2VIWA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2viwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2viwA01
3SUFA 1P8VC 1WOFA 3P17H 3SHAH 4JZDH 2FYQA 3ZZ6A 4ZUHA 1C1NA 2PKSB 1ZGVA 1BBRE 4ABHA 1O5BB 2ILNA 1D6RA 4DG4A 3D23A 2FX4A 1QB1A 2QF3A 4GVUA 3BF6H 2PGBB 1AWFH 3A7YA 4HI3A 3SJIA 2Z9IA 1JWTA 1HV7A 4RKOB 4UE7H 1W14U 4IMZA 1Q31A 2FMJA 1BTUA 4JZEH 3A8AA 2ZGBH 1KY9A 5FHTA 5K7RA 1GJ4H 4R0IA 1DANH 2F9OA 2PKSC 1C2IA 2A45B 1PPCE 3BSQA 1CHGA 3EAJA 1NRRH 3E8LA 4WH8A 3PMBB 1G32B 2FODA 4FUFA 3UR9A 4LZ4B 1SGPE 3O8DA 3QLPH 3UQOA 3KQCA 3ZZBA 1O3IA 1K22H 1MBQA 1TPOA 2DE9A 1CGIE 1P05A 1JBUH 2VVCA 3SUEA 4DW2U 5DO4H 3HK3B 2TGAA 5HYOA 1NRQH 1RD3B 2OP9A 3K6YA 4GCHF 1HXEH 1LKBA 1QJ6B 4DIIH 4MNXA 1GI6A 2CF8H 4KP0A 2PKAA 1EUFA 2BY8X 1TNKA 3QWCH 5FPYA 2G4UA 1AB9B 2PWXA 4O3UA 3A7VA 1ETSH 3DFJA 1SQAA 2WPKS 4TPIZ 5ESBA 4DY7B 1JOUB 2Y82A 4MDSA 1HJAB 2RG3A 4GCHG 1G9IE 1ZZZA 2ALPA 3A7WA 1EZXC 1W2KH 2VGCB 1EP5A 2Z9JA 3ATKA 4DGJA 1AB9C 4YT7H 1Y5AT 1NZQH 4WY3A 1EPTB 1ANDA 4WF8A 5ABWA 1C5OH 3ZV8A 1C1VH 1OSSA 1CE5A 1PFXC 2F9VA 2ZFFH 1FLEE 1HJAC 1ACBE 2ULLA 2AERH 2ZHEH 2WUCA 2VGCC 3E3TA 1C5LH 1EJAA 1GVZA 1C5WB 3RXKA 1ZYOA 1YPMH 3M3VA 1O39A 3MYWA 4XBDA 1F5LA 3A86A 1EPTC 3PWBA 2ZU3A 3MNBA 1ZR0A 1A5HA 1FPCH 3PTBA 5F6MA 2B8OH 1WQSA 4D9RA 1CQQA 1HJ9A 1UTLM 1UJ1A 1KLIH 2VIQA 3OTJE 1P10A 2ZG0H 3H7TA 3BTWE 1HAGE 8LPRA 2RCEA 2OBOA 2QC2A 1A61H 2B9LA 4UFEH 3SU0A 1MTSA 2FESH 3UREA 2STAE 1XVMA 1DUAA 1EATA 3V13A 1TNGA 2FLBH 1TALA 1O2QA 4INKA 1GBEA 1C1SA 3GCTG 3TGKE 5GJ4B 1DPOA 4KKDA 2OINA 1CA0B 1ELVA 3LU9B 2A32A 1EAIA 2OC1A 4I8LA 3ZVCA 3SV2H 3GY5A 3UPEA 1MBMA 3PWCA 1IQKA 2QCYA 4X2XA 1AKSB 1O31A 2OCVB 2G4TA 1ZMNA 4ABIA 2BY6X 4NA7A 1A0HB 4X2YA 1T4VH 2ZCLP 1GBMA 1YPGH 4AYYB 1FY3A 1TWXB 4F49A 2ANKH 1QFKH 3JZ1B 3V0XA 1SGNE 4O97A 3RC5A 1DITH 1E38B 5HMAA 1EKBB 4ZAEA 1C2GA 2P95A 1P2MA 2UWLA 1BB0B 1CA0C 1L0ZA 3IWMA 3F68H 1A5IA 3A83A 3ZVBA 3ATIA 2CV3A 1O2WA 5A8ZA 3TJOA 3SN8A 3BG8A 1S85A 1SFQB 2UUFB 1PYTC 5HM2A 4D7GA 1GI5A 3RXTA 1P2NA 3Q77A 5JDUB 4CR9A 1O3LA 1THSH 1E37B 9ESTA 3T2NA 2A7JA 1H8IH 5BPEA 4IMQA 3OSYA 1GWAA 1LVOA 1JRTA 4UDWH 3SNDA 3VB6A 2QV1A 1C5PA 4NFEA 2VH0A 2WPIS 4NIYA 4ZXXH 2A4GA 1GMHG 1O2PA 1DWEH 2FOHA 2ZU5A 4ZHLU 3A8DA 4D9QA 4BTIB 4OS7A 3UWIA 1Z8RA 3NCLA 1CBWB 1GJ6A 3MHWU 2ZU1A 2QXGA 1O2MA 3E6PH 4AFSA 1O3NA 4X6NA 1KDQA 3O8BA 3TJVA 1C2KA 1KXBA 1UHBB 1V2PT 2J34A 1PYTD 1UTMA 3EGKH 1NPMA 3M7TA 3SUDA 5AHGH 3MH4A 3M7UA 1BTXA 1THPB 1SVPA 1O2VA 2WV4A 1G3CA 3RUOA 1CBWC 2PSYA 1SR5C 2FOCA 1HAYB 3V3MA 3RXIA 1A0LA 1C4V2 2WPMS 2C8YB 1Y59T 1MMJN 2SGPE 2FOGA 1SGTA 4JYUH 1AUJA 1HAVA 4KTCA 2BQWB 3TGJE 5GXPA 2ZFSA 2PTNA 2FOBA 1C5NH 1OP0A 1H9LB 4ISOA 3BG4B 1G37A 3GY7A 2ZHFH 3URCA 2C90B 2NU3E 1BQYA 1N1LA 1Y3XA 3ZVFA 2GDDA 4YLUA 2FOAA 1C1QA 3SO3A 1LMWB 1BRCE 1D9IA 2QA9E 1AWHB 1ZHMA 1V2KT 5GPIB 2BLVA 2AEIH 1YM0A 1O2UA 1CSOE 1OXGA 1ESTA 2QIQA 3BG4C 1L2EA 3L33A 3MO6A 4TWWA 2F9PA 3FP7E 3RMLH 3KEEA 1PPZA 3CP7A 1CHOF 3ZZ8A 1CO7E 3NXPA 2YOLA 1KXFA 4B75A 3LDXH 2IJOB 5EQRA 1D3DB 1GG6B 1J8AA 4TWYA 1E0FD 3RMMH 3PM3A 4FXGH 3SU1A 3ZVDA 2A0QB 1AVGH 2ZGJA 4HTCH 3S7HB 1WQVH 5AF9H 2OBQA 2V3OH 2ZGCA 1AD8H 3A7XA 4NZQA 1A1RA 1UTQA 4NZLA 2Q6DA 1GBTA 3GY4A 4CRFA 4INHA 2O8WA 5EPNA 2G52A 2O8TA 1GBHA 1O34A 3NWUA 1GG6C 3BTDE 1MKWH 3AW0A 3MOCA 1VITG 3C27B 1MD8A 1C2MA 3GDSA 1XKBC 1UCYH 2W26A 1ARCA 4TPYA 7GCHG 3FVFB 2JH6D 2AGGX 2GVFA 2ZECA 2G5NA 3TNTA 4MNWA 1BJVA 2AGEX 1A46H 4YLQH 2J94A 4O9VA 1TGNA 2BLOA 2ZFTA 4Y71A 4BAHB 1C5RA 1VJ9U 3E0PB 2VVUA 2PUXB 1XM1A 1RRKA 3GCOA 1EAWA 1RIWB 1IHSH 1DT2A 3P8GA 4D76A 4CBNA 3M5MA 1ZHPA 4Y8ZA 1W0ZU 2VIDA 3SJOA 1QRXA 4AYVB 1L1NA 3E16B 3BTGE 2PKAB 2RA3A 4FU8A 1JIRA 1AVXA 2AYWA 1W7XH 2F3CE 1FJSA 1ELTA 1LPKB 1CT4E 2Z3EA 1O2IA 5JBAS 4FUJA 4AB8A 1RIWC 2BZ6H 3BEFB 1C1TA 2Z6BD 4I8HA 2PLXA 4U01A 3C1KA 2Z3CA 1NU9A 1CT2E 1C4Y2 3EE0B 1FAKH 3NPSA 4XBBA 2LNCA 2F9BH 1DSUA 1FY5A 2ZC9H 4AN7A 1TPPA 1D3QB 3OX7U 4X8VH 1E36B 5T6DA 2FLRH 1A7SA 2BM2A 2FS8A 1HRTH 1S0QA 1V2TT 2JETB 4TY7A 3ZZ4A 2OQUA 3U1JB 3GYMA 4ZHMU 3SV6A 3PMAB 1BCUH 3IG6B 3K9XB 1IOEA 1TABE 1BZXE 4ZXYH 2GCTC 1TA6A 4CBOA 3SI3H 2J38A 1MQ5A 2YNBA 3UY9A 3BTKE 1CVWH 1NFYA 4GPGA 2TGDA 2LPRA 2Z3DA 1BTPA 5FCKA 3VXFH 1D4PB 1NROH 4ABBA 2JETC 1HJ8A 3ZVAA 4YO9A 3S69A 3LKWA 4LOYH 1ELCA 1GGDB 1MU8B 4FUIA 1UK3A 3SORA 1C5UA 4CH8B 4E05H 1TB6H 4WMEA 4NIVA 3ODDA 1DWDH 2BY7X 3PMHB 4X6OA 3HGNA 1GBKA 1EASA 1WYKA 1ZRKA 1TGBA 1J15A 1G36A 4E7NA 3S9AA 4Y6DA 3RLYH 1TGCA 3A89A 1V2NT 3T26A 4FU7A 1MQ6A 2BD4A 5DPAA 1GHWH 1F0UA 5EPYA 3K65B 2Q6GA 1DOJA 4IS5A 3DFLA 5SGAE 3KL6A 4JMYA 1GGDC 3UNSA 1UVTH 2BD5A 1K9OE 1P2QA 4KGAA 1SFIA 1DE7H 2D1JA 4JK6A 1F0RA 1V2QT 2PW8H 3TH4H 1HAOH 6GCHG 4NFFA 1FPHH 3AVZA 2TPIZ 4DVAU 2OD3B 1QBOA 3EYDA 2Y7XA 1N6XA 1BMMH 1OWIA 1C5YB 1HAIH 2EA3A 3T25A 2ZFPH 1QURH 2BDBA 5GWZA 3RU4T 2ZU2A 1O3BA 2GV6A 3AW1A 5ESTE 1ZSLA 3F6UH 4CR5A 1MTNB 5DP5A 1TOCB 1C9PA 1ANCA 2ZF0H 3UUZA 2GP9B 3LONA 4A1VA 3MTYA 1V3XA 3ZYDA 4XOJA 2BZAA 1QL9A 2Z9LA 3W94A 1VR1H 2R9PA 4Y8YA 2BY9X 1F0SA 1GHZA 4U2WA 2HGTH 5FCRA 2AFQB 1O5DH 3MU1A 4NCYA 2OLGA 1Z8GA 1E34B 5PTPA 1GL0E 4LK4A 2Y81A 4Q2KA 1MTNC 3ZZ9A 4NWLA 1BJUA 1SG8B 3P95A 1OYQA 3Q3YA 4RN6A 2SGDE 1QBNA 1ZLRA 2G8TA 5F8TA 2A5IA 2HRVA 3TVJB 2XWBI 3CS0A 5E0JA 4NIWA 1V2VT 1C2EA 2JH5D 1QB9A 1W0YH 1K2I1 2B0FA 3SU6A 2FI3E 1XUJA 4WXIA 4OGYA 1XMNB 2ZDVH 3SV9A 4LZ1H 2ZPQA 1E35B 1LVMA 4A1TA 3MU8A 1S84A 5A8XA 1L4DA 2VU8E 1KLTA 3PTNA 3M61U 1O37A 1IQIA 3VPKA 5DP8A 1AHTH 1SLWB 3TK6A 1YLCA 5LPEA 1ESAA 3BEIB 1T32A 1BRUP 3P92A 1BTZA 3RP2A 2OUAA 2P59A 1O3CA 2DUCA 2ALVA 1YCPM 2OTVA 2VWOA 4FUBA 1KDQB 1C4U2 3RXJA 4A1XA 5F8XA 2ZO3H 2A7HA 1B0FA 3TK5A 2IPHA 4I7YH 3LGWA 4K1SA 4MLFB 3P8FA 4I8JA 1FZZA 2R0KA 4AB9A 4UFDH 2G81E 5FX5A 5TCAA 5CMXH 4AG2A 3N7OA 4DURA 1V6DA 3GOVB 1GBBA 4X8TH 3GCHB 3UTUH 4ISLA 5A8YA 4K60A 1KSNA 2OQ5A 1O5AB 4D8NA 1LHCH 4CRAA 1IQHA 2F9NA 4B2CA 1TNLA 4DIHH 1LTOA 4FUCA 1GI0A 1T8OA 4Q7XA 3ATMA 1XUIA 2K1QA 1DS2E 1Y8TA 4I31A 2BTCE 3RMNH 3SJKA 3GCHC 1BRAA 1O3DA 2P93A 2NU1E 3RXDA 1GVLA 2ODPA 2XWAA 2HWLB 1H9IE 1GBAA 1CU1A 1AFEH 2Y5GA 3ZVEA 1Z71A 2G5VA 3FZZA 1GMCG 3ZZ3A 3FP8E 4TYDA 4NGAH 3KIDU 1HIAB 2FO9A 5EOKA 3GICB 2QXHA 3QK1A 3H7OA 1AE5A 2NU0E 1ETTH 3P6ZB 2GMTB 5DGJA 1B5GH 4YZUA 4ABGA 3RXQA 1KXCA 1Y3UA 2P94A 2ZZUH 4IBLH 4JZIA 1O3KA 2ZHWH 1SGFG 3Q00A 2FM2A 1GJCB 2B7DH 7LPRA 1U6QA 1ELDE 2W5EA 3R3GB 2GGVB 3NZIA 1ZTKA 2R2WU 2UWPA 2SGQE 5AFYH 8KME2 1OWEA 1OWDA 3FZDA 1C2LA 2TIOA 3GCTF 1ELEE 2GMTC 5LGOA 3EDXB 4BOHA 5EU8A 1FIZA 4CRCA 1UVSH 1YCPH 1G3BA 4X1NU 1MAYA 1V2RT 3LJJA 1PQ5A 4B76A 1O2XA 1IQJA 1D3PB 1H9HE 2A2XH 1YP9A 2GZ8A 1WSSH 3BEUA 3LH3A 1GMDG 3SZNA 4UFFH 1O5FH 2QN5T 1GBDA 2SFAA 4J1YA 2ZGHA 5EW2H 1AU8A 5CE1A 2HPPH 1TX7A 2W3KA 1WAYB 2QYIA 3ESTA 1S6FA 3CENA 2G51A 1V2OT 4MPVA 2H9TH 3IITA 5CHAB 1D6WA 3UOUA 3U1IB 4Z0KA 3SU5A 1B7XB 2QY0B 1OKXA 4GHQA 3S0NA 1GJ7B 2C3SA 4X6PA 2ZIQH 2HVXA 4UONA 3GISB 1SGQE 3E90B 3MH5A 1EZQA 2GZ9A 4A7IB 2NU2E 5E2OA 1L4ZA 2FX6A 4Y10E 5CHAC 1HLTH 3BTEE 1GHAG 4R8TB 1NESE 4NG9H 4HZHA 2XBXA 1G2MA 1SHHB 1G3DA 1SHYA 2O9QA 3KQBA 2XNIA 1AVWA 1TBZH 3B23B 4B74A 8ESTE 2BB4A 3KNXA 2CJIA 1W7GH 3UOPA 1DFPA 2H5DA 2FI5E 1QTFA 4Z6AH 1VITH 1A3EH 1GMHF 1ELBA 4BAKB 1F92A 1P12E 1TMBH 2GCHF 2GX4A 4KTSA 1EOJA 1T8MA 3M7QA 1BMLA 1DDJA 3A7TA 2THFB 2UUJB 4A6LA 1BTYA 2VIWA 3RXHA 5C1UA 3VB5A 1O2OA 2FTMA 1B0EA 1EAUA 4THNH 1O36A 1MZAA 2Y80A 1H1BA 2R2MB 2J95A 4RSPA 5A0BA 2BHGA 2GZ7A 1MD7A 2HNTF 4I8KA 1TQ7B 1G30B 1TA2A 2CF9H 1ANBA 1MKXH 1RTKA 1W12U 1VCPA 1CGHA 1DY8A 1Y5UT 3UWJH 2P8OB 4ESTE 1JRSA 1AIXH 2GCHG 2AS9A 4BTTB 1W3CA 2XBVA 4K5ZA 1C2HA 3MH6A 1NC6A 1NO9H 2A4RA 3ZZ5A 2AIQA 4CREA 1X7AC 1K1NA 3LC3A 1S6HA 2WPLS 4O03A 1TAWA 5DKMA 2AMPA 5EXMA 3S9CA 1ELFA 2D26C 4XSKU 1K28D 5FAHA 1K21H 2FOEA 2V6NA 4CRGA 2GV7A 2P8OC 4MTBA 3RU4E 1MKXK 3U8OH 1HBTH 2BD7A 1QJ7B 2BOKA 3LOXA 1UTOA 1FXYA 2VJ1A 1VCQA 1J14A 2Q1JA 4OS5A 1BRBE 1BMNH 1V2MT 2FDAA 3ZV9A 2UWOA 1L1GA 2ZDMA 3GCNA 1SBWA 4UFGH 3RM0H 5C2ZA 1YC0A 3ATWA 1ZRBA 1NTPA 2GTBA 3JZ2B 3L6PA 1IQNA 1O33A 3SGQE 1INCA 2D2DA 3MU0A 2Y5HA 3MO3A 2VWNA 1IQMA 2J92A 1THRH 4AFQA 3G01A 1YPHC 4OS6A 1AZZA 2H9EH 3F9HA 4UEHH 3O8CA 2VNTA 1PPBH 2PUQH 3RXSA 4ZHAA 4FU9A 3TH3H 1GBIA 3SW2B 3WY8A 1C5XB 2FYRA 3I77A 2P3UB 4D7FA 4K8BA 1C2FA 4NSVA 1MUEB 1FIWA 4K8YA 5A0CA 1NN6A 1UO6A 5TCCA 5A09A 1A2CH 3K2UA 6LPRA 4B1TA 1O3MA 2ZI2H 4I8GA 1TGSZ 3GY3A 3L3TA 3P70B 3LH1A 1VITF 3AAVA 1DXPA 1KTTB 1PQ8A 1GI8B 1WCZA 2F91A 1BT7A 7GCHF 3A88A 1P04A 1KTSB 1LDTT 1QIXB 1GJAB 2XYAA 5T3HA 4ZKOU 3FAOA 2SGEE 3VB3A 1LHEH 1O5GH 1T31A 1QHRB 3S9BA 1ABIH 1EPTA 1O3OA 2GDEH 1UTJA 1BA8B 4AGKA 1SI5H 4A5TS 1ANEA 1UCYE 3GY6A 3PMJA 3LGIA 2BXUH 3HK6B 1ZPCA 1C1PA 3GY8A 1ID5H 4TY6A 4OS4A 1K1PA 1S0RA 1OOKB 1LCYA 2C4FH 2P16A 1GHYH 3KN2A 3M5NA 3MU4A 4I33A 5AFZH 4B2AA 1SLVB 5GCHF 3M3TA 3VXEH 3TGIE 1HUTH 1C5VA 4FVDA 1C2JA 3E1XB 3QGNB 3RMOH 4H4FA 4J2YB 2ESTE 3EQ0H 1O3PB 2OC0A 3E91A 4ISIH 3B9FH 1MU6B 2BDHA 2GT7A 1JXPA 2VIVA 2ZWLH 3M36A 1MKWK 4CRBA 1T8LA 4MPWA 1DXWA 1SOTA 5C20A 1UCYK 3SQHE 3T28A 5I25A 3RXAA 1EAXA 4WJG2 1NU7B 1UTNA 4U30A 5JBBS 4ABAA 5GCHG 2J4IA 2C8ZB 3MU5A 2TRMA 2Y7ZA 4MPXA 3SU4A 1GHBF 5EW1H 2ANYA 1K1JA 3UFAA 4NIXA 1BHXB 2BDGA 2BOHB 3A85A 1YPKH 1TMTH 4WMFA 4BAQB 4JZFH 1GDNA 1QL7A 4CHAB 1G3EA 2O8MA 1XX9A 2XXLA 1AKSA 1NRNH 1C1UH 1EZUC 2CGAA 2QF0A 1BIOA 1LVBA 3RXMA 5LH8A 1TPSA 5JBTA 2AIPA 4K69A 4KELA 1DLKB 5DP3A 4ZROA 3FFGA 1GHBG 3MNCA 1QA0A 1O3FA 2VWMA 3URDA 3BN9A 1YGCH 3QZRA 2HPQH 3MNSA 2IN2A 1P06A 2ODYB 7ESTE 1YF4A 4ASHA 1TLDA 5DK1A 2BXTH 3QDZB 4Y0YE 1AE8H 1TBRH 1UTPA 5LPFA 3KGPA 5EXLA 4XBCA 1K1MA 2A7CA 4Q80A 1AQ7A 3VFEA 1XUKA 3DD2H 3OY6U 2C8WB 2BDYA 1TBQH 1SLUB 2UUYA 1RGQA 4RKJB 2FWWA 3VEQB 4YOIA 6GCHF 1K1LA 1QQ4A 4DOQA 3M37A 1ARBA 1S5SA 1AUTC 1P2OA 1P57B 2BVXH 1P9UA 3QZQA 1A4WH 1NT1A 3TLOA 1O3EA 1W10U 3OYPA 1YYY1 4WH6A 2BDIA 3SJ9A 1A0JA 2FI4E 2AMQA 4JK5A 3QTVH 1VGCB 1UTKA 1KYNA 1HYLA 1ZPBA 3RXGA 3SNEA 2ZCHP 1O30A 3HATH 1Z6EA 2FP7B 5BRRE 1OWJA 2OC7A 3ATLA 3SV7A 4Y11E 4IW4E 1IQLA 1O2YA 1GI7B 4IC6A 4WVPE 3PV4A 1UHBA 4OGXA 4AFZA 2A4OA 5DP9A 1P0SH 3SNBA 2R3UA 1TRMA 1SB1H 2ZQ1A 1O2LA 1VGCC 1QCPA 2Z7FE 1PJPA 1FY1A 2WINI 4F4OC 4YOJA 4X8SH 1HPGA 1QB6A 3DT0H 4Y79A 2V35A 4B71A 5EXNA 2BLQA 1NFXA 1AO5A 1S82A 3SHCH 1FN6A 1WTGH 1QR3E 1NS3A 4DT7B 1JIMA 1AMHA 1RFNA 2Z9GA 1IQGA 1SGYE 3LGTA 4SGBE 2CHAB 1GPZA 1ESBA 1PQAA 1QQUA 1XXDA 2BY5X 3F9GA 5GDSH 5I46H 1GI2A 2EI8A 2ANWA 4ZMAH 1XXFA 4WWYA 1DY9A 1WUNH 3KCGH 4X1RU 2XBYA 5JB8S 1XUHA 1HAXB 1QRZA 2GD4B 5E2PA 1V2LT 4ZH8A 2CHAC 3SV8A 1LQEA 1QJ1B 2VH6A 2FOMB 4JZ1A 1SSXA 1K1OA 4ABEA 5C5NA 3M5LA 3ZZDA 5EQQA 1BOQA 2P3TB 4SGAE 3Q76A 1T4UH 3RXBA 1HCGA 1UVPA 3ZZAA 1DM4B 1MAXA 1C1WH 1LHFH 2STBE 1FMGA 3ZZCA 3D62A 2AH4X 6CHAB 1FNIA 3LC5A 1YKTA 4H6TA 4MNVA 1T8NA 1TOMH 1A3BH 1ELAA 4JYVH 2QGRA 1SGFA 1SPJA 2I6QA 5E8EH 5FX6A 1C5QA 1V2JT 1BBRH 4ABDA 3AAUA 2HALA 3ITIA 4X0WU 4HFPB 1DX5M 5J4SA 3U98H 3DA9B 2V3HH 3MI4A 1P2KA 1Y5BT 2WUBA 3M35A 6CHAC 1KXEA 3TU7H 2FOFA 2RA0A 5FPTA 1GMCF 3TNSA 1HAVB 1ZOMA 1UMAH 2R3YA 3SNCA 1P3CA 3EA9A 5IDKA 1XVOA 1ORFA 5C67A 1GCDA 3A8CA 1BBRK 1CA8B 1BTWA 1O38A 4U32A 2ASUB 2PV9B 1GI3A 2D8WA 1F0TA 4IGDA 1NRPH 3H5CB 1ZJKA 2XTTB 3SOSA 3BTFE 1O2TA 3PB1E 4LXBH 4Y7BA 4ABJA 3STIA 1V2ST 4DCDA 4X2WA 3RM2H 4BNRA 1HFDA 3NUMA 3UR6A 2BD9A 4AFUA 3U69H 1RS0A 2HNTE 2G00A 2ZP0H 4O3TA 1J9CH 1K1IA 2QXJA 1XKAC 3T5FH 5ETXA 1FY8E 1EOLA 4IN2A 1AGJA 1GBJA 1O0DH 1QY6A 1EXFA 1N6YA 2WYJA 3BV9B 4INLA 1BMAA 2GT8A 4B2BA 1KXDA 3ELAH 1EP6A 1TNHA 1GMDF 4AGJA 2XCNA 1OYTH 5C1YA 2P3FH 4AOQA 1O2HA 5G4BA 4GHTA 5C5OA 2BX3A 1DSTA 2FXRA 5FBIA 3TH2H 3D49H 5EG4A 4ZKNU 1O2JA 4DJZB 4X2VA 1NRSH 1AI8H 2VIPA 3A84A 1Y3YA 3RDZA 3K6ZA 4KTUA 2HLCA 2PR3A 3F1SB 4K1EA 5HXFA 1WTHD 1BHXF 1O2ZA 1O2NA 3QTOH 1HNEE 1L1JA 2KAIA 5L2ZH 1Y3WA 1LKAA 2TGPZ 2EI6A 3I78A 3RLWH 4BTUB 1Z6JH 2ZDKA 3PO1B 4ZKSU 3ZYEA 1GDQA 2O8UA 1S83A 2R0LA 3RXEA 1WBGB 1GHAF 2ZEBA 1ZHRA 4M7GA 3A8BA 3MMGA 3VGCB 2C8XB 3DHKH 3NKKA 2UUKB 5FBEA 1LHGH 2ZTYA 3PYHA 4MNYA 5F03A 1YCPK 2O8LA 2BVSH 1F5RA 2XRCA 3NK8A 1XUGA 1C5TA 3SU2A 2ZDAH 3GY2A 4Y8XA 5H4IB 3B8JA 1OS8A 1ZMJA 3PO1C 3P8NA 2WPJS 2XW9A 1DICA 1OP2A 4YM9A 1DWCH 5A2MH 2ZPRA 3RXUA 3SQEE 1ZPZA 3VGCC 1O35A 1QGFA 2RDLA 3EA8A 1ZJDA 3GDUA 3E0NB 3UNQA 3KQDA 2H5CA 5DP4A 3RXRA 3LGVA 2AMDA 1P9SA 1H4WA 3RXOA 3SNAA 2YNAA 1IHTH 3SUGA 2BD8A 2F9UA 2EEKA 1O32A 3HGPA 1O2KA 4E06H 2PSXA 1EB1H 3SU3A 1EQ9A 3A82A 2VVVA 2F83A 1P2IA 1TNJA 4GSOA 3ZVGA 3Q3XA 1VZQH 3RC4A 4NSYA 3U8TH 5L2YH 3BTME 1D3TB 4IN1A 1P09A 4MQAA 5J4QA 2BDAA 1EJMA 1SL3A 4A92A 3RU4D 2WPHS 1OWHA 1TONA 2ZCKP 4BXSA 3QUMP 3BTTE 2ZHDA 1NFWA 4GLYA 2H6MA 2BMGB 2H9HA 1FUJA 1PQ7A 4QT8C 3HKJB 1GJBB 5EQSA 2SGAA 1M9UA 1TNIA 1O3HA 1O3GA 1ZSKA 2ZKSA 1ZSJA 1RXPA 1LPZB 1V2WT 1W11U 4MPUA 3SI4H 1WV7H 1OP8A 4BAMB 1LVYA 1TFXA 1FN8A 1RTFB 2J9NA 3A81A 5B6OA 2BYAX 2PGQB 3A80A 4JCNA 3PLPA 1GDUA 2FTLE 2GKVE 2PFEA 1FY4A 2Y6TA 3KF2A 1IQEA 1TGTA 1EX3A 3SJ8A 4H42U 2NWNA 2G55A 2SNVA 5HGGA 2W7SA 1FI8A 5JPMH 1GCTB 1YPLH 5AVDA 3VB4A 3STJA 2J2UA 1KXAA 2ZFQH 1LPGB 1N8OB 4NA8A 1Z1JA 3RC6A 1F2SE 1Z8JB 6ESTA 3ZZ7A 2Q6FA 2BD3A 1W8BH 1C2DA 3ODFA 1C1OA 2VIOA 4WMDA 4X1PU 1UVOA 3LT3A 3LPRA 3TPIZ 1FAXA 1HAHH 2ODQA 2ZTZA 1GJ5H 1GCTC 3OY5U 2EI7A 1PPEE 4OS2A 5L30H 2A4QA 2ZTXA 2AGIX 1MH0A 1N8OC 2QXIA 2PHBA 3F9EA 1TRYA 1C9TA 4BXWA 3CS7A 3EA7A 1HB0B 1SQTA 4FUHA 2I6SA 1GHVH 4AX9H 4K3JA 1AFQB 3TJUA 5JB9S 3SGAE 4K2YA 1SGDE 5GIBA 1C5ZB 1O2RA 2CXVA 2OC8A 1C5MD 5FPSA 1SGRE 2ZHQH 1AY6H 1IAUA 9LPRA 1FONA 1TQ0B 5E0HA 3VB7A 1FV9A 3I29A 3SBKA 3U9AH 3UNRA 1Y3VA 2Y5FA 1TRNA 1GL1A 1TX8A 1EB2A 1AFQC 1GHXH 3M3SA 2QAAA 1YBWA 3LGYA 1HIAA 4ISNA 3S7KB 3F9FA 4FUGA 3BIUH 2XBWA 1Q2WA 3BIVH 1EJNA 1S81A 2ZU4A 1BDAA 1OX1A 1PPFE 3GYLB 1Z8IB 1CT0E 1ABJH 1ETRH 1GJDB 4Q7YA 2FIRH 1QNJA 1GI1A 2FEQH 2WV5A 4FVBA 5E0GA 2TBSA 1UVUH 2ZDNA 4Y7AA 1GBLA 1ZTJA 5DP7A 2VINA 2C93B 1CGJE 1MTUA 2M5TA 1GBFA 4E7RG 2BDCA 4FUDA 2XC4A 1LO6A 1G2LA 1CHOG 4Q7ZA 3RXVA 4CRDA 5JBCS 3DUXH 3UQVA 1TX6A 2XC5A 1V2UT 3FANA 1GJ9B 2A5AA 4K1TA 4I32A 1O5CB 2VWLA 4MVNA 5DP6A 2H2ZA 2PTCE 5LPRA 1MCTA 2A5KA 1W13U 2WYGA 5DJ7A 3D65E 1RTLA 3MO9A 4Y76A 1SGIB 3KHVA 4AZ2B 2JKHA 1HGTH 2A2QH 5A0AE 2EC9H 3ENSB 1EZSC 1NY22 1SLXB 2JH0D 2FZZA 2ZNKH 2W7UA 8GCHF 3R0FA 4B73A 1FQ3A 3PROA 1ELGA 1LQDB 1UK2A 4NA9H 3U8RH 1WU1A 3O8RA 4Y0ZE 2BD2A 1P11E 1YPHE 1QBVH 1NFUA 2BQ6B 3M5OA 3MNXA 4XFQA 4MG3A 1T7CA 4BAOB 3RXCA 2OXSA 1XUFA 1GBCA 1KIGH 2TGTA 3QGJA 4XDEA 1P02A 1OWKA 2VB0A 1MTVA 4CHAC 2GCTB 3TITA 3GDVA 2NU4E 2H1UA 5L6NH 8GCHG 1SOZA 2CN0H 3V7TA 1DUEA 3RXFA 1GVKB 2CMYA 4XE4A 2V0BA 1C5SA 3QN7A 4H6SB 3QO6A 4ZKRU 1Z7KA 1ZGIA 1GI9B 1UK4A 1TIOA 4X1SU 5HM9A 1F7ZA 4FUEA 3T27A 3OU0A 4PROA 1P2JA 2BLWA 2SNWA 3HKIB 3RXLA 1TE0A 1C1MA 3LGUA 1AZ8A 1MCVA 2BQ7B 2Z94A 1SGCA 2HOBA 4AORA 4GAWA 5EODA 1PPHE 2ZPSA 1Q3XA 2Z9KA 5K0HA 2KAIB 2BX4A 2SGFE 2XC0A 3Q3KA 5FXLA 3PLBA 1TMUH 1VCWA 4YESB 3BTQE 1TYNA 1ZTLA 1J17T 1HAZB 4OS1A 3KQEA 4ABFA 4JYTA 1ZMLA 4BANB 4UD9H 1DWBH 1BTHH 1VJAU 1Z1IA 1FDPA 1SQOA 2FS9A 1PPGE 4X6MA 4X8UH 1P01A 5F8ZA 1HDTH 3MH7A 4HGCA 1KLJH 1BITA 4GUXA 1BUIA 1J16A 3P8OA 1JMOH 4YTAA 4WXVA 1TPAE 3BTHE 1A5GH 5IYTA 1MTWA 3A87A 3T29A 2ZA5A 5TJXA 1QA7A 3LJOA 5DG6A 3SGBE 3HPTB 1RJXB 2DE8A 2ZFRH 2XCFA 3W95A 5JYIA 4AG1A 1SMFE 5T6GA 1QL8A 1P3EA 1DLEA 3TJNA 4YT6H 3QX5H 1IQFA 1QRWA 1DVAH 3PLKA 4CH2B 1NM6A 3UIRA 2FPZA 3LIWA 3RXPA 4IC5A 4YOGA 7KMEH 1YPJH 1AN1E 1GI4A 1SGEE 4VGCB 3T62A 2ZDLA 4X1QU 3MWIU 2A31A 2HNTC 2BVRH 4NWKA 2ZGXH 3FP6E 1O2GH 1HXFH 2B5TB 1HAPH 5T6FA 1O2SA 2IOTA 1P03A 5C1XA 5C3NA 1SC8U 1YPEH 3AASA 1O3AA 3TK9A 2ZQ2A 3MFJA 1C1RA 2A1DB 1OPHB 1MZDA 1O5EH 2W3IA 3A7ZA 5EGMA 1LHDH 1YLDA 3V12A 4VGCC 4ISHH 1O3JA 1F5KU 3TIUA 2ANMH 1GJ8B 1H8DH
chains in the Genus database with same CATH superfamily
3SUFA 1P8VC 5F53A 1WOFA 3P17H 4RI0A 3SHAH 4JZDH 2FYQA 3ZZ6A 4ZUHA 1C1NA 2PKSB 1NBMD 1ZGVA 1BBRE 4ABHA 5EIYA 1O5BB 2ILNA 1D6RA 4DG4A 3D23A 2FX4A 1QB1A 2QF3A 4GVUA 3BF6H 2PGBB 1AWFH 3A7YA 4HI3A 3SJIA 4F55A 2Z9IA 1JWTA 1HV7A 4RKOB 4UE7H 1W14U 2IPQX 4IMZA 1Q31A 2FMJA 1BTUA 4JZEH 3A8AA 2ZGBH 1KY9A 5FHTA 5K7RA 1GJ4H 4R0IA 1DANH 2F9OA 2PKSC 1C2IA 2A45B 1PPCE 3BSQA 1CHGA 3EAJA 1NRRH 3E8LA 4WH8A 3PMBB 1G32B 2FODA 4FUFA 3UR9A 4DT4A 1SGPE 3O8DA 4B6FA 3QLPH 3UQOA 3KQCA 3ZZBA 1O3IA 1K22H 1MBQA 1TPOA 2DE9A 1CGIE 1P05A 1JBUH 2PP6A 2VVCA 3SUEA 4DW2U 5DO4H 3HK3B 2TGAA 5HYOA 1NRQH 1RD3B 2OP9A 3K6YA 4GCHF 1HXEH 1LKBA 1QJ6B 4DIIH 4MNXA 1GI6A 2QF4A 2CF8H 4KP0A 2PKAA 1E1QD 1EUFA 2BY8X 5C0UA 1TNKA 3QWCH 5FPYA 2G4UA 1AB9B 2PWXA 2JDID 4O3UA 3A7VA 1ETSH 3DFJA 1SQAA 2WPKS 4TPIZ 5ESBA 4DY7B 1JOUB 2Y82A 4MDSA 1HJAB 2RG3A 4GCHG 1G9IE 1ZZZA 2ALPA 3A7WA 1EZXC 1W2KH 2VGCB 1KMHB 3FOAA 1EP5A 2KCPA 3KYGA 2Z9JA 3ATKA 2RFKC 4DGJA 1AB9C 4YT7H 1Y5AT 1NZQH 4WY3A 1EPTB 1ANDA 4WF8A 5ABWA 1C5OH 3ZV8A 1C1VH 1OSSA 1CE5A 1PFXC 2F9VA 2ZFFH 1FLEE 1HJAC 1ACBE 2ULLA 2AERH 2ZHEH 2WUCA 2VGCC 3E3TA 1C5LH 1EJAA 1GVZA 4AC9A 1C5WB 3RXKA 1ZYOA 1YPMH 3M3VA 1O39A 3MYWA 4RT1A 5B6LA 4XBDA 1F5LA 3A86A 1EPTC 3PWBA 2ZU3A 3MNBA 1ZR0A 1A5HA 1FPCH 3PTBA 5F6MA 2B8OH 1WQSA 4D9RA 1CQQA 1HJ9A 1UTLM 1UJ1A 1KLIH 2VIQA 3OTJE 1P10A 2ZG0H 3H7TA 3BTWE 1HAGE 8LPRA 2RCEA 2OBOA 2QC2A 5HKKD 1A61H 2B9LA 4UFEH 3SU0A 1MTSA 2FESH 3UREA 2STAE 1XVMA 1DUAA 1EATA 3OFND 1TNGA 3V13A 2FLBH 1TALA 1O2QA 2M2AA 4INKA 1GBEA 1C1SA 3GCTG 3TGKE 5GJ4B 1DPOA 4KKDA 2OINA 1CA0B 1ELVA 3LU9B 2A32A 1EAIA 2OC1A 4I8LA 3ZVCA 3SV2H 3GY5A 3UPEA 1MBMA 3PWCA 1IQKA 2QCYA 4X2XA 1AKSB 1O31A 2OCVB 2G4TA 1ZMNA 4ABIA 2BY6X 4NA7A 1A0HB 4X2YA 1T4VH 2ZCLP 1GBMA 1YPGH 4AYYB 1FY3A 1TWXB 4F49A 5T1VA 2ANKH 1QFKH 2V7QD 3JZ1B 3V0XA 1SGNE 4O97A 3RC5A 1DITH 1E38B 5HMAA 1EKBB 4ZAEA 1C2GA 2P95A 1P2MA 2UWLA 1BB0B 4I86A 1CA0C 1L0ZA 3IWMA 3OEHD 3F68H 1A5IA 3A83A 3ZVBA 3ATIA 2CV3A 1O2WA 5A8ZA 3TJOA 3SN8A 3BG8A 1S85A 5KECA 1SFQB 2UUFB 1PYTC 5HM2A 4D7GA 1GI5A 3RXTA 1P2NA 5EJ1A 3Q77A 5JDUB 4CR9A 1O3LA 1THSH 1E37B 9ESTA 3T2NA 2A7JA 1H8IH 5BPEA 4IMQA 3OSYA 1GWAA 1LVOA 1JRTA 4UDWH 3SNDA 3VB6A 2QV1A 1C5PA 4NFEA 2VH0A 2WPIS 4NIYA 4ZXXH 2A4GA 1GMHG 1W0KD 1O2PA 4F48B 1DWEH 2FOHA 4RT0A 2ZU5A 4ZHLU 3A8DA 4D9QA 4BTIB 4OS7A 3UWIA 1Z8RA 3NCLA 1CBWB 1GJ6A 3MHWU 2ZU1A 2QXGA 1O2MA 3E6PH 4AFSA 1O3NA 4X6NA 1KDQA 3O8BA 3TJVA 1C2KA 1KXBA 1UHBB 1V2PT 2J34A 1PYTD 1UTMA 3EGKH 1MABB 1NPMA 3M7TA 3SUDA 5AHGH 3MH4A 3M7UA 1BTXA 1THPB 1SVPA 2J5UA 1O2VA 2WV4A 1G3CA 3RUOA 1CBWC 2PSYA 1SR5C 2FOCA 1HAYB 3V3MA 3RXIA 1A0LA 1C4V2 2IJD1 2WPMS 2C8YB 1Y59T 1MMJN 2SGPE 2FOGA 1SGTA 4JYUH 1AUJA 1HAVA 4KTCA 2BQWB 3TGJE 5GXPA 2ZFSA 2PTNA 2FOBA 1C5NH 1OP0A 1H9LB 4ISOA 3BG4B 1G37A 3GY7A 2ZHFH 3URCA 2C90B 2NU3E 3F2GA 1BQYA 1N1LA 1Y3XA 3ZVFA 2GDDA 4YLUA 2FOAA 1C1QA 3SO3A 1LMWB 1BRCE 1D9IA 2QA9E 1AWHB 2J98B 1ZHMA 1V2KT 5GPIB 2BLVA 2AEIH 1YM0A 1O2UA 1CSOE 1OXGA 1ESTA 2QIQA 3BG4C 1L2EA 3L33A 3MO6A 4TWWA 2F9PA 3FP7E 3RMLH 3KEEA 1PPZA 3CP7A 1CHOF 3ZZ8A 1CO7E 3NXPA 2YOLA 1KXFA 4B75A 3LDXH 2IJOB 5EQRA 1D3DB 1GG6B 1J8AA 4TWYA 2WSSD 1E0FD 3RMMH 3PM3A 4FXGH 3SU1A 3ZVDA 2A0QB 1AVGH 2ZGJA 3N7EA 4TT3D 4HTCH 3S7HB 1WQVH 5AF9H 2OBQA 2V3OH 2ZGCA 1AD8H 3A7XA 4NZQA 1A1RA 1UTQA 4NZLA 2Q6DA 1GBTA 3GY4A 4CRFA 4INHA 2O8WA 5EPNA 2G52A 2O8TA 1GBHA 1O34A 3NWUA 1GG6C 3BTDE 1MKWH 3AW0A 3MOCA 1VITG 2HLDD 3C27B 1MD8A 1C2MA 3GDSA 1XKBC 1UCYH 2W26A 1ARCA 4TPYA 7GCHG 3FVFB 2JH6D 2AGGX 2GVFA 2ZECA 2G5NA 3TNTA 4MNWA 3FKSD 1BJVA 4FETA 2AGEX 1A46H 4YLQH 2J94A 4O9VA 1TGNA 2BLOA 2ZFTA 4Y71A 4BAHB 1C5RA 5IK2D 1VJ9U 3E0PB 2VVUA 2PUXB 1XM1A 1RRKA 3GCOA 1EAWA 1RIWB 1IHSH 1DT2A 3P8GA 4D76A 4CBNA 3M5MA 1ZHPA 4Y8ZA 1W0ZU 2VIDA 3SJOA 1QRXA 4AYVB 1L1NA 4M9FA 3E16B 3BTGE 2PKAB 2RA3A 4FU8A 1JIRA 1AVXA 2AYWA 1W7XH 2F3CE 1FJSA 1ELTA 1LPKB 1CT4E 2Z3EA 1O2IA 5JBAS 4FUJA 4AB8A 1RIWC 2BZ6H 2JIZD 3BEFB 1C1TA 2Z6BD 4I8HA 2PLXA 4U01A 3C1KA 2Z3CA 1NU9A 1CT2E 1C4Y2 3EE0B 1FAKH 3NPSA 4XBBA 2LNCA 2F9BH 1DSUA 1FY5A 2ZC9H 4AN7A 1TPPA 1D3QB 3OX7U 4X8VH 1E36B 5T6DA 2FLRH 1A7SA 2BM2A 2FS8A 1HRTH 1S0QA 1V2TT 2JETB 4TY7A 3ZZ4A 2OQUA 3U1JB 3GYMA 4ZHMU 3SV6A 2WZQA 3PMAB 1BCUH 3IG6B 3K9XB 1IOEA 1TABE 1BZXE 4ZXYH 2GCTC 1EFRD 1TA6A 4CBOA 3SI3H 2J38A 1MQ5A 2YNBA 3F0OA 3UY9A 3BTKE 1CVWH 1NFYA 4GPGA 2TGDA 2LPRA 2Z3DA 1BTPA 5FCKA 3VXFH 1D4PB 1NROH 4ABBA 2JETC 1HJ8A 3ZVAA 4YO9A 3S69A 3LKWA 4LOYH 1ELCA 1GGDB 1MU8B 4FUIA 1UK3A 3PRBA 1C5UA 3SORA 4CH8B 1TB6H 4WMEA 4NIVA 3ODDA 4E05H 1DWDH 2BY7X 3PMHB 4X6OA 3HGNA 1GBKA 1EASA 1WYKA 1ZRKA 1TGBA 1J15A 1G36A 4E7NA 3S9AA 4Y6DA 3RLYH 1TGCA 3A89A 1V2NT 3T26A 4FU7A 1MQ6A 2BD4A 5DPAA 1GHWH 1F0UA 5EPYA 1K0HA 3K65B 2Q6GA 1DOJA 4IS5A 3DFLA 5SGAE 3KL6A 4JMYA 1GGDC 3UNSA 3WWBA 1UVTH 2BD5A 1K9OE 1P2QA 4KGAA 2VBCA 1SFIA 1DE7H 2D1JA 4JK6A 1F0RA 1V2QT 2PW8H 3TH4H 1HAOH 3SYJA 6GCHG 4NFFA 1FPHH 3AVZA 2TPIZ 4DVAU 2OD3B 1QBOA 3EYDA 2Y7XA 1N6XA 1BMMH 1OWIA 1C5YB 1HAIH 2EA3A 3T25A 2ZFPH 1QURH 2BDBA 5GWZA 3RU4T 2ZU2A 1O3BA 2GV6A 3AW1A 5ESTE 1ZSLA 3F6UH 4CR5A 1MTNB 3AK5A 5DP5A 1TOCB 1C9PA 1ANCA 3F3BA 2ZF0H 3UUZA 2GP9B 3LONA 4A1VA 3MTYA 1V3XA 3ZYDA 4XOJA 2BZAA 1QL9A 2Z9LA 3W94A 1VR1H 2R9PA 4Y8YA 2BY9X 1F0SA 1GHZA 4U2WA 2HGTH 5FCRA 2AFQB 1O5DH 3MU1A 4NCYA 2OLGA 1Z8GA 1E34B 5PTPA 1GL0E 4LK4A 2Y81A 4Q2KA 1MTNC 3ZZ9A 4NWLA 1BJUA 1SG8B 3P95A 1OYQA 3Q3YA 4RN6A 2SGDE 1QBNA 1ZLRA 2G8TA 5F8TA 2A5IA 2HRVA 4P00A 3TVJB 2XWBI 3CS0A 5E0JA 4NIWA 1V2VT 1C2EA 2JH5D 1QB9A 1W0YH 1K2I1 2B0FA 3SU6A 2FI3E 1XUJA 4WXIA 4OGYA 1XMNB 2ZDVH 3SV9A 4LZ1H 2ZPQA 1E35B 1LVMA 4A1TA 3MU8A 1S84A 5A8XA 1L4DA 2VU8E 1KLTA 3PTNA 3M61U 1O37A 1IQIA 3VPKA 5DP8A 1AHTH 2KCAA 1SLWB 3TK6A 1YLCA 5LPEA 1ESAA 3BEIB 1T32A 1BRUP 3P92A 1BTZA 3RP2A 4ACAA 2OUAA 2P59A 1O3CA 2DUCA 2ALVA 1YCPM 2OTVA 2VWOA 4FUBA 1KDQB 1C4U2 3RXJA 4A1XA 5F8XA 2ZO3H 2A7HA 1B0FA 3TK5A 2IPHA 4I7YH 3LGWA 1YWUA 4K1SA 4MLFB 2KFWA 3P8FA 4I8JA 1FZZA 2R0KA 4AB9A 4UFDH 2G81E 3OAAD 5FX5A 3N7DA 5TCAA 5CMXH 3DSPA 4AG2A 3N7OA 4DURA 2L74A 1V6DA 3GOVB 1GBBA 4X8TH 3GCHB 3UTUH 4ISLA 5A8YA 4K60A 1KSNA 2OQ5A 1O5AB 4D8NA 1LHCH 4CRAA 1IQHA 2F9NA 4B2CA 1TNLA 4DIHH 2QE7D 1LTOA 4FUCA 1GI0A 1T8OA 4Q7XA 3ATMA 1XUIA 3OE7D 2K1QA 1DS2E 1Y8TA 4I31A 2BTCE 3RMNH 3SJKA 3GCHC 1BRAA 1O3DA 2P93A 2NU1E 3RXDA 1GVLA 2ODPA 2XWAA 2HWLB 1H9IE 1GBAA 1CU1A 1AFEH 2Y5GA 3ZVEA 1Z71A 2G5VA 3FZZA 1GMCG 3ZZ3A 3FP8E 4TYDA 4NGAH 3KIDU 1HIAB 2FO9A 5EOKA 3GICB 2QXHA 3QK1A 3H7OA 1AE5A 2NU0E 1ETTH 3P6ZB 2GMTB 5DGJA 1B5GH 4YZUA 4ABGA 3RXQA 1KXCA 1Y3UA 2P94A 2ZZUH 4HG6A 4IBLH 4JZIA 1O3KA 2ZHWH 1SGFG 3Q00A 2FM2A 1GJCB 2B7DH 7LPRA 1U6QA 1ELDE 2W5EA 3R3GB 2GGVB 3NZIA 1ZTKA 2R2WU 2UWPA 2SGQE 5AFYH 8KME2 1OWEA 1OWDA 3FZDA 1C2LA 4ACBA 2TIOA 3GCTF 1ELEE 2GMTC 5LGOA 3EDXB 4BOHA 5EU8A 1FIZA 4CRCA 1UVSH 1YCPH 1G3BA 4X1NU 1MAYA 1V2RT 3LJJA 1PQ5A 4B76A 1O2XA 1IQJA 1D3PB 1H9HE 2A2XH 1YP9A 2GZ8A 1WSSH 3BEUA 3LH3A 1GMDG 3SZNA 4UFFH 1O5FH 2QN5T 1GBDA 2SFAA 4J1YA 5C0TA 2ZGHA 5EW2H 1AU8A 5CE1A 2HPPH 1TX7A 2W3KA 1WAYB 2QYIA 3ESTA 1S6FA 3CENA 1S6LA 2G51A 3FN8A 1V2OT 4MPVA 2H9TH 3IITA 5CHAB 1D6WA 3UOUA 4XD7D 3U1IB 4Z0KA 3SU5A 1B7XB 2QY0B 1OKXA 4GHQA 3S0NA 1GJ7B 2C3SA 4X6PA 2ZIQH 2HVXA 4UONA 3GISB 1SGQE 3E90B 3MH5A 1EZQA 2GZ9A 4A7IB 2NU2E 5E2OA 1L4ZA 2FX6A 4Y10E 5CHAC 1HLTH 3BTEE 5FL7D 1GHAG 4R8TB 1NESE 4NG9H 4HZHA 2XBXA 1G2MA 1SHHB 1G3DA 1SHYA 2O9QA 3KQBA 2XNIA 1AVWA 1TBZH 3B23B 4B74A 8ESTE 2BB4A 2XNDD 3KNXA 2CJIA 1W7GH 3UOPA 1DFPA 2H5DA 2FI5E 1QTFA 4Z6AH 1VITH 1A3EH 1GMHF 1ELBA 2QF5A 4BAKB 1F92A 1P12E 1TMBH 2GCHF 2GX4A 4KTSA 1EOJA 1T8MA 3M7QA 1BMLA 1DDJA 3A7TA 2THFB 2UUJB 4A6LA 1BTYA 2VIWA 3RXHA 4LZ4B 5C1UA 3VB5A 1O2OA 2FTMA 1B0EA 1EAUA 4THNH 1O36A 1MZAA 2Y80A 1H1BA 2R2MB 2J95A 4RSPA 5A0BA 2BHGA 2GZ7A 1MD7A 2HNTF 4I8KA 1TQ7B 1G30B 2WV9A 4YXWD 1TA2A 2CF9H 1ANBA 1MKXH 1RTKA 1W12U 1VCPA 1CGHA 1DY8A 1Y5UT 3UWJH 2P8OB 4ESTE 1JRSA 1AIXH 2GCHG 2AS9A 4BTTB 1W3CA 2XBVA 4K5ZA 1C2HA 2K0QA 3MH6A 1NC6A 1NO9H 2A4RA 3ZZ5A 2AIQA 4CREA 1X7AC 1K1NA 3LC3A 1S6HA 2WPLS 4O03A 1TAWA 5DKMA 2AMPA 5EXMA 3S9CA 1ELFA 2D26C 4XSKU 1K28D 5FAHA 1K21H 2FOEA 2V6NA 4CRGA 2GV7A 2P8OC 4MTBA 3RU4E 1MKXK 3U8OH 1HBTH 2BD7A 5CDFE 1QJ7B 2BOKA 3LOXA 1UTOA 1FXYA 1QZ8A 2VJ1A 1VCQA 1J14A 2Q1JA 4OS5A 1BRBE 1BMNH 3PRDA 1V2MT 2FDAA 3ZV9A 2UWOA 1L1GA 2ZDMA 3GCNA 1SBWA 4UFGH 2L6OA 3RM0H 3DSOA 5C2ZA 1YC0A 3ATWA 1ZRBA 1NTPA 2GTBA 3JZ2B 3L6PA 1IQNA 1O33A 3SGQE 3CNRA 1INCA 2D2DA 3MU0A 2Y5HA 3MO3A 2VWNA 1IQMA 2J92A 1THRH 4AFQA 3G01A 1YPHC 4OS6A 1AZZA 2H9EH 3F9HA 4UEHH 3O8CA 2VNTA 1PPBH 2PUQH 3RXSA 1WXRA 4ZHAA 4FU9A 3TH3H 1GBIA 3SW2B 3WY8A 1C5XB 2FYRA 3I77A 2P3UB 4D7FA 4K8BA 1C2FA 4NSVA 1MUEB 1FIWA 4K8YA 5A0CA 1NN6A 1UO6A 5TCCA 5A09A 1A2CH 3K2UA 6LPRA 4B1TA 1O3MA 5HIYA 2ZI2H 3FO8D 1TGSZ 3GY3A 3L3TA 3P70B 3LH1A 4I8GA 1VITF 3AAVA 1BMFD 1DXPA 1OHHD 1KTTB 1PQ8A 1GI8B 1WCZA 1WDIA 2F91A 1UW7A 1BT7A 7GCHF 3A88A 1P04A 1KTSB 1LDTT 1QIXB 1GJAB 2XYAA 5T3HA 4ZKOU 3FAOA 2SGEE 3VB3A 1LHEH 1O5GH 1T31A 1QHRB 3S9BA 1ABIH 1EPTA 1O3OA 2GDEH 3SZEA 1UTJA 1BA8B 4AGKA 1SI5H 4A5TS 1ANEA 1UCYE 3GY6A 4Z1MD 3PMJA 3LGIA 2BXUH 2WHXA 3MQKC 3HK6B 5CHBA 1ZPCA 1C1PA 3GY8A 1ID5H 4TY6A 1VKYA 4OS4A 1K1PA 1S0RA 1OOKB 1LCYA 2C4FH 2P16A 1GHYH 3KN2A 3M5NA 3MU4A 4I33A 5AFZH 4B2AA 1SLVB 5GCHF 3M3TA 3VXEH 3TGIE 1HUTH 1C5VA 4FVDA 1C2JA 3E1XB 3QGNB 3RMOH 4H4FA 4J2YB 1FX0B 2ESTE 3EQ0H 1O3PB 2OC0A 3E91A 4ISIH 3B9FH 1MU6B 2BDHA 2GT7A 1JXPA 2VIVA 2ZWLH 3M36A 1MKWK 4CRBA 1T8LA 4MPWA 1DXWA 1SOTA 5C20A 1UCYK 3SQHE 3T28A 5I25A 3RXAA 1EAXA 4WJG2 1NU7B 1UTNA 4U30A 5JBBS 4ABAA 5GCHG 2J4IA 2C8ZB 3MU5A 2TRMA 2Y7ZA 4MPXA 3SU4A 1GHBF 5EW1H 2ANYA 1K1JA 3UFAA 4NIXA 1BHXB 2BDGA 2BOHB 3A85A 1YPKH 1TMTH 4WMFA 4BAQB 4JZFH 1GDNA 1QL7A 4CHAB 1G3EA 2O8MA 1XX9A 2XXLA 1AKSA 1NRNH 1C1UH 1EZUC 2CGAA 2QF0A 1BIOA 1LVBA 3RXMA 5EJLA 5LH8A 3F2FA 3UB0A 1TPSA 5JBTA 2AIPA 4K69A 4KELA 1DLKB 5DP3A 4ZROA 3FFGA 1GHBG 3MNCA 1QA0A 1O3FA 2VWMA 3URDA 3BN9A 1YGCH 3QZRA 2HPQH 3MNSA 2IN2A 1P06A 2ODYB 7ESTE 1YF4A 4ASHA 1TLDA 5DK1A 2BXTH 3QDZB 4Y0YE 1AE8H 1TBRH 1UTPA 5LPFA 3KGPA 5EXLA 4XBCA 1K1MA 2A7CA 4Q80A 1AQ7A 3VFEA 1XUKA 3DD2H 3OY6U 2C8WB 2BDYA 1E1RD 1TBQH 1SLUB 2UUYA 1RGQA 4RKJB 2FWWA 3VEQB 4YOIA 6GCHF 1K1LA 1QQ4A 4DOQA 3M37A 1ARBA 1S5SA 3WW7A 1AUTC 1P2OA 1P57B 2BVXH 1P9UA 3QZQA 1A4WH 1NT1A 3TLOA 1O3EA 1W10U 3OYPA 1YYY1 4WH6A 2BDIA 3SJ9A 1A0JA 2FI4E 2AMQA 4JK5A 3QTVH 1VGCB 1UTKA 1KYNA 1HYLA 1ZPBA 3RXGA 3SNEA 2ZCHP 1O30A 3HATH 1Z6EA 2FP7B 5BRRE 1OWJA 2OC7A 3ATLA 3SV7A 4Y11E 4IW4E 1IQLA 1O2YA 1GI7B 4IC6A 4WVPE 3PV4A 1UHBA 4OGXA 4AFZA 2A4OA 5DP9A 1P0SH 3SNBA 2R3UA 1TRMA 1SB1H 2ZQ1A 1O2LA 1VGCC 1QCPA 2Z7FE 1PJPA 5GNDA 1FY1A 2WINI 4F4OC 4YOJA 4X8SH 1HPGA 1QB6A 3DT0H 1H8HD 4Y79A 3N99A 2V35A 4B71A 5EXNA 2BLQA 1NFXA 1AO5A 1S82A 3SHCH 1FN6A 1WTGH 1QR3E 1NS3A 4DT7B 1JIMA 1AMHA 3KYFA 1RFNA 1YY3A 2Z9GA 1IQGA 1SGYE 3LGTA 4SGBE 2CHAB 1GPZA 1ESBA 1PQAA 1QQUA 2CK3D 1XXDA 2BY5X 2KX4A 3F9GA 5GDSH 2KZ4A 5I46H 1GI2A 2EI8A 2ANWA 4ZMAH 1XXFA 2J98A 4WWYA 1DY9A 1WUNH 3KCGH 4X1RU 2XBYA 5JB8S 1XUHA 1HAXB 1QRZA 2GD4B 5E2PA 1V2LT 4ZH8A 2CHAC 3SV8A 1LQEA 1QJ1B 2VH6A 2FOMB 4JZ1A 1SSXA 1K1OA 4ABEA 5C5NA 3M5LA 3ZZDA 5EQQA 2LELA 1BOQA 2P3TB 1YLNA 4SGAE 3Q76A 1T4UH 3RXBA 1HCGA 1UVPA 3ZZAA 1DM4B 1MAXA 1C1WH 1LHFH 2STBE 1FMGA 3ZZCA 3D62A 2AH4X 6CHAB 1FNIA 3LC5A 3DCLA 1YKTA 4H6TA 4MNVA 1T8NA 1TOMH 1A3BH 1ELAA 4JYVH 2QGRA 1SGFA 1SPJA 2I6QA 5E8EH 5FX6A 1C5QA 1V2JT 1BBRH 4ABDA 3AAUA 2HALA 3ITIA 4X0WU 4HFPB 1DX5M 5J4SA 3U98H 3DA9B 2V3HH 3MI4A 1P2KA 1Y5BT 2WUBA 3M35A 6CHAC 1KXEA 3TU7H 3OEED 2FOFA 2RA0A 5FPTA 2KCOA 3KQ5A 1GMCF 3TNSA 1HAVB 1ZOMA 1UMAH 2R3YA 3SNCA 1P3CA 3EA9A 5IDKA 1XVOA 2EY4C 1NBME 1ORFA 5C67A 1GCDA 2KR7A 3A8CA 1BBRK 1CA8B 1BTWA 1O38A 4U32A 2ASUB 2PV9B 1GI3A 2D8WA 2OK5A 1F0TA 4IGDA 1NRPH 3H5CB 1ZJKA 2XTTB 3SOSA 3BTFE 1O2TA 3PB1E 4LXBH 4Y7BA 4ABJA 3STIA 1V2ST 4DCDA 4X2WA 3RM2H 4BNRA 1HFDA 3NUMA 3UR6A 2BD9A 4AFUA 3U69H 1RS0A 2HNTE 2G00A 2ZP0H 4O3TA 1J9CH 1K1IA 2QXJA 1XKAC 3T5FH 5ETXA 1FY8E 2KCYA 1EOLA 4IN2A 1AGJA 1GBJA 1O0DH 1QY6A 1W0JD 1EXFA 1N6YA 3OTPA 2WYJA 5DSFA 3BV9B 4INLA 1BMAA 2GT8A 4B2BA 1KXDA 3ELAH 1EP6A 1TNHA 1GMDF 4AGJA 2XCNA 1OYTH 5C1YA 2P3FH 4AOQA 1O2HA 5G4BA 4GHTA 5C5OA 2BX3A 1DSTA 2FXRA 5FBIA 2JJ1D 3TH2H 3D49H 5EG4A 4ZKNU 1O2JA 4DJZB 4X2VA 1NRSH 1AI8H 2VIPA 3A84A 1Y3YA 3RDZA 3K6ZA 4KTUA 2HLCA 2PR3A 3F1SB 4K1EA 5HXFA 1WTHD 1BHXF 1O2ZA 1O2NA 3QTOH 1HNEE 3PV5A 1L1JA 2KAIA 5L2ZH 1Y3WA 3PV2A 1LKAA 2TGPZ 3ZIAD 2EI6A 3I78A 3RLWH 4BTUB 1Z6JH 2ZDKA 3PO1B 4ZKSU 3ZYEA 1GDQA 2O8UA 1S83A 2R0LA 3RXEA 1WBGB 1GHAF 2ZEBA 1ZHRA 4M7GA 3A8BA 3MMGA 3VGCB 2C8XB 3DHKH 3NKKA 2UUKB 5FBEA 5HIZA 1LHGH 2ZTYA 3PYHA 4MNYA 5F03A 1YCPK 2GJGA 2O8LA 2BVSH 1F5RA 2XRCA 3NK8A 1XUGA 1C5TA 3SU2A 2ZDAH 3GY2A 4Y8XA 5H4IB 3B8JA 1OS8A 1ZMJA 3PO1C 3P8NA 2WPJS 2XW9A 1DICA 1OP2A 4YM9A 1DWCH 5A2MH 2ZPRA 3RXUA 3SQEE 1ZPZA 3VGCC 1O35A 1QGFA 2RDLA 3EA8A 1ZJDA 3GDUA 3E0NB 4TSFD 3UNQA 3KQDA 2H5CA 5DP4A 3RXRA 3LGVA 2AMDA 4B6EA 3EE7A 1P9SA 1H4WA 3RXOA 3SNAA 2YNAA 1IHTH 3SUGA 2BD8A 2F9UA 2EEKA 1O32A 2W6ID 3HGPA 1O2KA 4E06H 2PSXA 1EB1H 3SU3A 1EQ9A 3A82A 2VVVA 2F83A 1P2IA 1TNJA 4GSOA 3ZVGA 3Q3XA 1VZQH 3RC4A 2XOKD 4NSYA 3U8TH 5L2YH 3BTME 1D3TB 4IN1A 1P09A 4MQAA 5J4QA 2BDAA 1EJMA 1SL3A 4A92A 3RU4D 2WPHS 1OWHA 1TONA 2ZCKP 4BXSA 3QUMP 3BTTE 2ZHDA 1NFWA 4GLYA 2H6MA 2BMGB 2H9HA 4OM9A 1FUJA 1PQ7A 4QT8C 3HKJB 1GJBB 5EQSA 2SGAA 1M9UA 1TNIA 1O3HA 1O3GA 1ZSKA 2F43B 2ZKSA 1ZSJA 2LP6A 1RXPA 1LPZB 1V2WT 1W11U 4MPUA 3SI4H 1WV7H 1OP8A 4BAMB 1LVYA 1TFXA 1FN8A 1RTFB 2J9NA 3A81A 5B6OA 2BYAX 2PGQB 3A80A 4JCNA 3PLPA 1GDUA 2FTLE 2GKVE 2PFEA 1FY4A 2Y6TA 3KF2A 1IQEA 1E79D 1TGTA 1EX3A 3SJ8A 4H42U 2NWNA 2G55A 2SNVA 5HGGA 2W7SA 1FI8A 5JPMH 1GCTB 1YPLH 5AVDA 3VB4A 3STJA 2J2UA 1KXAA 2WPDD 2ZFQH 1LPGB 1N8OB 4NA8A 1Z1JA 3RC6A 1F2SE 3W1EA 1Z8JB 6ESTA 3ZZ7A 2Q6FA 2BD3A 1W8BH 1C2DA 3ODFA 1C1OA 2VIOA 4WMDA 4X1PU 1UVOA 3LT3A 3LPRA 3TPIZ 1FAXA 4P02A 3VG8A 1HAHH 2ODQA 2ZTZA 1GJ5H 1GCTC 3OY5U 2EI7A 1PPEE 4OS2A 5KEDA 5L30H 2A4QA 1SKYE 2ZTXA 2AGIX 1MH0A 1N8OC 2QXIA 2PHBA 3F9EA 1TRYA 1C9TA 4BXWA 3CS7A 3EA7A 5C17A 1HB0B 2JJ2D 1SQTA 2EQNA 1H8ED 4FUHA 2I6SA 1GHVH 4AX9H 4K3JA 1AFQB 3TJUA 5JB9S 3SGAE 4K2YA 1SGDE 5GIBA 1C5ZB 1O2RA 2CXVA 2OC8A 1C5MD 5FPSA 1SGRE 2ZHQH 1AY6H 1IAUA 9LPRA 1FONA 1TQ0B 5E0HA 3VB7A 1FV9A 3I29A 3SBKA 3U9AH 3UNRA 1Y3VA 2Y5FA 1TRNA 2YMSB 1COWD 2W6JD 1GL1A 1TX8A 1EB2A 1AFQC 1GHXH 3M3SA 2QAAA 1YBWA 5KGOA 3LGYA 1HIAA 4ISNA 3S7KB 3F9FA 4FUGA 3BIUH 2XBWA 1Q2WA 3BIVH 3DSGA 1EJNA 1S81A 2ZU4A 1BDAA 1OX1A 1PPFE 3GYLB 1Z8IB 1CT0E 1ABJH 1ETRH 1GJDB 4Q7YA 2FIRH 2YMSC 4FOUC 1QNJA 1GI1A 2FEQH 2WV5A 4FVBA 5E0GA 2TBSA 1UVUH 2ZDNA 4Y7AA 1GBLA 1ZTJA 5DP7A 2VINA 2C93B 1CGJE 1MTUA 2M5TA 1GBFA 4E7RG 2BDCA 4FUDA 2XC4A 1LO6A 1G2LA 1CHOG 4Q7ZA 3RXVA 4CRDA 5JBCS 3DUXH 3UQVA 5EJZA 1TX6A 2XC5A 3WWFA 1V2UT 3FANA 3U28C 1GJ9B 2A5AA 4K1TA 4I32A 1O5CB 2VWLA 4ASUD 4MVNA 5DP6A 2H2ZA 2PTCE 5LPRA 1MCTA 2A5KA 1W13U 2WYGA 5DJ7A 3D65E 1RTLA 3MO9A 4Y76A 1SGIB 3KHVA 4AZ2B 2JKHA 1HGTH 2A2QH 5A0AE 2EC9H 3ENSB 1EZSC 1NY22 1SLXB 2JH0D 2FZZA 2ZNKH 2W7UA 3GS9A 8GCHF 3R0FA 4B73A 1FQ3A 3PROA 4XRNA 1ELGA 1LQDB 1UK2A 4NA9H 3U8RH 1WU1A 3O8RA 4Y0ZE 2YMSD 2BD2A 1P11E 1YPHE 1QBVH 1NFUA 2BQ6B 3M5OA 2J97A 3MNXA 4XFQA 4MG3A 1T7CA 4BAOB 3RXCA 2OXSA 1XUFA 1GBCA 1KIGH 2TGTA 3QGJA 4XDEA 1P02A 1OWKA 2VB0A 1MTVA 4CHAC 2GCTB 3TITA 3GDVA 2NU4E 2H1UA 5L6NH 8GCHG 1SOZA 2CN0H 3V7TA 2KM0A 1DUEA 3RXFA 1GVKB 2CMYA 2F4LA 4XE4A 2V0BA 1C5SA 3QN7A 4H6SB 3QO6A 4ZKRU 1Z7KA 1ZGIA 5DN6D 1GI9B 1UK4A 1TIOA 4X1SU 5HM9A 1F7ZA 2V3MA 4FUEA 3T27A 3OU0A 4PROA 4Q63A 1P2JA 2BLWA 2SNWA 3NRLA 3HKIB 3RXLA 1TE0A 1C1MA 3LGUA 1AZ8A 1MCVA 2BQ7B 2Z94A 1SGCA 2HOBA 4AORA 4GAWA 5EODA 1PPHE 2ZPSA 1Q3XA 2Z9KA 5K0HA 2KAIB 2BX4A 2SGFE 2XC0A 3Q3KA 5FXLA 3PLBA 1TMUH 1VCWA 4YESB 3BTQE 4ZCNA 1TYNA 1ZTLA 1J17T 1HAZB 4OS1A 3KQEA 4ABFA 4JYTA 1ZMLA 4BANB 4UD9H 1DWBH 1BTHH 1VJAU 1Z1IA 1FDPA 1SQOA 2FS9A 5C94A 3UAIC 1PPGE 4X6MA 4X8UH 1P01A 5F8ZA 1HDTH 3MH7A 4HGCA 1KLJH 1BITA 4GUXA 1BUIA 1J16A 3P8OA 1JMOH 4YTAA 4WXVA 3F2HA 1TPAE 3BTHE 1A5GH 5IYTA 1MTWA 3A87A 3H09A 3T29A 2ZA5A 5TJXA 1QA7A 3LJOA 5DG6A 3SGBE 3HPTB 1RJXB 2DE8A 2ZFRH 2XCFA 3W95A 2RDEA 5JYIA 4AG1A 1SMFE 3F0PA 5T6GA 1QL8A 1P3EA 1DLEA 3TJNA 4YT6H 3QX5H 1IQFA 1QRWA 1DVAH 3PLKA 4CH2B 1NM6A 3UIRA 2FPZA 3LIWA 3RXPA 4IC5A 4YOGA 7KMEH 2K8IA 1YPJH 1AN1E 1GI4A 1SGEE 4VGCB 3T62A 2ZDLA 2AHME 3MWIU 2A31A 2HNTC 4X1QU 2BVRH 4NWKA 2ZGXH 3FP6E 1O2GH 1HXFH 2B5TB 1HAPH 5T6FA 1O2SA 2IOTA 1P03A 5C1XA 5C3NA 1SC8U 1YPEH 3AASA 1O3AA 3TK9A 2ZQ2A 2HVYB 3MFJA 1C1RA 2A1DB 1OPHB 1MZDA 1O5EH 2W3IA 3A7ZA 5EGMA 1LHDH 1YLDA 3V12A 4VGCC 4ISHH 1O3JA 4Q4LA 1F5KU 3TIUA 1SQRA 2ANMH 1GJ8B 1H8DH
chains in the Genus database with same CATH topology
3SUFA 1P8VC 1WOFA 3P17H 3SHAH 4JZDH 2FYQA 3ZZ6A 4ZUHA 1C1NA 2PKSB 1ZGVA 1BBRE 4ABHA 1O5BB 2ILNA 1D6RA 4DG4A 3D23A 2FX4A 1QB1A 2QF3A 4GVUA 3BF6H 2PGBB 1AWFH 3A7YA 4HI3A 3SJIA 2Z9IA 1JWTA 1HV7A 4RKOB 4UE7H 1W14U 4IMZA 1Q31A 2FMJA 1BTUA 4JZEH 3A8AA 2ZGBH 1KY9A 5FHTA 5K7RA 1GJ4H 4R0IA 1DANH 2F9OA 2PKSC 1C2IA 2A45B 1PPCE 3BSQA 1CHGA 3EAJA 1NRRH 3E8LA 4WH8A 3PMBB 1G32B 2FODA 4FUFA 3UR9A 4LZ4B 1SGPE 3O8DA 3QLPH 3UQOA 3KQCA 3ZZBA 1O3IA 1K22H 1MBQA 1TPOA 2DE9A 1CGIE 1P05A 1JBUH 2VVCA 3SUEA 4DW2U 5DO4H 3HK3B 2TGAA 5HYOA 1NRQH 1RD3B 2OP9A 3K6YA 4GCHF 1HXEH 1LKBA 1QJ6B 4DIIH 4MNXA 1GI6A 2CF8H 4KP0A 2PKAA 1EUFA 2BY8X 1TNKA 3QWCH 5FPYA 2G4UA 1AB9B 2PWXA 4O3UA 3A7VA 1ETSH 3DFJA 1SQAA 2WPKS 4TPIZ 5ESBA 4DY7B 1JOUB 2Y82A 4MDSA 1HJAB 2RG3A 4GCHG 1G9IE 1ZZZA 2ALPA 3A7WA 1EZXC 1W2KH 2VGCB 1EP5A 2Z9JA 3ATKA 4DGJA 1AB9C 4YT7H 1Y5AT 1NZQH 4WY3A 1EPTB 1ANDA 4WF8A 5ABWA 1C5OH 3ZV8A 1C1VH 1OSSA 1CE5A 1PFXC 2F9VA 2ZFFH 1FLEE 1HJAC 1ACBE 2ULLA 2AERH 2ZHEH 2WUCA 2VGCC 3E3TA 1C5LH 1EJAA 1GVZA 1C5WB 3RXKA 1ZYOA 1YPMH 3M3VA 1O39A 3MYWA 4XBDA 1F5LA 3A86A 1EPTC 3PWBA 2ZU3A 3MNBA 1ZR0A 1A5HA 1FPCH 3PTBA 5F6MA 2B8OH 1WQSA 4D9RA 1CQQA 1HJ9A 1UTLM 1UJ1A 1KLIH 2VIQA 3OTJE 1P10A 2ZG0H 3H7TA 3BTWE 1HAGE 8LPRA 2RCEA 2OBOA 2QC2A 1A61H 2B9LA 4UFEH 3SU0A 1MTSA 2FESH 3UREA 2STAE 1XVMA 1DUAA 1EATA 3V13A 1TNGA 2FLBH 1TALA 1O2QA 4INKA 1GBEA 1C1SA 3GCTG 3TGKE 5GJ4B 1DPOA 4KKDA 2OINA 1CA0B 1ELVA 3LU9B 2A32A 1EAIA 2OC1A 4I8LA 3ZVCA 3SV2H 3GY5A 3UPEA 1MBMA 3PWCA 1IQKA 2QCYA 4X2XA 1AKSB 1O31A 2OCVB 2G4TA 1ZMNA 4ABIA 2BY6X 4NA7A 1A0HB 4X2YA 1T4VH 2ZCLP 1GBMA 1YPGH 4AYYB 1FY3A 1TWXB 4F49A 2ANKH 1QFKH 3JZ1B 3V0XA 1SGNE 4O97A 3RC5A 1DITH 1E38B 5HMAA 1EKBB 4ZAEA 1C2GA 2P95A 1P2MA 2UWLA 1BB0B 1CA0C 1L0ZA 3IWMA 3F68H 1A5IA 3A83A 3ZVBA 3ATIA 2CV3A 1O2WA 5A8ZA 3TJOA 3SN8A 3BG8A 1S85A 1SFQB 2UUFB 1PYTC 5HM2A 4D7GA 1GI5A 3RXTA 1P2NA 3Q77A 5JDUB 4CR9A 1O3LA 1THSH 1E37B 9ESTA 3T2NA 2A7JA 1H8IH 5BPEA 4IMQA 3OSYA 1GWAA 1LVOA 1JRTA 4UDWH 3SNDA 3VB6A 2QV1A 1C5PA 4NFEA 2VH0A 2WPIS 4NIYA 4ZXXH 2A4GA 1GMHG 1O2PA 1DWEH 2FOHA 2ZU5A 4ZHLU 3A8DA 4D9QA 4BTIB 4OS7A 3UWIA 1Z8RA 3NCLA 1CBWB 1GJ6A 3MHWU 2ZU1A 2QXGA 1O2MA 3E6PH 4AFSA 1O3NA 4X6NA 1KDQA 3O8BA 3TJVA 1C2KA 1KXBA 1UHBB 1V2PT 2J34A 1PYTD 1UTMA 3EGKH 1NPMA 3M7TA 3SUDA 5AHGH 3MH4A 3M7UA 1BTXA 1THPB 1SVPA 1O2VA 2WV4A 1G3CA 3RUOA 1CBWC 2PSYA 1SR5C 2FOCA 1HAYB 3V3MA 3RXIA 1A0LA 1C4V2 2WPMS 2C8YB 1Y59T 1MMJN 2SGPE 2FOGA 1SGTA 4JYUH 1AUJA 1HAVA 4KTCA 2BQWB 3TGJE 5GXPA 2ZFSA 2PTNA 2FOBA 1C5NH 1OP0A 1H9LB 4ISOA 3BG4B 1G37A 3GY7A 2ZHFH 3URCA 2C90B 2NU3E 1BQYA 1N1LA 1Y3XA 3ZVFA 2GDDA 4YLUA 2FOAA 1C1QA 3SO3A 1LMWB 1BRCE 1D9IA 2QA9E 1AWHB 1ZHMA 1V2KT 5GPIB 2BLVA 2AEIH 1YM0A 1O2UA 1CSOE 1OXGA 1ESTA 2QIQA 3BG4C 1L2EA 3L33A 3MO6A 4TWWA 2F9PA 3FP7E 3RMLH 3KEEA 1PPZA 3CP7A 1CHOF 3ZZ8A 1CO7E 3NXPA 2YOLA 1KXFA 4B75A 3LDXH 2IJOB 5EQRA 1D3DB 1GG6B 1J8AA 4TWYA 1E0FD 3RMMH 3PM3A 4FXGH 3SU1A 3ZVDA 2A0QB 1AVGH 2ZGJA 4HTCH 3S7HB 1WQVH 5AF9H 2OBQA 2V3OH 2ZGCA 1AD8H 3A7XA 4NZQA 1A1RA 1UTQA 4NZLA 2Q6DA 1GBTA 3GY4A 4CRFA 4INHA 2O8WA 5EPNA 2G52A 2O8TA 1GBHA 1O34A 3NWUA 1GG6C 3BTDE 1MKWH 3AW0A 3MOCA 1VITG 3C27B 1MD8A 1C2MA 3GDSA 1XKBC 1UCYH 2W26A 1ARCA 4TPYA 7GCHG 3FVFB 2JH6D 2AGGX 2GVFA 2ZECA 2G5NA 3TNTA 4MNWA 1BJVA 2AGEX 1A46H 4YLQH 2J94A 4O9VA 1TGNA 2BLOA 2ZFTA 4Y71A 4BAHB 1C5RA 1VJ9U 3E0PB 2VVUA 2PUXB 1XM1A 1RRKA 3GCOA 1EAWA 1RIWB 1IHSH 1DT2A 3P8GA 4D76A 4CBNA 3M5MA 1ZHPA 4Y8ZA 1W0ZU 2VIDA 3SJOA 1QRXA 4AYVB 1L1NA 3E16B 3BTGE 2PKAB 2RA3A 4FU8A 1JIRA 1AVXA 2AYWA 1W7XH 2F3CE 1FJSA 1ELTA 1LPKB 1CT4E 2Z3EA 1O2IA 5JBAS 4FUJA 4AB8A 1RIWC 2BZ6H 3BEFB 1C1TA 2Z6BD 4I8HA 2PLXA 4U01A 3C1KA 2Z3CA 1NU9A 1CT2E 1C4Y2 3EE0B 1FAKH 3NPSA 4XBBA 2LNCA 2F9BH 1DSUA 1FY5A 2ZC9H 4AN7A 1TPPA 1D3QB 3OX7U 4X8VH 1E36B 5T6DA 2FLRH 1A7SA 2BM2A 2FS8A 1HRTH 1S0QA 1V2TT 2JETB 4TY7A 3ZZ4A 2OQUA 3U1JB 3GYMA 4ZHMU 3SV6A 3PMAB 1BCUH 3IG6B 3K9XB 1IOEA 1TABE 1BZXE 4ZXYH 2GCTC 1TA6A 4CBOA 3SI3H 2J38A 1MQ5A 2YNBA 3UY9A 3BTKE 1CVWH 1NFYA 4GPGA 2TGDA 2LPRA 2Z3DA 1BTPA 5FCKA 3VXFH 1D4PB 1NROH 4ABBA 2JETC 1HJ8A 3ZVAA 4YO9A 3S69A 3LKWA 4LOYH 1ELCA 1GGDB 1MU8B 4FUIA 1UK3A 3SORA 1C5UA 4CH8B 4E05H 1TB6H 4WMEA 4NIVA 3ODDA 1DWDH 2BY7X 3PMHB 4X6OA 3HGNA 1GBKA 1EASA 1WYKA 1ZRKA 1TGBA 1J15A 1G36A 4E7NA 3S9AA 4Y6DA 3RLYH 1TGCA 3A89A 1V2NT 3T26A 4FU7A 1MQ6A 2BD4A 5DPAA 1GHWH 1F0UA 5EPYA 3K65B 2Q6GA 1DOJA 4IS5A 3DFLA 5SGAE 3KL6A 4JMYA 1GGDC 3UNSA 1UVTH 2BD5A 1K9OE 1P2QA 4KGAA 1SFIA 1DE7H 2D1JA 4JK6A 1F0RA 1V2QT 2PW8H 3TH4H 1HAOH 6GCHG 4NFFA 1FPHH 3AVZA 2TPIZ 4DVAU 2OD3B 1QBOA 3EYDA 2Y7XA 1N6XA 1BMMH 1OWIA 1C5YB 1HAIH 2EA3A 3T25A 2ZFPH 1QURH 2BDBA 5GWZA 3RU4T 2ZU2A 1O3BA 2GV6A 3AW1A 5ESTE 1ZSLA 3F6UH 4CR5A 1MTNB 5DP5A 1TOCB 1C9PA 1ANCA 2ZF0H 3UUZA 2GP9B 3LONA 4A1VA 3MTYA 1V3XA 3ZYDA 4XOJA 2BZAA 1QL9A 2Z9LA 3W94A 1VR1H 2R9PA 4Y8YA 2BY9X 1F0SA 1GHZA 4U2WA 2HGTH 5FCRA 2AFQB 1O5DH 3MU1A 4NCYA 2OLGA 1Z8GA 1E34B 5PTPA 1GL0E 4LK4A 2Y81A 4Q2KA 1MTNC 3ZZ9A 4NWLA 1BJUA 1SG8B 3P95A 1OYQA 3Q3YA 4RN6A 2SGDE 1QBNA 1ZLRA 2G8TA 5F8TA 2A5IA 2HRVA 3TVJB 2XWBI 3CS0A 5E0JA 4NIWA 1V2VT 1C2EA 2JH5D 1QB9A 1W0YH 1K2I1 2B0FA 3SU6A 2FI3E 1XUJA 4WXIA 4OGYA 1XMNB 2ZDVH 3SV9A 4LZ1H 2ZPQA 1E35B 1LVMA 4A1TA 3MU8A 1S84A 5A8XA 1L4DA 2VU8E 1KLTA 3PTNA 3M61U 1O37A 1IQIA 3VPKA 5DP8A 1AHTH 1SLWB 3TK6A 1YLCA 5LPEA 1ESAA 3BEIB 1T32A 1BRUP 3P92A 1BTZA 3RP2A 2OUAA 2P59A 1O3CA 2DUCA 2ALVA 1YCPM 2OTVA 2VWOA 4FUBA 1KDQB 1C4U2 3RXJA 4A1XA 5F8XA 2ZO3H 2A7HA 1B0FA 3TK5A 2IPHA 4I7YH 3LGWA 4K1SA 4MLFB 3P8FA 4I8JA 1FZZA 2R0KA 4AB9A 4UFDH 2G81E 5FX5A 5TCAA 5CMXH 4AG2A 3N7OA 4DURA 1V6DA 3GOVB 1GBBA 4X8TH 3GCHB 3UTUH 4ISLA 5A8YA 4K60A 1KSNA 2OQ5A 1O5AB 4D8NA 1LHCH 4CRAA 1IQHA 2F9NA 4B2CA 1TNLA 4DIHH 1LTOA 4FUCA 1GI0A 1T8OA 4Q7XA 3ATMA 1XUIA 2K1QA 1DS2E 1Y8TA 4I31A 2BTCE 3RMNH 3SJKA 3GCHC 1BRAA 1O3DA 2P93A 2NU1E 3RXDA 1GVLA 2ODPA 2XWAA 2HWLB 1H9IE 1GBAA 1CU1A 1AFEH 2Y5GA 3ZVEA 1Z71A 2G5VA 3FZZA 1GMCG 3ZZ3A 3FP8E 4TYDA 4NGAH 3KIDU 1HIAB 2FO9A 5EOKA 3GICB 2QXHA 3QK1A 3H7OA 1AE5A 2NU0E 1ETTH 3P6ZB 2GMTB 5DGJA 1B5GH 4YZUA 4ABGA 3RXQA 1KXCA 1Y3UA 2P94A 2ZZUH 4IBLH 4JZIA 1O3KA 2ZHWH 1SGFG 3Q00A 2FM2A 1GJCB 2B7DH 7LPRA 1U6QA 1ELDE 2W5EA 3R3GB 2GGVB 3NZIA 1ZTKA 2R2WU 2UWPA 2SGQE 5AFYH 8KME2 1OWEA 1OWDA 3FZDA 1C2LA 2TIOA 3GCTF 1ELEE 2GMTC 5LGOA 3EDXB 4BOHA 5EU8A 1FIZA 4CRCA 1UVSH 1YCPH 1G3BA 4X1NU 1MAYA 1V2RT 3LJJA 1PQ5A 4B76A 1O2XA 1IQJA 1D3PB 1H9HE 2A2XH 1YP9A 2GZ8A 1WSSH 3BEUA 3LH3A 1GMDG 3SZNA 4UFFH 1O5FH 2QN5T 1GBDA 2SFAA 4J1YA 2ZGHA 5EW2H 1AU8A 5CE1A 2HPPH 1TX7A 2W3KA 1WAYB 2QYIA 3ESTA 1S6FA 3CENA 2G51A 1V2OT 4MPVA 2H9TH 3IITA 5CHAB 1D6WA 3UOUA 3U1IB 4Z0KA 3SU5A 1B7XB 2QY0B 1OKXA 4GHQA 3S0NA 1GJ7B 2C3SA 4X6PA 2ZIQH 2HVXA 4UONA 3GISB 1SGQE 3E90B 3MH5A 1EZQA 2GZ9A 4A7IB 2NU2E 5E2OA 1L4ZA 2FX6A 4Y10E 5CHAC 1HLTH 3BTEE 1GHAG 4R8TB 1NESE 4NG9H 4HZHA 2XBXA 1G2MA 1SHHB 1G3DA 1SHYA 2O9QA 3KQBA 2XNIA 1AVWA 1TBZH 3B23B 4B74A 8ESTE 2BB4A 3KNXA 2CJIA 1W7GH 3UOPA 1DFPA 2H5DA 2FI5E 1QTFA 4Z6AH 1VITH 1A3EH 1GMHF 1ELBA 4BAKB 1F92A 1P12E 1TMBH 2GCHF 2GX4A 4KTSA 1EOJA 1T8MA 3M7QA 1BMLA 1DDJA 3A7TA 2THFB 2UUJB 4A6LA 1BTYA 2VIWA 3RXHA 5C1UA 3VB5A 1O2OA 2FTMA 1B0EA 1EAUA 4THNH 1O36A 1MZAA 2Y80A 1H1BA 2R2MB 2J95A 4RSPA 5A0BA 2BHGA 2GZ7A 1MD7A 2HNTF 4I8KA 1TQ7B 1G30B 1TA2A 2CF9H 1ANBA 1MKXH 1RTKA 1W12U 1VCPA 1CGHA 1DY8A 1Y5UT 3UWJH 2P8OB 4ESTE 1JRSA 1AIXH 2GCHG 2AS9A 4BTTB 1W3CA 2XBVA 4K5ZA 1C2HA 3MH6A 1NC6A 1NO9H 2A4RA 3ZZ5A 2AIQA 4CREA 1X7AC 1K1NA 3LC3A 1S6HA 2WPLS 4O03A 1TAWA 5DKMA 2AMPA 5EXMA 3S9CA 1ELFA 2D26C 4XSKU 1K28D 5FAHA 1K21H 2FOEA 2V6NA 4CRGA 2GV7A 2P8OC 4MTBA 3RU4E 1MKXK 3U8OH 1HBTH 2BD7A 1QJ7B 2BOKA 3LOXA 1UTOA 1FXYA 2VJ1A 1VCQA 1J14A 2Q1JA 4OS5A 1BRBE 1BMNH 1V2MT 2FDAA 3ZV9A 2UWOA 1L1GA 2ZDMA 3GCNA 1SBWA 4UFGH 3RM0H 5C2ZA 1YC0A 3ATWA 1ZRBA 1NTPA 2GTBA 3JZ2B 3L6PA 1IQNA 1O33A 3SGQE 1INCA 2D2DA 3MU0A 2Y5HA 3MO3A 2VWNA