2O9QA

The crystal structure of bovine trypsin complexed with a small inhibition peptide orb2k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From protease inhibitor to antibiotics: single point mutation makes tremendous functional shift
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA02
1P06A 3S9CA 2Z9IA 2A45B 1UVPA 4ISNA 1O3PB 1UMAH 3CS0A 1P01A 1ZPCA 1EX3A 4ABDA 2AMDA 1ANCA 5K7RA 2J38A 1BUIA 3A88A 1UTKA 2TIOA 2CF9H 2HVXA 2ZHQH 5BRRE 1LHDH 1L1JA 4Q7YA 2BVSH 2D8WA 1EQ9A 4Q80A 4A92A 1FIWA 2CN0H 1H4WA 1LKAA 5AF9H 1GI5A 4TWWA 1QL9A 3K6YA 5C3NA 4MQAA 1DITH 2PSYA 2VH6A 2W7UA 1MAXA 1C1WH 1C2EA 4KELA 2WV4A 1ELEE 1GI2A 2HOBA 5ABWA 2OC0A 8GCHF 1VR1H 3M5MA 6GCHG 4GVUA 2B7DH 2J95A 4O9VA 5E8EH 2SGEE 1RS0A 2AGIX 1MTWA 3BIVH 3MNXA 4MG3A 5EU8A 4MLFB 1CGHA 4GHTA 2XCFA 1NFXA 4JYUH 2EA3A 3MU1A 1TNIA 1O2PA 3QDZB 1DE7H 4Z6AH 3QK1A 1GCTC 1CU1A 1G3BA 3MU4A 2O8MA 2VGCC 1ELFA 4WMDA 5T6FA 3GOVB 1AFQB 1UK2A 1GL1A 2FX6A 1TYNA 1YGCH 2BD4A 4ABBA 4WF8A 1O2XA 1PQ8A 4FUJA 5L2ZH 3S69A 1JOUB 1O30A 2TPIZ 3SHCH 3ATIA 1EJAA 2QY0B 5JPMH 1S83A 4BOHA 1EAXA 2VJ1A 1OWEA 8LPRA 2RDLA 1EZXC 3HPTB 2Y6TA 4XFQA 2BD2A 2FI5E 4NCYA 4K1EA 2ODYB 1CSOE 1EPTA 1QHRB 3R0FA 1XXFA 1O37A 3TJVA 1O3BA 4XBCA 3NKKA 3UUZA 4GPGA 3EQ0H 3TNTA 5F6MA 3ATMA 3OY6U 3BTHE 1GHBG 1YPEH 1S6HA 2GZ9A 2ANYA 3BTFE 3C1KA 2Z3EA 1KDQA 3B8JA 2I6QA 1VCWA 2OC8A 1K1LA 2ZA5A 1DVAH 1QL7A 2P93A 5FXLA 1LCYA 5PTPA 5A0AE 2M5TA 1BMAA 2FS8A 2WPLS 4CBOA 4HZHA 1HAGE 1QURH 3BG8A 1F2SE 2P8OC 1O2TA 4KKDA 5A09A 2XNIA 2G52A 3PMAB 1DLEA 2BD5A 1P04A 2QF3A 1TQ0B 1TX8A 3L3TA 3RXGA 4A1XA 1AZZA 2ZDNA 1TBRH 3M5LA 2F3CE 3MU0A 4LOYH 1Q31A 1O36A 1HFDA 2KAIA 1AI8H 1YPHE 4MNYA 3T28A 1SGFA 2BM2A 3SJKA 4AFQA 1H9HE 1BT7A 5A8ZA 2P8OB 5DKMA 1YKTA 1FXYA 2C8XB 2C8YB 3M61U 2HALA 3RMOH 4YOGA 1DY8A 2TGPZ 2R3UA 1PPHE 1C1OA 2C8ZB 1GMHG 3F6UH 2QXIA 2XBVA 3QTOH 1DXWA 1O2MA 3DFLA 3E90B 5EGMA 3P17H 2FX4A 5GCHG 8GCHG 1ABIH 5AVDA 1GJ6A 3I77A 1ZSLA 4MTBA 4Y11E 4U01A 5GXPA 1K21H 4TY7A 4ZH8A 4UFFH 2FMJA 3O8BA 3URCA 1HAHH 2ZF0H 1GMCG 4MVNA 4E05H 1NM6A 1NU7B 1RFNA 3P8OA 1L2EA 1GI9B 3AASA 2ILNA 1FY8E 1GGDC 2ZFFH 2D2DA 1CO7E 3RXIA 1C2FA 3P95A 3PMJA 1ZPBA 2HPPH 1SLWB 1O2QA 2EI8A 1C5ZB 1IOEA 3M37A 5CMXH 1HCGA 3UREA 1GJAB 2F9VA 2Z9KA 1KLIH 2PV9B 2OINA 1ARBA 3P92A 2Y7ZA 1W10U 3UFAA 1O5CB 1GI7B 3FZDA 1AQ7A 3TVJB 2ZWLH 4CRDA 2FYRA 3MU8A 2ZFQH 4K1SA 4Y8XA 2OBQA 5ETXA 5C5NA 5C67A 3SW2B 2XXLA 3U8OH 3VB5A 2A0QB 3GY4A 4E7NA 5JYIA 1TABE 4AYYB 4U32A 1OSSA 3PTBA 4AFUA 4TPIZ 2ZDVH 1EASA 2TGTA 1BTYA 1T7CA 2FDAA 4NA7A 4B71A 1NN6A 2OD3B 1A1RA 1GBIA 3VB3A 2BZ6H 3A7YA 1ZTLA 3A7WA 2Z9JA 1DOJA 1SGYE 1JRSA 1SGRE 1A4WH 3RLWH 2UWOA 2CXVA 1CT4E 1AVWA 1TNJA 4ZKRU 3MI4A 3RXFA 4WY3A 4BXSA 4HGCA 3BEFB 1EUFA 1GI4A 3AAVA 4Y79A 3K2UA 2FOBA 4B74A 2PKAA 4X2VA 1E36B 2ZQ2A 2ZG0H 2ZGJA 1NRQH 5GJ4B 1RTKA 1YBWA 1T4UH 1O3LA 2AS9A 2G5VA 2G4UA 6ESTA 1HJAC 3EAJA 3M3VA 1GBBA 5AFYH 3SJ8A 5FAHA 2A2QH 3SU3A 1Y3XA 2Y5HA 1L0ZA 1O2VA 2ZP0H 1GG6B 1ETTH 1YYY1 1TX7A 4THNH 2O8UA 1O34A 4ZHAA 4X1PU 5F8XA 2ANKH 4X8VH 1DM4B 4CBNA 1HAOH 4ISIH 1CBWB 3HGPA 3PO1B 1S5SA 1C5XB 4BNRA 3M5OA 3LONA 3F9FA 3STIA 1LMWB 2PLXA 2WPKS 3A8BA 2FOAA 1T31A 2VWNA 2BDHA 1TBQH 5GDSH 3SBKA 1C1SA 2JH0D 5GCHF 1TMUH 2YNBA 1ZLRA 1WSSH 1C5LH 1C2KA 1Z8IB 2BD8A 5JBCS 1E37B 3RXPA 2D1JA 1OWKA 2F9OA 3SNBA 3SZNA 1BTPA 2PKSB 1BHXB 1C9TA 5JB8S 2G00A 3WY8A 1DICA 1XKBC 1BRCE 1D3TB 4AX9H 1E0FD 5AFZH 2A5AA 3FP8E 1A46H 3MH5A 3QTVH 5G4BA 2IN2A 5JB9S 1KDQB 4WMEA 2F9BH 2JH5D 3LKWA 4NSVA 4K5ZA 1WBGB 3SV7A 1AZ8A 1WTGH 1UTQA 5L6NH 2UUFB 5JBAS 3HATH 1RTLA 1GBMA 1C5UA 4AN7A 1G37A 4IMZA 1SSXA 2G55A 6GCHF 1AY6H 3RC6A 3V0XA 1SGFG 1BQYA 1ANDA 4DJZB 2SGAA 4DURA 1V2WT 1BMMH 5EW2H 1C2MA 3UY9A 3H7OA 3O8DA 2O9QA 5CHAC 5I25A 2FI3E 5J4QA 2CMYA 3ZZ7A 5EG4A 2BYAX 1TIOA 1FAXA 1KXCA 3VXEH 1DUAA 2WYJA 3SV6A 2SGFE 1EAUA 3MU5A 3NZIA 3KGPA 3ZVAA 1TMTH 5HM2A 1GI1A 3SHAH 1Y59T 3D62A 5FPSA 1KTTB 2TGAA 3QN7A 3A7VA 4UONA 3GICB 1T4VH 4I32A 5DP3A 2C93B 1VGCB 1O5GH 4K1TA 5FCKA 3P70B 2GZ7A 1DWDH 4YTAA 1MH0A 2HNTC 3CP7A 4MNWA 4OS4A 2EI6A 3PLBA 1IQGA 3HGNA 4AZ2B 2VINA 4YLQH 4HFPB 3DD2H 4BAQB 3ZZ4A 3I29A 3NCLA 1WAYB 1O3IA 1HBTH 1NFYA 2NWNA 1IQJA 1TNLA 1V2ST 1NESE 2AERH 2NU3E 3ZVGA 2GX4A 2AH4X 2C3SA 1UHBA 3T2NA 1OOKB 5ESBA 2O8TA 1FAKH 4OS6A 1DSTA 1T8LA 1JXPA 3Q00A 1GJ5H 1FLEE 2Z3DA 1LO6A 1MZDA 5A8YA 5F8TA 3P8GA 5EQRA 5EOKA 1BRBE 1WYKA 5FX6A 2GDDA 3A84A 3M7QA 1C1UH 1ELTA 1KIGH 3RU4D 3W95A 4B2BA 2ZGXH 1OKXA 4Y0ZE 5FX5A 1MD7A 4SGBE 1CE5A 3OTJE 1A3EH 1JWTA 3BTGE 2IPHA 4F49A 1HV7A 2Z9LA 1K28D 1P3CA 3E0NB 1TRMA 1HPGA 4ZHMU 2Y80A 3LJOA 5AHGH 2BOKA 2V35A 1W12U 2C90B 2PUXB 1J8AA 3SORA 1SPJA 3SNCA 3MNBA 3A7XA 1GVKB 2BDCA 2XC0A 2B9LA 3OY5U 2QA9E 1GDUA 2DE9A 1QNJA 1EKBB 3RXOA 1QB9A 1EB1H 1NFWA 1BMNH 1V2QT 1ELBA 1TX6A 4XOJA 1UVSH 2AFQB 5EXLA 1XUGA 1Z8GA 2RCEA 1O0DH 1MBQA 4HI3A 2RA0A 5FBIA 2V6NA 1H8DH 3PWBA 2ZCKP 1D6WA 7ESTE 1Y3YA 4A1VA 1YPMH 4CH8B 1F7ZA 3QLPH 3RU4T 1VITH 3PYHA 2Z6BD 2GCHF 2VH0A 4ISOA 4Y71A 1EXFA 3T62A 3NWUA 1LVOA 3I78A 3DT0H 3U1IB 1CVWH 3A7ZA 4IW4E 2DUCA 1TB6H 2PW8H 1ZRBA 1O2JA 4OS7A 1RRKA 1S82A 3ZZDA 1HAPH 1LHEH 4OS2A 9LPRA 1GBKA 3ZVFA 1WU1A 2AIPA 1RD3B 1E38B 1ZYOA 5T3HA 4ZMAH 3E0PB 1GG6C 3GYMA 1SOZA 4E06H 1QB6A 3ZZ8A 1ZMJA 2BX4A 3LGYA 1C1VH 1HJ8A 2BLQA 3FAOA 5T6DA 2OTVA 4ABEA 1A5HA 1HAVB 1TBZH 2ZEBA 1D3QB 1GHBF 3MHWU 2H9TH 4B1TA 4AFZA 1GJ8B 1B0EA 4HTCH 4A6LA 4NG9H 5E2OA 1O2IA 1TOMH 4IS5A 1OXGA 4FUGA 4OGYA 2Z94A 4AG2A 1EZQA 1GI3A 3LDXH 1S85A 1P11E 2GZ8A 3D49H 1ZZZA 1QJ1B 1V2OT 3P6ZB 1SGTA 1TRNA 4UE7H 4NGAH 4NA8A 4K60A 1HJ9A 2HRVA 4ABJA 3TH4H 1AUTC 2BXUH 1V2JT 1MUEB 3OX7U 4FUFA 1CGIE 1XX9A 3MNCA 2BLOA 1VGCC 1Z6EA 1GMDG 2EEKA 1H9LB 3A86A 4FU7A 1XUKA 1ZGIA 1F5KU 2CHAC 2ZTYA 1ARCA 4XBDA 1AD8H 1EZSC 1Y8TA 1LTOA 1D3PB 1VITG 1OP0A 3GY5A 3T26A 1TPAE 2STAE 1WOFA 3Q3KA 3R3GB 3LC3A 1JBUH 2ZU5A 1C2IA 1PYTD 1W0YH 2FOMB 4B75A 1FY5A 1Y5UT 2R0KA 1AMHA 1UTOA 1M9UA 2XTTB 1GBJA 1IQMA 1A0LA 4BTIB 3SJ9A 1P05A 4MDSA 1GPZA 1SB1H 2WPMS 5DK1A 3BSQA 2FLRH 3KQEA 2A5KA 1P2IA 3TPIZ 3JZ2B 4Q7ZA 4AOQA 1QBOA 1TGBA 1TQ7B 1K9OE 5E0JA 1BBRH 2BTCE 1BOQA 1P2MA 3KIDU 3S7KB 3W94A 3URDA 4WXVA 3A89A 5JBBS 3A87A 1EATA 4D8NA 2VIOA 1HAYB 1MTNB 1CT0E 1TA6A 1HXEH 1W13U 4KGAA 1CA0C 3TK6A 3LPRA 2HWLB 4XE4A 2W26A 1P9UA 3BIUH 1KTSB 1EOLA 2P3FH 4U2WA 5A0BA 1O32A 3MO9A 1H8IH 1QY6A 1UCYE 4VGCC 1P03A 1SFQB 3T29A 3RC4A 2PKAB 2J94A 3E8LA 1MCVA 4BXWA 1N6XA 1J15A 1PPBH 3MO6A 1J17T 1NTPA 3Q3XA 2WPJS 1GJDB 2R0LA 2FIRH 4FU9A 5TCAA 1HAIH 5FCRA 1IQEA 1BTUA 1Z71A 2O8WA 3TITA 1H1BA 4NFEA 3ZZCA 1UCYK 2OUAA 4JZDH 5EPNA 2BY5X 6CHAB 2B8OH 2XBXA 4AFSA 5HXFA 1AE5A 1EP6A 3NPSA 4I7YH 3DFJA 1AN1E 1CBWC 4R0IA 1SLXB 1Q2WA 1IQFA 3ZYDA 1GBEA 2XC5A 2UUJB 2BD9A 1MAYA 2GKVE 3IITA 2QIQA 1ELGA 2Q6FA 1RTFB 5EXNA 3LU9B 2A4RA 1G2LA 4AYVB 1NO9H 2Y5FA 3SO3A 1MKWK 5C20A 3KN2A 2G8TA 1O3MA 1BCUH 2VVCA 1C1PA 2HNTE 4X1SU 3VPKA 1GDNA 3EA9A 5SGAE 5A2MH 1PQAA 3GY6A 2SGPE 2BY8X 1W11U 5LPRA 1HLTH 1QL8A 1NT1A 2V3OH 4YT7H 2Y5GA 2ESTE 3Q76A 1LPKB 4X2XA 4B73A 1QJ6B 1EOJA 4K3JA 4BAOB 1DWEH 5GWZA 1BA8B 1Z1JA 4CREA 1IQNA 1XXDA 3UNRA 4OS5A 1P09A 2QXJA 2JH6D 4YOJA 2F9NA 5DP7A 1BITA 4O3UA 2ZFTA 3G01A 1AIXH 4Z0KA 2EI7A 1PQ7A 4A5TS 1C5PA 1ZTJA 4LZ4B 1MCTA 3PMBB 2QXHA 3KF2A 4DT7B 4IGDA 1O38A 1LPGB 1TPPA 1BHXF 4ABGA 4J1YA 1O2ZA 3S9AA 4CRAA 1AUJA 3GISB 5FBEA 2QAAA 3BV9B 1HIAA 2GDEH 4NWLA 1YCPH 2H5CA 3E3TA 5A8XA 3SNAA 1P10A 1K1IA 2XYAA 3RXAA 4GHQA 1L1NA 3FZZA 3ATKA 1HUTH 3C27B 3RC5A 1UCYH 2Z7FE 5C2ZA 4WVPE 1LVYA 1S81A 1SQTA 1G2MA 1MD8A 2FOEA 2F83A 2PR3A 3BTKE 2VGCB 2AMQA 2UWLA 3K6ZA 3LGUA 3M3SA 3PO1C 5L2YH 3HKJB 1UVTH 3UOUA 5DP4A 1PJPA 2LPRA 2PWXA 5FHTA 5LH8A 1G3DA 4FUIA 1TGTA 1DSUA 2FOFA 1C4U2 3SU0A 2RG3A 3RXDA 3RP2A 1L4ZA 1FNIA 3TLOA 1UK3A 1ZMLA 3GY3A 1AFEH 1N8OC 1AKSA 5CHAB 2D26C 2W3KA 3GCHC 4ZXYH 3M36A 2PKSC 1UTNA 2J9NA 3H5CB 4FVDA 1E34B 3FVFB 1PPZA 1C1NA 1C2HA 2A7JA 4Y8ZA 3UQOA 3RXBA 1CHOG 2QCYA 1GHYH 1TNKA 1SHHB 2TGDA 2WYGA 1QGFA 1V2LT 2VB0A 4AG1A 2NU4E 1MQ5A 3GDVA 1DS2E 1DLKB 4INLA 2J2UA 1K1PA 4DIHH 2OC1A 4INKA 5C1UA 1A5GH 2ZPRA 7LPRA 1AWHB 1FMGA 1PPGE 1EPTC 1SGDE 1RXPA 3RXUA 4NIXA 2IJOB 2OCVB 1C2GA 3F68H 1V2PT 3GY8A 2CHAB 2ZKSA 1P2KA 4JZIA 1WTHD 3ATWA 4B2CA 2A31A 1GCDA 4DOQA 4A7IB 1THRH 1GI0A 4GCHG 1DWBH 2HLCA 3STJA 4CHAB 3M5NA 3LGWA 1HAVA 2FO9A 3FP6E 3UWJH 3CENA 3RXVA 1SLUB 2A4QA 4I31A 4AB8A 1KXEA 1QA0A 4YOIA 4INHA 1MTUA 1TPSA 2BOHB 4JCNA 4X1QU 3BF6H 2ZGHA 1O3DA 5C5OA 3ZZBA 2A7CA 2FXRA 5IYTA 1WCZA 3GDSA 4NIYA 3SI3H 5I46H 2JETB 4GAWA 3NXPA 2PHBA 3HK3B 3ENSB 2WUBA 3F9HA 1EJNA 1GCTB 4CRCA 3LH1A 1K1JA 4H6TA 1P8VC 1QA7A 1AHTH 1OX1A 4MNVA 4QT8C 2BVXH 5HMAA 5DG6A 4YM9A 3MO3A 1MKXH 4ESTE 1WQSA 1TGSZ 2JKHA 1UK4A 2BLVA 2ZECA 4ZAEA 1JMOH 1INCA 2HPQH 2I6SA 2Z9GA 5GIBA 1O2SA 2YNAA 1HDTH 3SNEA 5DPAA 1HJAB 1CT2E 1O3JA 2DE8A 2ODPA 1GMDF 4UDWH 1TWXB 1GBCA 1AVXA 1J14A 1A61H 2BY7X 2YOLA 1GBFA 3DHKH 1CA0B 5CE1A 2CJIA 2C4FH 4CRBA 1O3AA 4CR5A 4OS1A 4Q2KA 5IDKA 1O2KA 2OXSA 4KTSA 3ZYEA 1VJAU 1YLDA 2QN5T 2ZDMA 2BLWA 4VGCB 5DP5A 3UPEA 1EAWA 1GVLA 2ZU1A 1FZZA 4CH2B 3NK8A 4ABAA 3A8DA 3SGBE 1GGDB 1S0QA 1DDJA 1HXFH 3TNSA 3ELAH 1ELCA 3SI4H 2GGVB 2J4IA 1T8NA 1DT2A 2UUKB 4UFGH 3RLYH 1QRXA 3PV4A 5DO4H 4CRGA 4ABIA 3VFEA 2F9UA 4JYVH 3UTUH 1ETSH 2BB4A 2XWBI 1F0SA 2VIPA 1U6QA 1K2I1 1HB0B 4WWYA 2PGBB 1C4Y2 1LQEA 2BDYA 2NU1E 1BRUP 3A81A 1G3EA 1WUNH 3IG6B 4IC6A 2AGEX 2GV6A 1O2RA 1WQVH 2ANWA 3UNSA 2A2XH 3VB4A 4A1TA 1SGEE 1YPHC 1B7XB 2ZNKH 4LXBH 1SBWA 1GMHF 2GMTC 1V2MT 3SGAE 3MTYA 1S6FA 1S84A 3N7OA 1P2JA 2A4GA 1GI8B 1QJ7B 1V2TT 2FPZA 4ABHA 4KTUA 1KLTA 2FOHA 5A0CA 2JETC 1ZRKA 4X8TH 1P57B 1C5OH 2FM2A 3BG4B 3U8RH 2QGRA 2A32A 3O8CA 2GCHG 4IN2A 3F1SB 1MKXK 4I8GA 1AFQC 2VU8E 4Y10E 1TGCA 2BY6X 4NA9H 2O8LA 3V13A 1HRTH 1PPFE 1QBVH 4B2AA 4WH6A 1TOCB 1KXDA 1GJ4H 2Z3CA 4LK4A 5FPYA 3BG4C 3QZRA 1SOTA 1ZJDA 2VIDA 1T8MA 1DUEA 3K9XB 3ODDA 1MZAA 4SGAE 5EW1H 1SI5H 3HK6B 1BJVA 1C1TA 1FV9A 4AB9A 1FY3A 3TH3H 2GTBA 1XUHA 1C5MD 4X1NU 1C2LA 1FQ3A 5BPEA 1V2VT 3RXLA 4D7GA 1MBMA 4H42U 3ZV8A 4BTUB 2ZC9H 2ZU4A 5DGJA 4F4OC 2G51A 4X6OA 1UTPA 1FUJA 2Y7XA 2OQUA 3V3MA 1XUJA 2ZPQA 1H9IE 1GDQA 3PLPA 4MPUA 1T8OA 2C8WB 1ZSKA 2BD3A 3BEIB 3QGNB 2BMGB 2GCTC 1Z7KA 3BTDE 3LH3A 2ZIQH 3RXEA 1FPCH 1AB9B 1C5NH 1TONA 2ZFPH 2H9HA 1J16A 1HAZB 1O5FH 1J9CH 3MH4A 4BTTB 1D4PB 1RGQA 1HYLA 2GP9B 2OLGA 2ULLA 4I8JA 4DGJA 1EP5A 3PWCA 1SL3A 3GCTF 3VB6A 1Z8RA 2ANMH 2FLBH 2ZQ1A 2BDBA 1SGCA 5B6OA 3D65E 1FPHH 3SQHE 1O3OA 3M35A 3QX5H 4TWYA 4AGJA 3D23A 3ZVBA 1LVMA 1XUFA 2ZGBH 2CGAA 1KYNA 2GD4B 1MTVA 3ZVDA 1NRNH 3LT3A 3VGCC 1OWHA 4CRFA 1OS8A 1NFUA 1Y5BT 2ASUB 8KME2 1AGJA 2ZHWH 1BJUA 5DJ7A 1C1MA 1IQHA 4O03A 4MPWA 5LPFA 3SV8A 3H7TA 2KAIB 1YPGH 1JIRA 1W14U 1GI6A 1FONA 4NZLA 1OWIA 2XCNA 5LPEA 4NIVA 1HIAB 4K8YA 2RA3A 1O31A 1FDPA 3EA8A 1Q3XA 5C1YA 1YCPK 3SV9A 3SUEA 3KEEA 3RDZA 4KP0A 4LZ1H 3SUGA 3U98H 1SGPE 3ZVEA 4OGXA 2BDGA 4DCDA 3EA7A 3TGJE 1P2QA 4K2YA 2BZAA 4X2WA 2GVFA 3RXSA 4NFFA 1A5IA 1UHBB 3V12A 4YT6H 3T27A 1DPOA 2Q1JA 2VWMA 4IMQA 4B76A 4JK5A 4CHAC 2P3UB 7GCHG 1AVGH 1TNGA 2FWWA 1QQ4A 4ZKNU 2VWLA 1A3BH 1HGTH 4ZROA 2BX3A 2PUQH 3KNXA 3ZZAA 4JZEH 3PB1E 4ISHH 3QO6A 1XVOA 1CHOF 1TMBH 1VCQA 1YM0A 4GCHF 3EDXB 1PQ5A 5HYOA 5LGOA 4FUBA 3RMMH 1LDTT 6CHAC 5E0GA 1TGNA 1T32A 1O3NA 1Y3VA 3SU2A 1GHZA 2ZHDA 3VGCB 1ZPZA 5DP6A 1AKSB 1G30B 3BTTE 2XBYA 1G32B 1ZSJA 1OYQA 3BTQE 3M3TA 1GHAF 1DFPA 1GBLA 1ABJH 4UD9H 3P8NA 1QFKH 5EQQA 1IHSH 1C5VA 3ITIA 2ZU2A 3A85A 3EGKH 3UIRA 2TRMA 4TYDA 2G81E 1NROH 5F03A 4ABFA 2ZFSA 1TRYA 1EB2A 2BQWB 2K1QA 1P12E 1O33A 1EJMA 3ZVCA 3BEUA 2ZFRH 2SGQE 4IN1A 1YPKH 1C5RA 2NU2E 3GY2A 1FI8A 3SQEE 3ATLA 1SMFE 1IQLA 8ESTE 5FPTA 5K0HA 1MTSA 1PYTC 4D76A 3VXFH 3TGKE 4WXIA 3AW0A 4D7FA 1BIOA 3IWMA 1SGIB 2R2MB 1UTLM 1W2KH 3SU4A 1BTWA 1O3KA 1PPEE 3A8AA 1BBRE 5E2PA 1C9PA 3UWIA 3ZZ3A 1ESBA 2FOCA 3KHVA 1YC0A 4ZKOU 2P59A 1YF4A 2PSXA 3A7TA 2B0FA 1DX5M 4MPXA 1O5BB 2J92A 1KLJH 1IAUA 1TALA 4IBLH 4WH8A 1W7XH 5J4SA 2HNTF 2TBSA 4Y0YE 3GYLB 3UQVA 2H2ZA 4M7GA 1N6YA 1VCPA 2VIWA 4FUDA 1SG8B 2A1DB 5TCCA 4WMFA 1W8BH 1N8OB 2BDAA 1S0RA 4UEHH 4D9QA 1XKAC 2GV7A 1NC6A 3OSYA 2R9PA 1XM1A 2ZDKA 5EQSA 1NZQH 2BY9X 1D9IA 4ZKSU 2WINI 4JZFH 4X6PA 1GHXH 2OP9A 1SC8U 1OYTH 1VZQH 3U9AH 1O3HA 1OP8A 2ODQA 3LGIA 1THPB 4DG4A 3E1XB 4RKOB 3BTME 1GHVH 3TJOA 2GT7A 1XUIA 4BAHB 3LOXA 3VB7A 2PTCE 1C5TA 2ZO3H 2AEIH 1GMCF 2ZDLA 3QZQA 3MYWA 1P0SH 5F8ZA 1LHCH 2ALPA 1FJSA 3PMHB 3RUOA 1SR5C 3PLKA 2QC2A 5GPIB 1EZUC 1MQ6A 4H6SB 2ZCHP 4U30A 1LHGH 3TJNA 3JZ1B 1C2DA 2A7HA 1MKWH 2PTNA 3A80A 4I8LA 4DY7B 2SFAA 1NRRH 1QIXB 2BQ7B 4DIIH 4X6MA 4E7RG 2F91A 3Q3YA 3SJOA 1FN6A 4FU8A 3B23B 1MU6B 1G9IE 1KXAA 4X8SH 3V7TA 4PROA 1F0UA 4ZUHA 1L4DA 1MU8B 1ZGVA 2ZU3A 3EE0B 1KXFA 3U8TH 3KQBA 2XW9A 1FY4A 3A83A 4X2YA 3SUFA 2BDIA 2ZPSA 4FUHA 5HGGA 3ESTA 1P2OA 3S9BA 4KTCA 5DP9A 1JIMA 3TIUA 1MTNC 2THFB 1UJ1A 3GCOA 3GDUA 3S7HB 1EPTB 4NZQA 1GHAG 1V2RT 4JK6A 3SU5A 1DXPA 3F9GA 3M7UA 1CQQA 1Z6JH 4DW2U 2CF8H 1BDAA 1QR3E 2ZDAH 1K1OA 2P94A 1GWAA 5DP8A 5HM9A 3RXKA 2CV3A 2AGGX 2FYQA 1KY9A 1ZR0A 3M7TA 3LGVA 1A0JA 4I8KA 3L6PA 1FN8A 1OWJA 1NS3A 1TLDA 1V6DA 2G5NA 1UO6A 3E16B 2A5IA 1VITF 2V0BA 1F0RA 2VIQA 1UTJA 2OC7A 4YESB 1GBHA 1GJCB 1TPOA 1UVOA 2FZZA 7KMEH 1QTFA 1BTHH 1CGJE 1RIWC 2FOGA 1GBTA 1RIWB 1X7AC 1C5YB 4WJG2 2WPHS 2P95A 1P3EA 1YP9A 4ASHA 1YPJH 2ZTXA 3T5FH 3P8FA 2H6MA 1BZXE 2FODA 1O3FA 3EYDA 2F9PA 5EODA 1F0TA 3UR6A 1FIZA 3GCNA 2WPIS 2UWPA 2FTLE 3RU4E 3KQCA 2VIVA 2QV1A 2QF0A 2Q6DA 3AAUA 1NRSH 3ZV9A 3TH2H 4NSYA 4GLYA 1SFIA 2ALVA 1C4V2 1K22H 2VVUA 3AVZA 1V2UT 3RMLH 1G36A 1ESAA 2NU0E 2A4OA 1E35B 2FP7B 1ETRH 5L30H 1LQDB 1QCPA 2HGTH 3SN8A 1AU8A 1VJ9U 1Z8JB 1O2GH 3E91A 3VEQB 4R8TB 4TY6A 4AORA 5ESTE 1EAIA 1ID5H 3A8CA 3KCGH 4CR9A 3BTWE 2AYWA 1GJ9B 3LGTA 1BTZA 1C2JA 3KL6A 1AO5A 1TA2A 1O3CA 3RXTA 1LVBA 3TU7H 1V2KT 2GT8A 1QQUA 1YPLH 5H4IB 2XRCA 3ZZ6A 3GY7A 1QBNA 1LHFH 1GHWH 3RMNH 4RN6A 3SUDA 1PPCE 1BRAA 3RM0H 3UR9A 3LJJA 2ZZUH 1O5DH 3SU6A 3GCHB 2SGDE 1KXBA 2FTMA 4MNXA 1N1LA 1MMJN 2BXTH 2G4TA 4FUCA 3TK9A 1F5LA 3PM3A 4FUEA 3BN9A 1O35A 1C5SA 5JDUB 2AMPA 1D3DB 1GJ7B 2FEQH 1SQAA 4I33A 1ZHMA 1G3CA 4J2YB 1JRTA 1A7SA 3SGQE 2VVVA 2VWOA 2P16A 2V3HH 3MOCA 1SLVB 1SGNE 1NPMA 1BBRK 1IQKA 1O39A 1DY9A 1ELAA 1O2WA 1TFXA 1PFXC 7GCHF 1ANBA 1XMNB 3MMGA 2AIQA 3RXJA 3L33A 3OU0A 4ZHLU 1QRWA 3SNDA 4BANB 1O5AB 4H4FA 4TPYA 2EC9H 2W7SA 3T25A 4Y6DA 1A0HB 2BVRH 4YLUA 4I8HA 4JYTA 4UFEH 2IOTA 4K69A 1HAXB 2R3YA 4K8BA 3MFJA 4Y76A 1IQIA 3QGJA 1WV7H 2Y81A 3SV2H 3K65B 1A2CH 4NIWA 1K1NA 3HKIB 1ZTKA 1K1MA 1AWFH 3FANA 4IC5A 3RXHA 3ZZ9A 3TGIE 1QB1A 1CHGA 3RXMA 3MWIU 1NY22 1W0ZU 1LPZB 1SHYA 1Y3UA 1GBAA 1O2HA 1C1RA 6LPRA 1ZJKA 1BTXA 1ZHPA 4Y7BA 3S0NA 3KQDA 4BAMB 3SOSA 1SGQE 4RKJB 2GCTB 3F9EA 3RM2H 2WV5A 1AB9C 4YZUA 1P02A 4AGKA 3QUMP 1GVZA 2XBWA 2P3TB 1ESTA 1XVMA 5T6GA 2XWAA 1IHTH 1SVPA 1TNHA 2ZTZA 2FI4E 1CA8B 3TJUA 1SQOA 1P2NA 4XBBA 1O2NA 1BMLA 1GJBB 4GUXA 2SNVA 3LC5A 3UNQA 2R2WU 1TE0A 3PROA 2GMTB 2H1UA 2STBE 1KSNA 4JZ1A 5EPYA 3O8RA 4Y8YA 2WUCA 4O97A 1NRPH 1W3CA 1NU9A 1O2YA 3MH7A 2H9EH 4ZXXH 2BD7A 4XSKU 2Y82A 1Y3WA 3GCTG 1D6RA 1Y5AT 2ZI2H 4D9RA 2PGQB 1DWCH 2FESH 3A82A 1ANEA 2SNWA 3ODFA 1L1GA 1LKBA 2ZHEH 3DA9B 4GSOA 4UFDH 4YO9A 1GBDA 2OQ5A 1W7GH 1ZHRA 1TAWA 2QXGA 4X6NA 1C5WB 4X8UH 4JMYA 3QWCH 2FS9A 4Q7XA 3U69H 4X1RU 2ZCLP 4O3TA 4XDEA 2J34A 1OPHB 3UOPA 2ZHFH 5TJXA 1RJXB 3RXQA 1BB0B 1V2NT 1O2OA 1O2LA 1O2UA 3TK5A 3DUXH 3PTNA 3MH6A 3RXCA 1ELVA 1UVUH 2W3IA 2UUYA 1OWDA 2ZGCA 1B5GH 5C1XA 3B9FH 9ESTA 3AW1A 4MPVA 3LIWA 1THSH 4BAKB 1ELDE 2BQ6B 3ZZ5A 3E6PH 1V3XA 2PFEA 1C1QA 2LNCA 4RSPA 3MNSA 1O3EA 1HNEE 3NUMA 4FVBA 5E0HA 2OBOA 3CS7A 1ACBE 3U1JB 2Q6GA 1O5EH 1YCPM 1C5QA 3SU1A 3OYPA 2W5EA 4Y7AA 2H5DA 1UTMA 2XC4A 3SJIA 1F5RA 1OP2A 1FY1A 1QRZA 1ORFA 1DANH 4FXGH 2VNTA 1YLCA 1F92A 1Z1IA 3Q77A 2B5TB 1B0FA 1P9SA 4ISLA 4NWKA 1ZOMA 5JBTA 4DVAU 1AE8H 1GL0E 2BHGA 3BTEE 3FFGA 3FP7E 3RXRA 1O3GA 5EXMA 1ZMNA 2QYIA 4X0WU
chains in the Genus database with same CATH superfamily
1P06A 3S9CA 2Z9IA 2A45B 1UVPA 4ISNA 1O3PB 1S6LA 3EE7A 1UMAH 3CS0A 1P01A 1ZPCA 1EX3A 4ABDA 2AMDA 3OEHD 1ANCA 5K7RA 2J38A 1BUIA 3A88A 2PP6A 1UTKA 2TIOA 2CF9H 2HVXA 2ZHQH 5BRRE 1LHDH 2WV9A 1L1JA 4Q7YA 2BVSH 2D8WA 1EQ9A 4Q80A 4A92A 1FIWA 1YY3A 2CN0H 1H4WA 1LKAA 5AF9H 1GI5A 4TWWA 1QL9A 3K6YA 5C3NA 4MQAA 1DITH 2PSYA 2VH6A 2W7UA 1MAXA 1C1WH 1C2EA 4KELA 2WV4A 1ELEE 1GI2A 2HOBA 5ABWA 2OC0A 8GCHF 1VR1H 3M5MA 6GCHG 4GVUA 2B7DH 2J95A 4O9VA 5E8EH 2SGEE 1RS0A 2AGIX 1MTWA 3BIVH 3MNXA 4MG3A 5EU8A 4MLFB 1CGHA 4GHTA 2XCFA 1NFXA 4JYUH 2EA3A 3MU1A 1TNIA 1O2PA 3QDZB 1DE7H 4Z6AH 3QK1A 1GCTC 1CU1A 1G3BA 3MU4A 2O8MA 2VGCC 1ELFA 4WMDA 5T6FA 3GOVB 1AFQB 1UK2A 1GL1A 2FX6A 1TYNA 1YGCH 2BD4A 4ABBA 4WF8A 1O2XA 1PQ8A 4FUJA 5L2ZH 3S69A 1JOUB 1O30A 2TPIZ 3SHCH 3ATIA 1EJAA 2QY0B 5JPMH 1S83A 4BOHA 1EAXA 2VJ1A 1OWEA 8LPRA 2J98B 2RDLA 1EZXC 3HPTB 2Y6TA 4XFQA 2BD2A 2FI5E 4NCYA 4K1EA 2ODYB 1CSOE 1EPTA 2QE7D 1QHRB 3R0FA 1XXFA 1O37A 3TJVA 1O3BA 4XBCA 3NKKA 3UUZA 4GPGA 3EQ0H 4RT0A 3TNTA 3ATMA 5F6MA 3OY6U 3BTHE 1GHBG 1YPEH 1S6HA 2GZ9A 1WXRA 2ANYA 3BTFE 3C1KA 2Z3EA 1KDQA 3B8JA 2I6QA 1VCWA 2OC8A 1K1LA 2JDID 2ZA5A 1DVAH 1QL7A 1WDIA 2P93A 5FXLA 1LCYA 5PTPA 5A0AE 2M5TA 1BMAA 2FS8A 2WPLS 4CBOA 4HZHA 1HAGE 1QURH 3BG8A 4AC9A 1F2SE 2P8OC 1O2TA 4KKDA 5A09A 1SQRA 2XNIA 2G52A 3PMAB 1DLEA 2BD5A 1P04A 3F0OA 2QF3A 1TQ0B 1TX8A 3L3TA 3RXGA 4A1XA 1AZZA 2ZDNA 1TBRH 3M5LA 2F3CE 3MU0A 4LOYH 1Q31A 1O36A 1HFDA 5HKKD 2JJ2D 2KAIA 1AI8H 1YPHE 4MNYA 3T28A 2AHME 1SGFA 2BM2A 3SJKA 4AFQA 1H9HE 1BT7A 5A8ZA 2P8OB 5DKMA 1YKTA 1FXYA 2C8XB 4P00A 2C8YB 3M61U 2HALA 3RMOH 2VBCA 4YOGA 1DY8A 2TGPZ 2R3UA 1PPHE 1C1OA 2C8ZB 1GMHG 3F6UH 2QXIA 2XBVA 1OHHD 3QTOH 1DXWA 1O2MA 3DFLA 3E90B 5EGMA 3P17H 2FX4A 5GCHG 8GCHG 1ABIH 2J97A 5AVDA 1GJ6A 3I77A 1ZSLA 4MTBA 4Y11E 4U01A 5GXPA 1K21H 4TY7A 4ZH8A 4UFFH 2FMJA 3O8BA 3URCA 1HAHH 2ZF0H 1GMCG 4MVNA 4E05H 1NM6A 1NU7B 1RFNA 3P8OA 1L2EA 1GI9B 3AASA 2ILNA 1FY8E 1GGDC 2ZFFH 2D2DA 1CO7E 3RXIA 1C2FA 3P95A 3PMJA 1ZPBA 2HPPH 1SLWB 1O2QA 2EI8A 3ZIAD 1C5ZB 1IOEA 3M37A 5CMXH 5C94A 1HCGA 3UREA 1GJAB 2F9VA 2Z9KA 1KLIH 2PV9B 2OINA 1ARBA 3P92A 2Y7ZA 1W10U 3UFAA 1O5CB 1GI7B 3FZDA 1AQ7A 3TVJB 2ZWLH 4CRDA 2FYRA 3MU8A 2ZFQH 4K1SA 4Y8XA 2OBQA 5ETXA 5C5NA 2K8IA 5C67A 3SW2B 2XXLA 3U8OH 3VB5A 2A0QB 3GY4A 4E7NA 5JYIA 1TABE 4AYYB 4U32A 1OSSA 3PTBA 4AFUA 4TPIZ 2ZDVH 1EASA 2TGTA 1BTYA 1T7CA 2FDAA 4NA7A 4B71A 1NN6A 2OD3B 1A1RA 1GBIA 3VB3A 2BZ6H 3A7YA 1ZTLA 3A7WA 2Z9JA 1DOJA 1SGYE 1JRSA 1SGRE 1A4WH 3RLWH 2UWOA 2CXVA 1CT4E 1AVWA 1TNJA 1YLNA 4ZKRU 3MI4A 3RXFA 4WY3A 4BXSA 4HGCA 3BEFB 1EUFA 1GI4A 3PRBA 3AAVA 4Y79A 3K2UA 2FOBA 4B74A 2PKAA 4X2VA 1E36B 2ZQ2A 2ZG0H 2ZGJA 1NRQH 5GJ4B 1RTKA 1YBWA 1T4UH 1O3LA 2AS9A 2G5VA 4ACBA 2G4UA 6ESTA 1HJAC 3EAJA 3MQKC 3M3VA 1GBBA 5AFYH 3SJ8A 5FAHA 2A2QH 3SU3A 1Y3XA 5B6LA 2Y5HA 1L0ZA 1O2VA 2ZP0H 1GG6B 1ETTH 1YYY1 1TX7A 4THNH 2O8UA 1O34A 4ZHAA 4X1PU 5F8XA 2ANKH 4X8VH 1DM4B 4CBNA 1HAOH 4ISIH 1CBWB 3HGPA 3PO1B 1S5SA 1C5XB 1UW7A 4BNRA 3M5OA 1FX0B 3LONA 2JJ1D 3F9FA 3STIA 1LMWB 2PLXA 2KCOA 2WPKS 3A8BA 2FOAA 1T31A 2VWNA 2BDHA 1TBQH 5GDSH 3SBKA 1C1SA 2JH0D 5GCHF 1TMUH 2YNBA 1ZLRA 1WSSH 1C5LH 1C2KA 1Z8IB 2BD8A 5JBCS 1E37B 3RXPA 2D1JA 1OWKA 2F9OA 3SNBA 3SZNA 1BTPA 2PKSB 1BHXB 1C9TA 5JB8S 2G00A 3WY8A 1DICA 2KR7A 1XKBC 1BRCE 1D3TB 4AX9H 1E0FD 5AFZH 2A5AA 3FP8E 1A46H 3MH5A 3QTVH 5G4BA 2IN2A 5JB9S 1KDQB 2L74A 4WMEA 2F9BH 2JH5D 3LKWA 4NSVA 4K5ZA 1WBGB 3SV7A 1AZ8A 1WTGH 4ZCNA 1UTQA 2L6OA 5L6NH 2UUFB 5JBAS 3HATH 1RTLA 1GBMA 1C5UA 4AN7A 1G37A 4IMZA 1SSXA 2G55A 6GCHF 1AY6H 3RC6A 3V0XA 1SGFG 1BQYA 1ANDA 4DJZB 2SGAA 4DURA 1V2WT 1BMMH 5EW2H 1C2MA 3UY9A 3H7OA 3O8DA 2O9QA 5CHAC 5I25A 2FI3E 5J4QA 2CMYA 3ZZ7A 5EG4A 2BYAX 1TIOA 1FAXA 1KXCA 3VXEH 1DUAA 2WYJA 3SV6A 2SGFE 1EAUA 3MU5A 3NZIA 4RT1A 3KGPA 3ZVAA 1TMTH 5HM2A 1GI1A 3SHAH 1Y59T 3D62A 5FPSA 1KTTB 2TGAA 3QN7A 3A7VA 4UONA 3GICB 1T4VH 4I32A 5DP3A 2C93B 1VGCB 4Q4LA 1O5GH 4K1TA 5FCKA 3P70B 5T1VA 2GZ7A 1DWDH 4YTAA 1MH0A 2HNTC 3CP7A 4MNWA 4OS4A 2EI6A 3PLBA 1IQGA 3HGNA 4AZ2B 2VINA 4YLQH 4HFPB 3DD2H 4BAQB 3ZZ4A 4M9FA 3I29A 3NCLA 3OFND 1WAYB 1O3IA 1HBTH 1NFYA 2NWNA 1IQJA 1TNLA 1V2ST 1NESE 2AERH 2NU3E 3ZVGA 2GX4A 2AH4X 2C3SA 1UHBA 3T2NA 2WPDD 1OOKB 5ESBA 2O8TA 1FAKH 4OS6A 1DSTA 1T8LA 1JXPA 3Q00A 1GJ5H 1FLEE 3NRLA 2Z3DA 1LO6A 1MZDA 5A8YA 3FOAA 5F8TA 3P8GA 5EQRA 5EOKA 1BRBE 1WYKA 2HVYB 5FX6A 2GDDA 3A84A 3M7QA 1C1UH 1ELTA 1KIGH 3RU4D 3W95A 4B2BA 2ZGXH 1OKXA 4Y0ZE 5HIYA 5FX5A 1MD7A 4SGBE 1CE5A 3OTJE 1A3EH 2RFKC 1JWTA 3BTGE 2IPHA 4F49A 1HV7A 2Z9LA 1K28D 1P3CA 3E0NB 1TRMA 1HPGA 4ZHMU 2Y80A 3LJOA 5AHGH 2BOKA 2V35A 1W12U 2C90B 2PUXB 1J8AA 3SORA 1SPJA 3SNCA 3MNBA 3A7XA 1GVKB 2BDCA 4ACAA 2XC0A 2B9LA 3OY5U 2QA9E 1GDUA 2DE9A 1QNJA 1EKBB 3RXOA 1QB9A 2V3MA 1EB1H 1BMFD 1NFWA 1BMNH 1V2QT 1ELBA 1TX6A 4XOJA 1UVSH 2AFQB 5EXLA 1XUGA 1Z8GA 2RCEA 1O0DH 1MBQA 4HI3A 2RA0A 5FBIA 2V6NA 1H8DH 3W1EA 3PWBA 2ZCKP 1D6WA 7ESTE 1Y3YA 4A1VA 1YPMH 4CH8B 1SKYE 1F7ZA 3QLPH 3RU4T 1VITH 3PYHA 2Z6BD 2GCHF 2VH0A 4ISOA 4Y71A 1EXFA 3T62A 3NWUA 1LVOA 3I78A 3DT0H 5F53A 3U1IB 1CVWH 3A7ZA 4IW4E 1EFRD 2DUCA 1TB6H 2PW8H 1ZRBA 1O2JA 4OS7A 1RRKA 1S82A 3ZZDA 1HAPH 1LHEH 4OS2A 9LPRA 1GBKA 3ZVFA 2W6JD 1WU1A 2AIPA 1RD3B 1E38B 1ZYOA 5T3HA 4XD7D 4ZMAH 3E0PB 1GG6C 3GYMA 1SOZA 4E06H 1QB6A 3ZZ8A 1ZMJA 2BX4A 3SYJA 3LGYA 1C1VH 1HJ8A 2BLQA 3F0PA 3FAOA 5T6DA 2OTVA 4ABEA 1A5HA 1HAVB 1TBZH 2ZEBA 1D3QB 1GHBF 3MHWU 2H9TH 4B1TA 4AFZA 1GJ8B 1B0EA 4HTCH 4A6LA 4NG9H 5E2OA 1O2IA 1TOMH 4IS5A 1OXGA 4FUGA 4OGYA 2Z94A 4AG2A 1EZQA 1GI3A 3LDXH 1S85A 1P11E 4FOUC 2GZ8A 1MABB 3D49H 1ZZZA 1QJ1B 1V2OT 3P6ZB 1SGTA 1TRNA 4UE7H 4NGAH 4NA8A 4K60A 1HJ9A 2HRVA 4ABJA 3TH4H 1K0HA 1AUTC 2BXUH 1V2JT 1MUEB 3OX7U 4FUFA 1CGIE 1XX9A 3MNCA 2BLOA 1VGCC 1Z6EA 1GMDG 2EEKA 1H9LB 3A86A 4B6EA 4FU7A 1XUKA 1ZGIA 1F5KU 2CHAC 2ZTYA 1ARCA 4XBDA 1AD8H 1EZSC 1Y8TA 1LTOA 1D3PB 1VITG 1OP0A 3GY5A 3T26A 1TPAE 2STAE 1WOFA 3Q3KA 3R3GB 3LC3A 1JBUH 2ZU5A 1C2IA 1PYTD 1W0YH 2FOMB 4B75A 1FY5A 1Y5UT 2R0KA 1AMHA 1UTOA 1M9UA 2XTTB 1GBJA 1IQMA 1A0LA 4BTIB 3SJ9A 1P05A 4MDSA 5IK2D 1GPZA 1SB1H 2WPMS 5DK1A 3BSQA 2FLRH 3KQEA 2A5KA 1P2IA 3TPIZ 3JZ2B 4Q7ZA 4AOQA 1QBOA 1TGBA 1TQ7B 1K9OE 5E0JA 1BBRH 2BTCE 3F3BA 1BOQA 1P2MA 3KIDU 3S7KB 3W94A 3URDA 4WXVA 3A89A 5JBBS 3A87A 1EATA 4D8NA 2VIOA 1HAYB 1MTNB 1CT0E 1TA6A 1HXEH 1W13U 4KGAA 1CA0C 3TK6A 3LPRA 2HWLB 4XE4A 2W26A 1P9UA 3BIUH 1KTSB 3FO8D 1EOLA 2P3FH 4U2WA 5A0BA 1O32A 3MO9A 1H8IH 1QY6A 1UCYE 4VGCC 3F2HA 1P03A 1SFQB 3T29A 3RC4A 2PKAB 2J94A 3E8LA 1MCVA 4BXWA 1N6XA 1J15A 1PPBH 1E1RD 1J17T 3MO6A 1NTPA 3Q3XA 2WPJS 1GJDB 2R0LA 2FIRH 4FU9A 5TCAA 1HAIH 5FCRA 1IQEA 1BTUA 1Z71A 2O8WA 3TITA 1H1BA 4NFEA 3ZZCA 1UCYK 2OUAA 4JZDH 5EPNA 2BY5X 2JIZD 2W6ID 2B8OH 6CHAB 2XBXA 4AFSA 5HXFA 1AE5A 1EP6A 3NPSA 4I7YH 3DFJA 1AN1E 1CBWC 4R0IA 1SLXB 1Q2WA 1IQFA 3ZYDA 1GBEA 2XC5A 2UUJB 2BD9A 1MAYA 2GKVE 3AK5A 5EIYA 3IITA 3H09A 2QIQA 1ELGA 2Q6FA 1RTFB 5EXNA 2KCAA 3LU9B 2A4RA 1G2LA 4AYVB 1NO9H 2Y5FA 3SO3A 1MKWK 5C20A 3KN2A 2G8TA 1O3MA 5CHBA 1BCUH 2VVCA 1C1PA 2HNTE 4X1SU 3VPKA 1GDNA 3EA9A 5SGAE 5A2MH 1PQAA 3GY6A 2SGPE 2BY8X 1W11U 5LPRA 1HLTH 1QL8A 1NT1A 2V3OH 4YT7H 3UAIC 2Y5GA 2ESTE 3Q76A 1LPKB 4X2XA 4B73A 1QJ6B 1EOJA 4K3JA 4BAOB 1DWEH 2KCPA 5GWZA 3PRDA 1BA8B 1Z1JA 4CREA 1IQNA 1XXDA 3UNRA 2XNDD 4XRNA 4OS5A 1P09A 2QXJA 2JH6D 4YOJA 2F9NA 5DP7A 1BITA 4O3UA 2ZFTA 3G01A 1AIXH 4Z0KA 2EI7A 1PQ7A 4A5TS 2J5UA 1C5PA 1ZTJA 4LZ4B 1MCTA 3PMBB 2QXHA 3KF2A 4DT7B 4IGDA 1O38A 1LPGB 1TPPA 1BHXF 4ABGA 4J1YA 1O2ZA 3S9AA 4CRAA 1AUJA 3GISB 5FBEA 2QAAA 3BV9B 1HIAA 2GDEH 3OAAD 4NWLA 1YCPH 2H5CA 3E3TA 5A8XA 3SNAA 1P10A 1K1IA 2XYAA 3RXAA 4GHQA 1L1NA 3FZZA 3ATKA 1HUTH 3C27B 3RC5A 1UCYH 2Z7FE 5C2ZA 4WVPE 1LVYA 1S81A 1SQTA 1G2MA 1MD8A 2FOEA 2F83A 2PR3A 3BTKE 2VGCB 2AMQA 2UWLA 3K6ZA 3LGUA 3M3SA 3PO1C 5L2YH 3HKJB 1UVTH 3UOUA 5DP4A 1PJPA 2LPRA 2PWXA 5FHTA 5LH8A 1G3DA 4FUIA 1TGTA 1DSUA 2FOFA 1C4U2 3SU0A 2RG3A 3RXDA 4TSFD 3RP2A 1L4ZA 1FNIA 3TLOA 1UK3A 1ZMLA 3GY3A 1AFEH 1N8OC 1AKSA 5CHAB 2D26C 4ASUD 2W3KA 3GCHC 4ZXYH 3M36A 2PKSC 1UTNA 2J9NA 3H5CB 4FVDA 1E34B 3FVFB 1PPZA 1C1NA 1C2HA 2A7JA 4Y8ZA 3UQOA 3RXBA 1CHOG 2QCYA 1GHYH 1TNKA 1SHHB 2TGDA 2WYGA 1QGFA 1V2LT 2VB0A 1NBMD 4AG1A 2NU4E 1MQ5A 3GDVA 1DS2E 1DLKB 4INLA 2J2UA 1K1PA 4DIHH 2OC1A 4INKA 5C1UA 1A5GH 2ZPRA 7LPRA 1AWHB 1FMGA 1PPGE 1EPTC 1SGDE 3DSPA 1RXPA 3RXUA 4NIXA 2IJOB 2OCVB 1C2GA 3F68H 1V2PT 3GY8A 2CHAB 2ZKSA 1P2KA 4JZIA 1WTHD 3ATWA 4B2CA 2A31A 1GCDA 4YXWD 4DOQA 4A7IB 1THRH 1GI0A 4GCHG 1DWBH 2HLCA 3STJA 4CHAB 3M5NA 3LGWA 1HAVA 2FO9A 3FP6E 3UWJH 3CENA 3RXVA 1SLUB 2A4QA 4I31A 4AB8A 1KXEA 1QA0A 4YOIA 4INHA 1MTUA 1TPSA 2QF4A 2BOHB 4JCNA 4X1QU 3BF6H 2ZGHA 3VG8A 1O3DA 5C5OA 3ZZBA 2A7CA 2FXRA 5IYTA 1WCZA 3GDSA 4NIYA 3SI3H 5CDFE 2JETB 4GAWA 5I46H 3NXPA 2PHBA 4HG6A 3HK3B 3ENSB 2HLDD 2WUBA 3F9HA 1EJNA 1GCTB 4CRCA 3LH1A 1K1JA 4H6TA 1P8VC 1QA7A 1NBME 1AHTH 1OX1A 4MNVA 4QT8C 2BVXH 5HMAA 5DG6A 4YM9A 3MO3A 1MKXH 2LELA 4ESTE 1E1QD 1WQSA 1TGSZ 2JKHA 1UK4A 2BLVA 2ZECA 4ZAEA 1JMOH 1INCA 2KZ4A 2HPQH 2I6SA 2Z9GA 5GIBA 1O2SA 2YNAA 1HDTH 3SNEA 5DPAA 1HJAB 1CT2E 2WSSD 1O3JA 2DE8A 2ODPA 1GMDF 4UDWH 1TWXB 1GBCA 1AVXA 1J14A 1A61H 2WZQA 2BY7X 2YOLA 1GBFA 3DHKH 1CA0B 5CE1A 2CJIA 2C4FH 4CRBA 1O3AA 2CK3D 4CR5A 4OS1A 4Q2KA 5IDKA 1O2KA 2OXSA 4KTSA 3ZYEA 1VJAU 1YLDA 2QN5T 2ZDMA 2BLWA 4VGCB 5DP5A 3UPEA 1EAWA 1GVLA 2ZU1A 1QZ8A 1FZZA 4CH2B 3NK8A 4ABAA 3A8DA 1KMHB 3SGBE 1GGDB 1S0QA 1DDJA 1HXFH 3TNSA 3ELAH 1ELCA 3SI4H 2GGVB 2J4IA 1T8NA 1DT2A 2UUKB 4UFGH 3RLYH 1QRXA 3PV4A 5DO4H 4CRGA 4ABIA 3VFEA 2F9UA 4JYVH 3UTUH 1ETSH 2BB4A 2XWBI 1F0SA 2VIPA 1U6QA 1K2I1 1HB0B 4WWYA 2PGBB 1C4Y2 1LQEA 2BDYA 2YMSD 2NU1E 1BRUP 3A81A 1G3EA 3PV5A 1WUNH 3IG6B 4IC6A 2AGEX 2GV6A 1O2RA 1WQVH 2ANWA 4FETA 3UNSA 2A2XH 3VB4A 4A1TA 1SGEE 1YPHC 1B7XB 2ZNKH 3WW7A 4LXBH 2KX4A 1SBWA 1GMHF 2GMTC 1V2MT 3SGAE 3MTYA 1S6FA 1S84A 3N7OA 1P2JA 2A4GA 1GI8B 1QJ7B 1V2TT 2FPZA 4ABHA 4KTUA 1YWUA 1KLTA 2FOHA 5A0CA 2JETC 1ZRKA 4X8TH 1P57B 2EQNA 1C5OH 2FM2A 3BG4B 3U8RH 2QGRA 2A32A 3O8CA 2GCHG 1COWD 4IN2A 3F1SB 1MKXK 4I8GA 1AFQC 2VU8E 4Y10E 1TGCA 2BY6X 4NA9H 2O8LA 3V13A 1HRTH 1PPFE 1QBVH 4B2AA 4WH6A 1TOCB 1KXDA 1GJ4H 2Z3CA 4LK4A 5FPYA 3BG4C 3QZRA 1SOTA 1ZJDA 2VIDA 1T8MA 1DUEA 3K9XB 3ODDA 1MZAA 4SGAE 5EW1H 1SI5H 3HK6B 1BJVA 1C1TA 1FV9A 4AB9A 1FY3A 3TH3H 2GTBA 1XUHA 1C5MD 4X1NU 1C2LA 1FQ3A 5BPEA 1V2VT 3RXLA 4D7GA 1MBMA 4H42U 5C17A 3ZV8A 4BTUB 2ZC9H 2ZU4A 5DGJA 4F4OC 2G51A 4X6OA 1UTPA 1FUJA 2Y7XA 2OQUA 3V3MA 1XUJA 2ZPQA 1H9IE 1GDQA 3PLPA 4MPUA 1T8OA 2C8WB 1ZSKA 2BD3A 3BEIB 3QGNB 2BMGB 2F4LA 2GCTC 1Z7KA 3BTDE 3LH3A 2ZIQH 3RXEA 1FPCH 1AB9B 1C5NH 1TONA 2KFWA 2ZFPH 2H9HA 1J16A 1HAZB 1O5FH 1J9CH 3MH4A 4BTTB 1D4PB 1RGQA 1HYLA 2GP9B 2OLGA 2ULLA 4I8JA 4DGJA 1EP5A 3PWCA 1SL3A 3GCTF 3VB6A 1Z8RA 2ANMH 2FLBH 2ZQ1A 2BDBA 1SGCA 5B6OA 3D65E 1FPHH 3SQHE 1O3OA 3M35A 3QX5H 4TWYA 4AGJA 3D23A 3ZVBA 1LVMA 1XUFA 2ZGBH 2CGAA 1KYNA 2GD4B 1MTVA 3ZVDA 1NRNH 3LT3A 3VGCC 1OWHA 4CRFA 1OS8A 1NFUA 1Y5BT 2ASUB 8KME2 1AGJA 2ZHWH 1BJUA 5DJ7A 1C1MA 1IQHA 4O03A 4MPWA 5LPFA 3SV8A 3H7TA 2KAIB 2LP6A 1YPGH 1JIRA 1W14U 1GI6A 1FONA 4NZLA 1OWIA 2XCNA 5LPEA 4NIVA 1HIAB 4K8YA 2RA3A 1O31A 1FDPA 3EA8A 1Q3XA 5C1YA 3WWFA 1YCPK 3SV9A 3SUEA 3KEEA 3RDZA 4KP0A 4LZ1H 1W0KD 3KYGA 3SUGA 3U98H 1SGPE 3ZVEA 4OGXA 2BDGA 4DCDA 3EA7A 3TGJE 1P2QA 4K2YA 2BZAA 4X2WA 2GVFA 3RXSA 4NFFA 1A5IA 1UHBB 3V12A 4YT6H 3DCLA 3T27A 1DPOA 2Q1JA 2VWMA 4IMQA 4B76A 4JK5A 4CHAC 2P3UB 7GCHG 1AVGH 1TNGA 2FWWA 1QQ4A 4ZKNU 2VWLA 1A3BH 1HGTH 4ZROA 2BX3A 2PUQH 3KNXA 3ZZAA 5KEDA 4JZEH 3PB1E 4ISHH 3QO6A 1XVOA 1CHOF 1TMBH 1VCQA 1YM0A 4GCHF 3EDXB 1PQ5A 5HYOA 5LGOA 4FUBA 3RMMH 1LDTT 6CHAC 5E0GA 1TGNA 1T32A 1O3NA 1Y3VA 3SU2A 1GHZA 2ZHDA 3VGCB 1ZPZA 5DP6A 1AKSB 1G30B 3BTTE 2XBYA 1G32B 1ZSJA 1OYQA 3BTQE 3M3TA 1GHAF 1DFPA 1GBLA 1ABJH 4UD9H 3P8NA 1QFKH 5EQQA 1IHSH 1C5VA 3ITIA 2ZU2A 3A85A 3EGKH 3UIRA 2TRMA 4TYDA 2G81E 1NROH 5F03A 4ABFA 2ZFSA 1TRYA 1EB2A 2BQWB 2K1QA 1P12E 1O33A 1EJMA 3ZVCA 3BEUA 2ZFRH 1VKYA 2SGQE 4IN1A 1YPKH 1C5RA 2NU2E 3GY2A 1FI8A 3SQEE 3ATLA 1SMFE 4OM9A 1IQLA 3PV2A 8ESTE 5FPTA 5K0HA 1MTSA 1PYTC 4D76A 3VXFH 3TGKE 4WXIA 3AW0A 4D7FA 1BIOA 3IWMA 5KECA 1SGIB 2R2MB 1UTLM 1W2KH 3SU4A 1BTWA 1O3KA 1PPEE 3A8AA 1BBRE 5E2PA 1C9PA 3UWIA 3ZZ3A 1ESBA 2FOCA 3KHVA 4I86A 1YC0A 4ZKOU 2P59A 2RDEA 1YF4A 2PSXA 3A7TA 2B0FA 1DX5M 4MPXA 1O5BB 2J92A 1KLJH 1IAUA 1TALA 4IBLH 4WH8A 1W7XH 5J4SA 2HNTF 2TBSA 4Y0YE 1H8ED 1E79D 3GYLB 3UQVA 2H2ZA 4M7GA 1N6YA 1VCPA 2VIWA 2EY4C 4P02A 4FUDA 1SG8B 2A1DB 5TCCA 4WMFA 1W8BH 1N8OB 2BDAA 1S0RA 4UEHH 4D9QA 1XKAC 2GV7A 1NC6A 3OSYA 2R9PA 1XM1A 2ZDKA 5EQSA 1NZQH 2BY9X 1D9IA 4ZKSU 2WINI 4JZFH 4X6PA 3UB0A 1GHXH 2OP9A 1SC8U 1OYTH 1VZQH 3U9AH 1O3HA 1OP8A 2ODQA 3LGIA 1THPB 3OTPA 4DG4A 3E1XB 4RKOB 3BTME 1GHVH 3TJOA 2GT7A 1XUIA 4BAHB 3LOXA 4F48B 3VB7A 2PTCE 4TT3D 1C5TA 2ZO3H 2AEIH 1GMCF 2ZDLA 3QZQA 3MYWA 1P0SH 2K0QA 5F8ZA 3F2FA 1LHCH 2ALPA 1FJSA 3PMHB 3RUOA 1SR5C 3PLKA 2QC2A 5GPIB 1EZUC 1MQ6A 4H6SB 2IPQX 2ZCHP 4U30A 2KM0A 5DN6D 1LHGH 3F2GA 3TJNA 3JZ1B 1C2DA 2A7HA 1MKWH 2PTNA 3A80A 4I8LA 4DY7B 2SFAA 1NRRH 1QIXB 2BQ7B 4DIIH 3N99A 4X6MA 4E7RG 2F91A 2YMSC 3Q3YA 3SJOA 1FN6A 4FU8A 3B23B 1MU6B 1G9IE 1KXAA 4X8SH 3V7TA 4PROA 1F0UA 3SZEA 4ZUHA 1L4DA 1MU8B 1ZGVA 2ZU3A 3EE0B 1KXFA 3U8TH 3KQBA 2XW9A 1FY4A 3A83A 4X2YA 3SUFA 2BDIA 2ZPSA 4FUHA 5HGGA 3ESTA 1P2OA 3S9BA 4KTCA 5DP9A 1JIMA 3TIUA 1MTNC 2THFB 1UJ1A 3GCOA 3GDUA 3S7HB 1EPTB 4NZQA 1GHAG 1V2RT 4JK6A 3SU5A 1DXPA 3F9GA 3M7UA 1CQQA 1Z6JH 4DW2U 2CF8H 1BDAA 1QR3E 2ZDAH 1K1OA 2P94A 1GWAA 5DP8A 5HM9A 3RXKA 2CV3A 2AGGX 2FYQA 2GJGA 1KY9A 1ZR0A 3M7TA 3LGVA 1A0JA 4I8KA 3L6PA 1FN8A 1OWJA 1NS3A 1TLDA 1V6DA 2G5NA 1UO6A 3E16B 2A5IA 1VITF 2V0BA 3KQ5A 3OE7D 1F0RA 2VIQA 1UTJA 2OC7A 4YESB 1GBHA 1GJCB 1TPOA 1UVOA 2FZZA 7KMEH 1QTFA 1BTHH 1CGJE 1RIWC 2FOGA 3DSGA 1GBTA 1RIWB 1X7AC 1C5YB 4WJG2 2P95A 2WPHS 1P3EA 4F55A 2XOKD 1YP9A 4ASHA 1YPJH 2ZTXA 3T5FH 3P8FA 2H6MA 1BZXE 2FODA 1O3FA 3EYDA 2F9PA 5EODA 1F0TA 3UR6A 1FIZA 3GCNA 5KGOA 2WPIS 2UWPA 2FTLE 4RI0A 3RU4E 3KQCA 2VIVA 2QV1A 2QF0A 2Q6DA 3AAUA 3FKSD 1NRSH 3ZV9A 2OK5A 3TH2H 4NSYA 4GLYA 1SFIA 2ALVA 1C4V2 1K22H 2VVUA 3AVZA 1V2UT 3RMLH 1G36A 1ESAA 2NU0E 2A4OA 1E35B 2FP7B 1ETRH 5L30H 1LQDB 1QCPA 2HGTH 3SN8A 1AU8A 1VJ9U 1Z8JB 1O2GH 3E91A 3VEQB 4R8TB 4TY6A 3U28C 4AORA 5ESTE 1EAIA 1ID5H 3A8CA 3KCGH 4CR9A 3BTWE 2AYWA 1GJ9B 3LGTA 1BTZA 1C2JA 3KL6A 1AO5A 1TA2A 1O3CA 3RXTA 1LVBA 3TU7H 1V2KT 2GT8A 2J98A 1QQUA 1YPLH 5H4IB 2XRCA 3ZZ6A 3GY7A 1QBNA 1LHFH 4B6FA 1GHWH 3RMNH 4RN6A 3SUDA 1PPCE 1BRAA 3RM0H 3UR9A 3LJJA 5EJZA 2ZZUH 1O5DH 3SU6A 3GCHB 2SGDE 1KXBA 2FTMA 4MNXA 2F43B 1N1LA 1MMJN 2BXTH 2G4TA 4FUCA 3TK9A 1F5LA 5FL7D 3PM3A 4FUEA 3BN9A 1O35A 1C5SA 5JDUB 2AMPA 1D3DB 1GJ7B 2FEQH 1SQAA 4I33A 1ZHMA 2M2AA 1G3CA 4Z1MD 4J2YB 1JRTA 1A7SA 3SGQE 2VVVA 2VWOA 2P16A 2V3HH 3MOCA 1SLVB 1SGNE 1NPMA 1BBRK 1IQKA 1O39A 1DY9A 1ELAA 1O2WA 1TFXA 1PFXC 7GCHF 1ANBA 1XMNB 5C0TA 3MMGA 2AIQA 3RXJA 3L33A 3OU0A 4ZHLU 1QRWA 3SNDA 4BANB 1O5AB 4H4FA 4TPYA 2EC9H 2W7SA 3T25A 4Y6DA 1A0HB 2BVRH 4YLUA 4I8HA 4JYTA 4UFEH 2IOTA 4K69A 1HAXB 2R3YA 4K8BA 3MFJA 4Y76A 1IQIA 5EJ1A 3QGJA 1WV7H 2Y81A 3SV2H 3K65B 1A2CH 4NIWA 1K1NA 3HKIB 1ZTKA 1K1MA 1AWFH 3FANA 4IC5A 3RXHA 3ZZ9A 3TGIE 1QB1A 1W0JD 1CHGA 3RXMA 3MWIU 1NY22 1W0ZU 1LPZB 1SHYA 1Y3UA 1GBAA 1O2HA 1C1RA 6LPRA 1ZJKA 1BTXA 1ZHPA 4Y7BA 3S0NA 3KQDA 4BAMB 2YMSB 3SOSA 1SGQE 4RKJB 2GCTB 3F9EA 3RM2H 2WV5A 1AB9C 4YZUA 1P02A 4AGKA 3QUMP 1GVZA 2XBWA 3DSOA 3N7DA 2P3TB 1ESTA 1XVMA 5T6GA 2XWAA 1IHTH 1SVPA 3GS9A 1TNHA 2ZTZA 2FI4E 1CA8B 3TJUA 1SQOA 1P2NA 4XBBA 1O2NA 1BMLA 1GJBB 4GUXA 2SNVA 3LC5A 3UNQA 2R2WU 1TE0A 3PROA 2GMTB 2H1UA 2IJD1 2STBE 1KSNA 4JZ1A 5EPYA 3O8RA 4Y8YA 2WUCA 4O97A 1NRPH 1W3CA 1NU9A 1O2YA 3MH7A 3N7EA 2H9EH 4ZXXH 2BD7A 3WWBA 4XSKU 2Y82A 1Y3WA 3GCTG 1D6RA 1Y5AT 2ZI2H 4D9RA 2PGQB 1DWCH 2FESH 3A82A 1ANEA 2SNWA 3ODFA 1L1GA 1LKBA 2ZHEH 3DA9B 4GSOA 4UFDH 4YO9A 4DT4A 1GBDA 2OQ5A 1W7GH 5DSFA 1ZHRA 1TAWA 2QXGA 4X6NA 1C5WB 4X8UH 4JMYA 3QWCH 5GNDA 2FS9A 4Q7XA 3U69H 4X1RU 2ZCLP 4O3TA 4XDEA 2J34A 1OPHB 3UOPA 2ZHFH 5TJXA 1RJXB 3RXQA 1BB0B 1V2NT 1O2OA 1O2LA 1O2UA 3TK5A 3DUXH 3PTNA 3MH6A 3RXCA 1ELVA 1UVUH 2W3IA 2UUYA 1OWDA 2ZGCA 1B5GH 5C1XA 3B9FH 3OEED 9ESTA 3AW1A 4MPVA 3LIWA 1THSH 4BAKB 1ELDE 2WHXA 2BQ6B 3ZZ5A 3E6PH 1V3XA 2PFEA 1C1QA 2LNCA 4RSPA 3MNSA 1O3EA 1HNEE 3NUMA 4FVBA 5E0HA 2OBOA 3CS7A 1ACBE 3U1JB 2Q6GA 1O5EH 2V7QD 1YCPM 1C5QA 5C0UA 3SU1A 3OYPA 2W5EA 4Y7AA 2H5DA 1UTMA 2XC4A 3SJIA 1F5RA 1OP2A 1FY1A 1QRZA 1ORFA 1DANH 4FXGH 2VNTA 1YLCA 1H8HD 1F92A 1Z1IA 3Q77A 3CNRA 3KYFA 2QF5A 2B5TB 1B0FA 1P9SA 5EJLA 4ISLA 4NWKA 1ZOMA 5JBTA 5HIZA 4DVAU 1AE8H 1GL0E 2BHGA 3BTEE 3FFGA 3FP7E 3RXRA 3FN8A 4Q63A 2KCYA 1O3GA 5EXMA 1ZMNA 2QYIA 4X0WU
chains in the Genus database with same CATH topology
1P06A 3S9CA 2Z9IA 2A45B 1UVPA 4ISNA 1O3PB 1UMAH 3CS0A 1P01A 1ZPCA 1EX3A 4ABDA 2AMDA 1ANCA 5K7RA 2J38A 1BUIA 3A88A 1UTKA 2TIOA 2CF9H 2HVXA 2ZHQH 5BRRE 1LHDH 1L1JA 4Q7YA 2BVSH 2D8WA 1EQ9A 4Q80A 4A92A 1FIWA 2CN0H 1H4WA 1LKAA 5AF9H 1GI5A 4TWWA 1QL9A 3K6YA 5C3NA 4MQAA 1DITH 2PSYA 2VH6A 2W7UA 1MAXA 1C1WH 1C2EA 4KELA 2WV4A 1ELEE 1GI2A 2HOBA 5ABWA 2OC0A 8GCHF 1VR1H 3M5MA 6GCHG 4GVUA 2B7DH 2J95A 4O9VA 5E8EH 2SGEE 1RS0A 2AGIX 1MTWA 3BIVH 3MNXA 4MG3A 5EU8A 4MLFB 1CGHA 4GHTA 2XCFA 1NFXA 4JYUH 2EA3A 3MU1A 1TNIA 1O2PA 3QDZB 1DE7H 4Z6AH 3QK1A 1GCTC 1CU1A 1G3BA 3MU4A 2O8MA 2VGCC 1ELFA 4WMDA 5T6FA 3GOVB 1AFQB 1UK2A 1GL1A 2FX6A 1TYNA 1YGCH 2BD4A 4ABBA 4WF8A 1O2XA 1PQ8A 4FUJA 5L2ZH 3S69A 1JOUB 1O30A 2TPIZ 3SHCH 3ATIA 1EJAA 2QY0B 5JPMH 1S83A 4BOHA 1EAXA 2VJ1A 1OWEA 8LPRA 2RDLA 1EZXC 3HPTB 2Y6TA 4XFQA 2BD2A 2FI5E 4NCYA 4K1EA 2ODYB 1CSOE 1EPTA 1QHRB 3R0FA 1XXFA 1O37A 3TJVA 1O3BA 4XBCA 3NKKA 3UUZA 4GPGA 3EQ0H 3TNTA 5F6MA 3ATMA 3OY6U 3BTHE 1GHBG 1YPEH 1S6HA 2GZ9A 2ANYA 3BTFE 3C1KA 2Z3EA 1KDQA 3B8JA 2I6QA 1VCWA 2OC8A 1K1LA 2ZA5A 1DVAH 1QL7A 2P93A 5FXLA 1LCYA 5PTPA 5A0AE 2M5TA 1BMAA 2FS8A 2WPLS 4CBOA 4HZHA 1HAGE 1QURH 3BG8A 1F2SE 2P8OC 1O2TA 4KKDA 5A09A 2XNIA 2G52A 3PMAB 1DLEA 2BD5A 1P04A 2QF3A 1TQ0B 1TX8A 3L3TA 3RXGA 4A1XA 1AZZA 2ZDNA 1TBRH 3M5LA 2F3CE 3MU0A 4LOYH 1Q31A 1O36A 1HFDA 2KAIA 1AI8H 1YPHE 4MNYA 3T28A 1SGFA 2BM2A 3SJKA 4AFQA 1H9HE 1BT7A 5A8ZA 2P8OB 5DKMA 1YKTA 1FXYA 2C8XB 2C8YB 3M61U 2HALA 3RMOH 4YOGA 1DY8A 2TGPZ 2R3UA 1PPHE 1C1OA 2C8ZB 1GMHG 3F6UH 2QXIA 2XBVA 3QTOH 1DXWA 1O2MA 3DFLA 3E90B 5EGMA 3P17H 2FX4A 5GCHG 8GCHG 1ABIH 5AVDA 1GJ6A 3I77A 1ZSLA 4MTBA 4Y11E 4U01A 5GXPA 1K21H 4TY7A 4ZH8A 4UFFH 2FMJA 3O8BA 3URCA 1HAHH 2ZF0H 1GMCG 4MVNA 4E05H 1NM6A 1NU7B 1RFNA 3P8OA 1L2EA 1GI9B 3AASA 2ILNA 1FY8E 1GGDC 2ZFFH 2D2DA 1CO7E 3RXIA 1C2FA 3P95A 3PMJA 1ZPBA 2HPPH 1SLWB 1O2QA 2EI8A 1C5ZB 1IOEA 3M37A 5CMXH 1HCGA 3UREA 1GJAB 2F9VA 2Z9KA 1KLIH 2PV9B 2OINA 1ARBA 3P92A 2Y7ZA 1W10U 3UFAA 1O5CB 1GI7B 3FZDA 1AQ7A 3TVJB 2ZWLH 4CRDA 2FYRA 3MU8A 2ZFQH 4K1SA 4Y8XA 2OBQA 5ETXA 5C5NA 5C67A 3SW2B 2XXLA 3U8OH 3VB5A 2A0QB 3GY4A 4E7NA 5JYIA 1TABE 4AYYB 4U32A 1OSSA 3PTBA 4AFUA 4TPIZ 2ZDVH 1EASA 2TGTA 1BTYA 1T7CA 2FDAA 4NA7A 4B71A 1NN6A 2OD3B 1A1RA 1GBIA 3VB3A 2BZ6H 3A7YA 1ZTLA 3A7WA 2Z9JA 1DOJA 1SGYE 1JRSA 1SGRE 1A4WH 3RLWH 2UWOA 2CXVA 1CT4E 1AVWA 1TNJA 4ZKRU 3MI4A 3RXFA 4WY3A 4BXSA 4HGCA 3BEFB 1EUFA 1GI4A 3AAVA 4Y79A 3K2UA 2FOBA 4B74A 2PKAA 4X2VA 1E36B 2ZQ2A 2ZG0H 2ZGJA 1NRQH 5GJ4B 1RTKA 1YBWA 1T4UH 1O3LA 2AS9A 2G5VA 2G4UA 6ESTA 1HJAC 3EAJA 3M3VA 1GBBA 5AFYH 3SJ8A 5FAHA 2A2QH 3SU3A 1Y3XA 2Y5HA 1L0ZA 1O2VA 2ZP0H 1GG6B 1ETTH 1YYY1 1TX7A 4THNH 2O8UA 1O34A 4ZHAA 4X1PU 5F8XA 2ANKH 4X8VH 1DM4B 4CBNA 1HAOH 4ISIH 1CBWB 3HGPA 3PO1B 1S5SA 1C5XB 4BNRA 3M5OA 3LONA 3F9FA 3STIA 1LMWB 2PLXA 2WPKS 3A8BA 2FOAA 1T31A 2VWNA 2BDHA 1TBQH 5GDSH 3SBKA 1C1SA 2JH0D 5GCHF 1TMUH 2YNBA 1ZLRA 1WSSH 1C5LH 1C2KA 1Z8IB 2BD8A 5JBCS 1E37B 3RXPA 2D1JA 1OWKA 2F9OA 3SNBA 3SZNA 1BTPA 2PKSB 1BHXB 1C9TA 5JB8S 2G00A 3WY8A 1DICA 1XKBC 1BRCE 1D3TB 4AX9H 1E0FD 5AFZH 2A5AA 3FP8E 1A46H 3MH5A 3QTVH 5G4BA 2IN2A 5JB9S 1KDQB 4WMEA 2F9BH 2JH5D 3LKWA 4NSVA 4K5ZA 1WBGB 3SV7A 1AZ8A 1WTGH 1UTQA 5L6NH 2UUFB 5JBAS 3HATH 1RTLA 1GBMA 1C5UA 4AN7A 1G37A 4IMZA 1SSXA 2G55A 6GCHF 1AY6H 3RC6A 3V0XA 1SGFG 1BQYA 1ANDA 4DJZB 2SGAA 4DURA 1V2WT 1BMMH 5EW2H 1C2MA 3UY9A 3H7OA 3O8DA 2O9QA 5CHAC 5I25A 2FI3E 5J4QA 2CMYA 3ZZ7A 5EG4A 2BYAX 1TIOA 1FAXA 1KXCA 3VXEH 1DUAA 2WYJA 3SV6A 2SGFE 1EAUA 3MU5A 3NZIA 3KGPA 3ZVAA 1TMTH 5HM2A 1GI1A 3SHAH 1Y59T 3D62A 5FPSA 1KTTB 2TGAA 3QN7A 3A7VA 4UONA 3GICB 1T4VH 4I32A 5DP3A 2C93B 1VGCB 1O5GH 4K1TA 5FCKA 3P70B 2GZ7A 1DWDH 4YTAA 1MH0A 2HNTC 3CP7A 4MNWA 4OS4A 2EI6A 3PLBA 1IQGA 3HGNA 4AZ2B 2VINA 4YLQH 4HFPB 3DD2H 4BAQB 3ZZ4A 3I29A 3NCLA 1WAYB 1O3IA 1HBTH 1NFYA 2NWNA 1IQJA 1TNLA 1V2ST 1NESE 2AERH 2NU3E 3ZVGA 2GX4A 2AH4X 2C3SA 1UHBA 3T2NA 1OOKB 5ESBA 2O8TA 1FAKH 4OS6A 1DSTA 1T8LA 1JXPA 3Q00A 1GJ5H 1FLEE 2Z3DA 1LO6A 1MZDA 5A8YA 5F8TA 3P8GA 5EQRA 5EOKA 1BRBE 1WYKA 5FX6A 2GDDA 3A84A 3M7QA 1C1UH 1ELTA 1KIGH 3RU4D 3W95A 4B2BA 2ZGXH 1OKXA 4Y0ZE 5FX5A 1MD7A 4SGBE 1CE5A 3OTJE 1A3EH 1JWTA 3BTGE 2IPHA 4F49A 1HV7A 2Z9LA 1K28D 1P3CA 3E0NB 1TRMA 1HPGA 4ZHMU 2Y80A 3LJOA 5AHGH 2BOKA 2V35A 1W12U 2C90B 2PUXB 1J8AA 3SORA 1SPJA 3SNCA 3MNBA 3A7XA 1GVKB 2BDCA 2XC0A 2B9LA 3OY5U 2QA9E 1GDUA 2DE9A 1QNJA 1EKBB 3RXOA 1QB9A 1EB1H 1NFWA 1BMNH 1V2QT 1ELBA 1TX6A 4XOJA 1UVSH 2AFQB 5EXLA 1XUGA 1Z8GA 2RCEA 1O0DH 1MBQA 4HI3A 2RA0A 5FBIA 2V6NA 1H8DH 3PWBA 2ZCKP 1D6WA 7ESTE 1Y3YA 4A1VA 1YPMH 4CH8B 1F7ZA 3QLPH 3RU4T 1VITH 3PYHA 2Z6BD 2GCHF 2VH0A 4ISOA 4Y71A 1EXFA 3T62A 3NWUA 1LVOA 3I78A 3DT0H 3U1IB 1CVWH 3A7ZA 4IW4E 2DUCA 1TB6H 2PW8H 1ZRBA 1O2JA 4OS7A 1RRKA 1S82A 3ZZDA 1HAPH 1LHEH 4OS2A 9LPRA 1GBKA 3ZVFA 1WU1A 2AIPA 1RD3B 1E38B 1ZYOA 5T3HA 4ZMAH 3E0PB 1GG6C 3GYMA 1SOZA 4E06H 1QB6A 3ZZ8A 1ZMJA 2BX4A 3LGYA 1C1VH 1HJ8A 2BLQA 3FAOA 5T6DA 2OTVA 4ABEA 1A5HA 1HAVB 1TBZH 2ZEBA 1D3QB 1GHBF 3MHWU 2H9TH 4B1TA 4AFZA 1GJ8B 1B0EA 4HTCH 4A6LA 4NG9H 5E2OA 1O2IA 1TOMH 4IS5A 1OXGA 4FUGA 4OGYA 2Z94A 4AG2A 1EZQA 1GI3A 3LDXH 1S85A 1P11E 2GZ8A 3D49H 1ZZZA 1QJ1B 1V2OT 3P6ZB 1SGTA 1TRNA 4UE7H 4NGAH 4NA8A 4K60A 1HJ9A 2HRVA 4ABJA 3TH4H 1AUTC 2BXUH 1V2JT 1MUEB 3OX7U 4FUFA 1CGIE 1XX9A 3MNCA 2BLOA 1VGCC 1Z6EA 1GMDG 2EEKA 1H9LB 3A86A 4FU7A 1XUKA 1ZGIA 1F5KU 2CHAC 2ZTYA 1ARCA 4XBDA 1AD8H 1EZSC 1Y8TA 1LTOA 1D3PB 1VITG 1OP0A 3GY5A 3T26A 1TPAE 2STAE 1WOFA 3Q3KA 3R3GB 3LC3A 1JBUH 2ZU5A 1C2IA 1PYTD 1W0YH 2FOMB 4B75A 1FY5A 1Y5UT 2R0KA 1AMHA 1UTOA 1M9UA 2XTTB 1GBJA 1IQMA 1A0LA 4BTIB 3SJ9A 1P05A 4MDSA 1GPZA 1SB1H 2WPMS 5DK1A 3BSQA 2FLRH 3KQEA 2A5KA 1P2IA 3TPIZ 3JZ2B 4Q7ZA 4AOQA 1QBOA 1TGBA 1TQ7B 1K9OE 5E0JA 1BBRH 2BTCE 1BOQA 1P2MA 3KIDU 3S7KB 3W94A 3URDA 4WXVA 3A89A 5JBBS 3A87A 1EATA 4D8NA 2VIOA 1HAYB 1MTNB 1CT0E 1TA6A 1HXEH 1W13U 4KGAA 1CA0C 3TK6A 3LPRA 2HWLB 4XE4A 2W26A 1P9UA 3BIUH 1KTSB 1EOLA 2P3FH 4U2WA 5A0BA 1O32A 3MO9A 1H8IH 1QY6A 1UCYE 4VGCC 1P03A 1SFQB 3T29A 3RC4A 2PKAB 2J94A 3E8LA 1MCVA 4BXWA 1N6XA 1J15A 1PPBH 3MO6A 1J17T 1NTPA 3Q3XA 2WPJS 1GJDB 2R0LA 2FIRH 4FU9A 5TCAA 1HAIH 5FCRA 1IQEA 1BTUA 1Z71A 2O8WA 3TITA 1H1BA 4NFEA 3ZZCA 1UCYK 2OUAA 4JZDH 5EPNA 2BY5X 6CHAB 2B8OH 2XBXA 4AFSA 5HXFA 1AE5A 1EP6A 3NPSA 4I7YH 3DFJA 1AN1E 1CBWC 4R0IA 1SLXB 1Q2WA 1IQFA 3ZYDA 1GBEA 2XC5A 2UUJB 2BD9A 1MAYA 2GKVE 3IITA 2QIQA 1ELGA 2Q6FA 1RTFB 5EXNA 3LU9B 2A4RA 1G2LA 4AYVB 1NO9H 2Y5FA 3SO3A 1MKWK 5C20A 3KN2A 2G8TA 1O3MA 1BCUH 2VVCA 1C1PA 2HNTE 4X1SU 3VPKA 1GDNA 3EA9A 5SGAE 5A2MH 1PQAA 3GY6A 2SGPE 2BY8X 1W11U 5LPRA 1HLTH 1QL8A 1NT1A 2V3OH 4YT7H 2Y5GA 2ESTE 3Q76A 1LPKB 4X2XA 4B73A 1QJ6B 1EOJA 4K3JA 4BAOB 1DWEH 5GWZA 1BA8B 1Z1JA 4CREA 1IQNA 1XXDA 3UNRA 4OS5A 1P09A 2QXJA 2JH6D 4YOJA 2F9NA 5DP7A 1BITA 4O3UA 2ZFTA 3G01A 1AIXH 4Z0KA 2EI7A 1PQ7A 4A5TS 1C5PA 1ZTJA 4LZ4B 1MCTA 3PMBB 2QXHA 3KF2A 4DT7B 4IGDA 1O38A 1LPGB 1TPPA 1BHXF 4ABGA 4J1YA 1O2ZA 3S9AA 4CRAA 1AUJA 3GISB 5FBEA 2QAAA 3BV9B 1HIAA 2GDEH 4NWLA 1YCPH 2H5CA 3E3TA 5A8XA 3SNAA 1P10A 1K1IA 2XYAA 3RXAA 4GHQA 1L1NA 3FZZA 3ATKA 1HUTH 3C27B 3RC5A 1UCYH 2Z7FE 5C2ZA 4WVPE 1LVYA 1S81A 1SQTA 1G2MA 1MD8A 2FOEA 2F83A 2PR3A 3BTKE 2VGCB 2AMQA 2UWLA 3K6ZA 3LGUA 3M3SA 3PO1C 5L2YH 3HKJB 1UVTH 3UOUA 5DP4A 1PJPA 2LPRA 2PWXA 5FHTA 5LH8A 1G3DA 4FUIA 1TGTA 1DSUA 2FOFA 1C4U2 3SU0A 2RG3A 3RXDA 3RP2A 1L4ZA 1FNIA 3TLOA 1UK3A 1ZMLA 3GY3A 1AFEH 1N8OC 1AKSA 5CHAB 2D26C 2W3KA 3GCHC 4ZXYH 3M36A 2PKSC 1UTNA 2J9NA 3H5CB 4FVDA 1E34B 3FVFB 1PPZA 1C1NA 1C2HA 2A7JA 4Y8ZA 3UQOA 3RXBA 1CHOG 2QCYA 1GHYH 1TNKA 1SHHB 2TGDA 2WYGA 1QGFA 1V2LT 2VB0A 4AG1A 2NU4E 1MQ5A 3GDVA 1DS2E 1DLKB 4INLA 2J2UA 1K1PA 4DIHH 2OC1A 4INKA 5C1UA 1A5GH 2ZPRA 7LPRA 1AWHB 1FMGA 1PPGE 1EPTC 1SGDE 1RXPA 3RXUA 4NIXA 2IJOB 2OCVB 1C2GA 3F68H 1V2PT 3GY8A 2CHAB 2ZKSA 1P2KA 4JZIA 1WTHD 3ATWA 4B2CA 2A31A 1GCDA 4DOQA 4A7IB 1THRH 1GI0A 4GCHG 1DWBH 2HLCA 3STJA 4CHAB 3M5NA 3LGWA 1HAVA