2VIWA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2viwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2viwA01
2P8OC 2V0BA 3SW2B 1NESE 4DCDA 2AGIX 1RIWC 1C5YB 1PYTC 2GCTB 3TU7H 1YGCH 2ZFRH 1NROH 4KGAA 2Z3CA 2OD3B 1ESAA 1MKWH 2ZDMA 4X1NU 3T2NA 2HWLB 1BA8B 2BY5X 2SGFE 4UFEH 3KQBA 2PTCE 3AAVA 2WPMS 3QK1A 2B9LA 3BTFE 2FXRA 3EGKH 2XXLA 2PSXA 1S6HA 1Z8JB 2HPQH 3A7WA 5CE1A 1TPSA 2OC1A 3SU1A 3ZZAA 2G4UA 4OS5A 4WY3A 1GBKA 4DIIH 1UHBB 3ZZCA 3KHVA 1TBZH 2ZCKP 3ZZ8A 1KYNA 2GDDA 1ZGIA 1DXPA 1AWHB 1SGIB 3UOUA 1S6FA 2ZI2H 3DHKH 1YCPH 1PPBH 3F68H 1H9LB 2BD3A 1IOEA 5HGGA 1GDQA 5A09A 4K60A 3LJOA 1EXFA 3MTYA 3LPRA 1P2MA 2BDAA 3URCA 1L4ZA 4I8LA 1EKBB 1GMHG 1O3PB 4Y79A 3T26A 3MHWU 4HTCH 1C9TA 1BHXB 2FEQH 3BTTE 3UFAA 2D2DA 2P93A 3A80A 2Y6TA 1C2JA 1TMUH 2O8TA 4JZFH 2O8LA 1SVPA 1O2SA 1NFUA 2IPHA 1T7CA 3DUXH 3OY6U 1S0QA 1GI4A 3GY6A 3EYDA 4X2YA 4A6LA 1SPJA 4K8YA 1BCUH 2ZTZA 3CS7A 3RXAA 4Y8ZA 2W7SA 1O3EA 1Y5BT 2BYAX 1LMWB 1UK3A 3MNXA 3A85A 2F9VA 1VJ9U 3B23B 1WTHD 4Y8YA 1RXPA 4GCHG 1K1LA 4D7FA 1P10A 2VU8E 3RC4A 4H6TA 3SHAH 3STIA 1MTVA 4CR5A 1ZSJA 3EDXB 2G55A 4UDWH 4DGJA 2QXIA 3BN9A 2C4FH 1WU1A 5E0HA 1LVYA 1C2KA 3T27A 1IQHA 2BD4A 1ZYOA 1CT2E 3PMAB 5DGJA 1YCPM 1HB0B 1G37A 5A8YA 1HRTH 2NU1E 3I29A 3H7OA 4MNVA 2PSYA 1D3DB 3GCHB 3TLOA 3HK6B 3SU3A 3SUDA 3T5FH 2GMTC 4JCNA 3PLBA 1OPHB 1F5RA 1W12U 1GGDC 5IYTA 1GHZA 2Z9LA 1W8BH 1UVTH 4AFZA 6ESTA 2Q1JA 1CA8B 1OYTH 3RXKA 4J2YB 2FOHA 1BBRH 1ZLRA 3OTJE 2TBSA 1AY6H 4Z6AH 2G8TA 1L4DA 2PGBB 3AASA 1DLEA 3L6PA 1QB9A 1PQ5A 1TOCB 1K1NA 3QDZB 5FBEA 5CHAB 3VB7A 3OSYA 3NZIA 1ETSH 3JZ1B 4DJZB 3BTGE 1S5SA 1GHBF 2ZHQH 1MKWK 5DP6A 1E35B 4BXWA 2VB0A 3KEEA 1EASA 2AFQB 1YPKH 4ZKRU 4X1RU 1FNIA 3GYMA 1K1MA 3MYWA 1OP8A 2FOCA 1G2LA 1C1WH 3FP8E 1GBIA 2V35A 4KTSA 1QR3E 4B71A 1MCTA 1O3HA 4NA9H 5AHGH 1EPTC 3M5MA 4ISLA 1FPCH 1C2EA 4K2YA 4JZIA 4THNH 1DANH 1TGBA 4SGAE 1DM4B 2ZC9H 1TGTA 2AS9A 4B74A 1QRWA 3BG4C 1FAKH 2BHGA 4CRAA 1W7XH 5E0GA 4NZQA 1D9IA 1G9IE 4NSVA 2TIOA 1GDNA 1AIXH 3ZZ6A 3UIRA 2ZDLA 1C1RA 4IBLH 5AFZH 3RXEA 4CRCA 5A0CA 1J16A 2H2ZA 1TX7A 1HJ9A 2AERH 1F5LA 4CHAC 1GBTA 3LJJA 3S9AA 2BQ7B 2JH6D 1XVMA 2VINA 2P3TB 4MNYA 4NWKA 2O8MA 1BRAA 1T32A 5C5NA 1GVKB 2JKHA 1W13U 1WUNH 4NFFA 1MTNB 1C5NH 3BTME 3ZVGA 1F0UA 4ZKNU 1DUEA 4X6OA 1O3AA 2WV5A 2ZIQH 2FS9A 2VIDA 5A2MH 1MQ6A 1O36A 3VEQB 1CSOE 2ZHWH 4GUXA 1K1PA 2XBVA 1LO6A 5ETXA 3V7TA 4BAMB 1CA0C 3FZDA 3JZ2B 3PTBA 1BDAA 3NPSA 3LKWA 2WUCA 3VPKA 2LNCA 2M5TA 1EAWA 1GI7B 1QL7A 2UWLA 2A4QA 1F0RA 5BPEA 1AUJA 1IQFA 1Y3VA 4XBDA 1C2LA 3SNCA 1SGQE 3TK6A 1FLEE 1YLDA 1FN8A 4QT8C 4TPIZ 5EW1H 5F6MA 4X1PU 2BY6X 2Z3DA 3BTHE 2ODPA 1OWKA 4GSOA 2ZWLH 1H4WA 3OU0A 3U1JB 4FUEA 1ELCA 4ZMAH 1GHBG 1OWDA 2SGAA 1ELAA 1YF4A 4A1VA 3MFJA 2VH6A 2FDAA 1C2HA 2F9BH 2ZG0H 3RU4T 5HMAA 2VGCB 2A4GA 2D8WA 3P8GA 2AGGX 1HV7A 4X2XA 5JYIA 2Z94A 2OBQA 1CE5A 1CHOG 1MMJN 3TH3H 3M7UA 1A4WH 1P03A 4DVAU 3KN2A 4O97A 3NWUA 1SB1H 3ITIA 3UREA 2PKSC 1QB1A 5JBBS 5ABWA 4KP0A 3RLWH 5L2YH 3K6YA 1ZJDA 3GCNA 1CVWH 2GTBA 1O3GA 1ZMNA 1KY9A 1MBMA 1ZPZA 2P3FH 8KME2 3S7KB 1P9SA 4OGXA 1LQEA 3GY3A 1C1OA 4ABDA 3M3VA 1C2FA 4ZKOU 2YNAA 1AMHA 1O2WA 3IWMA 1P01A 4PROA 1O2IA 3LDXH 3K9XB 1FXYA 2J94A 3T62A 1C5QA 2UUJB 4DT7B 1UCYE 3UPEA 2BVXH 1CQQA 1IQKA 5DPAA 1W2KH 3MOCA 1C5OH 4A92A 1QNJA 2ZNKH 1W10U 1F0TA 1O3KA 1SGFG 3UR6A 2PUXB 2QXHA 1XVOA 1E38B 3GY5A 3ZVFA 2RA0A 4DOQA 2FTMA 3MWIU 4ABGA 1A0LA 1BTWA 2YOLA 1PPCE 2F9UA 4FXGH 1IQNA 3TNSA 3CENA 1GDUA 1LCYA 1PQAA 2FI3E 2BD5A 1YBWA 4FVDA 2PW8H 2O8UA 1O5BB 2FOBA 1EATA 2XCFA 2ALPA 1HIAA 2GX4A 2SNVA 1UTPA 2ANKH 2VIQA 2ZA5A 2XC0A 3ZVCA 1C1MA 2BVRH 5I25A 2QF0A 1CU1A 1O2JA 1GBDA 5ESTE 2AMQA 4X8UH 3RXIA 4ABIA 3U8TH 4CRBA 1C4U2 4CBOA 2G5VA 3SNDA 4WH6A 5DK1A 3RXVA 1FY8E 3K65B 4NWLA 1TA2A 4B2CA 4TYDA 2ZFPH 5LPFA 5J4SA 2V3HH 3MO3A 1ACBE 2ZDNA 2R2MB 3QO6A 3QZQA 1GG6B 4XBCA 2HPPH 1O2UA 1FY3A 1KXEA 3SN8A 1S0RA 3DT0H 5FX5A 2QN5T 3F9GA 2ZU3A 3LONA 1BMNH 1O2MA 1YP9A 3UY9A 2PHBA 4KTCA 4AYYB 1OS8A 3VGCB 3PWCA 3MO9A 1EX3A 4GVUA 3B8JA 1WV7H 3KL6A 3QUMP 4INHA 1BUIA 3A8CA 4DURA 1VZQH 2BZ6H 2BD8A 1NFXA 1F2SE 5L6NH 2CF8H 4UFFH 4I32A 1YLCA 1NO9H 1P3CA 8GCHF 1GBEA 1O32A 3GY7A 1QRZA 4J1YA 1B7XB 1AVGH 2BDIA 1O3CA 3BIUH 1CGHA 4NA7A 3SO3A 3GCHC 3RMNH 3G01A 1AFQC 1RTKA 1F0SA 2CHAC 3GDSA 1FN6A 2JETC 5E0JA 4DG4A 3E8LA 1ANDA 3SZNA 1IHSH 5DP9A 3QX5H 1PPHE 3L3TA 1C5VA 3TJVA 4AB8A 1ORFA 1OXGA 5JBCS 3MH7A 4B76A 1GL1A 1EB2A 1GL0E 4K8BA 1NRSH 4ESTE 3E16B 5K7RA 1ZPCA 3ESTA 5EXNA 5HYOA 1N6XA 2ZKSA 9LPRA 1J9CH 1T8OA 1F5KU 1LKBA 4FUDA 1S83A 1GI9B 3Q3KA 3PYHA 2P3UB 1L1JA 4YLUA 4NZLA 1SGYE 4YT6H 2XC5A 4Z0KA 3VB3A 4NIYA 3S69A 3I78A 4ABEA 4MG3A 1JXPA 1DWDH 2NU4E 2DE8A 1G2MA 1EJMA 2W7UA 1AWFH 2FLRH 2FX4A 3RMLH 2ASUB 4D8NA 4F49A 3TVJB 1QCPA 1C5ZB 3N7OA 3TJUA 3UOPA 1JMOH 4A1TA 3HGNA 2FM2A 1PJPA 1AZ8A 3SUGA 3ZYDA 2ILNA 1HJAC 3UWIA 1SGFA 2ODYB 3SOSA 1GMHF 2ZZUH 1K9OE 3U98H 1E36B 1O35A 3UR9A 4GAWA 3C1KA 3KQDA 4RSPA 1SQAA 4MDSA 1WBGB 1CBWB 1KIGH 1TNLA 1HAHH 5FXLA 4Y7BA 2WPJS 4IN1A 2BM2A 3M3TA 1DWBH 2QC2A 2H1UA 1WSSH 4ISNA 4TWYA 1O3MA 1THSH 1KLJH 4CREA 1S82A 1IQEA 1BBRE 3DD2H 1ZOMA 3UQVA 1SC8U 2CGAA 1V3XA 1CT0E 1V2QT 1SL3A 2BLOA 1LTOA 1BJUA 1V6DA 2BDHA 4JYUH 4DY7B 1V2RT 3ZVEA 4GCHF 4BXSA 1J15A 1V2KT 2DE9A 1RS0A 3GOVB 4FUCA 3SGAE 2AMDA 5FHTA 1O2RA 3LGUA 1FIWA 1MUEB 1K2I1 1C1PA 1O3NA 2ZPQA 3MU5A 1B0EA 1PPZA 1Z8RA 1FI8A 1ZRKA 1AVXA 1GVLA 3SV7A 3M5NA 4MPVA 2ZU2A 3STJA 1A5IA 3I77A 2Q6FA 4A1XA 3EA7A 3SU0A 1KSNA 1ZJKA 4X0WU 5GWZA 3A81A 1ABIH 1K1JA 1VR1H 2ANWA 2R2WU 4KELA 3RXJA 3GISB 3F9HA 4Y0ZE 1V2NT 1GBFA 4JZEH 1O34A 3PTNA 3FAOA 2ZCLP 2B0FA 2VVCA 3GDUA 1AE5A 3BEIB 3GCTF 2QGRA 2THFB 4VGCB 1UK4A 1QJ6B 1O2LA 1NRRH 1CHGA 4E7RG 1N8OB 2BY7X 1D3QB 3NXPA 1TNJA 1O2KA 4ABBA 4ZUHA 3PROA 4Y7AA 3NKKA 2FI5E 3LGTA 1BMAA 1GHAF 4MLFB 2GT7A 3Q3YA 2GD4B 2G5NA 5C5OA 2AIQA 2FOAA 1GI3A 3HK3B 3SJOA 3L33A 2EI7A 3FP7E 3SI4H 4K1EA 1TE0A 2OBOA 2QCYA 3RU4D 1NRNH 1G3EA 3ATWA 4O9VA 2J34A 3SV8A 2PWXA 3LGIA 4ABHA 4UFGH 4GHTA 3RXPA 2FODA 1O2ZA 2GV7A 1P8VC 2ZGXH 1SGEE 4WWYA 2CMYA 3QZRA 1A3BH 1O3IA 3EE0B 2RCEA 2DUCA 1HBTH 2V6NA 2BY8X 3BG8A 1O3FA 2Z9GA 1KXDA 4Q7YA 1C2IA 3RC6A 1ARBA 1H9IE 3V3MA 1J14A 4CRDA 1GCTC 4Y11E 2PR3A 4A5TS 1MTWA 4B75A 2I6SA 1O2YA 4IMZA 1S81A 1DWCH 1O31A 1YPLH 2ODQA 1OP2A 1TLDA 1HIAB 5L30H 2B7DH 1YPHE 3PWBA 4TPYA 4Y76A 1TPAE 1AD8H 2TGTA 1UTKA 3HGPA 2PUQH 3M35A 1KLIH 2FPZA 1MAYA 1SGPE 1UO6A 2ZU5A 4NIVA 4RKOB 1IQIA 2GGVB 5EG4A 1ETRH 2NWNA 2Z9KA 2ZU1A 3U8OH 4ABFA 3ZZ3A 3C27B 1JIMA 2H9EH 1GI1A 1QQ4A 2VNTA 1WQVH 1QJ7B 4F4OC 4JK6A 4O3UA 5DP7A 1DS2E 2ZFTA 1A5HA 1ZTLA 4RKJB 1DY8A 2SGPE 1IQJA 5HM2A 3RXRA 3M7QA 2BZAA 1AFEH 1DVAH 3QN7A 3RXMA 3A84A 1P9UA 1NRQH 3GCTG 4IC6A 1XM1A 1MCVA 7KMEH 3ATIA 4X6NA 3A8DA 2BY9X 4CH8B 4UFDH 1EPTA 1SBWA 2PTNA 3GY4A 1ZSKA 2HNTC 1FMGA 4JMYA 4ZAEA 1A2CH 2UUYA 4I31A 1Z8GA 4YLQH 1RFNA 1GCDA 1GHAG 1HAIH 2OLGA 4GHQA 1WYKA 1AB9C 3MO6A 5L2ZH 1HXFH 1WOFA 2V3OH 1ELFA 3E0NB 4R0IA 1O33A 3H7TA 1V2ST 1CHOF 4DIHH 3M61U 1G30B 1V2TT 4B73A 2UUKB 3SQEE 1SQTA 1C4Y2 4Q80A 1DOJA 1AUTC 1GJ9B 2SFAA 1XUIA 2W26A 3U8RH 5FPTA 4BAHB 2K1QA 5FX6A 5T6GA 2Y82A 2BXTH 1MBQA 2A2XH 3MU4A 1HFDA 1CGIE 3VB5A 1WCZA 4ISIH 4LZ4B 9ESTA 1WAYB 1AKSA 1GJ5H 1DXWA 1BJVA 1J17T 2QAAA 3HKIB 1MTSA 4ZXXH 1KTTB 4XE4A 3SJIA 1HUTH 4ZH8A 3E3TA 4U01A 2OC8A 1BTXA 1W7GH 4K69A 2AH4X 2C90B 1GHVH 5IDKA 1TRMA 3TK9A 4X6PA 5T6DA 2ZGHA 4I8GA 1SGRE 1XMNB 1UTOA 1Y3WA 1Z1JA 1ELGA 1S84A 3TJNA 2VVVA 1V2LT 1BRBE 3SU4A 3PO1B 3A86A 4ISOA 1DWEH 1AHTH 1GJ4H 2J4IA 4IC5A 4YT7H 2OUAA 3SQHE 1HJ8A 3D62A 5SGAE 1OOKB 2A7HA 2ZTXA 1IQGA 1O30A 3KCGH 2D26C 2R0LA 1CO7E 3ATLA 1K21H 2P8OB 1UK2A 1D6WA 1BMMH 1ZMLA 4FU9A 4LOYH 1BTZA 3PMJA 2G00A 2ZECA 1TYNA 1P11E 3A8BA 2IJOB 2OTVA 1QBVH 3RDZA 1FV9A 3M3SA 3RXOA 4I7YH 5EQSA 3U69H 4I8JA 1GBAA 2ANMH 2Q6GA 1A1RA 2XCNA 1IHTH 2BX4A 3MNSA 1JOUB 3Q3XA 2BLVA 1SHYA 3RXCA 3LOXA 2C8YB 3P17H 5DKMA 1T4UH 1TQ0B 3ENSB 4HZHA 1Z71A 3TK5A 1MD8A 1V2MT 4ISHH 2GKVE 1JIRA 2F9NA 3M7TA 4NFEA 1SR5C 4Q2KA 2C93B 3AAUA 2ZDAH 1P05A 1TABE 3BTDE 2BDBA 1VGCC 2QXGA 2OP9A 2Y81A 1DX5M 2R9PA 3A7VA 1O39A 3SJ9A 1A61H 3F1SB 2GCTC 4WMEA 5FBIA 3ATKA 1P06A 2NU3E 6GCHG 3KQEA 1OWHA 2Z9JA 1C2MA 4FU7A 1PFXC 2ZTYA 4AFSA 5EPNA 1EUFA 1HLTH 2ZPRA 1ELDE 3MH4A 2A4OA 2H5DA 3OYPA 4OS4A 4AN7A 3NCLA 3TGJE 1XUFA 3SU5A 1O2VA 3TJOA 3ZYEA 2FZZA 2STAE 1QA7A 3MU0A 1TALA 1Q3XA 1XXFA 1QHRB 3SNBA 1OKXA 4XOJA 4YM9A 4LXBH 2GVFA 1SFQB 1TIOA 4O3TA 3RMOH 2XC4A 3P6ZB 4LK4A 3TGIE 1C2GA 1RGQA 1NU7B 3S0NA 1O5FH 1DUAA 2BDYA 5GCHG 1O2OA 3O8RA 1JBUH 1OWJA 1L0ZA 2ZGCA 4YZUA 5GXPA 1G32B 4YO9A 1O2GH 2CJIA 1BTUA 1C5XB 3A7YA 4IS5A 4HI3A 1C5TA 1EOJA 1AGJA 1YPMH 4H42U 1P2KA 2GZ7A 3AVZA 2BQWB 3VFEA 5FCKA 1YM0A 4Y6DA 2QIQA 1K22H 2BDGA 1J8AA 4ZROA 1LDTT 1GGDB 3D65E 3SJ8A 1VCWA 1AU8A 1C1NA 4IN2A 5A0BA 1TX8A 1P2NA 3RXGA 4D76A 2HNTF 1U6QA 2G51A 1Z1IA 4YTAA 4NIXA 5BRRE 3UQOA 2EEKA 1PPFE 1TBQH 3EA9A 2XBWA 1C5SA 2H5CA 1E34B 4FU8A 2UWOA 4OS7A 5AF9H 3D49H 1VITG 1EZQA 1O5EH 2CN0H 1DITH 1MU8B 2BOKA 5DP4A 1QB6A 1FDPA 1BTHH 1VCQA 2HALA 3P70B 1SGNE 3QGNB 4CRGA 1O2HA 5TJXA 1SFIA 1RTLA 1GI2A 5LPEA 1A5GH 4K5ZA 2B8OH 5FPSA 3P92A 1EPTB 2FOGA 1QIXB 1P57B 2RDLA 4FUGA 5DJ7A 5JB8S 3AW0A 1BTPA 1SLVB 1Y5AT 1ABJH 3MH6A 3BG4B 1P04A 1ETTH 4WJG2 5AFYH 5DP8A 4AGJA 2XWAA 3QGJA 1V2WT 1IAUA 2FYRA 3B9FH 1SLWB 1BQYA 2ZQ2A 1C1SA 1A0JA 1HXEH 3LC3A 1O5DH 4U32A 5CHAC 1QJ1B 4X2WA 5EOKA 5I46H 4A7IB 1FPHH 1F92A 2XBXA 1LVOA 4CHAB 2EI8A 3E6PH 1Q31A 2G81E 1ZTJA 4TY7A 2TGDA 4TWWA 1HAPH 1L1GA 1GI6A 2OC0A 3RXTA 1QGFA 1ZHRA 1G36A 2AEIH 2P16A 1NM6A 1Y8TA 5E2OA 2QYIA 3TPIZ 3GYLB 2SGDE 4HGCA 3SJKA 3E0PB 4BAOB 2BD7A 3SBKA 1IQLA 1RD3B 4NA8A 1AE8H 1AKSB 5T6FA 2ZHFH 2ANYA 2ZHEH 5B6OA 5ESBA 3ZZBA 1Z8IB 2A4RA 3MU8A 1K1IA 2SNWA 3GY2A 3M37A 1HCGA 5DP5A 3U1IB 1CA0B 2ZO3H 3BV9B 3SUFA 2H6MA 3P8OA 4BTUB 1LPGB 3LGYA 1TGSZ 1V2OT 1Y59T 3M5LA 2ZFQH 2VIOA 2A2QH 1XKAC 4D9RA 1INCA 3UWJH 1FONA 1QA0A 1ZR0A 3UTUH 4JK5A 2CXVA 2XTTB 2R3YA 1PYTD 1UVOA 3MU1A 2F9OA 5F8TA 4MNXA 1DLKB 4AORA 3RLYH 1MKXK 1E0FD 4CBNA 1XXDA 1GHYH 1ZSLA 2OXSA 4GLYA 1QBOA 3ODDA 1PQ7A 2ZEBA 1NPMA 1T31A 1LHFH 3F9FA 1CGJE 3FP6E 2VWOA 1MTNC 4NGAH 2EC9H 1O2NA 1RTFB 4K1SA 1P0SH 3URDA 1W11U 1K1OA 2WUBA 1TNGA 1GJ6A 2FIRH 1CT4E 1EAXA 2A1DB 3SU6A 1BITA 2Y7ZA 1DPOA 3EQ0H 2HRVA 3S9BA 5HXFA 1TFXA 3P95A 1C5UA 2F91A 4RN6A 4X1SU 2WPLS 1TGCA 1QRXA 3SNEA 1EJAA 5JPMH 3R0FA 4JYTA 3Q76A 4AG2A 1OWEA 4UONA 1T8LA 2Y5HA 3S7HB 5PTPA 1TB6H 4JZDH 1RRKA 3T25A 3T28A 1PQ8A 1Z7KA 1OWIA 3VXFH 2VJ1A 1Y3YA 2VWNA 1BZXE 4Y8XA 7LPRA 2WV4A 1QTFA 3BEFB 1EP6A 2BLWA 1SGDE 3U9AH 3BEUA 2BOHB 4JYVH 8LPRA 3RUOA 2BDCA 2BQ6B 2PKAA 5EGMA 1QY6A 2VGCC 5T3HA 2FI4E 3MH5A 3K6ZA 4K3JA 1TX6A 2JH0D 3D23A 1TQ7B 3EA8A 1QFKH 1A0HB 1RJXB 2QY0B 4I8HA 1P12E 1KXAA 3BTEE 1Y5UT 3ZZ4A 1THRH 5DG6A 3A87A 1GMCG 1SHHB 6CHAB 1ZZZA 1DFPA 1KTSB 1BMLA 1TA6A 1ELVA 2FESH 2WPHS 1SI5H 3MMGA 4UD9H 3RXDA 2A5AA 2SGEE 4M7GA 1BHXF 1A7SA 3RXSA 3KF2A 3HATH 2ULLA 5EPYA 1BRCE 3LGWA 1Q2WA 3RP2A 1AVWA 1C2DA 3SNAA 5C1YA 4CRFA 5DO4H 5EXMA 1GBBA 2QV1A 3CP7A 4O03A 3NK8A 5C3NA 4Y10E 1WTGH 2PFEA 2ZFSA 3GDVA 4I8KA 2STBE 2R0KA 5C67A 2WYGA 1C1TA 1V2PT 4BOHA 1H8DH 2PV9B 2TGAA 7GCHF 3V13A 2GCHG 2O8WA 2AMPA 3HKJB 1C4V2 1DDJA 3GY8A 2C8XB 2Y5FA 1SSXA 4FUIA 3LH1A 2UWPA 2HVXA 1FZZA 1HAOH 1HDTH 1GHWH 1NC6A 1D3TB 4K1TA 1Y3XA 3Q00A 1VJAU 2XBYA 1XUHA 1UCYK 3Q77A 1FUJA 1BB0B 2Z9IA 2D1JA 1N6YA 1DICA 1GVZA 1TBRH 1EZUC 1TPPA 4MQAA 3SHCH 4IGDA 1OX1A 1VCPA 3QTOH 3SU2A 3ZZ5A 2FOFA 1AO5A 1QL9A 3GCOA 1GI8B 1ESTA 3DFLA 4MPWA 3PM3A 1FY4A 3IG6B 4E05H 1UVPA 5H4IB 5AVDA 1AFQB 1EAIA 1GG6C 2CHAB 4ASHA 1G3BA 1TNKA 2JETB 2A0QB 2WPIS 1ZPBA 4FUJA 3FANA 3PMBB 4MNWA 1V2UT 1YPGH 1NS3A 5EW2H 2ZHDA 1C5LH 1DE7H 1FJSA 2PLXA 1G3CA 1GWAA 4MPXA 2XW9A 1SOZA 1O5GH 2VIVA 4DW2U 1P2QA 3AW1A 4Q7XA 2G4TA 3E90B 3VGCC 5CMXH 1L1NA 5JBTA 1NN6A 1IQMA 3RXQA 1GI0A 3A83A 3A7TA 1C1UH 3FFGA 2WINI 1KDQA 2F83A 2VH0A 4X2VA 1DSUA 1GHXH 1A3EH 2ZPSA 1TRNA 2WPKS 2Z3EA 3MNCA 1Z6EA 2JH5D 7ESTE 3MI4A 4OGYA 1NT1A 2C3SA 1HAYB 4X8VH 1GBLA 2VIPA 2F3CE 1O5CB 3QLPH 4XBBA 2WYJA 1MH0A 3TNTA 1LHDH 1OSSA 2FMJA 5C1UA 3W94A 1HJAB 2J92A 1LPZB 3FZZA 1HAXB 6GCHF 7GCHG 2ZF0H 2Y7XA 1EAUA 1NFWA 2B5TB 4X8SH 3PMHB 5GJ4B 2KAIA 3BIVH 3KNXA 3PLPA 4JZ1A 2TRMA 1NZQH 1YCPK 1DY9A 4AZ2B 1L2EA 1EQ9A 4X8TH 4MTBA 3BF6H 2EI6A 1JWTA 2IN2A 1QQUA 1DT2A 1OP0A 1XX9A 1LHCH 3SV6A 4MPUA 1KLTA 3A7ZA 3ELAH 5FCRA 2H9TH 2Z6BD 1O2PA 1HAVA 2NU2E 6LPRA 1NRPH 1EZSC 3LU9B 3M36A 2A5IA 4E7NA 4OS6A 1C1QA 3SI3H 1NFYA 5GCHF 3F6UH 3ZV8A 1GJDB 1O3BA 3RMMH 4D9QA 3UNRA 3E91A 1ZGVA 2OQUA 2GZ9A 2XWBI 2A32A 2AGEX 1H1BA 4AG1A 3RXUA 1W0ZU 1TNHA 1M9UA 2FLBH 1ANBA 4WMDA 5GIBA 3IITA 1UTNA 1UTQA 2FYQA 4AB9A 2VWMA 1WQSA 1KXBA 2YNBA 1RIWB 4WF8A 1CBWC 4NSYA 1XUGA 3MNBA 1TRYA 1ZMJA 4WH8A 5JB9S 1UJ1A 3ZV9A 5EU8A 1UTMA 1YKTA 4ZHAA 5EQQA 2RG3A 4AOQA 4Q7ZA 3R3GB 5J4QA 3M5OA 1T8NA 2AIPA 1SG8B 2W3IA 2C8ZB 4H4FA 3RU4E 3TGKE 1X7AC 2P94A 1T4VH 1PPGE 1XKBC 2PGQB 1QURH 1NY22 4AFQA 2IOTA 2QA9E 4D7GA 3ZZ9A 1AI8H 4TY6A 1YPEH 5DP3A 3SV9A 4OS2A 1GI5A 2CF9H 1SQOA 2O9QA 1O3OA 2FX6A 1O5AB 4XFQA 1YPJH 5EXLA 4AFUA 3ATMA 1SGCA 1QBNA 2W5EA 4FUHA 1VITF 2ZU4A 1XUKA 1MQ5A 3W95A 1AQ7A 2FOMB 3PLKA 4INLA 3TITA 1BBRK 2BXUH 4WXIA 4R8TB 1UHBA 1AZZA 4FUFA 2A5KA 4YOJA 3OY5U 1ANEA 2OCVB 5HM9A 3P8FA 1UVSH 2ZGJA 5FPYA 2H9HA 2J95A 2BTCE 2HGTH 1ANCA 2HNTE 1EOLA 4NIWA 5GDSH 1SGTA 5EQRA 2TPIZ 1EJNA 1TNIA 5C1XA 5C20A 4BANB 2HLCA 3OX7U 3FVFB 4CR9A 2FOEA 2PKAB 4XDEA 2G52A 5G4BA 1H8IH 3TH2H 1P3EA 3CS0A 3RXFA 5TCAA 1MZDA 1TWXB 1D3PB 1GPZA 1JRTA 3O8BA 4ABAA 4U2WA 1HAGE 1EB1H 3HPTB 1KXCA 4VGCC 3T29A 3RM2H 1NU9A 1N8OC 1TGNA 1GCTB 1GJ7B 1V2VT 1XUJA 3P8NA 1TMBH 1BIOA 3RXBA 1F7ZA 3A7XA 1HPGA 3H5CB 1LVMA 2F9PA 3LH3A 2BD9A 3BTKE 1KXFA 3PV4A 2ZDVH 3UNQA 1ESBA 1AN1E 4FUBA 3O8DA 1S85A 4U30A 5LPRA 1MAXA 1P09A 1SMFE 1P02A 3DA9B 3VB4A 4Y0YE 2XRCA 4AYVB 1GMDF 1BT7A 1GBHA 1PPEE 1MU6B 1W3CA 4ZHLU 2I6QA 3TIUA 1N1LA 3KGPA 6CHAC 4LZ1H 1UTJA 4FVBA 4MVNA 2A7JA 2GDEH 1MKXH 3ZVAA 2Q6DA 3ZZ7A 3A8AA 3LGVA 2XNIA 2J38A 1QL8A 4I33A 2GT8A 4BAKB 5LH8A 2GMTB 4YOIA 1G3DA 2ZGBH 1HGTH 1ELEE 1T8MA 3F9EA 3LIWA 5FAHA 4AGKA 1GJBB 1NTPA 1VITH 1YYY1 1MZAA 4ABJA 1O2QA 2VWLA 1LQDB 2Y5GA 1SLUB 1FIZA 2FS8A 4UEHH 4NCYA 1ELBA 4ZXYH 1O3LA 3SV2H 1B0FA 2ZFFH 4Y71A 1K28D 2CV3A 3KQCA 3ZZDA 3SORA 2VVUA 3WY8A 2ZDKA 1EP5A 1MTUA 1TPOA 3QTVH 4XSKU 1C5RA 2OQ5A 4KTUA 3ZVDA 2ZCHP 3SUEA 1Z6JH 1TONA 5F8XA 1ZHMA 1AB9B 1ARCA 3NUMA 2AYWA 1UMAH 4B1TA 4HFPB 1LPKB 3TH4H 3K2UA 2J2UA 4UE7H 2VIWA 1TMTH 2HOBA 1O37A 1GJ8B 2ZP0H 4B2AA 5A8XA 1O2TA 2FWWA 4WMFA 1EZXC 1BRUP 1W14U 1B5GH 2BD2A 1E37B 4WXVA 1ID5H 4IMQA 2BLQA 4NG9H 2LPRA 5LGOA 3UNSA 3QWCH 3VB6A 1LVBA 2GV6A 1C5MD 4BTTB 1YC0A 2C8WB 1A46H 1UVUH 1P2IA 1FY5A 4YOGA 1OYQA 4CH2B 1O0DH 3V12A 1C5PA 1KDQB 1FAXA 4YESB 4B2BA 1O3DA 1Y3UA 4BNRA 1FQ3A 1SOTA 2Y80A 2A7CA 2BX3A 1C1VH 1D6RA 1GMDG 4X1QU 1ZRBA 2R3UA 8ESTE 4INKA 4GPGA 2ESTE 3VXEH 2BVSH 1SLXB 1ZHPA 3SGQE 3BTQE 1BTYA 2FP7B 1ZTKA 4KKDA 3DFJA 2GP9B 1P2JA 5JBAS 1GBMA 1GMCF 4E06H 2XYAA 2KAIB 3RXLA 1TAWA 4BTIB 1GJAB 1YPHC 3LC5A 2ALVA 2ZQ1A 1LHGH 3A89A 5E8EH 5JDUB 2P59A 1O2XA 2OINA 1O38A 1UCYH 1GBCA 1GJCB 2A31A 3RC5A 2BB4A 4BAQB 1GBJA 3E1XB 1UTLM 1DSTA 1H9HE 2FTLE 2QF3A 1HAVB 1O3JA 2GZ8A 2TGPZ 3V0XA 2GCHF 1ELTA 1HAZB 5A0AE 4ZHMU 4ZKSU 3A82A 3S9CA 4H6SB 3RXHA 5EODA 3BTWE 1LKAA 4IW4E 3UUZA 2QXJA 5C2ZA 1C9PA 3LT3A 1W0YH 2UUFB 1P2OA 1HNEE 2J9NA 2FO9A 3ODFA 4OS1A 2SGQE 4SGBE 4WVPE 1LHEH 5E2PA 3PB1E 2RA3A 5TCCA 3PO1C 5K0HA 3RM0H 3GICB 2PKSB 3EAJA 2A45B 2NU0E 4X6MA 4AX9H 1JRSA 1THPB 1D4PB 5GPIB 3O8CA 3KIDU 2BMGB 1TOMH 3SGBE 5F03A 2W3KA 8GCHG 2P95A 1V2JT 5F8ZA 3BSQA 1VGCB 1HYLA 3ZVBA 1MD7A 2OC7A 2Z7FE 1FY1A 5A8ZA 1BOQA 1C5WB 3A88A 2EA3A
chains in the Genus database with same CATH superfamily
2P8OC 2V0BA 3SW2B 1NESE 5GNDA 4DCDA 2AGIX 1RIWC 1C5YB 3EE7A 1PYTC 2GCTB 3TU7H 1YGCH 2ZFRH 1NROH 4KGAA 2Z3CA 2OD3B 1ESAA 3FKSD 1MKWH 2ZDMA 4X1NU 3T2NA 2HWLB 1BA8B 2BY5X 2SGFE 4UFEH 3KQBA 2PTCE 3AAVA 1NBMD 2WPMS 3QK1A 2B9LA 3BTFE 2FXRA 3EGKH 2OK5A 2K0QA 2XXLA 2PSXA 1S6HA 1Z8JB 2HPQH 3A7WA 5CE1A 1TPSA 2OC1A 3SU1A 3ZZAA 2G4UA 4OS5A 4WY3A 1GBKA 4DIIH 1UHBB 2J98B 3KHVA 3ZZCA 1TBZH 2ZCKP 3ZZ8A 1KYNA 2GDDA 1ZGIA 1DXPA 1AWHB 1SGIB 3UOUA 1S6FA 2ZI2H 3DHKH 1YCPH 3KYGA 1PPBH 3F68H 1H9LB 2BD3A 1IOEA 5HGGA 1GDQA 5A09A 4K60A 3LJOA 1EXFA 3MTYA 3LPRA 1P2MA 2BDAA 3URCA 1L4ZA 4I8LA 1EKBB 1GMHG 1O3PB 4Y79A 3T26A 3MHWU 4HTCH 1C9TA 1BHXB 2FEQH 3BTTE 3UFAA 2D2DA 2P93A 3A80A 2Y6TA 1C2JA 1TMUH 2O8TA 4JZFH 2O8LA 1SVPA 1O2SA 1NFUA 2IPHA 1T7CA 1VKYA 3DUXH 3OY6U 1S0QA 1GI4A 3GY6A 3EYDA 4X2YA 4A6LA 1SPJA 4K8YA 1BCUH 2ZTZA 3CS7A 3H09A 3RXAA 4Y8ZA 2W7SA 1O3EA 1Y5BT 2BYAX 1LMWB 1UK3A 3MNXA 1MABB 3A85A 2F9VA 1VJ9U 3B23B 1WTHD 4Y8YA 1RXPA 4GCHG 1K1LA 4D7FA 1P10A 2VU8E 3RC4A 4H6TA 3SHAH 3STIA 1MTVA 4CR5A 1ZSJA 3EDXB 2G55A 2EQNA 2JDID 4UDWH 4DGJA 2QXIA 3BN9A 2C4FH 1WU1A 5E0HA 1LVYA 1C2KA 3T27A 1IQHA 2BD4A 1ZYOA 1CT2E 3PMAB 5DGJA 1YCPM 1HB0B 1G37A 4OM9A 5A8YA 1HRTH 2NU1E 3I29A 3H7OA 4MNVA 2PSYA 1D3DB 3GCHB 3TLOA 3HK6B 3SU3A 3SUDA 3T5FH 2GMTC 4JCNA 3PLBA 1OPHB 1F5RA 1W12U 1GGDC 5IYTA 1GHZA 2Z9LA 1W8BH 1UVTH 4AFZA 6ESTA 2Q1JA 1CA8B 1OYTH 3RXKA 4J2YB 3F0OA 2FOHA 1BBRH 1ZLRA 3OTJE 2TBSA 1AY6H 4Z6AH 2G8TA 1L4DA 2PGBB 3AASA 1DLEA 3L6PA 1E1QD 3PV5A 1QB9A 1PQ5A 1TOCB 1K1NA 2KFWA 3QDZB 5FBEA 5CHAB 3VB7A 3OSYA 3NZIA 1ETSH 3JZ1B 4DJZB 3BTGE 1S5SA 1GHBF 2ZHQH 1MKWK 5DP6A 1E35B 4BXWA 2VB0A 3KEEA 4RI0A 1EASA 2AFQB 1YPKH 2QF4A 4ZKRU 4X1RU 1FNIA 3GYMA 1K1MA 3MYWA 1OP8A 2FOCA 5KEDA 1G2LA 1C1WH 3FP8E 1GBIA 2V35A 4KTSA 1QR3E 4B71A 1MCTA 1O3HA 4NA9H 5AHGH 1EPTC 3F3BA 3M5MA 1FPCH 1C2EA 4ISLA 4K2YA 4JZIA 4THNH 1DANH 1TGBA 2KCPA 4SGAE 1DM4B 2ZC9H 1TGTA 2AS9A 4B74A 1QRWA 3BG4C 5F53A 1FAKH 2BHGA 4CRAA 1W7XH 5E0GA 4NZQA 1D9IA 1G9IE 4NSVA 2TIOA 1GDNA 1AIXH 3ZZ6A 3UIRA 2ZDLA 1C1RA 4IBLH 5AFZH 3RXEA 4CRCA 5A0CA 1J16A 2H2ZA 1TX7A 1HJ9A 3OTPA 2AERH 1F5LA 4CHAC 1GBTA 3MQKC 3LJJA 3S9AA 2BQ7B 2JH6D 4TSFD 1XVMA 2V7QD 2VINA 2P3TB 4MNYA 4NWKA 5EJZA 2O8MA 1BRAA 1T32A 5C5NA 1GVKB 2JKHA 1W13U 1WUNH 4NFFA 1MTNB 2QF5A 1C5NH 3BTME 3ZVGA 1F0UA 1YWUA 4ZKNU 1DUEA 4X6OA 1O3AA 2WV5A 2ZIQH 2FS9A 2VIDA 5A2MH 1MQ6A 1O36A 3VEQB 1CSOE 2ZHWH 3WW7A 4GUXA 1K1PA 2XBVA 1LO6A 3FO8D 5ETXA 3V7TA 4BAMB 1CA0C 3FZDA 3JZ2B 3PTBA 1BDAA 3NPSA 3LKWA 3ZIAD 2WUCA 3VPKA 2LNCA 2M5TA 1EAWA 1GI7B 1QL7A 2UWLA 2A4QA 1F0RA 5BPEA 1AUJA 1IQFA 1Y3VA 4XBDA 1C2LA 3SNCA 1SGQE 3TK6A 1FLEE 1YLDA 1FN8A 4QT8C 4TPIZ 5EW1H 5F6MA 4X1PU 2BY6X 4P02A 2Z3DA 3BTHE 2ODPA 1OWKA 4GSOA 2ZWLH 1H4WA 3OU0A 3U1JB 4FUEA 1ELCA 4ZMAH 1GHBG 1OWDA 2SGAA 1ELAA 1YF4A 4A1VA 3MFJA 2VH6A 2FDAA 1C2HA 2XNDD 5C17A 2F9BH 2ZG0H 3RU4T 2LELA 5HMAA 2VGCB 2A4GA 2D8WA 2QE7D 3P8GA 2AGGX 1HV7A 4X2XA 5JYIA 2Z94A 2OBQA 1CE5A 1CHOG 1MMJN 3TH3H 3M7UA 1A4WH 1P03A 4DVAU 3KN2A 4O97A 3NWUA 1SB1H 3ITIA 3UREA 2PKSC 4TT3D 1QB1A 5JBBS 5ABWA 4KP0A 3RLWH 5L2YH 3K6YA 1ZJDA 3GCNA 1CVWH 2GTBA 1O3GA 3F2FA 1ZMNA 1KY9A 1MBMA 1ZPZA 2P3FH 2HVYB 8KME2 2M2AA 3S7KB 4Z1MD 1P9SA 4OGXA 1LQEA 3GY3A 1C1OA 4ABDA 3M3VA 1C2FA 4ZKOU 2YNAA 1AMHA 1O2WA 3IWMA 1P01A 4PROA 1O2IA 3LDXH 3K9XB 1FXYA 2J94A 3T62A 1C5QA 2UUJB 3SZEA 1UCYE 4DT7B 3UPEA 2BVXH 1CQQA 1IQKA 5DPAA 1W2KH 3MOCA 1C5OH 4A92A 1QNJA 2ZNKH 1W10U 1F0TA 1O3KA 1SGFG 3UR6A 2PUXB 2QXHA 1XVOA 1E38B 3GY5A 3ZVFA 2PP6A 2RA0A 3SYJA 4DOQA 2FTMA 3MWIU 4ABGA 1A0LA 1BTWA 2YOLA 1PPCE 2F9UA 4FXGH 5C0UA 1IQNA 3TNSA 3CENA 1GDUA 1LCYA 2FI3E 1PQAA 2BD5A 1YBWA 4FVDA 2PW8H 2O8UA 1O5BB 2FOBA 1EATA 2XCFA 2ALPA 1HIAA 2GX4A 2SNVA 1UTPA 2ANKH 2VIQA 2ZA5A 2XC0A 3ZVCA 1C1MA 2BVRH 5I25A 2QF0A 1CU1A 1O2JA 1GBDA 5ESTE 2AMQA 4X8UH 3RXIA 4ABIA 3U8TH 4CRBA 1C4U2 4CBOA 2G5VA 3SNDA 4WH6A 5DK1A 3RXVA 1FY8E 3K65B 4Q4LA 4NWLA 1H8HD 1TA2A 4B2CA 4TYDA 2ZFPH 5LPFA 5J4SA 2V3HH 3MO3A 1ACBE 2ZDNA 2R2MB 3QO6A 3QZQA 1GG6B 4XBCA 2HPPH 1O2UA 1FY3A 1KXEA 3SN8A 1S0RA 3DT0H 5FX5A 2QN5T 1UW7A 3F9GA 2ZU3A 1SKYE 3LONA 4ACBA 1BMNH 1O2MA 1YP9A 3UY9A 2PHBA 4KTCA 4AYYB 1OS8A 3VGCB 3PWCA 3MO9A 1EX3A 4GVUA 3B8JA 1WV7H 3KL6A 3QUMP 1FX0B 4INHA 1BUIA 3A8CA 4DURA 1VZQH 2BZ6H 2BD8A 1NFXA 1F2SE 5L6NH 2CF8H 4UFFH 4I32A 1YLCA 1NO9H 1P3CA 3DSGA 8GCHF 1GBEA 1O32A 3GY7A 1QRZA 4J1YA 1B7XB 1AVGH 2BDIA 1O3CA 3BIUH 1CGHA 4NA7A 3SO3A 3GCHC 3RMNH 3G01A 1AFQC 1RTKA 1F0SA 2CHAC 3GDSA 1FN6A 3OFND 2JETC 5E0JA 4DG4A 3E8LA 1ANDA 3SZNA 1IHSH 5DP9A 3QX5H 1PPHE 3L3TA 1C5VA 3TJVA 4AB8A 1ORFA 1OXGA 1W0JD 5JBCS 3MH7A 4B76A 1GL1A 4P00A 1EB2A 1GL0E 4K8BA 1NRSH 4ESTE 3E16B 5K7RA 1ZPCA 3ESTA 5EXNA 5HYOA 1N6XA 2ZKSA 9LPRA 1J9CH 1T8OA 1F5KU 1LKBA 4FUDA 1S83A 1GI9B 3Q3KA 3PYHA 2WZQA 3WWFA 2P3UB 1L1JA 4YLUA 4NZLA 1SGYE 4YT6H 2XC5A 4Z0KA 3VB3A 4NIYA 3S69A 3I78A 4ABEA 4MG3A 1JXPA 1DWDH 2NU4E 2DE8A 1G2MA 1EJMA 2W7UA 4F48B 1AWFH 2FLRH 2FX4A 3RMLH 2ASUB 4D8NA 4F49A 3TVJB 1QCPA 1C5ZB 3N7OA 3TJUA 3UOPA 1JMOH 3KYFA 3HGNA 4A1TA 2FM2A 1PJPA 1AZ8A 3SUGA 3ZYDA 2ILNA 1HJAC 3UWIA 1SGFA 2ODYB 3SOSA 1GMHF 2ZZUH 1K9OE 3PRDA 1E36B 3U98H 1O35A 3CNRA 3UR9A 4GAWA 3C1KA 3KQDA 4RSPA 1SQAA 4MDSA 1WBGB 1CBWB 1KIGH 1TNLA 1HAHH 5FXLA 4Y7BA 2WPJS 4IN1A 3OE7D 2BM2A 3M3TA 1DWBH 3OAAD 2QC2A 2H1UA 1WSSH 4ISNA 4TWYA 1O3MA 1THSH 1KLJH 4CREA 5EJLA 1S82A 1IQEA 1BBRE 3DD2H 1ZOMA 5EJ1A 3UQVA 5DSFA 1SC8U 2CGAA 1V3XA 1CT0E 1V2QT 1SL3A 2BLOA 1LTOA 1BJUA 1V6DA 2BDHA 4JYUH 4DY7B 1V2RT 3ZVEA 4GCHF 4BXSA 1J15A 1V2KT 2DE9A 1RS0A 3GOVB 4FUCA 3SGAE 2AMDA 5FHTA 1O2RA 3LGUA 1FIWA 1MUEB 1K2I1 1C1PA 1O3NA 2ZPQA 4ZCNA 3MU5A 4FETA 1B0EA 1PPZA 1Z8RA 1FI8A 1ZRKA 1AVXA 1GVLA 2RDEA 3SV7A 3M5NA 4MPVA 2ZU2A 3STJA 1A5IA 3I77A 2Q6FA 4A1XA 3EA7A 3SU0A 1KSNA 1ZJKA 4X0WU 5GWZA 3A81A 1ABIH 1K1JA 1VR1H 2ANWA 2R2WU 4KELA 3RXJA 3GISB 3F9HA 4Y0ZE 1V2NT 1GBFA 4YXWD 4JZEH 1O34A 3PTNA 3FAOA 3KQ5A 2ZCLP 2B0FA 2VVCA 3GDUA 1AE5A 3BEIB 3GCTF 2QGRA 2THFB 4VGCB 1UK4A 1QJ6B 1O2LA 1NRRH 1CHGA 4E7RG 1N8OB 2BY7X 1D3QB 3NXPA 1TNJA 1O2KA 4ABBA 4ZUHA 3PROA 4Y7AA 3NKKA 2FI5E 3LGTA 1BMAA 1GHAF 4MLFB 2GT7A 3Q3YA 2GD4B 2G5NA 5C5OA 2AIQA 2FOAA 1GI3A 3HK3B 3SJOA 3DCLA 1H8ED 2EI7A 3L33A 3FP7E 3SI4H 4K1EA 1YY3A 3FOAA 1TE0A 2OBOA 2QCYA 3RU4D 1NRNH 1G3EA 3ATWA 4O9VA 2J34A 3SV8A 2PWXA 3LGIA 3N99A 4UFGH 4ABHA 4GHTA 3RXPA 2FODA 1O2ZA 2GV7A 1P8VC 2ZGXH 1SGEE 4WWYA 2CMYA 3QZRA 1A3BH 1O3IA 3EE0B 2RCEA 2DUCA 1HBTH 2V6NA 2BY8X 3BG8A 1O3FA 2Z9GA 1KXDA 4Q7YA 1C2IA 3RC6A 1ARBA 1H9IE 3V3MA 1J14A 4CRDA 1GCTC 4Y11E 2PR3A 4A5TS 1MTWA 4B75A 2I6SA 1O2YA 4IMZA 1S81A 1DWCH 1O31A 1YPLH 2ODQA 1OP2A 1TLDA 1HIAB 5L30H 2B7DH 1YPHE 3PWBA 4TPYA 4Y76A 1TPAE 1AD8H 2TGTA 1UTKA 3HGPA 2PUQH 3M35A 1KLIH 2FPZA 1MAYA 1SGPE 1UO6A 2W6ID 2ZU5A 4NIVA 4RKOB 1IQIA 2GGVB 5EG4A 1ETRH 2NWNA 2Z9KA 2ZU1A 3U8OH 4ABFA 3ZZ3A 3C27B 1JIMA 2H9EH 1W0KD 1GI1A 1QQ4A 2VNTA 1WQVH 1QJ7B 4F4OC 4JK6A 4O3UA 5DP7A 1DS2E 2ZFTA 1A5HA 1ZTLA 4RKJB 1DY8A 2SGPE 1IQJA 5HM2A 3RXRA 3M7QA 2BZAA 3VG8A 1AFEH 1DVAH 3QN7A 3RXMA 3A84A 1P9UA 1NRQH 3GCTG 4IC6A 1XM1A 5CHBA 1MCVA 7KMEH 3ATIA 4X6NA 2KM0A 3A8DA 2BY9X 4CH8B 4UFDH 1EPTA 1SBWA 2PTNA 3GY4A 1ZSKA 2HNTC 1FMGA 4JMYA 4ZAEA 1E1RD 1A2CH 2UUYA 4I31A 1Z8GA 4YLQH 1RFNA 1GCDA 1GHAG 1HAIH 2OLGA 4GHQA 1WYKA 1AB9C 3MO6A 5L2ZH 1HXFH 1WOFA 2V3OH 1ELFA 3E0NB 4R0IA 1O33A 1SQRA 3H7TA 1V2ST 1CHOF 4DIHH 3M61U 1G30B 1V2TT 4B73A 2UUKB 3SQEE 1SQTA 1C4Y2 4Q80A 1DOJA 1AUTC 1GJ9B 2SFAA 1XUIA 2W26A 4I86A 3U8RH 5FPTA 4BAHB 2K1QA 5FX6A 5T6GA 2Y82A 2BXTH 1MBQA 2A2XH 3MU4A 1HFDA 1CGIE 3VB5A 1WCZA 4ISIH 4LZ4B 9ESTA 1WAYB 1AKSA 5DN6D 2V3MA 2IPQX 1GJ5H 1BJVA 1J17T 2QAAA 3HKIB 5IK2D 1DXWA 1MTSA 5EIYA 4ZXXH 1KTTB 4XE4A 3SJIA 1HUTH 4ZH8A 3E3TA 4U01A 2OC8A 1BTXA 1W7GH 4K69A 1WDIA 2AH4X 2C90B 1GHVH 2YMSD 5IDKA 1TRMA 3TK9A 4X6PA 5T6DA 2ZGHA 4I8GA 1SGRE 1XMNB 1UTOA 1Y3WA 1Z1JA 1ELGA 1S84A 3TJNA 2VVVA 1V2LT 1BRBE 3SU4A 2KCYA 3PO1B 3A86A 4ISOA 1DWEH 1AHTH 1GJ4H 2J4IA 4IC5A 4YT7H 2OUAA 3SQHE 3F2GA 1HJ8A 3D62A 5SGAE 1OOKB 2A7HA 2ZTXA 1IQGA 1O30A 3KCGH 2D26C 2R0LA 1CO7E 3ATLA 1K21H 2P8OB 1UK2A 1D6WA 5T1VA 1BMMH 1ZMLA 4FU9A 4LOYH 1BTZA 3PMJA 2G00A 2ZECA 1TYNA 1P11E 1QZ8A 3A8BA 2IJOB 2OTVA 1QBVH 3RDZA 1FV9A 2YMSC 3M3SA 3RXOA 4I7YH 5EQSA 3U69H 4I8JA 1GBAA 2ANMH 2Q6GA 1A1RA 2XCNA 5KECA 1IHTH 1E79D 4XD7D 2BX4A 3MNSA 1JOUB 3Q3XA 2BLVA 1SHYA 3RXCA 3LOXA 2C8YB 3P17H 5DKMA 1T4UH 1TQ0B 3ENSB 4HZHA 1Z71A 3TK5A 1MD8A 1V2MT 4ISHH 2GKVE 1JIRA 2F9NA 3M7TA 4NFEA 3W1EA 1SR5C 4Q2KA 2C93B 3AAUA 3DSOA 2ZDAH 1P05A 1TABE 3BTDE 2BDBA 1VGCC 2QXGA 2OP9A 2Y81A 1DX5M 2R9PA 3A7VA 1O39A 3SJ9A 1A61H 3F1SB 2GCTC 4WMEA 5FBIA 3ATKA 1P06A 2JIZD 2NU3E 6GCHG 3KQEA 1OWHA 2Z9JA 1C2MA 4FU7A 1PFXC 2ZTYA 4AFSA 5EPNA 1EUFA 5CDFE 1HLTH 2ZPRA 3NRLA 1ELDE 3MH4A 2A4OA 2H5DA 3OYPA 4OS4A 4AN7A 3NCLA 3TGJE 1XUFA 3SU5A 1O2VA 3TJOA 3ZYEA 2FZZA 2STAE 1QA7A 3MU0A 1TALA 1Q3XA 1XXFA 2HLDD 1QHRB 3SNBA 1OKXA 4XOJA 4YM9A 4LXBH 2GVFA 1SFQB 1TIOA 4O3TA 3RMOH 2XC4A 3P6ZB 4LK4A 3TGIE 1C2GA 1RGQA 1NU7B 3S0NA 1O5FH 1DUAA 2BDYA 5GCHG 1O2OA 3O8RA 1JBUH 1OWJA 1L0ZA 2ZGCA 4YZUA 3N7EA 5GXPA 1G32B 4YO9A 1O2GH 2CJIA 1BTUA 1C5XB 3A7YA 4IS5A 4HI3A 1C5TA 1EOJA 1AGJA 1YPMH 4H42U 1P2KA 2GZ7A 2KCAA 3AVZA 2BQWB 3VFEA 5FCKA 1YM0A 4Y6DA 2QIQA 1K22H 2BDGA 2JJ1D 1J8AA 4ZROA 1LDTT 1GGDB 3D65E 3SJ8A 1VCWA 1AU8A 1C1NA 4IN2A 5A0BA 1TX8A 1P2NA 3RXGA 4D76A 2HNTF 1U6QA 2G51A 1Z1IA 4YTAA 4NIXA 5BRRE 3UQOA 2EEKA 1PPFE 1TBQH 3EA9A 2XBWA 1C5SA 2H5CA 1E34B 4FU8A 2UWOA 4OS7A 5AF9H 3D49H 1VITG 1EZQA 1O5EH 2CN0H 1DITH 1MU8B 2BOKA 5DP4A 1QB6A 1FDPA 1BTHH 1VCQA 2HALA 3P70B 1SGNE 3QGNB 4CRGA 1O2HA 5TJXA 1SFIA 1RTLA 1GI2A 5LPEA 1A5GH 4K5ZA 2B8OH 5FPSA 3P92A 1EPTB 2FOGA 1QIXB 1P57B 2RDLA 4FUGA 5DJ7A 5JB8S 3AW0A 1BTPA 1SLVB 1Y5AT 1ABJH 3MH6A 3BG4B 1P04A 1ETTH 4WJG2 5AFYH 5DP8A 4AGJA 2XWAA 3QGJA 1V2WT 1IAUA 2FYRA 3B9FH 1SLWB 1BQYA 2ZQ2A 1C1SA 1A0JA 1HXEH 3LC3A 1O5DH 2KZ4A 4U32A 5CHAC 1QJ1B 4X2WA 5EOKA 5I46H 4A7IB 1FPHH 1F92A 2XBXA 1LVOA 4CHAB 2EI8A 3E6PH 1Q31A 2G81E 1ZTJA 4TY7A 2TGDA 4TWWA 1HAPH 1L1GA 1GI6A 2OC0A 3RXTA 1QGFA 1ZHRA 1G36A 2AEIH 2WSSD 2P16A 4ACAA 1NM6A 1Y8TA 5E2OA 2QYIA 3TPIZ 3GYLB 2SGDE 4HGCA 3SJKA 3E0PB 4BAOB 2BD7A 3SBKA 1IQLA 1RD3B 4NA8A 1AE8H 1AKSB 5T6FA 2ZHFH 2ANYA 2ZHEH 5B6OA 5ESBA 3ZZBA 1Z8IB 2A4RA 3MU8A 1K1IA 2SNWA 3GY2A 3M37A 1HCGA 5DP5A 3U1IB 1CA0B 2ZO3H 3BV9B 3SUFA 2H6MA 3P8OA 4BTUB 1LPGB 3LGYA 1TGSZ 1V2OT 2AHME 1Y59T 3M5LA 2ZFQH 2VIOA 5B6LA 2A2QH 1XKAC 4D9RA 1INCA 3UWJH 1FONA 1QA0A 1ZR0A 3UTUH 4JK5A 2CXVA 2XTTB 2WPDD 2R3YA 1PYTD 1UVOA 3MU1A 2F9OA 5F8TA 4MNXA 1DLKB 4AORA 3RLYH 1MKXK 1E0FD 3UAIC 1XXDA 4CBNA 1GHYH 1ZSLA 2OXSA 4GLYA 1QBOA 3ODDA 1PQ7A 2ZEBA 1NPMA 1T31A 1LHFH 3F9FA 1CGJE 3FP6E 2VWOA 1MTNC 4NGAH 2EC9H 1O2NA 1RTFB 4K1SA 1P0SH 3URDA 1W11U 1K1OA 2WUBA 1TNGA 1GJ6A 2FIRH 1CT4E 1EAXA 2A1DB 3SU6A 1BITA 3PRBA 2Y7ZA 1DPOA 3EQ0H 2HRVA 3S9BA 5HXFA 1TFXA 3P95A 1C5UA 2F91A 4RN6A 1YLNA 4X1SU 2WPLS 1TGCA 3OEHD 1QRXA 3SNEA 1EJAA 5JPMH 3R0FA 4JYTA 3Q76A 4AG2A 1OWEA 4UONA 1T8LA 2Y5HA 3S7HB 5PTPA 1TB6H 4JZDH 1RRKA 3T25A 3T28A 1PQ8A 1Z7KA 1OWIA 5C0TA 3VXFH 2VJ1A 1Y3YA 2VWNA 3AK5A 1BZXE 4Y8XA 7LPRA 2WV4A 1QTFA 3BEFB 1EP6A 2BLWA 1SGDE 3U9AH 3BEUA 2BOHB 4JYVH 8LPRA 3RUOA 2BDCA 2BQ6B 2PKAA 5EGMA 1QY6A 2VGCC 5T3HA 2FI4E 3MH5A 3K6ZA 4K3JA 1TX6A 2JH0D 3D23A 1TQ7B 3EA8A 1QFKH 1A0HB 1RJXB 2QY0B 4I8HA 1P12E 1KXAA 3BTEE 1Y5UT 3ZZ4A 1THRH 5DG6A 3A87A 1GMCG 1SHHB 2WHXA 6CHAB 1ZZZA 1DFPA 1KTSB 1BMLA 1TA6A 1ELVA 2FESH 2WPHS 1SI5H 3MMGA 4UD9H 3RXDA 2A5AA 2SGEE 4M7GA 1BHXF 1A7SA 3RXSA 3KF2A 3HATH 2ULLA 5EPYA 1BRCE 3LGWA 1Q2WA 3RP2A 1AVWA 1C2DA 3SNAA 2EY4C 5C1YA 4CRFA 5DO4H 5EXMA 1GBBA 2QV1A 3CP7A 4O03A 3NK8A 5C3NA 4DT4A 4Y10E 1WTGH 2PFEA 2ZFSA 3GDVA 4I8KA 2STBE 2R0KA 5C67A 2WYGA 1C1TA 1V2PT 4BOHA 1H8DH 2PV9B 2TGAA 7GCHF 3V13A 2GCHG 2O8WA 2AMPA 3HKJB 1C4V2 1DDJA 2KX4A 3GY8A 2C8XB 2Y5FA 1SSXA 4FUIA 3LH1A 2UWPA 2HVXA 1FZZA 1HAOH 1HDTH 1GHWH 3N7DA 1NC6A 1D3TB 4K1TA 1Y3XA 4Q63A 3Q00A 1VJAU 2XBYA 1XUHA 1UCYK 3Q77A 1FUJA 1BB0B 2Z9IA 2D1JA 1N6YA 1DICA 1GVZA 1TBRH 1EZUC 1TPPA 4MQAA 3SHCH 4IGDA 2GJGA 1OX1A 1VCPA 3QTOH 4HG6A 4FOUC 3SU2A 2FOFA 3ZZ5A 1AO5A 1QL9A 3GCOA 1GI8B 5FL7D 1ESTA 3DFLA 4MPWA 3PM3A 1FY4A 3IG6B 4E05H 1UVPA 5H4IB 5AVDA 1AFQB 2KCOA 1EAIA 1GG6C 2CHAB 4ASHA 1G3BA 1TNKA 2JETB 2A0QB 2WPIS 1ZPBA 4FUJA 3FANA 3PMBB 4MNWA 3F0PA 2L74A 1V2UT 1YPGH 1NS3A 5EW2H 2ZHDA 5C94A 1C5LH 1DE7H 1FJSA 2PLXA 1K0HA 1G3CA 1GWAA 4MPXA 2XW9A 1SOZA 1O5GH 2VIVA 4DW2U 1P2QA 3AW1A 4Q7XA 2G4TA 3E90B 3VGCC 5CMXH 1L1NA 5JBTA 3GS9A 1NN6A 1IQMA 3RXQA 1GI0A 3A83A 3A7TA 1C1UH 2XOKD 3FFGA 2WINI 1KDQA 2F83A 2VH0A 4X2VA 1DSUA 1GHXH 1A3EH 2ZPSA 1TRNA 2WPKS 2Z3EA 3MNCA 1Z6EA 2JH5D 3U28C 7ESTE 3MI4A 4OGYA 2KR7A 1NT1A 2C3SA 1HAYB 4X8VH 1GBLA 2VIPA 2F3CE 1O5CB 3QLPH 4XBBA 4XRNA 2WYJA 1MH0A 3TNTA 1LHDH 1OSSA 2FMJA 5C1UA 3W94A 1HJAB 2J92A 1LPZB 3FZZA 1HAXB 6GCHF 7GCHG 2ZF0H 2Y7XA 1EAUA 1NFWA 2B5TB 4X8SH 3PMHB 5GJ4B 2KAIA 3BIVH 3KNXA 3PLPA 4JZ1A 2TRMA 1NZQH 1YCPK 1DY9A 4AZ2B 1L2EA 1EQ9A 4X8TH 4MTBA 3BF6H 2EI6A 1JWTA 2IN2A 1QQUA 1DT2A 1OP0A 1XX9A 1LHCH 3SV6A 4MPUA 1KLTA 3A7ZA 3ELAH 5FCRA 2H9TH 2Z6BD 1O2PA 1HAVA 2NU2E 6LPRA 1NRPH 1EZSC 3LU9B 3M36A 1NBME 2A5IA 4E7NA 4OS6A 1C1QA 3SI3H 1NFYA 5GCHF 3F6UH 5HKKD 3ZV8A 1GJDB 4ASUD 1O3BA 3RMMH 4D9QA 3UNRA 3E91A 1ZGVA 2OQUA 2CK3D 2GZ9A 2XWBI 2A32A 2AGEX 1H1BA 4AG1A 3RXUA 1W0ZU 1TNHA 1M9UA 2FLBH 1ANBA 4WMDA 5GIBA 3IITA 1UTNA 1UTQA 2FYQA 4AB9A 2VWMA 1WQSA 1KXBA 2YNBA 1RIWB 4WF8A 1CBWC 4NSYA 1XUGA 3MNBA 1TRYA 1ZMJA 4WH8A 5JB9S 2RFKC 1UJ1A 2VBCA 2F4LA 3ZV9A 5EU8A 1UTMA 1YKTA 4ZHAA 5EQQA 2RG3A 4AOQA 4Q7ZA 4B6EA 3R3GB 5J4QA 3M5OA 1T8NA 2AIPA 1SG8B 2W3IA 2C8ZB 4H4FA 3RU4E 3TGKE 1X7AC 2P94A 1T4VH 1PPGE 1XKBC 2PGQB 1QURH 1NY22 4AFQA 2IOTA 2QA9E 4D7GA 3ZZ9A 1AI8H 4TY6A 1YPEH 4RT1A 5DP3A 3SV9A 4OS2A 1GI5A 2CF9H 1SQOA 2O9QA 1O3OA 2FX6A 1O5AB 4XFQA 1YPJH 5EXLA 4AFUA 3ATMA 1SGCA 1QBNA 2W5EA 4FUHA 1VITF 2ZU4A 1XUKA 1MQ5A 3W95A 1AQ7A 2FOMB 3PLKA 4INLA 3UB0A 3TITA 1COWD 1BBRK 2BXUH 4WXIA 4R8TB 1UHBA 1AZZA 4FUFA 2A5KA 4YOJA 3OY5U 1ANEA 2J98A 2OCVB 5HM9A 3P8FA 1UVSH 2ZGJA 5FPYA 2H9HA 2J95A 2BTCE 2HGTH 1ANCA 2HNTE 1EOLA 4NIWA 5GDSH 1SGTA 5EQRA 2TPIZ 1EJNA 1TNIA 5C1XA 5C20A 4BANB 2HLCA 3OX7U 3FVFB 5HIYA 4CR9A 2FOEA 2PKAB 4XDEA 2G52A 5G4BA 1H8IH 3TH2H 1P3EA 3CS0A 3RXFA 5TCAA 1MZDA 1TWXB 1D3PB 1GPZA 1JRTA 3O8BA 4ABAA 4U2WA 1HAGE 1EB1H 3HPTB 1KXCA 4VGCC 4M9FA 3T29A 3RM2H 1NU9A 1N8OC 1TGNA 1GCTB 1GJ7B 1V2VT 1XUJA 2J5UA 3P8NA 1TMBH 1BIOA 3RXBA 1F7ZA 3A7XA 1HPGA 3H5CB 1LVMA 1EFRD 2F9PA 3LH3A 2BD9A 3PV2A 3BTKE 1KXFA 3PV4A 2ZDVH 3UNQA 1ESBA 1AN1E 2JJ2D 3FN8A 4B6FA 4FUBA 3O8DA 1S85A 4U30A 5LPRA 1MAXA 1P09A 1SMFE 1P02A 3DA9B 3VB4A 4Y0YE 2XRCA 4AYVB 1GMDF 1BT7A 1GBHA 1PPEE 1MU6B 1W3CA 4ZHLU 2I6QA 3TIUA 1N1LA 2WV9A 3KGPA 6CHAC 4LZ1H 1UTJA 4FVBA 4MVNA 2A7JA 2GDEH 1MKXH 3ZVAA 2Q6DA 3ZZ7A 3A8AA 3LGVA 2XNIA 2J38A 1QL8A 4I33A 1S6LA 2GT8A 4F55A 4BAKB 5LH8A 2GMTB 4YOIA 1G3DA 2ZGBH 1HGTH 1ELEE 1T8MA 3F9EA 3LIWA 5FAHA 4AGKA 1GJBB 1NTPA 1VITH 1YYY1 1MZAA 4ABJA 1O2QA 2VWLA 1LQDB 2Y5GA 1SLUB 1FIZA 2FS8A 4UEHH 4NCYA 1ELBA 4ZXYH 1O3LA 3SV2H 1B0FA 2ZFFH 3DSPA 4Y71A 1K28D 2CV3A 3KQCA 3ZZDA 3SORA 2VVUA 3WY8A 2ZDKA 1EP5A 1MTUA 1TPOA 3QTVH 4XSKU 1C5RA 2OQ5A 4KTUA 3ZVDA 2ZCHP 3SUEA 2L6OA 1Z6JH 1TONA 5F8XA 1ZHMA 1AB9B 1ARCA 3NUMA 2AYWA 1UMAH 2IJD1 4B1TA 4HFPB 1LPKB 3TH4H 3K2UA 2J2UA 2W6JD 4UE7H 2VIWA 1TMTH 2HOBA 5KGOA 1O37A 1GJ8B 2ZP0H 4B2AA 5A8XA 1O2TA 2FWWA 4WMFA 1EZXC 1BRUP 1W14U 1B5GH 2BD2A 1E37B 4WXVA 1ID5H 4IMQA 2BLQA 2K8IA 4NG9H 3OEED 2LPRA 5LGOA 3UNSA 3QWCH 3VB6A 1LVBA 2GV6A 1C5MD 4BTTB 3WWBA 1YC0A 2C8WB 1A46H 1UVUH 1P2IA 1FY5A 4YOGA 1OYQA 4CH2B 1O0DH 3V12A 1C5PA 1KDQB 1FAXA 4YESB 4B2BA 1O3DA 1Y3UA 4BNRA 1FQ3A 1SOTA 2Y80A 2A7CA 2BX3A 1C1VH 1D6RA 1GMDG 4X1QU 1ZRBA 2R3UA 8ESTE 4INKA 4GPGA 2ESTE 1BMFD 3VXEH 2BVSH 1SLXB 1ZHPA 3SGQE 3BTQE 1BTYA 2FP7B 1ZTKA 4KKDA 3DFJA 2GP9B 1P2JA 5JBAS 1GBMA 1GMCF 4E06H 2XYAA 2KAIB 3RXLA 2F43B 1TAWA 4RT0A 4BTIB 1GJAB 1YPHC 3LC5A 2ALVA 2ZQ1A 1LHGH 2J97A 3A89A 5E8EH 5JDUB 2P59A 1O2XA 2OINA 1O38A 1UCYH 1GBCA 1GJCB 2A31A 2LP6A 3RC5A 2BB4A 4BAQB 1GBJA 3E1XB 1UTLM 1DSTA 1H9HE 2FTLE 2QF3A 1HAVB 1O3JA 2GZ8A 2TGPZ 4AC9A 3V0XA 2GCHF 1ELTA 1HAZB 5A0AE 4ZHMU 4ZKSU 3A82A 3S9CA 4H6SB 2YMSB 3RXHA 5EODA 3BTWE 1LKAA 4IW4E 3UUZA 2QXJA 5C2ZA 1C9PA 3LT3A 1KMHB 1W0YH 2UUFB 1P2OA 1HNEE 2J9NA 2FO9A 3ODFA 4OS1A 2SGQE 4SGBE 4WVPE 1LHEH 5E2PA 3PB1E 2RA3A 5TCCA 3PO1C 5K0HA 3RM0H 3GICB 2PKSB 3EAJA 1WXRA 2A45B 2NU0E 4X6MA 4AX9H 1JRSA 1THPB 1D4PB 5GPIB 3O8CA 3KIDU 2BMGB 1TOMH 3SGBE 1OHHD 5F03A 2W3KA 8GCHG 2P95A 1V2JT 5F8ZA 3BSQA 1VGCB 1HYLA 5HIZA 3ZVBA 3F2HA 1MD7A 2OC7A 2Z7FE 1FY1A 5A8ZA 1BOQA 1C5WB 3A88A 2EA3A
chains in the Genus database with same CATH topology
2P8OC 2V0BA 3SW2B 1NESE 4DCDA 2AGIX 1RIWC 1C5YB 1PYTC 2GCTB 3TU7H 1YGCH 2ZFRH 1NROH 4KGAA 2Z3CA 2OD3B 1ESAA 1MKWH 2ZDMA 4X1NU 3T2NA 2HWLB 1BA8B 2BY5X 2SGFE 4UFEH 3KQBA 2PTCE 3AAVA 2WPMS 3QK1A 2B9LA 3BTFE 2FXRA 3EGKH 2XXLA 2PSXA 1S6HA 1Z8JB 2HPQH 3A7WA 5CE1A 1TPSA 2OC1A 3SU1A 3ZZAA 2G4UA 4OS5A 4WY3A 1GBKA 4DIIH 1UHBB 3ZZCA 3KHVA 1TBZH 2ZCKP 3ZZ8A 1KYNA 2GDDA 1ZGIA 1DXPA 1AWHB 1SGIB 3UOUA 1S6FA 2ZI2H 3DHKH 1YCPH 1PPBH 3F68H 1H9LB 2BD3A 1IOEA 5HGGA 1GDQA 5A09A 4K60A 3LJOA 1EXFA 3MTYA 3LPRA 1P2MA 2BDAA 3URCA 1L4ZA 4I8LA 1EKBB 1GMHG 1O3PB 4Y79A 3T26A 3MHWU 4HTCH 1C9TA 1BHXB 2FEQH 3BTTE 3UFAA 2D2DA 2P93A 3A80A 2Y6TA 1C2JA 1TMUH 2O8TA 4JZFH 2O8LA 1SVPA 1O2SA 1NFUA 2IPHA 1T7CA 3DUXH 3OY6U 1S0QA 1GI4A 3GY6A 3EYDA 4X2YA 4A6LA 1SPJA 4K8YA 1BCUH 2ZTZA 3CS7A 3RXAA 4Y8ZA 2W7SA 1O3EA 1Y5BT 2BYAX 1LMWB 1UK3A 3MNXA 3A85A 2F9VA 1VJ9U 3B23B 1WTHD 4Y8YA 1RXPA 4GCHG 1K1LA 4D7FA 1P10A 2VU8E 3RC4A 4H6TA 3SHAH 3STIA 1MTVA 4CR5A 1ZSJA 3EDXB 2G55A 4UDWH 4DGJA 2QXIA 3BN9A 2C4FH 1WU1A 5E0HA 1LVYA 1C2KA 3T27A 1IQHA 2BD4A 1ZYOA 1CT2E 3PMAB 5DGJA 1YCPM 1HB0B 1G37A 5A8YA 1HRTH 2NU1E 3I29A 3H7OA 4MNVA 2PSYA 1D3DB 3GCHB 3TLOA 3HK6B 3SU3A 3SUDA 3T5FH 2GMTC 4JCNA 3PLBA 1OPHB 1F5RA 1W12U 1GGDC 5IYTA 1GHZA 2Z9LA 1W8BH 1UVTH 4AFZA 6ESTA 2Q1JA 1CA8B 1OYTH 3RXKA 4J2YB 2FOHA 1BBRH 1ZLRA 3OTJE 2TBSA 1AY6H 4Z6AH 2G8TA 1L4DA 2PGBB 3AASA 1DLEA 3L6PA 1QB9A 1PQ5A 1TOCB 1K1NA 3QDZB 5FBEA 5CHAB 3VB7A 3OSYA 3NZIA 1ETSH 3JZ1B 4DJZB 3BTGE 1S5SA 1GHBF 2ZHQH 1MKWK 5DP6A 1E35B 4BXWA 2VB0A 3KEEA 1EASA 2AFQB 1YPKH 4ZKRU 4X1RU 1FNIA 3GYMA 1K1MA 3MYWA 1OP8A 2FOCA 1G2LA 1C1WH 3FP8E 1GBIA 2V35A 4KTSA 1QR3E 4B71A 1MCTA 1O3HA 4NA9H 5AHGH 1EPTC 3M5MA 4ISLA 1FPCH 1C2EA 4K2YA 4JZIA 4THNH 1DANH 1TGBA 4SGAE 1DM4B 2ZC9H 1TGTA 2AS9A 4B74A 1QRWA 3BG4C 1FAKH 2BHGA 4CRAA 1W7XH 5E0GA 4NZQA 1D9IA 1G9IE 4NSVA 2TIOA 1GDNA 1AIXH 3ZZ6A 3UIRA 2ZDLA 1C1RA 4IBLH 5AFZH 3RXEA 4CRCA 5A0CA 1J16A 2H2ZA 1TX7A 1HJ9A 2AERH 1F5LA 4CHAC 1GBTA 3LJJA 3S9AA 2BQ7B 2JH6D 1XVMA 2VINA 2P3TB 4MNYA 4NWKA 2O8MA 1BRAA 1T32A 5C5NA 1GVKB 2JKHA 1W13U 1WUNH 4NFFA 1MTNB 1C5NH 3BTME 3ZVGA 1F0UA 4ZKNU 1DUEA 4X6OA 1O3AA 2WV5A 2ZIQH 2FS9A 2VIDA 5A2MH 1MQ6A 1O36A 3VEQB 1CSOE 2ZHWH 4GUXA 1K1PA 2XBVA 1LO6A 5ETXA 3V7TA 4BAMB 1CA0C 3FZDA 3JZ2B 3PTBA 1BDAA 3NPSA 3LKWA 2WUCA 3VPKA 2LNCA 2M5TA 1EAWA 1GI7B 1QL7A 2UWLA 2A4QA 1F0RA 5BPEA 1AUJA 1IQFA 1Y3VA 4XBDA 1C2LA 3SNCA 1SGQE 3TK6A 1FLEE 1YLDA 1FN8A 4QT8C 4TPIZ 5EW1H 5F6MA 4X1PU 2BY6X 2Z3DA 3BTHE 2ODPA 1OWKA 4GSOA 2ZWLH 1H4WA 3OU0A 3U1JB 4FUEA 1ELCA 4ZMAH 1GHBG 1OWDA 2SGAA 1ELAA 1YF4A 4A1VA 3MFJA 2VH6A 2FDAA 1C2HA 2F9BH 2ZG0H 3RU4T 5HMAA 2VGCB 2A4GA 2D8WA 3P8GA 2AGGX 1HV7A 4X2XA 5JYIA 2Z94A 2OBQA 1CE5A 1CHOG 1MMJN 3TH3H 3M7UA 1A4WH 1P03A 4DVAU 3KN2A 4O97A 3NWUA 1SB1H 3ITIA 3UREA 2PKSC 1QB1A 5JBBS 5ABWA 4KP0A 3RLWH 5L2YH 3K6YA 1ZJDA 3GCNA 1CVWH 2GTBA 1O3GA 1ZMNA 1KY9A 1MBMA 1ZPZA 2P3FH 8KME2 3S7KB 1P9SA 4OGXA 1LQEA 3GY3A 1C1OA 4ABDA 3M3VA 1C2FA 4ZKOU 2YNAA 1AMHA 1O2WA 3IWMA 1P01A 4PROA 1O2IA 3LDXH 3K9XB 1FXYA 2J94A 3T62A 1C5QA 2UUJB 4DT7B 1UCYE 3UPEA 2BVXH 1CQQA 1IQKA 5DPAA 1W2KH 3MOCA 1C5OH 4A92A 1QNJA 2ZNKH 1W10U 1F0TA 1O3KA 1SGFG 3UR6A 2PUXB 2QXHA 1XVOA 1E38B 3GY5A 3ZVFA 2RA0A 4DOQA 2FTMA 3MWIU 4ABGA 1A0LA 1BTWA 2YOLA 1PPCE 2F9UA 4FXGH 1IQNA 3TNSA 3CENA 1GDUA 1LCYA 1PQAA 2FI3E 2BD5A 1YBWA 4FVDA 2PW8H 2O8UA 1O5BB 2FOBA 1EATA 2XCFA 2ALPA 1HIAA 2GX4A 2SNVA 1UTPA 2ANKH 2VIQA 2ZA5A 2XC0A 3ZVCA 1C1MA 2BVRH 5I25A 2QF0A 1CU1A 1O2JA 1GBDA 5ESTE 2AMQA 4X8UH 3RXIA 4ABIA 3U8TH 4CRBA 1C4U2 4CBOA 2G5VA 3SNDA 4WH6A 5DK1A 3RXVA 1FY8E 3K65B 4NWLA 1TA2A 4B2CA 4TYDA 2ZFPH 5LPFA 5J4SA 2V3HH 3MO3A 1ACBE 2ZDNA 2R2MB 3QO6A 3QZQA 1GG6B 4XBCA 2HPPH 1O2UA 1FY3A 1KXEA 3SN8A 1S0RA 3DT0H 5FX5A 2QN5T 3F9GA 2ZU3A 3LONA 1BMNH 1O2MA 1YP9A 3UY9A 2PHBA 4KTCA 4AYYB 1OS8A 3VGCB 3PWCA 3MO9A 1EX3A 4GVUA 3B8JA 1WV7H 3KL6A 3QUMP 4INHA 1BUIA 3A8CA 4DURA 1VZQH 2BZ6H 2BD8A 1NFXA 1F2SE 5L6NH 2CF8H 4UFFH 4I32A 1YLCA 1NO9H 1P3CA 8GCHF 1GBEA 1O32A 3GY7A 1QRZA 4J1YA 1B7XB 1AVGH 2BDIA 1O3CA 3BIUH 1CGHA 4NA7A 3SO3A 3GCHC 3RMNH 3G01A 1AFQC 1RTKA 1F0SA 2CHAC 3GDSA 1FN6A 2JETC 5E0JA 4DG4A 3E8LA 1ANDA 3SZNA 1IHSH 5DP9A 3QX5H 1PPHE 3L3TA 1C5VA 3TJVA 4AB8A 1ORFA 1OXGA 5JBCS 3MH7A 4B76A 1GL1A 1EB2A 1GL0E 4K8BA 1NRSH 4ESTE 3E16B 5K7RA 1ZPCA 3ESTA 5EXNA 5HYOA 1N6XA 2ZKSA 9LPRA 1J9CH 1T8OA 1F5KU 1LKBA 4FUDA 1S83A 1GI9B 3Q3KA 3PYHA 2P3UB 1L1JA 4YLUA 4NZLA 1SGYE 4YT6H 2XC5A 4Z0KA 3VB3A 4NIYA 3S69A 3I78A 4ABEA 4MG3A 1JXPA 1DWDH 2NU4E 2DE8A 1G2MA 1EJMA 2W7UA 1AWFH 2FLRH 2FX4A 3RMLH 2ASUB 4D8NA 4F49A 3TVJB 1QCPA 1C5ZB 3N7OA 3TJUA 3UOPA 1JMOH 4A1TA 3HGNA 2FM2A 1PJPA 1AZ8A 3SUGA 3ZYDA 2ILNA 1HJAC 3UWIA 1SGFA 2ODYB 3SOSA 1GMHF 2ZZUH 1K9OE 3U98H 1E36B 1O35A 3UR9A 4GAWA 3C1KA 3KQDA 4RSPA 1SQAA 4MDSA 1WBGB 1CBWB 1KIGH 1TNLA 1HAHH 5FXLA 4Y7BA 2WPJS 4IN1A 2BM2A 3M3TA 1DWBH 2QC2A 2H1UA 1WSSH 4ISNA 4TWYA 1O3MA 1THSH 1KLJH 4CREA 1S82A 1IQEA 1BBRE 3DD2H 1ZOMA 3UQVA 1SC8U 2CGAA 1V3XA 1CT0E 1V2QT 1SL3A 2BLOA 1LTOA 1BJUA 1V6DA 2BDHA 4JYUH 4DY7B 1V2RT 3ZVEA 4GCHF 4BXSA 1J15A 1V2KT 2DE9A 1RS0A 3GOVB 4FUCA 3SGAE 2AMDA 5FHTA 1O2RA 3LGUA 1FIWA 1MUEB 1K2I1 1C1PA 1O3NA 2ZPQA 3MU5A 1B0EA 1PPZA 1Z8RA 1FI8A 1ZRKA 1AVXA 1GVLA 3SV7A 3M5NA 4MPVA 2ZU2A 3STJA 1A5IA 3I77A 2Q6FA 4A1XA 3EA7A 3SU0A 1KSNA 1ZJKA 4X0WU 5GWZA 3A81A 1ABIH 1K1JA 1VR1H 2ANWA 2R2WU 4KELA 3RXJA 3GISB 3F9HA 4Y0ZE 1V2NT 1GBFA 4JZEH 1O34A 3PTNA 3FAOA 2ZCLP 2B0FA 2VVCA 3GDUA 1AE5A 3BEIB 3GCTF 2QGRA 2THFB 4VGCB 1UK4A 1QJ6B 1O2LA 1NRRH 1CHGA 4E7RG 1N8OB 2BY7X 1D3QB 3NXPA 1TNJA 1O2KA 4ABBA 4ZUHA 3PROA 4Y7AA 3NKKA 2FI5E 3LGTA 1BMAA 1GHAF 4MLFB 2GT7A 3Q3YA 2GD4B 2G5NA 5C5OA 2AIQA 2FOAA 1GI3A 3HK3B 3SJOA 3L33A 2EI7A 3FP7E 3SI4H 4K1EA 1TE0A 2OBOA 2QCYA 3RU4D 1NRNH 1G3EA 3ATWA 4O9VA 2J34A 3SV8A 2PWXA 3LGIA 4ABHA 4UFGH 4GHTA 3RXPA 2FODA 1O2ZA 2GV7A 1P8VC 2ZGXH 1SGEE 4WWYA 2CMYA 3QZRA 1A3BH 1O3IA 3EE0B 2RCEA 2DUCA 1HBTH 2V6NA 2BY8X 3BG8A 1O3FA 2Z9GA 1KXDA 4Q7YA 1C2IA 3RC6A 1ARBA 1H9IE 3V3MA 1J14A 4CRDA 1GCTC 4Y11E 2PR3A 4A5TS 1MTWA 4B75A 2I6SA 1O2YA 4IMZA 1S81A 1DWCH 1O31A 1YPLH 2ODQA 1OP2A 1TLDA 1HIAB 5L30H 2B7DH 1YPHE 3PWBA 4TPYA 4Y76A 1TPAE 1AD8H 2TGTA 1UTKA 3HGPA 2PUQH 3M35A 1KLIH 2FPZA 1MAYA 1SGPE 1UO6A 2ZU5A 4NIVA 4RKOB 1IQIA 2GGVB 5EG4A 1ETRH 2NWNA 2Z9KA 2ZU1A 3U8OH 4ABFA 3ZZ3A 3C27B 1JIMA 2H9EH 1GI1A 1QQ4A 2VNTA 1WQVH 1QJ7B 4F4OC 4JK6A 4O3UA 5DP7A 1DS2E 2ZFTA 1A5HA 1ZTLA 4RKJB 1DY8A 2SGPE 1IQJA 5HM2A 3RXRA 3M7QA 2BZAA 1AFEH 1DVAH 3QN7A 3RXMA 3A84A 1P9UA 1NRQH 3GCTG 4IC6A 1XM1A 1MCVA 7KMEH 3ATIA 4X6NA 3A8DA 2BY9X 4CH8B 4UFDH 1EPTA 1SBWA 2PTNA 3GY4A 1ZSKA 2HNTC 1FMGA 4JMYA 4ZAEA 1A2CH 2UUYA 4I31A 1Z8GA 4YLQH 1RFNA 1GCDA 1GHAG 1HAIH 2OLGA 4GHQA 1WYKA 1AB9C 3MO6A 5L2ZH 1HXFH 1WOFA 2V3OH 1ELFA 3E0NB 4R0IA 1O33A 3H7TA 1V2ST 1CHOF 4DIHH 3M61U 1G30B 1V2TT 4B73A 2UUKB 3SQEE 1SQTA 1C4Y2 4Q80A 1DOJA 1AUTC 1GJ9B 2SFAA 1XUIA 2W26A 3U8RH 5FPTA 4BAHB 2K1QA 5FX6A 5T6GA 2Y82A 2BXTH 1MBQA 2A2XH 3MU4A 1HFDA 1CGIE 3VB5A 1WCZA 4ISIH 4LZ4B 9ESTA 1WAYB 1AKSA 1GJ5H 1DXWA 1BJVA 1J17T 2QAAA 3HKIB 1MTSA 4ZXXH 1KTTB 4XE4A 3SJIA 1HUTH 4ZH8A 3E3TA 4U01A 2OC8A 1BTXA 1W7GH 4K69A 2AH4X 2C90B 1GHVH 5IDKA 1TRMA 3TK9A 4X6PA 5T6DA 2ZGHA 4I8GA 1SGRE 1XMNB 1UTOA 1Y3WA 1Z1JA 1ELGA 1S84A 3TJNA 2VVVA 1V2LT 1BRBE 3SU4A 3PO1B 3A86A 4ISOA 1DWEH 1AHTH 1GJ4H 2J4IA 4IC5A 4YT7H 2OUAA 3SQHE 1HJ8A 3D62A 5SGAE 1OOKB 2A7HA 2ZTXA 1IQGA 1O30A 3KCGH 2D26C 2R0LA 1CO7E 3ATLA 1K21H 2P8OB 1UK2A 1D6WA 1BMMH 1ZMLA 4FU9A 4LOYH 1BTZA 3PMJA 2G00A 2ZECA 1TYNA 1P11E 3A8BA 2IJOB 2OTVA 1QBVH 3RDZA 1FV9A 3M3SA 3RXOA 4I7YH 5EQSA 3U69H 4I8JA 1GBAA 2ANMH 2Q6GA 1A1RA 2XCNA 1IHTH 2BX4A 3MNSA 1JOUB 3Q3XA 2BLVA 1SHYA 3RXCA 3LOXA 2C8YB 3P17H 5DKMA 1T4UH 1TQ0B 3ENSB 4HZHA 1Z71A 3TK5A 1MD8A 1V2MT 4ISHH 2GKVE 1JIRA 2F9NA 3M7TA 4NFEA 1SR5C 4Q2KA 2C93B 3AAUA 2ZDAH 1P05A 1TABE 3BTDE 2BDBA 1VGCC 2QXGA 2OP9A 2Y81A 1DX5M 2R9PA<