1TNHA

Prediction of novel serine protease inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnhA02
3SNAA 2FX6A 1P2KA 2FOCA 3BN9A 3QN7A 1TYNA 3GY6A 2BOKA 1C1OA 4CRFA 3RLYH 1GBMA 2A5AA 2BY9X 2ZFPH 4AFSA 2Q6FA 4BANB 2GMTC 2ZHWH 1MKXH 1KXCA 1BTXA 2W3IA 1ESAA 3VB3A 1PPHE 1U6QA 2PWXA 2A7JA 2ZU1A 2GMTB 2ZO3H 1RFNA 2QC2A 1BRCE 3R0FA 1OPHB 1C2JA 5ETXA 2Y5FA 2GT8A 1O2NA 4NIXA 3A7VA 4XSKU 3SNEA 3LDXH 5HXFA 2XYAA 2HWLB 4I8HA 1OP2A 2G4UA 4ABIA 1GDQA 3PB1E 4FUIA 1MTNC 1SGDE 5FCRA 1ZTLA 4DGJA 1Y3YA 1DM4B 2SNWA 1GVKB 1GL0E 3P95A 2BVXH 1HYLA 1P02A 2CHAB 1FQ3A 3ATIA 3SJIA 4Y76A 4XOJA 1HAVA 3P17H 2A2QH 2OXSA 1SGPE 1F0RA 2XC5A 3LU9B 1GG6C 5A8YA 1MTUA 1BBRE 3VEQB 2XBVA 5JPMH 3OY5U 3QK1A 1O3MA 4ZROA 2CMYA 3A7XA 1PPGE 1C1UH 3VGCC 4O9VA 1GG6B 7GCHF 8ESTE 3FZZA 2VWOA 1LCYA 4JZ1A 3MHWU 3VGCB 3N7OA 5A0CA 3BIVH 1MUEB 4H6TA 2VIDA 2OC1A 1UTMA 1B7XB 1W10U 3OY6U 2C93B 4X6OA 5JBBS 4LZ1H 1EX3A 3ZZ3A 2F9OA 1C5NH 2FTLE 2A2XH 1SGFA 1D3PB 3BG8A 1CBWB 4NIYA 3SHCH 4AG1A 4AN7A 1PPEE 2G8TA 1O3OA 3PROA 3E8LA 3UOUA 1GGDC 1UMAH 1P3EA 5GXPA 1J16A 2W5EA 1TNIA 5DP8A 1GBIA 4ISNA 3U98H 1C5ZB 1GGDB 1AUTC 1TRNA 3A81A 5E0JA 4TY7A 2BXTH 3U1JB 5E0GA 2GTBA 1GMHF 1SLXB 1TBQH 3D49H 5GPIB 1O2IA 3SU5A 1UHBB 5JBCS 4Q2KA 1VITG 1Y5BT 1DXWA 3UOPA 1Y5AT 1F7ZA 1ZGVA 2JH6D 1OWIA 3RC5A 2ZHDA 4ZKSU 1P2IA 2ZG0H 3F9HA 4OS2A 2V6NA 1HV7A 1F92A 5DGJA 1Z8RA 1VCPA 5C67A 1HJ8A 2HNTF 1O3HA 3IG6B 1A5HA 4GUXA 2ZQ1A 3ZVDA 1C1QA 4D8NA 1OYQA 3KL6A 3ATMA 2PV9B 1GBTA 1AWFH 4Y7AA 1FUJA 2Y5GA 4Y6DA 2ZPQA 1EPTB 1YPMH 4TY6A 1BTZA 2ANMH 2Q6DA 4B75A 5HM9A 3MMGA 1C2MA 1OWKA 4NA9H 1GJ8B 3SQHE 1ANEA 1BBRH 3LH3A 1QGFA 1ZHMA 2WUCA 4JZIA 1ETTH 2PSYA 3IITA 1O2ZA 1GBHA 1AN1E 3A7TA 4LOYH 1A0HB 4X6NA 1XUKA 1MAXA 2FEQH 1N6XA 2A45B 1GPZA 3LGUA 3E90B 1V2OT 2GCTC 3MU4A 4IC6A 4MNVA 2CJIA 3UIRA 3SORA 1TA6A 3FP7E 3KQCA 2V3HH 5JB9S 1B5GH 1JWTA 4K8BA 2C90B 1C2LA 2C8WB 3TGJE 3PM3A 1C9TA 5K7RA 2HNTE 1GI4A 4JYTA 3RXDA 5I46H 4B76A 1GJ5H 2HVXA 1GI7B 1KTSB 1GBLA 1SR5C 1BA8B 2H9HA 3E3TA 3OU0A 1NO9H 1SSXA 2XRCA 3OTJE 4X8UH 1NU7B 2QF0A 3H7OA 1SGTA 1NZQH 2ZQ2A 1AD8H 3HKIB 1SQTA 5A0AE 2AIPA 1MU8B 3LJJA 1D3DB 5CE1A 1O2YA 1TNHA 3V0XA 2AEIH 2ZI2H 4INKA 1G9IE 2WYGA 2UWOA 3RXJA 8LPRA 1O2KA 3LOXA 2VVVA 2ODYB 4X6MA 5TCCA 3ZVCA 5FCKA 4HGCA 1ZR0A 2VIOA 1EB1H 2WV5A 3ZVEA 1C1RA 1YPHC 1H9IE 2AGIX 2BXUH 1H8IH 1H8DH 2XWAA 1ARBA 2SGQE 3SJ9A 2P59A 3P92A 1HJAB 1THPB 1GBAA 5DP7A 1HLTH 1BMNH 4AFQA 1NESE 2AFQB 1J14A 2UWPA 1V2TT 5FBIA 2VJ1A 5C3NA 2XCFA 2Z6BD 4Y0ZE 1ETSH 4X1SU 3ENSB 3URCA 5CMXH 1YC0A 3S9CA 3SZNA 1TOCB 5DP9A 5JYIA 3RMLH 4CHAB 4Y79A 2BLVA 4XFQA 4AB8A 1K22H 1MBQA 1FDPA 1B0EA 3PLBA 4X1QU 2ZCLP 1WCZA 3A7YA 4YT6H 5PTPA 3U8TH 3GYMA 3SUGA 2ZHEH 4B2BA 3E16B 1PYTD 2WINI 4AZ2B 1V2UT 2PKAB 3SW2B 3ZZ8A 5DP6A 2BQ7B 1Z6JH 1LVYA 3BSQA 4IMQA 3RU4E 1LO6A 3PLPA 2Z9IA 3TK9A 1DWBH 1S6HA 1VJAU 1ESBA 4X1NU 2B0FA 3A82A 2GP9B 1UCYE 1O2UA 1ZYOA 4GSOA 3UQVA 2GCHF 1EOJA 1LHGH 2C8YB 4WF8A 2FTMA 1WAYB 5E0HA 2Y7ZA 3SI4H 1JRSA 2D8WA 1A46H 2P93A 1IQJA 1ELAA 1NM6A 1C5MD 1GJ6A 3BTQE 2F9PA 4D76A 1V2PT 1ZOMA 1XVOA 3RLWH 3MU5A 1HPGA 2GDEH 2UUJB 3QO6A 5HM2A 5A09A 2SGDE 3SV6A 3P8NA 1CA0C 1BTPA 2HPPH 1LPKB 4HI3A 3S9AA 1LHDH 2YNAA 1O2HA 1TQ7B 2NU4E 1W11U 1GJCB 2Q6GA 1W12U 4FUDA 2QXIA 1HAPH 1LQEA 1CA0B 1A1RA 2JH0D 1XUIA 4GVUA 1A4WH 5EU8A 1Z6EA 3HATH 1MTWA 3RUOA 2Z3CA 4ABJA 4NWKA 2IOTA 2J38A 1C2EA 3PV4A 1NN6A 4MNXA 3RMNH 1K1JA 2QA9E 1LHCH 4DJZB 2O9QA 1FAXA 3F6UH 1IQEA 2RCEA 2PUQH 1HIAA 1J9CH 2ESTE 3T2NA 3UNRA 1TMUH 3TJUA 3DD2H 1K1NA 4ZXYH 3O8CA 1GI8B 2ZHQH 2A32A 2BD3A 2G55A 1PQAA 4NA7A 3RXSA 2OD3B 2GD4B 5FAHA 1RD3B 1SOZA 2FS9A 1HAVB 1TPOA 4FUEA 5JB8S 4DG4A 1LKBA 1S83A 1UVOA 3AW0A 1LPGB 4WH6A 4K8YA 1ELEE 1W8BH 4O3UA 1UK3A 1GMCG 1VGCB 4QT8C 6CHAC 3U8OH 1KSNA 1T7CA 4OGYA 2FPZA 1G32B 3RC6A 2VH6A 3M5LA 1UCYH 1W3CA 2H9TH 2ZU5A 1J15A 4X2XA 3E0NB 6CHAB 3RMMH 4MLFB 2C4FH 2V0BA 3K9XB 4UE7H 1YF4A 1OWDA 1UTQA 1YKTA 3NWUA 2THFB 3TNSA 4ABAA 2PR3A 2UWLA 2DE9A 1P3CA 4Z6AH 3LGWA 5EXLA 3TLOA 3BG4C 4UFGH 1V2QT 1DUEA 1G3CA 1N6YA 1A5GH 1NRQH 2CV3A 3Q3KA 2PGBB 1IQKA 1K1PA 1NC6A 4UFEH 5TJXA 4NGAH 3NXPA 3RXTA 1UCYK 2ZDNA 5A2MH 3BTHE 1QL7A 4WH8A 4ZXXH 2NU3E 1GHZA 2OQUA 2BLWA 1ZJKA 2FOBA 1LTOA 1SL3A 3QDZB 3TJOA 1N8OC 4H4FA 1IQMA 1UVUH 2ZF0H 1OWEA 1SFIA 2GGVB 1UTOA 1W7GH 1C1MA 2OLGA 2BZ6H 4UEHH 2AMPA 1OWJA 1NS3A 1MZAA 3ELAH 4CRGA 1ELGA 1G3EA 1TX8A 1O3NA 1FY4A 2D26C 4CRDA 3PLKA 3W94A 1P04A 3SOSA 1GI3A 1S0QA 3A8BA 4YLUA 4AOQA 1T8NA 5DJ7A 3LKWA 2PW8H 3A83A 5JDUB 3ZZ5A 2P8OB 4TPYA 5EQRA 1JIMA 2HGTH 1ZPCA 1FY1A 3E6PH 1FPHH 2ZHFH 1C2HA 1MZDA 3BV9B 4DT7B 2CF8H 1O36A 2Z3DA 1FY5A 1GCTB 3Q3YA 5DG6A 2PGQB 1CA8B 3GCHB 3P8FA 1ELCA 3P70B 3MNCA 1XKBC 4JCNA 5F6MA 1ELDE 1Z8IB 1VR1H 2Z9KA 3NCLA 4TWYA 1ZJDA 3D23A 3MO9A 3GISB 2YNBA 1S84A 3C27B 1EQ9A 1D6WA 4MPUA 3FANA 1UTPA 3SUDA 1S85A 1QJ6B 3ZZ4A 1AVWA 1ELTA 4Q7ZA 2FESH 3T5FH 1XUFA 3KNXA 4JYVH 1CE5A 1S6FA 2ODQA 3ZZ9A 4Y7BA 2Q1JA 1O38A 2PKAA 3QGNB 3RXAA 1CQQA 3SU6A 3GDUA 1SVPA 4AFZA 3AAUA 3BF6H 2AIQA 5JBTA 3O8BA 4NIWA 1UTLM 4KGAA 3JZ2B 1O3GA 1O3JA 1GVZA 4INHA 2P3TB 3SV9A 3GICB 3BTDE 3RMOH 1ANCA 1GBDA 1SG8B 1XUGA 1YBWA 3A8CA 3FZDA 4WXVA 1P2JA 3MTYA 4U32A 1ZGIA 2TGDA 4TWWA 1DWCH 1P01A 4NA8A 3TNTA 3MH7A 4SGAE 2BLQA 3TH4H 4K1SA 5K0HA 5AHGH 2BDIA 5BPEA 2WUBA 1AI8H 1QA0A 2BTCE 1NT1A 2EC9H 1NFXA 3JZ1B 2A7CA 3S7KB 3TH3H 1QL8A 1CSOE 3K65B 5LPFA 1Q2WA 2GZ9A 1SC8U 1THSH 1CHGA 3VXFH 1FIZA 1ELBA 1T4VH 1GJBB 2FXRA 2IPHA 1D9IA 4ZAEA 2XCNA 1GHBG 1DLEA 1HRTH 2ZEBA 1EOLA 1P11E 2AMDA 3ATKA 1D6RA 4XDEA 1T4UH 3SJOA 3VB5A 4NSYA 2Z9JA 1Y3UA 3A7ZA 2Z94A 1O2JA 1SBWA 1E0FD 4MPWA 1WYKA 3SNBA 3M3SA 4ZHMU 4CRAA 5A8XA 2BDHA 1GDNA 2FOGA 3S0NA 4TPIZ 1MKXK 1QL9A 1MTNB 4GCHG 3S69A 2TPIZ 1YLCA 1TMTH 4K1EA 1EATA 3MYWA 3QWCH 3LGIA 3AASA 1LPZB 3TITA 1O2TA 2A5KA 2NU2E 1W14U 1O2RA 1V2KT 5F8ZA 2ZDVH 3RXRA 1YM0A 2QAAA 2GDDA 2W7SA 3W95A 4KTCA 3RXHA 3LPRA 3GY7A 2GZ8A 5AF9H 5LPEA 1FXYA 3UPEA 3KIDU 1FN8A 1FAKH 2OC7A 3EA9A 3NUMA 1ZLRA 3UUZA 4F4OC 5LH8A 2NU1E 1T31A 3AW1A 2OTVA 2ZGHA 1BMMH 3Q00A 1WQVH 2ZDMA 5F8TA 3P8GA 1ZSLA 5AVDA 1ZPBA 4TYDA 1O5AB 1GMDG 2OQ5A 2OINA 3A7WA 4M7GA 2GZ7A 2AH4X 1O3AA 3ATLA 1EZSC 2HRVA 3MNXA 1ZZZA 2Y7XA 1OX1A 2ULLA 4GHTA 1C5PA 2R0KA 3ODDA 3HGNA 1KXEA 1LHEH 2WPLS 2PSXA 2ZTXA 1NFWA 2AMQA 1DE7H 8KME2 1A0JA 2D1JA 1ELVA 2BYAX 3K2UA 1GI2A 4MG3A 1Y3XA 1GMCF 1EAIA 5EPYA 2ZECA 4R8TB 1FPCH 1HIAB 1TGBA 1W2KH 4WXIA 3R3GB 1GDUA 4OS6A 4I7YH 4MTBA 5FXLA 1DY9A 1C5QA 1QJ7B 3G01A 2Y82A 4ZKOU 1MAYA 1LVOA 1V2VT 2M5TA 2TGPZ 4JK5A 3U69H 3UFAA 2FODA 1TOMH 2ZFTA 1O5BB 2ZFFH 3RXQA 1C1TA 4D9RA 3HKJB 3ZZCA 9LPRA 1FN6A 1TMBH 2SGEE 3EA8A 1IQFA 5A0BA 1L1NA 1S5SA 2RA3A 1HJ9A 1FNIA 4AGJA 5GCHF 1YCPH 4GPGA 5B6OA 1CHOF 2F9UA 2QV1A 5GWZA 4X1RU 3VB6A 3Q77A 1SFQB 1HDTH 3LT3A 1C4V2 1F0SA 2VGCC 1XX9A 1YGCH 2OCVB 2RG3A 3KQBA 1ZMNA 2GV6A 2Y5HA 2GX4A 1WUNH 1Y3VA 3L33A 1Z8JB 1XKAC 3TIUA 2VGCB 1ACBE 5C5OA 4NZQA 1ABIH 2BD5A 3AAVA 1UVPA 2VIWA 2R9PA 1MCVA 2QCYA 1K21H 1J8AA 2LNCA 2WPMS 2PTCE 2FIRH 3M37A 3ZYEA 1YCPK 5T6DA 1QB1A 1MKWH 2GCTB 3UNQA 3SV8A 1BBRK 4IS5A 1V3XA 1DSUA 1L0ZA 2BQ6B 1MCTA 3P8OA 3EYDA 4FU8A 1TX7A 3HK6B 3RP2A 2FM2A 4E05H 1F0UA 5C2ZA 2ANKH 2FOEA 3UWIA 3DFLA 2J92A 4FU7A 1EUFA 1G30B 2A31A 2R2MB 1O2SA 1ZMLA 3MWIU 1P12E 3T29A 1GJ4H 1IQIA 3QX5H 1O3KA 4I8LA 4UFDH 1FJSA 2WV4A 1O32A 5EXNA 4X8VH 1MKWK 1SHHB 1YYY1 1K1IA 1T8OA 1UTNA 2QXGA 1DWDH 1BRBE 4KELA 1GWAA 1TQ0B 3GYLB 1Y8TA 3TVJB 4OS5A 1C2KA 4A1TA 2F9NA 1TBZH 3ZZDA 3RXUA 4DOQA 5EOKA 5AFZH 5IYTA 2JETC 1UVSH 4MNYA 4CR9A 2ZFSA 3KGPA 2TGAA 1SGNE 1S82A 1UTKA 3FP6E 3ZYDA 1SGIB 2C8ZB 4JMYA 4ISOA 2W3KA 1GCDA 1RIWC 1CVWH 4UD9H 5C1XA 1A0LA 1P10A 3SI3H 4XBDA 4K1TA 1QNJA 2ZU4A 2RA0A 1RIWB 4YLQH 3URDA 4ZHAA 3VB7A 4O3TA 1GBFA 1EASA 1PQ5A 3NZIA 2BOHB 3DFJA 4YOGA 3NPSA 1TB6H 3SNCA 1DLKB 4LXBH 4A7IB 4ISIH 1HAHH 2BD9A 4Y8YA 4B73A 1CO7E 1QBNA 2G5VA 3VXEH 3Q3XA 1Z71A 3SU4A 2HNTC 1DICA 3QZQA 4MDSA 4F49A 1F0TA 4YTAA 3C1KA 1V2JT 2PKSC 1O35A 2Y80A 1UTJA 4DURA 4Y11E 5DP4A 2UUKB 3BTGE 2PKSB 5F8XA 1OSSA 1ZSJA 4A1VA 1HNEE 2G81E 1FI8A 2G4TA 1DS2E 1WTHD 1AVGH 1K9OE 1O2GH 1XXDA 3QLPH 4FUJA 4WWYA 4U30A 1C4Y2 3K6YA 4AGKA 1AY6H 2Y81A 3RM0H 1UO6A 1FMGA 4GCHF 2XBYA 9ESTA 1FY8E 1C1VH 1GJ9B 5DO4H 1BOQA 4X2YA 3RXCA 3RU4D 1PYTC 1OWHA 5C1UA 2G52A 1OYTH 4XBBA 4X8SH 2BX4A 2XC4A 3FVFB 2BDGA 1YPGH 2EA3A 1BTWA 3UQOA 1QBOA 4WJG2 1BRUP 3MNBA 4OS1A 1ANBA 2VWNA 4OGXA 1WQSA 1TRYA 1AFEH 1GBCA 4AYVB 1VJ9U 1RTFB 3GOVB 3ZVGA 2WPJS 4X2WA 3EE0B 1YLDA 4ABDA 1GJAB 2CF9H 1AE5A 1L4ZA 1EZQA 3TK5A 1BJVA 1TNGA 1CGHA 3EAJA 1FZZA 2G00A 4CBNA 5EPNA 4J2YB 3GY8A 3CENA 2HPQH 1XVMA 1O2MA 2P95A 5FPSA 5L6NH 1GL1A 3MU8A 2XC0A 1SPJA 1LHFH 1T32A 2G51A 1QRZA 1ETRH 3O8DA 4HZHA 4YM9A 2DUCA 3STJA 4H6SB 3LGTA 1LVBA 1THRH 2AERH 2A4QA 1KXDA 3PTBA 2O8LA 1VITF 4BXSA 4NZLA 1KYNA 1ZHRA 3MU1A 3RC4A 3GCNA 1F5RA 1C5LH 1GHVH 4ZH8A 1DX5M 2GT7A 1E38B 1KXAA 1T8LA 3IWMA 2A4OA 3F68H 4VGCC 1IAUA 1WTGH 4B1TA 1SLVB 1ZMJA 2FI3E 1J17T 1N1LA 4MPVA 3GDVA 4A92A 1L1JA 1A7SA 1TNLA 6ESTA 4SGBE 4VGCB 1A5IA 3A84A 1EXFA 4IN2A 4BTUB 4FXGH 1O3CA 4LZ4B 3BG4B 4JYUH 3LGVA 3T28A 4IMZA 2XW9A 3ATWA 4YT7H 2ZGXH 2IN2A 3B9FH 2J94A 3CS7A 3HGPA 2K1QA 1VCWA 1MD7A 2BD7A 4NFEA 1K1LA 1BDAA 3QTVH 4THNH 3TJVA 1BMAA 1C1PA 1Q31A 3ZVBA 3RXGA 2R3YA 4RSPA 1AGJA 1EB2A 5GJ4B 2XWBI 1N8OB 1JIRA 3NK8A 5J4QA 1YPEH 1SI5H 3M35A 2QY0B 4PROA 1Q3XA 5C5NA 1P9UA 1SGEE 2BX3A 2OUAA 1ZHPA 1QQ4A 3UREA 1V2MT 3SO3A 4E7RG 4UDWH 1TALA 2B9LA 4ABFA 6GCHG 3SGBE 2O8MA 4DIHH 2ZTZA 3QGJA 2KAIA 2W26A 2A0QB 3ZV9A 3ZZBA 1GBBA 2PHBA 2WPIS 3M7QA 3U9AH 4CRCA 1SQOA 1UK2A 1GBKA 1UK4A 1P2OA 4FUHA 3SU0A 3V3MA 3MO3A 1YPKH 1JXPA 2VWMA 1O5EH 1OKXA 1FV9A 4Q80A 4Y0YE 1ZTJA 5HYOA 1EZXC 3M5MA 3A8AA 1V2NT 3U8RH 1C5YB 1PPFE 4NCYA 4R0IA 4IW4E 2BY8X 4Y8XA 4ISLA 3PMBB 3VFEA 1SHYA 1NRPH 1P05A 2V3OH 2O8WA 1O5FH 3L3TA 1O2PA 1C1NA 4X1PU 1D3QB 1W0YH 5T6FA 1QHRB 2B7DH 1O2XA 1XMNB 2BDAA 2WYJA 1O34A 1O2WA 4RKJB 1Z8GA 1KXBA 1EJAA 8GCHG 1NPMA 1SGCA 1V2ST 2AS9A 4FVBA 2ZPRA 2FZZA 2STBE 2OBOA 3U1IB 4WMFA 2P94A 2A4GA 1OP0A 4XBCA 4OS4A 1G36A 3GY2A 2ZFQH 4ABBA 5CHAC 1F5KU 3OYPA 4GHQA 1OXGA 1BTUA 4I8KA 2FOAA 1K28D 5CHAB 1RTLA 3DUXH 1KLIH 1TBRH 4HTCH 1AKSA 3SU2A 2ZP0H 5EXMA 4ZMAH 1GI9B 2ZZUH 1VITH 1C5TA 1WSSH 1C5VA 1QRXA 2B5TB 3EA7A 4E06H 2D2DA 1FY3A 1DWEH 3V12A 5T3HA 1W13U 2I6QA 2P3UB 1SLWB 3LGYA 1IHSH 1LKAA 2VVCA 2CN0H 2C3SA 5ESTE 1TFXA 1QCPA 1DT2A 3F9EA 4K60A 1XM1A 1BHXB 2BD4A 4E7NA 5DP5A 3SUEA 1O3DA 3BEFB 2F3CE 1EAUA 2FP7B 4WMDA 2J34A 3VPKA 1OOKB 2Y6TA 1HUTH 3CS0A 2GCHG 4MPXA 5J4SA 1C2GA 3RXKA 3KQDA 2ZCHP 1CGIE 1RGQA 1LDTT 2OC8A 3TPIZ 3UY9A 3ZZ7A 3MH6A 2VH0A 3DHKH 1TE0A 2SGAA 4D7GA 2FI4E 3LJOA 3GY4A 1E37B 1GHAG 2A1DB 6LPRA 1OP8A 3ESTA 1QA7A 2PUXB 2ZPSA 4K2YA 4B74A 5DK1A 1HXEH 2CHAC 4BAQB 1V2RT 3E91A 2FWWA 3BTKE 1EAXA 1BT7A 2O8UA 2NU0E 2TRMA 4XE4A 1HAOH 1IQHA 1TGCA 1O2VA 4WY3A 2ZWLH 4MQAA 1B0FA 1W7XH 4X2VA 2GVFA 2FOHA 2JKHA 3V13A 1XXFA 3S9BA 1NFYA 1UJ1A 4FU9A 5DP3A 1NFUA 2H5DA 3GY3A 4BTIB 4YO9A 1KDQA 2HLCA 4H42U 2VNTA 1BIOA 1TNKA 3RXVA 4O97A 1FIWA 4FUGA 4BAHB 1QQUA 1EP6A 1HGTH 3I77A 1CBWC 2BB4A 4IN1A 2ZFRH 1LMWB 2QIQA 4ZUHA 3FAOA 4IGDA 1KLJH 1O5DH 4D9QA 2FYQA 4I8GA 2XXLA 3EGKH 1GHXH 1ELFA 2R3UA 3MO6A 3ZZ6A 1MQ6A 2J4IA 1C1WH 1OS8A 4AG2A 2FI5E 3KEEA 5EODA 5FHTA 3Q76A 2CXVA 3ODFA 2ZU2A 1JMOH 1BMLA 1AO5A 1P2QA 5ESBA 1HXFH 1Y59T 2FLBH 2EEKA 1TGSZ 3SJ8A 1AMHA 1C2FA 3ZVFA 2BDCA 1X7AC 1QB6A 3KHVA 3RDZA 1DPOA 1JRTA 4RKOB 5H4IB 1AWHB 1PQ8A 5AFYH 3A86A 3F1SB 3LH1A 1DOJA 1O3BA 1AVXA 1C4U2 1KXFA 3A85A 1L1GA 2Z9GA 1RS0A 2FS8A 7ESTE 3P6ZB 5T6GA 4CRBA 1O31A 4INLA 1C1SA 4A6LA 3D62A 5I25A 4CR5A 4NG9H 1GBJA 4AX9H 4A1XA 1IQGA 1BTYA 3BTME 3UNSA 1EKBB 2XTTB 3DA9B 2CGAA 3TGIE 5FPYA 4ABHA 3ITIA 3M3VA 2OP9A 3I78A 1CU1A 3EDXB 1TPPA 3OX7U 4UFFH 1EPTC 5JBAS 2VU8E 2OC0A 1O0DH 1P03A 1TONA 3SV2H 1D4PB 1YPHE 3TJNA 7LPRA 1PFXC 3EQ0H 1NU9A 2AYWA 3HPTB 5GIBA 4ABGA 1C5SA 1GHWH 2HALA 1DSTA 3TU7H 1A2CH 2G5NA 2O8TA 4U2WA 5FPTA 1DANH 1LQDB 2FOMB 3PYHA 1TWXB 3TGKE 1ZRBA 2VVUA 5LGOA 4DCDA 1CT4E 4BAKB 1EZUC 3LC3A 1O2LA 4NFFA 1UVTH 2GKVE 3TH2H 6GCHF 2J95A 5E2OA 2ZGBH 2BZAA 1AZZA 2SNVA 2ZIQH 3GDSA 2A7HA 3BIUH 1K2I1 4K3JA 5C20A 3T26A 2ODPA 2XBXA 4YOIA 1MBMA 3SJKA 1TPAE 3F9GA 3SGAE 2C8XB 3MOCA 3RXIA 4Y71A 1EAWA 2A4RA 1HAGE 3RXMA 4ZHLU 1C2IA 2DE8A 3QZRA 1ZRKA 3SHAH 2I6SA 2ZA5A 1TGNA 1EJMA 3L6PA 1ANDA 2OBQA 4B2CA 3M61U 1O3IA 2VIPA 1P8VC 3LONA 3UWJH 4BOHA 1QFKH 2KAIB 2FDAA 3BEIB 1HCGA 2F9BH 4I31A 1ESTA 3K6ZA 1BITA 2QGRA 1WOFA 2A5IA 1O2OA 1MD8A 1TLDA 4UONA 4D7FA 1AQ7A 1IHTH 1G2LA 1GI6A 2WPKS 2VIQA 2ZNKH 1ID5H 8GCHF 3NKKA 2JETB 3MH4A 3RXOA 1SGQE 2J2UA 1L4DA 1ZPZA 4O03A 1IQLA 2BY5X 3M5NA 1DY8A 3OSYA 4X8TH 1GBEA 2FOFA 3SGQE 1HJAC 4JZDH 1NTPA 4KTSA 4KTUA 2ZDLA 5ABWA 1KTTB 2VWLA 3M36A 5EW1H 3A80A 5EQQA 2EI8A 3BTTE 1IOEA 2BM2A 2FMJA 1QURH 1C2DA 3VB4A 3A88A 1DVAH 4BTTB 4FVDA 1HBTH 2J9NA 3GCTG 1HAYB 1A3BH 3RXLA 3T25A 3KF2A 3QTOH 4CHAC 5E2PA 2QXHA 4YZUA 1DUAA 1KLTA 5L30H 1O3FA 2P16A 1FONA 2AGEX 3SNDA 4U01A 1BJUA 4OS7A 1INCA 4I8JA 1QBVH 1GHYH 1KY9A 3PMAB 1H9HE 2SFAA 1YPLH 3MI4A 2Z7FE 3SN8A 1AU8A 1GHBF 1PPZA 3SBKA 1Z1JA 3KCGH 4CREA 1RXPA 1LVMA 4B71A 3ZVAA 3FP8E 3H5CB 3M7TA 1DDJA 3PO1C 1Z1IA 2SGFE 3V7TA 2BDBA 3RXPA 1S81A 7KMEH 5DKMA 4X0WU 1G3DA 2VINA 2BQWB 1AKSB 1W0ZU 2ZGCA 2HOBA 3PO1B 1HB0B 4B2AA 1P09A 1BZXE 4KKDA 1XUJA 1AB9C 2PFEA 3D65E 4JZFH 2F91A 1MU6B 2UUFB 1V2LT 4NWLA 2VB0A 3T62A 1GI0A 1YCPM 1K1OA 4MNWA 3UR6A 1TIOA 4BAMB 3PTNA 3SV7A 1AB9B 4X6PA 3GCOA 1VCQA 4AFUA 1GHAF 1G2MA 1MMJN 3I29A 2YOLA 2FO9A 2V35A 1SGRE 1QTFA 4JK6A 1DXPA 5TCAA 4DW2U 2ZDAH 1F5LA 1P06A 2TBSA 5EGMA 1KIGH 1P57B 1GJDB 2GV7A 4I33A 3QUMP 4GLYA 3B23B 3BTWE 4BAOB 1RJXB 7GCHG 4K69A 2UUYA 3MU0A 1O37A 1BTHH 1QJ1B 2TGTA 4BXWA 4IC5A 2ILNA 1UHBA 3F9FA 2PLXA 3M5OA 5BRRE 5EQSA 2QF3A 1GMDF 3DT0H 2ALPA 1QY6A 1O39A 1PPBH 5C1YA 1RTKA 1WBGB 1CGJE 4DY7B 1DFPA 1C5UA 2ZKSA 3PWBA 1H9LB 1BQYA 3RXFA 2H6MA 4Y8ZA 2BLOA 2JH5D 3BEUA 5A8ZA 2Z3EA 1K1MA 3ZZAA 5FX6A 5HGGA 2BDYA 4BNRA 3BTEE 3BTFE 1H4WA 4HFPB 5FBEA 4AB9A 1H1BA 1GMHG 1CT0E 4Q7YA 4Q7XA 1VGCC 1KDQB 1EPTA 2B8OH 1ZTKA 3PWCA 1QIXB 4LK4A 1AE8H 4YESB 3A89A 1AUJA 2BHGA 1RRKA 1ARCA 2BD2A 2IJOB 1T8MA 2BVRH 5GDSH 1D3TB 1ZSKA 1V6DA 1WU1A 3T27A 2F83A 4NIVA 1GI5A 1XUHA 1TA2A 1QRWA 3LIWA 4ASHA 1C5WB 1GVLA 3PMHB 4I32A 1HAZB 1BHXF 1C5XB 3KN2A 1BUIA 2ANWA 2ZTYA 2ZU3A 1EJNA 1AHTH 2F9VA 4FUCA 1E34B 2FX4A 3SU3A 1AZ8A 2FLRH 1AFQC 2WPHS 5GCHG 1CHOG 4YOJA 3B8JA 3M3TA 3FFGA 1YP9A 1MH0A 1NROH 3SUFA 1A61H 4ESTE 3M7UA 4JZEH 1AFQB 4ZKRU 2BVSH 1O3LA 1O30A 3HK3B 5IDKA 1NRRH 1Z7KA 1P0SH 3RXEA 1SOTA 4CBOA 1YPJH 3SQEE 2BY7X 5E8EH 3RU4T 5LPRA 3TK6A 3UR9A 3WY8A 3AVZA 4AORA 5L2YH 4AYYB 1MQ5A 4K5ZA 3MFJA 3MH5A 1P9SA 2TIOA 3RXBA 2H1UA 4FUBA 3KQEA 1EP5A 3H7TA 3E1XB 1V2WT 4FUFA 1FLEE 2EI6A 1PPCE 1SB1H 2AGGX 1HAIH 2EI7A 1BRAA 1DITH 1HAXB 5SGAE 2STAE 1QR3E 2QN5T 1IQNA 2SGPE 2P8OC 4DIIH 4A5TS 2BD8A 1O33A 3S7HB 1GJ7B 1Y5UT 1NY22 2ASUB 1E36B 2ZCKP 1TGTA 3A8DA 1GCTC 1S0RA 1Y3WA 1QB9A 3GCHC 1JOUB 1WV7H 1SLUB 2H9EH 2H2ZA 1CT2E 4DVAU 4WMEA 1C9PA 2R0LA 2XBWA 5EW2H 2FYRA 3PMJA 1PJPA 2BY6X 2ZDKA 2ANYA 1NRNH 4ISHH 1ORFA 3O8RA 1O5CB 1O3EA 1E35B 2R2WU 2P3FH 4GAWA 1ABJH 3GY5A 3E0PB 1SGYE 3MNSA 1BCUH 5FX5A 2ZGJA 1PQ7A 4KP0A 2NWNA 3RM2H 2ZC9H 2H5CA 1G37A 1O3PB 3UTUH 4NSVA 3LC5A 5F03A 1NRSH 2RDLA 2ALVA 1MTVA 5DPAA 2W7UA 1AIXH 4ZKNU 4IBLH 1TPSA 2QYIA 1SGFG 2XNIA 4Y10E 1O5GH 4ABEA 1TABE 2LPRA 2VIVA 3SU1A 3ZV8A 5EG4A 3STIA 4WVPE 4CH2B 1C5RA 1JBUH 1TRMA 4RN6A 2QXJA 5L2ZH 1F2SE 1HFDA 2BMGB 1TX6A 1C5OH 1O2QA 5HMAA 1TNJA 1BB0B 1M9UA 3A87A 4J1YA 1P2MA 1GI1A 2PTNA 1VZQH 1G3BA 1SMFE 1MTSA 3GCTF 1L2EA 1SQAA 4CH8B 2Z9LA 1TAWA 4MVNA 4Z0KA 1A3EH 5G4BA 1P2NA 3CP7A
chains in the Genus database with same CATH superfamily
3SNAA 2FX6A 1P2KA 2FOCA 3BN9A 3QN7A 1TYNA 3GY6A 2BOKA 1C1OA 4CRFA 3RLYH 1GBMA 2A5AA 2BY9X 2ZFPH 4AFSA 2Q6FA 3MQKC 4BANB 2GMTC 2ZHWH 1MKXH 1KXCA 1BTXA 2W3IA 1ESAA 3VB3A 1PPHE 1U6QA 2PWXA 2A7JA 2ZU1A 2GMTB 2ZO3H 1RFNA 2QC2A 1BRCE 3R0FA 1OPHB 1C2JA 5ETXA 2Y5FA 2GT8A 1O2NA 4NIXA 3A7VA 4XSKU 3SNEA 3LDXH 5HXFA 2XYAA 2HWLB 4I8HA 1OP2A 2G4UA 4ABIA 1GDQA 3PB1E 4FUIA 1MTNC 1SGDE 5FCRA 5EJZA 1ZTLA 4DGJA 1Y3YA 1DM4B 2SNWA 1GVKB 1GL0E 3P95A 2BVXH 1HYLA 1P02A 2CHAB 1FQ3A 3ATIA 3SJIA 4Y76A 4XOJA 1HAVA 3P17H 2A2QH 2OXSA 1SGPE 1F0RA 2XC5A 3LU9B 1GG6C 5A8YA 1MTUA 1BBRE 3VEQB 2XBVA 5JPMH 3OY5U 3QK1A 1O3MA 4ZROA 1OHHD 2CMYA 3A7XA 1PPGE 1C1UH 3VGCC 4O9VA 1GG6B 7GCHF 8ESTE 3FZZA 2VWOA 1LCYA 4JZ1A 3MHWU 3VGCB 3N7OA 5A0CA 3BIVH 1MUEB 4H6TA 2VIDA 2OC1A 1UTMA 1B7XB 1W10U 3OY6U 2C93B 4X6OA 5JBBS 4LZ1H 1EX3A 3ZZ3A 2F9OA 1C5NH 2FTLE 2A2XH 1SGFA 1D3PB 3BG8A 1CBWB 4NIYA 3SHCH 4AG1A 4AN7A 1PPEE 2G8TA 2XOKD 1O3OA 3PROA 2W6JD 3E8LA 3UOUA 1GGDC 1UMAH 1P3EA 5GXPA 1J16A 2W5EA 1TNIA 1E79D 5DP8A 1GBIA 4ISNA 3U98H 1C5ZB 1GGDB 1AUTC 4HG6A 1TRNA 3A81A 5E0JA 4TY7A 2BXTH 3U1JB 5E0GA 2GTBA 1GMHF 1SLXB 1TBQH 3D49H 5GPIB 1O2IA 3SU5A 1UHBB 5JBCS 4Q2KA 1VITG 1Y5BT 1DXWA 3UOPA 1Y5AT 1F7ZA 1ZGVA 2JH6D 3N7DA 1OWIA 3RC5A 2ZHDA 4ZKSU 1P2IA 2ZG0H 3F9HA 4OS2A 2V6NA 1HV7A 1F92A 5DGJA 1Z8RA 1COWD 1VCPA 5C67A 1HJ8A 2HNTF 1O3HA 3IG6B 1A5HA 4GUXA 2ZQ1A 3ZVDA 1C1QA 5T1VA 3DCLA 4D8NA 1OYQA 3KL6A 3F0PA 3ATMA 1S6LA 2PV9B 1GBTA 1AWFH 4Y7AA 1FUJA 2Y5GA 4Y6DA 2ZPQA 1EPTB 2M2AA 1YPMH 4TY6A 1BTZA 2ANMH 2Q6DA 4B75A 5HM9A 3MMGA 1C2MA 1OWKA 4NA9H 1GJ8B 3SQHE 1ANEA 1BBRH 3LH3A 1QGFA 1ZHMA 2WUCA 3WWBA 4TT3D 4JZIA 1ETTH 2PSYA 3IITA 1O2ZA 3UAIC 1GBHA 1AN1E 3A7TA 4LOYH 1A0HB 4X6NA 1XUKA 1MAXA 2FEQH 1N6XA 2A45B 1GPZA 3LGUA 3E90B 1V2OT 2GCTC 3MU4A 4IC6A 1H8ED 4MNVA 2CJIA 3UIRA 3SORA 1TA6A 3FP7E 3KQCA 2V3HH 5JB9S 1B5GH 1JWTA 4K8BA 2WV9A 2C90B 1C2LA 2C8WB 3TGJE 3PM3A 1C9TA 5K7RA 2HNTE 1GI4A 4JYTA 3RXDA 5I46H 4B76A 1GJ5H 2HVXA 1GI7B 1KTSB 1GBLA 1SR5C 1BA8B 2H9HA 2WSSD 3E3TA 3OU0A 1NO9H 1SSXA 2XRCA 3OTJE 4Q63A 4X8UH 1NU7B 2QF0A 3H7OA 1SGTA 1NZQH 2ZQ2A 1AD8H 3HKIB 1SQTA 5A0AE 2AIPA 5C0TA 1MU8B 3LJJA 1D3DB 5CE1A 2W6ID 1O2YA 1TNHA 3V0XA 2AEIH 2ZI2H 4INKA 1G9IE 2WYGA 2UWOA 3RXJA 8LPRA 1O2KA 3LOXA 2VVVA 1BMFD 2ODYB 4X6MA 5TCCA 3ZVCA 5FCKA 4HGCA 1ZR0A 2EY4C 2VIOA 1EB1H 2WV5A 3ZVEA 1C1RA 1YPHC 1H9IE 2AGIX 2BXUH 1H8IH 1H8DH 2XWAA 1ARBA 2SGQE 3SJ9A 2P59A 3P92A 1HJAB 1THPB 1GBAA 5DP7A 1HLTH 1BMNH 4AFQA 1NESE 2AFQB 1J14A 2UWPA 1V2TT 5FBIA 2VJ1A 5C3NA 2XCFA 2Z6BD 1H8HD 4Y0ZE 1ETSH 4X1SU 3ENSB 3URCA 5CMXH 1YC0A 3S9CA 3SZNA 1TOCB 4XD7D 5DP9A 5JYIA 3RMLH 4CHAB 4Y79A 2BLVA 4XFQA 4AB8A 1K22H 1MBQA 1FDPA 1B0EA 3PLBA 4X1QU 2ZCLP 1WCZA 3A7YA 4YT6H 5PTPA 3U8TH 3GYMA 3SUGA 2ZHEH 4B2BA 3E16B 1PYTD 2WINI 4AZ2B 1V2UT 2PKAB 3SW2B 3ZZ8A 5DP6A 2BQ7B 1Z6JH 1LVYA 3BSQA 4IMQA 3RU4E 1LO6A 3PLPA 2Z9IA 3TK9A 1DWBH 1S6HA 1VJAU 1ESBA 2QF4A 4X1NU 2B0FA 3A82A 2GP9B 1UCYE 1O2UA 1ZYOA 3FOAA 4GSOA 3UQVA 2GCHF 1EOJA 1LHGH 2C8YB 4WF8A 2FTMA 1WAYB 5E0HA 2Y7ZA 3SI4H 1JRSA 2D8WA 1A46H 2P93A 1IQJA 4Z1MD 1ELAA 1NM6A 1C5MD 1GJ6A 3BTQE 2F9PA 4D76A 1V2PT 1ZOMA 1XVOA 3RLWH 3MU5A 1HPGA 2GDEH 2UUJB 3QO6A 5HM2A 5A09A 2SGDE 3FKSD 3SV6A 3P8NA 1CA0C 1BTPA 2HPPH 1LPKB 4HI3A 3S9AA 1LHDH 2YNAA 1O2HA 1TQ7B 2KCAA 2NU4E 1W11U 1GJCB 2Q6GA 1W12U 4FUDA 2QXIA 1HAPH 1LQEA 1CA0B 4F55A 1A1RA 2JH0D 1XUIA 4GVUA 1A4WH 5EU8A 1Z6EA 3HATH 1MTWA 3RUOA 2Z3CA 4ABJA 4NWKA 2IOTA 2J38A 1C2EA 3PV4A 1NN6A 4MNXA 3RMNH 2RFKC 1K1JA 2QA9E 1LHCH 2QF5A 4DJZB 2O9QA 1FAXA 3F6UH 1IQEA 2RCEA 2PUQH 1HIAA 1J9CH 2ESTE 3T2NA 3UNRA 1TMUH 3TJUA 2QE7D 3DD2H 1K1NA 4ZXYH 3O8CA 1GI8B 2ZHQH 2A32A 2BD3A 2G55A 1PQAA 4NA7A 3RXSA 2OD3B 2GD4B 2KX4A 1RD3B 5FAHA 1SOZA 2FS9A 1HAVB 1TPOA 4FUEA 5JB8S 5IK2D 4DG4A 1LKBA 1QZ8A 1S83A 1UVOA 3AW0A 1LPGB 4WH6A 4K8YA 1ELEE 1W8BH 4O3UA 1UK3A 1GMCG 3SYJA 1VGCB 4QT8C 6CHAC 3U8OH 1KSNA 1T7CA 4OGYA 2FPZA 1G32B 3RC6A 2VH6A 3M5LA 1UCYH 3OEED 1W3CA 2H9TH 2ZU5A 1J15A 4X2XA 3E0NB 6CHAB 3RMMH 4MLFB 2C4FH 2V0BA 3K9XB 4UE7H 1YF4A 1OWDA 1UTQA 1YKTA 3NWUA 2THFB 3TNSA 4ABAA 2KCOA 2PR3A 2UWLA 2DE9A 1P3CA 4Z6AH 3LGWA 5EXLA 3TLOA 3BG4C 4UFGH 1V2QT 1DUEA 1G3CA 1N6YA 1A5GH 1NRQH 2CV3A 3Q3KA 2PGBB 1IQKA 1K1PA 1NC6A 4UFEH 5TJXA 4NGAH 3NXPA 3RXTA 1UCYK 2ZDNA 5A2MH 3BTHE 1QL7A 4WH8A 4ZXXH 2NU3E 1GHZA 2OQUA 2BLWA 1ZJKA 2FOBA 1LTOA 1SL3A 3QDZB 3TJOA 1N8OC 4H4FA 1IQMA 1UVUH 2ZF0H 1OWEA 4F48B 1SFIA 2GGVB 1UTOA 1W7GH 1C1MA 2OLGA 2BZ6H 4UEHH 2AMPA 1OWJA 1NS3A 1MZAA 3ELAH 4CRGA 1ELGA 1G3EA 1TX8A 1O3NA 1FY4A 2D26C 4CRDA 3PLKA 3W94A 1P04A 3SOSA 5HIZA 1GI3A 1S0QA 3A8BA 4YLUA 4AOQA 1T8NA 5DJ7A 3LKWA 2PW8H 3A83A 1K0HA 2KFWA 5JDUB 3ZZ5A 1YLNA 2P8OB 3WW7A 4TPYA 5EQRA 1JIMA 2HGTH 1ZPCA 1FY1A 3E6PH 1FPHH 2ZHFH 1C2HA 1MZDA 3BV9B 4DT7B 2CF8H 1O36A 2Z3DA 4FETA 1FY5A 1E1QD 1GCTB 5B6LA 3Q3YA 5DG6A 2PGQB 1CA8B 3KYFA 3GCHB 3P8FA 1ELCA 3P70B 3MNCA 1XKBC 3SZEA 4JCNA 5F6MA 1ELDE 1Z8IB 1VR1H 2Z9KA 3NCLA 4TWYA 1ZJDA 3D23A 3MO9A 2LELA 3GISB 2YNBA 1S84A 3C27B 1EQ9A 1D6WA 4MPUA 3FANA 1UTPA 3SUDA 1S85A 1QJ6B 3ZZ4A 1AVWA 1ELTA 4Q7ZA 2FESH 3T5FH 1XUFA 3KNXA 4JYVH 1CE5A 1S6FA 2ODQA 3ZZ9A 4Y7BA 2Q1JA 1O38A 2PKAA 3QGNB 3RXAA 1CQQA 3SU6A 3GDUA 1SVPA 4AFZA 3AAUA 3BF6H 2AIQA 5JBTA 3O8BA 4NIWA 1UTLM 4KGAA 3JZ2B 1O3GA 1O3JA 1GVZA 2K8IA 4INHA 2P3TB 3SV9A 3GICB 3BTDE 3RMOH 1ANCA 1GBDA 1SG8B 1XUGA 1YBWA 3A8CA 3FZDA 4WXVA 1P2JA 3MTYA 4U32A 1ZGIA 5HKKD 2TGDA 4TWWA 1DWCH 1P01A 3CNRA 4NA8A 3TNTA 3MH7A 4SGAE 2BLQA 3TH4H 1KMHB 4K1SA 3KYGA 5K0HA 5AHGH 2BDIA 5BPEA 2WUBA 1AI8H 1QA0A 2BTCE 1NT1A 2EC9H 1NFXA 3JZ1B 2A7CA 3S7KB 3TH3H 1QL8A 1CSOE 3K65B 5LPFA 1Q2WA 2GZ9A 1SC8U 1THSH 1CHGA 3VXFH 1FIZA 1ELBA 1T4VH 3DSPA 2WHXA 1GJBB 2FXRA 2IPHA 2KCYA 1D9IA 4ZAEA 2XCNA 1GHBG 1DLEA 3F2GA 2HVYB 1HRTH 2ZEBA 1EOLA 1P11E 2AMDA 3ATKA 1D6RA 4XDEA 1T4UH 3SJOA 3VB5A 4NSYA 2Z9JA 1Y3UA 3A7ZA 2Z94A 1O2JA 1SBWA 1E0FD 4MPWA 2YMSD 1WYKA 3SNBA 3M3SA 4ZHMU 4CRAA 5A8XA 2BDHA 1GDNA 2FOGA 3PV2A 3S0NA 4TPIZ 1MKXK 1QL9A 1MTNB 4GCHG 3S69A 2TPIZ 1YLCA 1TMTH 4K1EA 1EATA 3MYWA 3QWCH 3LGIA 3AASA 1LPZB 3TITA 1O2TA 2A5KA 2NU2E 1W14U 1O2RA 5CHBA 1V2KT 5F8ZA 2ZDVH 2CK3D 3RXRA 3GS9A 1YM0A 2QAAA 2GDDA 2W7SA 3W95A 4KTCA 2F43B 3OAAD 3LPRA 3RXHA 3GY7A 2GZ8A 5AF9H 5LPEA 1FXYA 3UPEA 3KIDU 1FN8A 1FAKH 2OC7A 3EA9A 3NUMA 1ZLRA 3UUZA 4F4OC 5LH8A 2NU1E 1T31A 3OFND 3AW1A 2J97A 2OTVA 2ZGHA 1BMMH 3Q00A 1WQVH 2ZDMA 5F8TA 3P8GA 1ZSLA 5AVDA 1ZPBA 4TYDA 1O5AB 1GMDG 2OQ5A 2OINA 3A7WA 4M7GA 2GZ7A 2AH4X 1O3AA 3ATLA 1EZSC 2HRVA 3MNXA 4RI0A 4RT1A 1ZZZA 2Y7XA 1OX1A 2ULLA 4GHTA 1C5PA 2R0KA 3ODDA 3HGNA 1KXEA 1LHEH 2WPLS 2PSXA 2ZTXA 1NFWA 2AMQA 1DE7H 8KME2 1A0JA 2D1JA 1ELVA 2BYAX 3K2UA 1GI2A 4MG3A 1Y3XA 3PV5A 1GMCF 1EAIA 4P02A 2ZECA 5EPYA 4R8TB 1FPCH 4B6FA 1HIAB 1TGBA 1W2KH 2AHME 4WXIA 3R3GB 1GDUA 4OS6A 4I7YH 4MTBA 5FXLA 1DY9A 1C5QA 1QJ7B 3G01A 2Y82A 4ZKOU 5C0UA 1MAYA 1LVOA 1V2VT 2M5TA 2TGPZ 2WPDD 4JK5A 3U69H 3UFAA 2FODA 1TOMH 2ZFTA 1O5BB 2ZFFH 3RXQA 1C1TA 4D9RA 3HKJB 3ZZCA 9LPRA 1FN6A 1TMBH 2SGEE 4OM9A 3EA8A 1IQFA 5A0BA 1L1NA 1S5SA 2RA3A 1HJ9A 1FNIA 4AGJA 5GCHF 1YCPH 4GPGA 5B6OA 1CHOF 2F9UA 2QV1A 5GWZA 4X1RU 3VB6A 3Q77A 1SFQB 1HDTH 3LT3A 1C4V2 1F0SA 2VGCC 1XX9A 1YGCH 2OCVB 2RG3A 3KQBA 1ZMNA 2GV6A 2Y5HA 2GX4A 4RT0A 1WUNH 1Y3VA 3L33A 1Z8JB 1XKAC 3TIUA 2VGCB 1ACBE 5C5OA 4NZQA 1ABIH 2BD5A 5HIYA 3AAVA 1UVPA 2VIWA 2R9PA 1MCVA 2QCYA 1K21H 1J8AA 1SQRA 2LNCA 2WPMS 2PTCE 2FIRH 3M37A 3ZYEA 1YCPK 3H09A 5T6DA 1QB1A 1MKWH 2GCTB 3UNQA 3SV8A 1BBRK 4IS5A 1V3XA 1DSUA 1L0ZA 2BQ6B 1MCTA 3P8OA 3EYDA 4FU8A 1TX7A 3HK6B 3RP2A 2FM2A 4E05H 1F0UA 5C2ZA 2ANKH 2FOEA 3UWIA 3DFLA 2J92A 4FU7A 1EUFA 1G30B 2A31A 2R2MB 1O2SA 1ZMLA 3MWIU 1P12E 3T29A 2LP6A 1GJ4H 1IQIA 3QX5H 1O3KA 4I8LA 4UFDH 1FJSA 2WV4A 1O32A 5EXNA 4X8VH 1MKWK 1SHHB 1YYY1 1K1IA 1T8OA 3F0OA 1UTNA 2QXGA 1DWDH 1BRBE 4KELA 1GWAA 1TQ0B 3GYLB 1Y8TA 3TVJB 1UW7A 4OS5A 1C2KA 4A1TA 2F9NA 1TBZH 3ZZDA 3RXUA 4DOQA 5EOKA 5AFZH 5IYTA 2JETC 1UVSH 4MNYA 4CR9A 2ZFSA 3KGPA 2TGAA 1SGNE 1S82A 1UTKA 3FP6E 3ZYDA 1SGIB 2C8ZB 4JMYA 4ISOA 2W3KA 2JJ2D 1GCDA 1RIWC 1CVWH 4UD9H 5KEDA 5C1XA 1A0LA 1P10A 3SI3H 4XBDA 4K1TA 1W0JD 1QNJA 2ZU4A 2RA0A 1RIWB 4YLQH 3URDA 4ZHAA 3VB7A 4O3TA 1GBFA 1EASA 1PQ5A 3NZIA 2BOHB 3DFJA 4YOGA 3NPSA 1TB6H 3SNCA 1DLKB 4LXBH 4A7IB 4ISIH 1HAHH 2GJGA 2BD9A 3FO8D 4Y8YA 4B73A 1CO7E 1QBNA 2G5VA 3VXEH 4ASUD 3Q3XA 1Z71A 3SU4A 2HNTC 1DICA 3QZQA 4MDSA 4F49A 1F0TA 2KM0A 4YTAA 3C1KA 1V2JT 2PKSC 1O35A 3DSOA 2Y80A 1UTJA 4DURA 4Y11E 5DP4A 2UUKB 3BTGE 2PKSB 5F8XA 1OSSA 1ZSJA 4A1VA 1HNEE 2G81E 1FI8A 2G4TA 1DS2E 1WTHD 1AVGH 1K9OE 1O2GH 1XXDA 3QLPH 4FUJA 4WWYA 2L74A 4U30A 1C4Y2 3K6YA 4AGKA 1AY6H 2Y81A 3RM0H 1UO6A 1FMGA 4GCHF 2XBYA 9ESTA 1FY8E 2PP6A 1C1VH 1GJ9B 5DO4H 1BOQA 4X2YA 3RXCA 3RU4D 1PYTC 1OWHA 5C1UA 2G52A 1OYTH 4XBBA 4X8SH 2BX4A 2XC4A 3FVFB 2BDGA 1YPGH 2EA3A 1BTWA 3NRLA 3UQOA 1QBOA 4WJG2 1BRUP 3MNBA 4OS1A 1ANBA 2VWNA 4OGXA 1WQSA 1TRYA 1AFEH 1GBCA 4AYVB 1VJ9U 1RTFB 3GOVB 3ZVGA 2WPJS 4X2WA 3EE0B 1YLDA 4ABDA 1GJAB 2CF9H 1AE5A 1L4ZA 1EZQA 3TK5A 1BJVA 1TNGA 5C17A 1CGHA 3EAJA 1FZZA 2G00A 4CBNA 5EPNA 4J2YB 3GY8A 3CENA 2HPQH 1XVMA 1O2MA 2P95A 5FPSA 5L6NH 1GL1A 3MU8A 2XC0A 1SPJA 1LHFH 1T32A 2G51A 1QRZA 1ETRH 3O8DA 4HZHA 4YM9A 2DUCA 3STJA 2EQNA 4H6SB 3LGTA 1LVBA 1THRH 2AERH 2A4QA 1KXDA 3PTBA 2O8LA 1VITF 4BXSA 4NZLA 1KYNA 1ZHRA 3MU1A 3RC4A 3GCNA 1F5RA 1C5LH 1GHVH 4ZH8A 1DX5M 2GT7A 3N99A 1E38B 1KXAA 1T8LA 3IWMA 2A4OA 3F68H 4VGCC 1IAUA 1WTGH 4B1TA 1SLVB 1ZMJA 2FI3E 1J17T 1N1LA 4MPVA 3GDVA 4A92A 1L1JA 1A7SA 1TNLA 6ESTA 1NBME 4SGBE 4VGCB 1A5IA 3A84A 1EXFA 4IN2A 4BTUB 4FXGH 1O3CA 4LZ4B 3BG4B 4JYUH 3F2FA 3LGVA 2KZ4A 3T28A 4IMZA 2XW9A 3ATWA 4YT7H 2ZGXH 2IN2A 3B9FH 2J94A 3CS7A 3HGPA 2K1QA 1VCWA 1MD7A 2BD7A 4FOUC 4NFEA 1K1LA 1BDAA 3QTVH 4THNH 3TJVA 1FX0B 1BMAA 1C1PA 1Q31A 3ZVBA 3RXGA 2R3YA 4RSPA 1AGJA 1EB2A 5GJ4B 2XWBI 1N8OB 1JIRA 3NK8A 4I86A 1YPEH 5J4QA 1SI5H 1VKYA 3M35A 2QY0B 4PROA 1Q3XA 5C5NA 1P9UA 1SGEE 2BX3A 2OUAA 1ZHPA 1QQ4A 3UREA 1V2MT 3SO3A 4E7RG 4UDWH 1TALA 2B9LA 4ABFA 5F53A 6GCHG 3SGBE 2O8MA 4DIHH 2ZTZA 3QGJA 2KAIA 2W26A 2A0QB 3ZV9A 3ZZBA 1GBBA 2PHBA 2RDEA 2WPIS 3M7QA 3U9AH 4CRCA 1SQOA 1UK2A 1GBKA 1UK4A 1P2OA 2JIZD 4FUHA 3SU0A 3V3MA 3MO3A 1YPKH 1JXPA 2VWMA 1O5EH 3ZIAD 1OKXA 1FV9A 4Q80A 4Y0YE 1ZTJA 5HYOA 1EZXC 3M5MA 3A8AA 1V2NT 3U8RH 4AC9A 1C5YB 1PPFE 4NCYA 4R0IA 4IW4E 2BY8X 4Y8XA 4ISLA 3PMBB 3VFEA 1SHYA 1NRPH 1E1RD 1P05A 2V3OH 2O8WA 1O5FH 3L3TA 5C94A 1O2PA 1C1NA 2L6OA 1D3QB 4X1PU 1W0YH 5T6FA 1QHRB 2B7DH 1O2XA 1XMNB 2BDAA 5DN6D 2WYJA 1O34A 1O2WA 4RKJB 1Z8GA 1KXBA 1EJAA 8GCHG 1NPMA 1SGCA 1V2ST 3EE7A 2AS9A 4P00A 4FVBA 2ZPRA 2FZZA 2STBE 2OBOA 3U1IB 4WMFA 2P94A 2A4GA 1OP0A 4XBCA 4OS4A 3VG8A 1G36A 3GY2A 2ZFQH 4ABBA 5CHAC 1F5KU 3OYPA 4GHQA 1OXGA 1BTUA 4I8KA 2FOAA 1K28D 5CHAB 1RTLA 3DUXH 1KLIH 1TBRH 4HTCH 1AKSA 3SU2A 2ZP0H 5EXMA 4ZMAH 1GI9B 2ZZUH 1VITH 1C5TA 1WSSH 1C5VA 1QRXA 2B5TB 3EA7A 4E06H 2D2DA 1FY3A 1DWEH 3V12A 5T3HA 1W13U 2I6QA 1EFRD 2P3UB 1SLWB 3LGYA 1IHSH 1LKAA 2VVCA 2CN0H 2C3SA 5ESTE 1TFXA 1QCPA 1DT2A 3F9EA 4K60A 1WDIA 1XM1A 1BHXB 2BD4A 4E7NA 5DP5A 4ZCNA 3SUEA 1O3DA 3BEFB 2F3CE 1EAUA 2FP7B 4WMDA 3PRDA 2J34A 3VPKA 1OOKB 2Y6TA 1HUTH 3CS0A 2GCHG 4MPXA 5J4SA 1C2GA 3RXKA 3KQDA 2ZCHP 1CGIE 1RGQA 1LDTT 2OC8A 3TPIZ 3UY9A 3ZZ7A 3MH6A 2VH0A 3DHKH 1TE0A 2SGAA 4D7GA 2FI4E 3LJOA 3GY4A 1E37B 1GHAG 2A1DB 4ACAA 6LPRA 1OP8A 3ESTA 1QA7A 2PUXB 2ZPSA 4K2YA 4B74A 5DK1A 1HXEH 2CHAC 4BAQB 1V2RT 3E91A 2FWWA 3BTKE 1EAXA 1BT7A 2O8UA 2NU0E 2TRMA 4XE4A 1HAOH 1IQHA 1TGCA 1O2VA 4WY3A 2ZWLH 4MQAA 1B0FA 1W7XH 5KGOA 4X2VA 2GVFA 2FOHA 2JKHA 1W0KD 3V13A 1XXFA 3S9BA 1NFYA 1UJ1A 4FU9A 5DP3A 1NFUA 2H5DA 3GY3A 4BTIB 1YY3A 3N7EA 4YO9A 1KDQA 2HLCA 4H42U 2VNTA 1BIOA 1TNKA 2YMSC 3RXVA 4O97A 1FIWA 4FUGA 4BAHB 1QQUA 1EP6A 1HGTH 3I77A 1CBWC 2IPQX 2BB4A 2YMSB 4IN1A 2ZFRH 1LMWB 2QIQA 4ZUHA 3FAOA 4IGDA 1KLJH 1O5DH 4XRNA 4D9QA 2FYQA 4I8GA 2XXLA 3EGKH 1GHXH 1ELFA 5KECA 4TSFD 2R3UA 3MO6A 3ZZ6A 1MQ6A 2J4IA 1C1WH 1OS8A 4AG2A 2FI5E 3KEEA 5EODA 5FHTA 3Q76A 2CXVA 3ODFA 2ZU2A 1JMOH 1BMLA 1AO5A 1P2QA 5ESBA 1HXFH 1Y59T 2FLBH 2EEKA 1TGSZ 3SJ8A 1AMHA 5EJLA 1C2FA 3ZVFA 2BDCA 1X7AC 1QB6A 3KHVA 3RDZA 1DPOA 1JRTA 4RKOB 5H4IB 1AWHB 1PQ8A 5AFYH 3A86A 3F1SB 3LH1A 1DOJA 1O3BA 1AVXA 1C4U2 1KXFA 3A85A 1L1GA 2Z9GA 1RS0A 2FS8A 7ESTE 3P6ZB 5T6GA 4CRBA 1O31A 4INLA 1C1SA 4A6LA 3D62A 5I25A 4CR5A 4NG9H 1GBJA 4AX9H 4A1XA 1IQGA 1BTYA 3BTME 3UNSA 1EKBB 2XTTB 3DA9B 2CGAA 3TGIE 5FPYA 4ABHA 3ITIA 3M3VA 2OP9A 5CDFE 3I78A 1CU1A 3EDXB 1TPPA 3KQ5A 3OX7U 4UFFH 2J5UA 1EPTC 5JBAS 2VU8E 2OC0A 1O0DH 1P03A 1TONA 3SV2H 1D4PB 1YPHE 3TJNA 7LPRA 1PFXC 3EQ0H 1NU9A 3OEHD 2AYWA 3HPTB 5GIBA 4ABGA 1C5SA 1GHWH 2HALA 1DSTA 3TU7H 1A2CH 2G5NA 2O8TA 4U2WA 5FPTA 1DANH 1LQDB 2FOMB 3PYHA 1TWXB 3TGKE 3F3BA 1ZRBA 2VVUA 5LGOA 4DCDA 2V7QD 1CT4E 4BAKB 2IJD1 1EZUC 3LC3A 1O2LA 4NFFA 1UVTH 2GKVE 3TH2H 6GCHF 2J95A 5E2OA 2ZGBH 2BZAA 1AZZA 2SNVA 2ZIQH 3GDSA 2A7HA 3BIUH 1K2I1 4K3JA 2XNDD 5C20A 3T26A 2ODPA 2XBXA 4YOIA 5EJ1A 1MBMA 3SJKA 1TPAE 3F9GA 3SGAE 2C8XB 3MOCA 3RXIA 4Y71A 1EAWA 2A4RA 1HAGE 3RXMA 4ZHLU 1C2IA 2DE8A 3QZRA 1ZRKA 3SHAH 2I6SA 2ZA5A 1TGNA 1EJMA 3L6PA 1ANDA 2OBQA 4B2CA 3M61U 1O3IA 2VIPA 1P8VC 3LONA 3UWJH 4BOHA 1QFKH 2KAIB 2FDAA 3BEIB 1HCGA 1MABB 2F9BH 4I31A 1ESTA 3K6ZA 1BITA 2QGRA 2VBCA 5DSFA 1WOFA 2A5IA 1O2OA 1MD8A 1TLDA 4UONA 4D7FA 2KR7A 1AQ7A 1IHTH 1G2LA 1GI6A 2WPKS 2VIQA 2ZNKH 1ID5H 8GCHF 3NKKA 2JETB 3MH4A 3OE7D 4Q4LA 3UB0A 3RXOA 1SGQE 2J2UA 1L4DA 1ZPZA 4O03A 1IQLA 2BY5X 3M5NA 3F2HA 1DY8A 3FN8A 3OSYA 4X8TH 1GBEA 2FOFA 3SGQE 1HJAC 4JZDH 1NTPA 4KTSA 4KTUA 2JJ1D 2ZDLA 5ABWA 1KTTB 2VWLA 3M36A 3AK5A 5EW1H 3A80A 5EQQA 2EI8A 3BTTE 1IOEA 2BM2A 2FMJA 1QURH 1C2DA 3VB4A 3A88A 1DVAH 4BTTB 4FVDA 1HBTH 2J9NA 3GCTG 1HAYB 1A3BH 3RXLA 3T25A 3KF2A 3QTOH 4CHAC 5E2PA 2QXHA 4YZUA 1DUAA 1KLTA 5L30H 1O3FA 2P16A 1FONA 2AGEX 3SNDA 4U01A 5EIYA 1BJUA 4OS7A 1INCA 4I8JA 1QBVH 1GHYH 1KY9A 3PMAB 1H9HE 2SFAA 1YPLH 4ACBA 3MI4A 2Z7FE 3SN8A 1AU8A 1GHBF 1PPZA 3SBKA 1Z1JA 3KCGH 2HLDD 4CREA 1RXPA 1LVMA 4B71A 3ZVAA 2K0QA 3FP8E 3H5CB 3M7TA 1DDJA 3PO1C 1Z1IA 2SGFE 3V7TA 2BDBA 3RXPA 1S81A 7KMEH 5DKMA 4X0WU 1G3DA 2VINA 2BQWB 1AKSB 1W0ZU 2ZGCA 2HOBA 3PO1B 1HB0B 4B2AA 1P09A 1BZXE 4KKDA 1XUJA 1AB9C 2PFEA 3D65E 4JZFH 2F91A 1MU6B 2UUFB 2F4LA 1V2LT 4NWLA 2J98B 2VB0A 3T62A 1GI0A 1YCPM 1K1OA 4MNWA 3UR6A 1TIOA 4BAMB 3PTNA 3SV7A 1AB9B 4X6PA 3GCOA 1VCQA 4AFUA 1GHAF 1G2MA 1MMJN 3I29A 2KCPA 2YOLA 2FO9A 2V35A 1SGRE 1QTFA 1SKYE 4JK6A 1DXPA 5TCAA 4DW2U 2ZDAH 1F5LA 1P06A 2TBSA 5EGMA 1KIGH 1P57B 1GJDB 2GV7A 4I33A 3QUMP 4GLYA 3B23B 3BTWE 4BAOB 1RJXB 7GCHG 4DT4A 4B6EA 4K69A 2UUYA 3MU0A 1O37A 1BTHH 1QJ1B 2TGTA 4BXWA 4IC5A 2ILNA 1UHBA 3F9FA 2PLXA 3M5OA 2V3MA 5BRRE 5EQSA 2QF3A 1GMDF 3DT0H 2ALPA 2WZQA 1QY6A 1O39A 1PPBH 5C1YA 1RTKA 1WBGB 1CGJE 4DY7B 1DFPA 1C5UA 2ZKSA 3PWBA 1H9LB 1BQYA 5FL7D 2H6MA 4Y8ZA 3RXFA 2BLOA 2JH5D 3BEUA 5A8ZA 2Z3EA 1K1MA 3ZZAA 5FX6A 5HGGA 2BDYA 4BNRA 3BTEE 3BTFE 3OTPA 1H4WA 4HFPB 5FBEA 4AB9A 1H1BA 1GMHG 1CT0E 4Q7YA 4Q7XA 1VGCC 1KDQB 1EPTA 2B8OH 1ZTKA 3PWCA 1QIXB 4LK4A 1AE8H 4YESB 3A89A 1AUJA 2BHGA 1RRKA 1ARCA 2BD2A 2IJOB 1T8MA 2BVRH 5GDSH 1D3TB 1WXRA 1ZSKA 1V6DA 1WU1A 3T27A 2F83A 4NIVA 1GI5A 1XUHA 1TA2A 1QRWA 3LIWA 4ASHA 1C5WB 1GVLA 3PMHB 4I32A 1HAZB 1BHXF 2JDID 1C5XB 3KN2A 1BUIA 2ANWA 2ZTYA 2ZU3A 1EJNA 1AHTH 2F9VA 4FUCA 1E34B 2FX4A 3PRBA 3SU3A 1AZ8A 2FLRH 1AFQC 2WPHS 5GCHG 1CHOG 4YOJA 3B8JA 3M3TA 3FFGA 1YP9A 1MH0A 1NROH 3WWFA 3SUFA 1A61H 4ESTE 3M7UA 4JZEH 1AFQB 4ZKRU 2BVSH 1O3LA 1O30A 3HK3B 4YXWD 5IDKA 1NRRH 1Z7KA 5GNDA 1P0SH 3RXEA 1SOTA 4CBOA 1YPJH 3SQEE 1NBMD 2BY7X 5E8EH 3RU4T 5LPRA 3TK6A 3UR9A 3WY8A 3AVZA 4AORA 5L2YH 4AYYB 1MQ5A 4K5ZA 3MFJA 3MH5A 1P9SA 2TIOA 3RXBA 2H1UA 4FUBA 3KQEA 1EP5A 3H7TA 3E1XB 1V2WT 4FUFA 1FLEE 2EI6A 1PPCE 1SB1H 2AGGX 1HAIH 2EI7A 1BRAA 1DITH 1HAXB 5SGAE 2STAE 1QR3E 2QN5T 1IQNA 2SGPE 2P8OC 4DIIH 4A5TS 2BD8A 1O33A 3S7HB 1GJ7B 1Y5UT 1NY22 2ASUB 1E36B 2ZCKP 1TGTA 3A8DA 1GCTC 1S0RA 1Y3WA 1QB9A 3GCHC 1JOUB 1WV7H 1SLUB 2H9EH 2H2ZA 1CT2E 4DVAU 4WMEA 1C9PA 2R0LA 2XBWA 5EW2H 2FYRA 3PMJA 1PJPA 2BY6X 2ZDKA 2ANYA 1NRNH 4ISHH 1ORFA 3O8RA 1O5CB 1O3EA 1E35B 2R2WU 2P3FH 4GAWA 1ABJH 3GY5A 3E0PB 1SGYE 3MNSA 1BCUH 5FX5A 2ZGJA 1PQ7A 1YWUA 4KP0A 2NWNA 3RM2H 2ZC9H 2H5CA 1G37A 1O3PB 3UTUH 4NSVA 3LC5A 5F03A 1NRSH 2RDLA 2ALVA 1MTVA 5DPAA 2W7UA 1AIXH 4ZKNU 4IBLH 1TPSA 2QYIA 1SGFG 2XNIA 4Y10E 1O5GH 4ABEA 1TABE 2LPRA 2VIVA 3SU1A 3ZV8A 4M9FA 5EG4A 3STIA 4WVPE 4CH2B 1C5RA 1JBUH 1TRMA 4RN6A 3DSGA 2QXJA 5L2ZH 1F2SE 1HFDA 2BMGB 1TX6A 1C5OH 1O2QA 5HMAA 1TNJA 1BB0B 1M9UA 3A87A 4J1YA 1P2MA 1GI1A 2J98A 2PTNA 3W1EA 1VZQH 1G3BA 1SMFE 1MTSA 3GCTF 3U28C 1L2EA 1SQAA 4CH8B 2Z9LA 1TAWA 4MVNA 4Z0KA 1A3EH 5G4BA 1P2NA 2OK5A 3CP7A
chains in the Genus database with same CATH topology
3SNAA 2FX6A 1P2KA 2FOCA 3BN9A 3QN7A 1TYNA 3GY6A 2BOKA 1C1OA 4CRFA 3RLYH 1GBMA 2A5AA 2BY9X 2ZFPH 4AFSA 2Q6FA 4BANB 2GMTC 2ZHWH 1MKXH 1KXCA 1BTXA 2W3IA 1ESAA 3VB3A 1PPHE 1U6QA 2PWXA 2A7JA 2ZU1A 2GMTB 2ZO3H 1RFNA 2QC2A 1BRCE 3R0FA 1OPHB 1C2JA 5ETXA 2Y5FA 2GT8A 1O2NA 4NIXA 3A7VA 4XSKU 3SNEA 3LDXH 5HXFA 2XYAA 2HWLB 4I8HA 1OP2A 2G4UA 4ABIA 1GDQA 3PB1E 4FUIA 1MTNC 1SGDE 5FCRA 1ZTLA 4DGJA 1Y3YA 1DM4B 2SNWA 1GVKB 1GL0E 3P95A 2BVXH 1HYLA 1P02A 2CHAB 1FQ3A 3ATIA 3SJIA 4Y76A 4XOJA 1HAVA 3P17H 2A2QH 2OXSA 1SGPE 1F0RA 2XC5A 3LU9B 1GG6C 5A8YA 1MTUA 1BBRE 3VEQB 2XBVA 5JPMH 3OY5U 3QK1A 1O3MA 4ZROA 2CMYA 3A7XA 1PPGE 1C1UH 3VGCC 4O9VA 1GG6B 7GCHF 8ESTE 3FZZA 2VWOA 1LCYA 4JZ1A 3MHWU 3VGCB 3N7OA 5A0CA 3BIVH 1MUEB 4H6TA 2VIDA 2OC1A 1UTMA 1B7XB 1W10U 3OY6U 2C93B 4X6OA 5JBBS 4LZ1H 1EX3A 3ZZ3A 2F9OA 1C5NH 2FTLE 2A2XH 1SGFA 1D3PB 3BG8A 1CBWB 4NIYA 3SHCH 4AG1A 4AN7A 1PPEE 2G8TA 1O3OA 3PROA 3E8LA 3UOUA 1GGDC 1UMAH 1P3EA 5GXPA 1J16A 2W5EA 1TNIA 5DP8A 1GBIA 4ISNA 3U98H 1C5ZB 1GGDB 1AUTC 1TRNA 3A81A 5E0JA 4TY7A 2BXTH 3U1JB 5E0GA 2GTBA 1GMHF 1SLXB 1TBQH 3D49H 5GPIB 1O2IA 3SU5A 1UHBB 5JBCS 4Q2KA 1VITG 1Y5BT 1DXWA 3UOPA 1Y5AT 1F7ZA 1ZGVA 2JH6D 1OWIA 3RC5A 2ZHDA 4ZKSU 1P2IA 2ZG0H 3F9HA 4OS2A 2V6NA 1HV7A 1F92A 5DGJA 1Z8RA 1VCPA 5C67A 1HJ8A 2HNTF 1O3HA 3IG6B 1A5HA 4GUXA 2ZQ1A 3ZVDA 1C1QA 4D8NA 1OYQA 3KL6A 3ATMA 2PV9B 1GBTA 1AWFH 4Y7AA 1FUJA 2Y5GA 4Y6DA 2ZPQA 1EPTB 1YPMH 4TY6A 1BTZA 2ANMH 2Q6DA 4B75A 5HM9A 3MMGA 1C2MA 1OWKA 4NA9H 1GJ8B 3SQHE 1ANEA 1BBRH 3LH3A 1QGFA 1ZHMA 2WUCA 4JZIA 1ETTH 2PSYA 3IITA 1O2ZA 1GBHA 1AN1E 3A7TA 4LOYH 1A0HB 4X6NA 1XUKA 1MAXA 2FEQH 1N6XA 2A45B 1GPZA 3LGUA 3E90B 1V2OT 2GCTC 3MU4A 4IC6A 4MNVA 2CJIA 3UIRA 3SORA 1TA6A 3FP7E 3KQCA 2V3HH 5JB9S 1B5GH 1JWTA 4K8BA 2C90B 1C2LA 2C8WB 3TGJE 3PM3A 1C9TA 5K7RA 2HNTE 1GI4A 4JYTA 3RXDA 5I46H 4B76A 1GJ5H 2HVXA 1GI7B 1KTSB 1GBLA 1SR5C 1BA8B 2H9HA 3E3TA 3OU0A 1NO9H 1SSXA 2XRCA 3OTJE 4X8UH 1NU7B 2QF0A 3H7OA 1SGTA 1NZQH 2ZQ2A 1AD8H 3HKIB 1SQTA 5A0AE 2AIPA 1MU8B 3LJJA 1D3DB 5CE1A 1O2YA 1TNHA 3V0XA 2AEIH 2ZI2H 4INKA 1G9IE 2WYGA 2UWOA 3RXJA 8LPRA 1O2KA 3LOXA 2VVVA 2ODYB 4X6MA 5TCCA 3ZVCA 5FCKA 4HGCA 1ZR0A 2VIOA 1EB1H 2WV5A 3ZVEA 1C1RA 1YPHC 1H9IE 2AGIX 2BXUH 1H8IH 1H8DH 2XWAA 1ARBA 2SGQE 3SJ9A 2P59A 3P92A 1HJAB 1THPB 1GBAA 5DP7A 1HLTH 1BMNH 4AFQA 1NESE 2AFQB 1J14A 2UWPA 1V2TT 5FBIA 2VJ1A 5C3NA 2XCFA 2Z6BD 4Y0ZE 1ETSH 4X1SU 3ENSB 3URCA 5CMXH 1YC0A 3S9CA 3SZNA 1TOCB 5DP9A 5JYIA 3RMLH 4CHAB 4Y79A 2BLVA 4XFQA 4AB8A 1K22H 1MBQA 1FDPA 1B0EA 3PLBA 4X1QU 2ZCLP 1WCZA 3A7YA 4YT6H 5PTPA 3U8TH 3GYMA 3SUGA 2ZHEH 4B2BA 3E16B 1PYTD 2WINI 4AZ2B 1V2UT 2PKAB 3SW2B 3ZZ8A 5DP6A 2BQ7B 1Z6JH 1LVYA 3BSQA 4IMQA 3RU4E 1LO6A 3PLPA 2Z9IA 3TK9A 1DWBH 1S6HA 1VJAU 1ESBA 4X1NU 2B0FA 3A82A 2GP9B 1UCYE 1O2UA 1ZYOA 4GSOA 3UQVA 2GCHF 1EOJA 1LHGH 2C8YB 4WF8A 2FTMA 1WAYB 5E0HA 2Y7ZA 3SI4H 1JRSA 2D8WA 1A46H 2P93A 1IQJA 1ELAA 1NM6A 1C5MD 1GJ6A 3BTQE 2F9PA 4D76A 1V2PT 1ZOMA 1XVOA 3RLWH 3MU5A 1HPGA 2GDEH 2UUJB 3QO6A 5HM2A 5A09A 2SGDE 3SV6A 3P8NA 1CA0C 1BTPA 2HPPH 1LPKB 4HI3A 3S9AA 1LHDH 2YNAA 1O2HA 1TQ7B 2NU4E 1W11U 1GJCB 2Q6GA 1W12U 4FUDA 2QXIA 1HAPH 1LQEA 1CA0B 1A1RA 2JH0D 1XUIA 4GVUA 1A4WH 5EU8A 1Z6EA 3HATH 1MTWA 3RUOA 2Z3CA 4ABJA 4NWKA 2IOTA 2J38A 1C2EA 3PV4A 1NN6A 4MNXA 3RMNH 1K1JA 2QA9E 1LHCH 4DJZB 2O9QA 1FAXA 3F6UH 1IQEA 2RCEA 2PUQH 1HIAA 1J9CH 2ESTE 3T2NA 3UNRA 1TMUH 3TJUA 3DD2H 1K1NA 4ZXYH 3O8CA 1GI8B 2ZHQH 2A32A 2BD3A 2G55A 1PQAA 4NA7A 3RXSA 2OD3B 2GD4B 5FAHA 1RD3B 1SOZA 2FS9A 1HAVB 1TPOA 4FUEA 5JB8S 4DG4A 1LKBA 1S83A 1UVOA 3AW0A 1LPGB 4WH6A 4K8YA 1ELEE 1W8BH 4O3UA 1UK3A 1GMCG 1VGCB 4QT8C 6CHAC 3U8OH 1KSNA 1T7CA 4OGYA 2FPZA 1G32B 3RC6A 2VH6A 3M5LA 1UCYH 1W3CA 2H9TH 2ZU5A 1J15A 4X2XA 3E0NB 6CHAB 3RMMH 4MLFB 2C4FH 2V0BA 3K9XB 4UE7H 1YF4A 1OWDA 1UTQA 1YKTA 3NWUA 2THFB 3TNSA 4ABAA 2PR3A 2UWLA 2DE9A 1P3CA 4Z6AH 3LGWA 5EXLA 3TLOA 3BG4C 4UFGH 1V2QT 1DUEA 1G3CA 1N6YA 1A5GH 1NRQH 2CV3A 3Q3KA 2PGBB 1IQKA 1K1PA 1NC6A 4UFEH 5TJXA 4NGAH 3NXPA 3RXTA 1UCYK 2ZDNA 5A2MH 3BTHE 1QL7A 4WH8A 4ZXXH 2NU3E 1GHZA 2OQUA 2BLWA 1ZJKA 2FOBA 1LTOA 1SL3A 3QDZB 3TJOA 1N8OC 4H4FA 1IQMA 1UVUH 2ZF0H 1OWEA 1SFIA 2GGVB 1UTOA 1W7GH 1C1MA 2OLGA 2BZ6H 4UEHH 2AMPA 1OWJA 1NS3A 1MZAA 3ELAH 4CRGA 1ELGA 1G3EA 1TX8A 1O3NA 1FY4A 2D26C 4CRDA 3PLKA 3W94A 1P04A 3SOSA 1GI3A 1S0QA 3A8BA 4YLUA 4AOQA 1T8NA 5DJ7A 3LKWA 2PW8H 3A83A 5JDUB 3ZZ5A 2P8OB 4TPYA 5EQRA 1JIMA 2HGTH 1ZPCA 1FY1A 3E6PH 1FPHH 2ZHFH 1C2HA 1MZDA 3BV9B 4DT7B 2CF8H 1O36A 2Z3DA 1FY5A 1GCTB 3Q3YA 5DG6A 2PGQB 1CA8B 3GCHB 3P8FA 1ELCA 3P70B 3MNCA 1XKBC 4JCNA 5F6MA 1ELDE 1Z8IB 1VR1H 2Z9KA 3NCLA 4TWYA 1ZJDA 3D23A 3MO9A 3GISB 2YNBA 1S84A 3C27B 1EQ9A 1D6WA 4MPUA 3FANA 1UTPA 3SUDA 1S85A 1QJ6B 3ZZ4A 1AVWA 1ELTA 4Q7ZA 2FESH 3T5FH 1XUFA 3KNXA 4JYVH 1CE5A 1S6FA 2ODQA 3ZZ9A 4Y7BA 2Q1JA 1O38A 2PKAA 3QGNB 3RXAA 1CQQA 3SU6A 3GDUA 1SVPA 4AFZA 3AAUA 3BF6H 2AIQA 5JBTA 3O8BA 4NIWA 1UTLM 4KGAA 3JZ2B 1O3GA 1O3JA 1GVZA 4INHA 2P3TB 3SV9A 3GICB 3BTDE 3RMOH 1ANCA 1GBDA 1SG8B 1XUGA 1YBWA 3A8CA 3FZDA 4WXVA 1P2JA 3MTYA 4U32A 1ZGIA 2TGDA 4TWWA 1DWCH 1P01A 4NA8A 3TNTA 3MH7A 4SGAE 2BLQA 3TH4H 4K1SA 5K0HA 5AHGH 2BDIA 5BPEA 2WUBA 1AI8H 1QA0A 2BTCE 1NT1A 2EC9H 1NFXA 3JZ1B 2A7CA 3S7KB 3TH3H 1QL8A 1CSOE 3K65B 5LPFA 1Q2WA 2GZ9A 1SC8U 1THSH 1CHGA 3VXFH 1FIZA 1ELBA 1T4VH 1GJBB 2FXRA 2IPHA 1D9IA 4ZAEA 2XCNA 1GHBG 1DLEA 1HRTH 2ZEBA 1EOLA 1P11E 2AMDA 3ATKA 1D6RA 4XDEA 1T4UH 3SJOA 3VB5A 4NSYA 2Z9JA 1Y3UA 3A7ZA 2Z94A 1O2JA 1SBWA 1E0FD 4MPWA 1WYKA 3SNBA 3M3SA 4ZHMU 4CRAA 5A8XA 2BDHA 1GDNA 2FOGA 3S0NA 4TPIZ 1MKXK 1QL9A 1MTNB 4GCHG 3S69A 2TPIZ 1YLCA 1TMTH 4K1EA 1EATA 3MYWA 3QWCH 3LGIA 3AASA 1LPZB 3TITA 1O2TA 2A5KA 2NU2E 1W14U 1O2RA 1V2KT 5F8ZA 2ZDVH 3RXRA 1YM0A 2QAAA 2GDDA 2W7SA 3W95A 4KTCA 3RXHA 3LPRA 3GY7A 2GZ8A 5AF9H 5LPEA 1FXYA 3UPEA 3KIDU 1FN8A 1FAKH 2OC7A 3EA9A 3NUMA 1ZLRA 3UUZA 4F4OC 5LH8A 2NU1E 1T31A 3AW1A 2OTVA 2ZGHA 1BMMH 3Q00A 1WQVH 2ZDMA 5F8TA 3P8GA 1ZSLA 5AVDA 1ZPBA 4TYDA 1O5AB 1GMDG 2OQ5A 2OINA 3A7WA 4M7GA 2GZ7A 2AH4X 1O3AA 3ATLA 1EZSC 2HRVA 3MNXA 1ZZZA 2Y7XA 1OX1A 2ULLA 4GHTA 1C5PA 2R0KA 3ODDA 3HGNA 1KXEA 1LHEH 2WPLS 2PSXA 2ZTXA 1NFWA 2AMQA 1DE7H 8KME2 1A0JA 2D1JA 1ELVA 2BYAX 3K2UA 1GI2A 4MG3A 1Y3XA 1GMCF 1EAIA 5EPYA 2ZECA 4R8TB 1FPCH 1HIAB 1TGBA 1W2KH 4WXIA 3R3GB 1GDUA 4OS6A 4I7YH 4MTBA 5FXLA 1DY9A 1C5QA 1QJ7B 3G01A 2Y82A 4ZKOU 1MAYA 1LVOA 1V2VT 2M5TA 2TGPZ 4JK5A 3U69H 3UFAA 2FODA 1TOMH 2ZFTA 1O5BB 2ZFFH 3RXQA 1C1TA 4D9RA 3HKJB 3ZZCA 9LPRA 1FN6A 1TMBH 2SGEE 3EA8A 1IQFA 5A0BA 1L1NA 1S5SA 2RA3A 1HJ9A 1FNIA 4AGJA 5GCHF 1YCPH 4GPGA 5B6OA 1CHOF 2F9UA 2QV1A 5GWZA 4X1RU 3VB6A 3Q77A 1SFQB 1HDTH 3LT3A 1C4V2 1F0SA 2VGCC 1XX9A 1YGCH 2OCVB 2RG3A 3KQBA 1ZMNA 2GV6A 2Y5HA 2GX4A 1WUNH 1Y3VA 3L33A 1Z8JB 1XKAC 3TIUA 2VGCB 1ACBE 5C5OA 4NZQA 1ABIH 2BD5A 3AAVA 1UVPA 2VIWA 2R9PA 1MCVA 2QCYA 1K21H 1J8AA 2LNCA 2WPMS 2PTCE 2FIRH 3M37A 3ZYEA 1YCPK 5T6DA 1QB1A 1MKWH 2GCTB 3UNQA 3SV8A 1BBRK 4IS5A 1V3XA 1DSUA 1L0ZA 2BQ6B 1MCTA 3P8OA 3EYDA 4FU8A 1TX7A 3HK6B 3RP2A 2FM2A 4E05H 1F0UA 5C2ZA 2ANKH 2FOEA 3UWIA 3DFLA 2J92A 4FU7A 1EUFA 1G30B 2A31A 2R2MB 1O2SA 1ZMLA 3MWIU 1P12E 3T29A 1GJ4H 1IQIA 3QX5H 1O3KA 4I8LA 4UFDH 1FJSA 2WV4A 1O32A 5EXNA 4X8VH 1MKWK 1SHHB 1YYY1 1K1IA 1T8OA 1UTNA 2QXGA 1DWDH 1BRBE 4KELA 1GWAA 1TQ0B 3GYLB 1Y8TA 3TVJB 4OS5A 1C2KA 4A1TA 2F9NA 1TBZH 3ZZDA 3RXUA 4DOQA 5EOKA 5AFZH 5IYTA 2JETC 1UVSH 4MNYA 4CR9A 2ZFSA 3KGPA 2TGAA 1SGNE 1S82A 1UTKA 3FP6E 3ZYDA 1SGIB 2C8ZB 4JMYA 4ISOA 2W3KA 1GCDA 1RIWC 1CVWH 4UD9H 5C1XA 1A0LA 1P10A 3SI3H 4XBDA 4K1TA 1QNJA 2ZU4A 2RA0A 1RIWB 4YLQH 3URDA 4ZHAA 3VB7A 4O3TA 1GBFA 1EASA 1PQ5A 3NZIA 2BOHB 3DFJA 4YOGA 3NPSA 1TB6H 3SNCA 1DLKB 4LXBH 4A7IB 4ISIH 1HAHH 2BD9A 4Y8YA 4B73A 1CO7E 1QBNA 2G5VA 3VXEH 3Q3XA 1Z71A 3SU4A 2HNTC 1DICA 3QZQA 4MDSA 4F49A 1F0TA 4YTAA 3C1KA 1V2JT 2PKSC 1O35A 2Y80A 1UTJA 4DURA 4Y11E 5DP4A 2UUKB 3BTGE 2PKSB 5F8XA 1OSSA 1ZSJA 4A1VA 1HNEE 2G81E 1FI8A 2G4TA 1DS2E