2O9QA

The crystal structure of bovine trypsin complexed with a small inhibition peptide orb2k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title From protease inhibitor to antibiotics: single point mutation makes tremendous functional shift
rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA02
4YTAA 3QO6A 1GHVH 2R3UA 1MBQA 3ZZ6A 1A0LA 4Y8YA 2ALPA 3VXEH 1NRSH 2CGAA 2HRVA 4U2WA 1MTNB 4BOHA 1AVGH 3GY5A 1WBGB 1YCPM 2NU2E 4CH8B 1HUTH 1QHRB 3LDXH 4GHTA 2VH0A 1O3KA 2BDBA 1XKAC 4U30A 2J94A 1P2JA 3A86A 1FY3A 3A88A 1RXPA 3TK9A 4ABDA 5LPRA 1K1NA 3BSQA 4AOQA 4GVUA 3KQEA 4H42U 1P12E 3LC5A 1TMBH 1HV7A 1KSNA 1RTFB 1IHSH 1DXWA 1MBMA 5GXPA 2ZPSA 1QA7A 1CA0C 1O2NA 1UTQA 2EEKA 8GCHG 3N7OA 3PYHA 5DK1A 4THNH 1SFIA 1VITF 4YOJA 3KQDA 2A7JA 1LPZB 5L2YH 2GD4B 3PM3A 2BD5A 4B2BA 3SBKA 3SU4A 2QXGA 3TJVA 1GMCG 3BEFB 1ARBA 6GCHF 2Z9JA 2AGIX 1VZQH 2STAE 1IQEA 2AYWA 3SI4H 3EA9A 3VGCB 3SW2B 5ABWA 1V2QT 5GWZA 1EPTA 1EXFA 3UREA 3GY4A 8KME2 3LJOA 1SLXB 1Z1IA 2TGPZ 5EXNA 2ULLA 2VIWA 1ELBA 1QQUA 1AHTH 1TYNA 4AFQA 1W14U 1O30A 1ETTH 3L33A 3BEIB 2ZDNA 1T8OA 3U8TH 2JH5D 1P3EA 2VWOA 1O3AA 2FI3E 1C4Y2 1WOFA 3RDZA 1ABIH 1MTWA 1AO5A 1DT2A 1O3EA 4NZQA 2ZDAH 2G5VA 4BAKB 1BCUH 1QFKH 3LGUA 4HFPB 2SNWA 4GLYA 1ZR0A 2GVFA 4MNXA 4RN6A 1GL0E 5K7RA 1Y5AT 1HCGA 5C20A 3RLYH 1K1LA 3PMJA 1SMFE 1YCPK 1YPHE 3I77A 1IQKA 1O3LA 1C2GA 3FZZA 3PWCA 3ATWA 3SUEA 4WXIA 4KKDA 4X8SH 1P03A 4KELA 1C9TA 4NIXA 1SGFA 4OS5A 1K1MA 1C1MA 1GI8B 2ZG0H 1A4WH 5FBIA 3ZZDA 1O2ZA 8ESTE 2ZIQH 1O32A 2OUAA 2FEQH 3BIUH 2BOHB 2FO9A 5EOKA 3Q3YA 1C1OA 3VEQB 2FTMA 3DUXH 1C1NA 3M7QA 2BQWB 2GZ9A 1C5RA 3P95A 2FOHA 3SNEA 1BMMH 3RC4A 3TH2H 2R0KA 1DLEA 3LC3A 1QRXA 1C4U2 3TNTA 4ABHA 1Q3XA 1C5MD 1BMLA 1TBRH 1TNJA 5HGGA 2EC9H 4DIIH 4CRAA 3QK1A 1AKSB 1Z6EA 1LVBA 3GCNA 4X1SU 1TX8A 3HK3B 2Y82A 2F9VA 2LPRA 3GDVA 3RXJA 1LCYA 1Z8JB 2ZGCA 1Z8IB 3F6UH 4X2YA 1J15A 3UTUH 1O2RA 2AGEX 3L6PA 1SGIB 3CENA 3RXOA 2A4QA 5LGOA 1TGBA 4GAWA 4HGCA 4MNWA 3UPEA 1RTKA 2FLRH 4TY6A 4JZDH 2ILNA 2PGBB 1O2UA 1AY6H 2OBOA 1ELDE 1JIRA 1J16A 3EE0B 1A2CH 1LDTT 4B2CA 1HIAB 2CV3A 1FDPA 4Y7BA 3A7ZA 1DSUA 2A0QB 2BQ7B 3FANA 1ANDA 2XNIA 1C5YB 3B9FH 1HAVB 3I29A 1FUJA 2D2DA 1F0TA 1ZPCA 3LU9B 2ANWA 1D3PB 4TWYA 2B7DH 1BMAA 5E0JA 5E8EH 1HJAC 1BJVA 4NSVA 3UWJH 4AYYB 2Y7XA 1NRRH 2XTTB 3LGVA 4H6TA 3HKJB 3MWIU 1Y3XA 3CS7A 4AG2A 1FQ3A 2C8WB 1N1LA 3KEEA 5AF9H 2GDEH 3BN9A 2FOGA 1F5RA 1TNKA 1K1PA 4Y6DA 5DP4A 2ZTZA 1UTMA 3TITA 3BG8A 1UHBA 1AQ7A 1HAZB 4AFUA 1RIWB 3ITIA 3FZDA 4YLQH 1FLEE 4ZMAH 1GBFA 2GCHG 4VGCB 1NN6A 5FCRA 2PUXB 1BTUA 1YPHC 1IQFA 1ZHPA 4I8GA 2GDDA 1GI9B 1BTPA 1SB1H 2ZCKP 3MMGA 1TIOA 1SI5H 1ANBA 4ISHH 2BQ6B 3UNSA 1Y5UT 4XBCA 1N6XA 1W12U 2I6SA 3BV9B 4YLUA 1C1QA 1X7AC 1HJ9A 1YBWA 2QIQA 1ZHMA 4HZHA 1GVLA 7KMEH 2B5TB 4X6NA 4Q80A 1GCTB 4I8KA 3MU8A 1CVWH 1QTFA 1GI2A 3MHWU 9ESTA 2STBE 3QZQA 3Q00A 1LO6A 1HYLA 3FVFB 1K21H 1OWKA 1P11E 1SHYA 4JYVH 1GCDA 1YPGH 2XXLA 5LH8A 3MH5A 4O97A 4AB9A 3ZVGA 1GBBA 1TALA 3M3TA 1CHOG 3ZZCA 5F8TA 4KP0A 4I7YH 2OCVB 1GHYH 2ZTXA 3P8FA 1XM1A 1EPTB 1O5EH 1GI3A 2ZWLH 4I33A 2H6MA 1O5GH 1D3DB 1UCYH 2QGRA 1SHHB 2VIDA 1RGQA 1C2FA 3SGQE 2P95A 1BOQA 4XBBA 2ZFRH 1PYTC 3NCLA 1O3PB 2GV6A 2BB4A 3RXKA 2WPJS 1FN6A 1T31A 1ELTA 1NU9A 1WQVH 3ZYDA 1AVXA 1C2KA 1GBLA 4K1EA 1K1IA 5DPAA 2O8MA 4R0IA 3OU0A 4Y71A 3QLPH 1E36B 1KY9A 1V2RT 1WUNH 4X2XA 1FXYA 4ZAEA 4IC6A 2JETC 5A0CA 4MNVA 1ZSJA 2QC2A 2GKVE 2PKAA 2A45B 2AERH 8LPRA 3SJOA 1MU8B 1N8OB 1O2HA 1IQGA 1V3XA 1GDUA 3QN7A 4PROA 1VGCC 2CMYA 3T26A 2BD2A 3RM2H 1AB9B 3BEUA 5E2PA 3T29A 1NT1A 1QCPA 3RMNH 5FAHA 1ZSLA 4JZIA 1J9CH 1OYQA 4DIHH 1BMNH 1GG6C 5E2OA 2A1DB 2GT7A 1C4V2 4CRFA 1EQ9A 1W11U 1FPCH 4AB8A 1UTNA 1E38B 1GMDF 3SI3H 2VWLA 1AN1E 2QYIA 1A3EH 4I8LA 1WCZA 3A8BA 4O3TA 5EG4A 1UK3A 1O2SA 4BTIB 1EAXA 3MU4A 3QX5H 4DURA 1Z71A 4Y10E 4GCHG 1KXEA 1AUJA 1CHGA 1P2IA 3B23B 1CA0B 1YPJH 5L6NH 1CSOE 3HK6B 1P04A 1TONA 2HNTE 2F9PA 2Y5FA 1BRAA 1O2VA 4Q7YA 3S9AA 2GX4A 1O3MA 4ABEA 4YM9A 5L2ZH 3QZRA 2ASUB 1BRCE 2Z3EA 1ANEA 1UMAH 3H7OA 1ESBA 1MUEB 3SV7A 3A81A 3OX7U 3I78A 2Y80A 1PYTD 1ZOMA 2XCNA 2DE8A 3SNDA 4OGYA 1NZQH 1DY9A 1TFXA 4X1NU 1NPMA 4CRGA 2LNCA 2VGCC 2F9OA 2TGTA 1O35A 2H5DA 1CT0E 1D3QB 4DG4A 2GMTC 4IN2A 1C5QA 3DT0H 2ZFPH 3P70B 1TX7A 2OP9A 2ZKSA 3RXUA 1WAYB 1MAYA 1TLDA 5JBCS 1UVUH 1BTYA 2UUFB 1F5KU 2C90B 1ANCA 1QB1A 2FYRA 4TY7A 8GCHF 2O8TA 4B1TA 3MTYA 1O2YA 1GJ8B 5FPYA 3PO1B 3RM0H 3MO6A 3ZVEA 1D6WA 5AVDA 2D8WA 4I8HA 1O37A 4BXWA 1C2EA 4D76A 1MZDA 1WU1A 1AI8H 2B9LA 1OWIA 4Y8ZA 5DJ7A 4X1RU 1DICA 5TCAA 1UHBB 2H1UA 3LGTA 1O2WA 3H7TA 1EJMA 1BDAA 2G55A 5F8ZA 3ZZAA 3BTFE 1O2JA 3TPIZ 3TGJE 1OYTH 1H1BA 4BAHB 1NFYA 1UO6A 2V3OH 3SO3A 1BTXA 2G4TA 3NZIA 4JZEH 3SGAE 1H9IE 2ZFSA 5AFZH 3ZZ7A 5FCKA 5DP7A 4ABGA 3BTEE 1P02A 4WMDA 3S7KB 3SORA 4BTUB 2H9HA 2P8OC 1L4ZA 2G5NA 2IN2A 4I31A 2UWLA 1C2DA 3LH1A 2TRMA 3QTOH 3C1KA 1DUEA 3VB3A 1BRBE 1PFXC 4LXBH 1EAWA 3A85A 3Q3KA 1S81A 5C2ZA 4UE7H 2WPHS 3U98H 2BD8A 1O31A 1G3EA 2OC0A 2FZZA 1HAVA 2SGPE 2DUCA 3MU1A 3GYMA 4AORA 3MH6A 1D6RA 3SUDA 2GGVB 3SNCA 1TB6H 2G00A 3RC5A 1Y5BT 1ZPZA 2ZHQH 1ZYOA 1DWCH 1BT7A 1UTKA 1P09A 2HNTC 1GBAA 2GV7A 1SSXA 2A7CA 4ZKRU 1TAWA 1XXFA 3RMLH 3U69H 5JBBS 3M7UA 5FX5A 2O8LA 2PKSC 1O3BA 1E37B 1DXPA 3A7YA 2ZI2H 3VB7A 4A1XA 3TGIE 3A87A 1AGJA 2J9NA 4FVBA 1P8VC 4TYDA 3E16B 1O3GA 5PTPA 1GI6A 1LTOA 1HJAB 1DY8A 1C5PA 2JKHA 2PTNA 3M5OA 2G81E 2ZFQH 3GDUA 1Z8RA 1FY1A 2OBQA 4OS7A 5DG6A 2PKAB 1HPGA 2J4IA 2ZO3H 2ZU3A 2BXUH 5E0HA 1QRZA 3E0PB 3SV9A 4D9QA 3GCHC 2XYAA 1A0JA 4B2AA 3RXSA 5A09A 1BA8B 4X1QU 1KIGH 3AASA 2PLXA 7GCHG 1OSSA 1F0RA 1VCPA 2CF9H 4NA7A 1Y3WA 3OY6U 3RMOH 1O2MA 2SGAA 1KLIH 1LHEH 5K0HA 1AWFH 1TGNA 2ZEBA 3KQBA 2ZDLA 1G36A 3RXTA 1HBTH 4O03A 1FY5A 1DOJA 2ZZUH 3VB4A 3O8BA 3O8RA 1MMJN 2GT8A 1O3NA 2XBXA 1OP8A 5DP3A 2I6QA 4J2YB 2W3IA 1IQLA 1LKBA 4AYVB 1GGDC 1YF4A 1O3DA 1QIXB 1YCPH 2AMDA 1GJ6A 2ZECA 3UIRA 6LPRA 2P3UB 3A8DA 4JYUH 1TNGA 4GPGA 1C1RA 3HGNA 1FN8A 4CRDA 2A4OA 1CBWC 3P8OA 4D7GA 2QXHA 4UFGH 4OS1A 3RXHA 4UFDH 3D23A 4FUCA 1TRYA 3RXCA 5L30H 2V35A 2DE9A 3PTNA 2V0BA 1JRSA 4ISLA 3V0XA 1F0UA 1ZMJA 2CF8H 3SU1A 3SU6A 3FP6E 4NA8A 4JMYA 1TNHA 2PW8H 2FMJA 1B5GH 1HAIH 1S84A 1GJAB 4INHA 1TBQH 3A80A 3CP7A 2SGQE 3T28A 4ZKNU 1QBOA 2O9QA 2FOCA 2RCEA 1MKXK 1UTOA 4CREA 5ETXA 2RDLA 4JCNA 1SLVB 2ODPA 3RXLA 2BLQA 3QUMP 1G2LA 1ID5H 1EZSC 2Z9GA 2FXRA 4UDWH 3RUOA 1LHFH 5ESBA 3EA7A 2BM2A 4U32A 2ALVA 3ZZ8A 2BD7A 1GBJA 1SG8B 2JETB 3S7HB 1P06A 3E6PH 4I32A 1GJ5H 4Y76A 1C5XB 2WUBA 3UOUA 1YPEH 1FONA 1CGJE 3RLWH 1XMNB 1ABJH 2BD3A 5EXMA 3SV2H 2BD9A 1Z6JH 1LVYA 1CHOF 5GIBA 2WPLS 3EDXB 1MD8A 3RXDA 4ZHLU 4FVDA 1BUIA 3E90B 2XBVA 5EPNA 1PQAA 4FUDA 1C1PA 5FX6A 1MTUA 1GMHG 5A0BA 1C5ZB 3ZVFA 3P17H 4D9RA 1GG6B 3S9CA 1G37A 3V3MA 1UVPA 3BTME 1DE7H 4XDEA 3RXEA 4AGJA 3K6ZA 2FPZA 1AFQC 1O2LA 1ESTA 4WY3A 1UTLM 3ZVBA 1V2WT 3PTBA 2O8UA 4DT7B 2OTVA 1P2OA 3A83A 2F9UA 1GBEA 3V12A 2Y81A 4O9VA 1W13U 1ESAA 1DANH 1GJ7B 3HATH 1O0DH 2NU0E 1JWTA 3KL6A 5HMAA 1NRQH 1GHAG 4NA9H 4NFFA 5HXFA 3U8RH 1Y59T 2PFEA 4AZ2B 1FZZA 1LQDB 1AE5A 2B0FA 1J8AA 3SHAH 1V2JT 4RSPA 4LZ4B 5DP9A 2P3FH 1RRKA 1ZHRA 2ZC9H 5FPTA 2BXTH 1GBHA 1GI0A 4E06H 2GTBA 3FP7E 1L4DA 3LGWA 4AN7A 2Z9IA 1BTZA 1PPBH 2ODYB 2RG3A 1EOJA 1F92A 1SGDE 1O5FH 2XBWA 4AFSA 1RS0A 3DFJA 1EATA 2VGCB 1GHBG 2FWWA 1LHDH 3UR6A 1PPFE 4ZROA 3ZZBA 4A5TS 5F6MA 2GMTB 3D65E 1QJ7B 1H8DH 2TIOA 1MCTA 3PMBB 4ISNA 1SGFG 3FFGA 4GCHF 4MPWA 4XE4A 4E7NA 1DSTA 4DOQA 1TABE 2Q6GA 1O2OA 2FOEA 1KYNA 4MG3A 1HAYB 1TA6A 5BPEA 4UONA 4BAOB 1D3TB 2V6NA 1T4VH 3A7VA 2FM2A 3GCTG 5DP6A 1NROH 1FIWA 3HGPA 2R0LA 1C1TA 1HDTH 5EU8A 1HAPH 1T4UH 1EOLA 1VR1H 4AX9H 1SGPE 2ZNKH 4ESTE 3TK6A 4ZKOU 1IQNA 1YM0A 1XVOA 2ZCLP 4CH2B 3BTQE 2A2XH 1YGCH 3UFAA 6ESTA 3RXMA 2GZ7A 2Z6BD 1U6QA 1KXFA 3BIVH 3KF2A 1O2GH 2HOBA 4K69A 1L0ZA 1P2KA 2PV9B 2AH4X 3T27A 2BZ6H 1GI4A 3GDSA 4A7IB 1O2XA 3VGCC 1DUAA 4WWYA 1QQ4A 3SJIA 3ATKA 1GBCA 5EQRA 2FI4E 1IAUA 2XCFA 1ZJDA 2FP7B 1CGHA 3Q3XA 1C5WB 2A2QH 4YZUA 1KDQB 5BRRE 3PB1E 1GDNA 2AMPA 1A7SA 1ZLRA 1TGCA 5J4QA 2O8WA 4ABFA 3SJ8A 1BB0B 4IC5A 4NIYA 2XBYA 4BTTB 2Y5GA 3TJNA 1TPOA 3ELAH 3MI4A 1DWDH 2BVSH 3QTVH 3SNAA 4MLFB 1SGNE 1O3FA 3WY8A 3MU5A 4H6SB 4XFQA 1WSSH 1C2MA 1C5UA 4WMEA 3URCA 1TNIA 1PPGE 3OTJE 2UUJB 1BJUA 3PROA 1P9SA 2BOKA 1KXCA 1SLWB 3ATIA 2WYGA 3SU3A 1O5BB 5A8ZA 2OC7A 2PKSB 4MPXA 5CE1A 1Q31A 1O2PA 3RXIA 5A8XA 2FS8A 1OXGA 3S9BA 3B8JA 2F3CE 4JYTA 2PGQB 4FU9A 1ZGVA 1E0FD 2Y5HA 5CMXH 1OP0A 2VVVA 2WPIS 4Z6AH 1QB6A 5C1XA 1EB2A 3SU5A 3MFJA 3CS0A 3K9XB 2ZHEH 3MO9A 5FHTA 4JK5A 3MO3A 1BTWA 2ZGXH 1LPGB 2R9PA 4YT7H 3E1XB 2BY8X 3GY8A 1J14A 2VJ1A 3UQVA 2ZGHA 1SGQE 3F1SB 3GY2A 4TWWA 2BX3A 1KXDA 3MNBA 1Z7KA 2FYQA 3SQHE 3KNXA 1O39A 4KTSA 1DM4B 1EKBB 1A0HB 1ORFA 1V2LT 2FOFA 4GSOA 1KXAA 1NFUA 4K3JA 1XXDA 4IGDA 1SQTA 1PJPA 3LIWA 4NIVA 3LONA 2SGEE 4WF8A 2UWOA 1GBDA 3LJJA 1EB1H 1D9IA 4X1PU 4K2YA 1T8MA 2F9NA 2ZDKA 1L2EA 2PSXA 1H8IH 1GHWH 2AGGX 2THFB 4M7GA 1K1OA 4Y0ZE 1G3BA 1DVAH 4LK4A 3KIDU 3SUFA 2D1JA 4INKA 3L3TA 1G32B 3ODDA 1ZRBA 2ZF0H 3UUZA 2BYAX 1CA8B 3T2NA 1ETRH 3TNSA 4MPUA 6CHAC 1ELCA 4Y0YE 2FODA 4I8JA 2IOTA 4Y7AA 2UUKB 3LH3A 3SGBE 1ZZZA 2BTCE 1CE5A 1QBNA 1Z8GA 2Y6TA 2R2MB 3E3TA 3EQ0H 4UD9H 1O5CB 1RTLA 1GGDB 1ZRKA 3RMMH 3SV8A 2QV1A 3GICB 4CBNA 1GBKA 3LGIA 1CGIE 1DITH 4LZ1H 1O38A 1H9LB 3SU0A 2BDHA 2WYJA 2NU3E 1AFEH 1C1WH 1NFXA 2VIVA 3ZZ3A 1GWAA 1NFWA 1LKAA 2TGDA 4NGAH 1C5NH 2PHBA 1K28D 1O36A 1S0RA 3AW0A 3EAJA 4GHQA 4YOGA 5B6OA 5FXLA 1C1UH 3GISB 1QR3E 4FUGA 2BY7X 2QXIA 3HKIB 1IQMA 1QY6A 2IJOB 5EW2H 1NC6A 3MNSA 2R3YA 2AMQA 1XX9A 1XUKA 2G4UA 1AVWA 7LPRA 1GMCF 4K8BA 2EI8A 1O2IA 2ZDVH 4VGCC 1O2KA 3LPRA 1ELVA 2BD4A 1C2LA 4JZFH 1RD3B 3VB5A 1YP9A 3KGPA 2C3SA 2TPIZ 2YNAA 3T62A 3SJ9A 4E7RG 1Y8TA 2Z7FE 3RXFA 3BG4C 5DP5A 3UWIA 1GBMA 1O3CA 1PPCE 2CHAC 1GDQA 2BY6X 3M61U 2A4RA 4XSKU 2AEIH 2BDAA 3W94A 1GCTC 2J2UA 4FUIA 2BDCA 1QL8A 4ZH8A 5C5NA 4DY7B 1HGTH 1P57B 1P05A 3KCGH 2RA3A 4IMZA 3JZ1B 1LMWB 4XOJA 2VH6A 3U1IB 4RKOB 1PQ5A 3RU4T 4WH8A 1IOEA 4ZXYH 4BNRA 3M35A 1V2ST 2YNBA 3IG6B 1W2KH 1DPOA 1O33A 3BTTE 2VIOA 1SPJA 4E05H 1HB0B 2BVXH 1BTHH 4D8NA 5DO4H 4ABBA 2YOLA 3R0FA 4LOYH 3GY3A 1GVKB 1ETSH 3M3VA 3UNRA 1EPTC 4JZ1A 1LVMA 2HPQH 1RFNA 1SLUB 2ODQA 3AW1A 1C1VH 3VFEA 3H5CB 5JYIA 3P8NA 1NRPH 1P10A 1THSH 2VU8E 1AFQB 3NXPA 5TJXA 1OWJA 1F0SA 4AG1A 1THPB 1TA2A 4H4FA 2OC8A 4FU7A 4X6PA 2HPPH 3ATLA 1HFDA 1QNJA 2WV4A 4B76A 1TPSA 5G4BA 4DVAU 4X8VH 1XUGA 1MH0A 1TRMA 3EA8A 2PR3A 1CT2E 1FV9A 1TGTA 1EP5A 2BDIA 5T6GA 3OYPA 1SOTA 5GCHG 1GMHF 4ZKSU 3IWMA 1DFPA 2ZU4A 2ZHDA 5AHGH 3Q76A 2AFQB 3TH3H 1OWHA 3ZV8A 1FY8E 4IBLH 5C3NA 3RC6A 3PLBA 1SOZA 1EASA 4NWKA 3G01A 1YYY1 2KAIB 4CR5A 3ZYEA 4JK6A 1QA0A 1MQ5A 2SFAA 4YO9A 1P3CA 4IMQA 4YOIA 2A4GA 4Q2KA 1A5HA 3HPTB 1ZJKA 4Y8XA 2HNTF 4A92A 3DFLA 1QB9A 3EGKH 2HVXA 1GVZA 1YPKH 2F9BH 4FUEA 1LQEA 1GHAF 3A7WA 4F4OC 4FU8A 1FAKH 1G3CA 2NU1E 1YLDA 3M36A 1KDQA 5DGJA 3LKWA 1EUFA 1XVMA 4ZUHA 1IQIA 1W7XH 3ODFA 1EZUC 1HJ8A 1AE8H 4K1SA 4X6MA 2BY5X 2P59A 4U01A 2FESH 4R8TB 4A1VA 1MKXH 2HWLB 1Z1JA 1LHCH 3SZNA 1G30B 1QRWA 1TQ7B 3TJUA 4MDSA 2PUQH 5EGMA 1S6FA 1GHBF 2W7UA 1HAHH 1NS3A 2ZQ1A 3U8OH 3ATMA 5DP8A 1JIMA 1XKBC 2GCHF 1C2HA 4K5ZA 1P9UA 4IN1A 1GBIA 4RKJB 2OINA 1BQYA 1HRTH 1O34A 3MOCA 1ZTKA 4CHAC 1XUIA 4MNYA 3ZZ5A 4IW4E 3A7TA 2TGAA 3ESTA 1BIOA 4KGAA 2ZGJA 1TBZH 2BMGB 5CHAC 3STIA 3GCTF 1W0ZU 1FPHH 1O3OA 4B71A 2VIPA 1HLTH 1FAXA 2V3HH 4B75A 1H9HE 4WJG2 2JH0D 3M37A 3SHCH 3RU4D 1IQJA 4BXSA 1GHZA 1P2QA 3PO1C 1PPZA 3QGNB 4WXVA 3ZZ9A 1BBRH 1S83A 2K1QA 1WTHD 4WMFA 4B74A 4MPVA 4MTBA 3T25A 2TBSA 1FMGA 1TNLA 2PTCE 1VCQA 3TIUA 4SGAE 2GCTC 2HGTH 2BZAA 2J38A 1LVOA 4B73A 4DJZB 1UVTH 7ESTE 4SGBE 5EPYA 2XWAA 2C4FH 1ZPBA 2XWBI 3VPKA 5LPEA 1VJAU 1EAUA 2NWNA 2OXSA 3ENSB 2AIQA 3P8GA 1VGCB 2H2ZA 2ZFFH 1B0EA 3BTGE 2ZA5A 5TCCA 1G3DA 1INCA 1QJ1B 2XC5A 3RXBA 1S0QA 4OS6A 1MAXA 1PQ7A 1DWBH 5A0AE 1TMUH 1SGRE 2J34A 1BBRK 4FUJA 4TPYA 5JDUB 2XC4A 3ZV9A 2BVRH 5E0GA 5JPMH 1KTTB 3MH4A 3FAOA 4WVPE 3PLPA 2C93B 2JH6D 1A61H 1MU6B 3DA9B 1G9IE 2ANMH 1TOMH 4A1TA 3SQEE 1C2JA 1F5LA 1G2MA 1AUTC 1B0FA 1UK2A 1FIZA 5LPFA 4KTUA 2BLWA 2F83A 1BBRE 3A8CA 4Q7XA 2ZU2A 1EP6A 2W7SA 3SUGA 3A7XA 3AAVA 2VNTA 3QGJA 2ZGBH 4HTCH 2CN0H 1XUFA 1D4PB 1TX6A 1O2QA 2EI7A 3UNQA 2VVUA 1YKTA 3LGYA 3QDZB 3VB6A 2F91A 5FPSA 3M7TA 1N6YA 1QURH 3OY5U 1XUJA 3TH4H 2BY9X 4MVNA 2ZCHP 1NRNH 1VCWA 3W95A 1L1NA 2A5IA 4ZHAA 2W3KA 2VINA 3RP2A 1UVOA 4ZXXH 1W0YH 4ABAA 3SJKA 1YLCA 6CHAB 1EAIA 5T6FA 1HAXB 2ZHWH 1BRUP 1S6HA 5C1UA 1VITG 2Z9LA 4BAMB 1MZAA 5JBAS 1V6DA 2ZFTA 3SOSA 3O8CA 3BTWE 3TU7H 1A5IA 1SQAA 2ZP0H 6GCHG 1UJ1A 3SN8A 1B7XB 3A89A 1ELGA 1P0SH 1SR5C 1KLJH 5DKMA 1MTNC 1JMOH 2P93A 1E35B 4GUXA 3U1JB 1O5AB 2FOMB 1P2MA 2FLBH 1P2NA 2HLCA 1K9OE 1Y3UA 2Q6DA 1FJSA 1T7CA 1EZXC 4CBOA 2SGDE 4K1TA 2FOBA 1NU7B 1GI1A 3K6YA 3ZVDA 1CU1A 1V2VT 4K8YA 2J95A 1HAOH 1JOUB 1BHXF 1GI5A 1QBVH 5F8XA 2Z3CA 2PSYA 1JXPA 1A46H 2QF3A 4NZLA 3SNBA 5C67A 2FX6A 2QAAA 1SFQB 2B8OH 4QT8C 5GJ4B 1ZGIA 2ZU5A 1A1RA 2OLGA 2QN5T 3OSYA 3IITA 2G52A 2AS9A 3T5FH 3M3SA 3BF6H 3SU2A 1C5TA 2UWPA 2WV5A 1AZZA 2WPMS 1V2UT 5IYTA 3M5LA 1CT4E 1GJDB 1W7GH 2WINI 4F49A 1AMHA 1SGEE 3BG4B 1HAGE 4BANB 2NU4E 2BLOA 3DD2H 2CHAB 3RXPA 3QWCH 4DGJA 5HYOA 1WV7H 1ELAA 1FNIA 2VWMA 2QF0A 3EYDA 3S0NA 1V2PT 3V13A 1EJNA 1HNEE 2P8OB 1DDJA 3AAUA 2SGFE 1Y3VA 2CJIA 3BTHE 2H9TH 2CXVA 1EJAA 2FOAA 4IS5A 4FUBA 4YESB 4X2VA 4X8TH 4ISOA 5HM9A 3TVJB 4ABIA 1AZ8A 1T32A 2Y7ZA 5T6DA 3F9EA 2GZ8A 1GI7B 1L1JA 1NTPA 1TQ0B 4MQAA 1M9UA 1THRH 4NG9H 3NUMA 5C1YA 3KN2A 1O3HA 3E0NB 1TWXB 3GY7A 1V2NT 4CR9A 2ANKH 2M5TA 1F7ZA 2G51A 2ZPRA 1KXBA 1H4WA 2J92A 1WTGH 1AIXH 3F9FA 1ZMNA 1C9PA 2FDAA 3BTDE 4YT6H 1AWHB 2XW9A 3UR9A 2ANYA 2OQUA 1W3CA 2Q1JA 1DX5M 2D26C 3RXGA 3O8DA 4UFFH 2KAIA 2W5EA 3P6ZB 3A82A 4NCYA 3SV6A 1AD8H 3R3GB 2BX4A 1FY4A 2FX4A 3PWBA 3KQCA 5H4IB 9LPRA 2ZHFH 2EA3A 1VITH 4XBDA 2VB0A 1UCYK 2EI6A 3RXAA 2P94A 1TOCB 4AFZA 2A5KA 4D7FA 1O3IA 3P92A 2BDYA 3KHVA 1HXEH 1UK4A 3S69A 3UQOA 4UEHH 2HALA 3MNXA 1C5VA 2ZQ2A 1GBTA 3DHKH 2R2WU 1GJCB 3GCHB 5JBTA 1KLTA 5C5OA 1GJBB 1S5SA 3D62A 2VWNA 4NFEA 1WQSA 1ZMLA 2QY0B 4NSYA 1ZTLA 4OS4A 1UCYE 3E91A 1P01A 4X8UH 1V2KT 1TE0A 4HI3A 3ZVCA 3NK8A 3PV4A 1KTSB 1NY22 5T3HA 1C5OH 3GYLB 1O3JA 2OC1A 5JB8S 2G8TA 1Q2WA 1PPEE 3E8LA 3GOVB 4FXGH 1VJ9U 1EZQA 1T8NA 2VIQA 1C5SA 3C27B 1TMTH 5FBEA 4AGKA 3TLOA 2AIPA 1O2TA 4TPIZ 2XC0A 2A5AA 3STJA 2Z3DA 4ABJA 2C8ZB 3FP8E 3MNCA 5GCHF 3PMAB 4Y79A 1HXFH 1OPHB 4DCDA 5A8YA 5A2MH 1E34B 1OP2A 1UTPA 1XUHA 3RXVA 1IQHA 1YC0A 3K2UA 1SC8U 1S82A 1PQ8A 1J17T 1BITA 4A6LA 1YPMH 1UTJA 4KTCA 4X2WA 5EQSA 2H5CA 1CBWB 3RU4E 5SGAE 1NM6A 1V2TT 1SVPA 1EX3A 2ESTE 4ZHMU 5EXLA 1ELFA 3UOPA 2OD3B 1SGYE 2A7HA 2UUYA 5HM2A 7GCHF 1OWDA 3LT3A 3NKKA 2BDGA 5EW1H 4WH6A 4FUFA 1OS8A 4CHAB 1RIWC 1TGSZ 2W26A 1C2IA 2FS9A 3JZ2B 2WPKS 5ESTE 1PPHE 4Y11E 1C5LH 5CHAB 2Z9KA 1LHGH 5GDSH 2RA0A 1CQQA 1GJ4H 2ZTYA 2GP9B 1SGTA 2FI5E 4CRCA 1ELEE 2FIRH 1ACBE 1SBWA 4ISIH 1MTSA 2XRCA 1QL9A 1TRNA 1YPLH 1OOKB 1GL1A 2ZPQA 3TGKE 4Z0KA 1NESE 1A3BH 3RXRA 4ASHA 2SNVA 1AU8A 4FUHA 3TK5A 4O3UA 1GJ9B 2GCTB 3PLKA 1AKSA 2P3TB 2Z94A 2QCYA 1GHXH 3M5MA 1OX1A 1OKXA 3PMHB 1S85A 3MH7A 3ZVAA 3K65B 3F68H 1SQOA 1V2MT 2A31A 1QGFA 2FTLE 3GY6A 1WYKA 3URDA 4OGXA 3ZZ4A 1QL7A 1ZTJA 5J4SA 1DLKB 4NIWA 5GPIB 1SGCA 3A8AA 3AVZA 1F2SE 1UVSH 5EQQA 1MKWH 1JRTA 2QA9E 1Y3YA 1MTVA 1L1GA 4INLA 3Q77A 3F9HA 1IHTH 1O5DH 1K1JA 2BLVA 1LPKB 1NO9H 1W8BH 5JB9S 3LOXA 3BTKE 1HIAA 3TJOA 1DWEH 2IPHA 3UY9A 1V2OT 1MQ6A 1OWEA 3MYWA 2OQ5A 2BHGA 1SL3A 3F9GA 2A32A 2C8XB 1ARCA 3RXQA 1A5GH 1TPPA 1BHXB 1GPZA 2QXJA 4DW2U 1GMDG 4CRBA 2PWXA 4UFEH 2WUCA 1MKWK 3D49H 1W10U 5AFYH 5F03A 2P16A 3NWUA 4NWLA 2ZDMA 1MD7A 4K60A 1K22H 5I25A 4BAQB 3MU0A 2ZU1A 1N8OC 2VVCA 4X6OA 5EODA 2Q6FA 4X0WU 3GCOA 4OS2A 2C8YB 1RJXB 1MCVA 4Q7ZA 3V7TA 3A84A 3NPSA 3M5NA 5I46H 3U9AH 1TPAE 4J1YA 3VXFH 1DS2E 2H9EH 1T8LA 1C1SA 1ZSKA 1AB9C 1BZXE 1FI8A 5IDKA 1CO7E 1QJ6B 1K2I1 1JBUH
chains in the Genus database with same CATH superfamily
4YTAA 3QO6A 1GHVH 2R3UA 1MBQA 3ZZ6A 1A0LA 4Y8YA 2ALPA 3VXEH 1NRSH 2CGAA 2HRVA 4U2WA 2L6OA 1MTNB 4B6FA 4BOHA 1AVGH 3GY5A 1WBGB 1YCPM 2NU2E 4CH8B 1HUTH 1QHRB 3LDXH 4GHTA 2VH0A 1O3KA 2BDBA 1XKAC 4U30A 2J94A 1P2JA 3A86A 1FY3A 3A88A 1RXPA 3TK9A 4ABDA 5LPRA 1K1NA 3BSQA 4AOQA 4GVUA 3KQEA 4H42U 1P12E 3GS9A 3LC5A 3PRBA 3F3BA 1TMBH 1HV7A 1KSNA 1RTFB 1IHSH 1DXWA 1MBMA 5GXPA 2ZPSA 1QA7A 1CA0C 1O2NA 1UTQA 2EEKA 8GCHG 3NRLA 3N7OA 3PYHA 5DK1A 4THNH 1SFIA 1VITF 4YOJA 3KQDA 2A7JA 1LPZB 5L2YH 2GD4B 3PM3A 2BD5A 4B2BA 3SBKA 3SU4A 2QXGA 3TJVA 1GMCG 3BEFB 1ARBA 6GCHF 2Z9JA 2AGIX 1VZQH 2STAE 1IQEA 2AYWA 3SI4H 2IJD1 3EA9A 3VGCB 3SW2B 5ABWA 1V2QT 5GWZA 1EPTA 1EXFA 3UREA 3GY4A 8KME2 3LJOA 1SLXB 1Z1IA 2TGPZ 5EXNA 2ULLA 2VIWA 1ELBA 1QQUA 1AHTH 1TYNA 5HKKD 4AFQA 1W14U 5DSFA 1O30A 1ETTH 3L33A 3BEIB 2ZDNA 1T8OA 3U8TH 2JH5D 1P3EA 2VWOA 1O3AA 2FI3E 1C4Y2 1WOFA 3RDZA 1ABIH 1MTWA 1AO5A 1DT2A 1O3EA 4NZQA 2ZDAH 2G5VA 2V3MA 1BCUH 1QFKH 3LGUA 4HFPB 2SNWA 4BAKB 4GLYA 1ZR0A 2GVFA 4MNXA 4RN6A 1GL0E 5K7RA 1Y5AT 1HCGA 5C20A 3RLYH 1K1LA 3PMJA 1SMFE 1YCPK 1YPHE 3I77A 1IQKA 1O3LA 1C2GA 3FZZA 3PWCA 3ATWA 3SUEA 4WXIA 4KKDA 4X8SH 1P03A 4KELA 1C9TA 4NIXA 1SGFA 4OS5A 1K1MA 1C1MA 1GI8B 2ZG0H 1A4WH 5FBIA 3ZZDA 1O2ZA 5DN6D 8ESTE 2ZIQH 1O32A 2FEQH 2OUAA 3BIUH 2BOHB 2FO9A 5EOKA 3Q3YA 1C1OA 3VEQB 2FTMA 3DUXH 1C1NA 3M7QA 2BQWB 2GZ9A 1C5RA 3P95A 2FOHA 3SNEA 1BMMH 1UW7A 3RC4A 3TH2H 2R0KA 1DLEA 3LC3A 1QRXA 1C4U2 3TNTA 4ABHA 1Q3XA 1C5MD 1BMLA 1TBRH 1TNJA 5HGGA 2EC9H 4DIIH 4CRAA 3QK1A 1AKSB 1Z6EA 1LVBA 3GCNA 4X1SU 1TX8A 3HK3B 2Y82A 2F9VA 2LPRA 3GDVA 3RXJA 1LCYA 1Z8JB 2ZGCA 1Z8IB 3F6UH 4X2YA 1J15A 2EY4C 3UTUH 1O2RA 2AGEX 3L6PA 1SGIB 3CENA 3RXOA 2K0QA 2A4QA 5LGOA 1TGBA 4GAWA 4HGCA 4MNWA 3UPEA 1RTKA 1H8ED 2FLRH 4TY6A 4JZDH 2ILNA 2PP6A 2PGBB 1O2UA 1AY6H 2OBOA 1ELDE 2YMSB 1JIRA 1J16A 3EE0B 1A2CH 1LDTT 4B2CA 1HIAB 2CV3A 1FDPA 2XOKD 4Y7BA 3A7ZA 1DSUA 4RT0A 2A0QB 1K0HA 2BQ7B 3FANA 1ANDA 2XNIA 1C5YB 3B9FH 1HAVB 3AK5A 3I29A 1FUJA 2D2DA 1F0TA 1ZPCA 3FKSD 3LU9B 4TSFD 2ANWA 1D3PB 4TWYA 2B7DH 1BMAA 5E0JA 5E8EH 1HJAC 1BJVA 4NSVA 3UWJH 4AYYB 2Y7XA 1NRRH 2XTTB 3LGVA 4H6TA 3HKJB 3MWIU 1Y3XA 3CS7A 4AG2A 1FQ3A 2C8WB 1N1LA 3KEEA 2QF4A 5AF9H 2GDEH 3BN9A 2FOGA 1F5RA 1TNKA 1K1PA 4Y6DA 5DP4A 2ZTZA 1UTMA 3TITA 3BG8A 1UHBA 1AQ7A 1HAZB 4AFUA 1RIWB 3ITIA 3FZDA 4YLQH 1FLEE 4ZMAH 1GBFA 2GCHG 4VGCB 1NN6A 5FCRA 2PUXB 1BTUA 1YPHC 1IQFA 1ZHPA 4I8GA 2GDDA 1GI9B 1BTPA 1SB1H 2ZCKP 2LELA 3MMGA 1TIOA 1SI5H 1ANBA 4ISHH 2BQ6B 3UNSA 1Y5UT 4XBCA 1N6XA 1W12U 2I6SA 3BV9B 4YLUA 1C1QA 1X7AC 1HJ9A 1YBWA 2QIQA 1ZHMA 1KMHB 1NBME 4HZHA 1GVLA 7KMEH 3FN8A 2B5TB 4X6NA 4Q80A 1GCTB 4I8KA 3MU8A 3OE7D 1CVWH 1QTFA 1GI2A 3MHWU 9ESTA 2STBE 3DSOA 3QZQA 3Q00A 4P02A 1LO6A 1HYLA 3FVFB 1K21H 1OWKA 1P11E 1SHYA 4JYVH 1FX0B 1GCDA 1YPGH 2XXLA 5LH8A 3MH5A 2WV9A 2JDID 4O97A 4AB9A 3ZVGA 1GBBA 1TALA 3M3TA 1CHOG 3ZZCA 5F8TA 4KP0A 4I7YH 2OCVB 1GHYH 2ZTXA 3P8FA 1XM1A 1EPTB 1O5EH 1GI3A 2ZWLH 4I33A 2H6MA 1O5GH 1D3DB 1UCYH 2QGRA 1SHHB 2VIDA 1RGQA 1C2FA 5C17A 3SGQE 2P95A 4ZCNA 1BOQA 4XBBA 2ZFRH 3ZIAD 1PYTC 3NCLA 1O3PB 2GV6A 2BB4A 3RXKA 2WPJS 1FN6A 1T31A 1ELTA 1NU9A 1WQVH 3ZYDA 1AVXA 1C2KA 1GBLA 4K1EA 1K1IA 3H09A 5DPAA 2O8MA 4R0IA 3OU0A 4Y71A 3QLPH 1E36B 1KY9A 1V2RT 1WUNH 4X2XA 1FXYA 4ZAEA 4IC6A 2JETC 5F53A 5A0CA 4MNVA 1ZSJA 2QC2A 2GKVE 2PKAA 2A45B 2AERH 8LPRA 3SJOA 1MU8B 1N8OB 1O2HA 1IQGA 1V3XA 1GDUA 3QN7A 4PROA 1VGCC 2CMYA 3T26A 2BD2A 3RM2H 1AB9B 3BEUA 5E2PA 3T29A 1NT1A 1QCPA 3RMNH 5FAHA 1ZSLA 4JZIA 1J9CH 1OYQA 3FO8D 4DIHH 1BMNH 1GG6C 5E2OA 2A1DB 2GT7A 1C4V2 4CRFA 1EQ9A 1W11U 1FPCH 4AB8A 1UTNA 1E38B 1GMDF 3SI3H 2VWLA 1AN1E 2QYIA 1A3EH 4I8LA 1WCZA 3A8BA 4O3TA 5EG4A 1UK3A 1O2SA 4BTIB 1EAXA 3MU4A 3QX5H 4DURA 1Z71A 4Y10E 4GCHG 1KXEA 1AUJA 1CHGA 1P2IA 3W1EA 3B23B 1CA0B 1YPJH 5L6NH 1CSOE 3HK6B 4ASUD 1P04A 1TONA 2HNTE 2F9PA 2Y5FA 1BRAA 1O2VA 1H8HD 4Q7YA 2GX4A 1O3MA 3S9AA 4ABEA 4YM9A 5L2ZH 3QZRA 2ASUB 1BRCE 2Z3EA 1ANEA 1UMAH 3H7OA 1ESBA 1MUEB 3SV7A 3A81A 2OK5A 3OX7U 3I78A 2Y80A 1PYTD 1ZOMA 2XCNA 2DE8A 3SNDA 4OGYA 1NZQH 1DY9A 2KCAA 1TFXA 4X1NU 1NPMA 2XNDD 4CRGA 2LNCA 2VGCC 1EFRD 2F9OA 2TGTA 2QE7D 1O35A 2H5DA 1CT0E 1D3QB 4DG4A 2GMTC 4IN2A 1C5QA 3DT0H 2ZFPH 3P70B 1TX7A 2OP9A 2ZKSA 3RXUA 1WAYB 1MAYA 1TLDA 5JBCS 1UVUH 1BTYA 2RFKC 2UUFB 1F5KU 2C90B 1ANCA 1QB1A 2FYRA 4TY7A 8GCHF 2O8TA 4B1TA 3MTYA 1O2YA 1GJ8B 5FPYA 3PO1B 3RM0H 3MO6A 3ZVEA 1D6WA 5AVDA 2D8WA 4I8HA 1O37A 4BXWA 1C2EA 4D76A 1MZDA 1WU1A 1AI8H 2B9LA 1OWIA 4Y8ZA 5DJ7A 4X1RU 1DICA 5TCAA 1UHBB 2H1UA 3LGTA 1O2WA 2EQNA 3H7TA 1EJMA 1BDAA 2G55A 5F8ZA 3ZZAA 3BTFE 1O2JA 3TPIZ 3TGJE 1OYTH 1H1BA 4BAHB 1NFYA 1UO6A 2V3OH 3SO3A 1BTXA 2G4TA 3NZIA 4JZEH 2W6JD 3SGAE 1H9IE 2ZFSA 5AFZH 3ZZ7A 5FCKA 5DP7A 1SKYE 4ABGA 3BTEE 3KQ5A 1P02A 4WMDA 3S7KB 1NBMD 3SORA 4BTUB 2H9HA 3EE7A 2P8OC 1L4ZA 2G5NA 2IN2A 4I31A 2UWLA 1C2DA 3LH1A 2TRMA 3QTOH 3C1KA 1DUEA 3VB3A 1BRBE 1PFXC 4LXBH 1EAWA 3A85A 3Q3KA 1S81A 5C2ZA 4UE7H 2WPHS 3U98H 5CDFE 2BD8A 1O31A 1G3EA 2OC0A 2FZZA 1HAVA 2SGPE 2DUCA 3MU1A 3GYMA 4AORA 3MH6A 5T1VA 1D6RA 3SUDA 2GGVB 3OAAD 3SNCA 5B6LA 1TB6H 2G00A 3RC5A 1Y5BT 1ZPZA 2ZHQH 1ZYOA 1DWCH 1OHHD 1BT7A 1UTKA 1P09A 2F43B 2HNTC 1GBAA 2GV7A 1SSXA 2A7CA 4ZKRU 1TAWA 1XXFA 3RMLH 3U69H 5JBBS 3M7UA 5FX5A 2O8LA 2PKSC 1O3BA 1E37B 1DXPA 3A7YA 2ZI2H 3VB7A 4A1XA 3TGIE 3A87A 1AGJA 2J9NA 4FVBA 1P8VC 4TYDA 3E16B 1O3GA 5PTPA 1GI6A 1LTOA 1HJAB 1DY8A 1C5PA 2JKHA 2PTNA 3M5OA 5EJ1A 2G81E 2ZFQH 3GDUA 1Z8RA 1FY1A 2OBQA 3N99A 4OS7A 2JJ1D 5DG6A 2PKAB 1HPGA 2J4IA 2ZO3H 2ZU3A 2BXUH 5E0HA 1QRZA 3E0PB 3SV9A 4D9QA 3GCHC 2XYAA 1A0JA 4B2AA 3RXSA 5A09A 3SZEA 1BA8B 4X1QU 1KIGH 3AASA 2PLXA 7GCHG 2KCPA 1OSSA 1F0RA 1VCPA 2CF9H 4NA7A 1Y3WA 3OY6U 3RMOH 1O2MA 2SGAA 1KLIH 1LHEH 5K0HA 1AWFH 1TGNA 2ZEBA 3KQBA 2ZDLA 1G36A 5EJLA 3RXTA 1HBTH 1VKYA 4O03A 1FY5A 1DOJA 2ZZUH 3UAIC 3VB4A 3O8BA 3O8RA 1MMJN 2GT8A 1O3NA 2XBXA 1OP8A 5DP3A 2I6QA 4J2YB 2W3IA 1IQLA 1LKBA 4AYVB 1GGDC 1YF4A 1O3DA 1QIXB 1YCPH 2AMDA 1GJ6A 2ZECA 3UIRA 6LPRA 2P3UB 3A8DA 4JYUH 1WXRA 1TNGA 4GPGA 1C1RA 3HGNA 1FN8A 4CRDA 2A4OA 1CBWC 5EJZA 3P8OA 4D7GA 2QXHA 4UFGH 4OS1A 3RXHA 4UFDH 3D23A 4FUCA 1TRYA 3RXCA 5L30H 2V35A 2DE9A 3PTNA 2V0BA 1JRSA 4ISLA 3V0XA 1F0UA 1ZMJA 2CF8H 3SU1A 3SU6A 3FP6E 1QZ8A 4NA8A 4JMYA 1TNHA 2PW8H 2FMJA 1B5GH 1HAIH 1S84A 1GJAB 4INHA 1TBQH 3A80A 3CP7A 2SGQE 3T28A 4ZKNU 1QBOA 2FOCA 2O9QA 2RCEA 1MKXK 1UTOA 4CREA 5ETXA 2RDLA 4JCNA 1SLVB 2ODPA 3RXLA 2BLQA 3QUMP 1G2LA 1ID5H 1EZSC 2Z9GA 2FXRA 4UDWH 3RUOA 1LHFH 5ESBA 3EA7A 2BM2A 4U32A 2ALVA 1S6LA 3ZZ8A 2BD7A 1GBJA 1SG8B 2JETB 3S7HB 1P06A 3E6PH 4I32A 1GJ5H 4Y76A 1C5XB 2WUBA 3UOUA 1YPEH 3CNRA 1FONA 1CGJE 3RLWH 1XMNB 1ABJH 2BD3A 5EXMA 3SV2H 2BD9A 1Z6JH 1LVYA 1CHOF 5GIBA 2WPLS 3EDXB 1MD8A 3RXDA 4ZHLU 4FVDA 1BUIA 3E90B 2XBVA 5EPNA 1PQAA 4FUDA 1C1PA 5FX6A 1MTUA 1GMHG 5A0BA 1C5ZB 2CK3D 3ZVFA 3P17H 4D9RA 1GG6B 3S9CA 1G37A 3V3MA 1UVPA 3BTME 1DE7H 4XDEA 3RXEA 4AGJA 3K6ZA 2FPZA 1AFQC 1O2LA 1ESTA 4WY3A 1UTLM 3ZVBA 1V2WT 2M2AA 3PTBA 2O8UA 4DT7B 2OTVA 1P2OA 3A83A 2F9UA 1GBEA 3V12A 2Y81A 4O9VA 1W13U 1ESAA 1DANH 1GJ7B 3HATH 1O0DH 2NU0E 1JWTA 3KL6A 5HMAA 1NRQH 1GHAG 4NA9H 4NFFA 5HXFA 3U8RH 1Y59T 2PFEA 4AZ2B 1FZZA 1LQDB 1AE5A 1BMFD 2B0FA 1J8AA 3SHAH 3DSGA 1V2JT 4RSPA 4LZ4B 5DP9A 2WZQA 2P3FH 1RRKA 1ZHRA 2ZC9H 5FPTA 2BXTH 1GBHA 2L74A 1GI0A 4E06H 2GTBA 3FP7E 1L4DA 3LGWA 4AN7A 5EIYA 2Z9IA 1BTZA 1PPBH 2ODYB 2RG3A 1EOJA 3MQKC 1F92A 1SGDE 1O5FH 2XBWA 4AFSA 1RS0A 3DFJA 1EATA 2VGCB 1GHBG 2FWWA 1LHDH 3UR6A 1PPFE 4ZROA 3ZZBA 4A5TS 5F6MA 2GMTB 3D65E 1QJ7B 1H8DH 2TIOA 1MCTA 3PMBB 4ISNA 1SGFG 3FFGA 3FOAA 4GCHF 4MPWA 4XE4A 4E7NA 3OTPA 1DSTA 4DOQA 1TABE 2Q6GA 1O2OA 2FOEA 1KYNA 4MG3A 1HAYB 1TA6A 5BPEA 4UONA 4BAOB 1D3TB 2V6NA 1T4VH 3A7VA 2FM2A 3GCTG 5DP6A 1NROH 1FIWA 3HGPA 2R0LA 1C1TA 1HDTH 5EU8A 1HAPH 1T4UH 1EOLA 1VR1H 4AX9H 1SGPE 2ZNKH 4ESTE 3TK6A 4ZKOU 1IQNA 1YM0A 1XVOA 2ZCLP 4CH2B 3BTQE 2A2XH 1YGCH 3UFAA 2KZ4A 3N7DA 6ESTA 3RXMA 2GZ7A 2Z6BD 1U6QA 1KXFA 3BIVH 3N7EA 4I86A 2J5UA 3KF2A 1O2GH 2HOBA 4K69A 4XD7D 1L0ZA 1P2KA 2PV9B 2AH4X 3F2FA 3T27A 2BZ6H 1GI4A 3GDSA 4A7IB 1O2XA 3VGCC 1DUAA 4WWYA 1QQ4A 3SJIA 3ATKA 2J98A 1GBCA 5EQRA 2V7QD 2FI4E 1IAUA 2XCFA 1ZJDA 4HG6A 2FP7B 1CGHA 3Q3XA 1C5WB 2A2QH 4YZUA 1KDQB 5BRRE 3PB1E 1GDNA 2AMPA 1A7SA 1ZLRA 1TGCA 5J4QA 2O8WA 4ABFA 3SJ8A 1BB0B 4IC5A 4NIYA 2XBYA 3F0PA 2Y5GA 4BTTB 3TJNA 3F0OA 1TPOA 1YLNA 3ELAH 3MI4A 1DWDH 2BVSH 3QTVH 3SNAA 4MLFB 1SGNE 1O3FA 3WY8A 3MU5A 4H6SB 2JJ2D 4XFQA 1WSSH 1C2MA 1C5UA 4WMEA 3URCA 1TNIA 1PPGE 3OTJE 2UUJB 1BJUA 3PROA 1P9SA 2BOKA 1KXCA 1SLWB 3ATIA 2WYGA 3SU3A 1O5BB 5A8ZA 3WWFA 2OC7A 2PKSB 4MPXA 5CE1A 1Q31A 1O2PA 3RXIA 5A8XA 2FS8A 1OXGA 3S9BA 3B8JA 2F3CE 3OFND 4JYTA 2PGQB 4FU9A 1ZGVA 3SYJA 2W6ID 1E0FD 2Y5HA 5CMXH 1OP0A 2VVVA 2WPIS 4Z6AH 1QB6A 5C1XA 1EB2A 3SU5A 3MFJA 3CS0A 2WSSD 3K9XB 2ZHEH 3MO9A 5FHTA 4JK5A 3MO3A 1BTWA 1COWD 1LPGB 2ZGXH 2R9PA 4YT7H 3E1XB 2BY8X 3GY8A 1J14A 2VJ1A 3UQVA 3DSPA 2ZGHA 1SGQE 3F1SB 3GY2A 4TWWA 2BX3A 4Z1MD 3U28C 1KXDA 3MNBA 1Z7KA 2FYQA 3SQHE 3KNXA 1O39A 4KTSA 1DM4B 1EKBB 1A0HB 1ORFA 1V2LT 2FOFA 4GSOA 1KXAA 1NFUA 4K3JA 1XXDA 4IGDA 1SQTA 1PJPA 3LIWA 4NIVA 3LONA 2SGEE 4WF8A 2UWOA 1W0KD 1GBDA 3LJJA 1EB1H 1D9IA 4X1PU 4K2YA 1T8MA 2F9NA 2ZDKA 1L2EA 2PSXA 1H8IH 1GHWH 2AGGX 2THFB 4M7GA 1K1OA 1E1QD 4Y0ZE 1G3BA 1DVAH 4LK4A 3KIDU 3SUFA 2D1JA 2QF5A 4INKA 3L3TA 1G32B 3ODDA 1ZRBA 2ZF0H 3UUZA 2BYAX 1CA8B 3T2NA 1ETRH 3TNSA 4MPUA 6CHAC 2KCYA 1ELCA 4Y0YE 2FODA 4I8JA 2IOTA 4Y7AA 2UUKB 3LH3A 3SGBE 1ZZZA 2BTCE 3DCLA 1CE5A 1QBNA 1Z8GA 2Y6TA 2R2MB 3E3TA 3EQ0H 4UD9H 3F2HA 1O5CB 1RTLA 1GGDB 1ZRKA 3RMMH 3SV8A 2QV1A 3GICB 4CBNA 4Q63A 1GBKA 3LGIA 1CGIE 1DITH 4LZ1H 1O38A 1H9LB 3SU0A 2BDHA 2WYJA 2NU3E 1AFEH 1C1WH 1NFXA 2VIVA 3ZZ3A 2VBCA 1GWAA 1NFWA 1LKAA 2TGDA 4NGAH 1C5NH 2PHBA 1K28D 1O36A 1S0RA 3AW0A 3EAJA 4GHQA 4YOGA 5B6OA 2LP6A 5FXLA 1C1UH 3GISB 1QR3E 4FUGA 2BY7X 2QXIA 3HKIB 1IQMA 1QY6A 2IJOB 5EW2H 1NC6A 3MNSA 2R3YA 2AMQA 1XX9A 1XUKA 2G4UA 1AVWA 7LPRA 1GMCF 4K8BA 2EI8A 1O2IA 2ZDVH 4VGCC 1O2KA 3LPRA 1ELVA 2BD4A 1SQRA 1C2LA 4JZFH 1RD3B 3VB5A 1YP9A 3VG8A 3KGPA 1E1RD 2C3SA 2TPIZ 2YNAA 3T62A 3SJ9A 4E7RG 1Y8TA 2Z7FE 3RXFA 3BG4C 5DP5A 3UWIA 1GBMA 1O3CA 1PPCE 2CHAC 1GDQA 2BY6X 3M61U 2A4RA 4XSKU 2AEIH 2BDAA 3W94A 1GCTC 2J2UA 4FUIA 2BDCA 1QL8A 4ZH8A 5C5NA 4DY7B 1HGTH 1P57B 1P05A 3KCGH 2RA3A 4IMZA 3JZ1B 1LMWB 4XOJA 2J97A 2VH6A 3U1IB 4RKOB 1PQ5A 3RU4T 4WH8A 1IOEA 4ZXYH 4BNRA 3M35A 4DT4A 1V2ST 2YNBA 3IG6B 1W2KH 1DPOA 1O33A 3BTTE 2VIOA 1SPJA 5HIZA 4E05H 1HB0B 2BVXH 1BTHH 4D8NA 5DO4H 4ABBA 2YOLA 3R0FA 4LOYH 3GY3A 1GVKB 1ETSH 3M3VA 3UNRA 1EPTC 4JZ1A 1LVMA 2J98B 2HPQH 1RFNA 1SLUB 2ODQA 3AW1A 1C1VH 3VFEA 3H5CB 5JYIA 3P8NA 1NRPH 1P10A 1THSH 2VU8E 1AFQB 3NXPA 5TJXA 1OWJA 1F0SA 4AG1A 1THPB 1TA2A 4H4FA 2OC8A 4FU7A 4X6PA 2HPPH 3ATLA 1HFDA 1QNJA 2WV4A 4B76A 1TPSA 5G4BA 4DVAU 4X8VH 1XUGA 1MH0A 1TRMA 3EA8A 4B6EA 2PR3A 1CT2E 1FV9A 1TGTA 1EP5A 4RI0A 2BDIA 5T6GA 3OYPA 1SOTA 5GCHG 1GMHF 4ZKSU 3IWMA 1DFPA 2ZU4A 2ZHDA 5AHGH 3Q76A 2AFQB 3TH3H 1OWHA 3ZV8A 1FY8E 4IBLH 5C3NA 3RC6A 3PLBA 1SOZA 1EASA 4NWKA 3G01A 1YYY1 2KAIB 4CR5A 3WWBA 2IPQX 3ZYEA 4JK6A 1QA0A 1MQ5A 2SFAA 4OM9A 4YO9A 4F55A 1P3CA 4IMQA 4YOIA 5IK2D 5GNDA 2A4GA 4Q2KA 1A5HA 3HPTB 1ZJKA 4Y8XA 2HNTF 3OEHD 4A92A 3DFLA 1QB9A 3EGKH 2HVXA 1GVZA 1YPKH 2F9BH 4FUEA 1LQEA 5KECA 1GHAF 3A7WA 4F4OC 4FU8A 1FAKH 1G3CA 2NU1E 1YLDA 3M36A 1KDQA 5DGJA 3LKWA 1EUFA 1XVMA 3UB0A 4ZUHA 1IQIA 1W7XH 3ODFA 1EZUC 1HJ8A 1AE8H 4K1SA 4X6MA 2BY5X 2P59A 4U01A 2FESH 4R8TB 4A1VA 1MKXH 2HWLB 4RT1A 1Z1JA 1LHCH 3SZNA 1G30B 1QRWA 1TQ7B 3TJUA 4MDSA 2PUQH 5EGMA 1S6FA 1GHBF 2W7UA 1HAHH 1NS3A 2ZQ1A 3U8OH 3ATMA 5DP8A 1JIMA 1XKBC 2GCHF 1C2HA 4K5ZA 1P9UA 4IN1A 1GBIA 4RKJB 2OINA 1BQYA 1HRTH 1O34A 3MOCA 1ZTKA 4CHAC 1XUIA 4MNYA 3ZZ5A 4IW4E 3A7TA 2TGAA 3ESTA 1BIOA 4KGAA 2ZGJA 1TBZH 2BMGB 5CHAC 3STIA 3GCTF 1W0ZU 1FPHH 1O3OA 4B71A 2VIPA 1HLTH 1FAXA 2V3HH 4B75A 1H9HE 4WJG2 2JH0D 3M37A 3SHCH 3RU4D 1IQJA 4BXSA 1GHZA 1P2QA 3PO1C 1PPZA 3QGNB 4WXVA 3ZZ9A 1BBRH 1S83A 2K1QA 1WTHD 3OEED 4WMFA 4MPVA 4B74A 4MTBA 3T25A 2TBSA 1FMGA 1TNLA 2PTCE 1VCQA 3TIUA 4SGAE 2GCTC 2HGTH 2BZAA 2J38A 1LVOA 4B73A 4DJZB 1UVTH 5FL7D 7ESTE 4SGBE 5EPYA 2XWAA 2C4FH 1ZPBA 2XWBI 3VPKA 5LPEA 1VJAU 1EAUA 2NWNA 2OXSA 3ENSB 2AIQA 3P8GA 1VGCB 2H2ZA 5C94A 2ZFFH 1B0EA 3BTGE 2ZA5A 5TCCA 1G3DA 1INCA 1QJ1B 2XC5A 3RXBA 1S0QA 4OS6A 1MAXA 1PQ7A 5C0TA 1DWBH 5A0AE 2KX4A 1TMUH 1SGRE 2J34A 1BBRK 4FUJA 4TPYA 5JDUB 2XC4A 3ZV9A 2BVRH 5E0GA 5JPMH 3F2GA 1KTTB 3MH4A 3FAOA 4WVPE 3PLPA 2C93B 2JH6D 1A61H 1MU6B 3DA9B 1G9IE 2ANMH 1W0JD 1TOMH 4A1TA 3SQEE 1C2JA 1F5LA 1G2MA 1AUTC 1B0FA 1UK2A 1FIZA 5LPFA 4KTUA 2BLWA 2F83A 1BBRE 3A8CA 4Q7XA 2ZU2A 1EP6A 2W7SA 3SUGA 3A7XA 3AAVA 2VNTA 3KYFA 3QGJA 2ZGBH 4HTCH 2CN0H 1XUFA 1D4PB 1TX6A 1O2QA 2EI7A 3UNQA 2VVUA 1YKTA 3LGYA 3QDZB 3VB6A 2F91A 5FPSA 3M7TA 1N6YA 1YY3A 1QURH 3OY5U 1XUJA 3TH4H 2BY9X 4ACBA 2HVYB 4MVNA 2ZCHP 1NRNH 1VCWA 3W95A 1L1NA 2A5IA 4ZHAA 2W3KA 2VINA 3RP2A 1UVOA 4ZXXH 2AHME 1W0YH 4ABAA 3SJKA 1YLCA 6CHAB 1EAIA 5T6FA 1HAXB 2ZHWH 1BRUP 1S6HA 5C1UA 1VITG 2Z9LA 4BAMB 1MZAA 5JBAS 1V6DA 2ZFTA 3SOSA 3O8CA 3BTWE 3TU7H 1A5IA 1SQAA 4M9FA 2ZP0H 6GCHG 1UJ1A 3SN8A 1B7XB 3A89A 1ELGA 1P0SH 1SR5C 1KLJH 5DKMA 2WPDD 1MTNC 1JMOH 2P93A 1E35B 4GUXA 3U1JB 1O5AB 2FOMB 1P2MA 2FLBH 1P2NA 2HLCA 1K9OE 1Y3UA 2Q6DA 1FJSA 1T7CA 1EZXC 4CBOA 2SGDE 4K1TA 2FOBA 1NU7B 2GJGA 1GI1A 3K6YA 3ZVDA 1CU1A 1V2VT 4K8YA 2J95A 1HAOH 1JOUB 1BHXF 1GI5A 1QBVH 5F8XA 2Z3CA 2PSYA 1JXPA 1A46H 2QF3A 4NZLA 3SNBA 5C67A 2FX6A 2QAAA 1SFQB 2B8OH 4QT8C 5GJ4B 1ZGIA 2ZU5A 1A1RA 2OLGA 2QN5T 3OSYA 3IITA 2G52A 2AS9A 3T5FH 3M3SA 3BF6H 3SU2A 1C5TA 2UWPA 2WV5A 1AZZA 2WPMS 1V2UT 5IYTA 3M5LA 1CT4E 1GJDB 1W7GH 2WINI 4F49A 2WHXA 1AMHA 1SGEE 3BG4B 4XRNA 1HAGE 4BANB 2NU4E 2BLOA 3DD2H 2CHAB 3RXPA 3QWCH 4DGJA 5HYOA 1WV7H 1ELAA 1FNIA 2VWMA 2QF0A 3EYDA 3S0NA 1V2PT 5KGOA 3V13A 1EJNA 1HNEE 2P8OB 1DDJA 3AAUA 2SGFE 1Y3VA 2CJIA 3BTHE 2H9TH 2CXVA 1EJAA 2FOAA 4IS5A 4FUBA 4YESB 4X2VA 4X8TH 4ISOA 5HM9A 3TVJB 4ABIA 1AZ8A 1T32A 2Y7ZA 5T6DA 3F9EA 2GZ8A 1GI7B 1L1JA 1NTPA 1TQ0B 4MQAA 1M9UA 1THRH 4NG9H 3NUMA 5C1YA 3KN2A 1O3HA 3E0NB 1TWXB 3GY7A 3PRDA 1V2NT 4CR9A 5HIYA 2ANKH 2M5TA 1F7ZA 2G51A 2ZPRA 1KXBA 1H4WA 2J92A 1WTGH 1AIXH 4F48B 3F9FA 1ZMNA 1C9PA 2FDAA 3BTDE 4YT6H 1AWHB 2XW9A 3UR9A 2ANYA 2OQUA 1W3CA 2Q1JA 1DX5M 2D26C 4TT3D 3RXGA 3O8DA 4UFFH 2KAIA 5C0UA 3PV5A 2W5EA 3P6ZB 3A82A 4NCYA 3SV6A 1AD8H 3R3GB 2BX4A 1FY4A 2FX4A 3WW7A 3PWBA 3PV2A 3KQCA 5CHBA 5H4IB 9LPRA 2ZHFH 2EA3A 1VITH 4XBDA 2VB0A 1UCYK 4ACAA 2EI6A 3RXAA 2P94A 1TOCB 4AFZA 2A5KA 1YWUA 4D7FA 1O3IA 3P92A 2BDYA 3KHVA 1HXEH 1UK4A 3S69A 3UQOA 4UEHH 2HALA 3MNXA 1C5VA 2ZQ2A 1GBTA 3DHKH 2R2WU 1GJCB 3GCHB 5JBTA 1KLTA 5C5OA 1GJBB 1S5SA 2RDEA 2VWNA 3D62A 4NFEA 1WQSA 1ZMLA 2HLDD 2QY0B 1ZTLA 4NSYA 4OS4A 1UCYE 3E91A 1P01A 4X8UH 1V2KT 1TE0A 4HI3A 3ZVCA 5KEDA 3NK8A 3PV4A 1KTSB 1NY22 5T3HA 1C5OH 3GYLB 1O3JA 2OC1A 2K8IA 5JB8S 2G8TA 1Q2WA 2YMSC 1PPEE 3E8LA 3GOVB 4FXGH 1VJ9U 1EZQA 1T8NA 2VIQA 1C5SA 3C27B 1TMTH 5FBEA 4AGKA 3TLOA 2AIPA 1O2TA 4TPIZ 2XC0A 1MABB 2A5AA 2Z3DA 3STJA 4ABJA 2C8ZB 3FP8E 3MNCA 5GCHF 3PMAB 4Y79A 1HXFH 1OPHB 4DCDA 5A8YA 5A2MH 1E34B 1OP2A 1UTPA 1XUHA 2KR7A 4FETA 3RXVA 2KCOA 1IQHA 1YC0A 3K2UA 1SC8U 1S82A 1PQ8A 1J17T 1BITA 4A6LA 1YPMH 1UTJA 4KTCA 4X2WA 5EQSA 2H5CA 1CBWB 3RU4E 5SGAE 1NM6A 1V2TT 1SVPA 1EX3A 2ESTE 4ZHMU 5EXLA 1ELFA 3UOPA 2OD3B 4FOUC 1SGYE 2A7HA 2UUYA 5HM2A 7GCHF 1OWDA 3LT3A 3NKKA 2BDGA 5EW1H 4Q4LA 4WH6A 4FUFA 1OS8A 4CHAB 1RIWC 1TGSZ 2W26A 1C2IA 2FS9A 3JZ2B 2WPKS 5ESTE 1PPHE 4Y11E 1C5LH 5CHAB 2Z9KA 1LHGH 5GDSH 2RA0A 1CQQA 1GJ4H 2ZTYA 2GP9B 1SGTA 2FI5E 4CRCA 1ELEE 2FIRH 1ACBE 1SBWA 4ISIH 1MTSA 2XRCA 1QL9A 1TRNA 1YPLH 1OOKB 1GL1A 2ZPQA 3TGKE 4Z0KA 1NESE 1A3BH 3RXRA 4ASHA 2SNVA 1AU8A 4FUHA 3TK5A 4O3UA 1GJ9B 2GCTB 3PLKA 1AKSA 2P3TB 2Z94A 2QCYA 1GHXH 3M5MA 1OX1A 1OKXA 3PMHB 1S85A 3MH7A 3ZVAA 3K65B 2JIZD 3F68H 1SQOA 1V2MT 2A31A 1QGFA 2FTLE 3GY6A 1WYKA 3URDA 4OGXA 3ZZ4A 1QL7A 1ZTJA 2YMSD 5J4SA 1DLKB 4NIWA 5GPIB 4P00A 1SGCA 3A8AA 3AVZA 1F2SE 1UVSH 5EQQA 1MKWH 1JRTA 2QA9E 1Y3YA 1MTVA 1L1GA 4INLA 3Q77A 3F9HA 1IHTH 1O5DH 4AC9A 1K1JA 2BLVA 1LPKB 1NO9H 1W8BH 2KFWA 5JB9S 3LOXA 3BTKE 1HIAA 3TJOA 1DWEH 2IPHA 3UY9A 1V2OT 1MQ6A 1OWEA 3MYWA 2OQ5A 2BHGA 1E79D 1SL3A 3F9GA 2A32A 2C8XB 2F4LA 1ARCA 3RXQA 3KYGA 1A5GH 1TPPA 1BHXB 1GPZA 2QXJA 4DW2U 1GMDG 4CRBA 2PWXA 4UFEH 2WUCA 1MKWK 1WDIA 3D49H 1W10U 5AFYH 5F03A 2P16A 2KM0A 3NWUA 4NWLA 2ZDMA 1MD7A 4K60A 1K22H 5I25A 4BAQB 3MU0A 2ZU1A 1N8OC 2VVCA 4X6OA 5EODA 2Q6FA 4X0WU 3GCOA 4OS2A 2C8YB 1RJXB 1MCVA 4Q7ZA 3V7TA 3A84A 3NPSA 3M5NA 5I46H 3U9AH 4YXWD 1TPAE 4J1YA 3VXFH 1DS2E 2H9EH 1T8LA 1C1SA 1ZSKA 1AB9C 1BZXE 1FI8A 5IDKA 1CO7E 1QJ6B 1K2I1 1JBUH
chains in the Genus database with same CATH topology
4YTAA 3QO6A 1GHVH 2R3UA 1MBQA 3ZZ6A 1A0LA 4Y8YA 2ALPA 3VXEH 1NRSH 2CGAA 2HRVA 4U2WA 1MTNB 4BOHA 1AVGH 3GY5A 1WBGB 1YCPM 2NU2E 4CH8B 1HUTH 1QHRB 3LDXH 4GHTA 2VH0A 1O3KA 2BDBA 1XKAC 4U30A 2J94A 1P2JA 3A86A 1FY3A 3A88A 1RXPA 3TK9A 4ABDA 5LPRA 1K1NA 3BSQA 4AOQA 4GVUA 3KQEA 4H42U 1P12E 3LC5A 1TMBH 1HV7A 1KSNA 1RTFB 1IHSH 1DXWA 1MBMA 5GXPA 2ZPSA 1QA7A 1CA0C 1O2NA 1UTQA 2EEKA 8GCHG 3N7OA 3PYHA 5DK1A 4THNH 1SFIA 1VITF 4YOJA 3KQDA 2A7JA 1LPZB 5L2YH 2GD4B 3PM3A 2BD5A 4B2BA 3SBKA 3SU4A 2QXGA 3TJVA 1GMCG 3BEFB 1ARBA 6GCHF 2Z9JA 2AGIX 1VZQH 2STAE 1IQEA 2AYWA 3SI4H 3EA9A 3VGCB 3SW2B 5ABWA 1V2QT 5GWZA 1EPTA 1EXFA 3UREA 3GY4A 8KME2 3LJOA 1SLXB 1Z1IA 2TGPZ 5EXNA 2ULLA 2VIWA 1ELBA 1QQUA 1AHTH 1TYNA 4AFQA 1W14U 1O30A 1ETTH 3L33A 3BEIB 2ZDNA 1T8OA 3U8TH 2JH5D 1P3EA 2VWOA 1O3AA 2FI3E 1C4Y2 1WOFA 3RDZA 1ABIH 1MTWA 1AO5A 1DT2A 1O3EA 4NZQA 2ZDAH 2G5VA 4BAKB 1BCUH 1QFKH 3LGUA 4HFPB 2SNWA 4GLYA 1ZR0A 2GVFA 4MNXA 4RN6A 1GL0E 5K7RA 1Y5AT 1HCGA 5C20A 3RLYH 1K1LA 3PMJA 1SMFE 1YCPK 1YPHE 3I77A 1IQKA 1O3LA 1C2GA 3FZZA 3PWCA 3ATWA 3SUEA 4WXIA 4KKDA 4X8SH 1P03A 4KELA 1C9TA 4NIXA 1SGFA 4OS5A 1K1MA 1C1MA 1GI8B 2ZG0H 1A4WH 5FBIA 3ZZDA 1O2ZA 8ESTE 2ZIQH 1O32A 2OUAA 2FEQH 3BIUH 2BOHB 2FO9A 5EOKA 3Q3YA 1C1OA 3VEQB 2FTMA 3DUXH 1C1NA 3M7QA 2BQWB 2GZ9A 1C5RA 3P95A 2FOHA 3SNEA 1BMMH 3RC4A 3TH2H 2R0KA 1DLEA 3LC3A 1QRXA 1C4U2 3TNTA 4ABHA 1Q3XA 1C5MD 1BMLA 1TBRH 1TNJA 5HGGA 2EC9H 4DIIH 4CRAA 3QK1A 1AKSB 1Z6EA 1LVBA 3GCNA 4X1SU 1TX8A 3HK3B 2Y82A 2F9VA 2LPRA 3GDVA 3RXJA 1LCYA 1Z8JB 2ZGCA 1Z8IB 3F6UH 4X2YA 1J15A 3UTUH 1O2RA 2AGEX 3L6PA 1SGIB 3CENA 3RXOA 2A4QA 5LGOA 1TGBA 4GAWA 4HGCA 4MNWA 3UPEA 1RTKA 2FLRH 4TY6A 4JZDH 2ILNA 2PGBB 1O2UA 1AY6H 2OBOA 1ELDE 1JIRA 1J16A 3EE0B 1A2CH 1LDTT 4B2CA 1HIAB 2CV3A 1FDPA 4Y7BA 3A7ZA 1DSUA 2A0QB 2BQ7B 3FANA 1ANDA 2XNIA 1C5YB 3B9FH 1HAVB 3I29A 1FUJA 2D2DA 1F0TA 1ZPCA 3LU9B 2ANWA 1D3PB 4TWYA 2B7DH 1BMAA 5E0JA 5E8EH 1HJAC 1BJVA 4NSVA 3UWJH 4AYYB 2Y7XA 1NRRH 2XTTB 3LGVA 4H6TA 3HKJB 3MWIU 1Y3XA 3CS7A 4AG2A 1FQ3A 2C8WB 1N1LA 3KEEA 5AF9H 2GDEH 3BN9A 2FOGA 1F5RA 1TNKA 1K1PA 4Y6DA 5DP4A 2ZTZA 1UTMA 3TITA 3BG8A 1UHBA 1AQ7A 1HAZB 4AFUA 1RIWB 3ITIA 3FZDA 4YLQH 1FLEE 4ZMAH 1GBFA 2GCHG 4VGCB 1NN6A 5FCRA 2PUXB 1BTUA 1YPHC 1IQFA 1ZHPA 4I8GA 2GDDA 1GI9B 1BTPA 1SB1H 2ZCKP 3MMGA 1TIOA 1SI5H 1ANBA 4ISHH 2BQ6B 3UNSA 1Y5UT 4XBCA 1N6XA 1W12U 2I6SA 3BV9B 4YLUA 1C1QA 1X7AC 1HJ9A 1YBWA 2QIQA 1ZHMA 4HZHA 1GVLA 7KMEH 2B5TB 4X6NA 4Q80A 1GCTB 4I8KA 3MU8A 1CVWH 1QTFA 1GI2A 3MHWU 9ESTA 2STBE 3QZQA 3Q00A 1LO6A 1HYLA 3FVFB 1K21H 1OWKA 1P11E 1SHYA 4JYVH 1GCDA 1YPGH 2XXLA 5LH8A 3MH5A 4O97A 4AB9A 3ZVGA 1GBBA 1TALA 3M3TA 1CHOG 3ZZCA 5F8TA 4KP0A 4I7YH 2OCVB 1GHYH 2ZTXA 3P8FA 1XM1A 1EPTB 1O5EH 1GI3A 2ZWLH 4I33A 2H6MA 1O5GH 1D3DB 1UCYH 2QGRA 1SHHB 2VIDA 1RGQA 1C2FA 3SGQE 2P95A 1BOQA 4XBBA 2ZFRH 1PYTC 3NCLA 1O3PB 2GV6A 2BB4A 3RXKA 2WPJS 1FN6A 1T31A 1ELTA 1NU9A 1WQVH 3ZYDA 1AVXA 1C2KA 1GBLA 4K1EA 1K1IA 5DPAA 2O8MA 4R0IA 3OU0A 4Y71A 3QLPH 1E36B 1KY9A 1V2RT 1WUNH 4X2XA 1FXYA 4ZAEA 4IC6A 2JETC 5A0CA 4MNVA 1ZSJA 2QC2A 2GKVE 2PKAA 2A45B 2AERH 8LPRA 3SJOA 1MU8B 1N8OB 1O2HA 1IQGA 1V3XA 1GDUA 3QN7A 4PROA 1VGCC 2CMYA 3T26A 2BD2A 3RM2H 1AB9B 3BEUA 5E2PA 3T29A 1NT1A 1QCPA 3RMNH 5FAHA 1ZSLA 4JZIA 1J9CH 1OYQA 4DIHH 1BMNH 1GG6C 5E2OA 2A1DB 2GT7A 1C4V2 4CRFA 1EQ9A 1W11U 1FPCH 4AB8A 1UTNA 1E38B 1GMDF 3SI3H 2VWLA 1AN1E 2QYIA 1A3EH 4I8LA 1WCZA 3A8BA 4O3TA 5EG4A 1UK3A 1O2SA 4BTIB 1EAXA 3MU4A 3QX5H 4DURA 1Z71A 4Y10E 4GCHG 1KXEA 1AUJA 1CHGA 1P2IA 3B23B 1CA0B 1YPJH 5L6NH 1CSOE 3HK6B 1P04A 1TONA 2HNTE 2F9PA 2Y5FA 1BRAA 1O2VA 4Q7YA 3S9AA 2GX4A 1O3MA 4ABEA 4YM9A 5L2ZH 3QZRA 2ASUB 1BRCE 2Z3EA 1ANEA 1UMAH 3H7OA 1ESBA 1MUEB 3SV7A 3A81A 3OX7U 3I78A 2Y80A 1PYTD 1ZOMA 2XCNA 2DE8A 3SNDA 4OGYA 1NZQH 1DY9A 1TFXA 4X1NU 1NPMA 4CRGA 2LNCA 2VGCC 2F9OA 2TGTA 1O35A 2H5DA 1CT0E 1D3QB 4DG4A 2GMTC 4IN2A 1C5QA 3DT0H 2ZFPH 3P70B 1TX7A 2OP9A 2ZKSA 3RXUA 1WAYB 1MAYA 1TLDA 5JBCS 1UVUH 1BTYA 2UUFB 1F5KU 2C90B 1ANCA 1QB1A 2FYRA 4TY7A 8GCHF 2O8TA 4B1TA 3MTYA 1O2YA 1GJ8B 5FPYA 3PO1B 3RM0H 3MO6A 3ZVEA 1D6WA 5AVDA 2D8WA 4I8HA 1O37A 4BXWA 1C2EA 4D76A 1MZDA 1WU1A 1AI8H 2B9LA 1OWIA 4Y8ZA 5DJ7A 4X1RU 1DICA 5TCAA 1UHBB 2H1UA 3LGTA 1O2WA 3H7TA 1EJMA 1BDAA 2G55A 5F8ZA 3ZZAA 3BTFE 1O2JA 3TPIZ 3TGJE 1OYTH 1H1BA 4BAHB 1NFYA 1UO6A 2V3OH 3SO3A 1BTXA 2G4TA 3NZIA 4JZEH 3SGAE 1H9IE 2ZFSA 5AFZH 3ZZ7A 5FCKA 5DP7A 4ABGA 3BTEE 1P02A 4WMDA 3S7KB 3SORA 4BTUB 2H9HA 2P8OC 1L4ZA 2G5NA 2IN2A 4I31A 2UWLA 1C2DA 3LH1A 2TRMA 3QTOH 3C1KA 1DUEA 3VB3A 1BRBE 1PFXC 4LXBH 1EAWA 3A85A 3Q3KA 1S81A 5C2ZA 4UE7H 2WPHS 3U98H 2BD8A 1O31A 1G3EA 2OC0A 2FZZA 1HAVA 2SGPE 2DUCA 3MU1A 3GYMA 4AORA 3MH6A 1D6RA 3SUDA 2GGVB 3SNCA 1TB6H 2G00A 3RC5A 1Y5BT 1ZPZA 2ZHQH 1ZYOA 1DWCH 1BT7A 1UTKA 1P09A 2HNTC 1GBAA 2GV7A 1SSXA 2A7CA 4ZKRU 1TAWA 1XXFA 3RMLH 3U69H 5JBBS 3M7UA 5FX5A 2O8LA 2PKSC 1O3BA 1E37B 1DXPA 3A7YA 2ZI2H 3VB7A 4A1XA 3TGIE 3A87A 1AGJA 2J9NA 4FVBA 1P8VC 4TYDA 3E16B 1O3GA 5PTPA 1GI6A 1LTOA 1HJAB 1DY8A 1C5PA 2JKHA 2PTNA 3M5OA 2G81E 2ZFQH 3GDUA 1Z8RA 1FY1A 2OBQA 4OS7A 5DG6A 2PKAB 1HPGA 2J4IA 2ZO3H 2ZU3A 2BXUH 5E0HA 1QRZA 3E0PB 3SV9A 4D9QA 3GCHC 2XYAA 1A0JA 4B2AA 3RXSA 5A09A 1BA8B 4X1QU 1KIGH 3AASA 2PLXA 7GCHG 1OSSA 1F0RA 1VCPA 2CF9H 4NA7A 1Y3WA 3OY6U 3RMOH 1O2MA 2SGAA 1KLIH 1LHEH 5K0HA 1AWFH 1TGNA 2ZEBA 3KQBA 2ZDLA 1G36A 3RXTA 1HBTH 4O03A 1FY5A 1DOJA 2ZZUH 3VB4A 3O8BA 3O8RA 1MMJN 2GT8A 1O3NA 2XBXA 1OP8A 5DP3A 2I6QA 4J2YB 2W3IA 1IQLA 1LKBA 4AYVB 1GGDC 1YF4A 1O3DA 1QIXB 1YCPH 2AMDA 1GJ6A 2ZECA 3UIRA 6LPRA 2P3UB 3A8DA 4JYUH 1TNGA 4GPGA 1C1RA 3HGNA 1FN8A 4CRDA 2A4OA 1CBWC 3P8OA 4D7GA 2QXHA 4UFGH 4OS1A 3RXHA 4UFDH 3D23A 4FUCA 1TRYA 3RXCA 5L30H 2V35A 2DE9A 3PTNA 2V0BA 1JRSA 4ISLA 3V0XA 1F0UA 1ZMJA 2CF8H 3SU1A 3SU6A 3FP6E 4NA8A 4JMYA 1TNHA 2PW8H 2FMJA 1B5GH 1HAIH 1S84A 1GJAB 4INHA 1TBQH 3A80A 3CP7A 2SGQE 3T28A 4ZKNU 1QBOA 2O9QA 2FOCA 2RCEA 1MKXK 1UTOA 4CREA 5ETXA 2RDLA 4JCNA 1SLVB 2ODPA 3RXLA 2BLQA 3QUMP 1G2LA 1ID5H 1EZSC 2Z9GA 2FXRA 4UDWH 3RUOA 1LHFH 5ESBA 3EA7A 2BM2A 4U32A 2ALVA 3ZZ8A 2BD7A 1GBJA 1SG8B 2JETB 3S7HB 1P06A 3E6PH 4I32A 1GJ5H 4Y76A 1C5XB 2WUBA 3UOUA 1YPEH 1FONA 1CGJE 3RLWH 1XMNB 1ABJH 2BD3A 5EXMA 3SV2H 2BD9A 1Z6JH 1LVYA 1CHOF 5GIBA 2WPLS 3EDXB 1MD8A 3RXDA 4ZHLU 4FVDA 1BUIA 3E90B 2XBVA 5EPNA 1PQAA 4FUDA 1C1PA 5FX6A 1MTUA 1GMHG 5A0BA 1C5ZB 3ZVFA 3P17H 4D9RA 1GG6B 3S9CA 1G37A 3V3MA 1UVPA 3BTME 1DE7H 4XDEA 3RXEA 4AGJA 3K6ZA 2FPZA 1AFQC 1O2LA 1ESTA 4WY3A 1UTLM 3ZVBA 1V2WT 3PTBA 2O8UA 4DT7B 2OTVA 1P2OA 3A83A 2F9UA 1GBEA 3V12A 2Y81A 4O9VA 1W13U 1ESAA 1DANH 1GJ7B 3HATH 1O0DH 2NU0E 1JWTA 3KL6A 5HMAA 1NRQH 1GHAG 4NA9H 4NFFA 5HXFA 3U8RH 1Y59T 2PFEA 4AZ2B 1FZZA 1LQDB 1AE5A 2B0FA 1J8AA 3SHAH 1V2JT 4RSPA 4LZ4B 5DP9A 2P3FH 1RRKA 1ZHRA 2ZC9H 5FPTA 2BXTH 1GBHA 1GI0A 4E06H 2GTBA 3FP7E 1L4DA 3LGWA 4AN7A 2Z9IA 1BTZA 1PPBH 2ODYB 2RG3A 1EOJA 1F92A 1SGDE 1O5FH 2XBWA 4AFSA 1RS0A 3DFJA 1EATA 2VGCB 1GHBG 2FWWA 1LHDH 3UR6A 1PPFE 4ZROA 3ZZBA 4A5TS 5F6MA 2GMTB 3D65E 1QJ7B 1H8DH 2TIOA 1MCTA 3PMBB 4ISNA 1SGFG 3FFGA 4GCHF 4MPWA 4XE4A 4E7NA 1DSTA 4DOQA 1TABE 2Q6GA 1O2OA 2FOEA 1KYNA 4MG3A 1HAYB 1TA6A 5BPEA 4UONA 4BAOB 1D3TB 2V6NA 1T4VH 3A7VA 2FM2A 3GCTG 5DP6A 1NROH 1FIWA 3HGPA 2R0LA 1C1TA 1HDTH 5EU8A 1HAPH 1T4UH 1EOLA 1VR1H 4AX9H 1SGPE 2ZNKH 4ESTE 3TK6A 4ZKOU 1IQNA 1YM0A 1XVOA 2ZCLP 4CH2B 3BTQE 2A2XH 1YGCH 3UFAA 6ESTA 3RXMA 2GZ7A 2Z6BD 1U6QA 1KXFA 3BIVH 3KF2A 1O2GH 2HOBA 4K69A 1L0ZA 1P2KA 2PV9B 2AH4X 3T27A 2BZ6H 1GI4A 3GDSA 4A7IB 1O2XA 3VGCC 1DUAA 4WWYA 1QQ4A 3SJIA 3ATKA 1GBCA 5EQRA 2FI4E 1IAUA 2XCFA 1ZJDA 2FP7B 1CGHA 3Q3XA 1C5WB 2A2QH 4YZUA 1KDQB 5BRRE 3PB1E 1GDNA 2AMPA 1A7SA 1ZLRA 1TGCA 5J4QA 2O8WA 4ABFA 3SJ8A 1BB0B 4IC5A 4NIYA 2XBYA 4BTTB 2Y5GA 3TJNA 1TPOA 3ELAH 3MI4A 1DWDH 2BVSH 3QTVH 3SNAA 4MLFB 1SGNE 1O3FA 3WY8A 3MU5A 4H6SB 4XFQA 1WSSH 1C2MA 1C5UA 4WMEA 3URCA 1TNIA 1PPGE 3OTJE 2UUJB 1BJUA 3PROA 1P9SA 2BOKA 1KXCA 1SLWB 3ATIA 2WYGA 3SU3A 1O5BB 5A8ZA 2OC7A 2PKSB