2O9QA

The crystal structure of bovine trypsin complexed with a small inhibition peptide orb2k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From protease inhibitor to antibiotics: single point mutation makes tremendous functional shift
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA02
3BTHE 2FM2A 4AGKA 3ZZ3A 5HYOA 4OS6A 2OCVB 3TU7H 1ZHPA 1L1GA 1UTLM 2P59A 4Y8XA 2GKVE 2ZDVH 3SU4A 3B8JA 3F1SB 5EW2H 4CRCA 2CN0H 3E1XB 1W0ZU 2GTBA 1WTGH 1UCYH 2G00A 5EPYA 1W8BH 2I6QA 2V6NA 2ZHQH 1UVPA 4MNWA 1YLDA 4IBLH 5DJ7A 1BTYA 1HYLA 1L4DA 1L2EA 1W0YH 2F9BH 2OC8A 3A89A 5E2OA 1GBTA 4MLFB 1DPOA 1GPZA 1K9OE 1ZLRA 1WUNH 2EEKA 3L6PA 1V2NT 3PTBA 2VINA 2VWMA 1LHFH 1CGHA 1P2JA 4UONA 2Z94A 1OYTH 1O33A 3ATKA 1A1RA 1MU6B 3VFEA 1T32A 5T6FA 4DJZB 2Z9LA 3F68H 1P2MA 2JH5D 3RC5A 3P95A 1WTHD 3Q76A 3MI4A 3B9FH 3LDXH 1NPMA 1F0SA 4HI3A 1TPSA 4VGCB 3F9HA 1TGSZ 1LTOA 3QGJA 1MTWA 4ZHAA 1YPJH 1DANH 1HAXB 3KN2A 1F92A 1EB2A 4THNH 1ELVA 3EE0B 3S0NA 4ABDA 2BDCA 1C5WB 2C3SA 4XBBA 1TE0A 4BNRA 1O2LA 4O03A 5C2ZA 1CBWC 4AX9H 2C8YB 2SGAA 1G32B 3BIVH 1D6RA 1PPZA 2I6SA 1GHBG 3RC6A 1TFXA 1AKSA 3U69H 1Y5BT 2ULLA 3K6YA 1BRUP 1ESTA 3IG6B 1SGDE 1JIRA 3RXKA 2FXRA 5BRRE 3SHCH 4NGAH 2G51A 1KTSB 3EQ0H 1GCDA 4NA8A 3V0XA 1H9LB 2TIOA 3KNXA 1SGTA 2CJIA 2Z7FE 1C5SA 3TJNA 3F9FA 3UOPA 1MKWH 4GCHF 2SGFE 2O8UA 1UJ1A 1UTQA 4FVDA 1W7GH 1P9UA 3BN9A 1K28D 1A0LA 1KLTA 1UHBB 1FI8A 1GDNA 4OS5A 2P95A 4X1QU 5EGMA 5DK1A 4J1YA 3PROA 1TGBA 4FU7A 3O8DA 1O38A 2A32A 2WUBA 2WV4A 3BTQE 3H5CB 1YPHE 3F9GA 1U6QA 1GMCF 2P8OB 3SGQE 1ZJDA 2BD7A 1XXFA 1G3BA 3DHKH 1NU7B 1THSH 4KKDA 4X6MA 2Y7XA 1EXFA 4NA7A 1C5YB 1ZMNA 4YESB 1GBAA 1H4WA 3UUZA 1IAUA 1GHYH 5FPSA 1BHXB 1MTVA 2ZFRH 8GCHF 1ARBA 1C2JA 1V2WT 1GG6B 1TQ0B 2Q6FA 4JYVH 4AYYB 4AFUA 2O8LA 1AFQC 3VB3A 1QTFA 1QA0A 1MBMA 1K1PA 1SI5H 4LZ1H 1MMJN 4UEHH 5DG6A 1ETTH 2FLRH 4Y7BA 1QJ6B 6CHAC 4B2CA 4K5ZA 1K1NA 3D23A 1TNHA 1ZGIA 3GDUA 1ETSH 4UE7H 3LU9B 4WMDA 5EG4A 1C1NA 2BX4A 1SG8B 9LPRA 1BBRH 2VNTA 1VJAU 1B0EA 2WINI 5GWZA 1QJ7B 3LGYA 3RM0H 1V2MT 2AH4X 3PMHB 1AUTC 3C1KA 2Z9JA 1HBTH 1F0TA 1V2VT 2ZCLP 1O2TA 2FOCA 4I8KA 1C1PA 1TWXB 4I8JA 2VJ1A 3E16B 1BRCE 1FY1A 2ZFSA 2JKHA 4AGJA 4NFFA 2VGCC 1GDUA 4WMEA 3SV2H 3A8BA 1GGDB 1Y3VA 3MMGA 3FP7E 1TGCA 1FAKH 1BMAA 4X2WA 1PPBH 1K21H 3DFJA 1V2KT 4TWWA 3DFLA 2FI5E 1IQGA 1KXFA 2AS9A 1HAIH 2CXVA 4OGXA 2ESTE 2RA3A 1GBLA 3SNAA 3RXLA 1HAZB 2Z3EA 2ZDKA 1MAXA 2B9LA 1ETRH 4O9VA 5IYTA 1YKTA 1GI5A 1ZSJA 2FTLE 3GCTG 4ABHA 3DA9B 5JB8S 2CF9H 3SGAE 1SBWA 5DP4A 1Z1IA 2ODPA 4CR5A 1Z6JH 3SW2B 2BTCE 3T28A 5GPIB 4GHTA 3Q3YA 3A7TA 1UTKA 1ABJH 4JZEH 2XC5A 8ESTE 1SGIB 4X2VA 5FXLA 3ZYDA 1YC0A 2VWNA 1ZMLA 4CR9A 1SOTA 2EI7A 1C5QA 2AEIH 1JIMA 2C8ZB 1OX1A 3RXUA 3IWMA 4ZH8A 2XYAA 2BQWB 2VB0A 1V2OT 1LHGH 1PPGE 2QA9E 3NUMA 5E2PA 2GCTB 1EZXC 1K1OA 1AI8H 1BT7A 3MOCA 3HK6B 3HGPA 3SNCA 1RD3B 2WUCA 4HFPB 5GIBA 2A4GA 4JYUH 5TCCA 1C2HA 2TRMA 4UFDH 1CT4E 4D7FA 2PKAA 1ZGVA 4FU9A 1P9SA 2ZQ2A 5TCAA 1FV9A 1LHEH 1GVLA 3LGTA 2QYIA 1QB1A 1P2NA 2OQUA 3PV4A 4O97A 1AZZA 1O3LA 3GYLB 4K69A 1GHXH 1T31A 4X6NA 3LJOA 1HAYB 1KDQB 4YLQH 1QA7A 3ZZ6A 1D3TB 2V35A 1QB6A 4ZKRU 3Q3KA 2ZKSA 4R0IA 5T6DA 1SPJA 1ELTA 1TONA 4BTUB 2XBXA 2PR3A 1PQ5A 2GD4B 4X1RU 4ZHMU 1S85A 3SUEA 1P03A 3BTWE 2A5IA 3HKIB 2FDAA 3SQEE 4ZUHA 3SNBA 2P93A 1IQJA 1F5LA 1SHYA 8GCHG 1A61H 4ISLA 1OXGA 4B75A 1DX5M 3A8AA 3O8BA 4DIHH 1Z8GA 4U2WA 4X1PU 3EA8A 1HAVB 1EASA 3PYHA 1ZOMA 1O3HA 2A4OA 3Q00A 4WWYA 1KXDA 1DXPA 1TMTH 3U1JB 1Y8TA 2HVXA 1KXAA 3I77A 3KQDA 1IQNA 5G4BA 1NC6A 1BDAA 1DS2E 1GL0E 3UNRA 4E7NA 1O3PB 2NU0E 1G2LA 2PV9B 1IQIA 2VWOA 2ZTYA 5L2ZH 3IITA 1C2FA 2ZDLA 2PFEA 3TK6A 4U30A 2VH6A 1W13U 1O2XA 3SJ9A 1DOJA 5LGOA 1RTKA 3VGCC 1ZTKA 5FBIA 3TLOA 3A8CA 3KIDU 1ZR0A 1NN6A 2FS8A 2OC7A 1C2DA 2RG3A 1F5RA 2H9EH 3SUGA 1O34A 1GCTB 3RXEA 3UFAA 3O8CA 4D7GA 1CA0C 1CGJE 1ZHRA 2P16A 4B1TA 1YCPK 1OKXA 2TGDA 3UQOA 2A7CA 1Y3UA 2Z3CA 1TYNA 1V3XA 1IQLA 1DUAA 1L4ZA 2OC0A 2OC1A 1BRBE 3KGPA 1EZQA 1HRTH 2R3UA 3S9CA 2V0BA 1O3NA 5I46H 5SGAE 1D3QB 1GBFA 1FDPA 3A8DA 1C1VH 1C1RA 1VCPA 2BLOA 5HMAA 2ODQA 2F9UA 2FEQH 3MU1A 2EA3A 1HAPH 1VITG 5FX5A 5HXFA 1HDTH 2V3HH 1TRYA 5ESTE 2ZP0H 4Y71A 1OWIA 3VEQB 5A0AE 1QRZA 1TOMH 2BD8A 2FOEA 2V3OH 1P3EA 2GZ7A 1O3GA 3SO3A 1J8AA 4XDEA 4YZUA 4LOYH 4NSVA 1VCWA 1WYKA 2WPJS 5EQSA 4CHAC 2GV7A 1C5OH 2XRCA 3N7OA 1O3JA 4B2AA 1ELEE 2QXJA 1PYTC 3S69A 1C2LA 1P04A 5K0HA 1NTPA 3MTYA 4UDWH 1YPKH 1XM1A 4DCDA 1V6DA 3TITA 1PPCE 1YBWA 2PLXA 1RIWB 3UNSA 4WJG2 1P05A 4ZROA 3S7HB 1YP9A 1TALA 1NRQH 1O5FH 1FY8E 2PKSC 1BRAA 3NK8A 2FX6A 1SSXA 3JZ1B 1P01A 4WH6A 1P2QA 1KLJH 1UTNA 1GI7B 1HAOH 1MD8A 1J9CH 2BQ6B 2A31A 4ZMAH 2XC4A 1RTFB 2BZ6H 4BAMB 1SQAA 3SGBE 4IGDA 4INHA 1KXBA 3GDSA 2IPHA 3DD2H 1ZPCA 1FY4A 1SVPA 3QN7A 2ANMH 3Q77A 4GLYA 2HOBA 3H7OA 4Y8ZA 4A1VA 3U98H 1GMHF 3SU0A 3D49H 1XUFA 3RXDA 3RXCA 2DUCA 2GCTC 2GDDA 3OTJE 2QN5T 5FPTA 3M5NA 4I8HA 5C1XA 2VGCB 1P8VC 2IOTA 1RXPA 1A3BH 1O32A 1GHZA 4AFQA 3K9XB 3QK1A 2VIWA 1HJAB 1O2MA 4JZDH 3UOUA 1AQ7A 1JRTA 2EI8A 2RA0A 3RC4A 3TH3H 2ALVA 1EB1H 4BXSA 1J17T 1C5TA 1C5MD 1E37B 4MVNA 3RLYH 3S9BA 2QAAA 2P3FH 2VVVA 3M5OA 1W12U 3A7ZA 1O2OA 1O3MA 2NWNA 5GCHF 4TWYA 2QV1A 3KQBA 3RU4D 1BMLA 1D6WA 2ZQ1A 3RXQA 2ZFQH 1LCYA 1SGFA 1ZPZA 2C90B 4MTBA 3MO9A 3P8FA 2H2ZA 1JMOH 1GJ6A 1O3OA 1WSSH 3KCGH 1SB1H 1G3CA 1N6YA 3UIRA 1XKAC 3MU8A 2AIPA 4YOIA 1VZQH 3PMJA 5F8XA 2ZPQA 3BTEE 1TX6A 3OY5U 3HGNA 1OS8A 1NZQH 2J92A 3BF6H 3NPSA 4YT6H 3TK9A 3M3TA 5GXPA 1GJAB 5IDKA 3H7TA 3M7TA 3GY4A 3BTDE 4BXWA 4TPYA 3P8OA 4DOQA 3LKWA 3W94A 4X0WU 2GT8A 5GDSH 1UTJA 1CA8B 2FZZA 1EP6A 2ZTXA 1GMDF 4KTCA 1SLXB 4GCHG 2OXSA 1A7SA 8LPRA 1ZYOA 2H9HA 4Y8YA 3RP2A 4MNVA 1YF4A 1QRXA 2SFAA 1M9UA 3ZVFA 3TNSA 2CF8H 2NU3E 3AW0A 4X8TH 1MAYA 2ZU4A 2ZDNA 5A8ZA 1EPTC 3SZNA 4LXBH 9ESTA 2FX4A 4ISNA 3URCA 2ZHEH 6CHAB 2R2WU 3AVZA 2UWOA 1O2VA 1GMCG 2Z9GA 5AF9H 3T27A 1HLTH 1WOFA 3SV8A 5EPNA 4ZAEA 4X1NU 1ZTLA 3RXFA 3SHAH 4NIXA 1S6HA 5LPRA 1G36A 2ZPSA 3OYPA 3SJIA 3ZVGA 4O3UA 1AB9B 5J4QA 1O2RA 1AWHB 1XUKA 1SGCA 4IMQA 2GZ8A 2AGIX 1O5EH 1MTUA 1AO5A 1ELGA 1NU9A 2OLGA 1Z8RA 4ZXXH 4AOQA 1C5LH 1GVZA 1FXYA 2WPLS 5T3HA 1CBWB 5L6NH 1ORFA 1BZXE 2ILNA 1C5NH 5JBBS 4DW2U 1TNIA 2OTVA 1BMMH 1C2KA 1OP0A 2BQ7B 4R8TB 3ZZ9A 1DXWA 1GL1A 4XBDA 5DP8A 1GBHA 3LJJA 2W7SA 3SI4H 1BB0B 1SQOA 1CA0B 5LPFA 2A5KA 4Q7YA 1C5XB 1QQUA 1XXDA 3MH5A 4NG9H 2ZIQH 1QL8A 3VGCB 4CBOA 1THRH 1V2QT 4I31A 5C67A 3HK3B 3A80A 1QHRB 3SUDA 5H4IB 2SGPE 2F9PA 1J14A 2UUJB 1O39A 4AG2A 3KQCA 1D4PB 3ZV9A 2GMTB 2NU2E 3ODFA 2O8TA 4D76A 1BJVA 5C5OA 2C8XB 1TA2A 1CT0E 2BB4A 3LH3A 4UD9H 4JK5A 2FLBH 2BDIA 3T25A 1AB9C 2FPZA 1HAHH 3QGNB 1EAWA 1G2MA 3U1IB 3V3MA 1K1MA 5EQQA 6GCHF 2GZ9A 4AFSA 3ZZAA 1UVTH 1G3DA 4BTIB 3PB1E 1EQ9A 2FODA 1GJ7B 4Y11E 2GT7A 1LPGB 2VIQA 4LK4A 4AZ2B 2OBQA 3K6ZA 1DUEA 1FPCH 4VGCC 2WYGA 1MCVA 2XW9A 2YOLA 1FY3A 1EPTB 3E0PB 1LVMA 3GY2A 3MNXA 1QURH 3A83A 3PLPA 5K7RA 3CS7A 3GCNA 1XUGA 4Z6AH 5F8TA 1E38B 1C1MA 3K65B 1EOLA 1BBRE 2NU1E 2ZG0H 1UO6A 2ANWA 3DUXH 2ALPA 4Y0ZE 4X8SH 1ANBA 2ZPRA 1VITF 2ZF0H 1D3DB 2PGQB 3BSQA 1SLVB 1Z8JB 1GBEA 4IW4E 2ZNKH 3SV7A 3UWIA 3P8GA 1QRWA 1GI9B 1OWDA 3FVFB 1A3EH 5JBAS 1SGEE 1L0ZA 2FI3E 4OS1A 3U9AH 2BXTH 4CRFA 3TH4H 1ELCA 2CMYA 4BAOB 5C1UA 1O5BB 1MCTA 1C1QA 2ZGCA 1GHVH 4AB8A 2Q6DA 4JZ1A 1RGQA 2R9PA 2H9TH 1L1JA 1TABE 3SI3H 4WXIA 4TYDA 1EAIA 4X1SU 2PSYA 1F0RA 1W2KH 3RXMA 4FUEA 1AZ8A 3EA9A 1EPTA 5EXLA 1IHTH 5JDUB 2ZGBH 4HGCA 1DITH 4UFFH 5JBCS 7ESTE 2H1UA 1DLKB 2PWXA 3GY3A 1WBGB 3RXVA 2G52A 1CQQA 1SR5C 1A46H 1B0FA 3ESTA 1HJAC 3BEIB 2ZFPH 4NIWA 1LHDH 3ZZCA 2FMJA 2HPPH 5CE1A 3P70B 1Z8IB 4CREA 4XFQA 2PTCE 3SNEA 4ABFA 2Y5FA 4I8LA 1UTOA 4GVUA 3MWIU 1MKXK 1O5DH 1C2GA 2AERH 2B7DH 2OINA 1C5PA 2THFB 2QIQA 1ZMJA 2IN2A 3ZVEA 4CH2B 1O31A 4IS5A 3FFGA 1PYTD 3ATMA 1SFQB 2JH6D 1OWHA 2A7JA 1S5SA 3L33A 1FMGA 3QTOH 5DP7A 5T6GA 1ZJKA 1RS0A 3LGVA 3MYWA 2VVUA 2VIVA 4F49A 4X8VH 4UFGH 2FIRH 2VH0A 4NSYA 4HZHA 2J9NA 1WV7H 5J4SA 3T26A 1B5GH 1O30A 2IJOB 2BY5X 3M36A 1N8OC 2FI4E 1ACBE 3QX5H 1O0DH 3OU0A 3JZ2B 4K1SA 2QF3A 1ELFA 5DP3A 4FUFA 2Y6TA 1KSNA 5DGJA 1CVWH 4B73A 2XWBI 2D26C 1LVYA 1HB0B 1NRPH 1K1IA 2SNVA 1G30B 1FY5A 1HIAB 1IOEA 2BVRH 2BD3A 1EKBB 3QUMP 1S83A 3ZV8A 1DY9A 4AN7A 1CHOG 1BTZA 4TPIZ 1DFPA 1TPOA 2ANYA 2JETC 5AVDA 3QO6A 1GDQA 3D65E 4B2BA 3SU1A 2ZECA 2KAIB 2PGBB 1SGQE 3VB5A 3QZRA 3UR6A 1DWBH 1QIXB 2O8MA 2Z9KA 4MPXA 5A09A 6GCHG 4KP0A 2RCEA 1YYY1 1MQ6A 1TMBH 4IC5A 4I7YH 1BTPA 1INCA 3ZVDA 5A8XA 1E36B 1W7XH 2Y5HA 3GOVB 2ZU2A 3P17H 2EC9H 1D9IA 2GMTC 2STBE 2Y81A 4AB9A 1BA8B 1EUFA 2UWLA 1DSTA 2J95A 1PJPA 3STJA 1A4WH 1O2NA 4HTCH 2OD3B 1AHTH 3A7VA 5HM9A 1BMNH 1O2GH 1T8LA 1RFNA 1YPGH 5CMXH 2PUQH 1OPHB 4ABJA 1QY6A 2VIOA 3LT3A 1QNJA 4D9RA 3SJOA 2M5TA 1AVXA 1ELAA 2QF0A 2ZZUH 1NO9H 3ZVBA 3A81A 1O2JA 1DICA 1OOKB 3MNSA 1DT2A 1AGJA 2P3TB 4JYTA 1W14U 2G81E 1N1LA 1SGNE 1DSUA 2BY9X 5ETXA 3LC5A 1CHGA 1GJCB 3AW1A 5CHAC 1EJMA 5C1YA 3GYMA 4FUHA 4X8UH 1GBJA 3RXSA 1IQFA 1FIWA 3BG4C 2BHGA 4H4FA 1SGYE 1WQVH 1SQTA 1BCUH 1HXFH 2WPMS 3E0NB 4OS7A 2GDEH 1FAXA 3KF2A 3VB4A 1V2RT 1O37A 2GCHF 3ATLA 4MDSA 1QL7A 5FCKA 3MHWU 2BD5A 1F2SE 4ZKSU 5TJXA 1K1LA 3ZZ8A 4WH8A 1ANDA 1GI0A 2FS9A 5CHAB 4A5TS 2BOKA 3TNTA 1CSOE 1IQHA 1ELBA 3EGKH 1Y5AT 2NU4E 1ZTJA 1KIGH 1THPB 1EAXA 3TPIZ 1J15A 3T29A 2ZGJA 2PHBA 1ZZZA 1GWAA 1O2UA 1HGTH 3UPEA 2BMGB 2VWLA 2HPQH 2OBOA 3LGWA 3PWCA 4IMZA 3OX7U 1Y3XA 3TK5A 4ZHLU 4NA9H 4RSPA 1O3CA 2J94A 3MH4A 1TX8A 5FAHA 1HIAA 1SLWB 3ZZBA 1UCYK 2A1DB 5GCHG 1QQ4A 3AAVA 5A0BA 2C8WB 2ZFTA 4JCNA 1NT1A 3EAJA 1AN1E 1OP8A 2G5NA 2F9NA 1HJ8A 2C4FH 3V12A 1SGRE 2F9VA 3M7UA 3QWCH 3LIWA 1H8IH 2Y80A 3A86A 5EXMA 4QT8C 1A5GH 3WY8A 1JXPA 2HNTE 1TRMA 1XUIA 1O3IA 4MNXA 1AKSB 1DWDH 1XKBC 1C1UH 2BDAA 1GBKA 4FUCA 5E8EH 1T8OA 2BZAA 1OYQA 3QDZB 2ZGXH 1O2YA 1G9IE 4GSOA 1PFXC 1C5ZB 1TNKA 1HAGE 7KMEH 3M3VA 4JK6A 1BHXF 3LPRA 4FVBA 4D8NA 2JETB 1MBQA 2UUYA 4SGBE 1UVUH 5C3NA 1KTTB 2Y7ZA 1O2QA 3P6ZB 1CU1A 1L1NA 3FZZA 1GI3A 4OS4A 4CBNA 1GJ9B 1MKXH 2BVXH 1Y3WA 3L3TA 3P92A 1FJSA 4INLA 3SNDA 3K2UA 4NZQA 2O9QA 5DKMA 1HJ9A 1MZAA 1LDTT 4LZ4B 4FUGA 4K2YA 2BDHA 3RXRA 4Q80A 3QLPH 1OSSA 4BTTB 4SGAE 1Q3XA 2AGGX 2UUFB 1SGPE 3ZVAA 1P2OA 2J38A 1AU8A 2FOMB 1A0JA 1UTPA 1ZHMA 4ABAA 1OWEA 3E91A 1ANEA 2YNBA 6LPRA 1AD8H 1X7AC 3FP6E 3RXJA 5C20A 3TGJE 1C5UA 1UK2A 1TNGA 1MKWK 2FOAA 3TGKE 2H5CA 2AYWA 4WMFA 1T4UH 2A7HA 2BX3A 1ZRBA 2F3CE 1O2PA 1K22H 2BD9A 2WPKS 3ITIA 3RM2H 1GI4A 2PKAB 1VR1H 1W3CA 3SJKA 4NCYA 1EATA 1GGDC 3HKJB 1CT2E 1MZDA 2R2MB 1TLDA 1UVOA 1V2JT 5HGGA 3B23B 2FESH 1DLEA 1HNEE 1V2PT 1DWCH 4DIIH 1UK4A 2D2DA 1SLUB 2DE8A 1EZSC 1QCPA 1FZZA 1KDQA 1H8DH 4ISOA 4NWKA 4ABIA 3PLBA 4MPUA 3TH2H 3MFJA 1DE7H 1BTXA 3UREA 2XBYA 2Q1JA 3FP8E 4MPVA 3G01A 2XWAA 1UVSH 2ZCKP 1SFIA 4Q7XA 2OUAA 2GGVB 5AFZH 4ASHA 4K8BA 3M61U 1BJUA 2H5DA 2J4IA 2WYJA 1H1BA 1XUJA 3MO6A 1MUEB 2CHAB 2PW8H 2K1QA 1P2KA 3RXAA 1SMFE 2R3YA 4OS2A 1K2I1 3BTME 7GCHF 1VGCC 1BBRK 4X6OA 4Y0YE 4ABBA 1UCYE 1EAUA 1UTMA 3SORA 4Y6DA 1YCPH 5F6MA 1NRRH 3U8RH 1QGFA 1Y3YA 2B5TB 4ZKNU 2SGDE 1YPEH 1Q2WA 1CO7E 1TGNA 2W3IA 2PSXA 4DY7B 1S84A 4YOJA 3RXBA 2AMQA 1S0RA 3RXOA 3FAOA 1RIWC 3MU5A 3S7KB 2FP7B 2GVFA 1O3FA 1WCZA 2J34A 3SU2A 1NRSH 1AMHA 3ODDA 5F03A 1EX3A 1LVOA 3SV6A 1QBVH 1NRNH 3E8LA 1EP5A 3PMBB 2FYRA 2QXIA 2PTNA 1E0FD 1TNJA 3PO1B 2TPIZ 1GJDB 3LC3A 4RN6A 2A2XH 1GI6A 3GCTF 3EYDA 1RRKA 1QBOA 1NFYA 1NROH 2D1JA 3U8TH 1MTNB 1C9TA 5L2YH 2TGAA 2WV5A 3KHVA 4A92A 5DPAA 4FUDA 2EI6A 2A4RA 2ZDMA 1SC8U 5DP6A 1LKBA 3F6UH 4MPWA 4H6SB 2AFQB 3ZZ5A 1TQ7B 3CS0A 1T8MA 2FO9A 3BG4B 3RU4E 1O35A 1IQEA 3HATH 1GBDA 3A7WA 3BTFE 4WXVA 2LPRA 4E06H 1MTSA 3GICB 1EZUC 4YT7H 4JMYA 1LKAA 3M35A 1O2KA 2P94A 2WPHS 1V2TT 5FCRA 1TBQH 1GCTC 3D62A 3M7QA 1UHBA 4IC6A 2VIPA 2AGEX 1O5AB 1RTLA 4DT7B 1FQ3A 3LONA 4XSKU 3TJVA 4U32A 1F7ZA 4YM9A 1TA6A 1ID5H 1P11E 2UWPA 1KXEA 1P02A 1P06A 2AIQA 2A0QB 2HGTH 4ABGA 3BTKE 1DVAH 3KL6A 4ISHH 3GISB 2G4TA 2ZA5A 1XMNB 2XCNA 1ANCA 4BAKB 2BVSH 4MNYA 1SGFG 1EJAA 3RMNH 3BIUH 5E0JA 1DDJA 1MTNC 1LVBA 3TIUA 1MU8B 1O2ZA 3CP7A 1P57B 4AFZA 1VITH 1Y5UT 4TY6A 4H6TA 2UUKB 2FTMA 3PO1C 3CENA 5EQRA 4CRDA 1BTUA 4I32A 3BEUA 2F91A 2J2UA 3SU3A 1GHWH 4FUIA 1AWFH 1GJ4H 1S82A 1C1OA 4Y7AA 2FOHA 2GP9B 4DVAU 1AE5A 2BLVA 2HRVA 3A7YA 3T2NA 1HCGA 4K1TA 2XXLA 4CRBA 5GJ4B 3ATWA 2FOGA 4K8YA 3LOXA 1MD7A 3RXHA 1S81A 2ASUB 1V2UT 3PWBA 4MQAA 3M5LA 1SHHB 3BV9B 1CHOF 2CGAA 4CRGA 2XTTB 4U01A 3I78A 3TVJB 3E6PH 1ESBA 1C9PA 1ZSLA 2VVCA 2W7UA 2D8WA 4BAHB 4X6PA 4FUJA 4YO9A 2VIDA 2BLWA 3RMMH 1JOUB 2VU8E 5A0CA 2G5VA 1VGCB 1A2CH 1GHBF 2Y82A 3MO3A 1O3AA 1NFUA 4YTAA 5A8YA 4XOJA 1LO6A 1BQYA 3I29A 3O8RA 3MNBA 1GBMA 2CHAC 1C4Y2 1ZRKA 1ABIH 1O2WA 3Q3XA 1GI1A 2ZWLH 3RXTA 1O3EA 2ZU5A 3STIA 2QCYA 1BITA 1C1WH 1CGIE 1TRNA 4YLUA 2BDYA 1P12E 1WAYB 3GCHB 2QXHA 1A5HA 1XX9A 2BDBA 8KME2 4FUBA 4DG4A 1QL9A 3E90B 1DM4B 5E0HA 2W5EA 3UTUH 4YOGA 1TPAE 3GCOA 1AUJA 2ZC9H 2ZFFH 3A84A 1FN6A 5FPYA 3GY7A 1TNLA 3W95A 5L30H 1C1SA 3NWUA 4IN2A 1HUTH 1KY9A 3PLKA 1F0UA 1TMUH 2ANKH 1QBNA 4X2XA 2XBWA 4KELA 1C2EA 2XC0A 1QR3E 1GHAG 1YPHC 1RJXB 1E35B 3T5FH 1AFQB 1BTHH 2BD4A 1YPLH 2HNTF 3BTGE 1ZSKA 5EOKA 1J16A 1KLIH 5ABWA 4Q2KA 1GG6C 4INKA 1LPKB 1LMWB 3RUOA 2FWWA 1TBRH 2AMDA 3UWJH 3A88A 4E05H 2BY8X 1LQDB 4WVPE 2QY0B 2G4UA 2XCFA 3QTVH 2P3UB 1ESAA 1GJ5H 2BY6X 1Z71A 1PPEE 1C5VA 4K3JA 2HALA 3LGIA 3VB6A 1N6XA 1JRSA 4J2YB 2PKSB 4JZFH 3ZZ4A 1WQSA 2PUXB 1PPHE 3V7TA 3RMLH 1GBBA 3RXPA 4A6LA 5EXNA 2GV6A 2Z3DA 3ZZ7A 1YLCA 3OSYA 3UQVA 1GMHG 3MH6A 1K1JA 1AVWA 3NCLA 4B76A 5B6OA 3KQEA 1TGTA 4A7IB 4PROA 2F9OA 1A0HB 4AG1A 4KTSA 4NZLA 2HNTC 2HWLB 4KGAA 4CHAB 1GJ8B 2C93B 3SJ8A 3GY8A 1FIZA 1O2HA 3E3TA 1NFWA 2Y5GA 3VPKA 1XVMA 3A82A 1Y59T 2W26A 1C4U2 2ZDAH 5HM2A 2A2QH 3NKKA 1NFXA 1OP2A 3GY6A 1QB9A 2TBSA 3PMAB 4FXGH 5BPEA 2BDGA 2JH0D 1C5RA 1VJ9U 1SL3A 3A85A 4ESTE 1GVKB 4NFEA 3MU0A 4XE4A 3C27B 3RDZA 1T7CA 3LH1A 4D9QA 2BYAX 3MNCA 3VXEH 1T8NA 1E34B 2P8OC 3VXFH 4IN1A 5A2MH 2BOHB 3M37A 5PTPA 3SBKA 1V2LT 4GHQA 1UMAH 2XBVA 4H42U 2O8WA 1BIOA 1W11U 5E0GA 3U8OH 1TOCB 4BOHA 1HAVA 1HXEH 3A7XA 1O5CB 2FOBA 2HLCA 1O5GH 1NM6A 4ZKOU 4RKJB 2Z6BD 2ODYB 1C1TA 3VB7A 1F5KU 1AY6H 4WF8A 5F8ZA 3MH7A 4I8GA 1OWKA 4OGYA 3RMOH 2A45B 4B71A 2FOFA 2Z9IA 4FU8A 1TB6H 1O2IA 1NESE 4X2YA 2OP9A 5AFYH 4Y10E 1GI2A 3PM3A 3GY5A 4AYVB 5FHTA 1CE5A 4NIVA 1P10A 1Z1JA 2ZO3H 3OY6U 2OQ5A 1TAWA 4MG3A 4XBCA 3NXPA 1AVGH 3ATIA 1ZPBA 2ZHDA 4M7GA 1O3BA 1LPZB 3P8NA 1G37A 3TJOA 2ZEBA 5DO4H 4Q7ZA 1T4VH 1IQMA 3SV9A 1AFEH 1GMDG 1MH0A 4I33A 2WPIS 1HPGA 1KYNA 1Z6EA 1GBCA 1O3DA 2BD2A 1G3EA 1Z7KA 3SU6A 1YCPM 2SNWA 2TGTA 4BANB 2R0LA 7LPRA 2ZTZA 1V2ST 3SU5A 2TGPZ 4GUXA 1P09A 1B7XB 4Y76A 3EA7A 1PQ8A 2CV3A 3PTNA 4GAWA 5AHGH 1ELDE 4O3TA 1EOJA 3MU4A 4BAQB 1C4V2 2YNAA 6ESTA 3ELAH 4Y79A 1KXCA 1BTWA 4CRAA 5JBTA 1A5IA 1TBZH 2ZU3A 4K1EA 1W10U 3T62A 1GHAF 2QC2A 1YPMH 4TY7A 2B8OH 3KEEA 2ZGHA 1C2MA 3S9AA 1FUJA 5LH8A 2W3KA 5EODA 1GJBB 4AORA 3M5MA 4A1TA 3UNQA 4DGJA 3SQHE 2GX4A 1P2IA 4DURA 1P3CA 3RXIA 1H9HE 7GCHG 1PQ7A 1P0SH 1OWJA 2SGQE 3SUFA 1FLEE 4ISIH 4ZXYH 1S0QA 3EDXB 1DY8A 5DP5A 1MQ5A 1IHSH 3SN8A 2F83A 1EJNA 1GI8B 2R0KA 2STAE 4NIYA 2A4QA 2QXGA 2RDLA 3AASA 3UR9A 3ZZDA 5FX6A 2BXUH 3FZDA 3RU4T 3TGIE 1QFKH 2QGRA 4JZIA 4B74A 3RLWH 2SGEE 1N8OB 3F9EA 4UFEH 4ABEA 1AIXH 2AMPA 3ZYEA 1FN8A 1TX7A 2Q6GA 1XUHA 1XVOA 3QZQA 2ZHFH 2G55A 4Z0KA 1JBUH 1IQKA 1YM0A 1HV7A 3BTTE 3GCHC 1GBIA 2DE9A 5EU8A 3TJUA 1QJ1B 2ZI2H 5DP9A 3GDVA 2KAIA 4F4OC 5LPEA 3BEFB 1JWTA 3URDA 5JPMH 1FONA 1BOQA 3FANA 1WU1A 2FYQA 2LNCA 4E7RG 3DT0H 3UY9A 3V13A 3ZVCA 2BY7X 5C5NA 2G8TA 1S6FA 5FBEA 2BM2A 5ESBA 5JB9S 3M3SA 1DWEH 2ZU1A 2XNIA 5I25A 1SOZA 1FPHH 1LQEA 4KTUA 2ZHWH 1NY22 1PQAA 1TIOA 3R0FA 2BLQA 4WY3A 3SOSA 4CH8B 1HFDA 1BUIA 3NZIA 1PPFE 1TPPA 1YGCH 4GPGA 1AE8H 3R3GB 3RXGA 3BG8A 1Q31A 3A87A 2GCHG 1NS3A 2B0FA 1LHCH 3HPTB 3ENSB 4RKOB 2A5AA 4K60A 1H9IE 5EW1H 1O2SA 4NWLA 1O3KA 3LGUA 1ARCA 5JYIA 1VCQA 2H6MA 3AAUA 1FNIA 1D3PB 1O36A 1C2IA 2ZCHP 1UK3A 4A1XA
chains in the Genus database with same CATH superfamily
3BTHE 2FM2A 4AGKA 3ZZ3A 5HYOA 4OM9A 4OS6A 2OCVB 3TU7H 1ZHPA 1L1GA 1UTLM 2P59A 3FN8A 4Y8XA 2GKVE 2ZDVH 3SU4A 3B8JA 3F1SB 5EW2H 4CRCA 2CN0H 3E1XB 1W0ZU 2GTBA 1WTGH 1UCYH 2G00A 5EPYA 1W8BH 2I6QA 2V6NA 2ZHQH 1UVPA 2GJGA 4MNWA 1YLDA 2YMSD 4IBLH 5DJ7A 1BTYA 1HYLA 1L4DA 1L2EA 1W0YH 2F9BH 2OC8A 3A89A 5E2OA 1GBTA 4MLFB 1DPOA 1GPZA 1K9OE 1ZLRA 1WUNH 2EEKA 3L6PA 1V2NT 3PTBA 2VINA 2VWMA 1LHFH 1CGHA 2LP6A 1P2JA 4UONA 3FOAA 4YXWD 2Z94A 1OYTH 1O33A 3ATKA 1A1RA 1MU6B 3U28C 3VFEA 1T32A 5T6FA 4DJZB 2Z9LA 3F68H 1P2MA 2JH5D 3RC5A 3P95A 1WTHD 3Q76A 3MI4A 3B9FH 3LDXH 1NPMA 1F0SA 4HI3A 1TPSA 4VGCB 3F9HA 1TGSZ 4FETA 1LTOA 3QGJA 1MTWA 4ZHAA 1YPJH 1DANH 1HAXB 3KN2A 1F92A 1EB2A 4THNH 1ELVA 3EE0B 3S0NA 4ABDA 2BDCA 1C5WB 2C3SA 4XBBA 1TE0A 4BNRA 1O2LA 4O03A 5C2ZA 1CBWC 4AX9H 2C8YB 2SGAA 1G32B 3BIVH 1D6RA 1PPZA 2I6SA 1GHBG 3RC6A 1TFXA 1AKSA 3U69H 1Y5BT 2ULLA 3K6YA 1BRUP 1ESTA 3IG6B 1SGDE 1JIRA 3RXKA 2FXRA 5BRRE 3SHCH 4NGAH 2G51A 1KTSB 3EQ0H 1GCDA 4NA8A 3V0XA 1H9LB 2TIOA 3KNXA 1SGTA 2CJIA 2Z7FE 1C5SA 3PRBA 3TJNA 3F9FA 3UOPA 1MKWH 4GCHF 2SGFE 2O8UA 1UJ1A 1UTQA 4FVDA 1W7GH 1P9UA 3BN9A 1K28D 1A0LA 1KLTA 1UHBB 1FI8A 1GDNA 4OS5A 2P95A 4X1QU 5EGMA 5DK1A 4J1YA 3PROA 1TGBA 4FU7A 3O8DA 1O38A 2A32A 2WUBA 2WV4A 3BTQE 3H5CB 1YPHE 1MABB 3F9GA 1U6QA 1GMCF 2P8OB 3SGQE 5GNDA 1ZJDA 2BD7A 1XXFA 1G3BA 3DHKH 1NU7B 1THSH 4KKDA 4X6MA 2Y7XA 1EXFA 4NA7A 1C5YB 1ZMNA 4YESB 1GBAA 1H4WA 3UUZA 1IAUA 1GHYH 5FPSA 1BHXB 1MTVA 2ZFRH 8GCHF 1ARBA 1C2JA 1V2WT 1WXRA 1GG6B 1TQ0B 2Q6FA 4JYVH 4AYYB 4AFUA 2O8LA 1AFQC 3KYFA 3VB3A 1QTFA 1QA0A 1MBMA 1K1PA 1SI5H 4LZ1H 1MMJN 4UEHH 5DG6A 1ETTH 2FLRH 4Y7BA 1QJ6B 6CHAC 4B2CA 4K5ZA 1K1NA 3D23A 1TNHA 1ZGIA 3GDUA 5CDFE 1ETSH 4UE7H 3LU9B 4WMDA 5EG4A 1C1NA 2BX4A 1SG8B 9LPRA 1BBRH 2VNTA 1VJAU 1B0EA 2WINI 5GWZA 5HKKD 1QJ7B 3LGYA 3RM0H 1V2MT 2AH4X 3PMHB 1AUTC 3C1KA 2Z9JA 1HBTH 1F0TA 1V2VT 2ZCLP 1O2TA 2FOCA 4I8KA 4HG6A 1C1PA 1TWXB 4I8JA 2VJ1A 3E16B 4AC9A 1BRCE 1FY1A 2ZFSA 2JKHA 4AGJA 4NFFA 2VGCC 1GDUA 4WMEA 3SV2H 3A8BA 1GGDB 1Y3VA 3MMGA 3FP7E 1TGCA 1FAKH 1BMAA 3OE7D 4X2WA 1PPBH 1K21H 3DFJA 1V2KT 4TWWA 1YY3A 3DFLA 2FI5E 1IQGA 1KXFA 3N7DA 2AS9A 1HAIH 2CXVA 4OGXA 2ESTE 2RA3A 1GBLA 3SNAA 3RXLA 1HAZB 2Z3EA 2ZDKA 1MAXA 2B9LA 1ETRH 4O9VA 5IYTA 1YKTA 1GI5A 1ZSJA 2FTLE 3GCTG 4ABHA 3DA9B 5JB8S 2CF9H 3SGAE 1SBWA 5DP4A 1Z1IA 2ODPA 4CR5A 1Z6JH 3SW2B 2BTCE 3T28A 5GPIB 4I86A 4GHTA 3Q3YA 3A7TA 1UTKA 3DCLA 1ABJH 4JZEH 2XC5A 8ESTE 1SGIB 4X2VA 5FXLA 3ZYDA 1YC0A 2VWNA 1ZMLA 4CR9A 1SOTA 2EI7A 1C5QA 2AEIH 1JIMA 2C8ZB 1OX1A 4P02A 3RXUA 3IWMA 4ZH8A 2XYAA 2BQWB 2VB0A 1V2OT 1LHGH 1PPGE 2QA9E 3NUMA 1KMHB 2GCTB 5E2PA 1EZXC 1K1OA 1AI8H 1BT7A 3MOCA 3HK6B 2QF5A 3HGPA 3SNCA 1RD3B 2WUCA 4HFPB 5GIBA 2A4GA 4JYUH 5TCCA 1C2HA 2TRMA 4UFDH 1CT4E 4D7FA 2PKAA 1ZGVA 4FU9A 1P9SA 2ZQ2A 5TCAA 1FV9A 5CHBA 1LHEH 1GVLA 3LGTA 2QYIA 1QB1A 3SYJA 1P2NA 2OQUA 3PV4A 4O97A 1AZZA 1O3LA 3GYLB 4K69A 1GHXH 1T31A 4X6NA 3LJOA 1HAYB 1KDQB 5T1VA 4YLQH 1QA7A 3ZZ6A 1D3TB 2V35A 1QB6A 4ZKRU 3Q3KA 2ZKSA 4R0IA 5T6DA 1SPJA 1ELTA 1TONA 4BTUB 3W1EA 2XBXA 3F2GA 2PR3A 1PQ5A 2GD4B 4X1RU 4ZHMU 1S85A 3SUEA 1P03A 3BTWE 2A5IA 3HKIB 2FDAA 3SQEE 4ZUHA 3SNBA 2P93A 1IQJA 2IJD1 1F5LA 1SHYA 8GCHG 1A61H 4ISLA 1H8ED 1OXGA 4B75A 1DX5M 3A8AA 3O8BA 4DIHH 1Z8GA 4U2WA 4X1PU 3DSGA 1HAVB 3EA8A 1EASA 3PYHA 1ZOMA 1O3HA 2A4OA 3Q00A 4WWYA 1KXDA 1DXPA 1TMTH 3U1JB 1Y8TA 2HVXA 1KXAA 3I77A 3KQDA 1IQNA 5G4BA 1NC6A 1BDAA 1DS2E 1GL0E 3UNRA 1YLNA 4E7NA 1O3PB 2NU0E 1G2LA 2PV9B 1IQIA 2VWOA 2ZTYA 5L2ZH 3IITA 1C2FA 2ZDLA 2PFEA 3TK6A 4U30A 2VH6A 1H8HD 1W13U 1O2XA 3SJ9A 1DOJA 5LGOA 1RTKA 3VGCC 1ZTKA 5FBIA 3TLOA 3A8CA 4TT3D 3KIDU 1ZR0A 1NN6A 2FS8A 2OC7A 1C2DA 2RG3A 1F5RA 2H9EH 3SUGA 1O34A 1GCTB 3RXEA 3UFAA 3O8CA 4D7GA 1CA0C 1CGJE 1ZHRA 4DT4A 2P16A 4B1TA 1YCPK 1OKXA 2TGDA 3UQOA 2A7CA 1Y3UA 2Z3CA 1TYNA 1V3XA 1IQLA 1DUAA 1L4ZA 2OC0A 2OC1A 1BRBE 3KGPA 1EZQA 1HRTH 2R3UA 3S9CA 2V0BA 1O3NA 5I46H 5SGAE 1D3QB 1GBFA 1FDPA 3A8DA 1C1VH 1C1RA 1VCPA 2BLOA 5HMAA 2ODQA 2F9UA 2FEQH 3MU1A 2EA3A 1HAPH 1VITG 5FX5A 5HXFA 1HDTH 2V3HH 1TRYA 5ESTE 2ZP0H 4Y71A 1OWIA 3VEQB 5A0AE 1QRZA 1TOMH 2BD8A 2FOEA 2V3OH 1P3EA 2GZ7A 1O3GA 3SO3A 1J8AA 4XDEA 4YZUA 4LOYH 4NSVA 1VCWA 1WYKA 2WPJS 5EQSA 4CHAC 2GV7A 5DSFA 1C5OH 2XRCA 3N7OA 1O3JA 4B2AA 1ELEE 2JJ2D 2QXJA 1PYTC 3S69A 1C2LA 1P04A 5K0HA 1NTPA 3MTYA 4UDWH 1YPKH 1XM1A 4DCDA 1V6DA 3TITA 1PPCE 1YBWA 2PLXA 1RIWB 3UNSA 4WJG2 1P05A 4ZROA 3S7HB 1YP9A 1TALA 1NRQH 1O5FH 1FY8E 2PKSC 1BRAA 3NK8A 2FX6A 1SSXA 3JZ1B 1P01A 4WH6A 1P2QA 1KLJH 1UTNA 1GI7B 1HAOH 1MD8A 1J9CH 2BQ6B 2A31A 4ZMAH 2XC4A 1RTFB 2BZ6H 4BAMB 1SQAA 3SGBE 4IGDA 4INHA 1KXBA 3GDSA 2IPHA 3DD2H 1ZPCA 3N99A 1FY4A 1SVPA 3QN7A 2ANMH 3Q77A 4GLYA 2HOBA 3H7OA 4Y8ZA 4A1VA 3U98H 1GMHF 3SU0A 3D49H 1XUFA 3RXDA 3RXCA 2DUCA 2GCTC 2GDDA 3OTJE 2QN5T 5FPTA 3M5NA 4I8HA 5C1XA 2VGCB 1P8VC 2WZQA 2IOTA 1RXPA 1A3BH 1O32A 1GHZA 4AFQA 3K9XB 3QK1A 2VIWA 1HJAB 1O2MA 4JZDH 3UOUA 1AQ7A 1JRTA 2EI8A 2RA0A 3RC4A 3TH3H 2ALVA 1EB1H 4BXSA 1J17T 1C5TA 1C5MD 1E37B 4MVNA 3RLYH 3S9BA 2QAAA 2P3FH 2VVVA 3M5OA 1W12U 3A7ZA 1O2OA 1O3MA 2NWNA 5GCHF 4TWYA 2QV1A 3KQBA 3RU4D 1BMLA 1D6WA 2ZQ1A 3RXQA 2PP6A 1LCYA 2ZFQH 1SGFA 1ZPZA 2C90B 2WSSD 3MO9A 4MTBA 3P8FA 1S6LA 2H2ZA 1JMOH 1GJ6A 1O3OA 1WSSH 3KCGH 1SB1H 1G3CA 1N6YA 3UIRA 1XKAC 3MU8A 2AIPA 4YOIA 1VZQH 3PMJA 5F8XA 2ZPQA 3BTEE 1TX6A 3OY5U 3HGNA 1OS8A 1NZQH 2J92A 3BF6H 3NPSA 4YT6H 3TK9A 3M3TA 5GXPA 1GJAB 5IDKA 3H7TA 3M7TA 3GY4A 3BTDE 3FO8D 4BXWA 4TPYA 3P8OA 4DOQA 3LKWA 3W94A 4X0WU 2GT8A 5GDSH 1UTJA 1CA8B 2FZZA 1EP6A 2ZTXA 1GMDF 4KTCA 1SLXB 4GCHG 2OXSA 1A7SA 3PV5A 8LPRA 1ZYOA 2H9HA 4Y8YA 3RP2A 4MNVA 1YF4A 1QRXA 2SFAA 1M9UA 3ZVFA 3TNSA 2CF8H 2NU3E 3AW0A 4X8TH 1SQRA 1MAYA 2ZU4A 2ZDNA 5A8ZA 1EPTC 3PRDA 3SZNA 4LXBH 2KM0A 9ESTA 2FX4A 4ISNA 3URCA 2ZHEH 6CHAB 2R2WU 3AVZA 3OTPA 2UWOA 1O2VA 1GMCG 2Z9GA 5AF9H 2M2AA 3T27A 1HLTH 1WOFA 3SV8A 5EPNA 4ZAEA 4X1NU 1ZTLA 3RXFA 3SHAH 4NIXA 1S6HA 5LPRA 1G36A 2ZPSA 3OYPA 3SJIA 3ZVGA 4O3UA 1AB9B 5J4QA 1O2RA 1AWHB 1XUKA 1SGCA 4IMQA 2GZ8A 2AGIX 1O5EH 1MTUA 1AO5A 1ELGA 1NU9A 2OLGA 1Z8RA 4ZXXH 4AOQA 1C5LH 1GVZA 1FXYA 2WPLS 5T3HA 1CBWB 5L6NH 1ORFA 1BZXE 2ILNA 1C5NH 5JBBS 4DW2U 1TNIA 2OTVA 1BMMH 1C2KA 1OP0A 2BQ7B 4R8TB 3ZZ9A 1DXWA 1GL1A 4XBDA 5DP8A 1GBHA 3LJJA 2W7SA 3SI4H 1BB0B 5KEDA 1SKYE 1SQOA 1CA0B 5LPFA 2KCAA 2A5KA 4Q7YA 1C5XB 1QQUA 1XXDA 3MH5A 2WV9A 4NG9H 2ZIQH 1QL8A 3VGCB 4CBOA 1THRH 1V2QT 4I31A 3AK5A 5C67A 3HK3B 3A80A 1QHRB 3SUDA 5H4IB 2SGPE 2F9PA 1J14A 2UUJB 3KYGA 1O39A 4AG2A 3KQCA 1D4PB 2L6OA 3ZV9A 2GMTB 2NU2E 3ODFA 2O8TA 4D76A 1BJVA 5C5OA 2C8XB 1TA2A 1CT0E 2BB4A 3LH3A 4UD9H 4JK5A 2FLBH 2BDIA 3OAAD 3T25A 1AB9C 2FPZA 1HAHH 3QGNB 1E79D 1EAWA 1G2MA 3U1IB 3V3MA 1K1MA 5EQQA 4P00A 6GCHF 2GZ9A 4AFSA 3ZZAA 1UVTH 1G3DA 4BTIB 3PB1E 1EQ9A 2FODA 1GJ7B 4Y11E 2GT7A 1LPGB 2VIQA 4LK4A 4AZ2B 2OBQA 3K6ZA 1DUEA 1FPCH 4VGCC 2WYGA 1MCVA 2XW9A 2YOLA 1FY3A 1EPTB 3E0PB 1LVMA 3GY2A 3MNXA 1QURH 3A83A 3PLPA 5K7RA 3CS7A 3GCNA 4B6EA 1XUGA 4Z6AH 5F8TA 1E38B 1C1MA 3K65B 1EOLA 1BBRE 2NU1E 2ZG0H 1UO6A 2ANWA 3DUXH 2ALPA 4Y0ZE 4X8SH 1ANBA 2ZPRA 1VITF 2KCPA 3OEHD 2ZF0H 1D3DB 2PGQB 3BSQA 1SLVB 1Z8JB 1GBEA 4IW4E 2ZNKH 3UB0A 3SV7A 3UWIA 3P8GA 1QRWA 1GI9B 1OWDA 3FVFB 1A3EH 5JBAS 1SGEE 1L0ZA 2FI3E 1QZ8A 4OS1A 3U9AH 2BXTH 4CRFA 2OK5A 3TH4H 1ELCA 2CMYA 4BAOB 2QF4A 5C1UA 4ACBA 4B6FA 5C94A 1O5BB 1MCTA 1C1QA 2ZGCA 1GHVH 4AB8A 2Q6DA 4JZ1A 1RGQA 4RT0A 3VG8A 2R9PA 2H9TH 1L1JA 1TABE 3SI3H 4WXIA 4TYDA 1EAIA 4X1SU 2PSYA 1F0RA 1W2KH 3RXMA 4FUEA 1AZ8A 3EA9A 1EPTA 5KECA 5EXLA 1IHTH 5JDUB 2ZGBH 4HGCA 1DITH 4UFFH 5JBCS 7ESTE 2H1UA 1DLKB 2PWXA 3GY3A 1WBGB 3RXVA 2G52A 1CQQA 1SR5C 1A46H 1B0FA 3ESTA 1HJAC 3BEIB 2ZFPH 4NIWA 1LHDH 3ZZCA 2FMJA 2HPPH 5CE1A 3P70B 1Z8IB 4CREA 4XFQA 2PTCE 3SNEA 4ABFA 2Y5FA 4I8LA 1UTOA 4GVUA 3MWIU 1MKXK 1O5DH 1C2GA 2AERH 2B7DH 2OINA 1C5PA 2THFB 2QIQA 1ZMJA 2IN2A 3ZVEA 4CH2B 1O31A 3DSOA 4IS5A 3FFGA 1PYTD 3ATMA 1SFQB 2JH6D 1OWHA 2A7JA 1S5SA 3L33A 1FMGA 3QTOH 5DP7A 5T6GA 1ZJKA 1RS0A 3LGVA 3SZEA 3MYWA 2VVUA 2VIVA 4F49A 4X8VH 4UFGH 2FIRH 2VH0A 3KQ5A 4NSYA 4HZHA 2J9NA 1WV7H 5J4SA 3T26A 1B5GH 1O30A 2IJOB 2BY5X 3M36A 1N8OC 2FI4E 1ACBE 3QX5H 1O0DH 3OU0A 3JZ2B 4K1SA 2QF3A 1ELFA 5DP3A 2EY4C 4FUFA 2Y6TA 1KSNA 5DGJA 1CVWH 4B73A 2D26C 2XWBI 1LVYA 5HIZA 1HB0B 1NRPH 1K1IA 2SNVA 1G30B 1FY5A 1HIAB 1IOEA 2BVRH 2BD3A 1EKBB 3QUMP 1S83A 3F2HA 3ZV8A 1DY9A 4AN7A 1CHOG 2L74A 1BTZA 4TPIZ 1DFPA 1TPOA 2ANYA 2JETC 5AVDA 3QO6A 1GDQA 3D65E 4B2BA 3SU1A 2ZECA 2KAIB 2PGBB 2V7QD 1SGQE 3VB5A 3QZRA 3UR6A 1DWBH 1QIXB 2O8MA 2Z9KA 4MPXA 5A09A 6GCHG 4KP0A 2RCEA 1YYY1 1MQ6A 1TMBH 4IC5A 4I7YH 1BTPA 1INCA 3ZVDA 5A8XA 1E36B 1W7XH 2Y5HA 3GOVB 2ZU2A 3P17H 2EC9H 1D9IA 2GMTC 2STBE 2Y81A 4AB9A 1BA8B 1EUFA 2UWLA 1DSTA 2J95A 1PJPA 3STJA 1A4WH 1O2NA 4HTCH 2OD3B 1AHTH 2J98B 3A7VA 5HM9A 1BMNH 1O2GH 1T8LA 1RFNA 1YPGH 5CMXH 2PUQH 1OPHB 4ABJA 1QY6A 2VIOA 3LT3A 1QNJA 4D9RA 3SJOA 2M5TA 1AVXA 1ELAA 2QF0A 2ZZUH 1NO9H 3ZVBA 1VKYA 3A81A 1O2JA 1DICA 1OOKB 3MNSA 1DT2A 1AGJA 2P3TB 4JYTA 1W14U 2G81E 1N1LA 1SGNE 1DSUA 2BY9X 5ETXA 3LC5A 1CHGA 1GJCB 3AW1A 5CHAC 1EJMA 5C1YA 3GYMA 4FUHA 4X8UH 1GBJA 3RXSA 1IQFA 1FIWA 3BG4C 2BHGA 4H4FA 1SGYE 1WQVH 1SQTA 1BCUH 1HXFH 4Z1MD 2WPMS 3E0NB 4OS7A 2GDEH 1FAXA 3KF2A 3VB4A 1V2RT 1O37A 2GCHF 3ATLA 4MDSA 1QL7A 5FCKA 3MHWU 1YWUA 2BD5A 1F2SE 4ZKSU 5TJXA 1K1LA 3ZZ8A 4WH8A 1ANDA 1GI0A 2FS9A 5CHAB 4A5TS 2BOKA 3TNTA 2W6ID 1CSOE 1IQHA 1ELBA 3EGKH 1Y5AT 2NU4E 1ZTJA 1KIGH 1THPB 1EAXA 3TPIZ 1J15A 3T29A 2ZGJA 2PHBA 1ZZZA 1GWAA 1O2UA 1HGTH 3UPEA 2BMGB 2VWLA 2HPQH 2OBOA 3LGWA 3PWCA 4IMZA 3OX7U 1Y3XA 2XNDD 2W6JD 3TK5A 4ZHLU 4NA9H 4RSPA 1O3CA 2J94A 3MH4A 1TX8A 5FAHA 1HIAA 1SLWB 2J97A 3ZZBA 3MQKC 1UCYK 2A1DB 4Q63A 5GCHG 1QQ4A 3AAVA 5A0BA 2C8WB 2ZFTA 4JCNA 1NT1A 3EAJA 1AN1E 1OP8A 2G5NA 2F9NA 1HJ8A 2C4FH 3V12A 1SGRE 2F9VA 3M7UA 3QWCH 3LIWA 1H8IH 2Y80A 3A86A 5EXMA 4QT8C 1A5GH 3WY8A 1JXPA 2HNTE 1TRMA 1XUIA 1O3IA 4MNXA 4RI0A 1AKSB 1DWDH 4Q4LA 1XKBC 1C1UH 2BDAA 1GBKA 4FUCA 5E8EH 1T8OA 2BZAA 1OYQA 3QDZB 2ZGXH 1O2YA 1G9IE 4GSOA 1PFXC 1C5ZB 1TNKA 1HAGE 7KMEH 3M3VA 4JK6A 1BHXF 3LPRA 2YMSB 4FVBA 2JETB 4D8NA 1MBQA 2UUYA 4SGBE 2JIZD 1UVUH 5C3NA 1KTTB 2Y7ZA 1O2QA 3P6ZB 1CU1A 1L1NA 3FZZA 1GI3A 4OS4A 4CBNA 1W0JD 1GJ9B 1MKXH 2BVXH 1Y3WA 3L3TA 3P92A 1FJSA 4INLA 3SNDA 3K2UA 4NZQA 2O9QA 2KCYA 5DKMA 1HJ9A 1MZAA 1LDTT 4LZ4B 4FUGA 4K2YA 3FKSD 2BDHA 3RXRA 4Q80A 3QLPH 1OSSA 4BTTB 4SGAE 1Q3XA 2AGGX 2UUFB 2XOKD 1SGPE 3ZVAA 1P2OA 2J38A 1AU8A 2FOMB 1A0JA 2IPQX 2K0QA 1UTPA 1ZHMA 4ABAA 1OWEA 3E91A 1ANEA 2YNBA 6LPRA 1AD8H 1X7AC 3FP6E 3RXJA 5C20A 3TGJE 1C5UA 1UK2A 1TNGA 1MKWK 3F0OA 2FOAA 3TGKE 2H5CA 2AYWA 4WMFA 1EFRD 1T4UH 2A7HA 2BX3A 1ZRBA 2K8IA 2F3CE 1O2PA 1K22H 2BD9A 2WPKS 3ITIA 3RM2H 1GI4A 2PKAB 1VR1H 1W3CA 3SJKA 2WHXA 4NCYA 1EATA 1GGDC 3HKJB 1CT2E 1MZDA 2R2MB 1TLDA 3WWFA 1UVOA 1V2JT 5IK2D 5HGGA 3B23B 2FESH 1DLEA 1HNEE 1V2PT 2CK3D 1DWCH 4DIIH 1UK4A 2D2DA 1SLUB 2QE7D 2DE8A 1EZSC 1QCPA 1FZZA 1KDQA 1H8DH 4ISOA 4NWKA 4ABIA 3PLBA 4MPUA 3TH2H 3MFJA 1DE7H 1BTXA 3UREA 2XBYA 2Q1JA 3FP8E 4MPVA 3G01A 1WDIA 2XWAA 1UVSH 2ZCKP 1SFIA 4Q7XA 2OUAA 2GGVB 5AFZH 4ASHA 4K8BA 3M61U 1BJUA 2H5DA 2J4IA 2WYJA 1H1BA 1XUJA 3MO6A 1MUEB 2CHAB 2PW8H 2K1QA 1P2KA 3RXAA 1SMFE 2R3YA 4OS2A 3NRLA 1K2I1 3BTME 7GCHF 1VGCC 1BBRK 4X6OA 4Y0YE 4ABBA 1UCYE 1EAUA 1UTMA 3SORA 4Y6DA 1YCPH 5F6MA 4ZCNA 1NRRH 3U8RH 1QGFA 1Y3YA 2B5TB 4ZKNU 5EJ1A 2SGDE 1YPEH 1Q2WA 1CO7E 1TGNA 2V3MA 2W3IA 2PSXA 4DY7B 1S84A 3CNRA 4YOJA 3RXBA 2AMQA 1S0RA 3RXOA 3FAOA 3DSPA 5FL7D 1RIWC 3MU5A 3S7KB 2FP7B 2GVFA 1O3FA 1WCZA 2J34A 3SU2A 1NRSH 1AMHA 3ODDA 5F03A 1EX3A 1LVOA 3SV6A 1QBVH 1NRNH 3E8LA 1EP5A 5C17A 3PMBB 2FYRA 2QXIA 2PTNA 1E0FD 1TNJA 3PO1B 2TPIZ 1GJDB 3LC3A 4RN6A 2A2XH 1UW7A 1GI6A 3GCTF 3EYDA 1RRKA 1QBOA 1NFYA 1NROH 2D1JA 3U8TH 1MTNB 1C9TA 5L2YH 2TGAA 2WV5A 3KHVA 4A92A 5DPAA 4FUDA 2EI6A 2A4RA 2ZDMA 1SC8U 5DP6A 1LKBA 3F6UH 3OFND 4MPWA 4H6SB 2AFQB 3ZZ5A 1TQ7B 3CS0A 1T8MA 2FO9A 3BG4B 3RU4E 2JJ1D 1O35A 1IQEA 3HATH 1GBDA 3A7WA 3BTFE 4WXVA 2LPRA 4E06H 1MTSA 3GICB 1EZUC 4YT7H 4JMYA 3WW7A 1LKAA 3M35A 1O2KA 2P94A 2WPHS 1V2TT 5FCRA 1TBQH 1GCTC 3D62A 3M7QA 1UHBA 4IC6A 2VIPA 2AGEX 1O5AB 1RTLA 4DT7B 1FQ3A 3LONA 4XSKU 3TJVA 4U32A 1F7ZA 4YM9A 1TA6A 2F4LA 1ID5H 1P11E 2UWPA 2J98A 5HIYA 1KXEA 1P02A 2KFWA 1P06A 2AIQA 2A0QB 2HGTH 4ABGA 3BTKE 1DVAH 3KL6A 4ISHH 3GISB 2G4TA 5C0TA 2ZA5A 1XMNB 2XCNA 1ANCA 4BAKB 2BVSH 4MNYA 1SGFG 1EJAA 3RMNH 3BIUH 5E0JA 1DDJA 5F53A 1MTNC 1LVBA 3TIUA 1MU8B 1O2ZA 3CP7A 1P57B 4AFZA 1VITH 1Y5UT 4TY6A 4H6TA 2UUKB 2FTMA 3PO1C 3CENA 5EQRA 4CRDA 1BTUA 4I32A 3BEUA 2F91A 2J2UA 3SU3A 1GHWH 4FUIA 1AWFH 1GJ4H 1S82A 1C1OA 4Y7AA 2FOHA 2GP9B 4DVAU 1AE5A 2BLVA 2HRVA 3A7YA 3T2NA 1HCGA 4K1TA 2XXLA 4CRBA 5GJ4B 1K0HA 3ATWA 2FOGA 4K8YA 3LOXA 1MD7A 3RXHA 1S81A 2ASUB 1V2UT 3PWBA 2RDEA 4MQAA 3M5LA 3OEED 1SHHB 3BV9B 1W0KD 1CHOF 2CGAA 4CRGA 2XTTB 4U01A 3I78A 5EJLA 3TVJB 3E6PH 1ESBA 1C9PA 1ZSLA 2VVCA 2W7UA 2D8WA 4BAHB 4X6PA 4XRNA 4FUJA 4YO9A 2VIDA 1E1RD 2BLWA 3RMMH 3GS9A 1JOUB 2VU8E 5A0CA 2G5VA 1VGCB 1A2CH 1GHBF 2Y82A 3MO3A 1O3AA 1NFUA 4YTAA 5A8YA 4XOJA 1LO6A 1BQYA 3I29A 3O8RA 3MNBA 1GBMA 2CHAC 1C4Y2 1ZRKA 1ABIH 1O2WA 3Q3XA 1GI1A 2ZWLH 3RXTA 1O3EA 2ZU5A 3STIA 2QCYA 1BITA 1C1WH 1CGIE 1TRNA 4YLUA 2BDYA 1P12E 1WAYB 3GCHB 2QXHA 1A5HA 1XX9A 2BDBA 8KME2 4FUBA 4DG4A 1QL9A 3E90B 1DM4B 5E0HA 2W5EA 3UTUH 4YOGA 1TPAE 3GCOA 1AUJA 2ZC9H 2ZFFH 3A84A 1FN6A 5DN6D 5FPYA 3GY7A 1TNLA 3W95A 5L30H 1C1SA 3NWUA 4IN2A 1HUTH 1KY9A 3PLKA 1F0UA 1TMUH 2ANKH 1QBNA 4X2XA 2XBWA 2KCOA 4KELA 1C2EA 2XC0A 1QR3E 1GHAG 1YPHC 1RJXB 1E35B 3T5FH 2HLDD 1AFQB 1BTHH 2BD4A 1YPLH 2HNTF 3BTGE 1ZSKA 5EOKA 1J16A 1KLIH 5ABWA 4Q2KA 1GG6C 4INKA 1LPKB 1LMWB 3RUOA 2FWWA 1TBRH 2AMDA 3UWJH 3A88A 4E05H 2BY8X 1LQDB 4WVPE 4ASUD 2QY0B 2G4UA 2XCFA 3QTVH 2P3UB 1ESAA 1GJ5H 2BY6X 1Z71A 1PPEE 1C5VA 3WWBA 4K3JA 2HALA 3LGIA 3VB6A 1N6XA 1JRSA 4J2YB 2PKSB 4JZFH 3ZZ4A 1WQSA 2PUXB 1PPHE 3V7TA 3RMLH 1GBBA 3RXPA 4A6LA 5EXNA 4FOUC 2GV6A 2Z3DA 3F2FA 2HVYB 3ZZ7A 1YLCA 3OSYA 3UQVA 1GMHG 3MH6A 1K1JA 1AVWA 3NCLA 4B76A 5B6OA 3KQEA 1TGTA 4A7IB 4PROA 2F9OA 1A0HB 4AG1A 4KTSA 4NZLA 3ZIAD 2HNTC 2HWLB 4KGAA 4CHAB 1GJ8B 2C93B 2YMSC 3SJ8A 3GY8A 1FIZA 1O2HA 3E3TA 1NFWA 2Y5GA 3VPKA 1XVMA 3A82A 1Y59T 2W26A 1C4U2 2ZDAH 2J5UA 5HM2A 2A2QH 3NKKA 1NFXA 1OP2A 3GY6A 4TSFD 1QB9A 2TBSA 3PMAB 4FXGH 5BPEA 2BDGA 2JH0D 1C5RA 1VJ9U 1SL3A 3A85A 3F3BA 4ESTE 2WPDD 1GVKB 1BMFD 4NFEA 3MU0A 4XE4A 3C27B 3RDZA 1T7CA 3LH1A 4D9QA 2BYAX 3MNCA 4F48B 3VXEH 1T8NA 1E34B 2P8OC 3VXFH 4IN1A 5A2MH 2BOHB 3M37A 5PTPA 3SBKA 1V2LT 4GHQA 1UMAH 2XBVA 4H42U 2O8WA 1BIOA 1W11U 5E0GA 3U8OH 1TOCB 4BOHA 1HAVA 1HXEH 3A7XA 1O5CB 2FOBA 4XD7D 2HLCA 1O5GH 1NM6A 1FX0B 4ZKOU 4RKJB 2Z6BD 2ODYB 1C1TA 3VB7A 1F5KU 1AY6H 4WF8A 5F8ZA 3MH7A 4I8GA 1OWKA 4OGYA 3RMOH 2A45B 4B71A 5KGOA 2FOFA 2Z9IA 4FU8A 1TB6H 1O2IA 1NESE 4X2YA 2OP9A 5AFYH 4Y10E 1GI2A 3PM3A 3GY5A 4AYVB 5FHTA 1CE5A 4NIVA 1P10A 1Z1JA 2ZO3H 3OY6U 2OQ5A 1TAWA 4MG3A 4XBCA 3NXPA 1AVGH 3ATIA 1ZPBA 2ZHDA 4M7GA 1O3BA 1LPZB 3P8NA 1G37A 3TJOA 2AHME 2ZEBA 5DO4H 4Q7ZA 1T4VH 1IQMA 3SV9A 1AFEH 1GMDG 1MH0A 4I33A 2WPIS 1HPGA 1KYNA 1Z6EA 1GBCA 1O3DA 2BD2A 1G3EA 1Z7KA 3SU6A 4M9FA 1YCPM 2SNWA 2TGTA 4BANB 2R0LA 7LPRA 2ZTZA 1V2ST 3SU5A 2TGPZ 4GUXA 1P09A 1B7XB 4Y76A 3EA7A 1PQ8A 2CV3A 4ACAA 1OHHD 3PTNA 4GAWA 5AHGH 1ELDE 4O3TA 1EOJA 3MU4A 4RT1A 4BAQB 1C4V2 2YNAA 6ESTA 3ELAH 4Y79A 1KXCA 1BTWA 4CRAA 5JBTA 1NBMD 2LELA 1A5IA 1TBZH 2ZU3A 4K1EA 1W10U 3T62A 1GHAF 2QC2A 1YPMH 4TY7A 2B8OH 2KR7A 2ZGHA 3KEEA 1C2MA 3S9AA 1FUJA 5LH8A 2KZ4A 2W3KA 5EODA 1GJBB 4AORA 3M5MA 4A1TA 3UNQA 4DGJA 3SQHE 2GX4A 1P2IA 4DURA 1P3CA 2F43B 5C0UA 3RXIA 1H9HE 7GCHG 1PQ7A 1P0SH 1OWJA 3UAIC 2SGQE 3SUFA 1FLEE 4ISIH 4ZXYH 1S0QA 3EDXB 1DY8A 5DP5A 1MQ5A 1IHSH 3SN8A 2F83A 1E1QD 1EJNA 5EIYA 1GI8B 2R0KA 2STAE 3EE7A 4NIYA 2A4QA 2QXGA 3N7EA 2RDLA 3AASA 3UR9A 3PV2A 2KX4A 3ZZDA 5FX6A 2BXUH 3FZDA 3RU4T 3TGIE 1QFKH 2QGRA 4JZIA 4B74A 4F55A 3RLWH 2SGEE 1N8OB 3F9EA 4UFEH 4ABEA 1AIXH 2AMPA 3ZYEA 1FN8A 1TX7A 2Q6GA 1XUHA 1XVOA 3QZQA 2ZHFH 2G55A 4Z0KA 1JBUH 1IQKA 1YM0A 1HV7A 3BTTE 3GCHC 1GBIA 2DE9A 5EU8A 3TJUA 1QJ1B 2ZI2H 5DP9A 3GDVA 2KAIA 4F4OC 1NBME 2RFKC 5LPEA 3BEFB 2EQNA 1JWTA 2JDID 3URDA 5JPMH 1FONA 1BOQA 3FANA 1WU1A 2FYQA 2LNCA 4E7RG 3DT0H 3UY9A 3V13A 3ZVCA 2BY7X 5C5NA 2G8TA 1COWD 1S6FA 5FBEA 2BM2A 5ESBA 5JB9S 3M3SA 1DWEH 2ZU1A 2XNIA 5I25A 5EJZA 1SOZA 1FPHH 1LQEA 4KTUA 2ZHWH 1NY22 1PQAA 3H09A 1TIOA 3R0FA 2BLQA 4WY3A 3SOSA 4CH8B 1HFDA 1BUIA 3NZIA 1PPFE 1TPPA 1YGCH 3F0PA 4GPGA 1AE8H 3R3GB 3RXGA 3BG8A 1Q31A 3A87A 2GCHG 1NS3A 2B0FA 1LHCH 3HPTB 3ENSB 4RKOB 2A5AA 4K60A 1H9IE 5EW1H 1O2SA 4NWLA 1O3KA 3LGUA 5B6LA 1ARCA 5JYIA 1VCQA 2H6MA 3AAUA 1FNIA 1D3PB 1O36A 2VBCA 1C2IA 2ZCHP 1UK3A 4A1XA
chains in the Genus database with same CATH topology
3BTHE 2FM2A 4AGKA 3ZZ3A 5HYOA 4OS6A 2OCVB 3TU7H 1ZHPA 1L1GA 1UTLM 2P59A 4Y8XA 2GKVE 2ZDVH 3SU4A 3B8JA 3F1SB 5EW2H 4CRCA 2CN0H 3E1XB 1W0ZU 2GTBA 1WTGH 1UCYH 2G00A 5EPYA 1W8BH 2I6QA 2V6NA 2ZHQH 1UVPA 4MNWA 1YLDA 4IBLH 5DJ7A 1BTYA 1HYLA 1L4DA 1L2EA 1W0YH 2F9BH 2OC8A 3A89A 5E2OA 1GBTA 4MLFB 1DPOA 1GPZA 1K9OE 1ZLRA 1WUNH 2EEKA 3L6PA 1V2NT 3PTBA 2VINA 2VWMA 1LHFH 1CGHA 1P2JA 4UONA 2Z94A 1OYTH 1O33A 3ATKA 1A1RA 1MU6B 3VFEA 1T32A 5T6FA 4DJZB 2Z9LA 3F68H 1P2MA 2JH5D 3RC5A 3P95A 1WTHD 3Q76A 3MI4A 3B9FH 3LDXH 1NPMA 1F0SA 4HI3A 1TPSA 4VGCB 3F9HA 1TGSZ 1LTOA 3QGJA 1MTWA 4ZHAA 1YPJH 1DANH 1HAXB 3KN2A 1F92A 1EB2A 4THNH 1ELVA 3EE0B 3S0NA 4ABDA 2BDCA 1C5WB 2C3SA 4XBBA 1TE0A 4BNRA 1O2LA 4O03A 5C2ZA 1CBWC 4AX9H 2C8YB 2SGAA 1G32B 3BIVH 1D6RA 1PPZA 2I6SA 1GHBG 3RC6A 1TFXA 1AKSA 3U69H 1Y5BT 2ULLA 3K6YA 1BRUP 1ESTA 3IG6B 1SGDE 1JIRA 3RXKA 2FXRA 5BRRE 3SHCH 4NGAH 2G51A 1KTSB 3EQ0H 1GCDA 4NA8A 3V0XA 1H9LB 2TIOA 3KNXA 1SGTA 2CJIA 2Z7FE 1C5SA 3TJNA 3F9FA 3UOPA 1MKWH 4GCHF 2SGFE 2O8UA 1UJ1A 1UTQA 4FVDA 1W7GH 1P9UA 3BN9A 1K28D 1A0LA 1KLTA 1UHBB 1FI8A 1GDNA 4OS5A 2P95A 4X1QU 5EGMA 5DK1A 4J1YA 3PROA 1TGBA 4FU7A 3O8DA 1O38A 2A32A 2WUBA 2WV4A 3BTQE 3H5CB 1YPHE 3F9GA 1U6QA 1GMCF 2P8OB 3SGQE 1ZJDA 2BD7A 1XXFA 1G3BA 3DHKH 1NU7B 1THSH 4KKDA 4X6MA 2Y7XA 1EXFA 4NA7A 1C5YB 1ZMNA 4YESB 1GBAA 1H4WA 3UUZA 1IAUA 1GHYH 5FPSA 1BHXB 1MTVA 2ZFRH 8GCHF 1ARBA 1C2JA 1V2WT 1GG6B 1TQ0B 2Q6FA 4JYVH 4AYYB 4AFUA 2O8LA 1AFQC 3VB3A 1QTFA 1QA0A 1MBMA 1K1PA 1SI5H 4LZ1H 1MMJN 4UEHH 5DG6A 1ETTH 2FLRH 4Y7BA 1QJ6B 6CHAC 4B2CA 4K5ZA 1K1NA 3D23A 1TNHA 1ZGIA 3GDUA 1ETSH 4UE7H 3LU9B 4WMDA 5EG4A 1C1NA 2BX4A 1SG8B 9LPRA 1BBRH 2VNTA 1VJAU 1B0EA 2WINI 5GWZA 1QJ7B 3LGYA 3RM0H 1V2MT 2AH4X 3PMHB 1AUTC 3C1KA 2Z9JA 1HBTH 1F0TA 1V2VT 2ZCLP 1O2TA 2FOCA 4I8KA 1C1PA 1TWXB 4I8JA 2VJ1A 3E16B 1BRCE 1FY1A 2ZFSA 2JKHA 4AGJA 4NFFA 2VGCC 1GDUA 4WMEA 3SV2H 3A8BA 1GGDB 1Y3VA 3MMGA 3FP7E 1TGCA 1FAKH 1BMAA 4X2WA 1PPBH 1K21H 3DFJA 1V2KT 4TWWA 3DFLA 2FI5E 1IQGA 1KXFA 2AS9A 1HAIH 2CXVA 4OGXA 2ESTE 2RA3A 1GBLA 3SNAA 3RXLA 1HAZB 2Z3EA 2ZDKA 1MAXA 2B9LA 1ETRH 4O9VA 5IYTA 1YKTA 1GI5A 1ZSJA 2FTLE 3GCTG 4ABHA 3DA9B 5JB8S 2CF9H 3SGAE 1SBWA 5DP4A 1Z1IA 2ODPA 4CR5A 1Z6JH 3SW2B 2BTCE 3T28A 5GPIB 4GHTA 3Q3YA 3A7TA 1UTKA 1ABJH 4JZEH 2XC5A 8ESTE 1SGIB 4X2VA 5FXLA 3ZYDA 1YC0A 2VWNA 1ZMLA 4CR9A 1SOTA 2EI7A 1C5QA 2AEIH 1JIMA 2C8ZB 1OX1A 3RXUA 3IWMA 4ZH8A 2XYAA 2BQWB 2VB0A 1V2OT 1LHGH 1PPGE 2QA9E 3NUMA 5E2PA 2GCTB 1EZXC 1K1OA 1AI8H 1BT7A 3MOCA 3HK6B 3HGPA 3SNCA 1RD3B 2WUCA 4HFPB 5GIBA 2A4GA 4JYUH 5TCCA 1C2HA 2TRMA 4UFDH 1CT4E 4D7FA 2PKAA 1ZGVA 4FU9A 1P9SA 2ZQ2A 5TCAA 1FV9A 1LHEH 1GVLA 3LGTA 2QYIA 1QB1A 1P2NA 2OQUA 3PV4A 4O97A 1AZZA 1O3LA 3GYLB 4K69A 1GHXH 1T31A 4X6NA 3LJOA 1HAYB 1KDQB 4YLQH 1QA7A 3ZZ6A 1D3TB 2V35A 1QB6A 4ZKRU 3Q3KA 2ZKSA 4R0IA 5T6DA 1SPJA 1ELTA 1TONA 4BTUB 2XBXA 2PR3A 1PQ5A 2GD4B 4X1RU 4ZHMU 1S85A 3SUEA 1P03A 3BTWE 2A5IA 3HKIB 2FDAA 3SQEE 4ZUHA 3SNBA 2P93A 1IQJA 1F5LA 1SHYA 8GCHG 1A61H 4ISLA 1OXGA 4B75A 1DX5M 3A8AA 3O8BA 4DIHH 1Z8GA 4U2WA 4X1PU 3EA8A 1HAVB 1EASA 3PYHA 1ZOMA 1O3HA 2A4OA 3Q00A 4WWYA 1KXDA 1DXPA 1TMTH 3U1JB 1Y8TA 2HVXA 1KXAA 3I77A 3KQDA 1IQNA 5G4BA 1NC6A 1BDAA 1DS2E 1GL0E 3UNRA 4E7NA 1O3PB 2NU0E 1G2LA 2PV9B 1IQIA 2VWOA 2ZTYA 5L2ZH 3IITA 1C2FA 2ZDLA 2PFEA 3TK6A 4U30A 2VH6A 1W13U 1O2XA 3SJ9A 1DOJA 5LGOA 1RTKA 3VGCC 1ZTKA 5FBIA 3TLOA 3A8CA 3KIDU 1ZR0A 1NN6A 2FS8A 2OC7A 1C2DA 2RG3A 1F5RA 2H9EH 3SUGA 1O34A 1GCTB 3RXEA 3UFAA 3O8CA 4D7GA 1CA0C 1CGJE 1ZHRA 2P16A 4B1TA 1YCPK 1OKXA 2TGDA 3UQOA 2A7CA 1Y3UA 2Z3CA 1TYNA 1V3XA 1IQLA 1DUAA 1L4ZA 2OC0A 2OC1A 1BRBE 3KGPA 1EZQA 1HRTH 2R3UA 3S9CA 2V0BA 1O3NA 5I46H 5SGAE 1D3QB 1GBFA 1FDPA 3A8DA 1C1VH 1C1RA 1VCPA 2BLOA 5HMAA 2ODQA 2F9UA 2FEQH 3MU1A 2EA3A 1HAPH 1VITG 5FX5A 5HXFA 1HDTH 2V3HH 1TRYA 5ESTE 2ZP0H 4Y71A 1OWIA 3VEQB 5A0AE 1QRZA 1TOMH 2BD8A 2FOEA 2V3OH 1P3EA 2GZ7A 1O3GA 3SO3A 1J8AA 4XDEA 4YZUA 4LOYH 4NSVA 1VCWA 1WYKA 2WPJS 5EQSA 4CHAC 2GV7A 1C5OH 2XRCA 3N7OA 1O3JA 4B2AA 1ELEE 2QXJA 1PYTC 3S69A 1C2LA 1P04A 5K0HA 1NTPA 3MTYA 4UDWH 1YPKH 1XM1A 4DCDA 1V6DA 3TITA 1PPCE 1YBWA 2PLXA 1RIWB 3UNSA 4WJG2 1P05A 4ZROA 3S7HB 1YP9A 1TALA 1NRQH 1O5FH 1FY8E 2PKSC 1BRAA 3NK8A 2FX6A 1SSXA 3JZ1B 1P01A 4WH6A 1P2QA 1KLJH 1UTNA 1GI7B 1HAOH 1MD8A 1J9CH 2BQ6B 2A31A 4ZMAH 2XC4A 1RTFB 2BZ6H 4BAMB 1SQAA 3SGBE 4IGDA 4INHA 1KXBA 3GDSA 2IPHA 3DD2H 1ZPCA 1FY4A 1SVPA 3QN7A 2ANMH 3Q77A 4GLYA 2HOBA 3H7OA 4Y8ZA 4A1VA 3U98H 1GMHF 3SU0A 3D49H 1XUFA 3RXDA 3RXCA 2DUCA 2GCTC 2GDDA 3OTJE 2QN5T 5FPTA 3M5NA 4I8HA 5C1XA 2VGCB 1P8VC 2IOTA 1RXPA 1A3BH 1O32A 1GHZA 4AFQA 3K9XB 3QK1A 2VIWA 1HJAB 1O2MA 4JZDH 3UOUA 1AQ7A 1JRTA 2EI8A 2RA0A 3RC4A 3TH3H 2ALVA 1EB1H 4BXSA 1J17T 1C5TA 1C5MD 1E37B 4MVNA 3RLYH 3S9BA 2QAAA 2P3FH 2VVVA 3M5OA 1W12U 3A7ZA 1O2OA 1O3MA 2NWNA 5GCHF 4TWYA 2QV1A 3KQBA 3RU4D 1BMLA 1D6WA 2ZQ1A 3RXQA 2ZFQH 1LCYA 1SGFA 1ZPZA 2C90B 4MTBA 3MO9A 3P8FA 2H2ZA 1JMOH 1GJ6A 1O3OA 1WSSH 3KCGH 1SB1H 1G3CA 1N6YA 3UIRA 1XKAC 3MU8A 2AIPA 4YOIA 1VZQH 3PMJA 5F8XA 2ZPQA 3BTEE 1TX6A 3OY5U 3HGNA 1OS8A 1NZQH 2J92A 3BF6H 3NPSA 4YT6H 3TK9A 3M3TA 5GXPA 1GJAB 5IDKA 3H7TA 3M7TA 3GY4A 3BTDE 4BXWA 4TPYA 3P8OA 4DOQA 3LKWA 3W94A 4X0WU 2GT8A 5GDSH 1UTJA 1CA8B 2FZZA 1EP6A 2ZTXA 1GMDF 4KTCA 1SLXB 4GCHG 2OXSA 1A7SA 8LPRA 1ZYOA 2H9HA 4Y8YA 3RP2A 4MNVA 1YF4A 1QRXA 2SFAA 1M9UA 3ZVFA 3TNSA 2CF8H 2NU3E 3AW0A 4X8TH 1MAYA 2ZU4A 2ZDNA 5A8ZA 1EPTC 3SZNA 4LXBH 9ESTA 2FX4A 4ISNA 3URCA 2ZHEH 6CHAB 2R2WU 3AVZA 2UWOA 1O2VA 1GMCG 2Z9GA 5AF9H 3T27A 1HLTH 1WOFA 3SV8A 5EPNA 4ZAEA 4X1NU 1ZTLA 3RXFA 3SHAH 4NIXA 1S6HA 5LPRA 1G36A 2ZPSA 3OYPA 3SJIA 3ZVGA 4O3UA 1AB9B 5J4QA 1O2RA 1AWHB 1XUKA 1SGCA 4IMQA 2GZ8A 2AGIX 1O5EH 1MTUA 1AO5A 1ELGA 1NU9A 2OLGA 1Z8RA 4ZXXH 4AOQA 1C5LH 1GVZA 1FXYA 2WPLS 5T3HA 1CBWB 5L6NH 1ORFA 1BZXE 2ILNA 1C5NH 5JBBS 4DW2U 1TNIA 2OTVA 1BMMH 1C2KA 1OP0A 2BQ7B 4R8TB 3ZZ9A 1DXWA 1GL1A 4XBDA 5DP8A 1GBHA 3LJJA 2W7SA 3SI4H 1BB0B 1SQOA 1CA0B 5LPFA 2A5KA 4Q7YA 1C5XB 1QQUA 1XXDA 3MH5A 4NG9H 2ZIQH 1QL8A 3VGCB 4CBOA 1THRH 1V2QT 4I31A 5C67A 3HK3B 3A80A 1QHRB 3SUDA 5H4IB 2SGPE 2F9PA 1J14A 2UUJB 1O39A 4AG2A 3KQCA 1D4PB 3ZV9A 2GMTB 2NU2E 3ODFA 2O8TA 4D76A 1BJVA 5C5OA 2C8XB 1TA2A 1CT0E 2BB4A 3LH3A 4UD9H 4JK5A 2FLBH 2BDIA 3T25A 1AB9C 2FPZA 1HAHH 3QGNB 1EAWA 1G2MA 3U1IB 3V3MA 1K1MA 5EQQA 6GCHF 2GZ9A 4AFSA 3ZZAA 1UVTH 1G3DA 4BTIB 3PB1E 1EQ9A 2FODA 1GJ7B 4Y11E 2GT7A 1LPGB 2VIQA 4LK4A 4AZ2B 2OBQA 3K6ZA 1DUEA 1FPCH 4VGCC 2WYGA 1MCVA 2XW9A 2YOLA 1FY3A 1EPTB 3E0PB 1LVMA 3GY2A 3MNXA 1QURH 3A83A 3PLPA 5K7RA 3CS7A 3GCNA 1XUGA 4Z6AH 5F8TA 1E38B 1C1MA 3K65B 1EOLA 1BBRE 2NU1E 2ZG0H 1UO6A 2ANWA 3DUXH 2ALPA 4Y0ZE 4X8SH 1ANBA 2ZPRA 1VITF 2ZF0H 1D3DB 2PGQB 3BSQA 1SLVB 1Z8JB 1GBEA 4IW4E 2ZNKH 3SV7A 3UWIA 3P8GA 1QRWA 1GI9B 1OWDA 3FVFB 1A3EH 5JBAS 1SGEE 1L0ZA 2FI3E 4OS1A 3U9AH 2BXTH 4CRFA 3TH4H 1ELCA 2CMYA 4BAOB 5C1UA 1O5BB 1MCTA 1C1QA 2ZGCA 1GHVH 4AB8A 2Q6DA 4JZ1A 1RGQA 2R9PA 2H9TH 1L1JA 1TABE 3SI3H 4WXIA 4TYDA 1EAIA 4X1SU 2PSYA 1F0RA 1W2KH 3RXMA 4FUEA 1AZ8A 3EA9A 1EPTA 5EXLA 1IHTH 5JDUB 2ZGBH 4HGCA 1DITH 4UFFH 5JBCS 7ESTE 2H1UA 1DLKB 2PWXA 3GY3A 1WBGB 3RXVA 2G52A 1CQQA 1SR5C 1A46H 1B0FA 3ESTA 1HJAC 3BEIB 2ZFPH 4NIWA 1LHDH 3ZZCA 2FMJA 2HPPH 5CE1A 3P70B 1Z8IB 4CREA 4XFQA 2PTCE 3SNEA 4ABFA 2Y5FA 4I8LA 1UTOA 4GVUA 3MWIU 1MKXK 1O5DH 1C2GA 2AERH 2B7DH 2OINA 1C5PA 2THFB 2QIQA 1ZMJA 2IN2A 3ZVEA 4CH2B 1O31A 4IS5A 3FFGA 1PYTD 3ATMA 1SFQB 2JH6D 1OWHA 2A7JA 1S5SA 3L33A 1FMGA 3QTOH 5DP7A 5T6GA 1ZJKA 1RS0A 3LGVA 3MYWA 2VVUA 2VIVA 4F49A 4X8VH 4UFGH 2FIRH 2VH0A 4NSYA 4HZHA 2J9NA 1WV7H 5J4SA 3T26A 1B5GH 1O30A 2IJOB 2BY5X 3M36A 1N8OC 2FI4E 1ACBE 3QX5H 1O0DH 3OU0A 3JZ2B 4K1SA 2QF3A 1ELFA 5DP3A 4FUFA 2Y6TA 1KSNA 5DGJA 1CVWH 4B73A 2XWBI 2D26C 1LVYA 1HB0B 1NRPH 1K1IA 2SNVA 1G30B 1FY5A 1HIAB 1IOEA 2BVRH 2BD3A 1EKBB 3QUMP 1S83A 3ZV8A 1DY9A 4AN7A 1CHOG 1BTZA 4TPIZ 1DFPA 1TPOA 2ANYA 2JETC 5AVDA 3QO6A 1GDQA 3D65E 4B2BA 3SU1A 2ZECA 2KAIB 2PGBB 1SGQE 3VB5A