2O9QA

The crystal structure of bovine trypsin complexed with a small inhibition peptide orb2k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title From protease inhibitor to antibiotics: single point mutation makes tremendous functional shift
rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA02
3Q3KA 1FIZA 2ZFTA 3SHAH 4KKDA 4K2YA 3MO3A 1SGCA 1W0YH 2D2DA 3RXPA 1ELVA 1LKBA 5T6GA 5C5OA 1XXDA 1TQ7B 1Z8RA 3ZYEA 3BEFB 3HGNA 3QGJA 4CRCA 1LTOA 1TRNA 2BQ6B 1O2YA 1VJ9U 1GJDB 1WAYB 1MTNC 3A85A 1K22H 1FZZA 2QXGA 1A7SA 3EYDA 3RU4D 2O8UA 1DPOA 1AVGH 2OBQA 2ZPQA 4CR9A 1MU6B 1YC0A 4TY6A 1YF4A 4MG3A 1BDAA 1MKWK 3UY9A 1KXCA 3PLPA 3SUEA 3SJOA 3PYHA 1DM4B 1BCUH 3LKWA 3EGKH 3QZRA 4ZROA 1E37B 3QX5H 1O2VA 1IAUA 5J4QA 4KTCA 3PMHB 1AN1E 2Y7ZA 2J38A 1GBMA 2GCTB 1C2MA 1ZHMA 3F9FA 1M9UA 5LPRA 3GCTF 3SNBA 4IN1A 1CBWC 2G52A 1RTFB 2CN0H 1FNIA 2BY6X 3SQHE 1GHZA 2ZG0H 4Y7AA 4R0IA 1BBRK 4BNRA 5GIBA 4I31A 1GI6A 1P10A 1O2NA 4TY7A 4X6MA 1YPJH 2BOKA 1UHBB 3LC5A 3MNCA 5FCRA 1F7ZA 3CS0A 2GZ9A 3TU7H 1DE7H 1F5KU 1NU9A 4U32A 3RUOA 2BTCE 1L1GA 1S83A 2BYAX 1IQKA 1EXFA 1IQNA 2AERH 4DVAU 2GX4A 3HGPA 2AGGX 1SHYA 2AGIX 4MNWA 3HATH 2FDAA 4CRDA 4CH8B 1IQGA 4OS6A 1QNJA 1ZHRA 2BLWA 1SGQE 3UOPA 1D6RA 2EI7A 1YKTA 2O8LA 1GJBB 4DOQA 1KYNA 1TBZH 4X6NA 1Z8IB 1BT7A 5ETXA 2PLXA 2ZQ2A 5TJXA 1TWXB 1FN6A 2HNTF 1CT0E 1TNLA 1P05A 2FODA 4Y0YE 1O30A 2JETC 1OP2A 1ZMJA 2CV3A 1A61H 3PMAB 1GGDB 5HM2A 3K9XB 3S7KB 3RXOA 1TX8A 1QA7A 3MYWA 1BRCE 2A7CA 2V0BA 5A2MH 1L4ZA 1O33A 3ZVDA 1GBHA 1BHXF 3SN8A 4NA9H 2IN2A 2OP9A 3LGUA 1LQEA 3U9AH 4JCNA 4CREA 4NA7A 7KMEH 4CHAB 2OCVB 3E8LA 1CGJE 2BDBA 4HFPB 4R8TB 3QLPH 4OS4A 2BVRH 3MMGA 5C3NA 2JKHA 5A0AE 1A1RA 3A7YA 3IWMA 3M3TA 3DD2H 3CP7A 3RDZA 2ALPA 3EA9A 1ZJDA 1JRTA 4ABJA 1BRAA 3SU1A 3SQEE 4UDWH 1TMTH 1SMFE 1QJ7B 1OSSA 4F4OC 4JK5A 1QJ6B 3TK5A 1P02A 2JH0D 1C5OH 2ZTYA 1Y5AT 5EXNA 3RMNH 4WF8A 1EZXC 3UOUA 2J94A 2GDEH 1QA0A 1GCTB 2D1JA 2A31A 5DK1A 4ZHLU 2RA0A 1G37A 3MH4A 3KQDA 1GJCB 1TPAE 3AW0A 2A2QH 1NRSH 1C5MD 1HAXB 1P03A 3ZYDA 2THFB 4WMDA 2WUBA 5C20A 1V2WT 1C5PA 1QL7A 1A5HA 1CHOF 5C1XA 1VITG 3VB6A 1DXPA 3ZZ8A 1C2HA 2P16A 2ZPRA 1UK4A 3FP7E 1OWEA 2A4OA 2GVFA 1PPEE 1F92A 3ZZ5A 1AFQB 2TRMA 1FY4A 2OUAA 5A09A 3RU4T 1CA0C 1Z8GA 1TRMA 3MU5A 1AO5A 5BRRE 1AE8H 5G4BA 1HIAA 3C27B 2VU8E 1L1NA 3BEUA 3HKIB 3LC3A 2KAIA 1TNHA 2AFQB 2W7SA 3BIVH 1K1JA 1TLDA 2TIOA 1C2IA 1FI8A 1Y5BT 1MMJN 4OS2A 5ESTE 5JB9S 3LGTA 1C5VA 1QIXB 1C1TA 1K9OE 3RC5A 1HXFH 3O8DA 1CT4E 3QGNB 1IHTH 1CHGA 4NFEA 1GBBA 1ZLRA 2QC2A 3KGPA 1G3CA 1CO7E 1XMNB 1P3EA 1QR3E 1XUFA 1XVOA 1GI1A 3ZVCA 3GYMA 1P12E 3RXKA 2UUFB 2AS9A 5EPYA 2ZWLH 3U69H 3BSQA 4ZKRU 1MKXK 3O8RA 3GISB 1TYNA 4BTIB 1IOEA 2ANWA 3BTGE 2ZEBA 1BMAA 1BBRE 4FUCA 1PPGE 3SUDA 2BD4A 3VB5A 1OX1A 2EA3A 1EAUA 2VVCA 3LGIA 2AYWA 4KP0A 2BDYA 1QBVH 2DE8A 2WV4A 3SU3A 5L2ZH 1HAHH 7GCHF 1OWHA 2XC0A 2HVXA 2H9HA 3PMJA 4MPXA 1K1IA 3B8JA 1SL3A 5L2YH 1AB9B 2SFAA 6GCHG 1ELCA 2EI6A 2FLBH 3BIUH 2SGPE 2ALVA 4I33A 2BVXH 3RXGA 1T4VH 1EJAA 1O3DA 1F0UA 3A83A 5EW1H 1H8IH 1LHCH 3VEQB 1IQHA 2VVUA 1P2OA 3RXBA 3PTBA 4Z0KA 1O3BA 3UPEA 5I25A 1UCYE 2QXJA 1HRTH 4FXGH 1AZ8A 1QHRB 1C4U2 4A92A 1GI4A 1INCA 2FI3E 2BQ7B 1C2FA 1WSSH 5F6MA 1X7AC 1H9IE 5H4IB 3ATIA 2A45B 2Q1JA 1DSTA 1AWFH 2VJ1A 8GCHG 1OP8A 1GVKB 3B23B 1HYLA 3DT0H 4BOHA 5DP4A 3DUXH 3MH6A 1XUIA 1H9LB 5JBBS 3F1SB 3LGVA 1JIRA 1XM1A 4GCHF 3URCA 3ZVAA 3PWCA 2A7HA 3RXLA 1GBEA 3QZQA 4ZKOU 4FUHA 2GT7A 4BAOB 1O3GA 4A1XA 1MTVA 3BTQE 1O2SA 1XUKA 1KXBA 3BTTE 1SLVB 1DICA 4FUBA 3OY6U 3V13A 2ODPA 4MNXA 2C8XB 2P3TB 3QK1A 2XBWA 1QFKH 1S0RA 1T8MA 2NU3E 2W7UA 1A2CH 1BUIA 1GMHF 4UFGH 1NRRH 1AD8H 2BY5X 4TYDA 5FHTA 4CBNA 4XSKU 3M7UA 3M7QA 2WPMS 1EAXA 3PO1C 1TPSA 1OXGA 1GG6C 1OYQA 1HAYB 3A7WA 3SU0A 5EQSA 1NTPA 1YPLH 1G3BA 1ANDA 4CRGA 4BXSA 3Q00A 1EZUC 1AY6H 2RDLA 1TIOA 3A87A 3BTME 3ODDA 3LPRA 5IDKA 2NU0E 1BTUA 2A4GA 3U8RH 1A0JA 1O2WA 1BTXA 1THPB 5F8TA 1ZJKA 1GDQA 3A7ZA 2B7DH 1C1RA 2ZP0H 3RXFA 5K0HA 2CHAB 2Y5FA 4XBDA 1EZQA 3M35A 1SGTA 3RLWH 2VWMA 1FLEE 1GMDF 5E8EH 3ZZ6A 4GLYA 1GHBG 1WOFA 2FWWA 1JRSA 2STBE 1RRKA 3SOSA 2FLRH 1K1PA 1CQQA 3A82A 4X2YA 2SGAA 4BANB 3Q76A 1EOLA 4K5ZA 4XE4A 3RXAA 1GL0E 1XUGA 4LK4A 2PKAB 4NSVA 1ETRH 5ESBA 3ELAH 4NFFA 1P2NA 4IN2A 1UVPA 3MTYA 6LPRA 5EGMA 1SGPE 1NFXA 4SGAE 2BZ6H 4AGKA 1EPTA 2P8OB 4LZ1H 2XCFA 4X2VA 2R3YA 3UR9A 1PPBH 2ZDNA 5E0GA 2VNTA 3NKKA 4HGCA 4O3TA 2XXLA 1LHDH 2C8WB 4LOYH 5T6DA 1NFYA 4MQAA 2ZGCA 1C2KA 1IQIA 1QGFA 1WTGH 2G81E 3UWIA 2SGFE 2TGAA 1SGNE 4ZKSU 1NY22 5E2PA 2GZ8A 1K1LA 1NM6A 1TGSZ 3GY5A 4Y0ZE 2C90B 2GCTC 1VZQH 1PYTD 3A7VA 1MQ5A 3QN7A 3Q3YA 3URDA 1BB0B 4Q2KA 1BMMH 1QY6A 2F9PA 2QF0A 1HFDA 3BTHE 4ISLA 1LHEH 2A5AA 4X6PA 1BIOA 1YPGH 1AWHB 1UTQA 1EP6A 1ACBE 3EQ0H 3QUMP 1GBIA 1C5LH 3UNQA 4ABEA 1QJ1B 4AYYB 3ZZ7A 3MO6A 4ISHH 2FOCA 5I46H 4YO9A 4YT7H 1AKSA 1GI5A 1ORFA 5HMAA 3TIUA 1SGRE 2HWLB 3A8BA 4IS5A 2ZPSA 1N6YA 5DP8A 2XNIA 1Q31A 1LVBA 1A3EH 1PQ8A 1O38A 1K28D 4K8YA 3GYLB 3RXSA 2FOAA 5JDUB 4X6OA 1FV9A 3TH4H 2AGEX 5B6OA 3P8GA 2W3IA 1FJSA 5EG4A 4H6TA 3GY4A 3BTFE 5AFZH 2ZDAH 3MWIU 1GJ5H 4FVBA 3RXHA 3VB7A 3SZNA 3BTEE 2AIQA 2ANYA 6ESTA 3MFJA 1O5AB 1CA8B 1F0SA 1AE5A 5EU8A 3VGCB 1NESE 1CSOE 2LPRA 3ZVGA 2W5EA 1T7CA 4INKA 1QURH 2PW8H 1GDNA 3IG6B 4B75A 3QDZB 2GD4B 3GDSA 2G8TA 4O03A 4Q7YA 4CRBA 4NG9H 2AEIH 4Y8YA 4UFFH 1H4WA 4E7RG 1IQEA 3ZZAA 3ZVEA 2Y80A 3KQCA 4X1PU 5C2ZA 3SU5A 1QB6A 1ANEA 1GJ9B 1YCPK 1SBWA 3K6ZA 5DO4H 4BAMB 3GY7A 1RIWB 1Q2WA 2Y81A 1DUEA 4X8VH 1MBQA 3NXPA 3A8DA 5PTPA 3STJA 3UTUH 1LVOA 1O2HA 4AG1A 2B8OH 3BG8A 3OSYA 3Q3XA 1O3FA 1OWKA 1HNEE 2ZGBH 3UFAA 1DFPA 4JYVH 1C2JA 3RXJA 1HIAB 2GMTB 1MTSA 3GCHB 1PQ5A 1ZMLA 2KAIB 2ZCHP 3K6YA 3A84A 1P01A 4UEHH 4Q7ZA 5CMXH 2Y6TA 1NRQH 1GCTC 2C3SA 4ESTE 4ISNA 2R0LA 1S81A 1QBOA 4J1YA 5LGOA 2J4IA 1Z6JH 4JZDH 3MOCA 5TCCA 2ZGHA 1MCVA 4GUXA 4ABFA 2HOBA 1GVZA 5A8ZA 2RA3A 4JZ1A 1V2VT 3AW1A 2A4RA 2YNBA 3LONA 1CE5A 3SW2B 1ANCA 4B71A 1NO9H 1O5EH 2G4UA 1W13U 2ZFRH 4WXVA 3BV9B 5EOKA 3KQBA 4YESB 1D3QB 1DS2E 3CENA 4DW2U 1N8OB 3I78A 4UD9H 1AFQC 4I8JA 3I29A 2BD8A 4VGCC 4HTCH 2OXSA 1QL8A 1ZSLA 4FU7A 2PTCE 3E90B 1SGFG 1GDUA 3Q77A 2ZGJA 2SNWA 4I8HA 4INLA 3SBKA 1L0ZA 1UCYH 2WUCA 1S5SA 5C67A 1DWCH 3AAUA 1NRPH 4MPVA 2PKSC 2WINI 3PM3A 1ZTLA 1EJMA 3GCTG 4FUJA 1AQ7A 1LPZB 2OBOA 6CHAC 1B5GH 2VGCC 7ESTE 4XDEA 5BPEA 5C5NA 1KY9A 2OINA 1FPHH 4IC6A 5LPFA 1GL1A 4WWYA 2ZU1A 1T8LA 3U1IB 1G2LA 1GBJA 5DPAA 1J9CH 1C1OA 1MH0A 2ZU3A 1EOJA 3PB1E 1C2GA 2AMDA 3H7OA 2FX4A 1LO6A 1JXPA 1CU1A 1DVAH 1OKXA 3B9FH 3BTDE 5AFYH 2HLCA 2XWAA 1O36A 3O8BA 1U6QA 4E05H 3FZDA 1AZZA 3UR6A 1BOQA 2EI8A 3RC4A 2BY7X 1P09A 1NPMA 4FUIA 1KLJH 1ESTA 1GJ6A 1KTSB 4A1VA 1BHXB 2NWNA 1KDQA 2R9PA 4X0WU 2ZHDA 3ATMA 3NUMA 4MNVA 1ABJH 1ESAA 5K7RA 1YP9A 1JWTA 3LT3A 1L2EA 3ZV8A 4D9QA 5CHAC 1NFWA 1PQ7A 3KCGH 2BZAA 1UVOA 2V3HH 3ZZBA 4ZUHA 5JYIA 4AFQA 1SQTA 3E0NB 1KTTB 1O5DH 3ENSB 4UFDH 2OC7A 4GAWA 2SGEE 2R3UA 1K1OA 2Z9KA 1BMLA 1AVXA 4K1TA 2J95A 1T31A 2BDCA 1SOTA 3TK6A 2F9OA 4K8BA 1YPMH 5JB8S 1SHHB 1TNIA 1TQ0B 1MTNB 1O3IA 2AMPA 4KTUA 5A8XA 1DXWA 1C1SA 2ZFQH 3MU4A 4Y8XA 4AFUA 2NU1E 1UK3A 2OQUA 1RXPA 2G55A 2R2MB 2VIVA 1ARBA 4ZKNU 3UQOA 2LNCA 5JBTA 2FZZA 1ELTA 2VH6A 2GKVE 3MNXA 3ESTA 3HK6B 1GBFA 2HNTE 1D3PB 1NU7B 3TJNA 1C5SA 4XOJA 3TJOA 3T2NA 1TRYA 3SJIA 4B2AA 2FTLE 4FU8A 1HAVA 1L1JA 4JZIA 2XWBI 4TPYA 4WMEA 1FAXA 3TK9A 2FPZA 4ZHAA 1GHXH 1CHOG 3EDXB 2O8WA 1BRUP 1MKXH 1T32A 1V2QT 3SUFA 2G5VA 2VIWA 1BQYA 1DOJA 4Y79A 1SSXA 1K21H 1RGQA 1D3TB 8KME2 3F9HA 3ZZDA 1EPTB 3G01A 2HGTH 1KXAA 1F0RA 4JK6A 1HV7A 4K1EA 3MU8A 1GBTA 3KEEA 5GCHF 1GJ8B 4GVUA 1AIXH 3RLYH 4TWWA 1TAWA 1W7GH 1FONA 1PPZA 1SFQB 3ODFA 4NIWA 1H9HE 1C9TA 2FOGA 2ZU5A 1AFEH 5JBCS 1JIMA 3BG4B 4B2CA 1QRWA 3MHWU 5EPNA 1MQ6A 2FS8A 3QTVH 2ULLA 1WQSA 2GTBA 1ZHPA 2AH4X 1A5IA 4NIYA 3ZVBA 3P70B 4AN7A 2IJOB 2O9QA 4GSOA 4O97A 1YBWA 3FP8E 4IW4E 2ILNA 1J8AA 4XBCA 1VJAU 1UHBA 1V2UT 2HALA 1SI5H 2ZU2A 4JYUH 1UVSH 4B73A 4X2XA 3TNSA 4FU9A 3VFEA 2Z9GA 3RMMH 1Z1JA 2OD3B 3FFGA 2P8OC 1RJXB 4A1TA 2UUKB 5J4SA 1O3EA 2J92A 4I8LA 3SV7A 1AKSB 3VXEH 2BHGA 1A5GH 3OTJE 1CVWH 1SQOA 4RKJB 4AFSA 4B76A 3UQVA 4WY3A 1TGBA 1K1NA 4D7GA 1L4DA 1DDJA 1ELAA 2W3KA 1O5GH 3AVZA 2QA9E 2VVVA 1ZTKA 1DX5M 3OY5U 7GCHG 1WQVH 3ITIA 2WPLS 1FQ3A 3ZV9A 3TITA 5DKMA 4CRFA 2J9NA 3D23A 2BX4A 2XBYA 3M7TA 2ZCLP 3H7TA 1YCPM 2OTVA 3A89A 5EXMA 2ZHFH 1W14U 2I6SA 4A7IB 2F9VA 3CS7A 1GJAB 2H6MA 5T6FA 1HAOH 1AI8H 1ZR0A 1Z1IA 2BXUH 1HCGA 1RS0A 2Z9JA 1SFIA 1Z6EA 1W8BH 1E34B 2XC4A 2Y5HA 5DP7A 1RFNA 5GPIB 4LZ4B 5F8ZA 4X8TH 1P9SA 2ESTE 1EZSC 5L6NH 1FIWA 1GHYH 1OP0A 1G3EA 2H2ZA 4X1RU 3SNEA 1E36B 2F3CE 1C4V2 1AGJA 1EKBB 2BVSH 2D26C 5IYTA 1V2OT 2C93B 5L30H 1WTHD 1OOKB 1J14A 1KXEA 1J17T 4RKOB 4GCHG 1BTYA 1O2TA 1GHAF 3RC6A 3D62A 2BM2A 1YYY1 1H8DH 1GI0A 1C5WB 3P8OA 2ZF0H 2QXIA 4GPGA 1P8VC 4JYTA 1SGEE 4NCYA 2R2WU 1A0HB 1O3KA 3L33A 3TNTA 1XUJA 1DSUA 3VGCC 2PUQH 1F5LA 1C5TA 2P94A 2V35A 4FVDA 3BTKE 1V6DA 1GMHG 1UK2A 2PHBA 3SU6A 3KQEA 1C5YB 1LKAA 2YOLA 2Z94A 1WYKA 4YOIA 4CBOA 4DIIH 1THSH 3LGWA 1O2KA 4INHA 1D6WA 3SI3H 1TBQH 2VINA 4DGJA 2UUJB 5CE1A 1RIWC 1FXYA 4UONA 2ODQA 1PFXC 1TNGA 1SGIB 1HAIH 1BRBE 2VIQA 4FUEA 4HZHA 4MLFB 1O2ZA 1A46H 1Z8JB 3LDXH 5EW2H 2PFEA 1HLTH 4U2WA 2G5NA 3M37A 3FVFB 3P17H 1O31A 3M61U 1LHGH 1EAIA 1O3NA 1W3CA 1GI2A 2A2XH 2Q6FA 2UUYA 3F9EA 3SO3A 2GCHF 4H4FA 1NRNH 2VB0A 2DUCA 1D4PB 1NFUA 3NCLA 2QV1A 2GMTC 1KIGH 3GCHC 1ETSH 2H9TH 3QO6A 4FUGA 4WH6A 4TWYA 3F68H 1O3CA 1FN8A 1YLCA 4YT6H 1O2QA 2G51A 3DFJA 4A6LA 1C1UH 2P3FH 1MAYA 2BQWB 3A7TA 1UTMA 1TALA 4GHQA 4D7FA 1GMDG 1C1QA 2FP7B 3ZZ9A 3SI4H 2VH0A 4KELA 1GMCF 3V12A 2ZTXA 3SV8A 3EAJA 3OX7U 1SOZA 4O3UA 4NZQA 4Y76A 1SLUB 1Y3VA 5FX6A 1LPGB 1HJAB 2ANKH 3P8NA 1W10U 1O0DH 1O2UA 3L6PA 2H5DA 1QRZA 5JBAS 1QTFA 2B5TB 3M3SA 3KNXA 1LVMA 1UO6A 1N8OC 4OS1A 3PMBB 1E35B 2VIDA 1LCYA 1FDPA 2FYQA 3GCNA 3ZZ3A 2ZTZA 1O3AA 2ZKSA 4JZEH 4WMFA 1TONA 4ZH8A 1C1PA 3S69A 3ZVFA 3LJJA 4ZHMU 2PTNA 1EAWA 3N7OA 1MU8B 3MI4A 3STIA 4ISIH 1O2RA 2Z9LA 5DG6A 1KDQB 1BTWA 1ARCA 3RXCA 2Y5GA 2BY8X 2O8MA 5DJ7A 2WPKS 1GI8B 3HKJB 4WH8A 1GWAA 3TJVA 1SLXB 3U1JB 1UVTH 3P8FA 4MTBA 1HB0B 3D65E 3WY8A 4KGAA 2H5CA 1VR1H 2STAE 3RXQA 2ZNKH 1AUJA 4DY7B 1P3CA 3O8CA 2FOFA 4U01A 1P57B 1GGDC 1A3BH 4CRAA 3RM0H 3SV9A 1GI7B 7LPRA 4RN6A 3PO1B 4Z6AH 1ZGIA 1GG6B 2F83A 2A5KA 2HNTC 3UNSA 1ID5H 4D8NA 1DLEA 5EQQA 4UFEH 5TCAA 2A4QA 2BDAA 1MTWA 4H42U 4DG4A 1B7XB 3SNCA 3V3MA 2QF3A 4X8SH 4MVNA 2CF9H 3QWCH 4CHAC 1XKBC 2FYRA 4Y8ZA 3MU0A 1G30B 1HAZB 1N1LA 2ZECA 5FBEA 1NN6A 1P2MA 2HRVA 2PSXA 2EC9H 5HGGA 4Y6DA 4B74A 2D8WA 2FS9A 4XFQA 3GY3A 1ZPCA 2F9NA 1ZYOA 5FX5A 1WUNH 2FESH 3KIDU 2WPIS 3VB4A 3BF6H 3MNBA 2NU2E 1MKWH 1LDTT 1UTPA 1V3XA 2JH5D 2QY0B 2WYGA 1C5UA 2CF8H 2OC0A 4X8UH 1O2JA 4YOGA 1PPHE 3NZIA 3MU1A 1DY9A 1Z7KA 1AMHA 1FUJA 1HJ8A 1PQAA 1TGNA 3RXMA 1TA2A 4MDSA 1HAVB 1O3OA 3E0PB 1YM0A 1HJ9A 3A8CA 1C9PA 3OYPA 3NPSA 1O2LA 3SU4A 1VITH 1DLKB 1P0SH 8LPRA 2FXRA 4IC5A 1O35A 3FP6E 4X2WA 4IMQA 1FY3A 1QB9A 4AX9H 1BBRH 2IOTA 3LJOA 1FY8E 1V2LT 5GXPA 3E91A 5A8YA 1F0TA 1EUFA 2ANMH 3LGYA 1C5ZB 4YLUA 1BITA 1GBDA 4B1TA 1YPKH 2ZU4A 2VIOA 1JBUH 4AB8A 1P9UA 3SV6A 1N6XA 1IQFA 1CGHA 1PJPA 1NZQH 2ZQ1A 4NWLA 1EJNA 1O2PA 3GICB 2VWNA 4IBLH 4TPIZ 3PV4A 2XBXA 1E0FD 3TGIE 2G4TA 1DWDH 1F2SE 4D9RA 1SPJA 4SGBE 5DGJA 4XBBA 5F03A 1ELDE 1Q3XA 2UWLA 5FBIA 2C4FH 1GJ4H 1HAPH 1V2NT 2C8YB 4KTSA 3NWUA 4BTTB 3HK3B 4DCDA 2WYJA 1XUHA 2ZI2H 3T28A 3PTNA 3K2UA 1SVPA 3TLOA 2PKAA 1SLWB 2HPPH 1ZZZA 3LU9B 1TMUH 1IQMA 5A0CA 1YPHC 1EASA 3ATWA 1O3JA 1EPTC 1Y59T 4O9VA 1QBNA 4DJZB 1VGCB 3GY8A 1EQ9A 1GJ7B 4Y11E 3T5FH 4ABBA 3VXFH 3A81A 3A80A 1ELBA 2GDDA 2ZDVH 2BOHB 3A7XA 3RXVA 2FI4E 1NC6A 3EA8A 2XC5A 2F91A 4K60A 2GGVB 1AU8A 2CXVA 1DWEH 3BG4C 1UTJA 1BTZA 1V2KT 2ZDMA 2EEKA 1SGDE 1VCWA 1UTOA 1BJUA 5HYOA 1YPEH 1UCYK 2ZFFH 2FOEA 2FTMA 2XCNA 2QCYA 4U30A 3E1XB 1V2JT 2QAAA 1KLTA 4AZ2B 1T8NA 1C5QA 1P04A 4I32A 2FOMB 2C8ZB 3PLKA 2BD3A 1O2OA 1AB9C 1OYTH 4YLQH 4GHTA 1KXDA 4D76A 2QGRA 1O5FH 2O8TA 4E06H 1QB1A 1TABE 4JMYA 1MZDA 1Y5UT 4OGXA 3W94A 1DANH 2XW9A 1UTLM 1QQ4A 1S84A 2GV6A 4AG2A 4YM9A 4Y7BA 2ZA5A 3UREA 2OC1A 1MD8A 1O32A 2BD7A 2HPQH 4DT7B 1TNKA 2A1DB 3IITA 1XVMA 1C2EA 1QQUA 4K1SA 4Q80A 1Y8TA 1EX3A 4BAKB 2FOHA 1PPCE 2YNAA 1VITF 3LIWA 4YZUA 3T62A 3MH7A 4HI3A 1ESBA 1NROH 2AMQA 1J16A 3SNAA 1V2PT 1LPKB 4AFZA 4BAHB 2FO9A 1P2QA 1SR5C 4A5TS 2WPJS 2QIQA 2BXTH 2ZHEH 2F9BH 4OS5A 1D9IA 5AVDA 5FCKA 4LXBH 2Z6BD 5C1YA 2XYAA 4ABAA 3AASA 1A0LA 1FMGA 3M5LA 2UWOA 2PR3A 1G9IE 3RXDA 3SGAE 3DHKH 1IQJA 2VWOA 3SORA 4WJG2 3S9AA 1QRXA 1GPZA 2FI5E 2V3OH 5HXFA 5DP3A 4DIHH 1UVUH 3NK8A 2A7JA 2UWPA 4ABIA 1RTLA 1TOMH 2P59A 1FAKH 4AGJA 5A0BA 2ZFSA 2FEQH 5DP9A 1O3PB 4M7GA 3ZZCA 2Z9IA 1AVWA 1CBWB 3V7TA 1MCTA 1A4WH 5GJ4B 2FX6A 1V2RT 4I8GA 1V2TT 4ISOA 2ZCKP 4DURA 4VGCB 5E0HA 1V2ST 3H5CB 5AF9H 8ESTE 4ZXXH 2OLGA 1C5XB 3M3VA 3S7HB 1ELEE 2ZO3H 2I6QA 1J15A 2AIPA 5T3HA 3M36A 1HUTH 1O2IA 1P06A 1TGCA 2PSYA 3RXRA 3TH2H 1DITH 1O2MA 3SV2H 3A86A 3U8TH 4OS7A 2IPHA 2CHAC 2PKSB 3PWBA 3U8OH 3LH1A 2SGQE 2ZDLA 1THRH 3RXIA 1GBKA 1TFXA 2H1UA 1JOUB 1PPFE 3TPIZ 6CHAB 2VGCB 2V6NA 1WV7H 2ZHQH 6GCHF 1SGFA 1S85A 3T29A 2BD9A 4IMZA 2JETB 5DP6A 1O3LA 1ELFA 1TNJA 3P92A 1MUEB 4IGDA 2BLOA 1BZXE 5SGAE 4Y10E 1ABIH 2P93A 4K69A 1IHSH 1MBMA 3SGBE 1TE0A 3S0NA 5GCHG 3M5NA 1DY8A 3UNRA 1WBGB 1TX6A 1OWJA 4I8KA 1C1VH 4ZAEA 1W7XH 3JZ1B 2ZC9H 2GV7A 3SJ8A 2TGDA 1DUAA 1ZRKA 1Y3WA 4I7YH 3ZZ4A 3UWJH 5GWZA 5FPYA 8GCHF 3KHVA 2RCEA 4B2BA 2A32A 2XBVA 4UE7H 3UUZA 2QXHA 2SGDE 2Y82A 3DFLA 1TA6A 2PGQB 1HGTH 1TOCB 2QYIA 4WXIA 1GHVH 5CHAB 2Z7FE 1FY5A 2G00A 1HJAC 2RG3A 3E16B 1HXEH 1TPOA 1SGYE 2BLQA 2B0FA 2GP9B 3ATKA 3SJKA 2FM2A 2R0KA 1G3DA 3RP2A 1YPHE 1WU1A 3KF2A 1ZRBA 2H9EH 3K65B 1S6FA 3RXUA 3LH3A 3PROA 3RU4E 2XRCA 3I77A 4BTUB 2XTTB 4NWKA 1EATA 4BAQB 2FIRH 4YTAA 1C4Y2 1ZMNA 5EODA 2CJIA 1W11U 1BTPA 1P2KA 2BB4A 1FPCH 2BDIA 4X1QU 5FAHA 3M5MA 3HPTB 3OU0A 1W0ZU 1C1WH 4THNH 1SG8B 1XXFA 2PUXB 1KSNA 1Y3YA 4QT8C 3EA7A 1YLDA 4ABHA 2WPHS 1HPGA 4K3JA 2JH6D 1HDTH 3MNSA 2ZIQH 2A0QB 4NZLA 1XKAC 3C1KA 4NIVA 1E38B 4ZXYH 2J2UA 3R3GB 1LHFH 3RMLH 1S82A 1CA0B 1MTUA 2DE9A 3E3TA 4AB9A 5EXLA 2QN5T 3RM2H 1KXFA 1YGCH 5F8XA 2ZDKA 1TBRH 1TPPA 2ZZUH 5EQRA 1GVLA 2TGTA 2ZGXH 4NA8A 1ZOMA 1GHBF 3W95A 4NSYA 1D3DB 1GI3A 3RXTA 3P6ZB 3BTWE 4CR5A 3TH3H 1JMOH 1C5RA 3R0FA 3A88A 3T27A 2P3UB 4MPUA 1TGTA 1GHAG 1NS3A 1K1MA 1ZGVA 5JPMH 3FANA 1QCPA 2BD5A 2ZFPH 3UIRA 1WCZA 5FPSA 3JZ2B 3FAOA 1OWIA 1W12U 2ZHWH 2SNVA 4MPWA 5E0JA 4J2YB 1EP5A 2J34A 3S9CA 3GOVB 4NIXA 1OS8A 2BD2A 2BY9X 1O2GH 2Z3EA 1LVYA 4F49A 1ZSJA 5FPTA 1P11E 1GHWH 1UMAH 1ETTH 3AAVA 2A5IA 3GY2A 9ESTA 2WV5A 1XX9A 3F9GA 1IQLA 3S9BA 1T8OA 1C5NH 1SB1H 4YOJA 5ABWA 2PWXA 1ANBA 1ZTJA 3TGKE 1TX7A 1GBCA 1C2DA 1HBTH 1VCQA 1C1MA 1LMWB 1RD3B 4X1SU 4E7NA 1O2XA 3T26A 1NT1A 2VIPA 2FMJA 4ASHA 1B0FA 3E6PH 4Y71A 3TJUA 2OQ5A 3MO9A 3V0XA 2W26A 2OC8A 1T4UH 2GCHG 3SU2A 3VB3A 3GCOA 4NGAH 2GT8A 2PV9B 2NU4E 1MAXA 4RSPA 2GZ7A 1BA8B 1AHTH 4AYVB 1RTKA 5E2OA 1C2LA 1S6HA 4FUFA 5LPEA 1ZPBA 1O34A 2BLVA 4PROA 1EB1H 1O37A 3A8AA 4CH2B 1H1BA 3EE0B 1GMCG 1UJ1A 1O3HA 2Y7XA 3KN2A 3GDUA 3SHCH 1S0QA 3BN9A 3T25A 1GCDA 1GI9B 1UTKA 2TPIZ 2TBSA 3BEIB 1BMNH 3QTOH 1C1NA 3LOXA 1OWDA 2PGBB 1KLIH 1O3MA 1O5BB 1ELGA 1O5CB 2BMGB 4OGYA 4AORA 1SQAA 4ABDA 2BX3A 1QL9A 1G36A 2ODYB 1K2I1 3PLBA 4WVPE 1OPHB 2FOBA 1DT2A 4FUDA 4Q7XA 1HAGE 1VGCC 2CMYA 2BDGA 2Z3CA 3RMOH 3TGJE 1TB6H 4AOQA 1FY1A 2B9LA 1Y3XA 5LH8A 1F5RA 1BTHH 1YCPH 1MZAA 3RXEA 3FZZA 3SGQE 1B0EA 3L3TA 1SC8U 1GBLA 3GDVA 2Z3DA 4X1NU 1AUTC 3SJ9A 2F9UA 1P2JA 3ATLA 2CGAA 2VWLA 3SUGA 3GY6A 2Q6GA 1DWBH 3VPKA 1V2MT 1CT2E 1EB2A 3TVJB 4BXWA 1PYTC 2M5TA 2Q6DA 3KL6A 5GDSH 4H6SB 1CGIE 4ABGA 2BDHA 1TMBH 5C1UA 1UTNA 1O39A 5FXLA 3U98H 5AHGH 3DA9B 1Z71A 1Y3UA 1ZSKA 1P2IA 3F6UH 1LQDB 2P95A 4ZMAH 3D49H 3P95A 9LPRA 4JZFH 1BJVA 1W2KH 5DP5A 1G32B 3SNDA 2TGPZ 2ASUB 5HM9A 2K1QA 3M5OA 1ZPZA 1VCPA 1G2MA 1GBAA 3MH5A 4MNYA 1MD7A
chains in the Genus database with same CATH superfamily
3Q3KA 1FIZA 2ZFTA 3SHAH 3SZEA 4F48B 4KKDA 4K2YA 3MO3A 1SGCA 1W0YH 2D2DA 3RXPA 1ELVA 1LKBA 5T6GA 5C5OA 1XXDA 1TQ7B 1Z8RA 3ZYEA 3BEFB 3HGNA 3QGJA 4CRCA 1LTOA 1TRNA 2BQ6B 1O2YA 1VJ9U 2QE7D 1GJDB 1WAYB 1MTNC 3A85A 1K22H 1FZZA 1YWUA 1A7SA 2QXGA 3EYDA 3RU4D 2O8UA 1DPOA 1AVGH 2OBQA 2ZPQA 4CR9A 1MU6B 1YC0A 1SQRA 1YF4A 4TY6A 4MG3A 1BDAA 1MKWK 3UY9A 1KXCA 3PLPA 3SUEA 3SJOA 3PYHA 1DM4B 1BCUH 3LKWA 3EGKH 3QZRA 4ZROA 1E37B 3QX5H 1O2VA 1IAUA 5J4QA 4KTCA 3PMHB 1AN1E 2L74A 2Y7ZA 2J38A 1GBMA 2GCTB 1C2MA 1ZHMA 3F9FA 1M9UA 3F3BA 3GCTF 5LPRA 3SNBA 4IN1A 1CBWC 2G52A 1RTFB 2CN0H 1FNIA 2BY6X 3SQHE 1GHZA 2ZG0H 4Y7AA 4R0IA 1BBRK 4BNRA 5GIBA 4I31A 1GI6A 1P10A 1O2NA 4TY7A 4X6MA 1YPJH 2BOKA 1UHBB 3LC5A 3MNCA 5FCRA 1F7ZA 3CS0A 2GZ9A 3TU7H 1DE7H 1F5KU 1NU9A 4U32A 3RUOA 2BTCE 1L1GA 1S83A 2BYAX 1IQKA 1EXFA 1IQNA 2AERH 4DVAU 2GX4A 3HGPA 2AGGX 1SHYA 2AGIX 4MNWA 3HATH 2FDAA 4CRDA 4CH8B 1IQGA 4OS6A 1QNJA 1ZHRA 2BLWA 1SGQE 3UOPA 1D6RA 2EI7A 1YKTA 2O8LA 1GJBB 4DOQA 1KYNA 1TBZH 4X6NA 1Z8IB 1BT7A 5ETXA 2PLXA 2ZQ2A 5TJXA 1TWXB 1FN6A 2HNTF 1CT0E 1TNLA 1P05A 2FODA 4Y0YE 1O30A 2JETC 1OP2A 1ZMJA 2CV3A 1A61H 3PMAB 1GGDB 5HM2A 4XRNA 3K9XB 3S7KB 3RXOA 1TX8A 1QA7A 3MYWA 4RI0A 2QF5A 1BRCE 2A7CA 2V0BA 5A2MH 1L4ZA 1O33A 3ZVDA 1GBHA 1BHXF 3SN8A 4NA9H 2IN2A 2OP9A 3LGUA 1LQEA 3U9AH 4JCNA 3F2HA 4CREA 4NA7A 7KMEH 4CHAB 2OCVB 3E8LA 1CGJE 2BDBA 4HFPB 5CDFE 4R8TB 2JJ1D 3QLPH 4OS4A 2BVRH 3MMGA 5C3NA 2JKHA 5A0AE 5C0UA 1A1RA 3A7YA 3IWMA 3M3TA 3DD2H 3CP7A 3RDZA 2ALPA 3EA9A 1ZJDA 1JRTA 4ABJA 1BRAA 3SU1A 3SQEE 4UDWH 1EFRD 1TMTH 1SMFE 1QJ7B 1OSSA 4F4OC 2HLDD 4JK5A 1QJ6B 1E1RD 3TK5A 1P02A 2JH0D 1C5OH 2ZTYA 1Y5AT 2F43B 5EXNA 3RMNH 4WF8A 1EZXC 3UOUA 2J94A 2GDEH 1QA0A 1GCTB 2D1JA 2A31A 5DK1A 4ZHLU 2RA0A 1G37A 3MH4A 3KQDA 1GJCB 1TPAE 3AW0A 2A2QH 1MABB 1NRSH 1C5MD 1HAXB 3FO8D 1P03A 3ZYDA 2THFB 4WMDA 2WUBA 5C20A 1V2WT 1C5PA 1QL7A 1A5HA 1CHOF 5C1XA 4DT4A 1VITG 1E79D 3VB6A 1DXPA 3ZZ8A 1C2HA 2P16A 2ZPRA 1UK4A 3FP7E 1OWEA 2A4OA 1KMHB 2GVFA 1PPEE 1F92A 3ZZ5A 1AFQB 2TRMA 1FY4A 2OUAA 5A09A 3RU4T 1CA0C 1Z8GA 1TRMA 3MU5A 1AO5A 5BRRE 1AE8H 5G4BA 1HIAA 3C27B 2VU8E 1L1NA 3BEUA 3HKIB 3LC3A 2KAIA 1TNHA 2AFQB 2W7SA 5EJ1A 3BIVH 1K1JA 1TLDA 2TIOA 1C2IA 1FI8A 1Y5BT 1MMJN 4OS2A 5ESTE 5JB9S 3LGTA 1C5VA 1QIXB 5F53A 1C1TA 1K9OE 3RC5A 1HXFH 3CNRA 3O8DA 1CT4E 3QGNB 1IHTH 1CHGA 4NFEA 1GBBA 1ZLRA 2QC2A 3KGPA 1G3CA 1CO7E 1XMNB 1P3EA 1QR3E 1XUFA 5DN6D 1XVOA 1GI1A 3ZVCA 3GYMA 1P12E 3RXKA 2UUFB 2AS9A 5EPYA 2ZWLH 3U69H 3BSQA 4ZKRU 2J98B 1MKXK 3O8RA 4ZCNA 3GISB 1TYNA 2W6ID 4BTIB 1IOEA 2ANWA 3BTGE 2ZEBA 1BMAA 1BBRE 4FUCA 1PPGE 3SUDA 2BD4A 3VB5A 1OX1A 2EA3A 1EAUA 2VVCA 3LGIA 2AYWA 4KP0A 2BDYA 1QBVH 2DE8A 2WV4A 3SU3A 5L2ZH 1HAHH 7GCHF 1OWHA 2XC0A 2HVXA 2H9HA 3PMJA 4MPXA 1K1IA 3B8JA 1SL3A 5L2YH 1AB9B 2SFAA 6GCHG 3MQKC 1ELCA 2EI6A 2FLBH 3BIUH 2SGPE 2ALVA 4I33A 2BVXH 3RXGA 1T4VH 1EJAA 1O3DA 1F0UA 2V3MA 3A83A 5EW1H 1H8IH 1LHCH 3VEQB 1IQHA 5HIYA 2V7QD 2VVUA 1P2OA 3RXBA 3PTBA 4Z0KA 1O3BA 3UPEA 5I25A 1UCYE 2QXJA 1HRTH 4FXGH 1AZ8A 1QHRB 1C4U2 4A92A 1GI4A 1INCA 2FI3E 2BQ7B 1C2FA 1WSSH 5F6MA 1X7AC 1H9IE 5H4IB 3ATIA 2A45B 2Q1JA 1DSTA 1AWFH 2VJ1A 8GCHG 1OP8A 1GVKB 3B23B 1HYLA 3DT0H 4BOHA 5DP4A 3DUXH 3MH6A 1XUIA 1H9LB 5JBBS 3F1SB 3LGVA 1JIRA 1XM1A 4GCHF 3URCA 3ZVAA 3PWCA 2A7HA 3RXLA 1GBEA 3QZQA 4M9FA 4ZKOU 4FUHA 2GT7A 4BAOB 1O3GA 4A1XA 1MTVA 3BTQE 1O2SA 1XUKA 1KXBA 3BTTE 1SLVB 1DICA 4FUBA 3OY6U 3V13A 2ODPA 4MNXA 2C8XB 2P3TB 3QK1A 2XBWA 1QFKH 1S0RA 1T8MA 2NU3E 2W7UA 1A2CH 1BUIA 1GMHF 4UFGH 1NRRH 1AD8H 2BY5X 4TYDA 2KFWA 5FHTA 4CBNA 4XSKU 3M7UA 2WV9A 2WPMS 1EAXA 3M7QA 3PO1C 1TPSA 1OXGA 1GG6C 1OYQA 2GJGA 1HAYB 3A7WA 3SU0A 5EQSA 1NTPA 1YPLH 1G3BA 1ANDA 4CRGA 4BXSA 3Q00A 1EZUC 5EJLA 1AY6H 2RDLA 1FX0B 1TIOA 3A87A 3BTME 3ODDA 3LPRA 5IDKA 2NU0E 1BTUA 2A4GA 3U8RH 1A0JA 5FL7D 1O2WA 1BTXA 1THPB 5F8TA 1ZJKA 3F2FA 1GDQA 3A7ZA 2B7DH 1C1RA 2ZP0H 3RXFA 5K0HA 2CHAB 2Y5FA 4XBDA 1EZQA 4TSFD 3M35A 1K0HA 1SGTA 3RLWH 2VWMA 1FLEE 1GMDF 5E8EH 3ZZ6A 4GLYA 1GHBG 1WOFA 2FWWA 1JRSA 2STBE 1RRKA 3SOSA 2RFKC 2FLRH 1K1PA 1CQQA 3A82A 4X2YA 2SGAA 4BANB 3Q76A 1S6LA 1EOLA 4K5ZA 4XE4A 3RXAA 1GL0E 1XUGA 4LK4A 2PKAB 4NSVA 1ETRH 5ESBA 3ELAH 4NFFA 1P2NA 4IN2A 1UVPA 2KCOA 3MTYA 6LPRA 5EGMA 1SGPE 1NFXA 4SGAE 2BZ6H 4AGKA 1EPTA 2P8OB 4LZ1H 2L6OA 2XCFA 4X2VA 2R3YA 3UR9A 1PPBH 2ZDNA 5E0GA 2VNTA 3NKKA 4HGCA 4O3TA 2KCAA 2XXLA 1LHDH 2C8WB 4LOYH 5T6DA 1NFYA 4MQAA 2ZGCA 1C2KA 4B6EA 1IQIA 1QGFA 1WTGH 2G81E 3UWIA 2SGFE 2TGAA 1SGNE 4ZKSU 1NY22 5E2PA 2GZ8A 1K1LA 1NM6A 1TGSZ 3GY5A 4Y0ZE 2C90B 2GCTC 1VZQH 1PYTD 3A7VA 1MQ5A 3QN7A 3Q3YA 3URDA 1BB0B 4Q2KA 4Q4LA 1BMMH 1QY6A 2F9PA 2QF0A 1HFDA 3BTHE 4ISLA 1LHEH 2A5AA 4X6PA 1BIOA 1YPGH 1AWHB 2IPQX 1UTQA 1EP6A 2LELA 1ACBE 3EQ0H 3QUMP 4ACAA 1GBIA 1C5LH 3UNQA 4ABEA 1QJ1B 1YY3A 4AYYB 3ZZ7A 3MO6A 4ISHH 2FOCA 5I46H 4YO9A 4YT7H 1AKSA 1GI5A 1ORFA 5HMAA 3TIUA 1SGRE 2HWLB 3A8BA 4IS5A 2ZPSA 1N6YA 5DP8A 2XNIA 1Q31A 1LVBA 1A3EH 1PQ8A 1O38A 1K28D 3U28C 4K8YA 3GYLB 3RXSA 2WPDD 2FOAA 5JDUB 4X6OA 1FV9A 3TH4H 2AGEX 5B6OA 3P8GA 2W3IA 1FJSA 5EG4A 4H6TA 3GY4A 3BTFE 5AFZH 2ZDAH 3MWIU 1GJ5H 4FVBA 3RXHA 3VB7A 3SZNA 3BTEE 2AIQA 2ANYA 6ESTA 1YLNA 3MFJA 1O5AB 1CA8B 3KYGA 2XNDD 2XOKD 1F0SA 1AE5A 5EU8A 3VGCB 1NESE 1CSOE 2LPRA 3ZVGA 2W5EA 1T7CA 4INKA 1QURH 2PW8H 1GDNA 3IG6B 4B75A 3QDZB 2GD4B 3GDSA 2G8TA 4O03A 4Q7YA 4CRBA 4NG9H 2AEIH 4Y8YA 4UFFH 1H4WA 4E7RG 1IQEA 3ZZAA 3ZVEA 2Y80A 3KQCA 1SKYE 4X1PU 5C2ZA 3SU5A 1QB6A 1ANEA 1GJ9B 1YCPK 1SBWA 3K6ZA 3AK5A 4BAMB 5DO4H 3GY7A 1RIWB 1Q2WA 2Y81A 1DUEA 4X8VH 1MBQA 3NXPA 3A8DA 5PTPA 3STJA 3UTUH 1LVOA 1O2HA 4AG1A 2B8OH 2LP6A 3BG8A 3OEED 3OSYA 3Q3XA 1O3FA 5EJZA 1OWKA 1HNEE 2ZGBH 3UFAA 1DFPA 4JYVH 1C2JA 3RXJA 1HIAB 2GMTB 1MTSA 3GCHB 1PQ5A 1ZMLA 2KAIB 2ZCHP 3K6YA 3KQ5A 3A84A 1P01A 4UEHH 4Q7ZA 5CMXH 2Y6TA 1NRQH 1GCTC 2C3SA 4ESTE 4ISNA 2R0LA 4P02A 1S81A 2KR7A 1QBOA 4J1YA 1BMFD 5LGOA 2J4IA 1Z6JH 4JZDH 3MOCA 5TCCA 2ZGHA 1MCVA 4GUXA 4ABFA 2HOBA 1GVZA 5A8ZA 2RA3A 4JZ1A 1V2VT 3AW1A 2A4RA 2VBCA 1WXRA 2YNBA 3LONA 1CE5A 3SW2B 1ANCA 4B71A 1NO9H 1O5EH 2G4UA 1W13U 2ZFRH 4WXVA 3BV9B 5EOKA 3KQBA 4YESB 1D3QB 1DS2E 3CENA 4DW2U 1N8OB 3I78A 4UD9H 1AFQC 4I8JA 3I29A 2BD8A 1W0KD 4VGCC 4HTCH 2OXSA 1QL8A 5B6LA 1ZSLA 4FU7A 2PTCE 3E90B 1SGFG 1GDUA 3Q77A 2ZGJA 2SNWA 4I8HA 4INLA 3SBKA 1L0ZA 1UCYH 2WUCA 2K0QA 1S5SA 5C67A 1DWCH 3AAUA 1NRPH 4MPVA 2PKSC 2WINI 3PM3A 1ZTLA 1EJMA 3GCTG 4FUJA 1AQ7A 1LPZB 2OBOA 6CHAC 1B5GH 2VGCC 7ESTE 4XDEA 2J5UA 5BPEA 5C5NA 1KY9A 2OINA 1FPHH 4IC6A 5LPFA 1GL1A 4WWYA 2ZU1A 1T8LA 3U1IB 1G2LA 1GBJA 2J97A 5DPAA 1J9CH 1C1OA 1MH0A 2ZU3A 1EOJA 3PB1E 1C2GA 2AMDA 3H7OA 2FX4A 1LO6A 1JXPA 5C0TA 1CU1A 1DVAH 1OKXA 3B9FH 3BTDE 5AFYH 2HLCA 2XWAA 1O36A 3O8BA 1U6QA 4E05H 3FZDA 1AZZA 3UR6A 1BOQA 2EI8A 3RC4A 2BY7X 1P09A 1NPMA 4FUIA 1KLJH 1ESTA 1GJ6A 1KTSB 3DCLA 2YMSC 4A1VA 1BHXB 2NWNA 1KDQA 2R9PA 4X0WU 2ZHDA 3ATMA 3NUMA 4MNVA 1ABJH 1ESAA 5K7RA 1YP9A 1JWTA 3LT3A 1L2EA 3ZV8A 3OAAD 4D9QA 2RDEA 5CHAC 1NFWA 1PQ7A 3KCGH 2BZAA 1UVOA 2V3HH 3ZZBA 4ZUHA 5JYIA 4AFQA 1SQTA 2KZ4A 3E0NB 1KTTB 1O5DH 3ENSB 4UFDH 2OC7A 4GAWA 2SGEE 2R3UA 1K1OA 2Z9KA 1BMLA 1AVXA 4K1TA 2J95A 1T31A 2BDCA 5HKKD 1SOTA 3TK6A 2F9OA 4K8BA 3F0OA 1YPMH 5JB8S 1SHHB 1TNIA 1TQ0B 1MTNB 1O3IA 2AMPA 4KTUA 5A8XA 1DXWA 1C1SA 2ZFQH 3DSPA 3MU4A 2W6JD 4Y8XA 4AFUA 2NU1E 1UK3A 2OQUA 1RXPA 2G55A 2R2MB 2VIVA 1ARBA 4ZKNU 3UQOA 2LNCA 5JBTA 2FZZA 1ELTA 2VH6A 2GKVE 3MNXA 3ESTA 3HK6B 1GBFA 2HNTE 1D3PB 1NU7B 5KEDA 3TJNA 1C5SA 4OM9A 4XOJA 3TJOA 3T2NA 1TRYA 3SJIA 4B2AA 2FTLE 4FU8A 1HAVA 3KYFA 1L1JA 4JZIA 2CK3D 2XWBI 4TPYA 4WMEA 1FAXA 3TK9A 3VG8A 2FPZA 4ZHAA 2KCYA 1GHXH 1CHOG 1VKYA 3EDXB 2O8WA 1BRUP 1MKXH 1T32A 1V2QT 3SUFA 2G5VA 2VIWA 1BQYA 1DOJA 4Y79A 1SSXA 1K21H 1RGQA 1D3TB 4RT0A 8KME2 3F9HA 3ZZDA 1EPTB 3G01A 2HGTH 1KXAA 1F0RA 4JK6A 1HV7A 4K1EA 3MU8A 1GBTA 3KEEA 5GCHF 1GJ8B 4GVUA 1AIXH 3RLYH 4TWWA 1TAWA 1W7GH 1FONA 1PPZA 1SFQB 3N99A 3ODFA 4NIWA 1H9HE 1C9TA 2FOGA 2ZU5A 1AFEH 5JBCS 1JIMA 3BG4B 4B2CA 1QRWA 3MHWU 5EPNA 1MQ6A 2FS8A 3QTVH 2ULLA 1WQSA 2GTBA 1ZHPA 2AH4X 1NBME 1A5IA 5C17A 4NIYA 3ZVBA 3SYJA 3P70B 4AN7A 2IJOB 2O9QA 4GSOA 4O97A 1YBWA 3FP8E 4IW4E 2ILNA 1J8AA 4XBCA 1VJAU 1WDIA 1UHBA 1V2UT 2HALA 1SI5H 2ZU2A 4JYUH 1UVSH 4B73A 4X2XA 3TNSA 2JIZD 4FU9A 3VFEA 2Z9GA 3RMMH 1Z1JA 2OD3B 3FFGA 2P8OC 1RJXB 4A1TA 2UUKB 5J4SA 1O3EA 2J92A 4I8LA 3SV7A 1AKSB 3UB0A 3VXEH 2BHGA 1A5GH 3OTJE 2KM0A 1CVWH 1SQOA 4RKJB 4AFSA 4B76A 3UQVA 4WY3A 1TGBA 1K1NA 4D7GA 1L4DA 1DDJA 1ELAA 2W3KA 1O5GH 3AVZA 2QA9E 2M2AA 2VVVA 1ZTKA 4FOUC 1DX5M 3OY5U 7GCHG 1WQVH 3ITIA 2WPLS 1FQ3A 1OHHD 3ZV9A 2KX4A 4FETA 3TITA 5DKMA 4CRFA 2J9NA 3D23A 2BX4A 2XBYA 3M7TA 2ZCLP 3H7TA 1YCPM 2OTVA 3A89A 5EXMA 2ZHFH 1W14U 2I6SA 4A7IB 2F9VA 3CS7A 1GJAB 2H6MA 5T6FA 1HAOH 4Q63A 1AI8H 1ZR0A 1Z1IA 2BXUH 1HCGA 1RS0A 2Z9JA 1SFIA 1Z6EA 1W8BH 1E34B 2XC4A 2Y5HA 5DP7A 2QF4A 1RFNA 5GPIB 4LZ4B 5F8ZA 4X8TH 1P9SA 2ESTE 1EZSC 5L6NH 1FIWA 1GHYH 1OP0A 1G3EA 2H2ZA 4X1RU 3SNEA 2JDID 1E36B 2F3CE 1C4V2 1AGJA 1EKBB 1H8ED 2BVSH 2D26C 5IYTA 1V2OT 2C93B 5L30H 1WTHD 3OFND 1OOKB 1J14A 1KXEA 1J17T 4RKOB 4GCHG 1BTYA 1O2TA 1GHAF 3RC6A 3D62A 2BM2A 1YYY1 1H8DH 1GI0A 3N7DA 1C5WB 3P8OA 3WWBA 2ZF0H 2QXIA 4GPGA 1P8VC 4JYTA 1SGEE 4NCYA 2R2WU 1A0HB 1O3KA 3L33A 3TNTA 1XUJA 1DSUA 3VGCC 2PUQH 1F5LA 1C5TA 2P94A 2V35A 4FVDA 3BTKE 1V6DA 1GMHG 1UK2A 2PHBA 5DSFA 3SU6A 3KQEA 1C5YB 3WW7A 1LKAA 2YOLA 1UW7A 2Z94A 1WYKA 4YOIA 4CBOA 4DIIH 1THSH 3LGWA 1O2KA 4INHA 1D6WA 3SI3H 1TBQH 2VINA 4DGJA 2UUJB 3EE7A 5CE1A 1RIWC 1FXYA 4UONA 2ODQA 1PFXC 1TNGA 1SGIB 1HAIH 1BRBE 2VIQA 4FUEA 4HZHA 4MLFB 1O2ZA 1A46H 1Z8JB 3LDXH 5EW2H 2PFEA 1HLTH 4U2WA 2G5NA 3M37A 3FVFB 3P17H 1O31A 3M61U 1LHGH 1EAIA 1O3NA 1W3CA 1GI2A 2A2XH 2Q6FA 2UUYA 3F9EA 3SO3A 2GCHF 4H4FA 1NRNH 2VB0A 2DUCA 1D4PB 1NFUA 3NCLA 2QV1A 2GMTC 1KIGH 3GCHC 1ETSH 2WSSD 2H9TH 3QO6A 4FUGA 4WH6A 3OE7D 4TWYA 3F68H 1O3CA 1FN8A 1YLCA 4YT6H 1O2QA 2G51A 3DFJA 4A6LA 1C1UH 2P3FH 1MAYA 2BQWB 3A7TA 1UTMA 1TALA 4GHQA 4D7FA 1GMDG 1C1QA 2FP7B 3ZZ9A 3SI4H 2VH0A 3OTPA 4KELA 1GMCF 3V12A 2ZTXA 3SV8A 3EAJA 3OX7U 1SOZA 4O3UA 4NZQA 4Y76A 1SLUB 1Y3VA 5FX6A 1LPGB 1HJAB 2ANKH 3P8NA 1W10U 1O0DH 1O2UA 3L6PA 2H5DA 1QRZA 5JBAS 3PRBA 1QTFA 2B5TB 3M3SA 3KNXA 1LVMA 1UO6A 4P00A 1N8OC 4OS1A 3PMBB 1E35B 2VIDA 1LCYA 1FDPA 2FYQA 3GCNA 3ZZ3A 2ZTZA 1O3AA 2ZKSA 4JZEH 4WMFA 1TONA 4ZH8A 1C1PA 4I86A 3S69A 3ZVFA 2WZQA 3FOAA 3UAIC 3LJJA 4ZHMU 2PTNA 1EAWA 3N7OA 1MU8B 3MI4A 3STIA 4ISIH 1O2RA 2Z9LA 5DG6A 1KDQB 1BTWA 1ARCA 3RXCA 2Y5GA 2BY8X 2O8MA 5DJ7A 2WPKS 1GI8B 3HKJB 4WH8A 1GWAA 3TJVA 1SLXB 3U1JB 1UVTH 3P8FA 4MTBA 1HB0B 3D65E 3WY8A 4KGAA 2H5CA 5KGOA 1VR1H 2STAE 3RXQA 2ZNKH 1AUJA 4DY7B 1P3CA 3O8CA 2FOFA 4U01A 1P57B 1GGDC 1A3BH 4CRAA 3RM0H 3SV9A 1GI7B 7LPRA 4RN6A 3PO1B 4Z6AH 1ZGIA 1GG6B 2F83A 2A5KA 2HNTC 3UNSA 1ID5H 1W0JD 4D8NA 1DLEA 5EQQA 4UFEH 5TCAA 1NBMD 2A4QA 2BDAA 2OK5A 1MTWA 4H42U 4DG4A 1B7XB 3SNCA 3V3MA 2QF3A 4ASUD 4X8SH 4MVNA 2CF9H 3QWCH 4CHAC 1XKBC 2FYRA 4Y8ZA 3MU0A 1G30B 1HAZB 1N1LA 2ZECA 5FBEA 1NN6A 1P2MA 2HRVA 2PSXA 2EC9H 5HGGA 4Y6DA 4B74A 2D8WA 2FS9A 4XFQA 3GY3A 3GS9A 1ZPCA 2F9NA 1ZYOA 5FX5A 1WUNH 2FESH 3KIDU 2WPIS 3VB4A 3BF6H 3MNBA 1MKWH 1UTPA 1LDTT 1V3XA 2JH5D 2NU2E 2QY0B 2WYGA 1C5UA 2CF8H 2OC0A 4X8UH 1O2JA 4YOGA 1PPHE 3NZIA 3MU1A 1DY9A 1Z7KA 1AMHA 1FUJA 1HJ8A 1PQAA 1TGNA 3RXMA 1TA2A 4MDSA 1HAVB 1O3OA 3E0PB 1YM0A 1HJ9A 3A8CA 1C9PA 3OYPA 3NPSA 1O2LA 3SU4A 1VITH 1DLKB 1P0SH 8LPRA 2FXRA 4IC5A 1O35A 3FP6E 4X2WA 2EY4C 4IMQA 1FY3A 1QB9A 4AX9H 1BBRH 2IOTA 3LJOA 1FY8E 1V2LT 5IK2D 5GXPA 3E91A 5A8YA 1F0TA 1EUFA 2ANMH 3LGYA 1C5ZB 4YLUA 1BITA 1GBDA 4B1TA 1YPKH 2ZU4A 2VIOA 1JBUH 4AB8A 1P9UA 3SV6A 1N6XA 1IQFA 1CGHA 1PJPA 1NZQH 2ZQ1A 4NWLA 1EJNA 1O2PA 3GICB 2VWNA 4IBLH 4TPIZ 3PV4A 2XBXA 1E0FD 3TGIE 2G4TA 1DWDH 1F2SE 4D9RA 1SPJA 4SGBE 5DGJA 4XBBA 5F03A 1ELDE 1Q3XA 2UWLA 5FBIA 2C4FH 1GJ4H 1HAPH 1V2NT 2C8YB 2YMSD 4KTSA 3NWUA 4BTTB 3HK3B 4DCDA 2WYJA 1XUHA 2ZI2H 3T28A 3PTNA 3K2UA 1SVPA 3TLOA 2PKAA 1SLWB 2HPPH 1ZZZA 3LU9B 1TMUH 3PV2A 1IQMA 5A0CA 1YPHC 1EASA 3ATWA 1O3JA 1EPTC 1Y59T 4O9VA 1QBNA 4DJZB 1VGCB 3GY8A 1EQ9A 1GJ7B 4Y11E 3T5FH 4ABBA 3VXFH 3A81A 3A80A 1ELBA 2GDDA 2ZDVH 2BOHB 3A7XA 3RXVA 2FI4E 1NC6A 3EA8A 2XC5A 2F91A 4K60A 2GGVB 1AU8A 3H09A 2CXVA 1DWEH 3BG4C 1UTJA 1BTZA 1V2KT 2ZDMA 2EEKA 1SGDE 1VCWA 1UTOA 1BJUA 5HYOA 1YPEH 1UCYK 2ZFFH 2FOEA 2FTMA 2XCNA 2QCYA 4U30A 3E1XB 1V2JT 2QAAA 3WWFA 1KLTA 4AZ2B 1T8NA 1C5QA 1P04A 4I32A 5EIYA 2FOMB 2C8ZB 3PLKA 2BD3A 1O2OA 1AB9C 1OYTH 4YLQH 4GHTA 1KXDA 4D76A 1H8HD 2QGRA 1O5FH 2O8TA 4E06H 1QB1A 1TABE 4JMYA 1MZDA 1Y5UT 4OGXA 3W94A 1DANH 2XW9A 1UTLM 1QQ4A 1S84A 2GV6A 4AG2A 4YM9A 4Y7BA 2ZA5A 3UREA 2OC1A 1MD8A 1O32A 2BD7A 2HPQH 4DT7B 1TNKA 2A1DB 3IITA 1XVMA 1C2EA 1QQUA 4K1SA 4Q80A 1Y8TA 1EX3A 4BAKB 2FOHA 1PPCE 2YNAA 1VITF 3LIWA 4YZUA 3T62A 3MH7A 4HI3A 1ESBA 1NROH 1E1QD 2AMQA 1J16A 3SNAA 1V2PT 1LPKB 4AFZA 4BAHB 2FO9A 1P2QA 1SR5C 4A5TS 2WPJS 2QIQA 2BXTH 2ZHEH 2F9BH 4OS5A 1D9IA 5AVDA 5FCKA 4LXBH 2Z6BD 5C1YA 2XYAA 4ABAA 3AASA 1A0LA 1FMGA 3M5LA 2UWOA 2PR3A 1G9IE 3RXDA 3SGAE 3DHKH 1IQJA 2VWOA 3SORA 4WJG2 3S9AA 1QRXA 1GPZA 2FI5E 2V3OH 5HXFA 5DP3A 4DIHH 1UVUH 3NK8A 2A7JA 2UWPA 4ABIA 1RTLA 1TOMH 2P59A 1FAKH 4AGJA 5A0BA 2ZFSA 2FEQH 5DP9A 1O3PB 4M7GA 3ZZCA 2Z9IA 1AVWA 1CBWB 3V7TA 1MCTA 1A4WH 5GJ4B 2FX6A 1V2RT 4I8GA 1V2TT 4ISOA 2ZCKP 4DURA 4VGCB 5E0HA 1V2ST 3H5CB 5AF9H 8ESTE 4ZXXH 2OLGA 1C5XB 3M3VA 3S7HB 1ELEE 4AC9A 2ZO3H 2I6QA 1J15A 2AIPA 5T3HA 3M36A 2K8IA 1HUTH 1O2IA 1P06A 1TGCA 2PSYA 3RXRA 3TH2H 1DITH 1O2MA 3SV2H 3A86A 3U8TH 3FN8A 4OS7A 2IPHA 2CHAC 2PKSB 3PWBA 3U8OH 3LH1A 2SGQE 2ZDLA 1THRH 3RXIA 1GBKA 1TFXA 2H1UA 1JOUB 1PPFE 3TPIZ 6CHAB 2VGCB 2V6NA 1WV7H 2ZHQH 6GCHF 1SGFA 1S85A 3T29A 2BD9A 4IMZA 2JETB 5DP6A 1O3LA 1ELFA 1TNJA 3P92A 1MUEB 4IGDA 2BLOA 1BZXE 5SGAE 4Y10E 1ABIH 2P93A 4K69A 5CHBA 1IHSH 1MBMA 3SGBE 1TE0A 3S0NA 3PV5A 5GCHG 5C94A 3M5NA 1DY8A 3UNRA 1WBGB 1TX6A 1OWJA 4I8KA 1C1VH 4ZAEA 1W7XH 3JZ1B 2ZC9H 2GV7A 3F2GA 3SJ8A 2TGDA 1DUAA 1ZRKA 1Y3WA 4I7YH 3ZZ4A 3UWJH 5GWZA 5FPYA 2YMSB 8GCHF 3KHVA 2RCEA 4B2BA 2A32A 2XBVA 4UE7H 3UUZA 2QXHA 2SGDE 2Y82A 3DFLA 1TA6A 2PGQB 1HGTH 1TOCB 2QYIA 4WXIA 1GHVH 5CHAB 2Z7FE 1FY5A 2G00A 1HJAC 1QZ8A 2RG3A 3E16B 1COWD 1HXEH 1TPOA 1SGYE 2BLQA 2B0FA 3ZIAD 2GP9B 3ATKA 3SJKA 2FM2A 2R0KA 1G3DA 3RP2A 1YPHE 1WU1A 3F0PA 3KF2A 1ZRBA 2H9EH 3K65B 1S6FA 3RXUA 3LH3A 3PROA 3RU4E 2XRCA 3I77A 4BTUB 2XTTB 4NWKA 3W1EA 1EATA 4BAQB 3DSGA 2FIRH 4YTAA 1C4Y2 1ZMNA 5EODA 2CJIA 1W11U 1BTPA 1P2KA 2BB4A 1FPCH 2BDIA 4X1QU 5FAHA 3M5MA 3HPTB 3OU0A 1W0ZU 1C1WH 4THNH 1SG8B 1XXFA 2PUXB 1KSNA 1Y3YA 4QT8C 3EA7A 1YLDA 4ABHA 2WPHS 1HPGA 4K3JA 2JH6D 1HDTH 3MNSA 2ZIQH 2A0QB 4NZLA 1XKAC 3C1KA 4NIVA 1E38B 4ZXYH 2J2UA 3R3GB 1LHFH 3RMLH 1S82A 4YXWD 1CA0B 1MTUA 2DE9A 3E3TA 4AB9A 5EXLA 2QN5T 3RM2H 1KXFA 1YGCH 5F8XA 2ZDKA 1TBRH 1TPPA 2KCPA 2ZZUH 5EQRA 2IJD1 1GVLA 2TGTA 2ZGXH 4NA8A 2EQNA 1ZOMA 1GHBF 3W95A 4NSYA 1D3DB 1GI3A 3RXTA 3P6ZB 3BTWE 5GNDA 4CR5A 3TH3H 1JMOH 1C5RA 2HVYB 3R0FA 3A88A 3T27A 4TT3D 2P3UB 4MPUA 1TGTA 1GHAG 1NS3A 1K1MA 1ZGVA 5JPMH 3FANA 1QCPA 2BD5A 2ZFPH 3UIRA 3PRDA 1WCZA 5FPSA 3JZ2B 3FAOA 1OWIA 4ACBA 1W12U 3N7EA 2ZHWH 2SNVA 4MPWA 5T1VA 2AHME 3DSOA 5E0JA 4B6FA 4J2YB 1EP5A 2J34A 3S9CA 3GOVB 4NIXA 1OS8A 2BD2A 2BY9X 1O2GH 2Z3EA 1LVYA 4F49A 1ZSJA 5FPTA 1P11E 2JJ2D 1GHWH 1UMAH 1ETTH 3AAVA 2A5IA 3GY2A 9ESTA 2WV5A 1XX9A 3F9GA 1IQLA 3S9BA 1T8OA 1C5NH 1SB1H 4YOJA 5ABWA 2PWXA 1ANBA 1ZTJA 3TGKE 1TX7A 1GBCA 1C2DA 1HBTH 1VCQA 1C1MA 1LMWB 5HIZA 1RD3B 4X1SU 4E7NA 1O2XA 3T26A 1NT1A 2VIPA 2FMJA 4ASHA 1B0FA 3E6PH 4Y71A 3TJUA 2OQ5A 3MO9A 3V0XA 2W26A 2OC8A 1T4UH 2J98A 2GCHG 3SU2A 3VB3A 3GCOA 4NGAH 2GT8A 2PV9B 1MAXA 2NU4E 4RSPA 2GZ7A 1BA8B 1AHTH 4AYVB 1RTKA 5E2OA 1C2LA 1S6HA 4FUFA 5LPEA 1ZPBA 1O34A 2BLVA 4PROA 1EB1H 1O37A 3A8AA 4CH2B 1H1BA 3EE0B 1GMCG 3NRLA 1UJ1A 1O3HA 2Y7XA 3KN2A 3GDUA 3SHCH 1S0QA 2F4LA 3BN9A 3T25A 1GCDA 1GI9B 1UTKA 2TPIZ 2TBSA 3BEIB 1BMNH 3QTOH 2WHXA 1C1NA 3LOXA 4F55A 1OWDA 2PGBB 3OEHD 1KLIH 1O3MA 1O5BB 1ELGA 1O5CB 2BMGB 4OGYA 4AORA 1SQAA 4ABDA 2BX3A 1QL9A 5KECA 1G36A 2ODYB 1K2I1 3PLBA 4WVPE 1OPHB 2FOBA 1DT2A 4FUDA 4Q7XA 1HAGE 1VGCC 2CMYA 2BDGA 2Z3CA 3RMOH 4XD7D 3TGJE 1TB6H 4AOQA 1FY1A 2B9LA 1Y3XA 4Z1MD 5LH8A 1F5RA 1BTHH 1YCPH 1MZAA 3RXEA 3FZZA 3SGQE 1B0EA 3L3TA 1SC8U 1GBLA 3GDVA 2Z3DA 4X1NU 1AUTC 3SJ9A 2F9UA 1P2JA 3ATLA 2CGAA 2VWLA 2PP6A 3SUGA 3GY6A 2Q6GA 1DWBH 3VPKA 1V2MT 1CT2E 1EB2A 3TVJB 4BXWA 1PYTC 2M5TA 2Q6DA 3KL6A 5GDSH 4H6SB 1CGIE 4ABGA 2BDHA 1TMBH 5C1UA 1UTNA 1O39A 5FXLA 3U98H 5AHGH 3DA9B 1Z71A 1Y3UA 1ZSKA 1P2IA 3F6UH 1LQDB 2P95A 4ZMAH 3D49H 3P95A 9LPRA 4JZFH 1BJVA 1W2KH 5DP5A 1G32B 3SNDA 2TGPZ 2ASUB 5HM9A 2K1QA 4RT1A 3FKSD 3M5OA 1ZPZA 1VCPA 1G2MA 1GBAA 4HG6A 3MH5A 4MNYA 1MD7A
chains in the Genus database with same CATH topology
3Q3KA 1FIZA 2ZFTA 3SHAH 4KKDA 4K2YA 3MO3A 1SGCA 1W0YH 2D2DA 3RXPA 1ELVA 1LKBA 5T6GA 5C5OA 1XXDA 1TQ7B 1Z8RA 3ZYEA 3BEFB 3HGNA 3QGJA 4CRCA 1LTOA 1TRNA 2BQ6B 1O2YA 1VJ9U 1GJDB 1WAYB 1MTNC 3A85A 1K22H 1FZZA 2QXGA 1A7SA 3EYDA 3RU4D 2O8UA 1DPOA 1AVGH 2OBQA 2ZPQA 4CR9A 1MU6B 1YC0A 4TY6A 1YF4A 4MG3A 1BDAA 1MKWK 3UY9A 1KXCA 3PLPA 3SUEA 3SJOA 3PYHA 1DM4B 1BCUH 3LKWA 3EGKH 3QZRA 4ZROA 1E37B 3QX5H 1O2VA 1IAUA 5J4QA 4KTCA 3PMHB 1AN1E 2Y7ZA 2J38A 1GBMA 2GCTB 1C2MA 1ZHMA 3F9FA 1M9UA 5LPRA 3GCTF 3SNBA 4IN1A 1CBWC 2G52A 1RTFB 2CN0H 1FNIA 2BY6X 3SQHE 1GHZA 2ZG0H 4Y7AA 4R0IA 1BBRK 4BNRA 5GIBA 4I31A 1GI6A 1P10A 1O2NA 4TY7A 4X6MA 1YPJH 2BOKA 1UHBB 3LC5A 3MNCA 5FCRA 1F7ZA 3CS0A 2GZ9A 3TU7H 1DE7H 1F5KU 1NU9A 4U32A 3RUOA 2BTCE 1L1GA 1S83A 2BYAX 1IQKA 1EXFA 1IQNA 2AERH 4DVAU 2GX4A 3HGPA 2AGGX 1SHYA 2AGIX 4MNWA 3HATH 2FDAA 4CRDA 4CH8B 1IQGA 4OS6A 1QNJA 1ZHRA 2BLWA 1SGQE 3UOPA 1D6RA 2EI7A 1YKTA 2O8LA 1GJBB 4DOQA 1KYNA 1TBZH 4X6NA 1Z8IB 1BT7A 5ETXA 2PLXA 2ZQ2A 5TJXA 1TWXB 1FN6A 2HNTF 1CT0E 1TNLA 1P05A 2FODA 4Y0YE 1O30A 2JETC 1OP2A 1ZMJA 2CV3A 1A61H 3PMAB 1GGDB 5HM2A 3K9XB 3S7KB 3RXOA 1TX8A 1QA7A 3MYWA 1BRCE 2A7CA 2V0BA 5A2MH 1L4ZA 1O33A 3ZVDA 1GBHA 1BHXF 3SN8A 4NA9H 2IN2A 2OP9A 3LGUA 1LQEA 3U9AH 4JCNA 4CREA 4NA7A 7KMEH 4CHAB 2OCVB 3E8LA 1CGJE 2BDBA 4HFPB 4R8TB 3QLPH 4OS4A 2BVRH 3MMGA 5C3NA 2JKHA 5A0AE 1A1RA 3A7YA 3IWMA 3M3TA 3DD2H 3CP7A 3RDZA 2ALPA 3EA9A 1ZJDA 1JRTA 4ABJA 1BRAA 3SU1A 3SQEE 4UDWH 1TMTH 1SMFE 1QJ7B 1OSSA 4F4OC 4JK5A 1QJ6B 3TK5A 1P02A 2JH0D 1C5OH 2ZTYA 1Y5AT 5EXNA 3RMNH 4WF8A 1EZXC 3UOUA 2J94A 2GDEH 1QA0A 1GCTB 2D1JA 2A31A 5DK1A 4ZHLU 2RA0A 1G37A 3MH4A 3KQDA 1GJCB 1TPAE 3AW0A 2A2QH 1NRSH 1C5MD 1HAXB 1P03A 3ZYDA 2THFB 4WMDA 2WUBA 5C20A 1V2WT 1C5PA 1QL7A 1A5HA 1CHOF 5C1XA 1VITG 3VB6A 1DXPA 3ZZ8A 1C2HA 2P16A 2ZPRA 1UK4A 3FP7E 1OWEA 2A4OA 2GVFA 1PPEE 1F92A 3ZZ5A 1AFQB 2TRMA 1FY4A 2OUAA 5A09A 3RU4T 1CA0C 1Z8GA 1TRMA 3MU5A 1AO5A 5BRRE 1AE8H 5G4BA 1HIAA 3C27B 2VU8E 1L1NA 3BEUA 3HKIB 3LC3A 2KAIA 1TNHA 2AFQB 2W7SA 3BIVH 1K1JA 1TLDA 2TIOA 1C2IA 1FI8A 1Y5BT 1MMJN 4OS2A 5ESTE 5JB9S 3LGTA 1C5VA 1QIXB 1C1TA 1K9OE 3RC5A 1HXFH 3O8DA 1CT4E 3QGNB 1IHTH 1CHGA 4NFEA 1GBBA 1ZLRA 2QC2A 3KGPA 1G3CA 1CO7E 1XMNB 1P3EA 1QR3E 1XUFA 1XVOA 1GI1A 3ZVCA 3GYMA 1P12E 3RXKA 2UUFB 2AS9A 5EPYA 2ZWLH 3U69H 3BSQA 4ZKRU 1MKXK 3O8RA 3GISB 1TYNA 4BTIB 1IOEA 2ANWA 3BTGE 2ZEBA 1BMAA 1BBRE 4FUCA 1PPGE 3SUDA 2BD4A 3VB5A 1OX1A 2EA3A 1EAUA 2VVCA 3LGIA 2AYWA 4KP0A 2BDYA 1QBVH 2DE8A 2WV4A 3SU3A 5L2ZH 1HAHH 7GCHF 1OWHA 2XC0A 2HVXA 2H9HA 3PMJA 4MPXA 1K1IA 3B8JA 1SL3A 5L2YH 1AB9B 2SFAA 6GCHG 1ELCA 2EI6A 2FLBH 3BIUH 2SGPE 2ALVA 4I33A 2BVXH 3RXGA 1T4VH 1EJAA 1O3DA 1F0UA 3A83A 5EW1H 1H8IH 1LHCH 3VEQB 1IQHA 2VVUA 1P2OA 3RXBA 3PTBA 4Z0KA 1O3BA 3UPEA 5I25A 1UCYE 2QXJA 1HRTH 4FXGH 1AZ8A 1QHRB 1C4U2 4A92A 1GI4A 1INCA 2FI3E 2BQ7B 1C2FA 1WSSH 5F6MA 1X7AC 1H9IE 5H4IB 3ATIA 2A45B 2Q1JA 1DSTA 1AWFH 2VJ1A 8GCHG 1OP8A 1GVKB 3B23B 1HYLA 3DT0H 4BOHA 5DP4A 3DUXH 3MH6A 1XUIA 1H9LB 5JBBS 3F1SB 3LGVA 1JIRA 1XM1A 4GCHF 3URCA 3ZVAA 3PWCA 2A7HA 3RXLA 1GBEA 3QZQA 4ZKOU 4FUHA 2GT7A 4BAOB 1O3GA 4A1XA 1MTVA 3BTQE 1O2SA 1XUKA 1KXBA 3BTTE 1SLVB 1DICA 4FUBA 3OY6U 3V13A 2ODPA 4MNXA 2C8XB 2P3TB 3QK1A 2XBWA 1QFKH 1S0RA 1T8MA 2NU3E 2W7UA 1A2CH 1BUIA 1GMHF 4UFGH 1NRRH 1AD8H 2BY5X 4TYDA 5FHTA 4CBNA 4XSKU 3M7UA 3M7QA 2WPMS 1EAXA 3PO1C 1TPSA 1OXGA 1GG6C 1OYQA 1HAYB 3A7WA 3SU0A 5EQSA 1NTPA 1YPLH 1G3BA 1ANDA 4CRGA 4BXSA 3Q00A 1EZUC 1AY6H 2RDLA 1TIOA 3A87A 3BTME 3ODDA 3LPRA 5IDKA 2NU0E 1BTUA 2A4GA 3U8RH 1A0JA 1O2WA 1BTXA 1THPB 5F8TA 1ZJKA 1GDQA 3A7ZA 2B7DH 1C1RA 2ZP0H 3RXFA 5K0HA 2CHAB 2Y5FA 4XBDA 1EZQA 3M35A 1SGTA 3RLWH 2VWMA 1FLEE 1GMDF 5E8EH 3ZZ6A 4GLYA 1GHBG 1WOFA 2FWWA 1JRSA 2STBE 1RRKA 3SOSA 2FLRH 1K1PA 1CQQA 3A82A 4X2YA 2SGAA 4BANB 3Q76A 1EOLA 4K5ZA 4XE4A 3RXAA 1GL0E 1XUGA 4LK4A 2PKAB 4NSVA 1ETRH 5ESBA 3ELAH 4NFFA 1P2NA 4IN2A 1UVPA 3MTYA 6LPRA 5EGMA 1SGPE 1NFXA 4SGAE 2BZ6H 4AGKA 1EPTA 2P8OB 4LZ1H 2XCFA 4X2VA 2R3YA 3UR9A 1PPBH 2ZDNA 5E0GA 2VNTA 3NKKA 4HGCA 4O3TA 2XXLA 1LHDH 2C8WB 4LOYH 5T6DA 1NFYA 4MQAA 2ZGCA 1C2KA 1IQIA 1QGFA 1WTGH 2G81E 3UWIA 2SGFE 2TGAA 1SGNE 4ZKSU 1NY22 5E2PA 2GZ8A 1K1LA 1NM6A 1TGSZ 3GY5A 4Y0ZE 2C90B 2GCTC 1VZQH 1PYTD 3A7VA 1MQ5A 3QN7A 3Q3YA 3URDA 1BB0B 4Q2KA 1BMMH 1QY6A 2F9PA 2QF0A 1HFDA 3BTHE 4ISLA 1LHEH 2A5AA 4X6PA 1BIOA 1YPGH 1AWHB 1UTQA 1EP6A 1ACBE 3EQ0H 3QUMP 1GBIA 1C5LH 3UNQA 4ABEA 1QJ1B 4AYYB 3ZZ7A 3MO6A 4ISHH 2FOCA 5I46H 4YO9A 4YT7H 1AKSA 1GI5A 1ORFA 5HMAA 3TIUA 1SGRE 2HWLB 3A8BA 4IS5A 2ZPSA 1N6YA 5DP8A 2XNIA 1Q31A 1LVBA 1A3EH 1PQ8A 1O38A 1K28D 4K8YA 3GYLB 3RXSA 2FOAA 5JDUB 4X6OA 1FV9A 3TH4H 2AGEX 5B6OA 3P8GA 2W3IA 1FJSA 5EG4A 4H6TA 3GY4A 3BTFE 5AFZH 2ZDAH 3MWIU 1GJ5H 4FVBA 3RXHA 3VB7A 3SZNA 3BTEE 2AIQA 2ANYA 6ESTA 3MFJA 1O5AB 1CA8B 1F0SA 1AE5A 5EU8A 3VGCB 1NESE 1CSOE 2LPRA 3ZVGA 2W5EA 1T7CA 4INKA 1QURH 2PW8H 1GDNA 3IG6B 4B75A 3QDZB 2GD4B 3GDSA 2G8TA 4O03A 4Q7YA 4CRBA 4NG9H 2AEIH 4Y8YA 4UFFH 1H4WA 4E7RG 1IQEA 3ZZAA 3ZVEA 2Y80A 3KQCA 4X1PU 5C2ZA 3SU5A 1QB6A 1ANEA 1GJ9B 1YCPK 1SBWA 3K6ZA 5DO4H 4BAMB 3GY7A 1RIWB 1Q2WA 2Y81A 1DUEA 4X8VH 1MBQA 3NXPA 3A8DA 5PTPA 3STJA 3UTUH 1LVOA 1O2HA 4AG1A 2B8OH 3BG8A 3OSYA 3Q3XA 1O3FA 1OWKA 1HNEE 2ZGBH 3UFAA 1DFPA 4JYVH 1C2JA 3RXJA 1HIAB 2GMTB 1MTSA 3GCHB 1PQ5A 1ZMLA 2KAIB 2ZCHP 3K6YA 3A84A 1P01A 4UEHH 4Q7ZA 5CMXH 2Y6TA 1NRQH 1GCTC 2C3SA 4ESTE 4ISNA 2R0LA 1S81A 1QBOA 4J1YA 5LGOA 2J4IA 1Z6JH 4JZDH 3MOCA 5TCCA 2ZGHA 1MCVA 4GUXA 4ABFA 2HOBA 1GVZA 5A8ZA 2RA3A 4JZ1A 1V2VT 3AW1A 2A4RA 2YNBA 3LONA 1CE5A 3SW2B 1ANCA 4B71A 1NO9H 1O5EH 2G4UA 1W13U 2ZFRH 4WXVA 3BV9B 5EOKA 3KQBA 4YESB 1D3QB 1DS2E 3CENA 4DW2U 1N8OB 3I78A 4UD9H 1AFQC 4I8JA 3I29A 2BD8A 4VGCC 4HTCH 2OXSA 1QL8A 1ZSLA 4FU7A 2PTCE 3E90B 1SGFG 1GDUA 3Q77A 2ZGJA 2SNWA 4I8HA 4INLA 3SBKA 1L0ZA 1UCYH 2WUCA 1S5SA 5C67A 1DWCH 3AAUA 1NRPH 4MPVA 2PKSC 2WINI 3PM3A 1ZTLA 1EJMA 3GCTG 4FUJA 1AQ7A 1LPZB 2OBOA 6CHAC 1B5GH 2VGCC 7ESTE 4XDEA 5BPEA 5C5NA 1KY9A 2OINA 1FPHH 4IC6A 5LPFA 1GL1A 4WWYA 2ZU1A 1T8LA 3U1IB 1G2LA 1GBJA 5DPAA 1J9CH 1C1OA 1MH0A 2ZU3A 1EOJA 3PB1E 1C2GA 2AMDA 3H7OA 2FX4A 1LO6A 1JXPA 1CU1A 1DVAH 1OKXA 3B9FH 3BTDE 5AFYH 2HLCA 2XWAA 1O36A 3O8BA 1U6QA 4E05H 3FZDA 1AZZA 3UR6A 1BOQA 2EI8A 3RC4A 2BY7X 1P09A 1NPMA 4FUIA 1KLJH 1ESTA 1GJ6A 1KTSB 4A1VA 1BHXB 2NWNA 1KDQA 2R9PA 4X0WU 2ZHDA 3ATMA 3NUMA 4MNVA 1ABJH 1ESAA 5K7RA 1YP9A 1JWTA 3LT3A 1L2EA 3ZV8A 4D9QA 5CHAC 1NFWA 1PQ7A 3KCGH 2BZAA 1UVOA 2V3HH 3ZZBA 4ZUHA 5JYIA 4AFQA 1SQTA 3E0NB 1KTTB 1O5DH 3ENSB 4UFDH 2OC7A 4GAWA 2SGEE 2R3UA 1K1OA 2Z9KA 1BMLA 1AVXA 4K1TA 2J95A 1T31A 2BDCA 1SOTA 3TK6A 2F9OA 4K8BA 1YPMH 5JB8S 1SHHB 1TNIA 1TQ0B 1MTNB 1O3IA 2AMPA 4KTUA 5A8XA 1DXWA 1C1SA 2ZFQH 3MU4A 4Y8XA 4AFUA 2NU1E 1UK3A 2OQUA 1RXPA 2G55A 2R2MB 2VIVA 1ARBA 4ZKNU 3UQOA 2LNCA 5JBTA 2FZZA 1ELTA 2VH6A 2GKVE 3MNXA 3ESTA 3HK6B 1GBFA 2HNTE 1D3PB 1NU7B 3TJNA 1C5SA 4XOJA 3TJOA 3T2NA 1TRYA 3SJIA 4B2AA 2FTLE 4FU8A 1HAVA 1L1JA 4JZIA 2XWBI 4TPYA 4WMEA 1FAXA 3TK9A 2FPZA 4ZHAA 1GHXH 1CHOG 3EDXB 2O8WA 1BRUP 1MKXH 1T32A 1V2QT 3SUFA 2G5VA 2VIWA 1BQYA 1DOJA 4Y79A 1SSXA 1K21H 1RGQA 1D3TB 8KME2 3F9HA 3ZZDA 1EPTB 3G01A 2HGTH 1KXAA 1F0RA 4JK6A 1HV7A 4K1EA 3MU8A 1GBTA 3KEEA 5GCHF 1GJ8B 4GVUA 1AIXH 3RLYH 4TWWA 1TAWA 1W7GH 1FONA 1PPZA 1SFQB 3ODFA 4NIWA 1H9HE 1C9TA 2FOGA 2ZU5A 1AFEH 5JBCS 1JIMA 3BG4B 4B2CA 1QRWA 3MHWU 5EPNA 1MQ6A 2FS8A 3QTVH 2ULLA 1WQSA 2GTBA 1ZHPA 2AH4X 1A5IA 4NIYA 3ZVBA 3P70B 4AN7A 2IJOB 2O9QA 4GSOA 4O97A 1YBWA 3FP8E 4IW4E 2ILNA 1J8AA 4XBCA 1VJAU 1UHBA 1V2UT 2HALA 1SI5H 2ZU2A 4JYUH 1UVSH 4B73A 4X2XA 3TNSA 4FU9A 3VFEA 2Z9GA 3RMMH 1Z1JA 2OD3B 3FFGA 2P8OC 1RJXB 4A1TA 2UUKB 5J4SA 1O3EA 2J92A 4I8LA 3SV7A 1AKSB 3VXEH 2BHGA 1A5GH 3OTJE 1CVWH 1SQOA 4RKJB 4AFSA 4B76A 3UQVA 4WY3A 1TGBA 1K1NA 4D7GA 1L4DA 1DDJA 1ELAA 2W3KA 1O5GH 3AVZA 2QA9E 2VVVA 1ZTKA 1DX5M 3OY5U 7GCHG 1WQVH 3ITIA 2WPLS 1FQ3A 3ZV9A 3TITA 5DKMA 4CRFA 2J9NA 3D23A 2BX4A 2XBYA 3M7TA 2ZCLP 3H7TA 1YCPM </