1TNHA

Prediction of novel serine protease inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnhA02
1ESAA 3AASA 4ZKOU 4JZFH 3P95A 1JIRA 6LPRA 1GHAG 1AFQB 4K5ZA 2BY7X 3SUEA 1GHZA 4I8GA 3PB1E 1X7AC 1S6HA 2D2DA 3PMHB 2Z9IA 1FY1A 4UEHH 2BY9X 2Z3CA 1GMCG 1LHEH 3TJUA 3SJ8A 1OP2A 1LVMA 1QR3E 1KTSB 4AN7A 1OYTH 2H9TH 1GL0E 2OP9A 2A5AA 1BBRH 1GBIA 4CBOA 4FUBA 1CA0B 1W13U 2NU2E 1T8LA 5JYIA 1EPTC 1UTNA 2QF0A 2VINA 3VGCB 2ZCLP 2VVUA 1BHXB 4TPYA 3SU1A 3F9HA 2ZGCA 2HLCA 2PGBB 1O3MA 1CE5A 3PO1B 1DWDH 1NO9H 1AMHA 2PTCE 2D1JA 3SU3A 5C5NA 5T6FA 2VGCB 4B2BA 4Y71A 5E0GA 1O3CA 3RXLA 1EOJA 1XKAC 1XVMA 2FEQH 3BTEE 4BXSA 4ISHH 4KKDA 1SGNE 1SGCA 3BTHE 1SBWA 1EXFA 2GMTB 1K1LA 1TRMA 2ODPA 1SGDE 4NFFA 4CRCA 3ATIA 1FNIA 1D3TB 1LHFH 2TGPZ 3BTGE 3PV4A 1SSXA 1NN6A 2CV3A 3ZZCA 1ELGA 1AB9C 1UTOA 2VNTA 2I6QA 2Q6FA 4AX9H 1GI5A 5F8XA 1F5KU 3I78A 1CGHA 2AIPA 2FO9A 2ZP0H 1O2HA 4A7IB 1H4WA 3ZZ9A 2OC7A 1HPGA 4GCHG 5PTPA 1TGTA 1LQDB 1O2TA 1TB6H 2UUYA 2J9NA 2BTCE 2R0LA 1BTUA 2Z9KA 1O2KA 2OBOA 2OC8A 1C1QA 2PR3A 4Z6AH 3ZVFA 4GVUA 5JBTA 1EJAA 1LPGB 6ESTA 1UVUH 1IAUA 2AGGX 2CF8H 1P3EA 1F0UA 2V0BA 3A86A 3TH4H 3QK1A 4Y76A 3K6YA 1O2SA 1O3JA 2ZTYA 3LC5A 1O32A 2CJIA 1HAVA 2GT8A 2JKHA 1SGRE 2EEKA 1TMUH 1O2IA 2XCNA 1G2LA 2ZHWH 1W8BH 3EGKH 1TGNA 2ZDNA 2Y81A 3BTDE 4LOYH 5A0CA 1E34B 3IITA 1H8DH 1P57B 2VIWA 1GJBB 1PPHE 4K8YA 2H9HA 1UTKA 4O3TA 5TCCA 3MH4A 2G4TA 5J4SA 3BG4B 1ABIH 2QYIA 3OY6U 2C4FH 2W3IA 5IDKA 1NFXA 1L4ZA 1C2FA 2ZHEH 1YPGH 1Q2WA 1C5QA 5HXFA 1DE7H 3ZZ3A 3RLWH 3SU5A 2ZU1A 2RCEA 2VIPA 1QRXA 2SNVA 4NA7A 1M9UA 3UWJH 5DP8A 6GCHF 1GHVH 1D9IA 3KIDU 3RXFA 1SFQB 3TK6A 2ASUB 3LGTA 2WPLS 1EQ9A 1A3EH 2BD5A 1WBGB 2BX3A 2BDBA 1QHRB 3PLKA 4JZEH 1W14U 1VZQH 3PWBA 2R3UA 3GDUA 1P8VC 2BD4A 4H42U 5FBIA 1A5IA 1XMNB 2WPJS 3UOUA 1V2PT 3ZYDA 4DW2U 1C4V2 2P3FH 3KL6A 4ISIH 1LKAA 1GJ5H 3H7TA 5ABWA 2QXHA 3PLBA 1QRWA 3PMAB 3FP6E 3NZIA 2ZU2A 3T25A 2ZFQH 1HUTH 4MPWA 1TOCB 1SQTA 2AGIX 1YP9A 1O3FA 1H9LB 3ZV9A 2SGAA 4KP0A 1QQUA 1GJ9B 1S82A 3UFAA 2B8OH 1TQ7B 4A92A 4WVPE 4YOJA 1O3NA 3KNXA 3UUZA 3UREA 4LZ1H 2FOCA 3DFJA 3EA7A 1SI5H 3SI4H 3NK8A 2C8YB 1F0TA 1PQ5A 2F9PA 3SOSA 1G37A 3KQEA 2NU4E 1MTUA 1T4VH 1VR1H 3EAJA 1HAGE 7LPRA 2FYQA 2Y6TA 1E37B 4YO9A 1C5YB 1NU7B 4ABFA 4X2VA 2Z7FE 3MHWU 1THPB 4CH8B 3GCHB 2GV6A 4KGAA 1HIAB 2BVSH 3UNSA 4VGCC 5DP9A 2BHGA 5A8YA 1TBQH 4B73A 1MTSA 4E7NA 4AG2A 4NWKA 3UTUH 1C1MA 1IQEA 3FANA 3RMNH 1AKSB 3TITA 4BTTB 3RXCA 1K28D 3SI3H 4IS5A 2DE9A 1RJXB 3K2UA 3KQDA 1FY8E 3T2NA 1QJ7B 2V3OH 2TPIZ 1C1RA 2FPZA 1TGSZ 5T6DA 1UMAH 3QGJA 3SV8A 1TX8A 4O97A 1BITA 3O8CA 4ABEA 3RM0H 5F6MA 3KQCA 1YM0A 2PKSB 1NU9A 2QCYA 2ZEBA 2UUJB 3T28A 3HKIB 1DT2A 1QJ6B 1L2EA 3S9AA 2PKAB 2GGVB 1DLKB 2FZZA 4AFQA 1NRPH 5FCRA 2P95A 3VB3A 1YPEH 2FLBH 1RTKA 5AFYH 4AOQA 4D8NA 1BRAA 1A1RA 3TJOA 1C5OH 1EZUC 5FX6A 3V12A 2AIQA 3D65E 2HVXA 1AUJA 2WINI 1A2CH 1C2MA 4ZUHA 3OU0A 4AORA 1JIMA 5FAHA 5H4IB 1TMBH 1ZRKA 1MCTA 1GI1A 1OOKB 1C4U2 4I8HA 4M7GA 4B1TA 1F0SA 1YKTA 1ZTKA 4I8KA 4TPIZ 1SR5C 1C5UA 5CHAC 1O3AA 1EATA 2GDEH 1C2IA 4Q80A 1EB1H 1SPJA 1PQAA 1CT4E 4U32A 4Y7BA 3FZDA 1ESTA 3ZZAA 4LXBH 3Q3KA 1WAYB 2SFAA 1EX3A 2EI6A 3TNSA 5GWZA 1EB2A 3P6ZB 1IQNA 1V2NT 3SU6A 1GI0A 4WMFA 1O30A 5EQSA 1J14A 2ZC9H 4ZHAA 1FPHH 1ZSJA 5DG6A 3HGPA 3K9XB 3QUMP 3BTME 1MKWH 4Y8XA 5CMXH 1EZSC 3UQVA 3HPTB 5TCAA 1GHYH 1CT0E 1S5SA 2I6SA 2SGFE 2BLOA 3A89A 4AFZA 1OPHB 2Q1JA 1DSUA 1WUNH 1GGDB 1MTNB 3DT0H 4MG3A 1YPKH 1TBRH 1A46H 1GVZA 2KAIA 1GG6C 2BD2A 1V2JT 1HAYB 1BTPA 4CRBA 1O2NA 3SN8A 4K1TA 3GY4A 3S69A 3OY5U 5EODA 3JZ1B 1EASA 2ZFTA 1V2ST 4Q7YA 3UNRA 2OLGA 1BJUA 1VCWA 5C1YA 2ANMH 4DGJA 1QB6A 1E38B 2THFB 4MNVA 1BTYA 3PMBB 2QAAA 2Z3EA 4CR5A 1GCDA 1ZMJA 4MPUA 1C2DA 3ZV8A 2ULLA 3VPKA 1FN6A 1CSOE 1OP8A 1BT7A 1GDNA 3C1KA 1S85A 1C5WB 3NWUA 2EC9H 1K1NA 2F3CE 4BAQB 3GOVB 1AGJA 1O2WA 1HAHH 2TGTA 5E2OA 2DUCA 4E05H 5FHTA 1D3QB 2WPIS 1F7ZA 5L6NH 2Y5GA 1SLVB 1HJ8A 8ESTE 3S9BA 2BVXH 4JZ1A 1EP5A 1ZSKA 5EQRA 5FCKA 3M36A 5L2ZH 2A32A 3UNQA 3TJVA 3U8RH 2FS9A 1ZYOA 4ZMAH 1RGQA 2FI4E 1DX5M 1N1LA 1P2NA 4CREA 3E8LA 1SGYE 3CP7A 1C2KA 4QT8C 3ZZ5A 4MTBA 2GZ8A 1L0ZA 1BBRK 4WMEA 2ZDLA 4LZ4B 1AI8H 3GYLB 1GBCA 1Q3XA 1LHCH 2BZ6H 3STIA 2G00A 1SMFE 1HDTH 3PWCA 3URDA 1L1JA 1TYNA 1S6FA 2AFQB 3FAOA 1GJAB 1W3CA 2BY5X 2F9UA 1P02A 3A8CA 1TBZH 1DOJA 2GCHF 2EA3A 1SC8U 1CA8B 3TIUA 1GCTC 2ZA5A 2NU1E 2C8WB 1WTHD 5EXNA 1S83A 2WPKS 4I8LA 4GSOA 3HK3B 1GVLA 1B5GH 4BANB 1UK4A 4WJG2 1P01A 4D76A 1PPEE 1O2GH 1BRBE 1C5VA 1WSSH 1O5CB 2A4OA 2AMDA 3LGVA 3UOPA 5EW2H 3LH1A 3RC5A 2FOGA 1C5XB 2BVRH 3M3SA 5AHGH 1RIWB 1QA7A 1GPZA 2WV5A 4A6LA 1OWEA 1O5DH 3RP2A 2JETB 2Z9JA 4IW4E 1UVSH 1W2KH 1O3DA 2FTLE 1N8OC 1ELFA 2CHAC 4ABGA 1TLDA 1F0RA 4OS6A 4Q7ZA 1TNLA 4ZXXH 2GCHG 1LTOA 1MUEB 3SQHE 2O8UA 3CS7A 2SGEE 3A83A 2J92A 3VEQB 3SO3A 1UO6A 3MTYA 2V6NA 4AYVB 2AS9A 1AB9B 4B76A 4KTSA 1MTWA 5JBBS 2A5KA 1PQ7A 2BDCA 1W7XH 2Y80A 4XE4A 1DY9A 2UUFB 5HGGA 3KEEA 1BJVA 2HOBA 1O38A 1MAYA 1L1NA 1CHGA 5DGJA 1TNHA 2CGAA 3A7TA 4CH2B 2HNTE 1ZRBA 2A2XH 3M5NA 5I25A 2Z9LA 2ANWA 4NA8A 1DWCH 3ZZ6A 4X6OA 5A0AE 2FI3E 1CGJE 2FS8A 2BM2A 1FUJA 1EPTA 1S0QA 3P8GA 1TPSA 3MYWA 1FY5A 4X0WU 1AFEH 3RXVA 2NU0E 1GI9B 4ISLA 1W7GH 1AD8H 1XUFA 3SGBE 4AYYB 1ANBA 4NIXA 2O8TA 4Y7AA 1W10U 1VITH 1FAKH 4Y8ZA 2Z3DA 2H5DA 1S84A 7GCHF 2Z6BD 1LQEA 3D23A 4UFGH 1YPHC 5K7RA 1D3DB 4NFEA 2H1UA 1C9TA 1O2UA 3P8FA 3ZVCA 1GVKB 2G8TA 5DK1A 1ANDA 2YNBA 3O8DA 1MH0A 2PUQH 1CU1A 1TGCA 1V2KT 1AVXA 2CN0H 5SGAE 4UFDH 4O9VA 3RMOH 2GTBA 1GWAA 3QN7A 3SU4A 4NIVA 2PSYA 5E2PA 1Y3VA 1KXFA 2PW8H 3MNXA 1D4PB 2FXRA 1QURH 7GCHG 3BTWE 4Y10E 3UWIA 1O2ZA 3SV9A 4O3UA 2ZU5A 1HRTH 3A8DA 1FIZA 2F9VA 1C5TA 4X2YA 1ETSH 1O35A 2IN2A 1OWHA 1PPCE 3ODFA 1YPJH 1SB1H 5HYOA 1SOTA 1EUFA 3B8JA 1HAVB 1ZOMA 1JWTA 4ZKSU 1ETTH 1KDQA 2P8OB 2UWLA 1FXYA 2F9BH 1YBWA 3TK9A 2QGRA 2RDLA 3QTOH 4JMYA 3AAUA 1IOEA 1V2MT 3U1JB 3VXFH 1CO7E 2BDAA 2ZFPH 5ETXA 2VVCA 4CBNA 2GV7A 1AY6H 4OS2A 1XKBC 1O2PA 3FZZA 4K2YA 2FLRH 1LPKB 1DUAA 1BIOA 1O33A 3M7UA 1B0FA 1OS8A 2BYAX 3E91A 5BPEA 3P92A 4H6TA 1BDAA 1TALA 2J34A 1W12U 3JZ2B 2QY0B 1CGIE 2AYWA 2CMYA 1IQFA 2J38A 2J4IA 3U69H 1UTPA 4BAMB 4DY7B 1KXCA 1CBWC 5F8ZA 2GZ9A 2ZHDA 1EZQA 1G3BA 2EI8A 4A5TS 3F9EA 4UONA 1RTFB 1NRRH 3ATMA 3AW1A 1UK2A 5E0JA 2AEIH 5E0HA 4X1PU 3GCNA 1EP6A 3U98H 3L3TA 5JB8S 1GBBA 1QL8A 1S0RA 1O34A 3MU0A 4KELA 4SGBE 3VB7A 6CHAC 3K6ZA 3L33A 1O3LA 2B9LA 4HFPB 1FN8A 3LONA 7KMEH 1EOLA 1HXFH 1FV9A 3MH5A 2OD3B 2VU8E 1UVPA 1O3KA 2D8WA 3RXQA 1C5PA 4CRGA 1HNEE 3A81A 1J17T 2BDYA 4OGXA 2F9OA 1Y59T 2IOTA 4ZXYH 1NFUA 5IYTA 2XXLA 9ESTA 1O2OA 2Y7ZA 1C5LH 1AVGH 3SZNA 3MOCA 2AMQA 2PHBA 3MU1A 3SU2A 1J8AA 5FX5A 1GBLA 1HYLA 4DVAU 3FFGA 1GBJA 2ANKH 1BZXE 2ZFFH 3LH3A 1Y8TA 1HGTH 1UTJA 2ODQA 5EPYA 1C2JA 2XRCA 1VITF 3GISB 1JOUB 2FIRH 3MWIU 1WCZA 2W7UA 1GJ4H 1YPLH 3B23B 1RFNA 3RU4D 5FPSA 8LPRA 3V0XA 2EI7A 2ZTZA 1HJAC 1TONA 2BX4A 2XBXA 3I77A 3F9FA 2FOEA 1WV7H 3RXEA 3TPIZ 9LPRA 1GHXH 3ESTA 4NIWA 3LPRA 4JCNA 1LVOA 1NESE 3F6UH 5GJ4B 5A2MH 1C1OA 1T8OA 4TWYA 1UHBA 1VITG 1IQJA 6GCHG 4FUGA 3Q00A 1FI8A 1ESBA 4CRDA 1O3PB 1P2QA 1UVOA 3FVFB 4D9RA 2ZI2H 1F92A 1MKWK 4YTAA 3L6PA 1O5GH 1T32A 3ZVEA 2OCVB 1PPBH 1P10A 1DLEA 1JRSA 4Y79A 1VJAU 3M61U 2A1DB 4U2WA 1Y3WA 5B6OA 1P2JA 4XBCA 3PTBA 3ITIA 1YGCH 2Z9GA 1BHXF 2Y5FA 1TX7A 2PLXA 1QBOA 2LNCA 1S81A 4O03A 3M7TA 4WXVA 3T27A 2BOHB 1ARBA 3P8NA 1GHWH 3KGPA 2HPQH 1OXGA 1C2GA 1P2IA 2IPHA 4F49A 5EG4A 4BXWA 2DE8A 4FU9A 2H2ZA 3ODDA 1JMOH 4IGDA 3RXAA 4JZDH 2VIQA 2W3KA 1AE8H 1HLTH 1KTTB 4DOQA 4WF8A 1Z8JB 4ABAA 2WPMS 5DKMA 3RXKA 1ANEA 1FY3A 5ESTE 1IHSH 2ZDMA 4ABJA 1T8NA 1EAIA 1K1JA 1V2VT 1Z1IA 1NY22 1Z8IB 1ZTJA 2QIQA 3ZVGA 1BTXA 1N6XA 8KME2 1QJ1B 1ZJKA 1P0SH 2CXVA 1SLWB 1K1OA 1ELEE 3TNTA 4F4OC 4FVDA 5C3NA 5LGOA 1LKBA 1AZ8A 2GVFA 3PTNA 4NG9H 3BG8A 2OQUA 2PSXA 4ZHMU 2B5TB 5C20A 1GI3A 2FODA 3OX7U 2QXJA 1BUIA 2RA0A 4UDWH 1XUHA 1BCUH 1NZQH 3I29A 3TH3H 3M37A 1H8IH 5C1XA 2BZAA 2KAIB 1DANH 2AMPA 4CRAA 2GP9B 2FTMA 4MNXA 1P2KA 4UFFH 2ZCKP 3UY9A 1JBUH 1GJDB 2XYAA 1ELVA 3TK5A 1K1MA 1TRYA 2GCTC 4GAWA 1IQIA 1OWJA 2A45B 1G3EA 5FXLA 3EA8A 2XC5A 2PFEA 3BG4C 1ACBE 2BXUH 4XSKU 3RXIA 2P3TB 2XBWA 4U01A 3RXTA 3R3GB 4NSVA 2V35A 2AH4X 4JYUH 3M5MA 1XUJA 1L4DA 2JH0D 3BEIB 3A7WA 4J1YA 2QC2A 3QWCH 1EKBB 1SGIB 2OTVA 1GCTB 1Y3UA 4OS4A 1MU6B 4MDSA 3VB4A 4ESTE 3BSQA 3UIRA 1HAZB 2ZGXH 4OS5A 1W11U 3P70B 3TVJB 1K9OE 3MFJA 1C1UH 4D7GA 1KXEA 2J2UA 4ZKRU 5BRRE 2G51A 2O8WA 3CENA 4Y8YA 4H4FA 5EQQA 3STJA 3UQOA 2OC1A 4MVNA 1QFKH 4FU7A 1TWXB 2FP7B 1C5ZB 4FXGH 5A8ZA 4XFQA 2CHAB 1O3HA 1AN1E 5C2ZA 3HK6B 3NKKA 5DJ7A 1OKXA 1P12E 1SLUB 4WXIA 3TGKE 1OYQA 5AVDA 1LMWB 3RXPA 3F1SB 4NWLA 2STBE 2VWOA 1QQ4A 1MQ5A 1P06A 1C2LA 4A1XA 1O2VA 5EW1H 1ZPBA 1MAXA 1ANCA 2XWAA 1OP0A 5DO4H 1FQ3A 1D6RA 3VFEA 5ESBA 2SNWA 1GJ6A 1BTHH 1RTLA 1ELAA 1GBMA 3P8OA 3U9AH 1P2MA 3IWMA 1BRUP 3E16B 1PYTD 4ABBA 1GJ8B 4OS1A 1XXFA 1HAXB 2SGDE 2FYRA 4FUIA 4FUDA 4ZROA 1XXDA 1C2HA 1P03A 1K1PA 1Q31A 1QBVH 2BY8X 2G55A 3W94A 4AFSA 1UTMA 1BMNH 1ZTLA 3E90B 5EOKA 1LHDH 4MPXA 2TRMA 3S7HB 1UCYE 1K2I1 1TMTH 4WH6A 1V2OT 4K60A 2XNIA 1E0FD 1OWDA 1MQ6A 3LOXA 5DP7A 2TBSA 4CHAB 3RM2H 4IMZA 2BQ7B 1TNKA 1QL9A 2QXIA 3RMMH 1C1PA 1EJNA 4H6SB 1THRH 1E35B 1TE0A 2OUAA 3E6PH 1O0DH 4TY7A 1CT2E 1KXBA 1C1TA 2WYGA 1AVWA 2A31A 1MZDA 2ZGJA 3MU4A 3QZRA 2UUKB 1H9HE 1LHGH 2IJOB 1E36B 3SHCH 1SOZA 3ZZ4A 2ILNA 1PPGE 3SV7A 3ZVBA 2P94A 5EU8A 1SLXB 4J2YB 2FX4A 2G52A 3RUOA 4UFEH 4I8JA 3ZVDA 2ZGBH 4K1EA 3DUXH 1RRKA 2ZIQH 1GMHF 1TQ0B 3LT3A 3EA9A 1MZAA 3NPSA 4OS7A 2BDIA 1G2MA 3NUMA 3A7XA 1HBTH 4MNYA 1HAPH 1O3IA 1GBDA 1EPTB 2A0QB 4LK4A 1A5GH 1ZSLA 3MO9A 1O3EA 1IQLA 3RU4T 3RXUA 3EQ0H 2JH5D 1GDQA 1L1GA 2HPPH 4AB8A 2ZKSA 1QTFA 2PUXB 1RS0A 4THNH 4D9QA 4FUHA 1NTPA 5GCHF 3HKJB 2P93A 1GMHG 2W26A 2XTTB 4MPVA 3RMLH 1HAOH 1W0YH 2ZDKA 4XOJA 2B0FA 3GY7A 1MD7A 3U8TH 1TGBA 3MMGA 3EYDA 3VB6A 1C5RA 2BD9A 3IG6B 1KLJH 3MI4A 1BRCE 1A7SA 1ZMNA 4INLA 1Y3XA 1NFYA 2ZCHP 3E1XB 5F03A 4YESB 3RXGA 1P05A 2UWOA 4X6PA 2R3YA 2R9PA 2VWLA 3BTFE 3O8RA 4DIHH 1A0JA 1KYNA 1MU8B 2G5NA 1EAWA 1O2MA 1HFDA 4Z0KA 3M3VA 1WYKA 1Z8RA 1JXPA 2GZ7A 1O3GA 3D62A 3PROA 2D26C 1K21H 1CBWB 2A7JA 1G30B 3U8OH 4HZHA 1PJPA 4YM9A 1TA6A 3LC3A 2FOMB 1KDQB 4FVBA 1ELCA 4DG4A 2CF9H 3TU7H 1AO5A 1ELTA 4SGAE 3QX5H 1TFXA 2ZGHA 1TX6A 4INKA 1DY8A 5J4QA 5AFZH 2BLVA 2F9NA 3MNSA 4E7RG 3A88A 4NIYA 2ZG0H 1ZHMA 6CHAB 1DDJA 1KSNA 1W0ZU 2XBVA 2FWWA 1QRZA 3GYMA 3RXOA 1FDPA 1SHYA 3KCGH 5GDSH 1A0HB 1Y3YA 1D6WA 1O5EH 3F9GA 3GCOA 3ZZ8A 5CE1A 1UTQA 2FOHA 1MD8A 2BY6X 1GI2A 1GMCF 3MO3A 1C1WH 1DITH 1AHTH 3SHAH 1OWKA 3RXBA 2VH6A 1MKXH 4X8SH 2Q6DA 4B75A 4MLFB 2V3HH 3TLOA 1XUIA 2J95A 1INCA 1NM6A 4E06H 1YCPH 1O5BB 1O2QA 2GT7A 2XWBI 1K22H 1MBMA 4RSPA 1DXWA 1ORFA 2Q6GA 1SQOA 1QNJA 3UR6A 3BEFB 5LPEA 1WQVH 1HAIH 4DCDA 4K69A 1HJAB 2PWXA 4A1TA 4AGJA 4Y0YE 1V2WT 3KN2A 1SGFA 3GDSA 1GI6A 4X8VH 1YC0A 1XM1A 1TPOA 4X8TH 4IMQA 1Z71A 1VCQA 3RLYH 2HRVA 1O2RA 1QCPA 3ATLA 3E0PB 1ZPZA 5DPAA 2H9EH 2RG3A 2XC0A 1O3BA 1QA0A 1UCYH 1VGCC 4YZUA 1MBQA 4X1QU 1RIWC 1LVBA 1TPAE 2JETC 1SGQE 4GLYA 2FOBA 2ESTE 4GCHF 1GBAA 2FI5E 1G3DA 1UJ1A 4NSYA 4ABDA 1PPFE 2WUCA 1DSTA 1AU8A 3A80A 3SNBA 2C90B 2AERH 4NGAH 3U1IB 2BD3A 5DP4A 5DP5A 4IN2A 4B2CA 2XW9A 4A1VA 2TIOA 7ESTE 3E3TA 5HMAA 1V2UT 2TGDA 1P2OA 2K1QA 4IBLH 2A4RA 2O9QA 1TOMH 4K1SA 4VGCB 3SNEA 1NFWA 4X6MA 1TAWA 2JH6D 1CQQA 3BTKE 1ZHPA 3GY8A 3A8BA 5EXMA 3FP8E 1ABJH 1UHBB 1GBTA 2BQ6B 3KQBA 1OWIA 2F83A 3GY6A 1BOQA 1NRQH 1GJ7B 1WU1A 1BQYA 3BV9B 4PROA 3SNCA 3SNDA 3S9CA 5FBEA 4ZAEA 3SV6A 2PGQB 1THSH 2OQ5A 2VIOA 4NCYA 1KLIH 4Q2KA 3W95A 1KXAA 4Y0ZE 1DWBH 3GCTF 1C1NA 2B7DH 1OX1A 1Z1JA 3QLPH 3H5CB 2PV9B 1YYY1 2BB4A 1TABE 3A7YA 3PYHA 1LVYA 1O2XA 1YPMH 2ZHFH 2FMJA 3GY3A 3BN9A 2ALVA 2VWMA 2WYJA 4FUFA 2BQWB 2FDAA 1LCYA 1J15A 5G4BA 3VXEH 1ZLRA 2O8LA 3M35A 5LPFA 2QV1A 3A8AA 2ZNKH 1TRNA 2BDGA 1KY9A 4HTCH 3P17H 2ZU4A 3A84A 1BTWA 3AW0A 3FP7E 1UTLM 2VIVA 1GL1A 1EZXC 2UWPA 2GD4B 2ZQ1A 1SGFG 3V7TA 4XDEA 1BMLA 1T4UH 2SGPE 2GCTB 3GCTG 4X2WA 3M5LA 3SU0A 1T31A 1T7CA 1AFQC 1UVTH 1TA2A 2ZWLH 1J16A 2ZDAH 4WWYA 3M3TA 1KLTA 1C4Y2 2ZZUH 3B9FH 3KF2A 4ZHLU 1NRNH 2PTNA 1DUEA 1TNGA 1ZGVA 2C8ZB 1YLCA 1U6QA 3QO6A 3HATH 1A4WH 2OINA 1BMMH 1O31A 5CHAB 2XBYA 1CA0C 1ARCA 3GY2A 3VGCC 2QXGA 5A09A 2C3SA 2OXSA 1QGFA 1GMDF 1A0LA 1B0EA 2Y5HA 1Y5UT 1SGTA 3LJJA 1J9CH 4MQAA 3OSYA 4WH8A 2ANYA 4TWWA 4DURA 1BTZA 1C1VH 2FOFA 3GICB 3PO1C 3EE0B 2P8OC 3UPEA 1GI4A 2ZHQH 3AAVA 5GIBA 2VGCC 3BTTE 1YPHE 4HI3A 3RXHA 1G32B 1IQKA 3Q77A 2BD7A 3WY8A 1C1SA 2OC0A 2BD8A 1ZR0A 5F8TA 1UK3A 3V13A 1P09A 1WTGH 1IQGA 2GMTC 3OTJE 1EAUA 4ISOA 3MO6A 1O39A 1AQ7A 1GMDG 3LU9B 4DIIH 3UR9A 1GG6B 1V2QT 1F5RA 3S0NA 1GHBF 3LKWA 2BMGB 1CHOF 1HJ9A 1AZZA 2RA3A 1ZJDA 2ZU3A 3NXPA 3PMJA 2A7CA 3BIUH 2A4GA 4I32A 5GXPA 1TNIA 2W7SA 1Z7KA 1Z8GA 2ZFRH 2F91A 4JYVH 3SGQE 4Y6DA 5K0HA 5A0BA 3SW2B 4B71A 8GCHF 3SJ9A 1GHBG 1HV7A 1DPOA 1CHOG 3RXMA 4INHA 1QL7A 4AG1A 3LGYA 4BTUB 1IHTH 2HALA 1NRSH 1A3BH 5T6GA 4ASHA 2O8MA 1SVPA 1Z6JH 3SV2H 3ATWA 2STAE 5JBAS 4BOHA 1PQ8A 1FJSA 3BTQE 1FZZA 3LGIA 2BLQA 4RKOB 1AUTC 2VJ1A 1RD3B 4XBDA 5L2YH 1NS3A 1XUGA 3SORA 3RC4A 4KTCA 3TH2H 4X6NA 8GCHG 1AIXH 1ZZZA 5T3HA 3QDZB 3CS0A 1GBEA 1LPZB 2YOLA 1GJCB 1SG8B 1MTVA 1NROH 2ALPA 5EGMA 4ISNA 3SUGA 1O2YA 2R2MB 4RKJB 4BAHB 3T62A 5EXLA 1C5SA 4FUJA 3SQEE 3DA9B 3M5OA 3V3MA 2R0KA 1V3XA 1C9PA 2W5EA 5JBCS 1QIXB 3TGIE 1KXDA 1DFPA 4JK6A 1A61H 3N7OA 4I31A 3SNAA 4X1RU 5L30H 4WY3A 1AE5A 2ODYB 2FX6A 3HGNA 2HNTC 2ZQ2A 3GY5A 2SGQE 2GDDA 1HIAA 3A87A 5A8XA 3E0NB 1A5HA 1AWFH 5EPNA 1DXPA 2ZTXA 2A2QH 3VB5A 1VJ9U 2ZFSA 4AFUA 4DJZB 2J94A 1P11E 1P04A 5FPYA 1LDTT 1N8OB 4D7FA 1EAXA 1OSSA 3MNCA 1AKSA 1H1BA 2ZPQA 4WMDA 2G4UA 2HNTF 4AZ2B 3KHVA 1SL3A 1XUKA 1XX9A 4DT7B 1FLEE 4XBBA 1K1IA 1F5LA 1TPPA 1DVAH 1ETRH 3URCA 4FU8A 5DP3A 5C1UA 1SGPE 2G5VA 4IC5A 3ZVAA 1SFIA 2WV4A 2A5IA 3NCLA 1BBRE 3H7OA 3TGJE 1DICA 1YF4A 1HCGA 4K8BA 5HM9A 1G3CA 1WOFA 2PKAA 4CRFA 4RN6A 1XVOA 4GPGA 3ZZBA 5JB9S 1GBFA 3GCHC 4GUXA 3LDXH 1ZMLA 2WPHS 2NU3E 3C27B 3ZYEA 2M5TA 1O36A 4YLUA 3MH6A 1SQAA 1NPMA 3SUDA 3LIWA 2OBQA 1SGEE 5GPIB 4Y11E 1FMGA 4BNRA 5I46H 1Y5AT 4ABIA 1V2TT 3SGAE 1O2LA 2Z94A 3MH7A 5TJXA 1GI7B 4GHTA 4I33A 1P9UA 2LPRA 4YOIA 1YCPM 2VVVA 3A7VA 4X1SU 2NWNA 3RXRA 1FY4A 2HWLB 1ELDE 1TNJA 3O8BA 4MNWA 1PPZA 5HM2A 1O2JA 1FONA 3Q3XA 1MKXK 1Z6EA 1BA8B 1V2RT 3A7ZA 5JDUB 1ELBA 1O37A 4NZQA 2YNAA 4ZH8A 4KTUA 3SUFA 2ZF0H 2PKSC 1QB1A 2FOAA 3AVZA 4HGCA 5LH8A 1P9SA 3T29A 1YCPK 3DD2H 3T5FH 2VWNA 1RXPA 4ZKNU 2BXTH 2H5CA 3RXJA 1V2LT 1EJMA 1C5MD 2BDHA 1BB0B 1NT1A 1HB0B 2VIDA 3LGUA 3MNBA 4X8UH 4BAOB 4IN1A 3A85A 2H6MA 4AGKA 2AGEX 2C93B 2GKVE 4FUCA 4TYDA 1QY6A 2GX4A 2G81E 2C8XB 1P3CA 1YLDA 4CR9A 3A82A 3SJKA 3DHKH 1T8MA 2QF3A 4Q7XA 1F2SE 3PLPA 1QBNA 1V6DA 4YT7H 3RDZA 2R2WU 3ENSB 3QGNB 1UCYK 1KIGH 3Q76A 1C5NH 2HGTH 1N6YA 2VB0A 3QTVH 4AB9A 3SBKA 4YLQH 1BMAA 2ZECA 4BTIB 2P59A 1H9IE 4FUEA 4IC6A 1VGCB 2XCFA 4TY6A 2P16A 2Y7XA 3D49H 1DWEH 3Q3YA 4JZIA 1FIWA 4YOGA 1AWHB 4NZLA 3S7KB 4JK5A 3R0FA 5GCHG 1B7XB 1DM4B 3BEUA 4NA9H 3ZZ7A 2A7HA 2ZPSA 4B2AA 3ATKA 1ID5H 1ZHRA 4X1NU 3LGWA 4R8TB 4K3JA 4I7YH 4GHQA 5JPMH 1GGDC 2P3UB 1MTNC 1D3PB 1GI8B 1O3OA 4UD9H 1IQMA 3RXSA 3BIVH 1TIOA 1WQSA 2ZPRA 3EDXB 5FPTA 3F68H 4ABHA 1G36A 1MCVA 1JRTA 3GDVA 2BLWA 2WUBA 4OGYA 1O5AB 1ZGIA 5AF9H 3TJNA 5C67A 3RC6A 5E8EH 1GBKA 1LO6A 4YT6H 3RU4E 1FPCH 2VH0A 1PYTC 1MMJN 3M7QA 1GBHA 3G01A 3RXDA 1QB9A 1O5FH 2Y82A 3MU8A 4X2XA 3MU5A 4B74A 3K65B 3SJIA 3BF6H 1NC6A 2FM2A 1ZPCA 4U30A 1HXEH 3T26A 3LJOA 1VCPA 1GHAF 1GDUA 3QZQA 2XC4A 5C5OA 2ZO3H 4BAKB 3DFLA 1C2EA 1SHHB 2FESH 1IQHA 3ELAH 2QA9E 1CVWH 4CHAC 3OYPA 3PM3A 4JYTA 1G9IE 2A4QA 5DP6A 3SJOA 2QN5T 5LPRA 3ZZDA 1FAXA 1DS2E 1PFXC 2BOKA 2TGAA 1Y5BT 4UE7H 4R0IA 2ZDVH
chains in the Genus database with same CATH superfamily
1ESAA 3AASA 2CK3D 4ZKOU 4JZFH 3P95A 1JIRA 3DCLA 6LPRA 1GHAG 1AFQB 4K5ZA 1UW7A 2BY7X 3SUEA 1GHZA 4I8GA 3KQ5A 3PB1E 1X7AC 1S6HA 2D2DA 3PMHB 2Z9IA 1FY1A 4UEHH 2BY9X 2Z3CA 1GMCG 1LHEH 3TJUA 3SJ8A 1OP2A 3F0PA 1LVMA 1QR3E 1KTSB 4AN7A 1OYTH 2H9TH 1GL0E 2OP9A 2A5AA 1BBRH 3SYJA 1GBIA 4CBOA 4FUBA 1CA0B 1W13U 2NU2E 1T8LA 5JYIA 1EPTC 1UTNA 2QF0A 2VINA 3VGCB 2ZCLP 2VVUA 1BHXB 4TPYA 3SU1A 3F9HA 2ZGCA 2HLCA 4FETA 2PGBB 1O3MA 3FKSD 1CE5A 3PO1B 1DWDH 1NO9H 1AMHA 2PTCE 2D1JA 3SU3A 5C5NA 5T6FA 2VGCB 3F2FA 4B2BA 4Y71A 5E0GA 1O3CA 3RXLA 1EOJA 1XKAC 1XVMA 2FEQH 3BTEE 4BXSA 4ISHH 4KKDA 1SGNE 1SGCA 3BTHE 1SBWA 1EXFA 2GMTB 1K1LA 1TRMA 2ODPA 1SGDE 3KYFA 4NFFA 4CRCA 3ATIA 1FNIA 1D3TB 1LHFH 2TGPZ 3BTGE 3PV4A 1SSXA 1NN6A 2CV3A 3ZZCA 1ELGA 1AB9C 4RT1A 1UTOA 2VNTA 2WPDD 3PRBA 2I6QA 2Q6FA 4AX9H 1GI5A 5F8XA 1F5KU 3I78A 1CGHA 2AIPA 2J98A 2FO9A 2ZP0H 1O2HA 4A7IB 1H4WA 3ZZ9A 2OC7A 1HPGA 4GCHG 4RI0A 5PTPA 1TGTA 4TT3D 1LQDB 1O2TA 1TB6H 2UUYA 2J9NA 2BTCE 2R0LA 1BTUA 2Z9KA 1O2KA 2OBOA 2OC8A 2L74A 1C1QA 2PR3A 4Z6AH 3ZVFA 4GVUA 5JBTA 1EJAA 1LPGB 6ESTA 1UVUH 1IAUA 2AGGX 2CF8H 1P3EA 1F0UA 2V0BA 3A86A 3TH4H 3QK1A 4Y76A 3K6YA 1O2SA 1O3JA 2ZTYA 3LC5A 2IPQX 2RFKC 1O32A 2CJIA 1HAVA 2GT8A 2JKHA 1SGRE 2EEKA 1TMUH 1O2IA 2XCNA 1G2LA 2ZHWH 1W8BH 3EGKH 1TGNA 2ZDNA 2Y81A 3BTDE 4LOYH 5A0CA 1E34B 3IITA 3FOAA 1H8DH 1P57B 2VIWA 1GJBB 1PPHE 4K8YA 2H9HA 1UTKA 4O3TA 5TCCA 3MH4A 2G4TA 5J4SA 3BG4B 1ABIH 2QYIA 3OY6U 2C4FH 2W3IA 5IDKA 1NFXA 1L4ZA 1C2FA 2ZHEH 1YPGH 2XOKD 1Q2WA 1C5QA 5HXFA 1DE7H 3ZZ3A 3RLWH 3SU5A 2ZU1A 2RCEA 2VIPA 1QRXA 2SNVA 4NA7A 1M9UA 3UWJH 5DP8A 6GCHF 1GHVH 1D9IA 3KIDU 2L6OA 5GNDA 3RXFA 1SFQB 3TK6A 2ASUB 2YMSB 3LGTA 2WPLS 1EQ9A 1A3EH 2BD5A 1WBGB 2BX3A 2BDBA 1QHRB 3PLKA 2GJGA 1W14U 1VZQH 3PWBA 4JZEH 2R3UA 3GDUA 1P8VC 2BD4A 4H42U 5FBIA 1A5IA 1XMNB 2WPJS 3UOUA 1V2PT 3ZYDA 4DW2U 1C4V2 2P3FH 3KL6A 4ISIH 1LKAA 1GJ5H 3H7TA 5ABWA 2QXHA 3PLBA 1QRWA 3PMAB 3FP6E 3NZIA 2ZU2A 3T25A 2ZFQH 1HUTH 4MPWA 1TOCB 1SQTA 2AGIX 1YP9A 1O3FA 1H9LB 3ZV9A 2SGAA 4KP0A 1QQUA 1GJ9B 1S82A 3UFAA 2B8OH 1TQ7B 4A92A 4WVPE 4YOJA 1O3NA 3KNXA 3UUZA 3UREA 4LZ1H 2FOCA 1S6LA 3DFJA 3EA7A 1SI5H 3SI4H 3NK8A 2C8YB 1F0TA 1PQ5A 2F9PA 3SOSA 1G37A 3KQEA 2NU4E 1MTUA 1T4VH 1VR1H 3EAJA 1HAGE 7LPRA 2FYQA 2Y6TA 1E37B 4YO9A 1C5YB 1NU7B 4ABFA 4X2VA 2Z7FE 3MHWU 1THPB 4CH8B 3GCHB 2GV6A 4KGAA 1HIAB 2BVSH 3UNSA 4VGCC 5DP9A 2BHGA 5A8YA 1TBQH 4B73A 1MTSA 4E7NA 4AG2A 4NWKA 3UTUH 1C1MA 1IQEA 3FANA 3RMNH 1AKSB 3TITA 4BTTB 3RXCA 1K28D 3SI3H 4IS5A 2DE9A 1RJXB 3K2UA 3KQDA 1FY8E 3T2NA 1QJ7B 2V3OH 2TPIZ 1C1RA 2FPZA 1TGSZ 5T6DA 1UMAH 3QGJA 3SV8A 1TX8A 4O97A 1KMHB 2EQNA 1BITA 3O8CA 4ABEA 3RM0H 5F6MA 3KQCA 1YM0A 2PKSB 1NU9A 2QCYA 2ZEBA 2UUJB 3T28A 4F48B 3HKIB 1DT2A 3OTPA 1QJ6B 1L2EA 3S9AA 2PKAB 2GGVB 1DLKB 2FZZA 4AFQA 1NRPH 5FCRA 2P95A 3VB3A 1YPEH 2FLBH 1RTKA 5AFYH 4AOQA 4D8NA 1BRAA 1A1RA 3TJOA 1C5OH 1EZUC 5FX6A 3V12A 2AIQA 3D65E 2HVXA 1AUJA 2WINI 1A2CH 1C2MA 4ZUHA 3OU0A 4AORA 1JIMA 5FAHA 5H4IB 1TMBH 1ZRKA 1MCTA 1GI1A 1OOKB 1C4U2 4I8HA 4M7GA 4B1TA 2KCPA 5EJ1A 1F0SA 1YKTA 1ZTKA 4I8KA 4TPIZ 1SR5C 1C5UA 5CHAC 1O3AA 1EATA 2GDEH 1C2IA 4Q80A 1EB1H 1SPJA 1PQAA 1CT4E 4U32A 4Y7BA 3FZDA 5C0UA 1ESTA 3ZZAA 4LXBH 3Q3KA 3WWBA 1WAYB 2SFAA 1EX3A 2EI6A 3TNSA 5GWZA 1EB2A 3P6ZB 1IQNA 1V2NT 3SU6A 1GI0A 4WMFA 1O30A 5EQSA 1J14A 2ZC9H 4ZHAA 1FPHH 1ZSJA 5DG6A 3HGPA 3K9XB 3QUMP 3BTME 1MKWH 4Y8XA 5CMXH 1EZSC 3UQVA 3HPTB 5TCAA 1GHYH 1CT0E 1S5SA 2I6SA 2SGFE 2BLOA 3A89A 2KCOA 4AFZA 1OPHB 2Q1JA 1DSUA 1WUNH 1GGDB 1MTNB 3DT0H 4MG3A 1YPKH 1TBRH 3H09A 1A46H 1GVZA 2KAIA 1GG6C 2BD2A 1V2JT 1HAYB 1BTPA 4CRBA 1O2NA 3SN8A 4K1TA 3GY4A 3S69A 3OY5U 5EODA 3JZ1B 1YY3A 1EASA 2ZFTA 1V2ST 4Q7YA 3UNRA 2OLGA 2RDEA 1BJUA 1VCWA 5C1YA 2ANMH 4DGJA 1QB6A 1E38B 2J5UA 2THFB 4MNVA 5CHBA 1BTYA 3PMBB 2QAAA 2Z3EA 4CR5A 1GCDA 1ZMJA 4MPUA 1C2DA 3ZV8A 2ULLA 3VPKA 1FN6A 1CSOE 1OP8A 1BT7A 1GDNA 3C1KA 1S85A 1C5WB 3NWUA 2EC9H 4AC9A 1K1NA 2F3CE 4BAQB 3GOVB 1AGJA 1O2WA 1HAHH 2TGTA 5E2OA 2DUCA 4E05H 5FHTA 1D3QB 2WPIS 1F7ZA 5L6NH 2Y5GA 1SLVB 1HJ8A 8ESTE 3S9BA 2BVXH 4JZ1A 1EP5A 1ZSKA 5EQRA 5FCKA 3M36A 5L2ZH 2JJ1D 2A32A 3UNQA 3TJVA 3U8RH 2FS9A 1ZYOA 4ZMAH 1RGQA 2FI4E 3N7EA 1DX5M 1N1LA 1P2NA 4CREA 3E8LA 1SGYE 3CP7A 1C2KA 4QT8C 3ZZ5A 4MTBA 1W0JD 2GZ8A 1L0ZA 1BBRK 4WMEA 2ZDLA 4LZ4B 1AI8H 3GYLB 1GBCA 1Q3XA 1LHCH 2BZ6H 3STIA 2G00A 1SMFE 1HDTH 3PWCA 3URDA 1L1JA 1TYNA 1S6FA 2AFQB 3FAOA 1GJAB 1W3CA 2BY5X 2F9UA 1E1QD 1P02A 3A8CA 1TBZH 1DOJA 2GCHF 2EA3A 1SC8U 1CA8B 3TIUA 1GCTC 2ZA5A 2NU1E 2C8WB 3DSGA 1WTHD 5EXNA 1S83A 2WPKS 4I8LA 4GSOA 3HK3B 1GVLA 1B5GH 4BANB 1UK4A 4WJG2 1P01A 4B6EA 3OEHD 4D76A 1PPEE 1O2GH 1BRBE 1C5VA 1WSSH 1O5CB 2A4OA 2AMDA 3LGVA 3UOPA 5EW2H 3LH1A 3RC5A 2FOGA 1C5XB 2BVRH 3M3SA 5AHGH 1RIWB 1QA7A 1GPZA 2WV5A 4A6LA 1OWEA 1O5DH 3RP2A 2JETB 2Z9JA 4IW4E 1UVSH 1W2KH 1O3DA 2FTLE 1N8OC 1ELFA 2CHAC 4ABGA 1TLDA 1F0RA 4OS6A 4Q7ZA 1TNLA 4ZXXH 2GCHG 1LTOA 1MUEB 3SQHE 2O8UA 3ZIAD 3CS7A 2SGEE 3A83A 2J92A 3VEQB 3SO3A 4ASUD 1UO6A 3MTYA 2V6NA 4AYVB 2AS9A 1AB9B 4B76A 4KTSA 1MTWA 5JBBS 2A5KA 1PQ7A 2BDCA 1W7XH 2Y80A 4XE4A 1DY9A 2UUFB 5HGGA 3KEEA 1BJVA 2HOBA 1O38A 1MAYA 1L1NA 1CHGA 5DGJA 1TNHA 2CGAA 3A7TA 4CH2B 2HNTE 1ZRBA 4OM9A 2A2XH 3M5NA 5I25A 2Z9LA 2ANWA 4NA8A 1DWCH 2W6JD 3ZZ6A 4X6OA 5A0AE 2FI3E 1CGJE 2FS8A 2BM2A 3WW7A 1FUJA 1EPTA 1S0QA 3P8GA 1TPSA 3MYWA 1FY5A 4X0WU 1AFEH 3RXVA 2NU0E 1GI9B 4ISLA 1W7GH 1AD8H 1XUFA 3SGBE 4AYYB 1ANBA 4NIXA 2O8TA 4Y7AA 1W10U 1VITH 1FAKH 4Y8ZA 2Z3DA 2H5DA 1S84A 7GCHF 3SZEA 2Z6BD 1LQEA 3D23A 4UFGH 1YPHC 5K7RA 1D3DB 3PRDA 5EJZA 4NFEA 2H1UA 1C9TA 1O2UA 3P8FA 3ZVCA 1GVKB 2G8TA 5DK1A 4P00A 1ANDA 2YNBA 2J98B 3O8DA 1MH0A 2PUQH 1CU1A 1TGCA 4TSFD 1V2KT 1AVXA 2CN0H 5SGAE 4UFDH 4O9VA 3RMOH 2GTBA 1GWAA 3QN7A 3SU4A 4NIVA 2PSYA 5E2PA 1Y3VA 1KXFA 2PW8H 3MNXA 1D4PB 4ACAA 2FXRA 1QURH 7GCHG 3BTWE 4Y10E 3UWIA 1O2ZA 3SV9A 4O3UA 2ZU5A 1HRTH 3A8DA 1FIZA 2F9VA 1C5TA 4X2YA 1ETSH 1O35A 2IN2A 1OWHA 1PPCE 3ODFA 1YPJH 1SB1H 5HYOA 1SOTA 1EUFA 3B8JA 1HAVB 3UB0A 1ZOMA 1JWTA 4ZKSU 3UAIC 3WWFA 1ETTH 1KDQA 2P8OB 2UWLA 1FXYA 2F9BH 1YBWA 3TK9A 2QGRA 2RDLA 3QTOH 4JMYA 3AAUA 1IOEA 1V2MT 3U1JB 3U28C 3VXFH 1CO7E 2BDAA 2ZFPH 5ETXA 4YXWD 2VVCA 4CBNA 2GV7A 1AY6H 4OS2A 1XKBC 1O2PA 3FZZA 4K2YA 2FLRH 1LPKB 3PV2A 1DUAA 1BIOA 1O33A 3M7UA 1B0FA 1OS8A 2BYAX 3E91A 5BPEA 3P92A 4H6TA 5FL7D 1BDAA 1TALA 2J34A 1W12U 3JZ2B 2QY0B 1CGIE 2AYWA 2CMYA 1IQFA 2J38A 2J4IA 3U69H 1UTPA 4BAMB 4DY7B 1KXCA 1CBWC 5F8ZA 2GZ9A 2ZHDA 1EZQA 1G3BA 1W0KD 1YWUA 2EI8A 4A5TS 3F9EA 4UONA 1RTFB 1NRRH 3ATMA 3AW1A 1UK2A 5E0JA 2AEIH 5E0HA 3F0OA 4X1PU 3GCNA 1EP6A 3U98H 3L3TA 5JB8S 1GBBA 1QL8A 1S0RA 1O34A 3MU0A 4KELA 4SGBE 3VB7A 6CHAC 3K6ZA 3L33A 1O3LA 2B9LA 4HFPB 1FN8A 3LONA 7KMEH 1EOLA 1HXFH 1FV9A 3MH5A 2OD3B 2VU8E 1UVPA 1O3KA 2D8WA 1OHHD 3RXQA 1C5PA 4CRGA 1HNEE 3A81A 1J17T 2BDYA 4OGXA 2KFWA 2F9OA 2KCAA 1Y59T 2IOTA 4ZXYH 1NFUA 5IYTA 2XXLA 9ESTA 1O2OA 2Y7ZA 1C5LH 1AVGH 3SZNA 3MOCA 2AMQA 2PHBA 3MU1A 3SU2A 1J8AA 5FX5A 1GBLA 1HYLA 5F53A 4DVAU 3FFGA 1GBJA 2ANKH 1BZXE 2ZFFH 3LH3A 1Y8TA 1HGTH 1UTJA 2ODQA 5EPYA 1C2JA 2XRCA 1VITF 3GISB 1JOUB 2FIRH 2YMSD 3MWIU 1WCZA 2W7UA 1GJ4H 1YPLH 3B23B 1RFNA 1H8HD 3RU4D 5FPSA 8LPRA 3V0XA 2EI7A 2ZTZA 1HJAC 1TONA 2BX4A 2XBXA 3I77A 3F9FA 2FOEA 1WV7H 3RXEA 3TPIZ 9LPRA 1GHXH 3ESTA 4NIWA 3LPRA 4JCNA 1LVOA 1NESE 3F6UH 5GJ4B 5A2MH 1C1OA 1T8OA 4TWYA 1UHBA 1VITG 1IQJA 6GCHG 4FUGA 3Q00A 1FI8A 1ESBA 4CRDA 1O3PB 1P2QA 1UVOA 3FVFB 4D9RA 2ZI2H 2K8IA 1F92A 1MKWK 4YTAA 3L6PA 1O5GH 1T32A 3ZVEA 2OCVB 1PPBH 1P10A 3EE7A 1DLEA 1JRSA 1NBME 4Y79A 1VJAU 2LP6A 3M61U 2A1DB 4U2WA 1Y3WA 5B6OA 1P2JA 4XBCA 3PTBA 3ITIA 1YGCH 2Z9GA 1BHXF 2Y5FA 2EY4C 1TX7A 2PLXA 1QBOA 2LNCA 1S81A 4O03A 3M7TA 4WXVA 3T27A 2BOHB 1ARBA 3P8NA 1GHWH 3KGPA 2HPQH 1OXGA 1C2GA 1P2IA 2IPHA 4F49A 5EG4A 4BXWA 2DE8A 4FU9A 2H2ZA 3ODDA 1JMOH 4IGDA 3RXAA 3OFND 4JZDH 2VIQA 2W3KA 1AE8H 1HLTH 1KTTB 4DOQA 4WF8A 1Z8JB 4ABAA 2WPMS 5DKMA 3RXKA 1ANEA 1FY3A 5ESTE 1IHSH 2ZDMA 4ABJA 1T8NA 1EAIA 1K1JA 1V2VT 1Z1IA 1NY22 1Z8IB 1ZTJA 2QIQA 3ZVGA 1BTXA 1N6XA 8KME2 1QJ1B 1ZJKA 1P0SH 2CXVA 1SLWB 1K1OA 1ELEE 3TNTA 4F4OC 4FVDA 5KECA 5C3NA 5LGOA 1LKBA 1AZ8A 2GVFA 3PTNA 4NG9H 3BG8A 2OQUA 2PSXA 4ZHMU 2B5TB 5C20A 1GI3A 2FODA 3OX7U 2QXJA 1BUIA 2RA0A 4UDWH 1XUHA 1BCUH 1NZQH 3I29A 3TH3H 3M37A 1H8IH 5C1XA 2BZAA 2KAIB 1DANH 2AMPA 4CRAA 2GP9B 2FTMA 4MNXA 1P2KA 4UFFH 2ZCKP 3UY9A 1JBUH 1GJDB 2XYAA 1ELVA 3TK5A 1K1MA 1TRYA 2GCTC 4GAWA 1IQIA 1OWJA 2A45B 1G3EA 5FXLA 3EA8A 2XC5A 2PFEA 3BG4C 1ACBE 2BXUH 4XSKU 3RXIA 2P3TB 2XBWA 4U01A 3RXTA 3R3GB 4NSVA 2V35A 2AH4X 4JYUH 3M5MA 1XUJA 1L4DA 2JH0D 3BEIB 3A7WA 4J1YA 2QC2A 3QWCH 1EKBB 1SGIB 2OTVA 1GCTB 1Y3UA 4OS4A 1MU6B 4MDSA 3VB4A 4ESTE 3BSQA 3UIRA 1HAZB 2ZGXH 4OS5A 1WXRA 1W11U 3P70B 3TVJB 1K9OE 3MFJA 1C1UH 4D7GA 1KXEA 2J2UA 4ZKRU 5BRRE 2G51A 2O8WA 3CENA 4Y8YA 2AHME 4H4FA 5EQQA 2J97A 3STJA 3UQOA 2OC1A 4MVNA 1QFKH 4FU7A 1TWXB 2FP7B 1C5ZB 4FXGH 5A8ZA 4XFQA 2CHAB 1O3HA 1AN1E 5C2ZA 3HK6B 1COWD 3NKKA 5DJ7A 1OKXA 1P12E 1SLUB 4WXIA 3TGKE 1OYQA 5AVDA 1LMWB 1BMFD 3RXPA 3F1SB 4NWLA 4HG6A 2STBE 2VWOA 1QQ4A 1MQ5A 1P06A 1C2LA 4A1XA 1O2VA 5EW1H 4XRNA 1ZPBA 1MAXA 1WDIA 1ANCA 2XWAA 1OP0A 2LELA 3NRLA 5DO4H 1FQ3A 1D6RA 3VFEA 5ESBA 2SNWA 1GJ6A 5KGOA 1BTHH 1RTLA 1ELAA 1GBMA 3P8OA 2KZ4A 3U9AH 1P2MA 3IWMA 1BRUP 3E16B 1PYTD 5T1VA 4ABBA 1GJ8B 4OS1A 1XXFA 1HAXB 2SGDE 2FYRA 4FUIA 4FUDA 4ZROA 1XXDA 1C2HA 1P03A 1K1PA 1Q31A 1QBVH 2BY8X 2G55A 3W94A 4AFSA 1UTMA 1BMNH 1ZTLA 3E90B 5EOKA 1LHDH 4MPXA 2TRMA 3S7HB 1UCYE 1K2I1 1TMTH 4WH6A 1V2OT 4K60A 4I86A 2XNIA 1E0FD 1OWDA 1SQRA 1MQ6A 3LOXA 5DP7A 2TBSA 4CHAB 3RM2H 4IMZA 2BQ7B 1TNKA 1QL9A 2QXIA 3RMMH 1C1PA 1EJNA 4H6SB 1THRH 1E35B 1TE0A 2OUAA 5B6LA 3E6PH 1O0DH 4TY7A 1CT2E 1KXBA 1NBMD 1C1TA 2WYGA 1AVWA 2A31A 1MZDA 2ZGJA 3MU4A 3QZRA 2QF5A 2UUKB 1H9HE 1LHGH 2IJOB 1E36B 3SHCH 1SOZA 3ZZ4A 2ILNA 1PPGE 3SV7A 3ZVBA 2P94A 5EU8A 1SLXB 4J2YB 2FX4A 2G52A 3RUOA 4UFEH 4I8JA 3PV5A 3ZVDA 2ZGBH 4K1EA 3DUXH 1RRKA 2ZIQH 1GMHF 1TQ0B 3LT3A 3EA9A 1MZAA 3NPSA 4OS7A 2BDIA 1G2MA 2F4LA 3NUMA 3A7XA 1HBTH 4MNYA 1HAPH 1O3IA 1GBDA 1EPTB 2A0QB 4LK4A 1A5GH 4ZCNA 1ZSLA 3MO9A 1O3EA 1H8ED 1IQLA 3RU4T 3RXUA 3EQ0H 2JH5D 1GDQA 1L1GA 2HPPH 4AB8A 2ZKSA 1QTFA 2PUXB 1RS0A 4THNH 4D9QA 4FUHA 1NTPA 5HIYA 5GCHF 3HKJB 2P93A 1GMHG 2W26A 2XTTB 4MPVA 3RMLH 1HAOH 1W0YH 2ZDKA 4XOJA 2B0FA 3GY7A 4Q63A 1MD7A 3U8TH 2HLDD 1TGBA 3MMGA 3EYDA 3VB6A 1C5RA 2BD9A 3IG6B 1KLJH 3MI4A 1BRCE 1A7SA 1ZMNA 4INLA 1Y3XA 1NFYA 2ZCHP 3E1XB 5F03A 1E79D 4Z1MD 4YESB 3RXGA 1P05A 2UWOA 4X6PA 2R3YA 2R9PA 5C0TA 2VWLA 3BTFE 3O8RA 4DIHH 1A0JA 1KYNA 1MU8B 2G5NA 1EAWA 1O2MA 1HFDA 4Z0KA 3M3VA 1WYKA 4FOUC 3MQKC 1Z8RA 1JXPA 2GZ7A 1O3GA 3D62A 5DSFA 3PROA 2D26C 1K21H 1CBWB 2A7JA 1G30B 3U8OH 4HZHA 1PJPA 4YM9A 1TA6A 3LC3A 2FOMB 1KDQB 4FVBA 1ELCA 4DG4A 2CF9H 3TU7H 1AO5A 1ELTA 4SGAE 3QX5H 1TFXA 2ZGHA 3VG8A 1TX6A 4INKA 1DY8A 5J4QA 5AFZH 2BLVA 1K0HA 2F9NA 3MNSA 4E7RG 3A88A 4NIYA 2ZG0H 1ZHMA 6CHAB 1DDJA 1KSNA 1W0ZU 2XBVA 2FWWA 1QRZA 3GYMA 3RXOA 1FDPA 1SHYA 3KCGH 5GDSH 1A0HB 1Y3YA 1D6WA 1O5EH 3F9GA 3GCOA 3ZZ8A 5CE1A 1UTQA 2FOHA 2K0QA 1MD8A 2BY6X 1GI2A 1GMCF 3CNRA 2HVYB 3MO3A 1C1WH 1DITH 1AHTH 3SHAH 4RT0A 1OWKA 3OE7D 3RXBA 2VH6A 1MKXH 4X8SH 2Q6DA 4B75A 4MLFB 2V3HH 3TLOA 1XUIA 3N99A 3OEED 2J95A 1INCA 1NM6A 4E06H 1YCPH 1O5BB 1O2QA 2GT7A 2XWBI 1K22H 1MBMA 4RSPA 1DXWA 1ORFA 2Q6GA 1SQOA 1QNJA 3UR6A 3BEFB 5LPEA 1WQVH 1HAIH 4DCDA 4K69A 1HJAB 2PWXA 4A1TA 4AGJA 4Y0YE 1V2WT 3KN2A 1SGFA 3GDSA 1GI6A 4X8VH 1YC0A 1XM1A 4DT4A 1TPOA 4X8TH 2JDID 4IMQA 1Z71A 1VCQA 3RLYH 2HRVA 1O2RA 1QCPA 3ATLA 3E0PB 1ZPZA 5DPAA 2H9EH 2RG3A 2XC0A 1O3BA 1QA0A 1UCYH 1VGCC 4YZUA 1MBQA 4X1QU 2JIZD 1RIWC 1LVBA 1TPAE 2JETC 1SGQE 4GLYA 2FOBA 2ESTE 4GCHF 1GBAA 2FI5E 1G3DA 1UJ1A 4NSYA 4ABDA 1PPFE 2WUCA 2V7QD 1DSTA 1AU8A 3A80A 3SNBA 2C90B 2AERH 2M2AA 4NGAH 3U1IB 2BD3A 5DP4A 5DP5A 4IN2A 4B2CA 2XW9A 4A1VA 2TIOA 7ESTE 3E3TA 5HMAA 1V2UT 2TGDA 1P2OA 2K1QA 4IBLH 2A4RA 2O9QA 1TOMH 4K1SA 4VGCB 3SNEA 1NFWA 4X6MA 1TAWA 2JH6D 1CQQA 3BTKE 1ZHPA 3GY8A 3A8BA 5EXMA 3FP8E 1ABJH 1UHBB 1GBTA 2BQ6B 3KQBA 1OWIA 2F83A 3GY6A 1BOQA 1NRQH 1GJ7B 1WU1A 2WZQA 2W6ID 1BQYA 3BV9B 4PROA 3SNCA 3SNDA 3S9CA 5FBEA 3GS9A 4ZAEA 3SV6A 2PGQB 1THSH 2OQ5A 2VIOA 4NCYA 1KLIH 4Q2KA 3W95A 1KXAA 4Y0ZE 1DWBH 3GCTF 1C1NA 2B7DH 1OX1A 1Z1JA 1YLNA 5EJLA 3QLPH 3H5CB 2PV9B 1YYY1 2BB4A 1TABE 3A7YA 3PYHA 1LVYA 1O2XA 1YPMH 2ZHFH 2FMJA 3GY3A 3BN9A 2ALVA 2VWMA 2WYJA 4FUFA 2BQWB 2FDAA 1LCYA 1J15A 5G4BA 3VXEH 1ZLRA 2O8LA 3M35A 5LPFA 2QV1A 3A8AA 2ZNKH 1TRNA 2BDGA 1KY9A 4HTCH 3P17H 2ZU4A 3A84A 1BTWA 3AW0A 3FP7E 1UTLM 2VIVA 1GL1A 1EZXC 2UWPA 2GD4B 2ZQ1A 1SGFG 3V7TA 4XDEA 1BMLA 1T4UH 2SGPE 2GCTB 3GCTG 4X2WA 3M5LA 3SU0A 1T31A 1T7CA 1AFQC 1UVTH 1TA2A 2ZWLH 1J16A 2ZDAH 4WWYA 3M3TA 1KLTA 1C4Y2 2ZZUH 3B9FH 3N7DA 3KF2A 4ZHLU 1NRNH 2PTNA 1DUEA 3F2GA 1TNGA 1ZGVA 2C8ZB 1YLCA 1U6QA 3QO6A 3HATH 1A4WH 2OINA 1BMMH 1O31A 5CHAB 2XBYA 1CA0C 1ARCA 3GY2A 3VGCC 2QXGA 5A09A 2C3SA 2OXSA 4XD7D 1QGFA 1GMDF 1A0LA 1B0EA 2Y5HA 1Y5UT 1SGTA 3LJJA 2JJ2D 1J9CH 4MQAA 3OSYA 4WH8A 2ANYA 4TWWA 4DURA 1BTZA 1C1VH 2FOFA 3GICB 3PO1C 3EE0B 2P8OC 3UPEA 4Q4LA 1GI4A 2ZHQH 3AAVA 5GIBA 2VGCC 3BTTE 1YPHE 4HI3A 3RXHA 1G32B 1IQKA 3Q77A 2BD7A 3WY8A 1C1SA 2OC0A 2BD8A 1ZR0A 5F8TA 1UK3A 3V13A 1P09A 1WTGH 1VKYA 1IQGA 2GMTC 3OTJE 1EAUA 4ISOA 3MO6A 5C94A 1O39A 1AQ7A 1GMDG 3LU9B 4DIIH 3UR9A 1GG6B 4ACBA 1V2QT 1F5RA 3S0NA 1GHBF 3LKWA 2BMGB 1CHOF 2QE7D 1HJ9A 1AZZA 2RA3A 5C17A 1ZJDA 2ZU3A 3NXPA 3PMJA 2A7CA 1SKYE 2VBCA 3BIUH 2A4GA 4I32A 5GXPA 1QZ8A 1TNIA 3FN8A 2W7SA 1Z7KA 1Z8GA 2F43B 2ZFRH 2F91A 4JYVH 3SGQE 4Y6DA 5K0HA 5A0BA 3SW2B 3FO8D 4B71A 2OK5A 8GCHF 3SJ9A 1GHBG 1HV7A 1DPOA 1CHOG 3RXMA 5EIYA 4INHA 1QL7A 4AG1A 3LGYA 4BTUB 1IHTH 2HALA 1NRSH 1A3BH 5T6GA 4ASHA 2O8MA 1SVPA 1Z6JH 3SV2H 3ATWA 2STAE 5JBAS 4BOHA 1PQ8A 1FJSA 3BTQE 1FZZA 3LGIA 2BLQA 4RKOB 1AUTC 2VJ1A 1RD3B 4XBDA 5L2YH 1NS3A 1XUGA 3KYGA 3SORA 3RC4A 4KTCA 3TH2H 4X6NA 8GCHG 1AIXH 1ZZZA 5T3HA 3QDZB 3CS0A 1GBEA 1LPZB 2YOLA 1GJCB 1SG8B 1MTVA 4P02A 1EFRD 1NROH 2ALPA 5EGMA 3DSOA 4ISNA 3SUGA 1O2YA 2R2MB 2WV9A 4RKJB 4BAHB 3T62A 5EXLA 1C5SA 4FUJA 3SQEE 3DA9B 3M5OA 3V3MA 2R0KA 1V3XA 4M9FA 1C9PA 2W5EA 5HKKD 5JBCS 1QIXB 3TGIE 2KX4A 1KXDA 1DFPA 2YMSC 4JK6A 1A61H 3N7OA 4I31A 3SNAA 4X1RU 5L30H 4WY3A 1AE5A 2ODYB 2FX6A 3HGNA 2HNTC 2ZQ2A 3GY5A 2IJD1 2SGQE 2GDDA 1HIAA 3A87A 5A8XA 3E0NB 1A5HA 1AWFH 5EPNA 1DXPA 4B6FA 2ZTXA 2A2QH 3VB5A 1VJ9U 2ZFSA 4AFUA 4DJZB 2J94A 1P11E 1P04A 5FPYA 1LDTT 1N8OB 4D7FA 1EAXA 1OSSA 3MNCA 1AKSA 1H1BA 2ZPQA 4WMDA 2G4UA 2HNTF 4AZ2B 2XNDD 3KHVA 1SL3A 1XUKA 1XX9A 4DT7B 1FLEE 4XBBA 1K1IA 1F5LA 1TPPA 1DVAH 1ETRH 3URCA 4FU8A 5DP3A 5C1UA 3W1EA 1SGPE 2G5VA 4IC5A 3ZVAA 1SFIA 2WV4A 2A5IA 3NCLA 5KEDA 1BBRE 3H7OA 3TGJE 1DICA 1YF4A 1HCGA 4K8BA 5HM9A 1G3CA 1WOFA 2PKAA 4CRFA 1MABB 4RN6A 1XVOA 4GPGA 3ZZBA 5JB9S 1GBFA 3GCHC 4GUXA 3LDXH 1ZMLA 2WPHS 2NU3E 3C27B 3ZYEA 2M5TA 1O36A 4YLUA 3MH6A 3F2HA 1SQAA 1NPMA 3SUDA 3LIWA 2OBQA 1SGEE 5GPIB 4Y11E 1FMGA 4BNRA 5I46H 1Y5AT 4ABIA 1V2TT 3SGAE 1O2LA 2Z94A 3MH7A 5TJXA 1GI7B 4GHTA 4I33A 1P9UA 2LPRA 4YOIA 1YCPM 2VVVA 3A7VA 4X1SU 2NWNA 3DSPA 3RXRA 1FY4A 2HWLB 1ELDE 1TNJA 3O8BA 4MNWA 1PPZA 5HM2A 1O2JA 1FONA 3Q3XA 1MKXK 1Z6EA 1BA8B 1V2RT 3A7ZA 5JDUB 1ELBA 1O37A 4NZQA 2YNAA 2QF4A 4ZH8A 4KTUA 3SUFA 2ZF0H 2PKSC 1QB1A 2FOAA 3AVZA 4HGCA 5LH8A 1P9SA 3T29A 1YCPK 3DD2H 3T5FH 5HIZA 2VWNA 1RXPA 4ZKNU 2KM0A 2BXTH 2H5CA 3RXJA 3F3BA 1V2LT 1EJMA 2PP6A 1C5MD 2BDHA 1BB0B 1NT1A 1HB0B 2VIDA 3LGUA 3MNBA 4X8UH 4BAOB 4IN1A 3A85A 2H6MA 4AGKA 2AGEX 2C93B 2GKVE 4FUCA 4TYDA 5DN6D 1QY6A 2GX4A 2G81E 2C8XB 1P3CA 1YLDA 5IK2D 4CR9A 3A82A 3SJKA 3DHKH 1T8MA 2QF3A 4Q7XA 1F2SE 3PLPA 1QBNA 1V6DA 4YT7H 3RDZA 2R2WU 3ENSB 3QGNB 1UCYK 1KIGH 3Q76A 1C5NH 2HGTH 1N6YA 2VB0A 3QTVH 4F55A 4AB9A 3SBKA 4YLQH 1BMAA 2ZECA 4BTIB 2P59A 1H9IE 5CDFE 4FUEA 4IC6A 1VGCB 2XCFA 4TY6A 2P16A 2Y7XA 3D49H 1DWEH 3Q3YA 4JZIA 1FIWA 4YOGA 1AWHB 4NZLA 2KR7A 4JK5A 3S7KB 3R0FA 5GCHG 1B7XB 1DM4B 3BEUA 4NA9H 3ZZ7A 2A7HA 2ZPSA 4B2AA 3ATKA 3OAAD 1ID5H 1ZHRA 4X1NU 3LGWA 4R8TB 4K3JA 4I7YH 4GHQA 5JPMH 1GGDC 2P3UB 1MTNC 1D3PB 1GI8B 1O3OA 4UD9H 1IQMA 3RXSA 2KCYA 3BIVH 1TIOA 1WQSA 2ZPRA 3EDXB 5FPTA 3F68H 4ABHA 1G36A 1MCVA 1JRTA 2V3MA 3GDVA 2BLWA 2WUBA 4OGYA 1O5AB 1ZGIA 5AF9H 1E1RD 3TJNA 5C67A 3RC6A 5E8EH 1GBKA 3AK5A 1LO6A 2WSSD 4YT6H 3RU4E 1FPCH 2VH0A 1PYTC 1MMJN 3M7QA 1GBHA 3G01A 3RXDA 1QB9A 1O5FH 2Y82A 3MU8A 4X2XA 3MU5A 4B74A 3K65B 3SJIA 3BF6H 1NC6A 2FM2A 1ZPCA 4U30A 1HXEH 3T26A 3LJOA 1VCPA 1GHAF 1GDUA 3QZQA 2XC4A 5C5OA 2ZO3H 4BAKB 3DFLA 1C2EA 1SHHB 2FESH 1IQHA 3ELAH 2QA9E 1CVWH 4CHAC 3OYPA 3PM3A 1FX0B 4JYTA 1G9IE 2A4QA 5DP6A 3SJOA 2QN5T 5LPRA 3ZZDA 1FAXA 1DS2E 1PFXC 2BOKA 2TGAA 1Y5BT 4UE7H 4R0IA 2WHXA 2ZDVH
chains in the Genus database with same CATH topology
1ESAA 3AASA 4ZKOU 4JZFH 3P95A 1JIRA 6LPRA 1GHAG 1AFQB 4K5ZA 2BY7X 3SUEA 1GHZA 4I8GA 3PB1E 1X7AC 1S6HA 2D2DA 3PMHB 2Z9IA 1FY1A 4UEHH 2BY9X 2Z3CA 1GMCG 1LHEH 3TJUA 3SJ8A 1OP2A 1LVMA 1QR3E 1KTSB 4AN7A 1OYTH 2H9TH 1GL0E 2OP9A 2A5AA 1BBRH 1GBIA 4CBOA 4FUBA 1CA0B 1W13U 2NU2E 1T8LA 5JYIA 1EPTC 1UTNA 2QF0A 2VINA 3VGCB 2ZCLP 2VVUA 1BHXB 4TPYA 3SU1A 3F9HA 2ZGCA 2HLCA 2PGBB 1O3MA 1CE5A 3PO1B 1DWDH 1NO9H 1AMHA 2PTCE 2D1JA 3SU3A 5C5NA 5T6FA 2VGCB 4B2BA 4Y71A 5E0GA 1O3CA 3RXLA 1EOJA 1XKAC 1XVMA 2FEQH 3BTEE 4BXSA 4ISHH 4KKDA 1SGNE 1SGCA 3BTHE 1SBWA 1EXFA 2GMTB 1K1LA 1TRMA 2ODPA 1SGDE 4NFFA 4CRCA 3ATIA 1FNIA 1D3TB 1LHFH 2TGPZ 3BTGE 3PV4A 1SSXA 1NN6A 2CV3A 3ZZCA 1ELGA 1AB9C 1UTOA 2VNTA 2I6QA 2Q6FA 4AX9H 1GI5A 5F8XA 1F5KU 3I78A 1CGHA 2AIPA 2FO9A 2ZP0H 1O2HA 4A7IB 1H4WA 3ZZ9A 2OC7A 1HPGA 4GCHG 5PTPA 1TGTA 1LQDB 1O2TA 1TB6H 2UUYA 2J9NA 2BTCE 2R0LA 1BTUA 2Z9KA 1O2KA 2OBOA 2OC8A 1C1QA 2PR3A 4Z6AH 3ZVFA 4GVUA 5JBTA 1EJAA 1LPGB 6ESTA 1UVUH 1IAUA 2AGGX 2CF8H 1P3EA 1F0UA 2V0BA 3A86A 3TH4H 3QK1A 4Y76A 3K6YA 1O2SA 1O3JA 2ZTYA 3LC5A 1O32A 2CJIA 1HAVA 2GT8A 2JKHA 1SGRE 2EEKA 1TMUH 1O2IA 2XCNA 1G2LA 2ZHWH 1W8BH 3EGKH 1TGNA 2ZDNA 2Y81A 3BTDE 4LOYH 5A0CA 1E34B 3IITA 1H8DH 1P57B 2VIWA 1GJBB 1PPHE 4K8YA 2H9HA 1UTKA 4O3TA 5TCCA 3MH4A 2G4TA 5J4SA 3BG4B 1ABIH 2QYIA 3OY6U 2C4FH 2W3IA 5IDKA 1NFXA 1L4ZA 1C2FA 2ZHEH 1YPGH 1Q2WA 1C5QA 5HXFA 1DE7H 3ZZ3A 3RLWH 3SU5A 2ZU1A 2RCEA 2VIPA 1QRXA 2SNVA 4NA7A 1M9UA 3UWJH 5DP8A 6GCHF 1GHVH 1D9IA 3KIDU 3RXFA 1SFQB 3TK6A 2ASUB 3LGTA 2WPLS 1EQ9A 1A3EH 2BD5A 1WBGB 2BX3A 2BDBA 1QHRB 3PLKA 4JZEH 1W14U 1VZQH 3PWBA 2R3UA 3GDUA 1P8VC 2BD4A 4H42U 5FBIA 1A5IA 1XMNB 2WPJS 3UOUA 1V2PT 3ZYDA 4DW2U 1C4V2 2P3FH 3KL6A 4ISIH 1LKAA 1GJ5H 3H7TA 5ABWA 2QXHA 3PLBA 1QRWA 3PMAB 3FP6E 3NZIA 2ZU2A 3T25A 2ZFQH 1HUTH 4MPWA 1TOCB 1SQTA 2AGIX 1YP9A 1O3FA 1H9LB 3ZV9A 2SGAA 4KP0A 1QQUA 1GJ9B 1S82A 3UFAA 2B8OH 1TQ7B 4A92A 4WVPE 4YOJA 1O3NA 3KNXA 3UUZA 3UREA 4LZ1H 2FOCA 3DFJA 3EA7A 1SI5H 3SI4H 3NK8A 2C8YB 1F0TA 1PQ5A 2F9PA 3SOSA 1G37A 3KQEA 2NU4E 1MTUA 1T4VH 1VR1H 3EAJA 1HAGE 7LPRA 2FYQA 2Y6TA 1E37B 4YO9A 1C5YB 1NU7B 4ABFA 4X2VA 2Z7FE 3MHWU 1THPB 4CH8B 3GCHB 2GV6A 4KGAA 1HIAB 2BVSH 3UNSA 4VGCC 5DP9A 2BHGA 5A8YA 1TBQH 4B73A 1MTSA 4E7NA 4AG2A 4NWKA 3UTUH 1C1MA 1IQEA 3FANA 3RMNH 1AKSB 3TITA 4BTTB 3RXCA 1K28D 3SI3H 4IS5A 2DE9A 1RJXB 3K2UA 3KQDA 1FY8E 3T2NA 1QJ7B 2V3OH 2TPIZ 1C1RA 2FPZA 1TGSZ 5T6DA 1UMAH 3QGJA 3SV8A 1TX8A 4O97A 1BITA 3O8CA 4ABEA 3RM0H 5F6MA 3KQCA 1YM0A 2PKSB 1NU9A 2QCYA 2ZEBA 2UUJB 3T28A 3HKIB 1DT2A 1QJ6B 1L2EA 3S9AA 2PKAB 2GGVB 1DLKB 2FZZA 4AFQA 1NRPH 5FCRA 2P95A 3VB3A 1YPEH 2FLBH 1RTKA 5AFYH 4AOQA 4D8NA 1BRAA 1A1RA 3TJOA 1C5OH 1EZUC 5FX6A 3V12A 2AIQA 3D65E 2HVXA 1AUJA 2WINI 1A2CH 1C2MA 4ZUHA 3OU0A 4AORA 1JIMA 5FAHA 5H4IB 1TMBH 1ZRKA 1MCTA 1GI1A 1OOKB 1C4U2 4I8HA 4M7GA 4B1TA 1F0SA 1YKTA 1ZTKA 4I8KA 4TPIZ 1SR5C 1C5UA 5CHAC 1O3AA 1EATA 2GDEH 1C2IA 4Q80A 1EB1H 1SPJA 1PQAA 1CT4E 4U32A 4Y7BA 3FZDA 1ESTA 3ZZAA 4LXBH 3Q3KA 1WAYB 2SFAA 1EX3A 2EI6A 3TNSA 5GWZA 1EB2A 3P6ZB 1IQNA 1V2NT 3SU6A 1GI0A 4WMFA 1O30A 5EQSA 1J14A 2ZC9H 4ZHAA 1FPHH 1ZSJA 5DG6A 3HGPA 3K9XB 3QUMP 3BTME 1MKWH 4Y8XA 5CMXH 1EZSC 3UQVA 3HPTB 5TCAA 1GHYH 1CT0E 1S5SA 2I6SA 2SGFE 2BLOA 3A89A 4AFZA 1OPHB 2Q1JA 1DSUA 1WUNH 1GGDB 1MTNB 3DT0H 4MG3A 1YPKH 1TBRH 1A46H 1GVZA 2KAIA 1GG6C 2BD2A 1V2JT 1HAYB 1BTPA 4CRBA 1O2NA 3SN8A 4K1TA 3GY4A 3S69A 3OY5U 5EODA 3JZ1B 1EASA 2ZFTA 1V2ST 4Q7YA 3UNRA 2OLGA 1BJUA 1VCWA 5C1YA 2ANMH 4DGJA 1QB6A 1E38B 2THFB 4MNVA 1BTYA 3PMBB 2QAAA 2Z3EA 4CR5A 1GCDA 1ZMJA 4MPUA 1C2DA 3ZV8A 2ULLA 3VPKA 1FN6A 1CSOE 1OP8A 1BT7A 1GDNA 3C1KA 1S85A 1C5WB 3NWUA 2EC9H 1K1NA 2F3CE 4BAQB 3GOVB 1AGJA 1O2WA 1HAHH 2TGTA 5E2OA 2DUCA 4E05H 5FHTA 1D3QB 2WPIS 1F7ZA 5L6NH 2Y5GA 1SLVB 1HJ8A 8ESTE 3S9BA 2BVXH 4JZ1A 1EP5A 1ZSKA 5EQRA 5FCKA 3M36A 5L2ZH 2A32A 3UNQA 3TJVA 3U8RH 2FS9A 1ZYOA 4ZMAH 1RGQA 2FI4E 1DX5M 1N1LA 1P2NA 4CREA 3E8LA 1SGYE 3CP7A 1C2KA 4QT8C 3ZZ5A 4MTBA 2GZ8A 1L0ZA 1BBRK 4WMEA 2ZDLA 4LZ4B 1AI8H 3GYLB 1GBCA 1Q3XA 1LHCH 2BZ6H 3STIA 2G00A 1SMFE 1HDTH 3PWCA 3URDA 1L1JA 1TYNA 1S6FA 2AFQB 3FAOA 1GJAB 1W3CA 2BY5X 2F9UA 1P02A 3A8CA 1TBZH 1DOJA 2GCHF 2EA3A 1SC8U 1CA8B 3TIUA 1GCTC 2ZA5A 2NU1E 2C8WB 1WTHD 5EXNA 1S83A 2WPKS 4I8LA 4GSOA 3HK3B 1GVLA 1B5GH 4BANB 1UK4A 4WJG2 1P01A 4D76A 1PPEE 1O2GH 1BRBE 1C5VA 1WSSH 1O5CB 2A4OA 2AMDA 3LGVA 3UOPA 5EW2H 3LH1A 3RC5A 2FOGA 1C5XB 2BVRH 3M3SA 5AHGH 1RIWB 1QA7A 1GPZA 2WV5A 4A6LA 1OWEA 1O5DH 3RP2A 2JETB 2Z9JA 4IW4E 1UVSH 1W2KH 1O3DA 2FTLE 1N8OC 1ELFA 2CHAC 4ABGA 1TLDA 1F0RA 4OS6A 4Q7ZA 1TNLA 4ZXXH 2GCHG 1LTOA 1MUEB 3SQHE 2O8UA 3CS7A 2SGEE 3A83A 2J92A 3VEQB 3SO3A 1UO6A 3MTYA 2V6NA 4AYVB 2AS9A 1AB9B 4B76A 4KTSA 1MTWA 5JBBS 2A5KA 1PQ7A 2BDCA 1W7XH 2Y80A 4XE4A 1DY9A 2UUFB 5HGGA 3KEEA 1BJVA 2HOBA 1O38A 1MAYA 1L1NA 1CHGA 5DGJA 1TNHA 2CGAA 3A7TA 4CH2B 2HNTE 1ZRBA 2A2XH 3M5NA 5I25A 2Z9LA 2ANWA 4NA8A 1DWCH 3ZZ6A 4X6OA 5A0AE 2FI3E 1CGJE 2FS8A 2BM2A 1FUJA 1EPTA 1S0QA 3P8GA 1TPSA 3MYWA 1FY5A 4X0WU 1AFEH 3RXVA 2NU0E 1GI9B 4ISLA 1W7GH 1AD8H 1XUFA 3SGBE 4AYYB 1ANBA 4NIXA 2O8TA 4Y7AA 1W10U 1VITH 1FAKH 4Y8ZA 2Z3DA 2H5DA 1S84A 7GCHF 2Z6BD 1LQEA 3D23A 4UFGH 1YPHC 5K7RA 1D3DB 4NFEA 2H1UA 1C9TA 1O2UA 3P8FA 3ZVCA 1GVKB 2G8TA 5DK1A 1ANDA 2YNBA 3O8DA 1MH0A 2PUQH 1CU1A 1TGCA 1V2KT 1AVXA 2CN0H 5SGAE 4UFDH 4O9VA 3RMOH 2GTBA 1GWAA 3QN7A 3SU4A 4NIVA 2PSYA 5E2PA 1Y3VA 1KXFA 2PW8H 3MNXA 1D4PB 2FXRA 1QURH 7GCHG 3BTWE 4Y10E 3UWIA 1O2ZA 3SV9A 4O3UA 2ZU5A 1HRTH 3A8DA 1FIZA 2F9VA 1C5TA 4X2YA 1ETSH 1O35A 2IN2A 1OWHA 1PPCE 3ODFA 1YPJH 1SB1H 5HYOA 1SOTA 1EUFA 3B8JA 1HAVB 1ZOMA 1JWTA 4ZKSU 1ETTH 1KDQA 2P8OB 2UWLA 1FXYA 2F9BH 1YBWA 3TK9A 2QGRA 2RDLA 3QTOH 4JMYA 3AAUA 1IOEA 1V2MT 3U1JB 3VXFH 1CO7E 2BDAA 2ZFPH 5ETXA 2VVCA 4CBNA 2GV7A 1AY6H 4OS2A 1XKBC 1O2PA 3FZZA 4K2YA 2FLRH 1LPKB 1DUAA 1BIOA 1O33A 3M7UA 1B0FA 1OS8A 2BYAX 3E91A 5BPEA 3P92A 4H6TA 1BDAA 1TALA 2J34A 1W12U 3JZ2B 2QY0B 1CGIE 2AYWA 2CMYA 1IQFA 2J38A 2J4IA 3U69H 1UTPA 4BAMB 4DY7B 1KXCA 1CBWC 5F8ZA 2GZ9A 2ZHDA 1EZQA 1G3BA 2EI8A 4A5TS 3F9EA 4UONA 1RTFB 1NRRH 3ATMA 3AW1A 1UK2A 5E0JA 2AEIH 5E0HA 4X1PU 3GCNA 1EP6A 3U98H 3L3TA 5JB8S 1GBBA 1QL8A 1S0RA 1O34A 3MU0A 4KELA 4SGBE 3VB7A 6CHAC 3K6ZA 3L33A 1O3LA 2B9LA 4HFPB 1FN8A 3LONA 7KMEH 1EOLA 1HXFH 1FV9A 3MH5A 2OD3B 2VU8E 1UVPA 1O3KA 2D8WA 3RXQA 1C5PA 4CRGA 1HNEE 3A81A 1J17T 2BDYA 4OGXA 2F9OA 1Y59T 2IOTA 4ZXYH 1NFUA 5IYTA 2XXLA 9ESTA 1O2OA 2Y7ZA 1C5LH 1AVGH 3SZNA 3MOCA 2AMQA 2PHBA 3MU1A 3SU2A 1J8AA 5FX5A 1GBLA 1HYLA 4DVAU 3FFGA 1GBJA 2ANKH 1BZXE 2ZFFH 3LH3A 1Y8TA 1HGTH 1UTJA 2ODQA 5EPYA 1C2JA 2XRCA 1VITF 3GISB 1JOUB 2FIRH 3MWIU 1WCZA 2W7UA 1GJ4H 1YPLH 3B23B 1RFNA 3RU4D 5FPSA 8LPRA 3V0XA 2EI7A 2ZTZA 1HJAC 1TONA 2BX4A 2XBXA 3I77A 3F9FA 2FOEA 1WV7H 3RXEA 3TPIZ 9LPRA 1GHXH 3ESTA 4NIWA 3LPRA 4JCNA 1LVOA 1NESE 3F6UH 5GJ4B 5A2MH 1C1OA 1T8OA 4TWYA 1UHBA 1VITG 1IQJA 6GCHG 4FUGA 3Q00A 1FI8A 1ESBA 4CRDA 1O3PB 1P2QA 1UVOA 3FVFB 4D9RA 2ZI2H 1F92A 1MKWK 4YTAA 3L6PA 1O5GH 1T32A 3ZVEA 2OCVB 1PPBH 1P10A 1DLEA 1JRSA 4Y79A 1VJAU 3M61U 2A1DB 4U2WA 1Y3WA 5B6OA 1P2JA 4XBCA 3PTBA 3ITIA 1YGCH 2Z9GA 1BHXF 2Y5FA 1TX7A 2PLXA 1QBOA 2LNCA 1S81A 4O03A 3M7TA 4WXVA 3T27A 2BOHB 1ARBA 3P8NA 1GHWH 3KGPA 2HPQH 1OXGA 1C2GA 1P2IA 2IPHA 4F49A 5EG4A 4BXWA 2DE8A 4FU9A 2H2ZA 3ODDA 1JMOH 4IGDA 3RXAA 4JZDH 2VIQA 2W3KA 1AE8H 1HLTH 1KTTB 4DOQA 4WF8A 1Z8JB 4ABAA 2WPMS 5DKMA 3RXKA 1ANEA 1FY3A 5ESTE 1IHSH 2ZDMA 4ABJA 1T8NA 1EAIA 1K1JA 1V2VT 1Z1IA 1NY22 1Z8IB 1ZTJA 2QIQA 3ZVGA 1BTXA 1N6XA 8KME2 1QJ1B 1ZJKA 1P0SH 2CXVA 1SLWB 1K1OA 1ELEE 3TNTA 4F4OC 4FVDA 5C3NA 5LGOA 1LKBA 1AZ8A 2GVFA 3PTNA 4NG9H 3BG8A 2OQUA 2PSXA 4ZHMU 2B5TB 5C20A 1GI3A 2FODA 3OX7U 2QXJA 1BUIA 2RA0A 4UDWH 1XUHA 1BCUH 1NZQH 3I29A 3TH3H 3M37A 1H8IH 5C1XA 2BZAA 2KAIB 1DANH 2AMPA 4CRAA 2GP9B 2FTMA 4MNXA 1P2KA 4UFFH 2ZCKP 3UY9A 1JBUH 1GJDB 2XYAA 1ELVA 3TK5A 1K1MA 1TRYA 2GCTC 4GAWA 1IQIA 1OWJA 2A45B 1G3EA 5FXLA 3EA8A