2O9QA

The crystal structure of bovine trypsin complexed with a small inhibition peptide orb2k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title From protease inhibitor to antibiotics: single point mutation makes tremendous functional shift
rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA02
1XUKA 1RTKA 5HMAA 3EQ0H 2BD2A 4MPVA 2XWAA 1FIZA 2XC5A 4GCHF 3LGYA 1GBDA 4TY7A 4DY7B 3U1JB 4JYTA 1TYNA 3E16B 1P2KA 1V2JT 2QF0A 2Y7ZA 1G3EA 3RU4E 3ZZ3A 1EZXC 1SQAA 1CHOF 4WWYA 3UY9A 5C67A 1GI1A 1O31A 2PWXA 3ENSB 2C8YB 1LTOA 3BTFE 3U69H 3SO3A 4O9VA 4YOJA 2C90B 3QTOH 1Z8JB 2B8OH 1ELGA 2ZPSA 5JPMH 2J95A 2ANYA 3VB3A 3ZVFA 1C2KA 3VB7A 3UIRA 3A7YA 2BHGA 5DP6A 1EXFA 1AKSB 2GX4A 1HDTH 4AG1A 1Y5BT 1QURH 3CENA 3SW2B 4FUHA 2WV4A 1ZMJA 3CS7A 7KMEH 2G51A 3BG8A 3RLWH 2IN2A 4A5TS 1YPMH 4VGCB 3SBKA 1W7XH 2BY5X 2J34A 3QWCH 2TIOA 1ORFA 1QY6A 1YPLH 3D23A 4YOGA 2Y81A 3FANA 1DLKB 1C2MA 3SJ8A 3QZRA 4Z0KA 5F6MA 2A4RA 2ZECA 3U9AH 1ZTLA 2Z9LA 2OC1A 1B5GH 1CHOG 2R0KA 3BN9A 2AH4X 2BLVA 1QTFA 1UMAH 1OPHB 2Y5HA 4ABAA 1SVPA 3V12A 1MTNB 2Z3DA 1MU8B 1DUEA 1EQ9A 4TYDA 2V0BA 3ZVDA 2AFQB 1GI8B 2AGEX 3BV9B 2GDEH 2ZIQH 3MH5A 1J9CH 1O2IA 3TK5A 5C5OA 1AQ7A 3QO6A 2OQ5A 2RCEA 1TWXB 1P02A 1ZPCA 5A8YA 1T4VH 1C5XB 3QZQA 1PPGE 4AFQA 3Q3YA 4D7FA 1C2FA 1EAWA 2ZHEH 1GDQA 4VGCC 3TH2H 3F1SB 5TJXA 1GBHA 2RDLA 3KIDU 4NWLA 2ALVA 2R9PA 1V3XA 1BJUA 2J9NA 3RXRA 1EOLA 4U32A 4JYVH 4JZEH 1K28D 1DE7H 1E37B 1EKBB 2ZFFH 1BTZA 1CA0C 3QN7A 1VITG 1BMMH 3LDXH 3M3SA 2PR3A 4PROA 1C1OA 3RMNH 5FHTA 5AFYH 2VIQA 1DY9A 3A81A 4MNVA 1ZJDA 2RA3A 1EB2A 1CGIE 4HTCH 3OTJE 1SI5H 2WINI 1THRH 6CHAB 4YOIA 4B75A 5C1YA 1O3OA 2TGTA 1DSTA 1GDNA 5F03A 2HNTF 1NESE 3QGJA 3RXPA 5T6DA 1TA2A 5EODA 1D3QB 2JH0D 3SV7A 2PSYA 1JIRA 4X0WU 3C1KA 3URCA 3BTHE 2BDGA 2TGDA 1DXWA 2VIDA 4RKJB 1P3CA 1SGYE 4NSVA 1TNKA 5JB8S 4B74A 4X1RU 2A31A 4B2BA 2XBVA 2ANMH 3SUGA 1C5NH 1TOCB 1FPCH 4FUDA 1LVYA 1SB1H 2QXIA 1JOUB 4ABEA 1V2ST 2ZHDA 1NN6A 1HAHH 2OXSA 4AYYB 3SU2A 4ZHLU 1TX8A 2ESTE 2VVVA 2SNWA 3GCTG 1QRWA 4KGAA 1MBQA 1P2IA 1NRRH 4MNXA 2Z3CA 4GSOA 1TOMH 4NIYA 3MFJA 4GHQA 4RSPA 3N7OA 1O5BB 2ZWLH 1C5PA 4NFFA 1RRKA 1NRQH 3HATH 4FUEA 4D7GA 1DWEH 1TGNA 4X2VA 4OS2A 3DHKH 1W0YH 1Z8RA 5L2YH 2P8OC 1HAZB 5IYTA 3S0NA 1Y3WA 2VVCA 4K8YA 1QRZA 2YOLA 1XKAC 3PMBB 1FAKH 1G32B 1PPCE 1ZTKA 3RXUA 4AFSA 3LPRA 1QQUA 1GJ9B 3RXOA 1NRSH 1O35A 1C9TA 2D26C 2JH5D 4Y8XA 4WMDA 1BRCE 1ESBA 1O2WA 3VEQB 1GHXH 1C5ZB 1FI8A 5T3HA 1V2NT 1GJ6A 1HAIH 1RTLA 2FLRH 4MNWA 1GCDA 4WMFA 1FZZA 1KXAA 1EAUA 3RXJA 5AHGH 2FYQA 1YP9A 5C1XA 2ZP0H 3RXCA 3ZZ4A 3TK9A 3MU0A 2PKAB 2ZCKP 1JWTA 3RUOA 2Y80A 1QNJA 2V35A 1AO5A 1G30B 1V2MT 4GPGA 1BHXF 2W7UA 1C2DA 2YNAA 3UQVA 3OY6U 3L33A 6LPRA 1P12E 1O2OA 1KXCA 1SLUB 3BSQA 2FS9A 1C2LA 4I8LA 2I6SA 2VNTA 1F0TA 1HV7A 5ABWA 1KDQB 2FTLE 2G4UA 5C1UA 3SGQE 1C1MA 1CBWC 5LGOA 1GWAA 2VIVA 2Z9GA 1EX3A 1TPPA 4AB9A 1NFXA 3R0FA 3S9AA 3MNCA 1A61H 4CRCA 1FN6A 1ELVA 1O3AA 2GMTB 2BD9A 2OC8A 1KXFA 2SNVA 5H4IB 1WTHD 2VINA 4OGYA 1F0SA 1O36A 4Q7YA 1TIOA 1YC0A 1WOFA 1O5DH 2OC7A 3TIUA 3URDA 1YPEH 5T6GA 4Y6DA 5EPYA 1EP6A 1FAXA 3SU4A 1WQVH 3M5NA 5GWZA 2ZF0H 3LGWA 1EPTB 1AVWA 2GKVE 2ZGBH 4MDSA 4XBBA 1TE0A 5BRRE 1C2IA 1W3CA 1HYLA 2GGVB 2F9UA 1N6XA 1V2TT 1AE5A 2Z3EA 3QTVH 3VB5A 4FXGH 3WY8A 4UD9H 5EQRA 1ELEE 2RG3A 1TBQH 3NZIA 1N6YA 1SGTA 1IQHA 2A5KA 1MZDA 5DPAA 2R3UA 4WF8A 2H6MA 1D3TB 2QXJA 2BDIA 3BTTE 2VU8E 4DG4A 3UNQA 4FU7A 1BTUA 1BBRE 2STAE 1HAYB 2GMTC 3UWJH 2XBXA 1ZRKA 1CA8B 2J92A 2AS9A 3M61U 3A89A 2C8ZB 3KHVA 1F0RA 2OINA 2JKHA 1YLDA 1GVLA 1N8OB 3RXMA 1C5OH 2FDAA 2IJOB 3A8BA 1ESAA 4HFPB 5TCCA 1FY5A 3RXTA 4Y71A 3HKIB 1MKWK 2F9NA 1EPTC 2ASUB 5EQQA 1LVOA 1O2RA 2WUBA 4JYUH 3SJIA 2NU1E 4M7GA 5DG6A 4K8BA 4AG2A 3FZZA 5GCHF 1OOKB 4THNH 1O2XA 1GBFA 9ESTA 3U8TH 3L6PA 1O2TA 1KTTB 2ZDAH 4LK4A 1H8DH 3P95A 1GBJA 2GZ7A 2J38A 3GCHB 4OS6A 2BQWB 1LPZB 2DE8A 1Y5AT 3SV9A 1UTPA 1WV7H 2QY0B 1QBNA 4Y8ZA 2DUCA 1FJSA 2WPIS 1O2YA 1A3BH 3SJ9A 1C5RA 3Q77A 3SN8A 3M5LA 1HFDA 1BMNH 1V2KT 3SU1A 2Q6GA 1LPKB 2ZQ1A 2A4GA 2UUJB 2FOBA 3S9BA 1KXBA 4YM9A 2FZZA 1OYTH 2FPZA 1N8OC 3ZVCA 3T5FH 3ITIA 1O5EH 1C1TA 1GI6A 3NK8A 3LGIA 1A3EH 1BTPA 1LHEH 3F9GA 3K65B 3TJUA 5CMXH 3PROA 3Q3XA 1BBRH 1C5QA 4UEHH 1P2MA 2BYAX 4I8KA 1GVZA 4WJG2 4JZ1A 4JK6A 2AMDA 3RXEA 4DURA 1F7ZA 1DSUA 1GHWH 1SGNE 1P8VC 5I46H 1P9UA 2F83A 1MCVA 4BXSA 5L30H 3DUXH 3RU4T 1O3MA 1IHTH 2OTVA 3SU3A 1BZXE 2CV3A 3GCHC 2FOAA 1OP0A 4GVUA 1TRYA 2NWNA 3SNDA 4ABDA 1NROH 5GIBA 1SQOA 1LDTT 1MUEB 5EXLA 1XKBC 3IITA 3EAJA 3M3TA 4BAOB 3MNXA 3KCGH 1VJ9U 2UUFB 1GJCB 3K9XB 3A7WA 4INLA 4NZLA 1QQ4A 1AMHA 4X8SH 1O39A 4HGCA 4U2WA 1BRAA 3ODDA 2ZPQA 4U01A 3R3GB 3S7HB 3EE0B 1CHGA 1NFUA 2H1UA 1Z6JH 3GDUA 2BX4A 1D3PB 3JZ1B 4BANB 2B0FA 4AFUA 2G8TA 1P06A 2C8XB 2FLBH 1QB9A 2XNIA 1IQGA 1C1RA 2XBWA 2ZDLA 1HBTH 5FPYA 2SGEE 4CREA 1GJ5H 2Q6FA 1O32A 2SFAA 2ODQA 1THSH 4I32A 1V2VT 2PW8H 4I8HA 1EOJA 1V2RT 1DANH 1HAOH 5C20A 1AE8H 3KGPA 3MO6A 3OX7U 1QB6A 3GY6A 5EOKA 2ZU2A 1A1RA 2ZHFH 2G00A 1BOQA 2GV6A 1ZYOA 1DWDH 6GCHF 3T62A 3BEIB 1P04A 1C2GA 3LC3A 1QRXA 3OYPA 3HKJB 4O03A 3D65E 2EEKA 3MU8A 1A5GH 1GMDF 1T4UH 1PQ8A 3PTNA 2FS8A 3S9CA 4ASHA 1S6HA 3TK6A 1KXDA 4WY3A 4I33A 1EAIA 2ANWA 2QF3A 2FESH 1P10A 3SUEA 1L1GA 2BDAA 1G9IE 2NU0E 4YLQH 2TGPZ 2FOEA 2BQ7B 5EPNA 3A80A 3ZZ9A 3E1XB 5F8TA 1ELFA 2ZC9H 4ZHAA 1QB1A 1ELCA 5C5NA 1O2MA 1A2CH 3QX5H 3KQEA 1W2KH 1Q31A 4DIIH 1DWCH 1O33A 3M35A 1GVKB 3NPSA 1WBGB 1XUJA 1TX6A 3PLKA 4NFEA 8GCHG 1TNGA 3ZYEA 4X1QU 3UR6A 4XBCA 1IQFA 3GDSA 4A6LA 1K22H 5IDKA 3BIVH 4OS5A 1W0ZU 3GCOA 1C1WH 3KF2A 1YM0A 1F5RA 1UVOA 1MTUA 2BM2A 5JBBS 1BRUP 3E90B 1LHFH 2EI8A 3ZZAA 5G4BA 1GHAG 2PSXA 4ZKOU 2BX3A 1EZSC 2QXGA 1AWFH 5K0HA 3SUFA 1DOJA 3TGJE 1GBCA 4DJZB 1O2ZA 1LHDH 4IS5A 1A5HA 4CRBA 2QV1A 1TGBA 5FCRA 3S7KB 5ETXA 1AY6H 1UVPA 2BY7X 1HNEE 2EI7A 1VCQA 5JBCS 2FX4A 3HGPA 3MMGA 4F4OC 3P8OA 3MH4A 2FI5E 2ZTZA 3PMHB 2D2DA 3ZZBA 4IC6A 3U8OH 1PPBH 4JCNA 3M7QA 1MKXK 1F5KU 1D3DB 4K5ZA 4CBOA 1C5TA 3I29A 5L2ZH 1QL8A 5E8EH 6ESTA 3MH6A 2XYAA 3UOUA 1BA8B 4WXVA 1XUFA 4UFEH 1XUHA 3A8CA 4GCHG 4TY6A 2VB0A 4BAMB 2BLOA 2VIOA 3W94A 1PQ7A 3E91A 1H9IE 4HI3A 4NA9H 2P16A 4XDEA 3RXQA 3NKKA 1Q2WA 2GV7A 3KEEA 3GY7A 3BTGE 1HJ9A 5SGAE 3RC4A 5A0AE 3UPEA 1EUFA 1UTLM 1FPHH 1GJ4H 3UREA 1S6FA 4BXWA 4AX9H 4X6OA 3SV6A 1QFKH 5DJ7A 4UFDH 1NM6A 2PUXB 4K2YA 1E0FD 1GL0E 4D9RA 3F6UH 3LH3A 3TJVA 4Y0ZE 4KKDA 1LKBA 3NWUA 2PLXA 5HYOA 4FUGA 1TGTA 2BY8X 3U1IB 1F2SE 2TRMA 1PPFE 1O3HA 2OC0A 2CJIA 2BZ6H 1GHVH 1GMHF 2ZU5A 1C1VH 2FTMA 4Q2KA 3MYWA 1NFWA 1QCPA 3UOPA 5DP5A 1HAPH 2H5DA 1SGIB 1T8LA 5AFZH 5ESBA 3E3TA 2CXVA 1CVWH 2GCHF 5EW2H 1SSXA 4ISHH 1UCYK 1AIXH 1BRBE 4ISIH 1S81A 1XMNB 1MD8A 1HLTH 4CRAA 1UHBB 2O8MA 2ANKH 2THFB 1X7AC 5FXLA 2WPKS 3SOSA 3STJA 3A86A 2PHBA 3SU6A 1MTNC 1K1LA 1L4DA 3A7VA 1EZQA 3GISB 4FUCA 3RDZA 3CS0A 1UTNA 3GYLB 2TGAA 4GLYA 2R0LA 4TPYA 3ZVEA 2FODA 3RM2H 4YTAA 3MHWU 1TGCA 5E0HA 2F9BH 1GJAB 5DP7A 5HM2A 1YPHC 5JBAS 4IN1A 3M7TA 4WXIA 4Z6AH 1W14U 5FPSA 4ABHA 5EGMA 3MU4A 2AERH 3SGBE 1W13U 4ZHMU 1OWJA 2A7CA 2AGGX 1TONA 4CR5A 3ZVBA 1KXEA 1JRTA 2GCHG 1AVGH 4UE7H 3PB1E 1MTWA 2GP9B 1VCWA 1BJVA 3JZ2B 1CT2E 2HRVA 2TBSA 1SL3A 3S69A 3F9EA 1DPOA 3EA9A 3HPTB 1XUGA 4BTIB 4IN2A 2P59A 1GMCF 1J15A 1QJ6B 2AMPA 4FVDA 2VGCB 1FUJA 3GY5A 1H4WA 1XM1A 1CQQA 2ODYB 1SR5C 3DT0H 1ZLRA 2OP9A 1VR1H 3TGIE 5JYIA 3LU9B 3T26A 2BY6X 3LONA 3GCNA 1QR3E 2ZFQH 3B9FH 1AKSA 6CHAC 4NIXA 2QIQA 4IGDA 1FDPA 3KQCA 2H5CA 1VJAU 3AVZA 5EU8A 1PQ5A 2A7JA 2XC0A 4X6PA 1TNHA 1ACBE 4BTUB 5A0BA 1O2QA 2A0QB 3LGTA 4Y79A 1K1NA 1W10U 3H7TA 4XOJA 5A2MH 1HAGE 3KN2A 1UJ1A 1A0LA 1AB9B 2LNCA 2P3FH 1SLXB 4ZKSU 4BTTB 2G5NA 1SLWB 3I77A 3SU0A 2BDCA 3IG6B 3PMAB 2A32A 5A0CA 2Q1JA 3E8LA 1XXFA 1RTFB 3ATWA 4Y76A 3P8GA 1ZHPA 3VPKA 1IQMA 1O5CB 1HXEH 1S5SA 2Z6BD 2GVFA 1GBBA 1ZMNA 3K6ZA 4Y0YE 2W26A 1SC8U 3GY8A 1FIWA 1HJAB 2IOTA 4BAHB 2OD3B 3K2UA 1ZHRA 3A83A 5J4SA 1EJAA 2FMJA 1E35B 3RXAA 3ATKA 2P94A 1FMGA 2FOCA 1AU8A 2OBQA 2BD8A 2F91A 4X1NU 2A5IA 1GJBB 3V13A 1A46H 2FOMB 3D62A 1YPHE 2PGBB 3M7UA 1O5GH 3VB4A 4DIHH 3QK1A 1T7CA 2OCVB 1HJ8A 1Z1IA 2O8TA 4O97A 1KY9A 1HIAB 1Z6EA 1TMUH 4BOHA 1BTHH 3VFEA 5DP8A 4A1VA 4RKOB 3TU7H 3VGCB 1GGDB 4ABJA 2FP7B 3M5MA 3SHCH 1GI4A 2SGQE 3ATIA 1G36A 1VZQH 2FX6A 1K21H 1EATA 4I8JA 1D4PB 1GG6B 1C4U2 1LQEA 1SG8B 1WUNH 1TGSZ 1C2JA 1UK3A 3P92A 2NU4E 1INCA 1HJAC 1GI9B 1SOZA 3OU0A 4MQAA 1TBRH 4DW2U 2FYRA 1O5AB 2W5EA 4D76A 1NFYA 3SJOA 1BUIA 1P2JA 2P93A 1C5SA 4BNRA 1H9HE 3BF6H 4NSYA 3A8DA 2PGQB 1VITH 2VWLA 2ZCHP 3O8DA 3A82A 5HM9A 3TPIZ 4ZKNU 3UFAA 1K1JA 2CGAA 3BEUA 3G01A 1WCZA 3SNBA 3EGKH 3TH3H 1ELBA 9LPRA 5JBTA 5DP3A 1AZZA 4JK5A 1O3LA 4H6TA 1TRMA 1AUJA 1GGDC 3GOVB 4K60A 3VGCC 1CT0E 2BOHB 3EYDA 4CRFA 1HAVB 3SORA 5AVDA 1UCYE 2G4TA 1MKXH 1FNIA 5FX5A 3LOXA 1Y3VA 1E38B 1O3BA 3ZZ7A 1UO6A 1JMOH 2A45B 1GG6C 3SV2H 3TGKE 3QDZB 2KAIA 5EQSA 1SFIA 5DP4A 4YT7H 3FAOA 1O2LA 1BIOA 1TX7A 3SU5A 2Y82A 5GDSH 1ZPBA 1AWHB 2Z9IA 3MNBA 2WPHS 5ESTE 4JZDH 4MPWA 3Q3KA 4SGAE 2Y5FA 1GCTB 2CF9H 1ZGVA 1WTGH 3LGVA 5EXMA 1GBMA 3SQEE 1Z1JA 3UNSA 1QL7A 3P17H 3T29A 2CHAB 2ZU1A 2BD7A 1ELTA 5LPEA 1LO6A 3BIUH 1GJDB 2ZA5A 4E7NA 1P05A 1P03A 1V2QT 2HPPH 1SGEE 2PFEA 2P3UB 2ZU3A 1GBLA 2AGIX 1O3GA 2OUAA 2G52A 3CP7A 3PM3A 4INKA 3A84A 2STBE 5GPIB 2A5AA 2UWLA 4UFGH 4X8VH 3HGNA 2G5VA 4ZAEA 3ATMA 1CO7E 4DOQA 1JIMA 1KLIH 4Q80A 4JMYA 3U98H 2B5TB 5F8ZA 7LPRA 1GDUA 1RFNA 1SOTA 4Y10E 1IQEA 4KP0A 1O5FH 2PKAA 1QL9A 1SGRE 3TITA 1BMLA 1MAYA 1UVUH 1DFPA 1GCTC 3GICB 2C3SA 1SGFG 3AAUA 1UCYH 5GCHG 1YPJH 2ZNKH 1A0JA 4ZXXH 2BVRH 1UK2A 1PPZA 4WH8A 1OXGA 2HLCA 3BTQE 2ZU4A 2GT8A 2HOBA 1KDQA 4FVBA 5HGGA 4I8GA 5DGJA 3T25A 1KIGH 5K7RA 3RXGA 2FWWA 1PYTD 4K1SA 4Y7BA 2ULLA 2V3HH 1MZAA 1GHYH 2FOFA 1RS0A 2GZ8A 2Z9JA 1S85A 1ID5H 2UUKB 1SGQE 3UR9A 3V7TA 4Q7XA 1ETSH 1A7SA 4NIVA 1WAYB 3M36A 7GCHF 1Z8GA 2FI4E 1TB6H 2WUCA 1HB0B 3DA9B 1O3PB 4X2WA 1AZ8A 2QYIA 1ETRH 2PKSB 3TH4H 1BB0B 1EPTA 3RXIA 1C1NA 3AW1A 4AB8A 5J4QA 1P2QA 1ZSLA 1CSOE 5EXNA 1HXFH 3UQOA 1ANDA 1IQLA 1RIWB 3MU1A 1SPJA 3VXFH 1H8IH 1C4Y2 3PTBA 3W95A 5FX6A 1OS8A 3RC6A 5I25A 1O30A 3KL6A 1NRNH 2XC4A 4D9QA 1ANCA 3PLBA 3ZZCA 2ZGHA 3UUZA 4A1XA 1P11E 2BQ6B 1K1PA 3VXEH 8LPRA 8KME2 1ZRBA 1L0ZA 1UTKA 1BDAA 3A8AA 1QBOA 1Z7KA 1LKAA 2R2MB 3NXPA 4FU8A 1LHCH 4JZIA 1G2LA 5FCKA 4DT7B 1SGFA 1EP5A 3ELAH 2JH6D 7GCHG 2AMQA 1SHHB 1F92A 1Y3YA 2BD5A 1LQDB 3SV8A 2PKSC 3PV4A 1O2NA 4CH8B 2V3OH 3QLPH 1EZUC 3SZNA 1RIWC 3QGNB 1GBTA 2ZQ2A 3KQDA 2R2WU 3ZZDA 5A09A 2HPQH 4MPXA 1B0FA 1NO9H 1GBEA 4AGJA 1WQSA 2F3CE 4QT8C 2VIWA 4IBLH 5FBIA 3SJKA 1W8BH 1L1NA 1G2MA 3UWIA 2ZI2H 1SGPE 1CU1A 2NU2E 3A88A 3Q76A 2WPJS 3P70B 2ZGXH 3V3MA 1AN1E 3TJNA 3ZZ6A 4ISOA 1O2HA 1DX5M 1OP8A 5C2ZA 3ZVAA 2VWNA 1E34B 2A4QA 2GT7A 3IWMA 6GCHG 1QJ7B 1ZGIA 4OS4A 4NA8A 1J14A 1HRTH 2G55A 1D9IA 3RXKA 1PQAA 5CHAB 4B71A 1GMDG 4NIWA 2HVXA 5A8XA 4MPUA 2O9QA 1P9SA 3AW0A 2Y5GA 2ZKSA 3SUDA 2AYWA 1TABE 3F68H 7ESTE 2C4FH 1O38A 2ZFPH 1G3CA 3DFLA 4O3UA 3RMOH 1V2LT 2XXLA 1GPZA 3PMJA 4DVAU 1VCPA 1CT4E 2H9EH 1O3IA 2XBYA 1ZR0A 1P3EA 1XXDA 2BZAA 2ZTYA 1B0EA 1LPGB 2ZFTA 2QXHA 3O8BA 3Q00A 4Y8YA 4ZUHA 1O3KA 5DP9A 1C5UA 1DT2A 2CN0H 1ZHMA 3M5OA 1BTXA 1FLEE 3BG4B 3B23B 4U30A 1GBKA 1YYY1 2O8WA 3RXDA 3FP6E 1C4V2 1BTWA 3HK6B 1TBZH 5CHAC 1DDJA 2XCNA 2GDDA 1AUTC 1WSSH 4ESTE 2A2QH 1SBWA 2BVXH 2BDYA 3EA8A 5DKMA 2YNBA 4I31A 1FY1A 3RMLH 3AAVA 3RLYH 1TMBH 3BTWE 2FEQH 3EA7A 1TALA 2FI3E 2ODPA 3LC5A 2TPIZ 2D1JA 1MTVA 4UONA 5L6NH 1FV9A 1J16A 3E0NB 4KTUA 1CA0B 1O2GH 4A92A 4RN6A 4K1TA 1C5LH 1MKWH 4LOYH 4YLUA 1BT7A 4BAKB 1VITF 4MVNA 3MI4A 4FUFA 1DS2E 4UDWH 4XBDA 1LVMA 5JDUB 1O0DH 2ZPRA 3DFJA 1XX9A 3U8RH 2J94A 8ESTE 3BG4C 4O3TA 2BLWA 3RXVA 2WV5A 4KTSA 4XSKU 1RGQA 5DO4H 1PYTC 5E0JA 2ALPA 3QUMP 2W3IA 3BTME 1FY3A 1LMWB 1P01A 1T8MA 4JZFH 1W7GH 4E05H 1RD3B 1O2JA 1Y59T 1THPB 1P2NA 1AI8H 1V2OT 2PTCE 1OP2A 1DVAH 1BCUH 3HK3B 2ZHWH 2XWBI 1BBRK 1ZMLA 3P6ZB 4B2AA 3PWCA 4TWYA 1DWBH 1C5VA 4I7YH 3STIA 2WYGA 2EC9H 1GJ8B 1CGJE 2QGRA 1QIXB 1O2VA 4UFFH 2VWOA 2H2ZA 1GI7B 3SQHE 2SGFE 1Q3XA 1C5WB 4H6SB 3RMMH 1UK4A 2P3TB 2W7SA 1YCPK 3O8RA 4H42U 1ZOMA 1K2I1 3NCLA 3LIWA 1AD8H 1F0UA 1GMHG 1UTOA 1EJMA 5JB9S 2I6QA 4Q7ZA 3GCTF 1YCPM 1SQTA 3H5CB 3GY2A 2ZDNA 4ABFA 1KYNA 1Z71A 2Z7FE 5F8XA 5E0GA 2GTBA 2Z94A 2B7DH 4WVPE 2CMYA 4X1SU 1SFQB 5HXFA 3BTEE 3RC5A 2BD4A 1BQYA 2P8OB 2RA0A 1MD7A 4X2YA 3H7OA 2BOKA 2ILNA 1DXPA 2ZZUH 1Y5UT 2SGAA 4Y11E 1QHRB 3SHAH 3A7ZA 4ABIA 3T2NA 1ETTH 1K1IA 1V6DA 1FY8E 1C2EA 2BDHA 1OSSA 2PV9B 3NUMA 4ZH8A 2VJ1A 3MU5A 4BAQB 1PJPA 1P57B 2VH0A 2OLGA 4K3JA 2C93B 5A8ZA 1YGCH 3P8FA 4B1TA 2ZTXA 2OQUA 3DD2H 2QAAA 3RXLA 1ARCA 4AN7A 3OY5U 2OBOA 2KAIB 2HNTC 4NZQA 4IMZA 1IAUA 1TMTH 1S0QA 2FO9A 1O3FA 1OX1A 5C3NA 3SNEA 4NCYA 1LHGH 5LH8A 1IOEA 1ABIH 3RP2A 2EA3A 3A85A 1GI5A 1KLTA 3RXSA 3OSYA 2P95A 3PYHA 4OS7A 2F9PA 1NZQH 1GL1A 2BXTH 3TVJB 1A4WH 1SMFE 1TPAE 1NT1A 1CBWB 1GJ7B 1O3EA 1XVOA 1GMCG 1NC6A 1L2EA 2D8WA 3LGUA 4DGJA 4FUJA 1ZJKA 2VH6A 2BMGB 1GI3A 2VGCC 1K1MA 3PO1B 1Z8IB 1M9UA 1G37A 3RU4D 1JBUH 4NGAH 3LT3A 1BHXB 1NU7B 2XTTB 1TQ0B 1GI2A 2ZGJA 1ANBA 3MH7A 1U6QA 4CRGA 4ABBA 1DLEA 5T6FA 1NY22 3B8JA 1ZZZA 4SGBE 1ELDE 1XUIA 1HAXB 1YLCA 4TWWA 5FPTA 1O37A 2AIPA 1W11U 1O3JA 1L1JA 2A7HA 5BPEA 3ZVGA 1MMJN 1H9LB 1V2WT 3FFGA 4K1EA 1AFQB 1YF4A 1VGCB 1GHBF 3FZDA 1AB9C 3O8CA 2GCTB 3MO3A 1UTMA 1FONA 4AGKA 4GUXA 1MAXA 2PTNA 3TNSA 1O2PA 1T8NA 5FAHA 5LPFA 2ZGCA 4IMQA 1UHBA 1ELAA 3C27B 1AVXA 1UTQA 3ESTA 1OWIA 3LKWA 1NTPA 3VB6A 2BY9X 3LH1A 1IQIA 1DM4B 4AORA 1C5MD 4AZ2B 1C1QA 1QA7A 2V6NA 3PO1C 4MTBA 1T31A 2BDBA 1C1PA 1ZSKA 2FIRH 3GY3A 4XE4A 3RXHA 3BEFB 2F9VA 1LCYA 3MOCA 2Q6DA 4WMEA 3PLPA 3FP7E 3ZZ5A 3PWBA 1UVSH 1TNLA 1DY8A 3GDVA 1H1BA 5LPRA 1O3DA 1DUAA 2HNTE 2FM2A 1S83A 3MTYA 1AHTH 1O2UA 4AOQA 1P0SH 1EB1H 3RM0H 1QBVH 1GHBG 2BXUH 1AFQC 1CGHA 1VGCC 5EG4A 4NG9H 2GCTC 1WYKA 3A7XA 2UWOA 2G81E 3T28A 4IW4E 4CR9A 4E06H 1QJ1B 3M37A 1O3CA 2ZDKA 2AEIH 1N1LA 1P2OA 1ARBA 1C5YB 3TLOA 2Y7XA 1G3DA 1D6RA 1GBIA 4NA7A 4YESB 2QA9E 1OWEA 1MH0A 1JXPA 1WU1A 3SI3H 1RJXB 2CF8H 1RXPA 2ZO3H 5CE1A 3FVFB 4ISNA 1LVBA 1PFXC 2PUQH 3LJJA 2BB4A 3BTDE 4ZMAH 1OWHA 3MNSA 1UTJA 1YPKH 4LXBH 1T32A 4INHA 4FUIA 4KELA 2VIPA 1ABJH 1TNJA 5TCAA 1E36B 1FN8A 1S82A 2O8LA 5AF9H 2SGDE 1O2KA 1Y3UA 1YPGH 1IHSH 3D49H 3L3TA 2M5TA 1C1SA 1D6WA 1UVTH 2F9OA 4CRDA 3F9HA 1TAWA 4GHTA 1S0RA 3A87A 4CHAB 2Z9KA 4ZKRU 1TLDA 1FXYA 2A1DB 1J8AA 1BMAA 4TPIZ 3F9FA 3MWIU 1MU6B 1TPOA 1BTYA 1B7XB 4YZUA 3M3VA 2AIQA 2FXRA 4B2CA 1P09A 3I78A 3GY4A 1V2PT 1KTSB 1A5IA 3E0PB 2BTCE 2FOHA 4J2YB 4A1TA 2CHAC 1BITA 2VVUA 2NU3E 4AYVB 2IPHA 2ZFRH 1HUTH 4B76A 4ZROA 4HZHA 4D8NA 1PPEE 3RXFA 4AFZA 1HIAA 4ZXYH 2WYJA 2J2UA 4X6MA 2WPLS 4KTCA 1MQ5A 2SGPE 4LZ4B 2XCFA 5DK1A 2ZDVH 5B6OA 4MG3A 2HWLB 3TNTA 1AGJA 3SNAA 3ZV8A 4X8UH 1GHZA 1SHYA 1EAXA 1XVMA 3TJOA 5EW1H 1DITH 4CHAC 1YCPH 2BD3A 3T27A 4XFQA 1FY4A 2FOGA 1OKXA 1AFEH 3MO9A 2QC2A 4E7RG 3P8NA 2B9LA 1GI0A 1NPMA 2ZEBA 1DICA 3K6YA 1IQNA 4H4FA 2ZDMA 4CBNA 1S84A 3EDXB 2HGTH 1G3BA 2WPMS 1T8OA 3ZV9A 1ZSJA 5FBEA 4A7IB 2HALA 2J4IA 1OYQA 4YO9A 1NRPH 1TQ7B 3SNCA 1HCGA 1HGTH 1EASA 4MLFB 2GD4B 4NWKA 1ANEA 4ABGA 1ZPZA 2GZ9A 2A4OA 1IQJA 3V0XA 1YBWA 2XRCA 1JRSA 1K9OE 1ZTJA 2ZG0H 2UWPA 3FP8E 1EJNA 1V2UT 5GXPA 4K69A 4MNYA 4R8TB 4FU9A 1O2SA 3KQBA 1PPHE 4X8TH 4X1PU 4WH6A 4OGXA 5PTPA 1MQ6A 1O3NA 4FUBA 5GJ4B 1HAVA 1SGDE 2JETB 4GAWA 3RXBA 1K1OA 3UTUH 2BVSH 3SI4H 1MTSA 2VWMA 1TA6A 3ATLA 1SGCA 4LZ1H 1Y8TA 1TNIA 1HPGA 1SLVB 3SGAE 2DE9A 2XW9A 1C9PA 4ISLA 1Y3XA 1NS3A 1O34A 4B73A 3ODFA 2ZFSA 2QCYA 3KNXA 1OWDA 1W12U 8GCHF 4DCDA 3UNRA 1L4ZA 1CE5A 2UUYA 3LJOA 4YT6H 1TPSA 1A0HB 1MCTA 2Y6TA 1F5LA 2ZCLP 1KLJH 2QN5T 4Y7AA 1IQKA 1GHAF 1YKTA 2K1QA 1OWKA 3E6PH 4OS1A 1QA0A 2W3KA 5E2PA 4IC5A 1TFXA 3A7TA 1QGFA 2C8WB 1ESTA 3AASA 2JETC 1NU9A 1MBMA 1TRNA 2H9HA 1FQ3A 2LPRA 3ZZ8A 1J17T 2A2XH 1C2HA 2ZHQH 1C1UH 2O8UA 3ZYDA 5E2OA 2BLQA 4R0IA 1KSNA 4F49A 4X6NA 2H9TH 3GYMA 3BTKE 1GBAA 4X2XA 2EI6A 4J1YA 4CH2B 2R3YA
chains in the Genus database with same CATH superfamily
1XUKA 1RTKA 5HMAA 3EQ0H 2BD2A 4MPVA 2XWAA 1FIZA 2XC5A 3SYJA 4GCHF 3LGYA 1GBDA 4TY7A 4DY7B 3U1JB 4JYTA 1TYNA 3E16B 3OEHD 1P2KA 1V2JT 2QF0A 2Y7ZA 1G3EA 3RU4E 3ZZ3A 1EZXC 1SQAA 1CHOF 4WWYA 3UY9A 5C67A 1GI1A 1O31A 2PWXA 3ENSB 2C8YB 1LTOA 3BTFE 3U69H 3SO3A 4O9VA 4YOJA 2C90B 3QTOH 1Z8JB 2B8OH 1ELGA 5C0TA 2ZPSA 5JPMH 1YY3A 2J95A 2ANYA 3VB3A 3ZVFA 1C2KA 3VB7A 3UIRA 3A7YA 2BHGA 5DP6A 1EXFA 1AKSB 5HIYA 2GX4A 1HDTH 4AG1A 1Y5BT 1QURH 3CENA 2KCOA 3SW2B 4FUHA 2WV4A 1ZMJA 3CS7A 7KMEH 2G51A 3BG8A 3RLWH 2IN2A 4A5TS 1YPMH 4VGCB 3SBKA 1W7XH 2BY5X 2J34A 3QWCH 2TIOA 1ORFA 1QY6A 1YPLH 3D23A 4YOGA 2Y81A 3FANA 1DLKB 3F2GA 1C2MA 3SJ8A 3QZRA 4Z0KA 5F6MA 2A4RA 2ZECA 3U9AH 1ZTLA 1COWD 2Z9LA 2OC1A 1B5GH 1CHOG 2R0KA 3BN9A 2AH4X 2BLVA 1QTFA 1UMAH 1OPHB 2Y5HA 4ABAA 1SVPA 3V12A 1MTNB 2Z3DA 1MU8B 1DUEA 1EQ9A 4TYDA 2V0BA 3ZVDA 2AFQB 1GI8B 2AGEX 3BV9B 2GDEH 2ZIQH 2KZ4A 1J9CH 1O2IA 3MH5A 3TK5A 5C5OA 1AQ7A 3QO6A 2OQ5A 2RCEA 1TWXB 1P02A 1ZPCA 5A8YA 1T4VH 1C5XB 3PRDA 3QZQA 1PPGE 3MQKC 4AFQA 3Q3YA 2XNDD 4D7FA 1C2FA 1EAWA 2ZHEH 4YXWD 1GDQA 1W0JD 1FX0B 4VGCC 3TH2H 3F1SB 5TJXA 1GBHA 2RDLA 3KIDU 4NWLA 2ALVA 2R9PA 1V3XA 1BJUA 2J9NA 3RXRA 1EOLA 4U32A 4JYVH 4JZEH 1K28D 1DE7H 1E37B 1EKBB 2ZFFH 1BTZA 1CA0C 3QN7A 5FL7D 1VITG 1BMMH 3LDXH 3M3SA 2PR3A 4PROA 5C17A 1C1OA 3RMNH 5FHTA 5AFYH 5GNDA 2VIQA 1DY9A 3A81A 4MNVA 1ZJDA 2RA3A 1EB2A 1CGIE 4HTCH 3OTJE 1SI5H 2LELA 2WINI 1THRH 6CHAB 4YOIA 4B75A 5C1YA 1O3OA 2TGTA 1DSTA 1GDNA 5F03A 1K0HA 2HNTF 1NESE 3QGJA 3RXPA 5T6DA 4F55A 1TA2A 5EODA 1D3QB 2JH0D 3SV7A 2PSYA 1JIRA 4X0WU 3C1KA 3URCA 3BTHE 2BDGA 2TGDA 1DXWA 2VIDA 4RKJB 1P3CA 1SGYE 4NSVA 1TNKA 5JB8S 4B74A 4X1RU 2A31A 4B2BA 2XBVA 2ANMH 3SUGA 1C5NH 1TOCB 1FPCH 3NRLA 4FUDA 2XOKD 1LVYA 1SB1H 2QXIA 1JOUB 4ABEA 1V2ST 2ZHDA 1NN6A 1HAHH 2OXSA 4AYYB 3SU2A 4ZHLU 1TX8A 2ESTE 2VVVA 2SNWA 3GCTG 1QRWA 4KGAA 1MBQA 1P2IA 2V3MA 1NRRH 4MNXA 2Z3CA 4GSOA 1TOMH 4NIYA 3MFJA 4GHQA 4RSPA 3N7OA 1O5BB 2ZWLH 1C5PA 4NFFA 1RRKA 5HKKD 1NRQH 3HATH 4FUEA 4D7GA 1DWEH 1TGNA 4X2VA 4OS2A 3DHKH 1W0YH 1Z8RA 5L2YH 2P8OC 1HAZB 5IYTA 3S0NA 1Y3WA 2VVCA 3F3BA 4K8YA 1QRZA 2YOLA 1XKAC 3PMBB 1FAKH 1G32B 1PPCE 1ZTKA 3RXUA 4AFSA 3LPRA 1QQUA 1GJ9B 3RXOA 1NRSH 1O35A 1C9TA 2D26C 2JH5D 4Y8XA 4WMDA 1BRCE 1ESBA 1O2WA 3VEQB 1GHXH 1C5ZB 1FI8A 5T3HA 1V2NT 1GJ6A 1HAIH 1RTLA 2FLRH 4MNWA 1GCDA 4WMFA 5HIZA 1FZZA 1KXAA 1EAUA 3RXJA 1BMFD 5AHGH 2FYQA 1YP9A 5C1XA 2ZP0H 3RXCA 3ZZ4A 1EFRD 3TK9A 3MU0A 2PKAB 2ZCKP 1JWTA 3RUOA 2Y80A 1QNJA 2V35A 1AO5A 1G30B 1V2MT 4GPGA 1BHXF 2W7UA 1C2DA 2YNAA 3UQVA 3OY6U 3L33A 6LPRA 1P12E 1O2OA 1KXCA 1SLUB 3BSQA 2FS9A 1C2LA 4I8LA 2I6SA 2VNTA 1F0TA 1HV7A 5ABWA 1KDQB 2FTLE 2G4UA 5C1UA 3SGQE 1C1MA 1CBWC 5LGOA 1GWAA 2VIVA 2Z9GA 1EX3A 1TPPA 4AB9A 1NFXA 3R0FA 3S9AA 3MNCA 1A61H 4CRCA 1FN6A 1ELVA 1O3AA 2GMTB 2BD9A 2OC8A 1KXFA 2SNVA 5H4IB 1WTHD 2VINA 4OGYA 1F0SA 1O36A 4Q7YA 1TIOA 1YC0A 1WOFA 1O5DH 2OC7A 3TIUA 3URDA 1YPEH 5T6GA 4Y6DA 1E1RD 5EPYA 1EP6A 1FAXA 3SU4A 1WQVH 3M5NA 5GWZA 2ZF0H 3LGWA 1EPTB 1AVWA 2GKVE 2ZGBH 4MDSA 4XBBA 1TE0A 5BRRE 1C2IA 1W3CA 5T1VA 1HYLA 2GGVB 2F9UA 1N6XA 1V2TT 1AE5A 2Z3EA 3QTVH 3VB5A 4FXGH 3WY8A 4UD9H 5EQRA 1ELEE 2RG3A 1TBQH 3NZIA 1N6YA 1SGTA 1IQHA 2A5KA 4B6FA 1MZDA 5DPAA 2R3UA 4WF8A 2H6MA 1D3TB 2QXJA 2BDIA 3BTTE 2VU8E 4DG4A 3UNQA 4FU7A 1BTUA 1BBRE 2STAE 1HAYB 2GMTC 3UWJH 2XBXA 1ZRKA 1CA8B 2J92A 2AS9A 3M61U 4Q63A 3A89A 2C8ZB 3KHVA 1F0RA 2OINA 2JKHA 1YLDA 1GVLA 1N8OB 2JIZD 3RXMA 1C5OH 2FDAA 2IJOB 3A8BA 1ESAA 4HFPB 5TCCA 1FY5A 3RXTA 4Y71A 3HKIB 1MKWK 2F9NA 1EPTC 2ASUB 5EQQA 1LVOA 1O2RA 2WUBA 4JYUH 3SJIA 2NU1E 4M7GA 5DG6A 4K8BA 4AG2A 3FZZA 5GCHF 1OOKB 4THNH 1O2XA 1GBFA 9ESTA 3U8TH 3L6PA 1O2TA 1KTTB 2ZDAH 4LK4A 1H8DH 3P95A 1GBJA 2GZ7A 2IPQX 2J38A 3GCHB 4OS6A 2BQWB 3U28C 1LPZB 2DE8A 1Y5AT 3SV9A 1UTPA 1WV7H 2QY0B 1QBNA 4Y8ZA 2DUCA 1FJSA 2WPIS 1O2YA 1A3BH 1WDIA 3SJ9A 1C5RA 3Q77A 3SN8A 3M5LA 1HFDA 1BMNH 1V2KT 3SU1A 2Q6GA 1LPKB 2ZQ1A 2A4GA 2UUJB 2FOBA 3S9BA 1KXBA 5CHBA 4YM9A 2FZZA 1OYTH 2FPZA 4ACAA 1N8OC 3ZVCA 3T5FH 4P00A 3ITIA 1O5EH 1C1TA 1GI6A 3NK8A 3LGIA 1A3EH 1BTPA 1H8HD 1LHEH 3F9GA 3K65B 3TJUA 5CMXH 3PROA 3Q3XA 1BBRH 1C5QA 4UEHH 2EQNA 4RT0A 1P2MA 2BYAX 4I8KA 3W1EA 1GVZA 4WJG2 4JZ1A 4JK6A 2AMDA 3RXEA 4DURA 1F7ZA 4TSFD 1DSUA 1GHWH 1SGNE 1P8VC 5I46H 1P9UA 1YLNA 3PRBA 2F83A 1MCVA 4BXSA 5L30H 3DUXH 3RU4T 1O3MA 1IHTH 2OTVA 3SU3A 1BZXE 2CV3A 3GCHC 2FOAA 1OP0A 4GVUA 1TRYA 2NWNA 3SNDA 4ABDA 1NROH 5GIBA 1SQOA 1LDTT 1MUEB 5EXLA 1XKBC 3IITA 3EAJA 3M3TA 4BAOB 3MNXA 3KCGH 1VJ9U 2UUFB 1GJCB 3K9XB 3A7WA 4INLA 4NZLA 1QQ4A 1AMHA 4X8SH 1O39A 4HGCA 4U2WA 1BRAA 3ODDA 2ZPQA 4U01A 3R3GB 3S7HB 3EE0B 2L74A 1CHGA 1NFUA 2H1UA 1Z6JH 3GDUA 2BX4A 1D3PB 3JZ1B 4BANB 2B0FA 4AFUA 2G8TA 1P06A 2C8XB 2FLBH 1QB9A 2AHME 2XNIA 1IQGA 3DSOA 1C1RA 2XBWA 2ZDLA 1HBTH 5FPYA 2SGEE 4CREA 1GJ5H 2Q6FA 1O32A 2SFAA 2ODQA 1THSH 3DSPA 1V2VT 2PW8H 4I32A 4I8HA 1EOJA 1V2RT 1DANH 1HAOH 5C20A 1AE8H 3KGPA 3MO6A 3OX7U 1QB6A 3GY6A 5EOKA 2ZU2A 1A1RA 2ZHFH 2G00A 1BOQA 2GV6A 1ZYOA 1DWDH 6GCHF 3T62A 3BEIB 1P04A 1C2GA 3LC3A 1QRXA 3OYPA 3HKJB 4O03A 3D65E 2EEKA 3MU8A 1A5GH 5F53A 3FO8D 1GMDF 1T4UH 1PQ8A 3PTNA 2FS8A 3S9CA 4ASHA 1S6HA 3TK6A 1KXDA 4WY3A 4I33A 1EAIA 2ANWA 2QF3A 2FESH 1P10A 3SUEA 1L1GA 2BDAA 1G9IE 2NU0E 4YLQH 1MABB 2TGPZ 2FOEA 2BQ7B 5EPNA 3A80A 3ZZ9A 3E1XB 5F8TA 1ELFA 2ZC9H 4ZHAA 3VG8A 1QB1A 1ELCA 5C5NA 1O2MA 1A2CH 3QX5H 3KQEA 1W2KH 1Q31A 4DIIH 1DWCH 1O33A 3M35A 3N99A 1GVKB 3NPSA 1WBGB 1SQRA 1XUJA 1TX6A 3PLKA 4NFEA 8GCHG 1TNGA 3ZYEA 4X1QU 3UR6A 4XBCA 1IQFA 3GDSA 4A6LA 1K22H 5IDKA 3BIVH 4OS5A 1W0ZU 3GCOA 1C1WH 3KF2A 1YM0A 1F5RA 1UVOA 1MTUA 2BM2A 5JBBS 1BRUP 3E90B 1LHFH 2EI8A 3ZZAA 5G4BA 1GHAG 2PSXA 4ZKOU 2BX3A 1EZSC 2QXGA 1AWFH 5K0HA 3SUFA 1DOJA 3TGJE 1GBCA 4DJZB 1O2ZA 1LHDH 4IS5A 1A5HA 4CRBA 2QV1A 1TGBA 5FCRA 3S7KB 5ETXA 1AY6H 1UVPA 2BY7X 1HNEE 2EI7A 1VCQA 4TT3D 5JBCS 2HVYB 2FX4A 3HGPA 3MMGA 4F4OC 3P8OA 3MH4A 2FI5E 2ZTZA 3PMHB 2D2DA 3ZZBA 4IC6A 3U8OH 1PPBH 4JCNA 3M7QA 1MKXK 1F5KU 5DN6D 1D3DB 4K5ZA 5C0UA 4CBOA 1C5TA 3I29A 5L2ZH 1QL8A 5E8EH 6ESTA 3MH6A 2XYAA 3UOUA 1BA8B 4WXVA 1XUFA 4UFEH 1XUHA 3A8CA 4GCHG 4TY6A 2VB0A 4BAMB 2BLOA 2VIOA 3W94A 1PQ7A 3E91A 1H9IE 4HI3A 4NA9H 2P16A 4XDEA 3RXQA 3NKKA 1Q2WA 2GV7A 3KEEA 3GY7A 3BTGE 1HJ9A 5SGAE 3RC4A 5A0AE 3UPEA 1EUFA 1UTLM 1FPHH 1GJ4H 3UREA 1S6FA 4BXWA 4AX9H 4X6OA 3SV6A 1QFKH 5DJ7A 4UFDH 2J98B 1NM6A 2PUXB 4K2YA 1E0FD 1GL0E 4D9RA 3F6UH 3LH3A 3TJVA 4Y0ZE 4KKDA 4XD7D 1LKBA 3NWUA 2PLXA 5HYOA 4FUGA 1TGTA 1VKYA 2BY8X 3U1IB 1F2SE 2TRMA 1PPFE 1O3HA 2OC0A 2JDID 2CJIA 2BZ6H 1GHVH 1GMHF 2ZU5A 1C1VH 2FTMA 4Q2KA 3MYWA 1NFWA 1QCPA 3UOPA 5DP5A 1HAPH 2H5DA 1SGIB 1T8LA 5AFZH 5ESBA 3UAIC 3E3TA 2CXVA 1CVWH 2GCHF 5EW2H 2V7QD 1SSXA 4ISHH 1UCYK 1AIXH 1BRBE 4ISIH 1S81A 1XMNB 1MD8A 1HLTH 4CRAA 1UHBB 2O8MA 2ANKH 2THFB 1X7AC 5FXLA 2WPKS 3SOSA 3STJA 3A86A 4RT1A 2PHBA 2KCPA 3SU6A 1MTNC 1K1LA 2J97A 1L4DA 3A7VA 1EZQA 3GISB 4FUCA 3RDZA 3CS0A 1UTNA 3GYLB 2TGAA 4GLYA 2R0LA 4TPYA 3ZVEA 2HLDD 2FODA 3RM2H 4YTAA 3MHWU 1TGCA 5E0HA 2F9BH 1GJAB 5DP7A 5HM2A 1YPHC 5JBAS 4IN1A 3M7TA 4WXIA 4Z6AH 1W14U 5FPSA 4ABHA 5EGMA 3MU4A 2AERH 3SGBE 1W13U 4ZHMU 1OWJA 2A7CA 2AGGX 1TONA 4CR5A 3ZVBA 1KXEA 1JRTA 2GCHG 1AVGH 4UE7H 3PB1E 1MTWA 2GP9B 1VCWA 1BJVA 3JZ2B 1CT2E 2HRVA 2TBSA 1SL3A 3S69A 3F9EA 1DPOA 3EA9A 3HPTB 1XUGA 4BTIB 4IN2A 2P59A 4P02A 1GMCF 1J15A 1QJ6B 2AMPA 4FVDA 2VGCB 1FUJA 3GY5A 1H4WA 1XM1A 1CQQA 2ODYB 1SR5C 3DT0H 1ZLRA 2OP9A 1VR1H 3TGIE 5JYIA 3LU9B 3T26A 2BY6X 3LONA 3GCNA 1QR3E 2ZFQH 3B9FH 1AKSA 6CHAC 4NIXA 2QIQA 4IGDA 1FDPA 3KQCA 2H5CA 1VJAU 3DCLA 3AVZA 5EU8A 1PQ5A 2A7JA 2XC0A 4X6PA 2GJGA 1TNHA 1ACBE 4BTUB 5A0BA 1O2QA 2A0QB 3LGTA 4Y79A 1K1NA 1W10U 3H7TA 4XOJA 5A2MH 1HAGE 3KN2A 1UJ1A 1A0LA 1AB9B 2LNCA 2P3FH 1SLXB 4ZKSU 4BTTB 2G5NA 1SLWB 3I77A 3SU0A 2BDCA 3IG6B 3PMAB 2A32A 5A0CA 2Q1JA 3E8LA 1XXFA 1RTFB 3ATWA 4Y76A 3P8GA 1ZHPA 3VPKA 1IQMA 1O5CB 1HXEH 1S5SA 2Z6BD 2GVFA 1GBBA 1ZMNA 3K6ZA 4Y0YE 2W26A 1SC8U 3GY8A 1FIWA 1HJAB 2IOTA 4BAHB 2OD3B 3K2UA 1ZHRA 3A83A 5J4SA 1EJAA 2FMJA 1E35B 3RXAA 3ATKA 2P94A 1FMGA 2FOCA 1AU8A 2L6OA 2BD8A 2F91A 2OBQA 2A5IA 4X1NU 1GJBB 3V13A 1A46H 2FOMB 3D62A 1YPHE 2PGBB 3M7UA 1O5GH 3VB4A 4DIHH 3QK1A 1T7CA 2OCVB 1HJ8A 1WXRA 1Z1IA 2O8TA 4O97A 1KY9A 1HIAB 2YMSB 5IK2D 1Z6EA 1TMUH 4BOHA 1BTHH 3VFEA 5DP8A 4A1VA 4RKOB 3TU7H 3N7DA 3VGCB 1GGDB 4ABJA 2FP7B 3M5MA 3OEED 3SHCH 1GI4A 2SGQE 3ATIA 2QF4A 1G36A 1VZQH 2FX6A 1K21H 1EATA 4I8JA 1D4PB 1GG6B 1C4U2 1LQEA 1SG8B 1WUNH 1TGSZ 1C2JA 1UK3A 3P92A 2NU4E 4Z1MD 3PV5A 1INCA 1HJAC 1GI9B 1SOZA 3OU0A 4MQAA 1TBRH 4DW2U 2FYRA 1O5AB 2W5EA 4D76A 1NFYA 3SJOA 1BUIA 1P2JA 1S6LA 2P93A 1C5SA 4BNRA 1H9HE 3BF6H 4NSYA 3A8DA 2PGQB 1VITH 2VWLA 2ZCHP 3O8DA 4FETA 3OFND 3A82A 2WPDD 5HM9A 3TPIZ 4ZKNU 3UFAA 1K1JA 2CGAA 1W0KD 3BEUA 3G01A 1WCZA 3SNBA 3EGKH 3TH3H 1ELBA 9LPRA 5JBTA 5DP3A 1AZZA 4JK5A 1O3LA 4H6TA 1TRMA 1AUJA 1GGDC 3GOVB 4K60A 3VGCC 1CT0E 2BOHB 3EYDA 4CRFA 1HAVB 3SORA 5AVDA 1UCYE 2G4TA 1MKXH 1FNIA 5FX5A 3LOXA 1Y3VA 1E38B 3SZEA 1O3BA 3ZZ7A 1UO6A 1JMOH 2A45B 1GG6C 3SV2H 3TGKE 3QDZB 2KAIA 5EQSA 1SFIA 5DP4A 4YT7H 1E79D 1O2LA 1BIOA 3FAOA 1TX7A 3SU5A 2Y82A 5GDSH 1ZPBA 1AWHB 2Z9IA 3MNBA 2WPHS 5ESTE 4JZDH 4MPWA 2W6ID 3Q3KA 4SGAE 2Y5FA 1GCTB 2CF9H 1ZGVA 1WTGH 3LGVA 5EXMA 3AK5A 1GBMA 3SQEE 1Z1JA 3UNSA 1QL7A 3N7EA 3P17H 2CHAB 3T29A 5EJ1A 2ZU1A 3F2HA 2BD7A 1ELTA 5LPEA 1LO6A 3BIUH 1GJDB 2ZA5A 4E7NA 1P05A 1P03A 1V2QT 4ASUD 2HPPH 1SGEE 2PFEA 2P3UB 2ZU3A 1GBLA 2AGIX 1O3GA 2OUAA 2G52A 3CP7A 3PM3A 4INKA 3A84A 2KCAA 2STBE 5GPIB 2A5AA 2UWLA 4UFGH 4X8VH 3HGNA 2G5VA 4ZAEA 3ATMA 1CO7E 4DOQA 1JIMA 1KLIH 4Q80A 4JMYA 3U98H 2B5TB 5F8ZA 7LPRA 1GDUA 1RFNA 1SOTA 4Y10E 1SKYE 1IQEA 4KP0A 1O5FH 2PKAA 1QL9A 1SGRE 3TITA 1BMLA 1MAYA 1UVUH 1DFPA 1GCTC 3GICB 2C3SA 1SGFG 3AAUA 1UCYH 5GCHG 1YPJH 2ZNKH 1A0JA 4ZXXH 2BVRH 1UK2A 1PPZA 4WH8A 1OXGA 3FN8A 2HLCA 3BTQE 2ZU4A 2GT8A 2HOBA 1KDQA 4FVBA 5HGGA 4I8GA 5DGJA 3T25A 1KIGH 5K7RA 3RXGA 2FWWA 1PYTD 4K1SA 4Y7BA 2ULLA 2V3HH 3DSGA 1MZAA 4B6EA 1GHYH 2FOFA 1RS0A 2GZ8A 2Z9JA 1S85A 1ID5H 2UUKB 1SGQE 3UR9A 3V7TA 3ZIAD 4Q7XA 1ETSH 1A7SA 4NIVA 1WAYB 3M36A 7GCHF 1Z8GA 2FI4E 1TB6H 2WUCA 1HB0B 3DA9B 1O3PB 4X2WA 1AZ8A 2QYIA 1ETRH 2PKSB 3TH4H 1BB0B 1EPTA 3RXIA 1C1NA 3AW1A 4AB8A 5J4QA 1P2QA 2KCYA 1ZSLA 1CSOE 5EXNA 1HXFH 3UQOA 1ANDA 1IQLA 1RIWB 3MU1A 1SPJA 3VXFH 1H8IH 1C4Y2 3PTBA 3W95A 5FX6A 1OS8A 3RC6A 5I25A 1O30A 3KYGA 3KL6A 1NRNH 2XC4A 4D9QA 1ANCA 3PLBA 3ZZCA 2ZGHA 3UUZA 4A1XA 1P11E 2BQ6B 1K1PA 3VXEH 8LPRA 8KME2 1ZRBA 5KECA 1L0ZA 1UTKA 1BDAA 3A8AA 1QBOA 1Z7KA 2K0QA 1LKAA 2R2MB 3NXPA 4FU8A 1LHCH 4JZIA 1G2LA 5FCKA 4DT7B 1SGFA 1EP5A 2WZQA 3ELAH 2JJ1D 2JH6D 7GCHG 2AMQA 1SHHB 1F92A 1Y3YA 2BD5A 5KGOA 1LQDB 3SV8A 2PKSC 3PV4A 1O2NA 4CH8B 2V3OH 3QLPH 1EZUC 2KM0A 3FOAA 3SZNA 1RIWC 3QGNB 1GBTA 2ZQ2A 3KQDA 2R2WU 3ZZDA 3F0OA 5A09A 2HPQH 4MPXA 1B0FA 1NO9H 1GBEA 4AGJA 1WQSA 2F3CE 4QT8C 2LP6A 2VIWA 4IBLH 5FBIA 3SJKA 1W8BH 1L1NA 1G2MA 2WSSD 4Q4LA 3UWIA 2ZI2H 1SGPE 1CU1A 2NU2E 3A88A 3Q76A 2WPJS 3P70B 2ZGXH 3V3MA 1AN1E 3TJNA 3ZZ6A 4ISOA 1O2HA 1DX5M 1OP8A 5C2ZA 3FKSD 3ZVAA 2VWNA 1E34B 2A4QA 2GT7A 3IWMA 6GCHG 1QJ7B 1H8ED 1ZGIA 4OS4A 4NA8A 1J14A 1HRTH 2G55A 1D9IA 3RXKA 1PQAA 5CHAB 4B71A 1GMDG 4NIWA 2HVXA 5A8XA 4MPUA 2O9QA 1P9SA 3AW0A 2Y5GA 2ZKSA 3SUDA 2AYWA 1TABE 3F68H 7ESTE 2C4FH 1O38A 2ZFPH 1G3CA 3DFLA 4O3UA 3RMOH 1V2LT 2XXLA 5B6LA 1GPZA 2KX4A 3PMJA 4DVAU 3F2FA 1VCPA 1CT4E 2H9EH 2QE7D 1O3IA 2XBYA 1ZR0A 1P3EA 1XXDA 2BZAA 2ZTYA 1B0EA 1LPGB 2ZFTA 2QXHA 3O8BA 3Q00A 4Y8YA 4ZUHA 1O3KA 5DP9A 1C5UA 1DT2A 2CN0H 1ZHMA 3M5OA 1BTXA 1FLEE 3BG4B 3B23B 4U30A 1GBKA 1YYY1 2O8WA 3RXDA 3FP6E 1C4V2 1BTWA 3HK6B 1TBZH 5CHAC 1DDJA 2RDEA 2XCNA 3UB0A 2GDDA 1AUTC 1WSSH 5CDFE 4ESTE 2A2QH 1SBWA 2BVXH 2BDYA 3EA8A 5DKMA 2YNBA 4I31A 2M2AA 4OM9A 1FY1A 3OTPA 3RMLH 3AAVA 3RLYH 1TMBH 3BTWE 2FEQH 3EA7A 1TALA 2FI3E 2ODPA 2J5UA 3LC5A 2TPIZ 2D1JA 1MTVA 4UONA 2YMSD 5EJZA 5L6NH 1FV9A 1J16A 3E0NB 4KTUA 1CA0B 1O2GH 4A92A 4RN6A 4K1TA 1C5LH 1MKWH 4LOYH 4YLUA 1BT7A 4BAKB 1VITF 4MVNA 3MI4A 4FUFA 1DS2E 4UDWH 4XBDA 1LVMA 5JDUB 1YWUA 1O0DH 2ZPRA 3DFJA 1XX9A 3U8RH 2J94A 8ESTE 3BG4C 4O3TA 2BLWA 3RXVA 1QZ8A 2WV5A 4KTSA 4XSKU 1RGQA 5DO4H 1PYTC 5E0JA 2ALPA 3QUMP 2W3IA 3BTME 1FY3A 1LMWB 1P01A 1T8MA 4JZFH 1W7GH 4E05H 1RD3B 1O2JA 1Y59T 1THPB 1P2NA 1AI8H 1V2OT 2PTCE 1OP2A 1DVAH 1BCUH 3HK3B 2ZHWH 2XWBI 4FOUC 1BBRK 1ZMLA 3P6ZB 4B2AA 3PWCA 4TWYA 1DWBH 1C5VA 4I7YH 3STIA 2WYGA 2EC9H 1GJ8B 1CGJE 2QGRA 1QIXB 1NBMD 1O2VA 2WHXA 4UFFH 2VWOA 2H2ZA 1GI7B 3SQHE 2SGFE 1Q3XA 1C5WB 4H6SB 3RMMH 1UK4A 2P3TB 2W7SA 1YCPK 3O8RA 4H42U 1ZOMA 1K2I1 3NCLA 3LIWA 1AD8H 1F0UA 1GMHG 1UTOA 1EJMA 5JB9S 3KQ5A 2I6QA 4Q7ZA 3GCTF 1YCPM 1SQTA 3H5CB 3GY2A 2ZDNA 4ABFA 1KYNA 1Z71A 2Z7FE 5F8XA 5E0GA 2GTBA 2Z94A 2B7DH 4WVPE 2CMYA 4X1SU 1SFQB 5HXFA 3BTEE 3RC5A 2BD4A 1BQYA 3WWBA 2P8OB 2RA0A 1MD7A 4X2YA 3H7OA 2BOKA 2ILNA 1DXPA 2ZZUH 1Y5UT 2SGAA 4Y11E 2CK3D 1QHRB 3SHAH 3A7ZA 4HG6A 4ABIA 3T2NA 1ETTH 1K1IA 1V6DA 1FY8E 1C2EA 2BDHA 1OSSA 2PV9B 3CNRA 3NUMA 4ZH8A 2VJ1A 4RI0A 3MU5A 4BAQB 1PJPA 1P57B 2VH0A 2OLGA 4K3JA 4F48B 2C93B 5A8ZA 1YGCH 3P8FA 4B1TA 2ZTXA 2OQUA 3DD2H 2IJD1 1UW7A 2QAAA 3RXLA 1ARCA 4AN7A 3OY5U 2OBOA 2KAIB 2HNTC 4NZQA 4IMZA 1IAUA 1TMTH 1S0QA 2FO9A 1O3FA 1OX1A 5EJLA 5C3NA 3SNEA 4NCYA 1LHGH 5LH8A 1IOEA 1ABIH 3GS9A 3RP2A 2EA3A 3A85A 1GI5A 1KLTA 3RXSA 3OSYA 2P95A 3PYHA 3PV2A 4OS7A 2F9PA 1NZQH 3KYFA 1GL1A 2BXTH 3TVJB 1A4WH 1SMFE 1TPAE 1NT1A 1CBWB 1GJ7B 1O3EA 1XVOA 1GMCG 1NC6A 1L2EA 2D8WA 3LGUA 4DGJA 4FUJA 1ZJKA 3F0PA 2VH6A 2BMGB 1GI3A 2VGCC 1K1MA 2KR7A 3PO1B 1Z8IB 1M9UA 2J98A 1G37A 3RU4D 1JBUH 4NGAH 3LT3A 1BHXB 1NU7B 2XTTB 1TQ0B 1GI2A 2ZGJA 1ANBA 3MH7A 1U6QA 4CRGA 4ABBA 1DLEA 5T6FA 1NY22 3B8JA 1ZZZA 4SGBE 1ELDE 1XUIA 2F43B 1HAXB 1YLCA 2F4LA 4TWWA 5FPTA 1O37A 2AIPA 1W11U 1O3JA 1L1JA 2A7HA 5BPEA 3ZVGA 1MMJN 1H9LB 1V2WT 3FFGA 4K1EA 1AFQB 1YF4A 1VGCB 1GHBF 3FZDA 1AB9C 3O8CA 2GCTB 3MO3A 1UTMA 1FONA 4AGKA 4GUXA 1MAXA 2PTNA 2JJ2D 3TNSA 1O2PA 1T8NA 5FAHA 5LPFA 2ZGCA 4IMQA 1UHBA 1ELAA 3C27B 4ZCNA 1AVXA 1UTQA 3ESTA 1OWIA 3LKWA 1NTPA 3VB6A 2BY9X 3LH1A 1IQIA 1DM4B 4AORA 1C5MD 4AZ2B 1C1QA 1QA7A 2V6NA 3PO1C 4MTBA 1T31A 2BDBA 1C1PA 1ZSKA 4XRNA 2FIRH 3GY3A 4XE4A 3RXHA 3BEFB 2F9VA 1LCYA 3MOCA 2Q6DA 4WMEA 3PLPA 3FP7E 3ZZ5A 3PWBA 1UVSH 1TNLA 1DY8A 3GDVA 1H1BA 5LPRA 2KFWA 1O3DA 1DUAA 2HNTE 2FM2A 1S83A 3MTYA 1AHTH 1O2UA 4AOQA 2EY4C 1P0SH 1EB1H 3RM0H 1QBVH 1GHBG 2BXUH 1AFQC 1CGHA 1VGCC 2YMSC 4NG9H 5EG4A 2GCTC 1WYKA 3A7XA 2UWOA 2G81E 3T28A 4IW4E 4CR9A 4E06H 1QJ1B 3M37A 1O3CA 3OE7D 2ZDKA 2AEIH 2W6JD 1N1LA 1P2OA 1ARBA 1C5YB 3TLOA 2Y7XA 1G3DA 1D6RA 1GBIA 4NA7A 4YESB 2QA9E 1OWEA 1MH0A 1JXPA 2OK5A 1WU1A 3SI3H 1RJXB 2CF8H 1RXPA 2ZO3H 5CE1A 3FVFB 4ISNA 1LVBA 1PFXC 3H09A 2PUQH 4DT4A 3LJJA 2BB4A 3BTDE 4ZMAH 1OWHA 3MNSA 1UTJA 1YPKH 4LXBH 1T32A 4INHA 4FUIA 4KELA 2VIPA 1ABJH 1TNJA 5TCAA 1E36B 1FN8A 1S82A 2O8LA 5AF9H 2SGDE 1O2KA 1Y3UA 1YPGH 1IHSH 3D49H 3L3TA 2M5TA 1C1SA 1D6WA 1UVTH 2F9OA 4CRDA 3F9HA 1TAWA 4GHTA 1S0RA 3A87A 4CHAB 2Z9KA 4ZKRU 1TLDA 5EIYA 1FXYA 2A1DB 1J8AA 1BMAA 4TPIZ 3F9FA 3MWIU 1MU6B 1TPOA 1BTYA 1B7XB 4YZUA 3M3VA 1KMHB 2AIQA 2FXRA 4B2CA 1P09A 3I78A 3GY4A 1V2PT 1KTSB 1A5IA 3E0PB 2BTCE 2FOHA 4J2YB 4A1TA 2CHAC 1BITA 2VBCA 2VVUA 2NU3E 4AYVB 2IPHA 2ZFRH 1HUTH 4B76A 3OAAD 4ZROA 4HZHA 4D8NA 1PPEE 3RXFA 4AFZA 2WV9A 1HIAA 4ZXYH 2WYJA 4AC9A 2J2UA 4X6MA 2WPLS 4KTCA 1MQ5A 2SGPE 4LZ4B 2XCFA 5DK1A 2ZDVH 4I86A 5B6OA 4MG3A 2HWLB 3TNTA 1AGJA 3SNAA 3ZV8A 4X8UH 1GHZA 1SHYA 1EAXA 1XVMA 3TJOA 5EW1H 1DITH 4CHAC 1YCPH 2BD3A 3T27A 4XFQA 1FY4A 2FOGA 5KEDA 1OKXA 1AFEH 3MO9A 2QC2A 4E7RG 3P8NA 2B9LA 1GI0A 1NPMA 2ZEBA 1DICA 3K6YA 4M9FA 1IQNA 4H4FA 2ZDMA 4CBNA 1S84A 3EDXB 2HGTH 1G3BA 2WPMS 1T8OA 3ZV9A 1ZSJA 5FBEA 4A7IB 2HALA 2J4IA 1OYQA 4YO9A 1NRPH 1TQ7B 3SNCA 1HCGA 1HGTH 1EASA 4MLFB 2GD4B 4NWKA 1ANEA 4ABGA 5DSFA 1ZPZA 2GZ9A 2A4OA 1IQJA 3V0XA 1YBWA 2XRCA 1JRSA 1K9OE 1ZTJA 2ZG0H 2UWPA 3FP8E 1EJNA 1V2UT 5GXPA 4K69A 4MNYA 4R8TB 1NBME 4FU9A 1O2SA 3KQBA 1PPHE 4X8TH 4X1PU 4WH6A 4OGXA 5PTPA 3WW7A 2RFKC 1MQ6A 1O3NA 4FUBA 5GJ4B 1HAVA 1SGDE 2JETB 4GAWA 3RXBA 1K1OA 3UTUH 2BVSH 3SI4H 1MTSA 1OHHD 2VWMA 4ACBA 1TA6A 3ATLA 1SGCA 4LZ1H 1Y8TA 1TNIA 1HPGA 1SLVB 3SGAE 2DE9A 2XW9A 1C9PA 4ISLA 1Y3XA 1NS3A 1O34A 4B73A 5C94A 3ODFA 2ZFSA 2QCYA 3KNXA 1OWDA 1W12U 8GCHF 4DCDA 3UNRA 1E1QD 1L4ZA 1CE5A 2UUYA 3LJOA 4YT6H 1TPSA 1A0HB 1MCTA 2Y6TA 1F5LA 2ZCLP 1KLJH 2QN5T 4Y7AA 1IQKA 3EE7A 1GHAF 1YKTA 2K1QA 1OWKA 3E6PH 4OS1A 1QA0A 2W3KA 5E2PA 2PP6A 4IC5A 1TFXA 3A7TA 1QGFA 2C8WB 1ESTA 3AASA 2JETC 1NU9A 1MBMA 1TRNA 2H9HA 2QF5A 1FQ3A 2LPRA 3ZZ8A 1J17T 2A2XH 1C2HA 2ZHQH 1C1UH 2K8IA 3WWFA 2O8UA 3ZYDA 5E2OA 2BLQA 4R0IA 1KSNA 4F49A 4X6NA 2H9TH 3GYMA 3BTKE 1GBAA 4X2XA 2EI6A 4J1YA 4CH2B 2R3YA
chains in the Genus database with same CATH topology
1XUKA 1RTKA 5HMAA 3EQ0H 2BD2A 4MPVA 2XWAA 1FIZA 2XC5A 4GCHF 3LGYA 1GBDA 4TY7A 4DY7B 3U1JB 4JYTA 1TYNA 3E16B 1P2KA 1V2JT 2QF0A 2Y7ZA 1G3EA 3RU4E 3ZZ3A 1EZXC 1SQAA 1CHOF 4WWYA 3UY9A 5C67A 1GI1A 1O31A 2PWXA 3ENSB 2C8YB 1LTOA 3BTFE 3U69H 3SO3A 4O9VA 4YOJA 2C90B 3QTOH 1Z8JB 2B8OH 1ELGA 2ZPSA 5JPMH 2J95A 2ANYA 3VB3A 3ZVFA 1C2KA 3VB7A 3UIRA 3A7YA 2BHGA 5DP6A 1EXFA 1AKSB 2GX4A 1HDTH 4AG1A 1Y5BT 1QURH 3CENA 3SW2B 4FUHA 2WV4A 1ZMJA 3CS7A 7KMEH 2G51A 3BG8A 3RLWH 2IN2A 4A5TS 1YPMH 4VGCB 3SBKA 1W7XH 2BY5X 2J34A 3QWCH 2TIOA 1ORFA 1QY6A 1YPLH 3D23A 4YOGA 2Y81A 3FANA 1DLKB 1C2MA 3SJ8A 3QZRA 4Z0KA 5F6MA 2A4RA 2ZECA 3U9AH 1ZTLA 2Z9LA 2OC1A 1B5GH 1CHOG 2R0KA 3BN9A 2AH4X 2BLVA 1QTFA 1UMAH 1OPHB 2Y5HA 4ABAA 1SVPA 3V12A 1MTNB 2Z3DA 1MU8B 1DUEA 1EQ9A 4TYDA 2V0BA 3ZVDA 2AFQB 1GI8B 2AGEX 3BV9B 2GDEH 2ZIQH 3MH5A 1J9CH 1O2IA 3TK5A 5C5OA 1AQ7A 3QO6A 2OQ5A 2RCEA 1TWXB 1P02A 1ZPCA 5A8YA 1T4VH 1C5XB 3QZQA 1PPGE 4AFQA 3Q3YA 4D7FA 1C2FA 1EAWA 2ZHEH 1GDQA 4VGCC 3TH2H 3F1SB 5TJXA 1GBHA 2RDLA 3KIDU 4NWLA 2ALVA 2R9PA 1V3XA 1BJUA 2J9NA 3RXRA 1EOLA 4U32A 4JYVH 4JZEH 1K28D 1DE7H 1E37B 1EKBB 2ZFFH 1BTZA 1CA0C 3QN7A 1VITG 1BMMH 3LDXH 3M3SA 2PR3A 4PROA 1C1OA 3RMNH 5FHTA 5AFYH 2VIQA 1DY9A 3A81A 4MNVA 1ZJDA 2RA3A 1EB2A 1CGIE 4HTCH 3OTJE 1SI5H 2WINI 1THRH 6CHAB 4YOIA 4B75A 5C1YA 1O3OA 2TGTA 1DSTA 1GDNA 5F03A 2HNTF 1NESE 3QGJA 3RXPA 5T6DA 1TA2A 5EODA 1D3QB 2JH0D 3SV7A 2PSYA 1JIRA 4X0WU 3C1KA 3URCA 3BTHE 2BDGA 2TGDA 1DXWA 2VIDA 4RKJB 1P3CA 1SGYE 4NSVA 1TNKA 5JB8S 4B74A 4X1RU 2A31A 4B2BA 2XBVA 2ANMH 3SUGA 1C5NH 1TOCB 1FPCH 4FUDA 1LVYA 1SB1H 2QXIA 1JOUB 4ABEA 1V2ST 2ZHDA 1NN6A 1HAHH 2OXSA 4AYYB 3SU2A 4ZHLU 1TX8A 2ESTE 2VVVA 2SNWA 3GCTG 1QRWA 4KGAA 1MBQA 1P2IA 1NRRH 4MNXA 2Z3CA 4GSOA 1TOMH 4NIYA 3MFJA 4GHQA 4RSPA 3N7OA 1O5BB 2ZWLH 1C5PA 4NFFA 1RRKA 1NRQH 3HATH 4FUEA 4D7GA 1DWEH 1TGNA 4X2VA 4OS2A 3DHKH 1W0YH 1Z8RA 5L2YH 2P8OC 1HAZB 5IYTA 3S0NA 1Y3WA 2VVCA 4K8YA 1QRZA 2YOLA 1XKAC 3PMBB 1FAKH 1G32B 1PPCE 1ZTKA 3RXUA 4AFSA 3LPRA 1QQUA 1GJ9B 3RXOA 1NRSH 1O35A 1C9TA 2D26C 2JH5D 4Y8XA 4WMDA 1BRCE 1ESBA 1O2WA 3VEQB 1GHXH 1C5ZB 1FI8A 5T3HA 1V2NT 1GJ6A 1HAIH 1RTLA 2FLRH 4MNWA 1GCDA 4WMFA 1FZZA 1KXAA 1EAUA 3RXJA 5AHGH 2FYQA 1YP9A 5C1XA 2ZP0H 3RXCA 3ZZ4A 3TK9A 3MU0A 2PKAB 2ZCKP 1JWTA 3RUOA 2Y80A 1QNJA 2V35A 1AO5A 1G30B 1V2MT 4GPGA 1BHXF 2W7UA 1C2DA 2YNAA 3UQVA 3OY6U 3L33A 6LPRA 1P12E 1O2OA 1KXCA 1SLUB 3BSQA 2FS9A 1C2LA 4I8LA 2I6SA 2VNTA 1F0TA 1HV7A 5ABWA 1KDQB 2FTLE 2G4UA 5C1UA 3SGQE 1C1MA 1CBWC 5LGOA 1GWAA 2VIVA 2Z9GA 1EX3A 1TPPA 4AB9A 1NFXA 3R0FA 3S9AA 3MNCA 1A61H 4CRCA 1FN6A 1ELVA 1O3AA 2GMTB 2BD9A 2OC8A 1KXFA 2SNVA 5H4IB 1WTHD 2VINA 4OGYA 1F0SA 1O36A 4Q7YA 1TIOA 1YC0A 1WOFA 1O5DH 2OC7A 3TIUA 3URDA 1YPEH 5T6GA 4Y6DA 5EPYA 1EP6A 1FAXA 3SU4A 1WQVH 3M5NA 5GWZA 2ZF0H 3LGWA 1EPTB 1AVWA 2GKVE 2ZGBH 4MDSA 4XBBA 1TE0A 5BRRE 1C2IA 1W3CA 1HYLA 2GGVB 2F9UA 1N6XA 1V2TT 1AE5A 2Z3EA 3QTVH 3VB5A 4FXGH 3WY8A 4UD9H 5EQRA 1ELEE 2RG3A 1TBQH 3NZIA 1N6YA 1SGTA 1IQHA 2A5KA 1MZDA 5DPAA 2R3UA 4WF8A 2H6MA 1D3TB 2QXJA 2BDIA 3BTTE 2VU8E 4DG4A 3UNQA 4FU7A 1BTUA 1BBRE 2STAE 1HAYB 2GMTC 3UWJH 2XBXA 1ZRKA 1CA8B 2J92A 2AS9A 3M61U 3A89A 2C8ZB 3KHVA 1F0RA 2OINA 2JKHA 1YLDA 1GVLA 1N8OB 3RXMA 1C5OH 2FDAA 2IJOB 3A8BA 1ESAA 4HFPB 5TCCA 1FY5A 3RXTA 4Y71A 3HKIB 1MKWK 2F9NA 1EPTC 2ASUB 5EQQA 1LVOA 1O2RA 2WUBA 4JYUH 3SJIA 2NU1E 4M7GA 5DG6A 4K8BA 4AG2A 3FZZA 5GCHF 1OOKB 4THNH 1O2XA 1GBFA 9ESTA 3U8TH 3L6PA 1O2TA 1KTTB 2ZDAH 4LK4A 1H8DH 3P95A 1GBJA 2GZ7A 2J38A 3GCHB 4OS6A 2BQWB 1LPZB 2DE8A 1Y5AT 3SV9A 1UTPA 1WV7H 2QY0B 1QBNA 4Y8ZA 2DUCA 1FJSA 2WPIS 1O2YA 1A3BH 3SJ9A 1C5RA 3Q77A 3SN8A 3M5LA 1HFDA 1BMNH 1V2KT 3SU1A 2Q6GA 1LPKB 2ZQ1A 2A4GA 2UUJB 2FOBA 3S9BA 1KXBA 4YM9A 2FZZA 1OYTH 2FPZA 1N8OC 3ZVCA 3T5FH 3ITIA 1O5EH 1C1TA 1GI6A 3NK8A 3LGIA 1A3EH 1BTPA 1LHEH 3F9GA 3K65B 3TJUA 5CMXH 3PROA 3Q3XA 1BBRH 1C5QA 4UEHH 1P2MA 2BYAX 4I8KA 1GVZA 4WJG2 4JZ1A 4JK6A 2AMDA 3RXEA 4DURA 1F7ZA 1DSUA 1GHWH 1SGNE 1P8VC 5I46H 1P9UA 2F83A 1MCVA 4BXSA 5L30H 3DUXH 3RU4T 1O3MA 1IHTH 2OTVA 3SU3A 1BZXE 2CV3A 3GCHC 2FOAA 1OP0A 4GVUA 1TRYA 2NWNA 3SNDA 4ABDA 1NROH 5GIBA 1SQOA 1LDTT 1MUEB 5EXLA 1XKBC 3IITA 3EAJA 3M3TA 4BAOB 3MNXA 3KCGH 1VJ9U 2UUFB 1GJCB 3K9XB 3A7WA 4INLA 4NZLA 1QQ4A 1AMHA 4X8SH 1O39A 4HGCA 4U2WA 1BRAA 3ODDA 2ZPQA 4U01A 3R3GB 3S7HB 3EE0B 1CHGA 1NFUA 2H1UA 1Z6JH 3GDUA 2BX4A 1D3PB 3JZ1B 4BANB 2B0FA 4AFUA 2G8TA 1P06A 2C8XB 2FLBH 1QB9A 2XNIA 1IQGA 1C1RA 2XBWA 2ZDLA 1HBTH 5FPYA 2SGEE 4CREA 1GJ5H 2Q6FA 1O32A 2SFAA 2ODQA 1THSH 4I32A 1V2VT 2PW8H 4I8HA 1EOJA 1V2RT 1DANH 1HAOH 5C20A 1AE8H 3KGPA 3MO6A 3OX7U 1QB6A 3GY6A 5EOKA 2ZU2A 1A1RA 2ZHFH 2G00A 1BOQA 2GV6A 1ZYOA 1DWDH 6GCHF 3T62A 3BEIB 1P04A 1C2GA 3LC3A 1QRXA 3OYPA 3HKJB 4O03A 3D65E 2EEKA 3MU8A 1A5GH 1GMDF 1T4UH 1PQ8A 3PTNA 2FS8A 3S9CA 4ASHA 1S6HA 3TK6A 1KXDA 4WY3A 4I33A 1EAIA 2ANWA 2QF3A 2FESH 1P10A 3SUEA 1L1GA 2BDAA 1G9IE 2NU0E 4YLQH 2TGPZ 2FOEA 2BQ7B 5EPNA 3A80A 3ZZ9A 3E1XB 5F8TA 1ELFA 2ZC9H 4ZHAA 1QB1A 1ELCA 5C5NA 1O2MA 1A2CH 3QX5H 3KQEA 1W2KH 1Q31A 4DIIH 1DWCH 1O33A 3M35A 1GVKB 3NPSA 1WBGB 1XUJA 1TX6A 3PLKA 4NFEA 8GCHG 1TNGA 3ZYEA 4X1QU 3UR6A 4XBCA 1IQFA 3GDSA 4A6LA 1K22H 5IDKA 3BIVH 4OS5A 1W0ZU 3GCOA 1C1WH 3KF2A 1YM0A 1F5RA 1UVOA 1MTUA 2BM2A 5JBBS 1BRUP 3E90B 1LHFH 2EI8A 3ZZAA 5G4BA 1GHAG 2PSXA 4ZKOU 2BX3A 1EZSC 2QXGA 1AWFH 5K0HA 3SUFA 1DOJA 3TGJE 1GBCA 4DJZB 1O2ZA 1LHDH 4IS5A 1A5HA 4CRBA 2QV1A 1TGBA 5FCRA 3S7KB 5ETXA 1AY6H 1UVPA 2BY7X 1HNEE 2EI7A 1VCQA 5JBCS 2FX4A 3HGPA 3MMGA 4F4OC 3P8OA 3MH4A 2FI5E 2ZTZA 3PMHB 2D2DA 3ZZBA 4IC6A 3U8OH 1PPBH 4JCNA 3M7QA 1MKXK 1F5KU 1D3DB 4K5ZA 4CBOA 1C5TA 3I29A 5L2ZH 1QL8A 5E8EH 6ESTA 3MH6A 2XYAA 3UOUA 1BA8B 4WXVA 1XUFA 4UFEH 1XUHA 3A8CA 4GCHG 4TY6A 2VB0A 4BAMB 2BLOA 2VIOA 3W94A 1PQ7A 3E91A 1H9IE 4HI3A 4NA9H 2P16A 4XDEA 3RXQA 3NKKA 1Q2WA 2GV7A 3KEEA 3GY7A 3BTGE 1HJ9A 5SGAE 3RC4A 5A0AE 3UPEA 1EUFA 1UTLM 1FPHH 1GJ4H 3UREA 1S6FA 4BXWA 4AX9H 4X6OA 3SV6A 1QFKH 5DJ7A 4UFDH 1NM6A 2PUXB 4K2YA 1E0FD 1GL0E 4D9RA 3F6UH 3LH3A 3TJVA 4Y0ZE 4KKDA 1LKBA 3NWUA 2PLXA 5HYOA 4FUGA 1TGTA 2BY8X 3U1IB 1F2SE 2TRMA 1PPFE 1O3HA 2OC0A 2CJIA 2BZ6H 1GHVH 1GMHF 2ZU5A 1C1VH 2FTMA 4Q2KA 3MYWA 1NFWA 1QCPA 3UOPA 5DP5A 1HAPH 2H5DA 1SGIB 1T8LA 5AFZH 5ESBA 3E3TA 2CXVA 1CVWH 2GCHF 5EW2H 1SSXA 4ISHH 1UCYK 1AIXH 1BRBE 4ISIH 1S81A 1XMNB 1MD8A 1HLTH 4CRAA 1UHBB 2O8MA 2ANKH 2THFB 1X7AC 5FXLA 2WPKS 3SOSA 3STJA 3A86A 2PHBA 3SU6A 1MTNC 1K1LA 1L4DA 3A7VA 1EZQA 3GISB 4FUCA 3RDZA 3CS0A 1UTNA 3GYLB 2TGAA 4GLYA 2R0LA 4TPYA 3ZVEA 2FODA 3RM2H 4YTAA 3MHWU 1TGCA 5E0HA 2F9BH 1GJAB 5DP7A 5HM2A 1YPHC 5JBAS 4IN1A 3M7TA 4WXIA 4Z6AH 1W14U 5FPSA 4ABHA 5EGMA 3MU4A 2AERH 3SGBE 1W13U 4ZHMU 1OWJA 2A7CA 2AGGX 1TONA 4CR5A 3ZVBA 1KXEA 1JRTA 2GCHG 1AVGH 4UE7H 3PB1E 1MTWA 2GP9B 1VCWA 1BJVA 3JZ2B 1CT2E 2HRVA 2TBSA 1SL3A 3S69A 3F9EA 1DPOA 3EA9A 3HPTB 1XUGA 4BTIB 4IN2A 2P59A 1GMCF 1J15A 1QJ6B 2AMPA 4FVDA 2VGCB 1FUJA 3GY5A 1H4WA 1XM1A 1CQQA 2ODYB 1SR5C 3DT0H 1ZLRA 2OP9A 1VR1H 3TGIE 5JYIA 3LU9B 3T26A 2BY6X 3LONA 3GCNA 1QR3E 2ZFQH 3B9FH 1AKSA 6CHAC 4NIXA 2QIQA 4IGDA 1FDPA 3KQCA 2H5CA 1VJAU 3AVZA 5EU8A 1PQ5A 2A7JA 2XC0A 4X6PA 1TNHA 1ACBE 4BTUB 5A0BA 1O2QA 2A0QB 3LGTA 4Y79A 1K1NA 1W10U 3H7TA 4XOJA 5A2MH 1HAGE 3KN2A 1UJ1A 1A0LA 1AB9B 2LNCA 2P3FH 1SLXB 4ZKSU 4BTTB 2G5NA 1SLWB 3I77A 3SU0A 2BDCA 3IG6B 3PMAB 2A32A 5A0CA 2Q1JA 3E8LA 1XXFA 1RTFB 3ATWA 4Y76A 3P8GA 1ZHPA 3VPKA 1IQMA 1O5CB 1HXEH 1S5SA 2Z6BD 2GVFA 1GBBA 1ZMNA 3K6ZA 4Y0YE 2W26A 1SC8U 3GY8A 1FIWA 1HJAB 2IOTA 4BAHB 2OD3B 3K2UA 1ZHRA 3A83A 5J4SA 1EJAA 2FMJA 1E35B 3RXAA 3ATKA 2P94A 1FMGA 2FOCA 1AU8A 2OBQA 2BD8A 2F91A 4X1NU 2A5IA 1GJBB 3V13A 1A46H 2FOMB 3D62A 1YPHE 2PGBB 3M7UA 1O5GH 3VB4A 4DIHH 3QK1A 1T7CA 2OCVB 1HJ8A 1Z1IA 2O8TA 4O97A 1KY9A 1HIAB 1Z6EA 1TMUH 4BOHA 1BTHH 3VFEA 5DP8A 4A1VA 4RKOB 3TU7H 3VGCB 1GGDB 4ABJA 2FP7B 3M5MA 3SHCH 1GI4A 2SGQE 3ATIA 1G36A 1VZQH 2FX6A 1K21H 1EATA 4I8JA 1D4PB 1GG6B 1C4U2 1LQEA 1SG8B 1WUNH 1TGSZ 1C2JA 1UK3A 3P92A </