EGMA 2VB0A 3B8JA 2AERH 4NSYA 1DY8A 4DW2U 5JB8S 1RGQA 1NS3A 1SFIA 2FPZA 3GICB 4R8TB 3TPIZ 3A89A 1IQKA 3BTKE 4AGKA 1C1NA 1KDQB 1EPTB 1K2I1 1O3NA 4E7RG 2PHBA 3NXPA 1HJAC 2BTCE 1ZGIA 2FEQH 3A81A 4ABEA 3P8GA 4Z6AH 2FMJA 5E0HA 6LPRA 3FFGA 1SGPE 4I32A 3TLOA 1SGDE 1QBNA 1AFQC 1C2FA 1O34A 4GUXA 2ZDMA 1MU6B 2XTTB 3SU1A 3P70B 2G5VA 1O2JA 3KIDU 1O3FA 2A5KA 2SGFE 1CO7E 1GMCF 1CGJE 3BG8A 3LH3A 1WTGH 5TJXA 4ZROA 1O5CB 1BMNH 1JIRA 2Z6BD 1MQ6A 3P8OA 3VB7A 1B7XB 1UHBA 1ZRBA 1W7XH 1GBAA 1EZUC 1T32A 2OC0A 3A7TA 1FY5A 1QJ1B 3MU8A 5C2ZA 1Z71A 3UNRA 1J17T 1BBRH 3H5CB 3JZ1B 4VGCC 3KQBA 3P6ZB 4YO9A 3UNQA 1P10A 1YP9A 1CA0B 2XBXA 1SI5H 3T5FH 3MHWU 1UCYH 2D2DA 2FS8A 2ZHEH 5I25A 3SUGA 1K22H 3KQDA 3TVJB 5FPTA 2NU1E 4X0WU 3UIRA 1MD8A 4K2YA 3ZVDA 1GHWH 1H9IE 3LGWA 1HAHH 1A46H 1P06A 1HUTH 2QIQA 3PMJA 1AVGH 1GI6A 3M3VA 4ABGA 3RLWH 4FUEA 4H6TA 1RXPA 1SGNE 1O3IA 2R2WU 1OPHB 2QF3A 1L4ZA 1XXDA 1ZOMA 1AQ7A 1O2WA 1ZMNA 2ZDLA 1ELTA 2OBQA 1O2ZA 2ULLA 4AZ2B 2ZDKA 4Y11E 5A0BA 1AE5A 1FPHH 3DFLA 2ZNKH 3SQHE 2BQ6B 2C90B 3I29A 4YT6H 4BXSA 2ZFFH 2KAIA 1IQFA 1VCPA 5EW1H 3MU0A 1AFQB 3A8BA 3OYPA 2XRCA 3SV8A 6GCHG 1OWDA 2PGBB 1TOMH 3MU5A 2WV5A 1BQYA 1CT2E 2ZIQH 3TH3H 2HRVA 4WXVA 2WINI 1NZQH 2AMQA 5DP3A 4DJZB 3BTTE 2V3OH 2BD2A 3PTBA 4CRFA 2VH6A 4AFZA 1FQ3A 2VWNA 1D3PB 1P3EA 2TGDA 3LGVA 3RU4E 4B75A 2Y7XA 1HIAB 2ZGBH 2Z3EA 1P09A 2BDAA 2VIWA 1C5RA 1BCUH 1JXPA 2UUYA 1THRH 3PLBA 4GVUA 4X8UH 2HLCA 2FOMB 4ABJA 2ZI2H 1B0EA 1RS0A 1MD7A 4ABAA 1DSTA 3TU7H 1ZRKA 3MU1A 1HGTH 3QZRA 4I8JA 1FIZA 1ZPCA 4KP0A 4MNYA 1PQAA 1KXFA 2FOFA 3L6PA 1D3DB 1CHOG 1LHDH 1B5GH 1V2PT 1D3TB 2GV6A 2V6NA 2FP7B 2ZFSA 4DIHH 1WBGB 4AB8A 3BTGE 1HAIH 1RD3B 1LVMA 2ZHFH 4X2YA 3SGBE 4X8TH 1H8DH 1E0FD 1QA0A 2OINA 4NG9H 2ZQ2A 4TWWA 3UWJH 2F9NA 2VIVA 3RXBA 1SLWB 2GZ8A 5CMXH 4WF8A 1GHBF 1SR5C 4MG3A 1H1BA 2Y80A 1SGTA 1K9OE 2V3HH 1D3QB 3VB3A 2UUFB 1ZZZA 2O8LA 3BTFE 9LPRA 1PPCE 1G3EA 1L2EA 4IS5A 1ESBA 1J16A 2A7CA 4RKJB 5HYOA 1O2LA 3VFEA 1YGCH 4X8VH 1Q2WA 1HJ8A 1W10U 1CHGA 2Y5GA 1J14A 4TPIZ 1GPZA 2F91A 4CH2B 3RDZA 2GT7A 5GCHF 3RM0H 2AGIX 3QWCH 1FY1A 2J9NA 1DS2E 5PTPA 2CJIA 2ALVA 2Q6FA 3SNEA 1ZSKA 2ZCLP 3ESTA 1NRPH 2Y7ZA 2BHGA 2BX4A 2XWBI 5FX5A 3K2UA 1XMNB 2OC8A 1HLTH 1T8OA 2XBWA 1EQ9A 3FZZA 2WPIS 3M3TA 1LPGB 6GCHF 4MPVA 1Z8JB 4YESB 3RXHA 4IMQA 1CT0E 3TJOA 4ZKSU 1P2QA 2VIOA 2G4TA 1MTWA 2RDLA 4X2XA 1OYQA 3RXQA 1NESE 1AMHA 2ZDNA 5HM9A 5DP5A 3ZZCA 4NIXA 1BTUA 1YC0A 4X2WA 1MCVA 1TPOA 5F8TA 4GSOA 1A0LA 2Z9JA 2FI4E 3A86A 1P02A 1NN6A 5GJ4B 2YNAA 2VVCA 1MKWH 1C5XB 2J34A 3Q3KA 2WUCA 4YLUA 4AFQA 3DD2H 4UEHH 4JYUH 4O03A 4X1SU 1GI5A 2A5AA 3U8OH 4UFFH 7LPRA 1AWFH 3U9AH 1ANBA 1BBRK 1VCWA 4FUGA 1GI4A 2PKAB 2V35A 3ATKA 3RC4A 5T6GA 1WOFA 2XCFA 1CU1A 1DM4B 1HBTH 3ATIA 1EJMA 2NU2E 1C1UH 1THPB 4UFEH 1F0UA 3MO9A 1S6HA 1DUAA 3MNSA 3ZZ4A 4K60A 3MNXA 2A0QB 3U8RH 1BHXF 3RXVA 1XUGA 2P16A 4Y8ZA 3IWMA 1HFDA 4B73A 7GCHG 4ISNA 3AW1A 3VEQB 1YPGH 2BDCA 2VNTA 1L1NA 2LNCA 3RMOH 4KKDA 2NWNA 3RU4D 1O3LA 5ETXA 4B2BA 1A5HA 1IHSH 2R3UA 5DPAA 1MMJN 4WY3A 1FI8A 2P93A 1GDUA 3MOCA 1O2UA 1BTZA 5GCHG 2GDDA 2SNVA 5F8XA 1T8NA 2BD3A 3M5NA 4WVPE 3MH5A 2VIQA 1N1LA 5E2OA 3V3MA 1V2MT 1E35B 1D6WA 1ELGA 1GMHG 2AH4X 1TPPA 1HXEH 4IC5A 1Y5AT 3A84A 1AY6H 1IQNA 3T27A 5LPEA 2P95A 3D49H 1IQMA 2C8ZB 5L2ZH 1QB6A 4QT8C 4XBCA 4DY7B 3GY4A 1GI0A 1NU7B 3SNCA 2BVRH 1K1LA 2BZAA 1GBCA 5DP6A 1P9SA 5AF9H 2PW8H 3M37A 3ATLA 5FX6A 1MTUA 2ANKH 4UE7H 2FI3E 4ISIH 4TYDA 2PWXA 3MU4A 1O2OA 3SJ8A 3MYWA 2WPKS 3ZVEA 4H6SB 1NU9A 4JZ1A 1UTOA 5DP7A 1TGBA 3GY7A 2O8MA 1L0ZA 1OP8A 3FAOA 4FU9A 2Z9LA 2IOTA 3RUOA 3V0XA 4YT7H 5JYIA 3MWIU 2BDHA 1UK2A 3AAVA 2BX3A 1BOQA 1V2LT 2UWOA 2FTLE 3TK5A 1O3EA 1ORFA 1C5ZB 3MH6A 1E36B 2CHAB 3SGAE 2NU4E 1YPEH 2FDAA 3ENSB 1O3OA 2D8WA 1GJ6A 3LC5A 3BEUA 1YF4A 3GY2A 1TRNA 2WV4A 1ELCA 2PV9B 1ABJH 1GDNA 3ODFA 2ZTXA 2XBYA 3C1KA 1TALA 1YPLH 2UWPA 4CH8B 1Q3XA 3RXKA 5EXNA 3A7VA 2WYGA 4MQAA 3Q77A 1W11U 2XC5A 4LXBH 4BTUB 3SV6A 2ZTYA 1W8BH 4I8HA 2FS9A 3UWIA 1BA8B 3URDA 3SGQE 2QCYA 2ZFRH 5A09A 4CHAC 4ABFA 2SGPE 1PPFE 1Y8TA 1A0JA 4A92A 1LMWB 5EQSA 4INLA 1T4VH 3A7WA 1TBRH 2AMPA 4YOGA 1ZHMA 1CE5A 3MTYA 2WPMS 1HXFH 1KLJH 2A4OA 2W26A 2A7JA 2Y5HA 3SU3A 1S82A 1SBWA 1UCYE 1SQTA 1QJ7B 1ZLRA 2ZFTA 2ZTZA 1P04A 3S9BA 1NFUA 1BUIA 1C1MA 1ARBA 3A80A 1KLTA 3RXUA 2Z94A 3KEEA 3EA7A 1MU8B 1Y59T 3GY6A 1DICA 3E91A 8ESTE 3VB5A 4ZMAH 2ZA5A 5A0AE 4ABIA 2VU8E 5EQRA 1MTSA 1O5DH 1AO5A 1JMOH 3M5OA 2BMGB 3LH1A 1PFXC 3TIUA 4A1XA 4ZAEA 3P95A 4ISOA 1BITA 1T31A 1JBUH 2OTVA 4MVNA 1C2EA 1TRYA 4D7FA 3Q3YA 5A8YA 1C4U2 2SGEE 4GHTA 1CQQA 3UOUA 4ZHAA 1QL9A 2B7DH 1TPAE 1Y3XA 2XWAA 1U6QA 1YCPK 2CMYA 1EP6A 2BM2A 2F9UA 4JZIA 3TJUA 1C2LA 1YCPM 3LOXA 1Z1JA 1WTHD 3CENA 4ZUHA 2CV3A 2I6SA 1FDPA 3FP8E 3LPRA 2W3IA 5H4IB 4KTSA 1XUHA 2CF9H 2YNBA 3QDZB 1EOJA 1V3XA 5TCAA 3RXIA 1O32A 3MI4A 1C5SA 3PV4A 3W94A 4CRBA 2VGCC 1AIXH 2F3CE 2YOLA 1YLCA 4JCNA 1GCDA 1OP2A 5GXPA 3TITA 1KLIH 4BOHA 1GBEA 3K6YA 3RP2A 2R3YA 1G37A 2NU3E 2BQWB 2BY9X 3KCGH 4J2YB 1VCQA 1D4PB 1P03A 2OCVB 3KF2A 3GCTG 3QUMP 2GD4B 1C1TA 3UR6A 1YYY1 3SU4A 1SGFG 3QGNB 1E37B 2ZPSA 1ID5H 4YZUA 1XM1A 1KXCA 1ANEA 4X6NA 1HJ9A 1ZGVA 2C8WB 2ZKSA 1N6XA 1V2OT 2QXJA 2A5IA 4K8BA 4H4FA 1SGEE 4Y7BA 5SGAE 1TE0A 1H4WA 4OS5A 1O3KA 4O3TA 2PKAA 1C5MD 3D23A 2WPJS 4RSPA 2Q1JA 3SW2B 3M5LA 1QA7A 2BD5A 3MH4A 1KYNA 3BSQA 1WCZA 1Y5UT 1O2RA 1UCYK 3BG4B 4YLQH 1TABE 1P01A 4ABDA 1UVSH 3CP7A 3GOVB 5CE1A 1Q31A 2ALPA 3GYMA 1LHCH 4D8NA 1WYKA 1GBDA 1QQ4A 1AUJA 1GL0E 3ZV8A 1FONA 3TK6A 1TGSZ 2VJ1A 1NROH 4FVBA 2FOBA 4FVDA 1TNGA 1C5PA 1WU1A 3KQEA 3A7YA 2PGQB 2GKVE 1A5IA 1Z8IB 1TFXA 2ZCHP 1OS8A 3RXEA 1Z8GA 2ZHQH 3R3GB 1AU8A 1W12U 2AFQB 5CHAC 1GI9B 2P3UB 3QK1A 5IYTA 2BOHB 3NPSA 2G81E 3LIWA 4K1SA 1DVAH 2EI7A 1VJAU 3SU5A 4LZ1H 2J2UA 1W2KH 2BXUH 4A1TA 1EP5A 2GCHF 1Y3WA 1ELEE 2TIOA 1A2CH 5C1UA 3K9XB 2Z9GA 4E7NA 5J4SA 2PKSC 1WV7H 1PQ7A 3L33A 3RXAA 3ZZ9A 2TGTA 4ZKNU 1TLDA 1T8MA 4TPYA 4U01A 1O37A 1O3MA 4FU7A 5ESTE 4J1YA 3PLKA 3ZVGA 1TA2A 3T62A 1DE7H 1NT1A 2D26C 3LGYA 4GCHF 2HPPH 2PLXA 3QZQA 2FX4A 1LO6A 3LGTA 3NWUA 2TRMA 1AN1E 1F0RA 1UHBB 1EJAA 4MNVA 4I7YH 1O2IA 2P94A 1AFEH 1GJCB 1C5TA 4FUHA 1YPMH 2B8OH 2RCEA 1HDTH 1HJAB 1QTFA 1N6YA 2STAE 5G4BA 4Y0ZE 3GCTF 2VWLA 1QR3E 2G51A 3HGNA 3URCA 3M7UA 1IQIA 1EKBB 3I77A 3U1IB 1AI8H 1QY6A 5C20A 3GY8A 1GVLA 2BD4A 1FLEE 2DUCA 2ZWLH 3F9GA 1O2VA 2P3TB 4I8GA 1OWHA 1WAYB 1GHAF 1QQUA 4XOJA 4CBNA 4DURA 1SLUB 4X6PA 5ABWA 2O8UA 1OWJA 2VVUA 2CF8H 1GBKA 5A2MH 1INCA 3RXMA 3A7ZA 1D9IA 1GJ9B 1SVPA 4GHQA 4FUIA 1NY22 2HGTH 3A7XA 1ETTH 1F0SA 1SLXB 3E0PB 2B5TB 1LPKB 1KXEA
chains in the Genus database with same CATH superfamily
2OC1A 1CHOF 5HGGA 1EPTA 2FYQA 6ESTA 1O39A 2GJGA 4XSKU 2WPHS 3BV9B 2RA0A 1EJNA 1UTPA 3ZZ3A 2L6OA 2QXGA 1WUNH 1K28D 1FY8E 1OXGA 6CHAB 2XCNA 2WZQA 4UFGH 5E8EH 1GMHF 3UPEA 2QXHA 1QRZA 1DT2A 1S0RA 2RA3A 1A5GH 1ETRH 2J94A 4TY6A 4Y71A 3VG8A 1RIWC 2FOAA 3E3TA 1SGQE 3EGKH 4GLYA 4OS1A 1SKYE 1VITG 2A4QA 1PPEE 1S85A 4ACBA 3DFJA 1TNKA 2AEIH 2GZ9A 2HVYB 3TNSA 3ITIA 4U30A 2LPRA 1ZMJA 2FYRA 3VXEH 1PYTD 1GBHA 3UQVA 1AE8H 2H5DA 3LC3A 4CRGA 4OS2A 3S9CA 3QO6A 1TQ7B 2PR3A 2OC7A 1GI1A 4B74A 2PTCE 1BT7A 3GY5A 2IJOB 1J9CH 2UUKB 3RXFA 3S9AA 2EC9H 3N7DA 2KCYA 1GVZA 4WMFA 3OX7U 5T6DA 1GG6C 3T28A 1E34B 4LOYH 2CN0H 3GY3A 3RXJA 2FOCA 1ELBA 2OK5A 1GBLA 1ANDA 3A85A 2UWLA 2ZU1A 4K69A 4M7GA 2F43B 5E2PA 2M5TA 5L6NH 1W13U 1L1GA 1GHAG 1SGCA 2ODYB 2V3MA 4ASHA 1P2KA 3TGKE 3ZZ6A 2D1JA 2F4LA 1OX1A 1GJ8B 3Q00A 3BTHE 8GCHF 1C5VA 1NRQH 3ZZ8A 1S6LA 1QZ8A 1TNIA 3SU2A 3M36A 4WMDA 1DY9A 1HAVB 4JMYA 2ASUB 2L74A 1SC8U 1F5RA 2ZFPH 3E6PH 4CR5A 4FU8A 1EZQA 1QL8A 4D7GA 5DP9A 5EPYA 1AVXA 4SGAE 2BDBA 2FLRH 3BG4C 3F9EA 1HB0B 1OSSA 3H7OA 5JBTA 1GVKB 2C4FH 4ABHA 4FUJA 1CA0C 1D6RA 1JIMA 1F2SE 1QBVH 1A4WH 4YM9A 1BIOA 7ESTE 3U8TH 5F53A 1KY9A 1VITH 1QCPA 2BVSH 4ZHLU 1S84A 1DLEA 1NRRH 3ZZDA 1V2VT 1P57B 1GGDC 1ESTA 3E8LA 2BLOA 1ACBE 2J38A 3PWCA 2YMSD 1O5BB 1GBIA 1COWD 2A1DB 4AYYB 1FAXA 1OWKA 4ABBA 3NUMA 3VPKA 1TONA 4NFFA 3KNXA 1FMGA 1K1MA 1L1JA 2GVFA 3RXSA 1BDAA 1X7AC 2J98A 3QX5H 2FWWA 1QIXB 3LJOA 3QN7A 3SJIA 1KSNA 1CSOE 1FUJA 3HK3B 5LPRA 2TGPZ 4JK5A 3S69A 4AB9A 1IQLA 2WYJA 4YXWD 3K6ZA 3WWBA 1P9UA 4WH8A 1G3DA 4AC9A 4Z0KA 3KL6A 3U69H 2CGAA 1JWTA 4NIVA 1C1OA 3O8RA 4TWYA 1MUEB 1O3GA 2WPLS 2Z3DA 3G01A 1LHEH 2ZO3H 3EE0B 1YPKH 1DDJA 3N7OA 3RXPA 3SQEE 1GG6B 4B2AA 1C1QA 1THSH 1A7SA 3HK6B 5FAHA 3GCHC 1C1PA 3P92A 3A82A 4FUCA 5C0TA 2SFAA 3MH7A 1VGCB 1Y3UA 4BAQB 1EPTC 2A4RA 2ZF0H 5JBBS 5EJZA 1LCYA 1QNJA 2PKSB 5HM2A 1NPMA 1SG8B 3D65E 3VB4A 1C5YB 1GCTB 2AS9A 4JYVH 3LGIA 1S0QA 1DX5M 2AIPA 5A8ZA 1TMTH 2FX6A 2G00A 3M61U 4UDWH 3SI4H 3V13A 3WY8A 3KHVA 1W0YH 1TGCA 2HOBA 1K0HA 4K1EA 4YOIA 2IPHA 1DSUA 3FOAA 1DPOA 2BDIA 3ZZBA 1Z6JH 4AFUA 2A2XH 1UW7A 3EQ0H 1F92A 1GI8B 1GJ7B 2KX4A 1GBFA 3W95A 3GS9A 1O33A 4YOJA 1EAUA 3NKKA 1AB9B 2ZDAH 1BTPA 2F9VA 2IPQX 4GAWA 2G4UA 1ZJDA 4I8LA 1Z7KA 1TOCB 3UNSA 1W7GH 1DWBH 4UFDH 4Q7ZA 2ZC9H 1DXWA 3F9FA 1O2QA 1FN6A 1ZJKA 1H8IH 3S7HB 1P2MA 3LDXH 1NTPA 2VGCB 1ELDE 3KGPA 1SOZA 3GCHB 1O36A 1O5AB 3SNAA 4HGCA 2XC0A 2W6JD 4IN2A 2CHAC 2FO9A 1GMDF 4I86A 3SI3H 1CA8B 5C3NA 1ZSLA 1M9UA 4AGJA 1EATA 1C1VH 1H9LB 1HV7A 1V2RT 2HALA 2J97A 3DT0H 1GMCG 1W0ZU 1MAXA 2VWOA 1AZZA 2OBOA 1EOLA 1ZHRA 1BTXA 2PSXA 4ZXYH 1UTKA 2ZEBA 3DHKH 2TGAA 2ZHWH 1MZDA 2FOGA 3AVZA 3KYFA 2K0QA 4DVAU 2VINA 1MZAA 2SGAA 2BVXH 1OOKB 3KQ5A 3LT3A 1V2ST 4Y79A 1DWDH 1YPHE 1TMUH 2OXSA 3OY5U 1SFQB 2FLBH 2BXTH 4Y8YA 3ZV9A 1XVOA 1GJAB 1KXBA 2HNTE 2OD3B 2GDEH 4ISHH 1MTNC 1DXPA 1NM6A 3F2GA 1O3DA 2O9QA 2STBE 1K1PA 4B2CA 3LKWA 4K3JA 3SNDA 4HTCH 1TIOA 2ZPRA 2GMTB 1V2UT 1JRTA 3O8BA 4NIYA 4Q7YA 2PUXB 5A0CA 3M7QA 4I33A 3AK5A 1Y5BT 3CNRA 3BEIB 5FCRA 4WMEA 3DSOA 4K1TA 5DJ7A 2GX4A 5F03A 1GBJA 3T25A 1BJVA 2ZZUH 2AGGX 1UK4A 4AG2A 1YLDA 2PUQH 2GGVB 4AYVB 1SGYE 3MO6A 1F5LA 1GHZA 1O2SA 1C9PA 1RJXB 3UTUH 4ZXXH 4ZKOU 5K7RA 4B71A 1EB1H 3UQOA 1T7CA 3RMNH 1KDQA 1TB6H 2J95A 3PMAB 1BHXB 1TBZH 1TNLA 4UD9H 2AIQA 2FESH 4GCHG 5DSFA 4X1RU 4SGBE 4NZLA 4KELA 2GT8A 2J92A 3PRBA 4NZQA 3ZVAA 4F4OC 1GBBA 1Z6EA 2XOKD 4NWLA 2A4GA 5C5OA 1O35A 3GYLB 5C1YA 4KGAA 2C8XB 3E1XB 4NA7A 2G8TA 4AFSA 2Q6DA 5LGOA 2QF4A 1AGJA 2ZFQH 1QHRB 1PYTC 1YY3A 5FHTA 2BD9A 5EU8A 3FN8A 1UK3A 5JBAS 1TX8A 4ZH8A 4MNWA 1SPJA 2BLWA 2ODPA 1TX7A 4DG4A 5HMAA 2OP9A 2BLQA 4TY7A 1ZPBA 1PQ8A 2ZU2A 4WJG2 4M9FA 1ZPZA 4I31A 1XX9A 3GCOA 2GV7A 2IN2A 1HRTH 7GCHF 4IMZA 1YPJH 3EE7A 1SB1H 3T2NA 4ESTE 3QLPH 1GCTC 3RC5A 1ESAA 1UTQA 2A32A 1AZ8A 1ZHPA 3HGPA 1RIWB 1C1SA 2GCTC 1O5EH 5AVDA 1C2IA 1SL3A 1OWIA 1XUJA 3FO8D 4DCDA 1OKXA 1C5LH 4WH6A 1AKSB 1PQ5A 1GMDG 3GCNA 2G5NA 2PTNA 1O2PA 2KCAA 2QV1A 3ATMA 4JZEH 1FXYA 4O9VA 2QF0A 1LKAA 1QB9A 1UVUH 3D62A 3I78A 1LDTT 1IQHA 4FXGH 1P8VC 1VITF 3LONA 3UREA 1B0FA 2FI5E 5JDUB 2UUJB 1YM0A 3TK9A 2GP9B 3PWBA 1C5QA 4IN1A 2Z9KA 3BTDE 3VGCB 3DA9B 5C67A 2XC4A 1DLKB 5DGJA 4ASUD 2FOEA 2AYWA 2B9LA 4BTTB 1W3CA 3HPTB 4D9QA 2ANMH 4JZFH 1C5WB 1HAYB 1N8OC 3V7TA 3FP6E 1PPHE 2J5UA 3KN2A 1C2KA 1BRBE 3UOPA 1HAXB 2BB4A 1G32B 1G2MA 1N8OB 1ABIH 3TNTA 1HAOH 4XE4A 5DP8A 5C5NA 2C3SA 1LVOA 4YTAA 1TNJA 2BY8X 1BB0B 1VZQH 4THNH 1FX0B 1WQVH 3VXFH 2CK3D 1UO6A 1DUEA 3BTWE 3SUEA 3SJ9A 1FAKH 2ZG0H 3WW7A 1IHTH 3O8DA 1NRSH 1HIAA 1SGIB 1MH0A 1P0SH 2KZ4A 4WWYA 2B0FA 3UR9A 1BMLA 1XXFA 4LK4A 1DANH 5FBIA 3SU0A 2BDGA 2R0KA 4A6LA 1NO9H 2AGEX 2P59A 3ODDA 3RXGA 1G3BA 3B23B 1IAUA 2K8IA 1J8AA 1TA6A 1AVWA 3QTOH 3A88A 1ZR0A 3TGIE 2JDID 3PB1E 2LP6A 3SOSA 4A7IB 2XXLA 1ETSH 4MPUA 2V7QD 1BMAA 3BN9A 1C1RA 5GWZA 2Y82A 2J4IA 1HNEE 1CVWH 3RM2H 4B6FA 3V12A 4AOQA 3UY9A 2A31A 3DSPA 1G9IE 1RRKA 4Q4LA 4FUBA 2W7SA 3STIA 1YBWA 2P8OC 2G52A 1K1NA 1F5KU 5EQQA 1CBWC 1DFPA 1A0HB 1QFKH 1DWEH 2VBCA 1TPSA 4DT7B 3E90B 4IGDA 4MPXA 3EAJA 1RTLA 5E0JA 2Z9IA 3HKJB 2QAAA 1OYTH 3RC6A 1O2GH 4I8KA 1CT4E 2H5CA 4JK6A 3MMGA 2HNTC 5J4QA 1A3BH 2EI6A 1LPZB 1EUFA 2HLDD 1O2NA 5BPEA 3FKSD 1C2MA 2ILNA 2W7UA 1G36A 1KXDA 3HATH 3GISB 1BRUP 1EASA 2AHME 1DOJA 2CXVA 8KME2 4ZHMU 3DUXH 3ZIAD 3E0NB 1QBOA 2QGRA 3RU4T 1GJ4H 1C5UA 3EA9A 2WV9A 3PMBB 1O3CA 3EDXB 2QYIA 2ZGCA 1O30A 3TH2H 3H09A 1C2JA 3NRLA 4O97A 4JZDH 1CGHA 2ZDVH 2XYAA 2EEKA 3B9FH 1E38B 1K21H 2Y6TA 3RXCA 5JB9S 1HPGA 4B6EA 2F9PA 2BY5X 1C5OH 3FANA 5L2YH 4CRDA 2PSYA 4BANB 3GDSA 4LZ4B 1O5FH 3BF6H 1AKSA 1WDIA 4Y0YE 2Y81A 4E05H 2VIDA 1P11E 2O8TA 3NZIA 3RMMH 1O2XA 2GTBA 2H9HA 2OUAA 3M7TA 3EYDA 4AX9H 1EZSC 5DKMA 1TX6A 3F2FA 5DP4A 3A87A 4B1TA 1T4UH 3K65B 3SZNA 5FCKA 2JH5D 1OP0A 2ZU4A 5IDKA 4BTIB 1XUFA 3KQCA 1TGTA 1LQDB 1C2DA 3BTME 5EODA 5EW2H 3ZYEA 4U32A 1MCTA 2WUBA 1PPZA 1EB2A 4AG1A 1JOUB 3GDUA 3ZZAA 1MQ5A 3SUDA 2Q6GA 1HYLA 4FUFA 4X2VA 3H7TA 2I6QA 3VGCC 1IQJA 3ZVFA 1HAPH 1P2OA 1O3HA 2PFEA 2A45B 4GPGA 1NFYA 3A83A 3E16B 2OQUA 3P8NA 2QF5A 1EXFA 3TGJE 2QA9E 3RXRA 3RXTA 5AFYH 2G55A 1UTLM 3S7KB 2V0BA 2C8YB 8GCHG 1O3PB 2ZCKP 2SGDE 2BZ6H 2TPIZ 1G2LA 4O3UA 5DO4H 1O31A 4D76A 1F0TA 3L3TA 1TRMA 4NFEA 2JKHA 4FETA 3A8DA 1NRNH 1PPBH 1BTYA 2NU0E 2HPQH 2W3KA 4Q2KA 3BEFB 1CBWB 1AWHB 4BNRA 1HCGA 5AFZH 1E1QD 2XW9A 2ODQA 3HKIB 2Z3CA 3R0FA 1NFXA 5LH8A 2HVXA 1GHYH 2ZU3A 1P2IA 2SNWA 5DG6A 4D9RA 1RTKA 1SHYA 5TCCA 5L30H 4X1NU 1C2GA 4X1PU 1MBMA 1UVPA 2GMTC 2JETC 4KTUA 1HAVA 3SUFA 3RXLA 1FY4A 3SHAH 3MNCA 2DE8A 1ZYOA 2FTMA 4NA9H 4NGAH 4P02A 4B76A 1LHFH 3M3SA 1BTWA 1UTJA 1C4V2 1IQGA 5FBEA 2W6ID 1MTNB 1O38A 2ZGHA 1MAYA 1XVMA 2OLGA 4DIIH 1L4DA 3FVFB 3ATWA 4F49A 1AHTH 1SHHB 1PPGE 2FOHA 1UTMA 3PROA 5IK2D 1KXAA 2BOKA 1ZSJA 3ZZ7A 2AMDA 2WHXA 5K0HA 2ZECA 3SJOA 4TT3D 2Z7FE 4WXIA 5HXFA 5FPSA 3LU9B 1V6DA 3OAAD 1EAIA 1FPCH 4NSVA 1H8ED 2VH0A 4OS7A 1O2YA 1KTSB 1UVOA 5LPFA 2VVVA 3BTEE 3SBKA 3FZDA 3T26A 1GJBB 2BY6X 3TH4H 1GBMA 3ZVBA 1SGRE 3S0NA 2XBVA 2ANYA 1G30B 1ZTJA 5C0UA 4X1QU 1RTFB 4K5ZA 1P2JA 1O2TA 1SOTA 1TNHA 3TJVA 3RXDA 2FZZA 3CS0A 2R0LA 3LJJA 1C4Y2 4RN6A 4OGXA 1XKAC 2EA3A 4CRAA 1W0KD 4OS6A 1MTVA 3C27B 4CR9A 4AN7A 1LTOA 2TBSA 3SV2H 4Q80A 1YKTA 3IITA 3RLYH 4XBBA 3UUZA 3F1SB 1ANCA 5B6OA 1XUIA 1UJ1A 4NIWA 1MKWK 1SQOA 4A1VA 1O0DH 1A3EH 2QN5T 1P12E 4MDSA 1V2QT 4HI3A 1GI3A 4A5TS 1BZXE 1OWEA 1QL7A 1XUKA 4BXWA 5BRRE 2OQ5A 1MBQA 1Z8RA 1RFNA 2BD8A 4IC6A 3SYJA 3PO1C 4CBOA 3OTJE 1K1JA 2EI8A 2ZGXH 1O2MA 1FV9A 1K1OA 2EY4C 1EAWA 1VGCC 1PJPA 4Y7AA 4PROA 4BAHB 1GGDB 1GDQA 2F9OA 2R9PA 3TJNA 2GCTB 1FIWA 3SU6A 1O3JA 2VIPA 5GIBA 1GBTA 1MKXK 1TMBH 1LVYA 1WSSH 3Q3XA 1FNIA 4BAOB 1V2TT 1QGFA 5FXLA 3SV7A 4INHA 1QB1A 2A2QH 1TQ0B 1GHBG 2H6MA 5E0GA 2R2MB 1YLNA 3Q76A 4CREA 2QC2A 4E06H 1H9HE 1C5NH 2JH0D 4Y8XA 4NCYA 4IW4E 3W1EA 5T6FA 3ZZ5A 3AAUA 1KTTB 1S5SA 5EPNA 3UFAA 1BBRE 4CRCA 4Y76A 3SO3A 3P8FA 4INKA 5HKKD 1H8HD 3EA8A 1S81A 1TYNA 1G3CA 1EAXA 1VJ9U 3FP7E 3IG6B 2ZPQA 2RDEA 3PM3A 3ELAH 4NWKA 1XKBC 3NK8A 1V2WT 1WXRA 4Q63A 3SV9A 1GL1A 1O5GH 4X6MA 1DITH 2BY7X 3F6UH 1TGNA 2BDYA 1BRAA 3PMHB 3SN8A 3STJA 2GCHG 3F9HA 3CS7A 1Y3VA 1GWAA 2RG3A 5AHGH 3P17H 4JYTA 2ANWA 5CHAB 4DT4A 2H9EH 2JH6D 4Y10E 3SNBA 1TBQH 3OTPA 2BLVA 1FZZA 1O3AA 1LQEA 1HAZB 1ELVA 4R0IA 1QURH 1WQSA 2XNIA 2ZU5A 4XFQA 6CHAC 2ZHDA 4K8YA 3AW0A 4RKOB 1UMAH 3SORA 3PTNA 3A8CA 1LHGH 3PO1B 3M35A 1ELFA 5JPMH 4ZKRU 4BAMB 2P3FH 3RXOA 1V2KT 1QRXA 5GDSH 4AORA 1V2NT 3SHCH 5EOKA 3SZEA 3F68H 1P2NA 1IQEA 3OU0A 5T3HA 3SJKA 2P8OB 4NA8A 3T29A 1KIGH 3JZ2B 4X6OA 1GHVH 1LVBA 3MNBA 4Q7XA 5C1XA 1YWUA 3ZYDA 1A61H 1HAGE 2K1QA 2VWMA 1S83A 3QTVH 1TAWA 4XBDA 5F8ZA 5DK1A 1C2HA 1K1IA 1LKBA 1MKXH 2A7HA 2H9TH 4KTCA 2ZP0H 4OS4A 4DOQA 1ZTKA 3U28C 1CGIE 1GHXH 2FODA 4MNXA 2ZQ1A 1ARCA 5I46H 4X8SH 1AB9C 3NCLA 4ISLA 4Y6DA 2W5EA 2HNTF 4MPWA 2F83A 4MLFB 1SSXA 1T8LA 1FJSA 1GJ5H 3U1JB 3ZVCA 3A8AA 1YCPH 1JRSA 1S6FA 1UVTH 2HWLB 1AUTC 3LGUA 1QJ6B 4HFPB 4IBLH 1O2HA 1TWXB 4H42U 5EG4A 1NC6A 1VR1H 4U2WA 1GJDB 4MTBA 4UONA 1Y3YA 3BIVH 1F7ZA 2FIRH 1EZXC 4FUDA 5EXMA 1UTNA 2BQ7B 4CHAB 3BTQE 1BMMH 2DE9A 1P05A 1W14U 2THFB 3QGJA 1EX3A 8LPRA 2KAIB 5ESBA 1C1WH 2ESTE 3RMLH 3MFJA 2C93B 5F6MA 7KMEH 3O8CA 1NFWA 4DGJA 5GPIB 5A8XA 2BD7A 1NBMD 1SLVB 2WPDD 1V2JT 2GZ7A 1ELAA 1AD8H 1J15A 2QY0B 1IOEA 2FXRA 1A1RA 1SQAA 3GDVA 1GI7B 1Z1IA 2ZGJA 3OY6U 5EXLA 1SGFA 2BYAX 5KEDA 1O2KA 9ESTA 1YPHC 2SGQE 4OGYA 1DWCH 1SMFE 4HZHA 4BAKB 3PYHA 2Y5FA 3MO3A 2H2ZA 5FPYA 5JBCS 1BRCE 2FM2A 1BJUA 3U98H 2QXIA 3PLPA 1FY3A 3F0OA 3M5MA 1FN8A 1GI2A 3AASA 3BIUH 4XDEA 1C9TA 2KFWA 1BTHH 1ZTLA 3VB6A 2O8WA 4VGCB 3KYGA 1ZMLA 1QRWA 2H1UA 1O3BA 3OSYA 1P3CA 2JETB 2F9BH 5EGMA 2VB0A 3B8JA 2AERH 4NSYA 1DY8A 4DW2U 5JB8S 1RGQA 1NS3A 1SFIA 2FPZA 3GICB 4R8TB 3TPIZ 3A89A 1IQKA 3BTKE 4AGKA 1C1NA 1KDQB 5GNDA 1EPTB 1K2I1 1O3NA 4E7RG 2PHBA 3NXPA 1HJAC 2BTCE 1ZGIA 2FEQH 3A81A 4ABEA 3P8GA 4Z6AH 3DCLA 2FMJA 5E0HA 6LPRA 3FFGA 1SGPE 4I32A 3TLOA 1SGDE 1QBNA 1AFQC 1C2FA 1O34A 4GUXA 2ZDMA 1E79D 1MU6B 2XTTB 3P70B 3SU1A 2G5VA 1O2JA 3KIDU 1O3FA 2A5KA 2SGFE 1CO7E 1GMCF 1CGJE 3BG8A 3LH3A 4XD7D 1WTGH 5TJXA 4ZROA 1O5CB 1BMNH 1JIRA 2Z6BD 1MQ6A 3P8OA 3VB7A 1B7XB 1UHBA 1ZRBA 1W7XH 1GBAA 1EZUC 1T32A 2OC0A 3A7TA 1FY5A 1QJ1B 3MU8A 4F48B 1Z71A 5C2ZA 3UNRA 1J17T 1BBRH 3H5CB 3JZ1B 4VGCC 3KQBA 3P6ZB 4YO9A 3UNQA 1P10A 1YP9A 1CA0B 2M2AA 2XBXA 1SI5H 3T5FH 3MHWU 1UCYH 2D2DA 2FS8A 2ZHEH 5I25A 3SUGA 1K22H 3KQDA 3TVJB 5FPTA 2NU1E 4X0WU 3UIRA 1MD8A 4K2YA 3ZVDA 1GHWH 1H9IE 3LGWA 1HAHH 1A46H 1P06A 1HUTH 2QIQA 3PMJA 1AVGH 1GI6A 3M3VA 4ABGA 3RLWH 4FUEA 4H6TA 4FOUC 1RXPA 1SGNE 1O3IA 2R2WU 1OPHB 2QF3A 1L4ZA 1XXDA 1ZOMA 1AQ7A 1O2WA 1ZMNA 2ZDLA 1ELTA 3PV2A 2OBQA 1O2ZA 2ULLA 4AZ2B 2ZDKA 4Y11E 5A0BA 1AE5A 5KECA 1FPHH 5EIYA 3DFLA 2ZNKH 3SQHE 4Z1MD 2QE7D 2BQ6B 2C90B 3I29A 3OEHD 4YT6H 4BXSA 2ZFFH 2KAIA 1IQFA 1VCPA 5EW1H 3MU0A 1AFQB 3A8BA 3OYPA 2XRCA 3SV8A 6GCHG 1OWDA 2PGBB 1TOMH 3MU5A 2WV5A 1BQYA 1CT2E 2ZIQH 3TH3H 2HRVA 4WXVA 2WINI 3F0PA 1NZQH 2AMQA 5DP3A 4DJZB 2J98B 3BTTE 2V3OH 2BD2A 3PTBA 4CRFA 2VH6A 4AFZA 1FQ3A 2VWNA 1D3PB 1P3EA 2TGDA 3LGVA 3RU4E 4B75A 2Y7XA 1HIAB 2ZGBH 2Z3EA 1P09A 2BDAA 2VIWA 1C5RA 1BCUH 1JXPA 2UUYA 1THRH 3PLBA 4GVUA 4RT0A 4X8UH 2HLCA 2FOMB 4ABJA 2ZI2H 1B0EA 1RS0A 1MD7A 4ABAA 1DSTA 3TU7H 1ZRKA 3MU1A 1HGTH 3QZRA 4I8JA 1FIZA 1ZPCA 4KP0A 4MNYA 1PQAA 1KXFA 2FOFA 3L6PA 1D3DB 1CHOG 3WWFA 1LHDH 1B5GH 1V2PT 1D3TB 2GV6A 2V6NA 2FP7B 2ZFSA 3OE7D 4DIHH 1WBGB 4AB8A 3BTGE 1HAIH 1RD3B 1LVMA 2ZHFH 4X2YA 3SGBE 4X8TH 1H8DH 1E0FD 1QA0A 2OINA 4NG9H 5B6LA 2ZQ2A 4TWWA 3UWJH 2F9NA 2VIVA 3RXBA 1SLWB 2GZ8A 5CMXH 4WF8A 1GHBF 1SR5C 4MG3A 1H1BA 2Y80A 1VKYA 1SGTA 1K9OE 2V3HH 1D3QB 3VB3A 2UUFB 1ZZZA 2O8LA 3BTFE 9LPRA 3F3BA 2KM0A 1PPCE 1G3EA 5EJ1A 1L2EA 2IJD1 4IS5A 1ESBA 1J16A 2A7CA 4RKJB 5HYOA 1O2LA 3VFEA 1YGCH 4X8VH 1Q2WA 1HJ8A 1W10U 1CHGA 2Y5GA 1J14A 4TPIZ 1GPZA 2F91A 4CH2B 3RDZA 2GT7A 5GCHF 3RM0H 2AGIX 3QWCH 1FY1A 5HIYA 5T1VA 2J9NA 3PV5A 5C17A 1DS2E 5PTPA 2CJIA 2ALVA 2Q6FA 3SNEA 1ZSKA 2ZCLP 3ESTA 1NRPH 2Y7ZA 2BHGA 2BX4A 2XWBI 5FX5A 3K2UA 1XMNB 2OC8A 1HLTH 1T8OA 2XBWA 1EQ9A 3FZZA 2WPIS 3M3TA 1LPGB 6GCHF 4MPVA 1Z8JB 4YESB 3RXHA 4IMQA 1CT0E 3TJOA 4ZKSU 1P2QA 2VIOA 2G4TA 1MTWA 2RDLA 4X2XA 1OYQA 3RXQA 1NESE 1AMHA 2ZDNA 5HM9A 5DP5A 3ZZCA 4NIXA 1BTUA 1YC0A 4X2WA 5DN6D 1MCVA 1TPOA 5F8TA 4GSOA 1A0LA 2Z9JA 2FI4E 3A86A 1P02A 1NN6A 5GJ4B 2YNAA 2VVCA 1MKWH 1C5XB 3UAIC 2J34A 3Q3KA 2WUCA 4YLUA 4AFQA 2PP6A 3DD2H 4UEHH 4JYUH 4O03A 4X1SU 1GI5A 2A5AA 3U8OH 4UFFH 7LPRA 1AWFH 3U9AH 1ANBA 1BBRK 1VCWA 4FUGA 1GI4A 2PKAB 2V35A 3ATKA 3RC4A 5T6GA 1WOFA 2XCFA 1CU1A 1DM4B 1HBTH 3ATIA 1EJMA 2NU2E 1C1UH 1THPB 4UFEH 1F0UA 3MO9A 5HIZA 1S6HA 1DUAA 3MNSA 3ZZ4A 4K60A 2KCPA 3MNXA 2A0QB 3U8RH 1BHXF 3RXVA 1XUGA 2P16A 4Y8ZA 2KCOA 3IWMA 1HFDA 4B73A 7GCHG 4ISNA 5FL7D 3AW1A 4TSFD 3VEQB 1YPGH 2BDCA 2VNTA 1L1NA 2LNCA 3RMOH 4KKDA 2NWNA 3RU4D 1O3LA 5ETXA 4B2BA 1A5HA 1IHSH 2R3UA 5DPAA 1MMJN 4WY3A 2LELA 1FI8A 2P93A 1GDUA 3MOCA 3OFND 1O2UA 1BTZA 5GCHG 2GDDA 2SNVA 5F8XA 1T8NA 2BD3A 3M5NA 4WVPE 3MH5A 2VIQA 1N1LA 5E2OA 3V3MA 1V2MT 1E35B 1D6WA 1ELGA 1GMHG 2AH4X 1TPPA 1HXEH 4IC5A 1Y5AT 3A84A 1AY6H 1IQNA 3T27A 5LPEA 2P95A 3D49H 4P00A 1IQMA 2C8ZB 5L2ZH 1QB6A 4QT8C 4XBCA 4DY7B 3GY4A 1GI0A 1NU7B 3SNCA 2BVRH 1K1LA 2BZAA 1GBCA 5DP6A 1P9SA 5AF9H 2PW8H 3M37A 5EJLA 3ATLA 5FX6A 1MTUA 2ANKH 4UE7H 2FI3E 4ISIH 4TYDA 2PWXA 3MU4A 1O2OA 3SJ8A 3MYWA 2WPKS 3ZVEA 4H6SB 2KR7A 1NU9A 4JZ1A 1UTOA 4RT1A 5DP7A 1TGBA 2XNDD 3GY7A 2O8MA 1L0ZA 1OP8A 3FAOA 3OEED 2Z9LA 2IOTA 4FU9A 3RUOA 3V0XA 4YT7H 3MWIU 2BDHA 1UK2A 3AAVA 2BX3A 1BOQA 2WSSD 1V2LT 2UWOA 2FTLE 3TK5A 1O3EA 1ORFA 2RFKC 1C5ZB 3MH6A 3N7EA 1E36B 2CHAB 3SGAE 2NU4E 1YPEH 2FDAA 3ENSB 1O3OA 5C94A 2D8WA 1GJ6A 3LC5A 3BEUA 1YF4A 3GY2A 1TRNA 2WV4A 1ELCA 2PV9B 1ABJH 1GDNA 3ODFA 2ZTXA 2XBYA 3C1KA 1TALA 1YPLH 2UWPA 4CH8B 1E1RD 1Q3XA 3RXKA 5EXNA 3A7VA 2WYGA 4MQAA 3Q77A 1W11U 2XC5A 4LXBH 4BTUB 3SV6A 2ZTYA 1W8BH 4I8HA 2FS9A 3UWIA 1BA8B 3URDA 3SGQE 2QCYA 2ZFRH 5A09A 4CHAC 4ABFA 1MABB 2SGPE 1PPFE 1Y8TA 1A0JA 4A92A 1LMWB 5EQSA 4INLA 4XRNA 1T4VH 3A7WA 1TBRH 2AMPA 4YOGA 1ZHMA 1CE5A 3MTYA 2WPMS 1HXFH 1KLJH 1W0JD 2A4OA 2W26A 2A7JA 2Y5HA 3SU3A 1S82A 1SBWA 1UCYE 5CHBA 1SQTA 1QJ7B 1ZLRA 2ZFTA 2ZTZA 1P04A 3S9BA 1NFUA 1BUIA 1C1MA 1ARBA 3A80A 1KLTA 3RXUA 2Z94A 3KEEA 3EA7A 1MU8B 1Y59T 3GY6A 1DICA 3E91A 4F55A 8ESTE 3VB5A 4ZMAH 2ZA5A 5A0AE 4ABIA 2VU8E 5EQRA 1MTSA 1O5DH 1AO5A 1JMOH 3M5OA 2BMGB 3LH1A 1PFXC 3TIUA 4A1XA 4ZAEA 3P95A 4ISOA 1BITA 1T31A 1JBUH 2OTVA 4MVNA 1C2EA 1TRYA 4D7FA 3Q3YA 5A8YA 1C4U2 2SGEE 4GHTA 1CQQA 3UOUA 4ZHAA 1QL9A 2B7DH 1TPAE 1Y3XA 2XWAA 1U6QA 1YCPK 2CMYA 1EP6A 2BM2A 2F9UA 4JZIA 3TJUA 1C2LA 1YCPM 3LOXA 1Z1JA 1WTHD 3CENA 4ZUHA 4ZCNA 2CV3A 2I6SA 1FDPA 3FP8E 1NBME 3LPRA 2W3IA 5H4IB 4KTSA 1XUHA 2CF9H 2YNBA 1KMHB 3QDZB 1EOJA 5JYIA 1V3XA 5TCAA 3RXIA 1O32A 3MI4A 1C5SA 3PV4A 3W94A 4CRBA 1AIXH 2VGCC 2F3CE 2YOLA 1YLCA 4JCNA 1GCDA 1OP2A 5GXPA 3TITA 1KLIH 2JJ1D 4OM9A 4BOHA 1GBEA 3K6YA 3RP2A 2R3YA 1G37A 2NU3E 3PRDA 2BQWB 2BY9X 3KCGH 4J2YB 1VCQA 1D4PB 1P03A 2OCVB 3KF2A 3GCTG 3QUMP 2GD4B 4HG6A 1BMFD 1C1TA 3UR6A 1YYY1 3SU4A 1SGFG 3QGNB 1E37B 2ZPSA 1ID5H 4YZUA 1XM1A 1KXCA 1ANEA 4X6NA 1HJ9A 1ZGVA 2C8WB 2ZKSA 1N6XA 1V2OT 2QXJA 2A5IA 4K8BA 4H4FA 1SGEE 4Y7BA 5SGAE 1TE0A 1H4WA 4OS5A 1O3KA 4O3TA 2PKAA 1C5MD 3D23A 2WPJS 4RSPA 2Q1JA 3SW2B 3M5LA 1QA7A 2BD5A 3MH4A 1KYNA 3BSQA 1WCZA 1Y5UT 1O2RA 1UCYK 3BG4B 4YLQH 1TABE 1P01A 4ABDA 1UVSH 3CP7A 3GOVB 5CE1A 1Q31A 2ALPA 3GYMA 1LHCH 2YMSB 4D8NA 5CDFE 1WYKA 1GBDA 1QQ4A 5KGOA 1AUJA 1GL0E 3ZV8A 1FONA 3TK6A 1TGSZ 2VJ1A 1NROH 4FVBA 2FOBA 4FVDA 1TNGA 2JIZD 1C5PA 1WU1A 3KQEA 3A7YA 2PGQB 2GKVE 1A5IA 1EFRD 1Z8IB 1TFXA 2ZCHP 1OS8A 3RXEA 1Z8GA 2ZHQH 3R3GB 1AU8A 1W12U 2AFQB 5CHAC 1GI9B 2P3UB 3QK1A 3MQKC 5IYTA 2BOHB 3NPSA 2G81E 3LIWA 4K1SA 1DVAH 2EI7A 1VJAU 4RI0A 3SU5A 4LZ1H 2J2UA 1W2KH 2BXUH 4A1TA 1EP5A 2GCHF 1Y3WA 1ELEE 2TIOA 1A2CH 5C1UA 3DSGA 3K9XB 2Z9GA 4E7NA 5J4SA 2PKSC 1WV7H 1PQ7A 3L33A 3RXAA 3ZZ9A 2TGTA 4ZKNU 1TLDA 1T8MA 4TPYA 4U01A 1O37A 1O3MA 4FU7A 5ESTE 4J1YA 3PLKA 3ZVGA 1TA2A 3T62A 1DE7H 1NT1A 2D26C 3LGYA 2JJ2D 2YMSC 4GCHF 2HPPH 2PLXA 3QZQA 2FX4A 1LO6A 3LGTA 3NWUA 2TRMA 1AN1E 1F0RA 2EQNA 1UHBB 1EJAA 4MNVA 4I7YH 1O2IA 2P94A 1AFEH 1GJCB 1C5TA 4FUHA 1YPMH 2B8OH 2RCEA 1HDTH 1HJAB 1QTFA 1N6YA 2STAE 1SQRA 5G4BA 4Y0ZE 3GCTF 2VWLA 1QR3E 2G51A 3HGNA 3URCA 3M7UA 1IQIA 1EKBB 3I77A 3U1IB 1AI8H 1QY6A 5C20A 3GY8A 1GVLA 2BD4A 1FLEE 2DUCA 2ZWLH 3F9GA 1O2VA 2P3TB 1OHHD 4I8GA 1OWHA 1WAYB 1GHAF 1QQUA 4XOJA 4CBNA 4DURA 1SLUB 4X6PA 5ABWA 2O8UA 1OWJA 2VVUA 2CF8H 1GBKA 5A2MH 1INCA 3RXMA 3A7ZA 1D9IA 1GJ9B 3N99A 1SVPA 4GHQA 4FUIA 4ACAA 3UB0A 3F2HA 1NY22 2HGTH 3A7XA 1ETTH 1F0SA 1SLXB 3E0PB 2B5TB 1LPKB 1KXEA
chains in the Genus database with same CATH topology
2OC1A 1CHOF 5HGGA 1EPTA 2FYQA 6ESTA 1O39A 4XSKU 2WPHS 3BV9B 2RA0A 1EJNA 1UTPA 3ZZ3A 2QXGA 1WUNH 1K28D 1FY8E 1OXGA 6CHAB 2XCNA 4UFGH 5E8EH 1GMHF 3UPEA 2QXHA 1QRZA 1DT2A 1S0RA 2RA3A 1A5GH 1ETRH 2J94A 4TY6A 4Y71A 1RIWC 2FOAA 3E3TA 1SGQE 3EGKH 4GLYA 4OS1A 1VITG 2A4QA 1PPEE 1S85A 3DFJA 1TNKA 2AEIH 2GZ9A 3TNSA 3ITIA 4U30A 2LPRA 1ZMJA 2FYRA 3VXEH 1PYTD 1GBHA 3UQVA 1AE8H 2H5DA 3LC3A 4CRGA 4OS2A 3S9CA 3QO6A 1TQ7B 2PR3A 2OC7A 1GI1A 4B74A 2PTCE 1BT7A 3GY5A 2IJOB 1J9CH 2UUKB 3RXFA 3S9AA 2EC9H 1GVZA 4WMFA 3OX7U 5T6DA 1GG6C 3T28A 1E34B 4LOYH 2CN0H 3GY3A 3RXJA 2FOCA 1ELBA 1GBLA 1ANDA 3A85A 2UWLA 2ZU1A 4K69A 4M7GA 5E2PA 2M5TA 5L6NH 1W13U 1L1GA 1GHAG 1SGCA 2ODYB 4ASHA 1P2KA 3TGKE 3ZZ6A 2D1JA 1OX1A 1GJ8B 3Q00A 3BTHE 8GCHF 1C5VA 1NRQH 3ZZ8A 1TNIA 3SU2A 3M36A 4WMDA 1DY9A 1HAVB 4JMYA 2ASUB 1SC8U 1F5RA 2ZFPH 3E6PH 4CR5A 4FU8A 1EZQA 1QL8A 4D7GA 5DP9A 5EPYA 1AVXA 4SGAE 2BDBA 2FLRH 3BG4C 3F9EA 1HB0B 1OSSA 3H7OA 5JBTA 1GVKB 2C4FH 4ABHA 4FUJA 1CA0C 1D6RA 1JIMA 1F2SE 1QBVH 1A4WH 4YM9A 1BIOA 7ESTE 3U8TH 1KY9A 1VITH 1QCPA 2BVSH 4ZHLU 1S84A 1DLEA 1NRRH 3ZZDA 1V2VT 1P57B 1GGDC 1ESTA 3E8LA 2BLOA 1ACBE 2J38A 3PWCA 1O5BB 1GBIA 2A1DB 4AYYB 1FAXA 1OWKA 4ABBA 3NUMA 3VPKA 1TONA 4NFFA 3KNXA 1FMGA 1K1MA 1L1JA 2GVFA 3RXSA 1BDAA 1X7AC 3QX5H 2FWWA 1QIXB 3LJOA 3QN7A 3SJIA 1KSNA 1CSOE 1FUJA 3HK3B 5LPRA 2TGPZ 4JK5A 3S69A 4AB9A 1IQLA 2WYJA 3K6ZA 1P9UA 4WH8A 1G3DA 4Z0KA 3KL6A 3U69H 2CGAA 1JWTA 4NIVA 1C1OA 3O8RA 4TWYA 1MUEB 1O3GA 2WPLS 2Z3DA 3G01A 1LHEH 2ZO3H 3EE0B 1YPKH 1DDJA 3N7OA 3RXPA 3SQEE 1GG6B 4B2AA 1C1QA 1THSH 1A7SA 3HK6B 5FAHA 3GCHC 1C1PA 3P92A 3A82A 4FUCA 2SFAA 3MH7A 1VGCB 1Y3UA 4BAQB 1EPTC 2A4RA 2ZF0H 5JBBS 1LCYA 1QNJA 2PKSB 5HM2A 1NPMA 1SG8B 3D65E 3VB4A 1C5YB 1GCTB 2AS9A 4JYVH 3LGIA 1S0QA 1DX5M 2AIPA 5A8ZA 1TMTH 2FX6A 2G00A 3M61U 4UDWH 3SI4H 3V13A 3WY8A 3KHVA 1W0YH 1TGCA 2HOBA 4K1EA 4YOIA 2IPHA 1DSUA 1DPOA 2BDIA 3ZZBA 1Z6JH 4AFUA 2A2XH 3EQ0H 1F92A 1GI8B 1GJ7B 3W95A 1GBFA 1O33A 4YOJA 1EAUA 3NKKA 1AB9B 2ZDAH 1BTPA 2F9VA 4GAWA 2G4UA 1ZJDA 4I8LA 1Z7KA 1TOCB 3UNSA 1W7GH 1DWBH 4UFDH 4Q7ZA 2ZC9H 1DXWA 3F9FA 1O2QA 1FN6A 1ZJKA 1H8IH 3S7HB 1P2MA 3LDXH 1NTPA 2VGCB 1ELDE 3KGPA 1SOZA 3GCHB 1O36A 1O5AB 3SNAA 4HGCA 2XC0A 4IN2A 2CHAC 2FO9A 1GMDF 3SI3H 1CA8B 5C3NA 1ZSLA 1M9UA 4AGJA 1EATA 1C1VH 1H9LB 1HV7A 1V2RT 2HALA 3DT0H 1GMCG 1W0ZU 1MAXA 2VWOA 1AZZA 2OBOA 1EOLA 1ZHRA 1BTXA 2PSXA 4ZXYH 1UTKA 2ZEBA 3DHKH 2TGAA 2ZHWH 1MZDA 2FOGA 3AVZA 4DVAU 2VINA 1MZAA 2SGAA 2BVXH 1OOKB 3LT3A 1V2ST 4Y79A 1DWDH 1YPHE 1TMUH 2OXSA 3OY5U 1SFQB 2FLBH 2BXTH 4Y8YA 3ZV9A 1XVOA 1GJAB 1KXBA 2HNTE 2OD3B 2GDEH 4ISHH 1MTNC 1DXPA 1NM6A 1O3DA 2O9QA 2STBE 1K1PA 4B2CA 3LKWA 4K3JA 3SNDA 4HTCH 1TIOA 2ZPRA 2GMTB 1V2UT 1JRTA 3O8BA 4NIYA 4Q7YA 2PUXB 5A0CA 3M7QA 4I33A 1Y5BT 3BEIB 5FCRA 4WMEA 4K1TA 5DJ7A 2GX4A 5F03A 1GBJA 3T25A 1BJVA 2ZZUH 2AGGX 1UK4A 4AG2A 1YLDA 2PUQH 2GGVB 4AYVB 1SGYE 3MO6A 1F5LA 1GHZA 1O2SA 1C9PA 1RJXB 3UTUH 4ZXXH 4ZKOU 5K7RA 4B71A 1EB1H 3UQOA 1T7CA 3RMNH 1KDQA 1TB6H 2J95A 3PMAB 1BHXB 1TBZH 1TNLA 4UD9H 2AIQA 2FESH 4GCHG 4X1RU 4SGBE 4NZLA 4KELA 2GT8A 2J92A 4NZQA 3ZVAA 4F4OC 1GBBA 1Z6EA 4NWLA 2A4GA 5C5OA 1O35A 3GYLB 5C1YA 4KGAA 2C8XB 3E1XB 4NA7A 2G8TA 4AFSA 2Q6DA 5LGOA 1AGJA 2ZFQH 1QHRB 1PYTC 5FHTA 2BD9A 5EU8A 1UK3A 5JBAS 1TX8A 4ZH8A 4MNWA 1SPJA 2BLWA 2ODPA 1TX7A 4DG4A 5HMAA 2OP9A 2BLQA 4TY7A 1ZPBA 1PQ8A 2ZU2A 4WJG2 1ZPZA 4I31A 1XX9A 3GCOA 2GV7A 2IN2A 1HRTH 7GCHF 4IMZA 1YPJH 3T2NA 1SB1H 4ESTE 3QLPH 1GCTC 3RC5A 1ESAA 1UTQA 2A32A 1AZ8A 1ZHPA 3HGPA 1RIWB 1C1SA 2GCTC 1O5EH 5AVDA 1C2IA 1SL3A 1OWIA 1XUJA 4DCDA 1OKXA 1C5LH 4WH6A 1AKSB 1PQ5A 1GMDG 3GCNA 2G5NA 2PTNA 1O2PA 3ATMA 2QV1A 4JZEH 1FXYA 4O9VA 2QF0A 1LKAA 1QB9A 1UVUH 3D62A 3I78A 1LDTT 1IQHA 4FXGH 1P8VC 1VITF 3LONA 3UREA 1B0FA 2FI5E 5JDUB 2UUJB 1YM0A 3TK9A 2GP9B 3PWBA 1C5QA 4IN1A 2Z9KA 3BTDE 3VGCB 3DA9B 5C67A 2XC4A 1DLKB 5DGJA 2FOEA 2AYWA 2B9LA 4BTTB 1W3CA 3HPTB 4D9QA 2ANMH 4JZFH 1C5WB 1HAYB 1N8OC 3V7TA 3FP6E 1PPHE 3KN2A 1C2KA 1BRBE 3UOPA 1HAXB 2BB4A 1G32B 1G2MA 1N8OB 1ABIH 3TNTA 1HAOH 4XE4A 5DP8A 5C5NA 2C3SA 1LVOA 4YTAA 1TNJA 2BY8X 1BB0B 1VZQH 4THNH 1WQVH 3VXFH 1UO6A 1DUEA 3BTWE 3SUEA 3SJ9A 1FAKH 2ZG0H 1IHTH 3O8DA 1NRSH 1HIAA 1SGIB 1MH0A 1P0SH 4WWYA 2B0FA 3UR9A 1BMLA 1XXFA 4LK4A 1DANH 5FBIA 3SU0A 2BDGA 2R0KA 4A6LA 1NO9H 2AGEX 2P59A 3ODDA 3RXGA 1G3BA 3B23B 1IAUA 1J8AA 1TA6A 1AVWA 3QTOH 3A88A 1ZR0A 3TGIE 3PB1E 3SOSA 4A7IB 2XXLA 1ETSH 4MPUA 1BMAA 3BN9A 1C1RA 5GWZA 2Y82A 2J4IA 1HNEE 1CVWH 3RM2H 3V12A 4AOQA 3UY9A 2A31A 1G9IE 1RRKA 4FUBA 2W7SA 3STIA 1YBWA 2P8OC 2G52A 1K1NA 1F5KU 5EQQA 1CBWC 1DFPA 1A0HB 1QFKH 1DWEH 4DT7B 1TPSA 3E90B 4IGDA 4MPXA 3EAJA 1RTLA 5E0JA 2Z9IA 3HKJB 2QAAA 1OYTH 3RC6A 1O2GH 4I8KA 1CT4E 2H5CA 4JK6A 3MMGA 2HNTC 5J4QA 1A3BH 2EI6A 1LPZB 1EUFA 1O2NA 5BPEA 1C2MA 2ILNA 2W7UA 1G36A 1KXDA 3HATH 3GISB 1BRUP 1EASA 1DOJA 2CXVA 8KME2 4ZHMU 3DUXH 3E0NB 1QBOA 2QGRA 3RU4T 1GJ4H 1C5UA 3EA9A 3PMBB 1O3CA 3EDXB 2QYIA 2ZGCA 1O30A 3TH2H 1C2JA 4O97A 4JZDH 1CGHA 2ZDVH 2XYAA 2EEKA 3B9FH 1E38B 1K21H 2Y6TA 3RXCA 5JB9S 1HPGA 2F9PA 2BY5X 1C5OH 3FANA 5L2YH 4CRDA 2PSYA 4BANB 3GDSA 4LZ4B 1O5FH 3BF6H 1AKSA 4Y0YE 2Y81A 4E05H 2VIDA 1P11E 2O8TA 3NZIA 3RMMH 1O2XA 2GTBA 2H9HA 2OUAA 3M7TA 3EYDA 4AX9H 1EZSC 5DKMA 1TX6A 5DP4A 3A87A 4B1TA 1T4UH 3K65B 3SZNA 5FCKA 2JH5D 1OP0A 2ZU4A 5IDKA 4BTIB 1XUFA 3KQCA 1TGTA 1LQDB 1C2DA 3BTME 5EODA 5EW2H 3ZYEA 4U32A 1MCTA 2WUBA 1PPZA 1EB2A 4AG1A 1JOUB 3GDUA 3ZZAA 1MQ5A 3SUDA 2Q6GA 1HYLA 4FUFA 4X2VA 3H7TA 2I6QA 3VGCC 1IQJA 3ZVFA 1HAPH 1P2OA 1O3HA 2PFEA 2A45B 4GPGA 1NFYA 3A83A 3E16B 2OQUA 3P8NA 1EXFA 3TGJE 2QA9E 3RXRA 3RXTA 5AFYH 2G55A 1UTLM 3S7KB 2V0BA 2C8YB 8GCHG 1O3PB 2ZCKP 2SGDE 2BZ6H 2TPIZ 1G2LA 4O3UA 5DO4H 1O31A 4D76A 1F0TA 3L3TA 1TRMA 4NFEA 2JKHA 3A8DA 1NRNH 1PPBH 1BTYA 2NU0E 2HPQH 2W3KA 4Q2KA 3BEFB 1CBWB 1AWHB 4BNRA 1HCGA 5AFZH 2XW9A 2ODQA 3HKIB 2Z3CA 3R0FA 1NFXA 5LH8A 2HVXA 1GHYH 2ZU3A 1P2IA 2SNWA 5DG6A 4D9RA 1RTKA 1SHYA 5TCCA 5L30H 4X1NU 1C2GA 4X1PU 1MBMA 1UVPA 2GMTC 2JETC 4KTUA 1HAVA 3SUFA 3RXLA 1FY4A 3SHAH 3MNCA 2DE8A 1ZYOA 2FTMA 4NA9H 4NGAH 4B76A 1LHFH 3M3SA 1BTWA 1UTJA 1C4V2 1IQGA 5FBEA 1MTNB 1O38A 2ZGHA 1MAYA 1XVMA 2OLGA 4DIIH 1L4DA 3FVFB 3ATWA 4F49A 1AHTH 1SHHB 1PPGE 2FOHA 1UTMA 3PROA 1KXAA 2BOKA 1ZSJA 3ZZ7A 2AMDA 5K0HA 2ZECA 3SJOA 2Z7FE 4WXIA 5HXFA 5FPSA 3LU9B 1V6DA 1EAIA 1FPCH 4NSVA 2VH0A 4OS7A 1O2YA 1KTSB 1UVOA 5LPFA 2VVVA 3BTEE 3SBKA 3FZDA 3T26A 1GJBB 2BY6X 3TH4H 1GBMA 3ZVBA 1SGRE 3S0NA 2XBVA 2ANYA 1G30B 1ZTJA 4X1QU 1RTFB 4K5ZA 1P2JA 1O2TA 1SOTA 1TNHA 3TJVA 3RXDA 2FZZA 3CS0A 2R0LA 3LJJA 1C4Y2 4RN6A 4OGXA 1XKAC 2EA3A 4CRAA 4OS6A 1MTVA 3C27B 4CR9A 4AN7A 1LTOA 2TBSA 3SV2H 4Q80A 1YKTA 3IITA 3RLYH 4XBBA 3UUZA 3F1SB 1ANCA 5B6OA 1XUIA 1UJ1A 4NIWA 1MKWK 1SQOA 4A1VA 1O0DH 1A3EH 2QN5T 1P12E 4MDSA 1V2QT 4HI3A 1GI3A 4A5TS 1BZXE 1OWEA 1QL7A 1XUKA 4BXWA 5BRRE 2OQ5A 1MBQA 1Z8RA 1RFNA 2BD8A 4IC6A 3PO1C 4CBOA 3OTJE 1K1JA 2EI8A 2ZGXH 1O2MA 1FV9A 1K1OA 1EAWA 1VGCC 1PJPA 4Y7AA 4PROA 4BAHB 1GGDB 1GDQA 2F9OA 2R9PA 3TJNA 2GCTB 1FIWA 3SU6A 1O3JA 2VIPA 5GIBA 1GBTA 1MKXK 1TMBH 1LVYA 1WSSH 3Q3XA 1FNIA 4BAOB 1V2TT 1QGFA 5FXLA 3SV7A 4INHA 1QB1A 2A2QH 1TQ0B 1GHBG 2H6MA 5E0GA 2R2MB 3Q76A 4CREA 4E06H 2QC2A 1H9HE 1C5NH 2JH0D 4Y8XA 4NCYA 4IW4E 5T6FA 3ZZ5A 3AAUA 1KTTB 1S5SA 5EPNA 3UFAA 1BBRE 4CRCA 4Y76A 3SO3A 3P8FA 4INKA 3EA8A 1S81A 1TYNA 1G3CA 1EAXA 1VJ9U 3FP7E 3IG6B 2ZPQA 3PM3A 3ELAH 4NWKA 1XKBC 3NK8A 1V2WT 3SV9A 1GL1A 1O5GH 4X6MA 1DITH 2BY7X 3F6UH 1TGNA 2BDYA 1BRAA 3PMHB 3SN8A 3STJA 2GCHG 3F9HA 3CS7A 1Y3VA 1GWAA 2RG3A 5AHGH 3P17H 4JYTA 2ANWA 5CHAB 2H9EH 2JH6D 4Y10E 3SNBA 1TBQH 2BLVA 1FZZA 1O3AA 1LQEA 1HAZB 1ELVA 4R0IA 1QURH 1WQSA 2XNIA 2ZU5A 4XFQA 6CHAC 2ZHDA 4K8YA 3AW0A 4RKOB 1UMAH 3SORA 3PTNA 3A8CA 1LHGH 3PO1B 3M35A 1ELFA 5JPMH 4ZKRU 4BAMB 2P3FH 3RXOA 1V2KT 1QRXA 5GDSH 4AORA 1V2NT 3SHCH 5EOKA 3F68H 1P2NA 1IQEA 3OU0A 5T3HA 3SJKA 2P8OB 4NA8A 3T29A 1KIGH 3JZ2B 4X6OA 1GHVH 1LVBA 3MNBA