2O9QA

The crystal structure of bovine trypsin complexed with a small inhibition peptide orb2k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title From protease inhibitor to antibiotics: single point mutation makes tremendous functional shift
rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA02
1LVMA 1HYLA 1KYNA 2VIQA 3MNBA 3M35A 2UWOA 3HK6B 3DA9B 1K2I1 1D3PB 3P8GA 1KXFA 1PPCE 1SC8U 3W95A 2KAIB 4I8LA 3ZVGA 3S9AA 4GLYA 1TNKA 2FX6A 4BXWA 3I29A 1O2UA 1AKSB 4ZKSU 1TMBH 2A5KA 1SOTA 1AHTH 1CU1A 1WSSH 2DUCA 3ITIA 3RXIA 1J8AA 3BTDE 3HPTB 3SU6A 5DG6A 1RGQA 1AUTC 1CA8B 1DUAA 1O2NA 2OC0A 3EA8A 2BDAA 3IITA 1MBQA 2W7UA 1W0ZU 1GMDF 5DGJA 3URCA 2ANYA 4X6NA 2AEIH 3ZZ5A 4FUHA 1L4ZA 2JETB 3AAVA 2ZEBA 1NY22 4ZKNU 1G32B 3RXQA 3TK9A 2OTVA 2ZNKH 2ZGHA 2VNTA 2BD3A 2SGQE 3KQDA 1NU7B 1HJAC 5TCCA 1UK4A 1SLWB 1C5TA 2XC5A 4X1SU 1FDPA 2ZF0H 4X8TH 1DICA 4LZ1H 3SHCH 3UOPA 2PR3A 3SW2B 4LZ4B 5DP8A 1TNHA 1ETSH 1EX3A 3RXTA 2AGEX 2V6NA 1O2LA 3EAJA 2GZ8A 2ZDAH 3E6PH 2ZC9H 1DM4B 4MNVA 1OWIA 3MH7A 4X1NU 1AVXA 3GDUA 1UVUH 1W10U 3GCOA 2AMDA 4AORA 2EC9H 1RIWC 3OYPA 1AWHB 1O32A 4HGCA 3M3SA 3VB4A 1THSH 1FIZA 1TNJA 1CA0C 2P8OB 4B1TA 1F7ZA 1P9SA 1EPTB 3HGPA 4M7GA 1MKXK 2ZU1A 1QL7A 2ZDKA 3GY4A 3LPRA 1GDQA 1FJSA 1A3EH 1LVBA 3LJJA 1TPOA 6ESTA 2BOHB 4AB9A 1O2SA 4B75A 3RLYH 3NXPA 2HGTH 1SGRE 1W2KH 2FX4A 1J16A 2UUKB 2ZPSA 3MYWA 2CN0H 4DW2U 1ELDE 1SGDE 1ACBE 4BAOB 1RJXB 3Q77A 1TONA 3F68H 1K1PA 5EXLA 2GMTC 6CHAB 3SV2H 1RFNA 4JZEH 1K1JA 1ORFA 1P2NA 4BOHA 8GCHG 5FPYA 4INHA 1Y5AT 1WBGB 3HKJB 1QCPA 1O2JA 4GUXA 1DWDH 3SQEE 1V2MT 2J94A 1AB9B 3A8DA 3M37A 3E90B 1FONA 1N8OC 2PKSB 4NIWA 1FZZA 1YYY1 1AO5A 1DPOA 2AGGX 3U9AH 4CBOA 1C9PA 1JBUH 4IC6A 1CSOE 1LQDB 1DX5M 2Y82A 2ZGBH 3BTEE 2ODPA 4AYVB 1LHCH 1DITH 3U1IB 2H5CA 2J9NA 4Y0ZE 6LPRA 1IQIA 2YNAA 2QA9E 2ZHFH 1BHXF 2FODA 1D3QB 1MBMA 2P95A 1MAYA 1T7CA 1BRCE 5FXLA 2LPRA 1F2SE 1SLUB 1LPGB 1TABE 3EYDA 2G8TA 1F0TA 2PUQH 4JZ1A 1L1GA 1YPJH 2V35A 3A83A 1KLJH 3E3TA 3ZVCA 4UEHH 3MH6A 3KCGH 3PB1E 3F6UH 3UOUA 4NZQA 1PQAA 4FUGA 1P2MA 2ALPA 2H6MA 2Y5HA 1C9TA 3U98H 1GG6B 1V6DA 1TQ7B 3A7VA 2F9NA 2P93A 2OC7A 1FV9A 4IGDA 4NWLA 3AVZA 1C2FA 4MG3A 3QUMP 4CRGA 3S7KB 4ISNA 1C5MD 1BB0B 3RXHA 1GBCA 1G3EA 2PTNA 4D9QA 4ZHLU 1GHBG 1GHAG 2Q6FA 1N6XA 1ELEE 3O8BA 3KN2A 1P3CA 4JMYA 3Q3KA 1QJ1B 3BTWE 2W3KA 4GHTA 2ZFFH 1GCDA 1S83A 5E0HA 2ANMH 1MTNB 3A7ZA 1E37B 5EQQA 1DSTA 1G3CA 2ALVA 3GCTG 3TK5A 4DT7B 1Z8RA 1UTJA 1S5SA 3RU4E 4NG9H 5F8TA 1TPPA 1ELAA 1TX7A 3M7TA 2CXVA 1OOKB 1V2OT 2BD8A 4FXGH 1Z6JH 2FP7B 1YKTA 5DPAA 1IQMA 2BDIA 1Z8IB 4MNWA 3STJA 1SGPE 1KY9A 1GMCF 2P3TB 2OC8A 2TGPZ 1JWTA 1VCPA 3M5LA 2XW9A 1C5RA 1TNLA 2ODYB 4FU9A 5LPFA 3O8CA 1NC6A 1HAPH 1C5SA 3M5OA 1RTFB 3UPEA 2ZHDA 4ZXYH 2BLOA 1W8BH 3KQCA 1GBKA 4RSPA 1X7AC 5LPRA 2A5IA 2ZU2A 1A5IA 1ZMNA 1S6HA 4LXBH 3F1SB 4O3UA 1V2NT 3C27B 1BHXB 4BXSA 4BNRA 1N6YA 5EXNA 2ZG0H 1P2KA 4D76A 3RM2H 1C5VA 1HJAB 2FPZA 4ABEA 2QC2A 4X2WA 2HLCA 4FUDA 1DANH 1LQEA 4YESB 5C5OA 5E2OA 3RXSA 3SHAH 3LKWA 1UTPA 2BD2A 2SGAA 1MH0A 3H7TA 3B9FH 4X6OA 4NZLA 3VXFH 3RP2A 1BTXA 2PW8H 5JB8S 1QJ6B 1BTZA 1NESE 2AIPA 3GISB 4YO9A 2P3UB 2W26A 1SQTA 3SV8A 4OS4A 4AFUA 1GJ9B 1E38B 2GT8A 1RIWB 4I31A 2EEKA 2F9OA 1PPZA 5I25A 3P8FA 1ZZZA 2XBWA 1HRTH 1OWJA 1MTWA 2ZGCA 1CA0B 5A0AE 2R9PA 1P8VC 4ABJA 1Z1IA 1CHGA 1C5WB 4JZFH 1TMTH 1DOJA 3HKIB 1WU1A 4MTBA 4K8YA 3S7HB 1HIAB 3QZRA 5E8EH 1HNEE 3K65B 1GI6A 4UD9H 4ABGA 1AVGH 3P70B 3PMJA 4Y76A 1OKXA 4Y11E 4NGAH 4YLQH 2FLBH 1YLCA 2VGCB 1S6FA 2C4FH 5FPSA 2Z3EA 2NWNA 1GL1A 1EZQA 1QHRB 2GMTB 4DJZB 2TIOA 5J4SA 1YF4A 1W14U 3KIDU 2GZ9A 2UWLA 1GJ6A 2WV4A 3DT0H 1WAYB 1HV7A 1ZSLA 3BTME 1O3OA 3I77A 4Q80A 2A32A 1OWHA 3T5FH 2FM2A 1A1RA 1TNGA 1LMWB 4WMFA 4AYYB 3ODFA 3R3GB 4AGKA 1EATA 1GDNA 1O5BB 1SVPA 2JH0D 1N8OB 4BAHB 1TGTA 1QTFA 2OINA 2PWXA 1GI3A 3ZZ6A 2HOBA 1BQYA 3RXAA 4CREA 1MZAA 2FXRA 2VVCA 5F8ZA 2ASUB 1EB2A 1TB6H 2SGEE 1EASA 3RMLH 3WY8A 3SNCA 1SQOA 1QRWA 3NK8A 4NSVA 5DO4H 1RS0A 2XWBI 2VH6A 1GBFA 1Y3YA 2R3YA 1PYTD 2ZQ1A 1GJAB 3CS7A 2GP9B 3TK6A 1NFXA 2RDLA 2G5NA 4KELA 1GBHA 3NZIA 6GCHF 1XUJA 2TRMA 1V2WT 4TPIZ 3SNAA 1C1QA 4F49A 3NKKA 1A0JA 1FUJA 4YTAA 1AZ8A 1GBJA 1BT7A 1O2XA 1OX1A 3QLPH 2ZTZA 2VWNA 2FOMB 2O8LA 1EXFA 1GI5A 2ZHQH 1SBWA 1Z6EA 1K1LA 3LGIA 2ZI2H 2ZFPH 3PMBB 4YT6H 1O2GH 1KXAA 4ZROA 4JYUH 1IQFA 5ESBA 1D9IA 4IW4E 4OS7A 3RLWH 1ETRH 2PHBA 1BRUP 1GI4A 3L3TA 2BZAA 2STAE 1OYQA 1SLVB 5GCHF 1NS3A 1ID5H 4BTUB 1F5LA 1C2DA 1DLKB 3K2UA 2SFAA 1YBWA 4R0IA 1SR5C 4Q7XA 5DJ7A 1Y3XA 4CRFA 5C1UA 1F0SA 5E0GA 1TX6A 1OP2A 1O5DH 2D26C 1JIRA 3LH3A 1UCYH 2V0BA 5FX5A 2Z3DA 4X2VA 3ZV9A 1SI5H 2OBOA 1ZLRA 2D2DA 7GCHF 2BLVA 2CF8H 3MO9A 4CRDA 4UE7H 3F9HA 3S0NA 5LPEA 1GHXH 4U2WA 2W7SA 2R0LA 1ZPZA 3MU0A 2PKAA 5DP5A 4D7FA 1WUNH 2SNWA 2SGDE 2FZZA 2WPHS 3TJVA 1BBRH 1C4U2 1O2WA 2Z7FE 1NFUA 4FU8A 1GJ5H 4F4OC 3RXCA 3M36A 1LKAA 2HVXA 3E8LA 3RXUA 1BJVA 1CT4E 1C1SA 1NM6A 2BOKA 4FVBA 5L2YH 1KDQA 1DWBH 4H4FA 4FUEA 2XCFA 3SZNA 1WCZA 1Z8JB 1SFIA 1SFQB 1OXGA 1YPHC 1WYKA 2XBVA 3BTTE 2A4RA 1TA6A 2A5AA 4Z6AH 4CH2B 2F9PA 1A5HA 5FHTA 3GICB 2BLWA 4ZUHA 3RMOH 3ESTA 3LGTA 1B7XB 1M9UA 1HBTH 2ZFTA 4J2YB 4X8VH 5HGGA 4A6LA 4AG2A 3U8TH 4ABAA 1TOMH 2ZCLP 1F0UA 3PMAB 1W11U 3E91A 2NU2E 1ESBA 1PPFE 2SGFE 3VB5A 1S84A 2HNTC 2G00A 1NT1A 3G01A 3C1KA 1V2QT 4A7IB 3NPSA 3A86A 3M61U 4ISIH 4I8JA 2P16A 4DOQA 2FOBA 1C1OA 3V13A 3UR9A 3AW0A 3UREA 1O3LA 2BM2A 1BTHH 2FEQH 1UHBB 3V7TA 5J4QA 2HWLB 1AE8H 3RXFA 2QAAA 1TGSZ 2A45B 1TBQH 3A7TA 3BTGE 2XRCA 3T26A 4ISLA 3VB7A 4Y6DA 1MQ5A 3FP8E 3QX5H 3IG6B 1FXYA 1Q3XA 2ZWLH 4VGCC 3PROA 1EJMA 1GGDC 1GBAA 3LH1A 5EW1H 2BD9A 2P59A 2A2QH 2Z3CA 1OWEA 3MO6A 1UTMA 1ARBA 2OQ5A 2ESTE 3MU5A 3V3MA 1CGIE 3RXLA 1SGIB 1GHYH 2XYAA 2H9EH 3M3VA 1ZTKA 2D8WA 2PLXA 4B2CA 2K1QA 3ZZ4A 4B2AA 5GDSH 2GDEH 1UVTH 3A84A 3ATWA 1PJPA 2BD7A 2VU8E 1GBDA 5A2MH 3JZ2B 3PM3A 2BHGA 4KGAA 1FY4A 3PWBA 1ELVA 1TIOA 4XFQA 5AVDA 8GCHF 1QURH 1YCPM 2FOAA 1EB1H 2J4IA 4I8GA 1A2CH 4WH8A 4JK5A 1MKXH 1BMAA 5A8YA 2QF0A 3E16B 3GY3A 3QWCH 4DY7B 1C5ZB 2J92A 4J1YA 1ANEA 2VIDA 1LHEH 1QBVH 2AMQA 4A1XA 5HMAA 2WPIS 3T25A 3FZZA 1V2VT 4E7RG 2ZDLA 1GI0A 1BTPA 3CENA 3OY5U 1ZTLA 3UWIA 5B6OA 3SU1A 1O3KA 5JBBS 1ABJH 1Z71A 1C1TA 2NU0E 1MZDA 1AIXH 1EJNA 1GBEA 3FVFB 5G4BA 4X2YA 1EJAA 2OCVB 1W7XH 1VGCC 3BTFE 1BTWA 1H9HE 1JRSA 3T62A 1E36B 1QNJA 1YPKH 2HNTF 3K6ZA 2BXTH 1P9UA 5JBCS 1RTLA 3A8AA 1O5EH 2G55A 1CGJE 1FY1A 3OSYA 1V2UT 3ODDA 3DD2H 1O3NA 5ETXA 2EI6A 8KME2 1CQQA 2CJIA 4YZUA 4IN2A 3ATKA 5DK1A 4NSYA 1GI1A 1BOQA 3ZVBA 1MMJN 1O2HA 5C5NA 2CMYA 2CHAC 1FLEE 1U6QA 4SGAE 3ZZ3A 1MU6B 1A3BH 1MTVA 1CO7E 3L33A 1HJ9A 2D1JA 4AOQA 4K60A 4Q7ZA 1Q2WA 1VITG 3HK3B 1W0YH 1YGCH 2Z9KA 4Y8YA 1AGJA 2FOEA 1EOJA 1NPMA 1AU8A 3T28A 1IOEA 1LPZB 1GHAF 3DFJA 4IC5A 1HAIH 1UCYE 5EW2H 2BXUH 5DP3A 3JZ1B 5HM2A 2QF3A 3NCLA 3D62A 1VJAU 2AIQA 1H9IE 2ZU5A 4MPVA 3VB6A 1C2LA 1XUHA 4YOIA 1PYTC 1QQUA 2FOFA 3GCTF 5T3HA 1P09A 1O3JA 1SQAA 3MHWU 1FPCH 4OGYA 3QTVH 1O36A 2QY0B 1B0EA 1YCPK 1S82A 1DUEA 1EAUA 1SG8B 1BBRE 1O3PB 2VIPA 4ZXXH 1EAIA 1C4Y2 1SSXA 2FI3E 2FYQA 1DXPA 2ZTXA 3VB3A 1CBWC 1KTSB 1GHZA 1TOCB 1YPHE 5BRRE 1MUEB 2HALA 3H7OA 2O9QA 2ZPQA 3A8BA 1OPHB 1KSNA 3RUOA 1TRYA 1SPJA 3LONA 2GCTB 3NWUA 2ZKSA 4B76A 4Y10E 1NRSH 4Z0KA 4THNH 3UWJH 1BMMH 1HJ8A 1SL3A 1TGNA 4B74A 4X6MA 1YM0A 1A46H 3PO1C 1ELTA 5EXMA 3M7QA 3F9FA 1QJ7B 1NU9A 1Y8TA 1ZMLA 4WF8A 3SJ9A 2ZU3A 4ISOA 4CR9A 1JXPA 1KXCA 1BIOA 2HNTE 1C5YB 1AN1E 2ZZUH 1XVMA 5H4IB 4KTCA 1O5GH 3MNXA 1HAHH 1L1NA 4NWKA 2ZFQH 4XBBA 1AWFH 1K1IA 1XKBC 1BUIA 1ZSKA 1C1PA 2SGPE 3K9XB 3T29A 4DGJA 3AAUA 1ZSJA 3ZZ9A 1YLDA 1LO6A 3RXKA 3Q3YA 3GCNA 2G4UA 2Y5FA 3RC5A 2XTTB 3NUMA 3PLKA 1DXWA 4X8SH 5F6MA 1OYTH 1UTNA 5EQRA 3SV9A 1IAUA 4HZHA 2C90B 5JYIA 3FANA 3M7UA 4BTTB 3VEQB 3BG4C 4CRCA 1UMAH 1AFQC 3BSQA 4KTUA 4AGJA 2OLGA 1LVYA 3GDVA 3BG8A 4MNXA 3SO3A 2VWLA 2ZDNA 4YLUA 1XUGA 5AFZH 3EGKH 3PWCA 3QK1A 1C2JA 4BANB 2IPHA 1FY8E 1V2RT 2W5EA 4YOGA 5GIBA 1QBNA 1JOUB 4NA7A 2EI7A 4ZHAA 1NRNH 4Y7BA 2OBQA 4KTSA 3SJKA 2ZCHP 2QIQA 3LU9B 3MH5A 1UTOA 3MH4A 1PPGE 2BDHA 3TGJE 1TE0A 1O2RA 3UNQA 1NFYA 3A81A 1ZYOA 1V2KT 1EP6A 1XMNB 2VINA 5TCAA 1QIXB 4TYDA 1P02A 2IN2A 2VJ1A 3QTOH 4FUBA 4MNYA 3RU4D 1W12U 1C5PA 4D8NA 3MMGA 2G51A 2FS8A 3CS0A 1AMHA 4FUJA 1C2EA 2ZDMA 1HUTH 1IQLA 2C3SA 3D49H 4WWYA 1D6WA 1B5GH 1EAWA 2ZDVH 1HAYB 4Q2KA 3BEIB 1S85A 2F9VA 1FPHH 5HYOA 1TX8A 1ZHRA 2H9TH 2ANWA 2NU1E 2WPKS 3B8JA 4NFEA 1O30A 5CHAC 1MTUA 1RD3B 4TWWA 3RC6A 2ZHEH 3S69A 4XOJA 3W94A 1P0SH 3VPKA 2FS9A 1C2IA 1DY8A 1TMUH 3SJIA 1VR1H 2FOHA 1UO6A 2Y5GA 3GDSA 4JZDH 5C67A 2WYGA 1PPEE 1HAVA 3TVJB 5LH8A 1CT0E 3GCHC 1O2ZA 2XC0A 1XXDA 1C1UH 3DFLA 1EKBB 1BZXE 2F9BH 2WUBA 5AHGH 2A1DB 1VGCB 2OP9A 4WMEA 1A4WH 4UFGH 4K3JA 5FCKA 1GI9B 1FAXA 1OP0A 3GYLB 1ESAA 4HTCH 1K28D 2A4OA 3BTQE 3SORA 1T8MA 4UFDH 3RMNH 1W3CA 1GBMA 1ZHPA 5GWZA 1C5NH 1LHFH 2BDYA 1BJUA 2O8TA 1ZGVA 2HPPH 1GMCG 3BEFB 4DCDA 3A7WA 1AUJA 2CHAB 1GJ8B 2FI4E 1GJ7B 2XC4A 1THPB 3UR6A 1YPLH 3QGJA 4A5TS 3LIWA 1H1BA 1VJ9U 1T8NA 4MPWA 1SHYA 3LGWA 2CGAA 4OS1A 2AMPA 1J14A 4ABHA 1LHDH 2WINI 1XVOA 2ZGXH 2C8ZB 4K1TA 4XBCA 1L1JA 1O5FH 3V12A 4OS2A 2Z94A 1AI8H 4GCHG 1KXDA 1GJDB 1H8IH 5JDUB 1PPBH 1EOLA 1LTOA 1T31A 1Z1JA 1LHGH 1QB9A 1OS8A 2BY9X 4LK4A 4OS6A 4K5ZA 1SB1H 1W13U 2GV7A 3BEUA 1QRXA 4UONA 1P04A 4NCYA 3RXVA 3H5CB 3EE0B 2B7DH 3U1JB 4MPUA 1GBBA 2XBXA 1GVLA 2P3FH 3FP6E 1OWDA 2FYRA 2VVVA 3PTNA 3OTJE 3ZZ7A 2ZA5A 4DG4A 1UTLM 3IWMA 3KEEA 2B5TB 1DFPA 1UVPA 1HAXB 3A87A 1GHVH 4K2YA 1AKSA 2AGIX 3P92A 1O35A 1C2HA 1Z7KA 1AFEH 2QN5T 4Y8ZA 3PYHA 4X8UH 3SGQE 4A92A 2AFQB 2GGVB 4OGXA 3RXEA 1AVWA 2WPMS 1GVZA 1OP8A 2DE9A 1Y5UT 5JBAS 3PO1B 1GVKB 1VCQA 3HGNA 2O8UA 1XUKA 4H42U 1GMHG 3UQOA 2TGTA 2EI8A 5F03A 4ZKRU 5TJXA 3V0XA 1QL8A 3E1XB 4Q7YA 1SHHB 1C1VH 4XSKU 4UFEH 1LPKB 2Y81A 3LGVA 3SU0A 4JYTA 2Z9LA 1SGEE 2J38A 1EP5A 2HRVA 2VVUA 3ZVEA 1C4V2 2BX3A 3OU0A 3S9CA 1QRZA 2FWWA 2PUXB 1CE5A 1TYNA 1G3BA 1GI7B 1KXBA 2FOGA 1WQSA 1QA0A 3TJNA 1YPMH 3KNXA 3OY6U 4DURA 1EUFA 5SGAE 2BDGA 2Z6BD 3SGBE 1TFXA 1AFQB 2ZO3H 9ESTA 2ZU4A 3ENSB 2BQ7B 1QR3E 1HCGA 3VGCC 3PLPA 2PSYA 3A88A 3KGPA 4DIIH 2V3HH 2PGBB 1V3XA 3O8RA 1HB0B 3DUXH 2GX4A 1SGQE 3TH3H 3ZZBA 1YC0A 1TGCA 1EPTA 1VITH 4KP0A 3VXEH 3SV7A 3BTHE 1KLIH 5PTPA 2ZP0H 5LGOA 1EZXC 1BMNH 3BIVH 3ZZAA 2AS9A 1KIGH 2ZPRA 2PTCE 4Y8XA 2BZ6H 1HAZB 4X0WU 4D7GA 4MQAA 1YP9A 2Q6DA 1MTSA 1TBRH 3P6ZB 2WPJS 2R2WU 3P95A 4MLFB 1DWEH 4IN1A 1GI2A 1SMFE 1Y3VA 1CHOG 4NIYA 2GCHG 1HAOH 4TWYA 2C93B 5T6GA 5A0BA 4ESTE 1O33A 4R8TB 2H2ZA 3BIUH 2A7JA 4NIVA 4WXIA 1A0HB 1G36A 3U8RH 1NZQH 2H5DA 1GBLA 5DP6A 1W7GH 2PSXA 3A89A 5EU8A 4IMQA 1VZQH 5CHAB 1ZMJA 1FN6A 2H1UA 2BQWB 5A8XA 2W3IA 1KTTB 1FY3A 1T8OA 4X1RU 4ZKOU 2EA3A 1JIMA 2PFEA 2BYAX 3GCHB 3RXRA 1O3BA 3DHKH 4O9VA 1HGTH 3TGIE 3RXGA 1B0FA 4WXVA 2FMJA 3M5NA 3UNRA 2QYIA 3MTYA 1PQ8A 1E35B 3BN9A 3OX7U 4I33A 3HATH 1S0QA 2GTBA 3A7YA 3O8DA 2F9UA 4QT8C 1MTNC 1NO9H 1TALA 1WTGH 2ANKH 3ATIA 1QBOA 3SUEA 4ABIA 2YNBA 2O8WA 1MKWK 2G81E 4ASHA 1BA8B 3EQ0H 1AD8H 4TY6A 2QXIA 4UDWH 4BAKB 2QXGA 1HLTH 1TWXB 3P17H 3BTKE 1IQEA 1UVSH 2GKVE 5EPNA 1G30B 1TRMA 1Y59T 1ARCA 1P12E 2FDAA 1HXFH 2WV5A 3A8CA 3LOXA 1XUFA 3P8OA 3LC3A 3A82A 3RC4A 1FMGA 4RN6A 1NRPH 2ILNA 5A09A 1SOZA 1O2QA 3LT3A 1TNIA 3GY8A 5C3NA 3ATLA 5T6DA 4U01A 1LCYA 2A31A 1BCUH 2UUJB 2A0QB 3TITA 3ZZDA 4A1TA 1TQ0B 2Y6TA 3GY5A 4FUCA 2I6QA 5DP7A 1VITF 4MDSA 1TLDA 3SN8A 2BY6X 1IQKA 2Q1JA 4AZ2B 3SU5A 2FESH 2BY8X 2LNCA 1LKBA 1BITA 3SNBA 1SGNE 3UTUH 1ZR0A 1MQ6A 5DKMA 1KLTA 5GPIB 1XM1A 3STIA 5JBTA 1Y3WA 4NIXA 3RMMH 3ZVDA 2Y80A 4H6TA 3SNDA 1UTKA 3E0PB 4CHAC 5BPEA 2ZECA 1GWAA 3SUDA 1O38A 1G9IE 4B73A 1MAXA 4WVPE 1HXEH 5A8ZA 1ZRBA 2HPQH 1H8DH 2PKAB 5FAHA 4K1SA 2BVSH 3S9BA 1IHTH 3MNCA 4AG1A 1F5KU 3A7XA 2AH4X 3SU3A 4DVAU 1FY5A 1K21H 4FU7A 4CRAA 5IDKA 3SGAE 3TH4H 1E34B 1DY9A 1O2TA 1HFDA 1ANCA 3E0NB 1SGFG 4JZIA 3T27A 2ZFSA 1ZJKA 1CVWH 1KDQB 3PLBA 4GSOA 1O3DA 1GMDG 1O3FA 1YCPH 1FIWA 1K22H 2VGCC 3SNEA 4X1QU 3ZYEA 2CF9H 5EODA 1A61H 1RTKA 2P94A 1O5AB 5E2PA 7ESTE 4K69A 3UY9A 3LGUA 4ZH8A 1GHBF 4CR5A 5ESTE 2G52A 2UUFB 4XDEA 1P05A 2UWPA 1P2IA 2BDCA 3TNTA 1O2KA 2TPIZ 5EQSA 5EG4A 3VGCB 3N7OA 3K6YA 3QGNB 1P01A 2BX4A 1V2TT 1V2PT 1C5LH 4AN7A 1XUIA 4ISHH 1G3DA 3KQBA 2IOTA 1OSSA 1F5RA 1WV7H 3ELAH 3Q00A 1J17T 1V2JT 4U30A 1HIAA 1RXPA 2QCYA 1OWKA 1TGBA 2ZIQH 5I46H 3D65E 2VWMA 3U69H 5DP9A 1A0LA 3GY2A 2GT7A 4ZAEA 1PFXC 1NRRH 3MO3A 3UUZA 1ZPCA 1Q31A 3FZDA 1FNIA 4Y71A 2F3CE 1F92A 1ZPBA 1WQVH 2VIVA 1BMLA 3MFJA 1O3CA 3R0FA 3TPIZ 4ABFA 1ELGA 1P2JA 1D4PB 3SI4H 3MNSA 1GCTC 1MD7A 1IHSH 2CV3A 4X1PU 3F9EA 1O31A 3PMHB 4MVNA 2VIOA 1QL9A 1S81A 2ZHWH 4IBLH 1FI8A 4ABDA 1ESTA 1G2LA 4I8KA 2FI5E 3QDZB 4NFFA 2B8OH 3RXDA 4IMZA 1TAWA 1BRAA 2R2MB 1ELFA 1SGCA 1UK3A 2QGRA 2GDDA 3P8NA 1QB1A 4AFSA 5FBEA 1THRH 4GAWA 1MD8A 4XE4A 1ABIH 1ELBA 2Z9GA 3FP7E 4HI3A 4PROA 2RA0A 4XBDA 4AFZA 2C8WB 1YPGH 1O2PA 5T6FA 1HDTH 1QB6A 1ZRKA 2JH5D 1MU8B 5CE1A 5F8XA 2Y7ZA 4YT7H 1DSUA 2G5VA 4VGCB 1TPSA 2R0KA 1YPEH 1GGDB 1PPHE 2WPLS 5CMXH 3EA9A 3B23B 1TRNA 1SGTA 2GV6A 4FUIA 1C5UA 1O3MA 1IQNA 2FOCA 3LJOA 2OQUA 2VWOA 3ZYDA 3KQEA 5EPYA 4CH8B 2B0FA 3ZZCA 1GI8B 3SQHE 1EAXA 4TPYA 3RXMA 1NTPA 1AZZA 1LDTT 2QXJA 3PTBA 3TIUA 4CBNA 1K1NA 2VH0A 2AERH 1CGHA 4AB8A 5C20A 2XBYA 1O2OA 1BDAA 4U32A 3ATMA 2RA3A 2C8YB 1G2MA 1NRQH 2XCNA 3U8OH 2IJOB 1TBZH 2BD4A 2BY5X 3GY6A 1K1MA 1O3IA 1E0FD 1O5CB 3QZQA 2FLRH 3MU8A 4WJG2 5L6NH 3TU7H 2OD3B 3VFEA 1JRTA 1TPAE 1V2ST 2PV9B 4INLA 4ABBA 4B71A 4E7NA 5HM9A 3GYMA 1HPGA 1GPZA 3I78A 1XX9A 3FAOA 3RXOA 1P2OA 1D3DB 8ESTE 5L2ZH 4GCHF 3TJOA 4NA8A 4YOJA 3KF2A 1Y5BT 1GBIA 1DVAH 3M3TA 1T8LA 1H4WA 2GD4B 2QXHA 4CHAB 5EGMA 4LOYH 3A85A 3SUFA 2THFB 2XXLA 2OC1A 1GHWH 2WUCA 4OS5A 4Y79A 1Z8GA 4X6PA 1J9CH 1PQ5A 5C1YA 1O3EA 2QV1A 1C1WH 1XKAC 3ZVAA 1IQHA 1PQ7A 1UTQA 3D23A 2XWAA 1O3HA 3BV9B 3TGKE 1O2VA 1QY6A 1DDJA 1O39A 2BD5A 1INCA 4MPXA 1WOFA 1BTUA 1C5OH 1O2YA 5A0CA 1O2MA 3FFGA 5C2ZA 5L30H 4YM9A 2XNIA 4K8BA 1QQ4A 4JK6A 2F83A 2R3UA 1UK2A 4CRBA 1ELCA 1DWCH 1RRKA 4A1VA 1T4UH 1GMHF 4I8HA 3LC5A 2ODQA 4INKA 1P10A 4DIHH 1XXFA 1O3AA 4TY7A 1K1OA 5C1XA 4GPGA 1K9OE 1FAKH 3MWIU 1O37A 4UFFH 2BVRH 3QN7A 2A7HA 4AFQA 3Q3XA 3SOSA 3MI4A 1A5GH 3UNSA 2TGDA 1J15A 2BTCE 3L6PA 2JETC 4O3TA 2ULLA 5GJ4B 1BRBE 1Y3UA 3Q76A 4RKJB 2SNVA 1AY6H 1GJCB 5FX6A 1UHBA 3T2NA 5DP4A 3M5MA 3ZVFA 2ZQ2A 4E05H 1DLEA 4AX9H 5E0JA 2KAIA 2A4GA 2ZCKP 2AYWA 4ZMAH 1CBWB 3RXBA 1L4DA 1WTHD 2A4QA 3F9GA 3LDXH 1MCVA 1DE7H 1EZSC 4O03A 7KMEH 1T4VH 2VB0A 2BVXH 2B9LA 1L2EA 1H9LB 1C1NA 3ZV8A 3SU2A 4B2BA 5AF9H 1KXEA 5FPTA 3TH2H 2F91A 1O2IA 4X2XA 3GY7A 1MCTA 1GCTB 1FN8A 1ZGIA 2RCEA 1G37A 1C5XB 2M5TA 4WH6A 3TNSA 2P8OC 1EPTC 2FTLE 4JCNA 1ZHMA 5K7RA 1NN6A 7LPRA 2V3OH 3KL6A 5HXFA 3A80A 2Z9IA 9LPRA 1QFKH 1ETTH 3UQVA 4GVUA 3PV4A 2OUAA 1HAGE 3MU1A 2I6SA 1CHOF 2Q6GA 4D9RA 2GCHF 3TLOA 1CT2E 4WMDA 4E06H 2G4TA 4O97A 1DS2E 4WY3A 3LGYA 2BQ6B 6CHAC 2VIWA 2BLQA 2J2UA 1C5QA 1D6RA 2A2XH 2O8MA 1P06A 1UJ1A 4GHQA 1GBTA 2BDBA 2FTMA 2PGQB 5ABWA 3AW1A 3SU4A 2GVFA 3BG4B 4RKOB 2ZGJA 1C2MA 3TJUA 1LVOA 1SLXB 2BMGB 1D3TB 1TA2A 2NU4E 1BTYA 1EZUC 3UIRA 3SJ8A 1FQ3A 3CP7A 1AB9C 1C2GA 2Y7XA 4KKDA 3EA7A 1QGFA 1S0RA 3MU4A 2PKSC 3RU4T 1JMOH 2NU3E 1NFWA 2WYJA 2JKHA 1P3EA 2FO9A 3SV6A 1GJBB 4ZHMU 1GJ4H 1IQGA 5GXPA 1L0ZA 3URDA 2J34A 1HAVB 4I7YH 3UFAA 2UUYA 3EDXB 1V2LT 2FIRH 2OXSA 1ZTJA 3RDZA 3MOCA 1GDUA 3BF6H 3RM0H 6GCHG 4BAMB 1P11E 1ZOMA 2ZTYA 5FBIA 1QA7A 4JYVH 4BTIB 3SI3H 4NA9H 5K0HA 3QO6A 5EOKA 4HFPB 2J95A 1DT2A 1UCYK 1GL0E 1ANBA 1O3GA 1O0DH 2C8XB 4K1EA 3RXJA 1UVOA 4H6SB 3GOVB 1P57B 2BB4A 2TGAA 1AE5A 4I32A 2GCTC 5AFYH 3SUGA 2JH6D 1IQJA 2GZ7A 1F0RA 4Y0YE 4IS5A 2A7CA 4Y7AA 5GCHG 3SJOA 2H9HA 1ANDA 1O34A 1AQ7A 1A7SA 1BBRK 1GG6C 1MKWH 4FUFA 1SGFA 5JB9S 5FCRA 3AASA 4BAQB 2RG3A 2ZFRH 1VCWA 8LPRA 3RXPA 4SGBE 1C1RA 2BY7X 2DE8A 3ZZ8A 2TBSA 7GCHG 2Z9JA 3SBKA 5IYTA 1P2QA 2STBE 1N1LA 1C2KA 1ZJDA 2YOLA 3KHVA 5JPMH 1C1MA 1T32A 1SGYE 1EQ9A 4FVDA 1P03A 1NROH
chains in the Genus database with same CATH superfamily
1LVMA 1HYLA 1KYNA 2VIQA 3MNBA 3M35A 2UWOA 3HK6B 3DA9B 1K2I1 1D3PB 3P8GA 2KR7A 3MQKC 1KXFA 1PPCE 1SC8U 3W95A 2KAIB 4I8LA 3ZVGA 3S9AA 4GLYA 1TNKA 2FX6A 4F48B 4BXWA 3I29A 1O2UA 1AKSB 4ZKSU 1TMBH 2A5KA 1SOTA 1AHTH 1CU1A 1WSSH 2DUCA 3ITIA 2LELA 3RXIA 1J8AA 3BTDE 3HPTB 3SU6A 1KMHB 5DG6A 1RGQA 1AUTC 1CA8B 1DUAA 1O2NA 4P00A 2OC0A 3EA8A 2BDAA 3IITA 1MBQA 2W7UA 1W0ZU 1GMDF 5DGJA 2VBCA 2KCAA 3URCA 2ANYA 4X6NA 2AEIH 3ZZ5A 4FUHA 1L4ZA 2JETB 3AAVA 2ZEBA 1NY22 4ZKNU 1G32B 3RXQA 3TK9A 2OTVA 2ZNKH 2ZGHA 2VNTA 2BD3A 2SGQE 3KQDA 1NU7B 1HJAC 5TCCA 1UK4A 1SLWB 1C5TA 2XC5A 4X1SU 1FDPA 2ZF0H 2IJD1 1YLNA 1DICA 4X8TH 4LZ1H 3SHCH 3UOPA 2PR3A 3SW2B 4LZ4B 5DP8A 1TNHA 1ETSH 1EX3A 3RXTA 2AGEX 2V6NA 1O2LA 3EAJA 2GZ8A 2ZDAH 3E6PH 2ZC9H 1DM4B 4MNVA 1OWIA 3MH7A 4X1NU 1AVXA 3GDUA 1UVUH 1W10U 3GCOA 2AMDA 4AORA 2F4LA 2EC9H 1RIWC 3OYPA 1AWHB 1O32A 4HGCA 3M3SA 3VB4A 1THSH 1FIZA 1TNJA 1CA0C 2P8OB 4B1TA 1F7ZA 1P9SA 1EPTB 3F0OA 3HGPA 1MKXK 4M7GA 2ZU1A 1QL7A 2ZDKA 3GY4A 3LPRA 1GDQA 1FJSA 1A3EH 1LVBA 3LJJA 1TPOA 6ESTA 2BOHB 4AB9A 1O2SA 4B75A 3RLYH 3NXPA 4XRNA 2HGTH 1SGRE 1W2KH 2FX4A 1J16A 2UUKB 2ZPSA 3MYWA 2CN0H 4DW2U 1ELDE 1SGDE 1ACBE 4BAOB 1RJXB 3Q77A 1TONA 3F68H 1K1PA 5EXLA 2GMTC 6CHAB 3SV2H 1RFNA 4JZEH 1K1JA 1ORFA 2GJGA 1P2NA 4BOHA 8GCHG 5FPYA 4INHA 1Y5AT 4M9FA 1WBGB 3HKJB 1QCPA 1O2JA 4GUXA 1DWDH 3SQEE 1V2MT 2J94A 1AB9B 3SZEA 2WSSD 3A8DA 3M37A 3E90B 1FONA 1N8OC 2PKSB 3KYFA 4NIWA 1FZZA 1YYY1 1AO5A 1DPOA 2AGGX 3U9AH 4CBOA 1C9PA 1JBUH 4IC6A 1CSOE 1LQDB 1DX5M 2Y82A 2ZGBH 3BTEE 2ODPA 4AYVB 1LHCH 1DITH 3U1IB 2H5CA 3PV2A 2J9NA 4Y0ZE 6LPRA 1IQIA 2YNAA 3DCLA 2QA9E 2ZHFH 1BHXF 2FODA 1D3QB 1MBMA 2P95A 1MAYA 1T7CA 1BRCE 5FXLA 2LPRA 1F2SE 1SLUB 1LPGB 1TABE 3EYDA 2G8TA 1F0TA 2QF5A 2PUQH 4JZ1A 1L1GA 1YPJH 2V35A 3A83A 1KLJH 3E3TA 3ZVCA 4UEHH 3MH6A 3KCGH 3PB1E 1NBMD 3F6UH 3UOUA 4NZQA 1PQAA 4FUGA 1P2MA 2ALPA 2H6MA 2Y5HA 1C9TA 3U98H 1GG6B 1V6DA 1TQ7B 3A7VA 2F9NA 2P93A 2OC7A 1FV9A 4IGDA 4NWLA 3AVZA 1C2FA 4MG3A 3QUMP 4CRGA 3S7KB 4ISNA 1C5MD 1BB0B 3RXHA 1GBCA 1G3EA 2PTNA 4D9QA 4ZHLU 1GHBG 1GHAG 2Q6FA 1N6XA 1ELEE 3O8BA 3KN2A 1P3CA 4JMYA 4RT1A 3Q3KA 1QJ1B 3BTWE 5F53A 2W3KA 4GHTA 2ZFFH 1GCDA 1S83A 5E0HA 2ANMH 1MTNB 3A7ZA 1E37B 4B6EA 5EQQA 1DSTA 1G3CA 2ALVA 3GCTG 3TK5A 4DT7B 1Z8RA 1UTJA 1S5SA 3RU4E 4NG9H 5F8TA 1TPPA 1ELAA 2EQNA 1TX7A 3M7TA 2CXVA 1OOKB 1V2OT 2BD8A 4FXGH 1Z6JH 2FP7B 1YKTA 5DPAA 1IQMA 2BDIA 1Z8IB 4MNWA 3STJA 1SGPE 1KY9A 1GMCF 2P3TB 2OC8A 2TGPZ 1JWTA 1VCPA 3M5LA 2XW9A 1C5RA 1TNLA 2ODYB 4FU9A 5LPFA 3O8CA 1NC6A 1HAPH 3KQ5A 1C5SA 3M5OA 1RTFB 3UPEA 2ZHDA 4ZXYH 2BLOA 1W8BH 3KQCA 1GBKA 4RSPA 1X7AC 5LPRA 2A5IA 3OTPA 2ZU2A 1A5IA 1ZMNA 2KM0A 1S6HA 4LXBH 3F1SB 4O3UA 1V2NT 3C27B 1BHXB 4BXSA 4BNRA 1N6YA 5EXNA 2ZG0H 1P2KA 4D76A 3RM2H 1C5VA 1HJAB 2FPZA 4ABEA 2QC2A 4X2WA 2HLCA 4FUDA 1DANH 1LQEA 4YESB 5C5OA 5E2OA 3RXSA 3SHAH 3LKWA 1UTPA 2BD2A 2SGAA 2F43B 1MH0A 3H7TA 3B9FH 4X6OA 5CHBA 4NZLA 3UAIC 3VXFH 3RP2A 3F0PA 1BTXA 4TT3D 2PW8H 5JB8S 1QJ6B 1BTZA 1NESE 2AIPA 3GISB 4YO9A 2P3UB 2W26A 1SQTA 3SV8A 4OS4A 4AFUA 1GJ9B 1E38B 2GT8A 4ACAA 1RIWB 4I31A 2EEKA 2F9OA 1PPZA 5I25A 3P8FA 1ZZZA 2XBWA 1HRTH 1OWJA 1MTWA 2EY4C 2ZGCA 1CA0B 5A0AE 2R9PA 1P8VC 4ABJA 1Z1IA 1CHGA 1C5WB 4JZFH 1TMTH 1DOJA 3HKIB 1WU1A 4MTBA 4K8YA 3S7HB 1HIAB 3QZRA 5E8EH 1HNEE 3K65B 2WHXA 1GI6A 4UD9H 4ABGA 1AVGH 3P70B 3PMJA 4Y76A 1OKXA 4Y11E 4NGAH 4YLQH 2FLBH 1YLCA 2VGCB 1S6FA 2C4FH 3PV5A 5FPSA 2Z3EA 4Q4LA 3F3BA 2NWNA 1GL1A 1EZQA 1QHRB 2GMTB 4DJZB 2TIOA 5J4SA 1YF4A 1W14U 3KIDU 2GZ9A 2UWLA 1GJ6A 2WV4A 3DT0H 1WAYB 1HV7A 1ZSLA 3BTME 2KX4A 1O3OA 3I77A 4Q80A 2A32A 1OWHA 5C0UA 3T5FH 2FM2A 1A1RA 1TNGA 5EJZA 1LMWB 4WMFA 2L74A 4AYYB 3ODFA 3R3GB 4AGKA 1EATA 1GDNA 1O5BB 1SVPA 2JH0D 1N8OB 4BAHB 4FOUC 1TGTA 3N7EA 1QTFA 2OINA 2PWXA 1GI3A 3ZZ6A 2HOBA 1BQYA 3RXAA 4CREA 1MZAA 2FXRA 2VVCA 5F8ZA 2ASUB 1EB2A 1TB6H 2SGEE 1EASA 3RMLH 3WY8A 3SNCA 1SQOA 1QRWA 3NK8A 4NSVA 5DO4H 1RS0A 2XWBI 2VH6A 1GBFA 3OE7D 1Y3YA 3UB0A 2R3YA 1PYTD 2ZQ1A 1GJAB 3CS7A 2GP9B 3TK6A 1NFXA 2RDLA 2G5NA 4KELA 1GBHA 3NZIA 6GCHF 1XUJA 2TRMA 1V2WT 4TPIZ 3SNAA 1C1QA 4F49A 3NKKA 1A0JA 1FUJA 4YTAA 1AZ8A 1GBJA 1BT7A 1O2XA 1OX1A 3QLPH 2ZTZA 2VWNA 2FOMB 2O8LA 1EXFA 1GI5A 2ZHQH 1SBWA 1Z6EA 1K1LA 3LGIA 2ZI2H 2ZFPH 3PMBB 4YT6H 5DSFA 1O2GH 1KXAA 4ZROA 4RT0A 4JYUH 1IQFA 5ESBA 1D9IA 4IW4E 4OS7A 3RLWH 1ETRH 2PHBA 1BRUP 1GI4A 3L3TA 2BZAA 2STAE 1OYQA 1SLVB 5GCHF 1NS3A 3F2HA 1ID5H 4BTUB 1F5LA 1C2DA 1DLKB 3K2UA 2SFAA 1YBWA 4R0IA 1SR5C 5IK2D 4Q7XA 5DJ7A 1Y3XA 4CRFA 5C1UA 1F0SA 5E0GA 1TX6A 1OP2A 1O5DH 2D26C 1JIRA 3LH3A 1UCYH 2V0BA 5FX5A 1H8HD 2Z3DA 4X2VA 3ZV9A 1SI5H 2OBOA 1ZLRA 2D2DA 7GCHF 3F2FA 2W6JD 2BLVA 2CF8H 3MO9A 4CRDA 4UE7H 3F9HA 3S0NA 5LPEA 1GHXH 4U2WA 2W7SA 2R0LA 1ZPZA 3MU0A 2PKAA 5DP5A 4D7FA 1WUNH 2SNWA 2SGDE 2FZZA 2WPHS 3TJVA 2YMSD 1BBRH 1C4U2 1O2WA 2Z7FE 1NFUA 4FU8A 1GJ5H 4F4OC 3RXCA 3M36A 1LKAA 2HVXA 3E8LA 1YY3A 3RXUA 1BJVA 1CT4E 1C1SA 1NM6A 2BOKA 4FVBA 5L2YH 1KDQA 1DWBH 4H4FA 4FUEA 2XCFA 3SZNA 1WCZA 1E1QD 1Z8JB 1SFIA 2M2AA 1SFQB 1OXGA 1YPHC 1WYKA 2XBVA 3BTTE 2A4RA 1TA6A 2A5AA 4Z6AH 4CH2B 2F9PA 1A5HA 5FHTA 3GICB 2BLWA 4ZUHA 4ZCNA 3RMOH 3ESTA 3LGTA 1B7XB 1M9UA 1HBTH 2ZFTA 2JDID 2AHME 4J2YB 1K0HA 4X8VH 5HGGA 3WW7A 4A6LA 3U8TH 4ABAA 4AG2A 1E79D 1TOMH 2ZCLP 1F0UA 3PMAB 1W11U 3E91A 2NU2E 1ESBA 1PPFE 1SQRA 2SGFE 3VB5A 1S84A 2HNTC 2G00A 1NT1A 3G01A 3C1KA 1V2QT 4A7IB 2L6OA 3NPSA 3A86A 3M61U 4ISIH 4I8JA 5B6LA 2P16A 4DOQA 2FOBA 1C1OA 3V13A 3UR9A 3AW0A 3UREA 1O3LA 2BM2A 1BTHH 2FEQH 1UHBB 3V7TA 5J4QA 2HWLB 1AE8H 3RXFA 2QAAA 1TGSZ 2A45B 1TBQH 3A7TA 3BTGE 2XRCA 3T26A 4ISLA 3VB7A 4Y6DA 1MQ5A 3FP8E 3QX5H 3IG6B 1FXYA 2K0QA 1Q3XA 2ZWLH 4VGCC 2J98B 3PROA 1EJMA 1GGDC 1GBAA 3LH1A 5EW1H 2BD9A 2P59A 2A2QH 2Z3CA 1OWEA 3MO6A 1UTMA 3VG8A 1ARBA 2OQ5A 2ESTE 3MU5A 3V3MA 4DT4A 1CGIE 3RXLA 1SGIB 1GHYH 2XYAA 2H9EH 2WZQA 3M3VA 1ZTKA 2D8WA 2PLXA 4B2CA 2K1QA 3ZZ4A 4B2AA 5GDSH 2GDEH 1UVTH 3A84A 3ATWA 1PJPA 1COWD 2BD7A 1GBDA 2VU8E 5A2MH 3JZ2B 3PM3A 5CDFE 2BHGA 4KGAA 1FY4A 3PWBA 3OAAD 1BMFD 1ELVA 1TIOA 4XFQA 5AVDA 8GCHF 1QURH 1YCPM 2FOAA 1EB1H 2J4IA 4I8GA 1A2CH 4WH8A 4JK5A 1MKXH 1BMAA 5A8YA 2QF0A 3E16B 3GY3A 3QWCH 4DY7B 1C5ZB 2J92A 4J1YA 1ANEA 2VIDA 1LHEH 1QBVH 2AMQA 4A1XA 5HMAA 2WPIS 3T25A 3FZZA 1V2VT 4E7RG 2ZDLA 1GI0A 1BTPA 3CENA 3OY5U 1ZTLA 3SYJA 3UWIA 5B6OA 3SU1A 1O3KA 5JBBS 1ABJH 1Z71A 1C1TA 2NU0E 1MZDA 1AIXH 1EJNA 1GBEA 5KGOA 3FVFB 5G4BA 4X2YA 1EJAA 2OCVB 1W7XH 1VGCC 3BTFE 1BTWA 1H9HE 1JRSA 3T62A 1E36B 1QNJA 2JIZD 1YPKH 2HNTF 3K6ZA 2BXTH 2V7QD 1P9UA 5JBCS 5KECA 1RTLA 3A8AA 1O5EH 2G55A 1CGJE 1FY1A 3OSYA 1V2UT 3ODDA 3DD2H 1O3NA 5ETXA 2EI6A 8KME2 1CQQA 2CJIA 4YZUA 4IN2A 3ATKA 5DK1A 4NSYA 1GI1A 1BOQA 3ZVBA 1MMJN 1O2HA 5C5NA 2CMYA 2CHAC 1FLEE 1U6QA 4SGAE 3ZZ3A 1MU6B 1A3BH 1MTVA 1CO7E 3L33A 1HJ9A 2D1JA 4AOQA 4K60A 4Q7ZA 1Q2WA 2WPDD 1VITG 3HK3B 1W0YH 1YGCH 2Z9KA 4Y8YA 1AGJA 2FOEA 1EOJA 1NPMA 1AU8A 3T28A 1IOEA 1LPZB 1GHAF 3DFJA 4IC5A 1HAIH 2RDEA 1UCYE 5EW2H 2BXUH 5DP3A 3JZ1B 5HM2A 2QF3A 3NCLA 3D62A 1VJAU 2QE7D 2AIQA 1H9IE 2ZU5A 4MPVA 3VB6A 1C2LA 1XUHA 4YOIA 1PYTC 1QQUA 2FOFA 5HIZA 3GCTF 1S6LA 5T3HA 3F2GA 1P09A 1O3JA 1SQAA 3MHWU 2XOKD 1FPCH 4OGYA 3QTVH 1O36A 2QY0B 1B0EA 1YCPK 1S82A 2J97A 1DUEA 1EAUA 1SG8B 1BBRE 1O3PB 2VIPA 4ZXXH 1EAIA 1C4Y2 1SSXA 2FI3E 2FYQA 1DXPA 2ZTXA 3VB3A 1CBWC 1KTSB 1GHZA 1TOCB 1YPHE 5BRRE 1MUEB 2HALA 3H7OA 2O9QA 2ZPQA 3A8BA 1OPHB 1KSNA 3RUOA 1TRYA 1SPJA 3LONA 2GCTB 3NWUA 2ZKSA 4B76A 4Y10E 1NRSH 4Z0KA 4THNH 3UWJH 1BMMH 1HJ8A 1SL3A 1TGNA 4B74A 4X6MA 1YM0A 1A46H 3PO1C 1ELTA 5EXMA 3M7QA 3F9FA 1QJ7B 1NU9A 1Y8TA 1ZMLA 4WF8A 3SJ9A 2ZU3A 4ISOA 4CR9A 1JXPA 1KXCA 1BIOA 2HNTE 1C5YB 3AK5A 1AN1E 2ZZUH 1XVMA 5H4IB 4KTCA 1O5GH 3MNXA 1HAHH 1L1NA 4NWKA 2ZFQH 4XBBA 1AWFH 1K1IA 1XKBC 1BUIA 1ZSKA 1C1PA 2SGPE 3K9XB 3T29A 4DGJA 3AAUA 1ZSJA 3ZZ9A 1YLDA 1LO6A 3RXKA 3Q3YA 3GCNA 2G4UA 2Y5FA 3OEED 3RC5A 2XTTB 3NUMA 3PLKA 1DXWA 4X8SH 5F6MA 1OYTH 1UTNA 5EQRA 1EFRD 3SV9A 1IAUA 4HZHA 2C90B 5JYIA 3FANA 3M7UA 4BTTB 3VEQB 3BG4C 4CRCA 1UMAH 1AFQC 3BSQA 4KTUA 4AGJA 2OLGA 1LVYA 3GDVA 2HVYB 3BG8A 4MNXA 3SO3A 2VWLA 2ZDNA 4YLUA 1XUGA 5AFZH 3EGKH 3PWCA 3QK1A 1C2JA 4BANB 2IPHA 1FY8E 1V2RT 2W5EA 4YOGA 5GIBA 1QBNA 1JOUB 4NA7A 2EI7A 4ZHAA 1NRNH 4Y7BA 2OBQA 4KTSA 3SJKA 2ZCHP 4HG6A 2QIQA 3LU9B 3MH5A 1UTOA 3MH4A 1PPGE 2BDHA 3TGJE 1TE0A 1O2RA 3UNQA 1NFYA 3A81A 1ZYOA 1V2KT 4YXWD 1EP6A 4F55A 1XMNB 2VINA 5TCAA 1QIXB 4TYDA 1P02A 2IN2A 2VJ1A 3QTOH 4FUBA 4MNYA 3RU4D 1W12U 1C5PA 4D8NA 3MMGA 2G51A 2FS8A 3CS0A 1AMHA 4FUJA 1C2EA 2ZDMA 1HUTH 1IQLA 2C3SA 3D49H 4WWYA 1D6WA 1B5GH 1EAWA 2ZDVH 1HAYB 4Q2KA 3BEIB 1S85A 2F9VA 1FPHH 5HYOA 1TX8A 1ZHRA 2H9TH 2ANWA 2NU1E 2WPKS 3B8JA 4NFEA 1O30A 5CHAC 1MTUA 1RD3B 4TWWA 3RC6A 2ZHEH 3S69A 4XOJA 3W94A 1P0SH 3VPKA 2FS9A 1C2IA 1DY8A 1TMUH 3SJIA 1VR1H 2FOHA 1UO6A 2Y5GA 3GDSA 4JZDH 5C67A 2WYGA 1PPEE 1HAVA 3TVJB 5LH8A 1CT0E 3GCHC 1O2ZA 2XC0A 1XXDA 1C1UH 3DFLA 1EKBB 1BZXE 2F9BH 2WUBA 5AHGH 2A1DB 1VGCB 2OP9A 4WMEA 1A4WH 4UFGH 4K3JA 5FCKA 1GI9B 5T1VA 1FAXA 1W0KD 1OP0A 3GYLB 1ESAA 4HTCH 1K28D 2A4OA 3BTQE 3SORA 1T8MA 4UFDH 3RMNH 1W3CA 1GBMA 1ZHPA 5GWZA 1C5NH 1LHFH 2BDYA 1BJUA 2O8TA 3OEHD 1ZGVA 2HPPH 1W0JD 1GMCG 3BEFB 3DSOA 4DCDA 3A7WA 1AUJA 2CHAB 1GJ8B 2FI4E 1GJ7B 2XC4A 1THPB 3UR6A 1YPLH 3QGJA 4A5TS 3LIWA 1H1BA 1VJ9U 1T8NA 4MPWA 3H09A 1SHYA 3LGWA 2CGAA 4OS1A 2AMPA 2W6ID 1J14A 4ABHA 1LHDH 2WINI 1XVOA 3FO8D 2ZGXH 2C8ZB 4K1TA 4XBCA 1L1JA 1O5FH 3V12A 4OS2A 5HKKD 2Z94A 1AI8H 4GCHG 4AC9A 1KXDA 1GJDB 1H8IH 5JDUB 1PPBH 1EOLA 1LTOA 1T31A 1Z1JA 1LHGH 3U28C 1QB9A 1OS8A 2BY9X 4LK4A 4OS6A 4K5ZA 1SB1H 1W13U 2GV7A 3BEUA 1QRXA 4UONA 1P04A 4NCYA 3RXVA 3H5CB 3EE0B 2B7DH 3U1JB 4MPUA 1GBBA 2XBXA 1GVLA 2P3FH 3FP6E 1OWDA 2FYRA 2VVVA 2PP6A 3PTNA 3OTJE 2HLDD 3ZZ7A 4Z1MD 2ZA5A 4DG4A 1UTLM 3IWMA 3KEEA 2B5TB 1DFPA 1UVPA 1HAXB 3A87A 1GHVH 4K2YA 1AKSA 2KFWA 2AGIX 3P92A 1O35A 1C2HA 1Z7KA 1AFEH 2QN5T 4Y8ZA 3PYHA 4X8UH 3SGQE 4A92A 2AFQB 2GGVB 4OGXA 3RXEA 1AVWA 2WPMS 1GVZA 1OP8A 2DE9A 1Y5UT 5JBAS 3PO1B 1GVKB 1VCQA 3HGNA 2O8UA 1XUKA 4H42U 1GMHG 3UQOA 2TGTA 2EI8A 5F03A 4ZKRU 5TJXA 3V0XA 1QL8A 3E1XB 4Q7YA 1SHHB 1C1VH 4XSKU 4UFEH 1LPKB 2Y81A 3LGVA 3SU0A 4JYTA 2Z9LA 1SGEE 2J38A 1EP5A 2HRVA 2VVUA 3ZVEA 1C4V2 2BX3A 3OU0A 3S9CA 1QRZA 2XNDD 2FWWA 2PUXB 1CE5A 1TYNA 2JJ1D 1G3BA 1GI7B 1KXBA 2FOGA 1WQSA 1QA0A 3TJNA 1YPMH 3KNXA 2KCOA 3OY6U 4DURA 1EUFA 5SGAE 2BDGA 2Z6BD 3SGBE 1TFXA 1AFQB 2ZO3H 9ESTA 2ZU4A 3ENSB 2BQ7B 1QR3E 1HCGA 3VGCC 1OHHD 3PLPA 2PSYA 3A88A 3KGPA 4DIIH 2V3HH 2PGBB 1V3XA 3O8RA 1HB0B 3DUXH 2GX4A 1SGQE 3TH3H 2KZ4A 3ZZBA 1YC0A 1TGCA 1EPTA 1VITH 4KP0A 3VXEH 3SV7A 3BTHE 1KLIH 5PTPA 2ZP0H 5LGOA 1EZXC 1BMNH 3BIVH 3ZZAA 2AS9A 1KIGH 2ZPRA 2PTCE 4Y8XA 2BZ6H 1HAZB 4X0WU 4D7GA 4MQAA 3W1EA 1YP9A 2Q6DA 1MTSA 1TBRH 3P6ZB 2WPJS 5C94A 2R2WU 3P95A 4MLFB 1DWEH 4IN1A 1GI2A 1SMFE 1Y3VA 1CHOG 4NIYA 2GCHG 1HAOH 4TWYA 2C93B 5T6GA 5A0BA 4ESTE 1O33A 4R8TB 2H2ZA 3BIUH 2A7JA 4NIVA 4WXIA 1A0HB 1G36A 3U8RH 1NZQH 2H5DA 1GBLA 5DP6A 1W7GH 2PSXA 3A89A 5EU8A 4IMQA 1VZQH 5CHAB 1H8ED 2J5UA 1FN6A 1ZMJA 2BQWB 2H1UA 5A8XA 2W3IA 1KTTB 4RI0A 1FY3A 1T8OA 4X1RU 4ZKOU 2EA3A 1JIMA 2PFEA 2BYAX 3GCHB 3RXRA 1O3BA 3DHKH 4O9VA 1HGTH 3TGIE 3RXGA 1B0FA 4WXVA 2FMJA 3M5NA 3UNRA 2QYIA 3MTYA 1PQ8A 1E35B 3BN9A 3OX7U 4I33A 3HATH 1S0QA 2GTBA 3A7YA 3O8DA 2F9UA 4QT8C 1MTNC 1NO9H 1TALA 1WTGH 2ANKH 3ATIA 1QBOA 3SUEA 4ABIA 2YNBA 2O8WA 1MKWK 2G81E 4ASHA 1BA8B 3EQ0H 1AD8H 4TY6A 2QXIA 3N7DA 4UDWH 4BAKB 2QXGA 1HLTH 1TWXB 3P17H 4ASUD 3BTKE 1IQEA 1UVSH 2GKVE 5EPNA 2CK3D 1G30B 1TRMA 1Y59T 1ARCA 1P12E 2FDAA 1HXFH 2WV5A 3A8CA 3LOXA 3FOAA 1MABB 1XUFA 3P8OA 3LC3A 3A82A 3RC4A 1FMGA 4RN6A 1NRPH 2ILNA 5A09A 1SOZA 1O2QA 3LT3A 1TNIA 3GY8A 5C3NA 3ATLA 5T6DA 5GNDA 4U01A 1LCYA 2A31A 1BCUH 2UUJB 2A0QB 3TITA 2LP6A 3ZZDA 4A1TA 1TQ0B 2Y6TA 3GY5A 4FUCA 2I6QA 5DP7A 1VITF 4MDSA 1TLDA 3SN8A 2BY6X 1IQKA 2Q1JA 4AZ2B 3SU5A 2FESH 2BY8X 2LNCA 1LKBA 1BITA 3SNBA 1SGNE 3UTUH 1ZR0A 1MQ6A 5DKMA 1KLTA 5GPIB 1XM1A 3STIA 5JBTA 1Y3WA 4NIXA 3RMMH 3ZVDA 2Y80A 4H6TA 3SNDA 1UTKA 3E0PB 4CHAC 5BPEA 2ZECA 1GWAA 3SUDA 1O38A 1G9IE 4B73A 1MAXA 4WVPE 1HXEH 5A8ZA 1ZRBA 2HPQH 1H8DH 1UW7A 2PKAB 5FAHA 4K1SA 2BVSH 3S9BA 1IHTH 3MNCA 4AG1A 1F5KU 3A7XA 2AH4X 3SU3A 4DVAU 1FY5A 1K21H 4FU7A 4P02A 4CRAA 2KCPA 5IDKA 3SGAE 3TH4H 1E34B 1DY9A 1O2TA 1HFDA 1ANCA 3E0NB 1SGFG 4JZIA 3T27A 2ZFSA 1ZJKA 1CVWH 1KDQB 3PLBA 4GSOA 1O3DA 1GMDG 1O3FA 1YCPH 1FIWA 1K22H 2VGCC 3SNEA 4X1QU 3ZYEA 2CF9H 5EODA 1A61H 1RTKA 2P94A 1O5AB 5E2PA 7ESTE 3FN8A 4K69A 2QF4A 3UY9A 3LGUA 4ZH8A 1GHBF 4CR5A 5ESTE 2G52A 2UUFB 3FKSD 4XDEA 1P05A 2UWPA 1P2IA 2BDCA 3TNTA 1O2KA 2TPIZ 5EQSA 5EG4A 3VGCB 3N7OA 3K6YA 3QGNB 1P01A 2BX4A 3ZIAD 1V2TT 1V2PT 1C5LH 4AN7A 1XUIA 4ISHH 1G3DA 3KQBA 2IOTA 1OSSA 1F5RA 1WV7H 1NBME 3ELAH 3Q00A 1J17T 1V2JT 4U30A 1HIAA 1RXPA 2QCYA 1OWKA 1TGBA 2ZIQH 5I46H 3D65E 2VWMA 3U69H 5DP9A 1A0LA 3WWBA 3GY2A 2GT7A 4ZAEA 1PFXC 1NRRH 3MO3A 3UUZA 1ZPCA 1Q31A 3FZDA 1FNIA 4Y71A 2F3CE 1F92A 1ZPBA 1WQVH 2VIVA 1BMLA 3MFJA 1O3CA 3R0FA 3TPIZ 4I86A 4ABFA 1ELGA 1P2JA 1D4PB 3SI4H 3MNSA 1GCTC 1MD7A 1IHSH 2IPQX 2CV3A 4X1PU 3F9EA 1O31A 3PMHB 4MVNA 3NRLA 2VIOA 1QL9A 1S81A 2ZHWH 4IBLH 1FI8A 4ABDA 1ESTA 1G2LA 4I8KA 2FI5E 2WV9A 3QDZB 4NFFA 2B8OH 3RXDA 4IMZA 1TAWA 1BRAA 2R2MB 1ELFA 1SGCA 1UK3A 2QGRA 2GDDA 3P8NA 1QB1A 4AFSA 5FBEA 1THRH 5C17A 4GAWA 1MD8A 4XE4A 1ABIH 1ELBA 1QZ8A 2Z9GA 3PRDA 3FP7E 4HI3A 4PROA 2RA0A 4XBDA 4AFZA 2C8WB 4ACBA 1YPGH 1O2PA 5T6FA 2YMSC 1HDTH 1QB6A 1ZRKA 2JH5D 1MU8B 5CE1A 5F8XA 2Y7ZA 4YT7H 1DSUA 2G5VA 4VGCB 1TPSA 2R0KA 1YPEH 1GGDB 1PPHE 2WPLS 5CMXH 3EA9A 3B23B 1TRNA 5HIYA 1SGTA 2GV6A 4FUIA 4TSFD 1C5UA 1O3MA 1IQNA 2FOCA 3LJOA 1FX0B 2JJ2D 2OQUA 2VWOA 3ZYDA 3KQEA 5EPYA 4CH8B 2B0FA 3ZZCA 1GI8B 3SQHE 1EAXA 4TPYA 3RXMA 1NTPA 1AZZA 1LDTT 2QXJA 3PTBA 3TIUA 4CBNA 1K1NA 2VH0A 2AERH 1CGHA 4AB8A 5C20A 2XBYA 1O2OA 1BDAA 4U32A 3ATMA 2RA3A 2C8YB 1G2MA 1NRQH 3KYGA 2XCNA 3U8OH 2IJOB 1TBZH 2BD4A 2BY5X 3GY6A 1K1MA 1O3IA 1E0FD 1O5CB 3QZQA 2FLRH 3MU8A 4WJG2 5L6NH 3TU7H 2OD3B 3VFEA 1JRTA 1TPAE 1V2ST 2PV9B 4INLA 4ABBA 3EE7A 4B71A 4E7NA 5HM9A 3GYMA 1HPGA 1GPZA 3I78A 1XX9A 3FAOA 3RXOA 1P2OA 1D3DB 8ESTE 5L2ZH 4GCHF 3TJOA 4NA8A 4YOJA 3KF2A 1Y5BT 1GBIA 1DVAH 3M3TA 1T8LA 1H4WA 2GD4B 2QXHA 4CHAB 3WWFA 5EGMA 1VKYA 4LOYH 3A85A 3SUFA 4Q63A 2THFB 2XXLA 2OC1A 1GHWH 5EJLA 2WUCA 2KCYA 4OS5A 4Y79A 1Z8GA 4X6PA 1J9CH 1PQ5A 5C1YA 1O3EA 2QV1A 1C1WH 1XKAC 5FL7D 1IQHA 3ZVAA 1PQ7A 1UTQA 3D23A 2XWAA 1O3HA 3BV9B 3TGKE 2RFKC 1O2VA 1QY6A 1DDJA 1O39A 2BD5A 1INCA 4MPXA 1WOFA 1BTUA 1C5OH 1O2YA 5A0CA 1O2MA 3FFGA 5C2ZA 5L30H 4YM9A 2XNIA 4K8BA 4XD7D 1QQ4A 4JK6A 2F83A 2R3UA 1UK2A 4CRBA 1ELCA 5EIYA 1DWCH 1RRKA 3OFND 4A1VA 1T4UH 1GMHF 4I8HA 3LC5A 2ODQA 4INKA 1P10A 4DIHH 1XXFA 4OM9A 5C0TA 1O3AA 4TY7A 1K1OA 5C1XA 4GPGA 1K9OE 1FAKH 3MWIU 1O37A 4UFFH 2BVRH 3QN7A 2A7HA 4AFQA 3Q3XA 3SOSA 3MI4A 1A5GH 3UNSA 2TGDA 1J15A 2BTCE 3L6PA 2JETC 4O3TA 2ULLA 5GJ4B 1BRBE 1Y3UA 3Q76A 4RKJB 2SNVA 1AY6H 1GJCB 5FX6A 1UHBA 4FETA 3T2NA 5DP4A 3M5MA 3ZVFA 2ZQ2A 4E05H 1DLEA 4AX9H 5E0JA 2KAIA 2A4GA 2ZCKP 2AYWA 4ZMAH 1CBWB 3RXBA 1L4DA 1WTHD 2A4QA 2J98A 2V3MA 3F9GA 1MCVA 3LDXH 1DE7H 1EZSC 4O03A 7KMEH 1T4VH 2VB0A 2BVXH 2B9LA 1L2EA 1H9LB 1C1NA 3ZV8A 4B6FA 3SU2A 4B2BA 5AF9H 1KXEA 5FPTA 3TH2H 2F91A 1O2IA 4X2XA 3GY7A 1MCTA 1GCTB 1FN8A 1ZGIA 2RCEA 1G37A 1C5XB 2M5TA 3CNRA 4WH6A 3TNSA 2P8OC 1EPTC 2FTLE 4JCNA 1ZHMA 5K7RA 1NN6A 3N99A 7LPRA 2V3OH 3KL6A 5HXFA 3A80A 2Z9IA 9LPRA 1QFKH 1ETTH 3UQVA 4GVUA 3PV4A 2OUAA 1HAGE 3MU1A 2I6SA 1CHOF 2Q6GA 4D9RA 2GCHF 3TLOA 1CT2E 4WMDA 3DSGA 4E06H 2G4TA 4O97A 1DS2E 4WY3A 3LGYA 2BQ6B 6CHAC 2VIWA 2BLQA 2J2UA 1C5QA 1D6RA 2A2XH 2O8MA 1P06A 1UJ1A 4GHQA 1GBTA 5KEDA 2BDBA 3PRBA 2FTMA 2PGQB 5ABWA 1E1RD 3AW1A 3SU4A 2GVFA 2YMSB 3BG4B 4RKOB 2ZGJA 1C2MA 3TJUA 1LVOA 1SLXB 2BMGB 1D3TB 1TA2A 2NU4E 1BTYA 1EZUC 3UIRA 3SJ8A 1FQ3A 3CP7A 1AB9C 1C2GA 2Y7XA 4KKDA 3EA7A 1QGFA 1S0RA 3MU4A 2PKSC 3RU4T 1JMOH 2NU3E 1NFWA 2WYJA 2JKHA 1P3EA 2FO9A 3SV6A 1GJBB 4ZHMU 1GJ4H 1IQGA 5GXPA 1L0ZA 3URDA 2J34A 1HAVB 4I7YH 3UFAA 2UUYA 3EDXB 1V2LT 2FIRH 1YWUA 2OXSA 3DSPA 1ZTJA 3RDZA 3MOCA 1GDUA 3BF6H 3RM0H 6GCHG 4BAMB 1P11E 1ZOMA 2ZTYA 5FBIA 1QA7A 4JYVH 4BTIB 3SI3H 4NA9H 5K0HA 3QO6A 5EOKA 4HFPB 2J95A 1WDIA 1DT2A 2OK5A 5EJ1A 1UCYK 1GL0E 1ANBA 1O3GA 1O0DH 2C8XB 4K1EA 3RXJA 1UVOA 4H6SB 3GOVB 1P57B 2BB4A 2TGAA 1AE5A 4I32A 2GCTC 5AFYH 3SUGA 2JH6D 1IQJA 2GZ7A 1F0RA 4Y0YE 4IS5A 2A7CA 4Y7AA 5GCHG 3SJOA 2H9HA 1ANDA 1O34A 1AQ7A 1A7SA 1WXRA 1BBRK 1GG6C 1MKWH 4FUFA 1SGFA 5JB9S 5FCRA 3AASA 5DN6D 4BAQB 2RG3A 2ZFRH 1VCWA 8LPRA 3RXPA 4SGBE 1C1RA 2BY7X 2DE8A 3ZZ8A 2TBSA 7GCHG 2Z9JA 3SBKA 5IYTA 1SKYE 2K8IA 1P2QA 2STBE 1N1LA 1C2KA 1ZJDA 2YOLA 3KHVA 5JPMH 1C1MA 1T32A 3GS9A 1SGYE 1EQ9A 4FVDA 1P03A 1NROH
chains in the Genus database with same CATH topology
1LVMA 1HYLA 1KYNA 2VIQA 3MNBA 3M35A 2UWOA 3HK6B 3DA9B 1K2I1 1D3PB 3P8GA 1KXFA 1PPCE 1SC8U 3W95A 2KAIB 4I8LA 3ZVGA 3S9AA 4GLYA 1TNKA 2FX6A 4BXWA 3I29A 1O2UA 1AKSB 4ZKSU 1TMBH 2A5KA 1SOTA 1AHTH 1CU1A 1WSSH 2DUCA 3ITIA 3RXIA 1J8AA 3BTDE 3HPTB 3SU6A 5DG6A 1RGQA 1AUTC 1CA8B 1DUAA 1O2NA 2OC0A 3EA8A 2BDAA 3IITA 1MBQA 2W7UA 1W0ZU 1GMDF 5DGJA 3URCA 2ANYA 4X6NA 2AEIH 3ZZ5A 4FUHA 1L4ZA 2JETB 3AAVA 2ZEBA 1NY22 4ZKNU 1G32B 3RXQA 3TK9A 2OTVA 2ZNKH 2ZGHA 2VNTA 2BD3A 2SGQE 3KQDA 1NU7B 1HJAC 5TCCA 1UK4A 1SLWB 1C5TA 2XC5A 4X1SU 1FDPA 2ZF0H 4X8TH 1DICA 4LZ1H 3SHCH 3UOPA 2PR3A 3SW2B 4LZ4B 5DP8A 1TNHA 1ETSH 1EX3A 3RXTA 2AGEX 2V6NA 1O2LA 3EAJA 2GZ8A 2ZDAH 3E6PH 2ZC9H 1DM4B 4MNVA 1OWIA 3MH7A 4X1NU 1AVXA 3GDUA 1UVUH 1W10U 3GCOA 2AMDA 4AORA 2EC9H 1RIWC 3OYPA 1AWHB 1O32A 4HGCA 3M3SA 3VB4A 1THSH 1FIZA 1TNJA 1CA0C 2P8OB 4B1TA 1F7ZA 1P9SA 1EPTB 3HGPA 4M7GA 1MKXK 2ZU1A 1QL7A 2ZDKA 3GY4A 3LPRA 1GDQA 1FJSA 1A3EH 1LVBA 3LJJA 1TPOA 6ESTA 2BOHB 4AB9A 1O2SA 4B75A 3RLYH 3NXPA 2HGTH 1SGRE 1W2KH 2FX4A 1J16A 2UUKB 2ZPSA 3MYWA 2CN0H 4DW2U 1ELDE 1SGDE 1ACBE 4BAOB 1RJXB 3Q77A 1TONA 3F68H 1K1PA 5EXLA 2GMTC 6CHAB 3SV2H 1RFNA 4JZEH 1K1JA 1ORFA 1P2NA 4BOHA 8GCHG 5FPYA 4INHA 1Y5AT 1WBGB 3HKJB 1QCPA 1O2JA 4GUXA 1DWDH 3SQEE 1V2MT 2J94A 1AB9B 3A8DA 3M37A 3E90B 1FONA 1N8OC 2PKSB 4NIWA 1FZZA 1YYY1 1AO5A 1DPOA 2AGGX 3U9AH 4CBOA 1C9PA 1JBUH 4IC6A 1CSOE 1LQDB 1DX5M 2Y82A 2ZGBH 3BTEE 2ODPA 4AYVB 1LHCH 1DITH 3U1IB 2H5CA 2J9NA 4Y0ZE 6LPRA 1IQIA 2YNAA 2QA9E 2ZHFH 1BHXF 2FODA 1D3QB 1MBMA 2P95A 1MAYA 1T7CA 1BRCE 5FXLA 2LPRA 1F2SE 1SLUB 1LPGB 1TABE 3EYDA 2G8TA 1F0TA 2PUQH 4JZ1A 1L1GA 1YPJH 2V35A 3A83A 1KLJH 3E3TA 3ZVCA 4UEHH 3MH6A 3KCGH 3PB1E 3F6UH 3UOUA 4NZQA 1PQAA 4FUGA 1P2MA 2ALPA 2H6MA 2Y5HA 1C9TA 3U98H 1GG6B 1V6DA 1TQ7B 3A7VA 2F9NA 2P93A 2OC7A 1FV9A 4IGDA 4NWLA 3AVZA 1C2FA 4MG3A 3QUMP 4CRGA 3S7KB 4ISNA 1C5MD 1BB0B 3RXHA 1GBCA 1G3EA 2PTNA 4D9QA 4ZHLU 1GHBG 1GHAG 2Q6FA 1N6XA 1ELEE 3O8BA 3KN2A 1P3CA 4JMYA 3Q3KA 1QJ1B 3BTWE 2W3KA 4GHTA 2ZFFH 1GCDA 1S83A 5E0HA 2ANMH 1MTNB 3A7ZA 1E37B 5EQQA 1DSTA 1G3CA 2ALVA 3GCTG 3TK5A 4DT7B 1Z8RA 1UTJA 1S5SA 3RU4E 4NG9H 5F8TA 1TPPA 1ELAA 1TX7A 3M7TA 2CXVA 1OOKB 1V2OT 2BD8A 4FXGH 1Z6JH 2FP7B 1YKTA 5DPAA 1IQMA 2BDIA 1Z8IB 4MNWA 3STJA 1SGPE 1KY9A 1GMCF 2P3TB 2OC8A 2TGPZ 1JWTA 1VCPA 3M5LA 2XW9A 1C5RA 1TNLA 2ODYB 4FU9A 5LPFA 3O8CA 1NC6A 1HAPH 1C5SA 3M5OA 1RTFB 3UPEA 2ZHDA 4ZXYH 2BLOA 1W8BH 3KQCA 1GBKA 4RSPA 1X7AC 5LPRA 2A5IA 2ZU2A 1A5IA 1ZMNA 1S6HA 4LXBH 3F1SB 4O3UA 1V2NT 3C27B 1BHXB 4BXSA 4BNRA 1N6YA 5EXNA 2ZG0H 1P2KA 4D76A 3RM2H 1C5VA 1HJAB 2FPZA 4ABEA 2QC2A 4X2WA 2HLCA 4FUDA 1DANH 1LQEA 4YESB 5C5OA 5E2OA 3RXSA 3SHAH 3LKWA 1UTPA 2BD2A 2SGAA 1MH0A 3H7TA 3B9FH 4X6OA 4NZLA 3VXFH 3RP2A 1BTXA 2PW8H 5JB8S 1QJ6B 1BTZA 1NESE 2AIPA 3GISB 4YO9A 2P3UB 2W26A 1SQTA 3SV8A 4OS4A 4AFUA 1GJ9B 1E38B 2GT8A 1RIWB 4I31A 2EEKA 2F9OA 1PPZA 5I25A 3P8FA 1ZZZA 2XBWA 1HRTH 1OWJA 1MTWA 2ZGCA 1CA0B 5A0AE 2R9PA 1P8VC 4ABJA 1Z1IA 1CHGA 1C5WB 4JZFH 1TMTH 1DOJA 3HKIB 1WU1A 4MTBA 4K8YA 3S7HB 1HIAB 3QZRA 5E8EH 1HNEE 3K65B 1GI6A 4UD9H 4ABGA 1AVGH 3P70B 3PMJA 4Y76A 1OKXA 4Y11E 4NGAH 4YLQH 2FLBH 1YLCA 2VGCB 1S6FA 2C4FH 5FPSA 2Z3EA 2NWNA 1GL1A 1EZQA 1QHRB 2GMTB 4DJZB 2TIOA 5J4SA 1YF4A 1W14U 3KIDU 2GZ9A 2UWLA 1GJ6A 2WV4A 3DT0H 1WAYB 1HV7A 1ZSLA 3BTME 1O3OA 3I77A 4Q80A 2A32A 1OWHA 3T5FH 2FM2A 1A1RA 1TNGA 1LMWB 4WMFA 4AYYB 3ODFA 3R3GB 4AGKA 1EATA 1GDNA 1O5BB 1SVPA 2JH0D 1N8OB 4BAHB 1TGTA 1QTFA 2OINA 2PWXA 1GI3A 3ZZ6A 2HOBA 1BQYA 3RXAA 4CREA 1MZAA 2FXRA 2VVCA 5F8ZA 2ASUB 1EB2A 1TB6H 2SGEE 1EASA 3RMLH 3WY8A 3SNCA 1SQOA 1QRWA 3NK8A 4NSVA 5DO4H 1RS0A 2XWBI 2VH6A 1GBFA 1Y3YA 2R3YA 1PYTD 2ZQ1A 1GJAB 3CS7A 2GP9B 3TK6A 1NFXA 2RDLA 2G5NA 4KELA 1GBHA 3NZIA 6GCHF 1XUJA 2TRMA 1V2WT 4TPIZ 3SNAA 1C1QA 4F49A 3NKKA 1A0JA 1FUJA 4YTAA 1AZ8A 1GBJA 1BT7A 1O2XA 1OX1A 3QLPH 2ZTZA 2VWNA 2FOMB 2O8LA 1EXFA 1GI5A 2ZHQH 1SBWA 1Z6EA 1K1LA 3LGIA 2ZI2H 2ZFPH 3PMBB 4YT6H 1O2GH 1KXAA 4ZROA 4JYUH 1IQFA 5ESBA 1D9IA 4IW4E 4OS7A 3RLWH 1ETRH 2PHBA 1BRUP 1GI4A 3L3TA 2BZAA 2STAE 1OYQA 1SLVB 5GCHF 1NS3A 1ID5H 4BTUB 1F5LA 1C2DA 1DLKB 3K2UA 2SFAA 1YBWA 4R0IA 1SR5C 4Q7XA 5DJ7A 1Y3XA 4CRFA 5C1UA 1F0SA 5E0GA 1TX6A 1OP2A 1O5DH 2D26C 1JIRA 3LH3A 1UCYH 2V0BA 5FX5A 2Z3DA 4X2VA 3ZV9A 1SI5H 2OBOA 1ZLRA 2D2DA 7GCHF 2BLVA 2CF8H 3MO9A 4CRDA 4UE7H 3F9HA 3S0NA 5LPEA 1GHXH 4U2WA 2W7SA 2R0LA 1ZPZA 3MU0A 2PKAA 5DP5A 4D7FA 1WUNH 2SNWA 2SGDE 2FZZA 2WPHS 3TJVA 1BBRH 1C4U2 1O2WA 2Z7FE 1NFUA 4FU8A 1GJ5H 4F4OC 3RXCA 3M36A 1LKAA 2HVXA 3E8LA 3RXUA 1BJVA 1CT4E 1C1SA 1NM6A 2BOKA 4FVBA 5L2YH 1KDQA 1DWBH 4H4FA 4FUEA 2XCFA 3SZNA 1WCZA 1Z8JB 1SFIA 1SFQB 1OXGA 1YPHC 1WYKA 2XBVA 3BTTE 2A4RA 1TA6A 2A5AA 4Z6AH 4CH2B 2F9PA 1A5HA 5FHTA 3GICB 2BLWA 4ZUHA 3RMOH 3ESTA 3LGTA 1B7XB 1M9UA 1HBTH 2ZFTA 4J2YB 4X8VH 5HGGA 4A6LA 4AG2A 3U8TH 4ABAA 1TOMH 2ZCLP 1F0UA 3PMAB 1W11U 3E91A 2NU2E 1ESBA 1PPFE 2SGFE 3VB5A 1S84A 2HNTC 2G00A 1NT1A 3G01A 3C1KA 1V2QT 4A7IB 3NPSA 3A86A 3M61U 4ISIH 4I8JA 2P16A 4DOQA 2FOBA 1C1OA 3V13A 3UR9A 3AW0A 3UREA 1O3LA 2BM2A 1BTHH 2FEQH 1UHBB 3V7TA 5J4QA 2HWLB 1AE8H 3RXFA 2QAAA 1TGSZ 2A45B 1TBQH 3A7TA 3BTGE 2XRCA 3T26A 4ISLA 3VB7A 4Y6DA 1MQ5A 3FP8E 3QX5H 3IG6B 1FXYA 1Q3XA 2ZWLH 4VGCC 3PROA 1EJMA 1GGDC 1GBAA 3LH1A 5EW1H 2BD9A 2P59A 2A2QH 2Z3CA 1OWEA 3MO6A 1UTMA 1ARBA 2OQ5A 2ESTE 3MU5A 3V3MA 1CGIE 3RXLA 1SGIB 1GHYH 2XYAA 2H9EH 3M3VA 1ZTKA 2D8WA 2PLXA 4B2CA 2K1QA 3ZZ4A 4B2AA 5GDSH 2GDEH 1UVTH 3A84A 3ATWA 1PJPA 2BD7A 2VU8E 1GBDA 5A2MH 3JZ2B 3PM3A 2BHGA 4KGAA 1FY4A 3PWBA 1ELVA 1TIOA 4XFQA 5AVDA 8GCHF 1QURH 1YCPM 2FOAA 1EB1H 2J4IA 4I8GA 1A2CH 4WH8A 4JK5A 1MKXH 1BMAA 5A8YA 2QF0A 3E16B 3GY3A 3QWCH 4DY7B 1C5ZB 2J92A 4J1YA 1ANEA 2VIDA 1LHEH 1QBVH 2AMQA 4A1XA 5HMAA 2WPIS 3T25A 3FZZA 1V2VT 4E7RG 2ZDLA 1GI0A 1BTPA 3CENA 3OY5U 1ZTLA 3UWIA 5B6OA 3SU1A 1O3KA 5JBBS 1ABJH 1Z71A 1C1TA 2NU0E 1MZDA 1AIXH 1EJNA 1GBEA 3FVFB 5G4BA 4X2YA 1EJAA 2OCVB 1W7XH 1VGCC 3BTFE 1BTWA 1H9HE 1JRSA 3T62A 1E36B 1QNJA 1YPKH 2HNTF 3K6ZA 2BXTH 1P9UA 5JBCS 1RTLA 3A8AA 1O5EH 2G55A 1CGJE 1FY1A 3OSYA 1V2UT 3ODDA 3DD2H 1O3NA 5ETXA 2EI6A 8KME2 1CQQA 2CJIA 4YZUA 4IN2A 3ATKA 5DK1A 4NSYA 1GI1A 1BOQA 3ZVBA 1MMJN 1O2HA 5C5NA 2CMYA 2CHAC 1FLEE 1U6QA 4SGAE 3ZZ3A 1MU6B 1A3BH 1MTVA 1CO7E 3L33A 1HJ9A 2D1JA 4AOQA 4K60A 4Q7ZA 1Q2WA 1VITG 3HK3B 1W0YH 1YGCH 2Z9KA 4Y8YA 1AGJA 2FOEA 1EOJA 1NPMA 1AU8A 3T28A 1IOEA 1LPZB 1GHAF 3DFJA 4IC5A 1HAIH 1UCYE 5EW2H 2BXUH 5DP3A 3JZ1B 5HM2A 2QF3A 3NCLA 3D62A 1VJAU 2AIQA 1H9IE 2ZU5A 4MPVA 3VB6A 1C2LA 1XUHA 4YOIA 1PYTC 1QQUA 2FOFA 3GCTF 5T3HA 1P09A 1O3JA 1SQAA 3MHWU 1FPCH 4OGYA 3QTVH 1O36A 2QY0B 1B0EA 1YCPK 1S82A 1DUEA 1EAUA 1SG8B 1BBRE 1O3PB 2VIPA 4ZXXH 1EAIA 1C4Y2 1SSXA 2FI3E 2FYQA 1DXPA 2ZTXA 3VB3A 1CBWC 1KTSB 1GHZA 1TOCB 1YPHE 5BRRE 1MUEB 2HALA 3H7OA 2O9QA 2ZPQA 3A8BA 1OPHB 1KSNA 3RUOA 1TRYA 1SPJA 3LONA 2GCTB 3NWUA 2ZKSA 4B76A 4Y10E 1NRSH 4Z0KA 4THNH 3UWJH 1BMMH 1HJ8A 1SL3A 1TGNA 4B74A 4X6MA 1YM0A 1A46H 3PO1C 1ELTA 5EXMA 3M7QA 3F9FA 1QJ7B 1NU9A 1Y8TA 1ZMLA 4WF8A 3SJ9A 2ZU3A 4ISOA 4CR9A 1JXPA 1KXCA 1BIOA 2HNTE 1C5YB 1AN1E 2ZZUH 1XVMA 5H4IB 4KTCA 1O5GH 3MNXA 1HAHH 1L1NA 4NWKA 2ZFQH 4XBBA 1AWFH 1K1IA 1XKBC 1BUIA 1ZSKA 1C1PA 2SGPE 3K9XB 3T29A 4DGJA 3AAUA 1ZSJA 3ZZ9A 1YLDA 1LO6A 3RXKA 3Q3YA 3GCNA 2G4UA 2Y5FA 3RC5A 2XTTB 3NUMA 3PLKA 1DXWA 4X8SH 5F6MA 1OYTH 1UTNA 5EQRA 3SV9A 1IAUA 4HZHA 2C90B 5JYIA 3FANA 3M7UA 4BTTB 3VEQB 3BG4C 4CRCA 1UMAH 1AFQC 3BSQA 4KTUA 4AGJA 2OLGA 1LVYA 3GDVA 3BG8A 4MNXA 3SO3A 2VWLA 2ZDNA 4YLUA 1XUGA 5AFZH 3EGKH 3PWCA 3QK1A 1C2JA 4BANB 2IPHA 1FY8E 1V2RT 2W5EA 4YOGA 5GIBA 1QBNA 1JOUB 4NA7A 2EI7A 4ZHAA 1NRNH 4Y7BA 2OBQA 4KTSA 3SJKA 2ZCHP 2QIQA 3LU9B 3MH5A 1UTOA 3MH4A 1PPGE 2BDHA 3TGJE 1TE0A 1O2RA 3UNQA 1NFYA 3A81A 1ZYOA 1V2KT 1EP6A 1XMNB 2VINA 5TCAA 1QIXB 4TYDA 1P02A 2IN2A 2VJ1A 3QTOH 4FUBA 4MNYA 3RU4D 1W12U 1C5PA 4D8NA 3MMGA 2G51A 2FS8A 3CS0A 1AMHA 4FUJA 1C2EA 2ZDMA 1HUTH 1IQLA 2C3SA 3D49H 4WWYA 1D6WA 1B5GH 1EAWA 2ZDVH 1HAYB 4Q2KA