2O9QA

The crystal structure of bovine trypsin complexed with a small inhibition peptide orb2k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title From protease inhibitor to antibiotics: single point mutation makes tremendous functional shift
rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o9qA02
1GI5A 2ASUB 2P59A 1NS3A 2G81E 1T8MA 4Q80A 1P57B 4ABJA 3KQCA 3BF6H 1UCYH 1QCPA 3GCOA 1C4Y2 2GT7A 1OXGA 3SQHE 2ZU1A 4X1SU 1GMDF 1FUJA 3QTOH 2K1QA 2SNVA 2FOBA 3OYPA 1QRZA 1GMHG 2FI4E 1N6XA 2PKSC 4NFEA 2Z3DA 1NRRH 2ZI2H 1OS8A 1PPEE 1T4UH 3SU1A 5FBEA 1BCUH 1YPKH 1TOCB 3SHAH 3VEQB 3UTUH 3MO9A 2BD8A 3M5OA 2H2ZA 2O8UA 2FPZA 3A8DA 2FOEA 3E0PB 1ZSLA 1OWIA 1W7GH 1BIOA 1NT1A 3RMLH 1KXAA 1OPHB 3KGPA 3A86A 1NTPA 1CSOE 4FUJA 1Y3UA 5E2PA 3TNSA 1QQUA 1KYNA 1LVOA 2VIVA 3DFJA 2QF3A 2XRCA 4Q2KA 1TQ0B 1UTKA 1AUJA 1HIAA 1A46H 4K8BA 1GI1A 3JZ2B 3KCGH 1E37B 2F3CE 2QY0B 1EKBB 3A8CA 3VPKA 2AGEX 3S9BA 1SG8B 1UCYE 4B2CA 3U8TH 4LXBH 1XUJA 3PM3A 4I7YH 5EXLA 1O2WA 1C5YB 1SMFE 1C5WB 1AVXA 5E8EH 3ELAH 1K2I1 3KIDU 3VB6A 3RDZA 1NFXA 7ESTE 2WUBA 1THSH 2ZDMA 1YKTA 2BD7A 1HAXB 1YPJH 4Q7ZA 3E6PH 2Z9JA 3IITA 1WYKA 2BLWA 4WY3A 1O5EH 3VXFH 7GCHF 1W11U 1GHYH 2BVSH 3GCHB 2A4GA 3SJIA 3C1KA 5AFZH 1BMNH 2PKSB 4R0IA 1HPGA 1AB9C 2BQWB 3PMAB 2PGQB 1O2OA 4B74A 3P8FA 1SOTA 1XXFA 1NFWA 3RC6A 1SGDE 1TGNA 3W95A 2PKAB 1MBMA 3O8BA 4JMYA 2ZDKA 1C1QA 2XWBI 2CV3A 6LPRA 1SFIA 1O2RA 1TRYA 2F9BH 1F0TA 1IHTH 2J2UA 1GJAB 4SGAE 4OS2A 1ZPBA 4A6LA 1P2QA 2O8WA 4D76A 2ZCHP 4Y8XA 1TBZH 1GJ8B 2FWWA 3CP7A 3KQDA 2VH6A 1O5AB 2AMQA 2FTMA 1Q3XA 1Y59T 2W26A 4CRCA 2ZECA 1HAPH 1YM0A 2OQ5A 5T6FA 3U8OH 2FMJA 1BJUA 1QTFA 3P92A 3NXPA 2BB4A 1GBHA 4THNH 5C20A 2Z9IA 1O3NA 5EU8A 3NK8A 4HTCH 3TVJB 1XM1A 1Z1IA 1GHBF 1UK2A 1IQKA 4WVPE 1MTWA 2CMYA 1FY4A 2ZA5A 3BTEE 1C1VH 4NZLA 2AYWA 4DIIH 9ESTA 2F91A 4XSKU 1S6HA 1BTHH 1RD3B 1DXWA 2RDLA 3ZZ6A 2P3TB 4ISOA 3ZZ3A 1DUAA 3I77A 1XKAC 4K3JA 1AB9B 1VITF 1TMBH 3L6PA 3ATWA 3M5MA 2ZKSA 4GHQA 2C8ZB 2G8TA 4INHA 5JYIA 3ESTA 4ABAA 4KTUA 1TPSA 3SNEA 1UTLM 2BDCA 4CBNA 2LNCA 4BAKB 4B71A 1FIZA 1HAZB 1S85A 1TOMH 5IDKA 2TGDA 1RTLA 3BIUH 2XYAA 1BRCE 4FU8A 1QY6A 3B9FH 1HYLA 2ZQ1A 2D2DA 4X1NU 1GGDC 3EAJA 2RA0A 2ZTXA 3RXJA 5E0GA 4A92A 1TALA 1PJPA 3U98H 1S82A 2ZHEH 1VGCC 3S69A 1IQMA 3T28A 1D9IA 1SOZA 3VB3A 3BEUA 4WXVA 1AFQB 4RKOB 1C5QA 4I8GA 8GCHF 2Z3CA 1WV7H 1C9PA 3VGCB 4X2WA 2WPJS 1GBFA 1SGQE 4U2WA 1O3LA 3RXCA 1O5BB 4K1EA 4Y7BA 1O5CB 2FX4A 3SI3H 4Y79A 1LMWB 1V2TT 2VU8E 2XW9A 4IC5A 5J4QA 1CGHA 1VCWA 3RXSA 5ABWA 4TYDA 2SNWA 1ELTA 1FIWA 1O30A 3OTJE 3RXFA 1MTVA 1C2GA 1LQDB 2BX3A 1UVOA 1O3JA 3DHKH 2BLOA 4NA8A 3GCTF 1HBTH 2GCTC 3BTKE 5ESBA 4GAWA 2VVUA 1UTPA 1SSXA 4LZ1H 2A7JA 5C1UA 1MKWK 1GJCB 4FUHA 1O31A 1TFXA 2QXJA 2G5VA 4HGCA 3URDA 4VGCC 4X0WU 1QJ7B 1A0LA 3BIVH 4ZUHA 3FFGA 2BOKA 2AIQA 1OP8A 4FUIA 4Q7YA 2VGCC 1T32A 1EZXC 1F7ZA 3C27B 1EAUA 1GGDB 2SGDE 1GMCG 1D4PB 4X6OA 5A0CA 2ZZUH 1TNJA 5C5OA 2JH6D 1DITH 1ABJH 3MO3A 2OC0A 3T2NA 2QYIA 3Q00A 4JZEH 4ABHA 3SGQE 1BJVA 5EOKA 1O3KA 4XE4A 1GJ6A 1HLTH 3BTDE 1C1NA 1P2IA 2EI6A 1C5SA 1ZMNA 4FU7A 2PWXA 5HM2A 2C8WB 1K1MA 2J95A 1QJ6B 3LGUA 1RIWC 1A61H 4GPGA 2UUYA 1W13U 2A45B 3GDSA 3ZZBA 3SORA 3TK9A 3LT3A 1V2ST 2ZQ2A 1SLVB 1S6FA 1MKWH 2FS8A 2GMTC 1EP5A 1TRMA 2XC0A 1PPHE 1H9HE 1K9OE 3BN9A 3PYHA 1V2PT 1TRNA 5A2MH 3UQVA 2P93A 4X2XA 1ZHMA 4YESB 3M7UA 1ELFA 1FAKH 2BQ7B 4AFUA 1LDTT 4B2AA 2AEIH 2C3SA 4CH2B 3QZQA 3SJ9A 1KDQA 3RLWH 3FP6E 2WPMS 2ZGBH 1GBTA 1LTOA 2GCTB 5GIBA 1LKAA 1BTWA 1O3EA 1F2SE 3HATH 2A5KA 2CHAC 2VVCA 6ESTA 1H1BA 2ANMH 2GZ7A 4VGCB 1BHXF 4Y8YA 1P3CA 2QGRA 3Q77A 1ZJKA 4R8TB 1GWAA 2VGCB 2BXUH 3A7TA 5E2OA 1AZ8A 5JBBS 2ZGXH 4CHAC 4X1RU 4DW2U 1KTTB 1ZOMA 3U8RH 1UJ1A 5C3NA 1Q31A 3LJJA 4RSPA 1TNIA 3O8CA 2HPPH 2ZHFH 1D3DB 1BA8B 2DE8A 1C5RA 1TGCA 1CVWH 3KF2A 1DT2A 1HXEH 2H5DA 2C93B 2ZCKP 5GCHG 2ODQA 2HWLB 1E35B 1AFEH 1HJAC 2R3UA 4SGBE 1QRWA 3B8JA 1AVGH 1ELVA 1Y8TA 1Q2WA 2P8OC 2OINA 3UNSA 4XDEA 1C5LH 1RIWB 2ZC9H 5JPMH 1PPFE 2BD4A 3PV4A 4ISHH 4FUFA 1C5MD 1WQVH 4FUEA 2FOHA 1LVMA 3U1IB 4OS7A 3P8NA 1FY1A 2KAIA 1KTSB 1RFNA 1P2MA 3OY5U 3T5FH 2M5TA 1C1UH 4Y11E 4WWYA 2Y81A 3TK6A 3UWJH 2ODPA 2ZPRA 2PW8H 4X1PU 5HGGA 1K1JA 2ZDLA 2Z6BD 1O2VA 1ZLRA 1NC6A 4Y6DA 2Y5HA 5ESTE 3P8OA 3LOXA 1LHDH 1AZZA 1TQ7B 2QIQA 2WUCA 3TITA 2D1JA 5CMXH 1PYTD 1ELCA 2A4OA 2I6QA 4AFSA 2A1DB 1ARCA 1CU1A 1WUNH 1SC8U 5C5NA 1QJ1B 3AAUA 2RA3A 4I8KA 3W94A 1OWDA 4GLYA 4D9QA 2VIPA 2PUQH 1NRQH 1GCTC 1AE8H 1LHCH 2HRVA 4CHAB 3K9XB 1Z8IB 3E8LA 2PSYA 1W3CA 3BTWE 4CRFA 4K69A 1DUEA 3L33A 3GICB 1HJAB 3MU5A 4ISLA 2OXSA 3A89A 1IQJA 5HM9A 1FV9A 1GVZA 4I33A 1YPMH 2P8OB 4IN1A 4O97A 3SI4H 1W12U 3P6ZB 3ZZ4A 2FI3E 1C2DA 6CHAC 1GBDA 2ZFSA 2R9PA 4FVDA 2VIWA 1DOJA 2Y6TA 3ZZ5A 1TMUH 4JZFH 3B23B 3LDXH 2FLBH 2SGFE 1NESE 2XC4A 4YT6H 1QHRB 1BTZA 2BX4A 1O2UA 1FXYA 3BG4C 4JYTA 2ZFTA 3Q3XA 4KTSA 2VIOA 3NZIA 1FMGA 1S83A 1EASA 1PPZA 1W10U 4Y0YE 1CT2E 2XCFA 5JBAS 2PTCE 1BBRK 1RTFB 2WINI 1NO9H 3HKJB 1SGFA 3IG6B 2ANWA 3BEFB 3H7TA 2WPKS 3A8AA 3ZZAA 3ZVFA 2OTVA 1KXCA 3RXQA 1GBAA 5HYOA 1J9CH 8LPRA 1O5GH 4MPXA 2IJOB 4CBOA 1NU9A 1GI8B 4UFGH 3PMBB 4WXIA 3MNXA 2FOMB 3UR6A 1BMLA 2OCVB 3SOSA 1GCTB 2J38A 2Y7ZA 1OWHA 2AGIX 5EXNA 1O2NA 5FX5A 1TAWA 2STAE 3SJ8A 7LPRA 3T29A 1FONA 2OP9A 1DANH 4DT7B 3HGPA 4CRBA 8ESTE 3ZVAA 2V3OH 2FOAA 2G5NA 2TGTA 2O9QA 3QWCH 5DP3A 5F03A 2H9EH 2XXLA 5CHAC 2QXIA 4UONA 1CHOF 3IWMA 2ZU3A 4GCHF 3SUFA 1QA7A 2G52A 2ZDVH 3SJKA 1G9IE 2FYQA 1K21H 1KLIH 4U30A 6CHAB 1JRSA 1GI3A 3QUMP 4DY7B 1ZHRA 5CE1A 3QX5H 1UHBB 1NRNH 4X2YA 3UQOA 3ZYDA 1VR1H 4Q7XA 1TYNA 4CRGA 2NU2E 3BG4B 4B1TA 1K1NA 1MU6B 3GCHC 2BXTH 4NCYA 1BTXA 1GHAF 3QDZB 3BTFE 1NM6A 1J16A 1O2KA 2PUXB 1ARBA 3RMMH 3BTQE 2SGQE 3HKIB 1AKSB 1BQYA 1BTUA 1GHVH 1AU8A 1FN6A 2Y80A 2Q1JA 4CH8B 4E7RG 4ZXXH 2FLRH 2AGGX 1YF4A 5L6NH 3TGKE 1OWJA 1K22H 1QNJA 5F8XA 3RXEA 2QV1A 2HPQH 1TGBA 1GMDG 2OC7A 1OYTH 1PPGE 1YCPK 2HGTH 1HRTH 2B8OH 2ZHQH 1EPTC 5AHGH 1BBRE 3A88A 1ZGIA 3RU4D 1A7SA 1C9TA 3U1JB 3PTNA 3SZNA 2VWNA 1BMAA 3ODDA 1AI8H 5CHAB 1BRUP 1BTYA 1ETSH 3M35A 5T3HA 3ZZCA 3M36A 3PB1E 2F9UA 2YOLA 5JDUB 3RMOH 3Q3YA 3ATKA 3EQ0H 4K5ZA 3RU4T 2BDHA 2Z7FE 2QCYA 5DP7A 1FI8A 2THFB 1V2RT 1GBMA 1J14A 1S0QA 2BHGA 3AVZA 2H1UA 3P70B 4BAOB 2G55A 4HZHA 1RTKA 3MH6A 1P05A 4BXSA 1MTSA 1PQ8A 1YCPM 4FUCA 1IQLA 1LCYA 4KKDA 3KQBA 4MVNA 1O3PB 1G3DA 1HNEE 4AG1A 4YOIA 2Q6GA 1IOEA 1C5PA 2P94A 4Y76A 4U01A 1ZRBA 1HJ8A 4H6SB 3RXPA 1YBWA 2Y82A 3TPIZ 5SGAE 2D26C 2GX4A 5TCCA 1N1LA 5EW2H 1GI9B 1F0RA 4WMDA 4X2VA 1X7AC 1ZTJA 1T8NA 7GCHG 1JIMA 1EPTB 2Z9GA 5I46H 4BXWA 1E36B 3RXTA 4BTTB 3GISB 1OSSA 1EAIA 2P3UB 5EODA 2ALVA 4YM9A 2ZIQH 1TNHA 3S7HB 5JB9S 1Z8GA 4DJZB 3AW0A 2Q6FA 1DY9A 1SGNE 3RXLA 4CRDA 1C5XB 3VB5A 1AFQC 5AVDA 3E90B 3RU4E 3SU4A 5K0HA 1RGQA 3KL6A 3S9CA 3HGNA 2BY6X 1OWEA 1TA2A 1EJMA 2QF0A 4KGAA 3ZVBA 3VGCC 2FYRA 1P03A 1HAVA 1P2JA 2UUKB 3SO3A 5FHTA 2HALA 2BY9X 1UVPA 1CO7E 3SNAA 4ZKNU 1UHBA 1Y5UT 5TJXA 2QN5T 5GWZA 5L2YH 1AY6H 3N7OA 2AMDA 3ZYEA 1JOUB 1DX5M 1E38B 1TB6H 4YO9A 4K1TA 2ZDNA 1GJDB 4I8HA 1FN8A 1GHBG 1OOKB 4A1TA 3NCLA 3MTYA 4ZXYH 1L1GA 1ELEE 3RP2A 1FDPA 4AN7A 1AKSA 5FCKA 1W0YH 2A4RA 3T25A 3CENA 4I8LA 1UTMA 1ABIH 1Y5BT 3UOPA 3K65B 2J94A 3BTTE 2BLQA 1AQ7A 4DG4A 3MNBA 4ZHLU 3ATIA 4NSVA 3MH7A 2ESTE 1VITG 1V2MT 1Y3VA 1GDNA 1TX7A 1L0ZA 1YLDA 3DA9B 2R0KA 2W3KA 1TX6A 3LGYA 4H4FA 4D8NA 4QT8C 1PQAA 1VCPA 4FXGH 3STJA 1PYTC 2Z94A 1CA8B 3P17H 1Y3XA 1MZDA 4DVAU 1TNGA 1N6YA 3K2UA 1FAXA 2AH4X 2JETC 3A81A 3RC4A 2BM2A 4XBBA 1QL9A 2XBYA 4OS1A 3FZZA 2V6NA 3SV9A 1MQ6A 1GI0A 1MBQA 2A31A 2BD3A 2VB0A 3EE0B 1O35A 3MO6A 3QN7A 5H4IB 2FOCA 3TH3H 3SUDA 2FX6A 2ZP0H 1DDJA 2R2WU 1K1IA 5C1XA 3DD2H 1KXDA 4XFQA 4IS5A 3ZVGA 1P01A 8GCHG 3MU8A 1O2PA 1NRPH 3BTHE 3E3TA 4GHTA 1F5LA 5EXMA 1MUEB 4Z0KA 3QGJA 4AX9H 4X6MA 3VXEH 1OYQA 1LHEH 2WV5A 2VVVA 3ENSB 4YOGA 1CGJE 3I78A 1CA0C 2QA9E 1PPCE 1VJAU 1IQFA 2GCHF 2A2XH 4BAQB 2PKAA 1V2NT 1V3XA 1GPZA 1O37A 4NGAH 1GI7B 2TGPZ 4ABIA 1P9UA 4ZHAA 4B75A 3EA9A 2SGPE 4MNWA 2ZCLP 2AFQB 3VB7A 1GBCA 1GBEA 1AN1E 1EPTA 1TE0A 3GCTG 3MU0A 1W0ZU 1C1TA 3LGWA 5E0HA 3BV9B 3LKWA 4DOQA 1HV7A 1IHSH 3BTME 3M3VA 3ATMA 1LO6A 1MD8A 1P8VC 2CXVA 1MZAA 2C8XB 1OWKA 2BMGB 1P2NA 1DICA 1UVTH 3OU0A 4AGJA 4K8YA 1RS0A 1GBKA 2BDYA 3ZVCA 1T31A 2F83A 3K6ZA 4AYYB 1IQGA 5DP9A 1AE5A 1G37A 2ZTZA 1SPJA 2JETB 5DP4A 1A2CH 3QGNB 3SUEA 2G4TA 3SU5A 4M7GA 1P02A 2ANKH 4UFFH 1J17T 5EW1H 2UWOA 1XXDA 1ESTA 4OGYA 4X6NA 1NRSH 2F9VA 1TPAE 3RM2H 5C2ZA 1Z1JA 4AORA 1BUIA 4Y0ZE 1E0FD 5J4SA 1C2FA 1AD8H 2NWNA 1IQIA 3SBKA 1QB6A 4YZUA 1CA0B 1MKXK 2TRMA 1RRKA 1FPHH 1TNLA 1WAYB 1ELGA 1C1MA 3ATLA 2HNTC 2BD2A 1G3CA 5A09A 1PQ5A 3KNXA 1O2MA 1MH0A 1W2KH 6GCHF 5LPRA 1HAHH 5JBCS 2ZF0H 4NWLA 2OUAA 1UTOA 1UO6A 2UUFB 4BTUB 1G32B 2OQUA 2A5IA 1EOJA 1DY8A 4YLQH 4UDWH 1DWBH 4BOHA 1F0SA 1C2EA 2HLCA 1TBQH 2PGBB 5EQRA 4CR9A 1O3GA 3CS7A 2A7HA 1OX1A 4NSYA 1ELDE 3EYDA 1SHHB 2GZ8A 1TIOA 1D3PB 3AW1A 3JZ1B 4X1QU 1G2LA 1BZXE 2EI8A 2ANYA 5DP8A 4ZAEA 1C5TA 1O36A 2PTNA 4AFZA 1K28D 3MI4A 4OS4A 5DKMA 1B7XB 1NROH 3TH4H 1H8DH 1O5DH 2P3FH 3SHCH 3V13A 3LJOA 4AYVB 5T6GA 4RKJB 3I29A 3UY9A 2GT8A 1O32A 4UD9H 1FNIA 1O0DH 1GDUA 1GBIA 2CJIA 2FXRA 3U9AH 2TPIZ 1ZR0A 1J8AA 1P06A 4X8VH 1GJ5H 1DLEA 4NIYA 4KELA 3RXUA 3S0NA 1BDAA 1DWDH 2FEQH 1VZQH 3TJNA 1TA6A 1YYY1 3ZZ7A 1LHFH 1Y3YA 3DT0H 3GY2A 1YPLH 2OBOA 2A4QA 4J2YB 4B76A 1ZRKA 1HDTH 3BSQA 4IN2A 1O3FA 1P9SA 2QAAA 3T26A 1OP0A 4XBDA 3TJOA 2ZHWH 1WQSA 3MOCA 4NA9H 1V2VT 3RXVA 1TWXB 1P12E 1MCVA 2ZGJA 4JCNA 5G4BA 2RCEA 1TBRH 4Y8ZA 1A5HA 1RJXB 1UTJA 1ZJDA 1SHYA 1XMNB 2DUCA 2RG3A 3HPTB 3L3TA 4WF8A 3STIA 3TJVA 1DWEH 1KLJH 1SGIB 2C90B 3D49H 2BDAA 2C8YB 3FP8E 4MG3A 4X8SH 3FVFB 5TCAA 4NA7A 1GVKB 1QQ4A 4ISNA 1QL7A 2GGVB 1E34B 1C4V2 3RUOA 5JB8S 1S84A 2GZ9A 2R0LA 5GXPA 2Z3EA 1FPCH 1C5VA 3S7KB 3MU4A 1XUHA 1Y5AT 1SGTA 1GI4A 4A5TS 2YNBA 1MTUA 3UREA 1ELAA 1AMHA 3QK1A 1G3EA 1C5ZB 3E91A 3MU1A 1P11E 2DE9A 3MMGA 2ZPQA 5T6DA 4ZHMU 3H5CB 1HAIH 2H9HA 4YT7H 5FPTA 1EZUC 4FU9A 2FOFA 1TABE 2TIOA 1MTNC 1TMTH 1P0SH 1HCGA 1H9IE 1S5SA 2W7UA 1HB0B 3SW2B 2XBWA 1H4WA 1XUGA 4CRAA 4OS6A 3UIRA 1AIXH 4F4OC 3NUMA 3RXBA 2PR3A 2ZU5A 1Z8JB 2FIRH 2BD9A 3KEEA 2Y7XA 1UCYK 1G2MA 1PFXC 1TONA 3F1SB 1LKBA 1DVAH 4KTCA 1SL3A 5F8TA 1LQEA 3M7TA 4I8JA 3LPRA 1BBRH 2Y5GA 3TIUA 2ZU4A 4ZKRU 1LPZB 1S81A 3UNRA 1G3BA 2Z9LA 1MAYA 1GBLA 1UVSH 2QXGA 4U32A 1UVUH 2R2MB 3LC3A 1V2UT 3A83A 1QFKH 2BQ6B 2ZDAH 4GSOA 1DS2E 3SJOA 2WYGA 4TPIZ 4TWWA 4HI3A 1O2IA 3SNDA 4IC6A 1D3TB 4ESTE 1EZSC 1EAWA 2A5AA 1GMHF 4UEHH 1YP9A 1CQQA 2YNAA 3RMNH 3SU3A 1ELBA 3D65E 4J1YA 2J4IA 1O3IA 1OP2A 4ZROA 2OD3B 1CHOG 2B0FA 4GCHG 4NWKA 1ETTH 1GHWH 1EQ9A 1GBBA 2PFEA 1KXEA 1L4DA 3SU2A 5GJ4B 2VJ1A 2W5EA 3F9EA 2STBE 4NFFA 4CREA 1ZPZA 2VWMA 5AF9H 3GY5A 1HAOH 1KXBA 4O03A 3M3TA 1MTNB 3SV7A 2ZFFH 3MH5A 1L1JA 1EJAA 4BAHB 3PO1C 4OS5A 4JYVH 3V0XA 2GDDA 4UFDH 3MFJA 1XUKA 1GHAG 1C1PA 1O2LA 4MNXA 1WU1A 1C5UA 1NN6A 1ZSJA 4K2YA 1Z71A 5L30H 1EB2A 3KHVA 4INLA 1QA0A 1QURH 2EA3A 3LIWA 3RXOA 3TLOA 3U69H 2PLXA 1XUFA 1QBOA 2V0BA 1BMMH 1ZGVA 1EUFA 2G00A 1GJ4H 3FANA 3LC5A 3H7OA 1B0EA 1L4ZA 1V2LT 5GPIB 2OC1A 1P04A 4RN6A 1C2JA 2A2QH 1C5OH 5DO4H 1V6DA 1T7CA 4FUBA 3F9FA 5F6MA 2BDGA 1Z6JH 2CF9H 3BTGE 5FPYA 4BAMB 4JZDH 4ASHA 3OSYA 1KY9A 2F9OA 3P8GA 4AOQA 2ZHDA 4JZ1A 3PLKA 3LH1A 1T4VH 1YCPH 1GI2A 4H42U 1Z8RA 3RM0H 3PTBA 3RC5A 2ZEBA 2HOBA 3T27A 3E16B 3A84A 4AB9A 2UUJB 4ZKOU 1ANEA 1CHGA 2HNTE 4IMQA 1DSUA 1O5FH 3DFLA 1MQ5A 3SGAE 4IW4E 4LZ4B 1GL1A 5FPSA 4ZH8A 1V2OT 4XOJA 5DP5A 1GG6C 3ZZDA 1SFQB 3QO6A 3PO1B 1THRH 3AASA 2ILNA 4DGJA 3A7VA 2SGAA 3KN2A 1SGRE 3ZV9A 5HXFA 2TBSA 4OGXA 1HFDA 1ORFA 4ABEA 1HXFH 1O2XA 2JH0D 2VIDA 2BD5A 4ABDA 1MMJN 1AO5A 1DPOA 1FQ3A 1ID5H 3OX7U 1K1LA 1ZMLA 3UOUA 1BB0B 1O3AA 1GL0E 4MLFB 1F92A 5I25A 2EC9H 1GHXH 4TY7A 1XUIA 1V2WT 2VIQA 1UTNA 1D3QB 1EXFA 1V2KT 4UE7H 3GCNA 1SGCA 4CR5A 1ZTKA 3TH2H 4X8UH 3SV2H 1G30B 5A8XA 1FY8E 1SI5H 1SLUB 1P2OA 4E7NA 1A5GH 5LPFA 3M7QA 1QB1A 2FP7B 2EEKA 4AG2A 1O3BA 4DIHH 4I32A 2BDBA 3FP7E 3A7ZA 1TGSZ 2JKHA 2VNTA 4WMFA 3LH3A 1C2MA 2BVXH 1SBWA 1Z7KA 2J9NA 3A7YA 1EX3A 1UK4A 2UWPA 4MPWA 4E05H 1TGTA 1WTGH 2ZFRH 1LVBA 3WY8A 1GBJA 1SVPA 1W7XH 2GDEH 1LVYA 3GDUA 4I31A 2ODYB 1DFPA 8KME2 1ETRH 2TGAA 3CS0A 2B5TB 1XX9A 1KDQB 1TPPA 1YPHE 3E0NB 1GCDA 1GG6B 5FCRA 2D8WA 3SGBE 2BZAA 1L2EA 1ANDA 1DE7H 1SR5C 1SQOA 3RXIA 5JBTA 1AUTC 1KIGH 1QR3E 1QIXB 2XTTB 4ABGA 3VFEA 1M9UA 3QZRA 1ESBA 2FI5E 1GJ9B 3D62A 1C1SA 1YC0A 3QLPH 1A1RA 1N8OC 3R0FA 1O3OA 2A32A 3P95A 3M61U 2SFAA 3ZVEA 1MCTA 4MDSA 4ABBA 4YOJA 3SUGA 3TNTA 5DJ7A 2XBXA 2OLGA 4MTBA 1BRAA 1UK3A 1O3CA 3D23A 1J15A 2H9TH 4O9VA 1A0JA 1A5IA 1ZHPA 5A0BA 3EDXB 3UR9A 4PROA 1C5NH 1H8IH 2ZG0H 1TLDA 3T62A 4H6TA 3EA8A 2C4FH 1B5GH 3FAOA 1P10A 2OC8A 3NKKA 1SGPE 5FXLA 2AIPA 1PQ7A 1JBUH 2NU3E 2NU4E 3BG8A 3SU0A 4NZQA 5DP6A 2XC5A 1IQEA 1FY3A 2BY7X 1O3HA 3MWIU 5C67A 2KAIB 1C2IA 3A85A 1SLWB 1QBVH 4GVUA 4K60A 2VINA 4MPVA 3M5LA 2XCNA 1AWFH 1SQTA 1U6QA 4INKA 4LOYH 3NPSA 3A7XA 4Z6AH 2VWOA 4TPYA 1G36A 1NY22 7KMEH 2FM2A 3SN8A 3V3MA 1GJ7B 1SGEE 1TPOA 2A7CA 1O38A 4X8TH 4ABFA 4FVBA 1DXPA 1GMCF 1HAGE 1O34A 2H6MA 2B7DH 3ZZ8A 3RXAA 1T8LA 3GYLB 2WPLS 4TY6A 3SNBA 3UPEA 2UWLA 1XKBC 2ALPA 4BNRA 2Y5FA 1BOQA 5HMAA 4A7IB 1O2ZA 2IPHA 1ZMJA 3RXDA 2LPRA 1UTQA 1K1PA 1N8OB 2SGEE 1SGFG 1CT4E 2GKVE 1EATA 2GCHG 1JRTA 3S9AA 4NIVA 1TX8A 2J34A 2PSXA 1THPB 3V12A 4K1SA 1O3DA 2AERH 2NU1E 4D9RA 1H9LB 5A8YA 1AWHB 3QTVH 1NU7B 4MNVA 1DLKB 1OKXA 2BTCE 2ZNKH 5F8ZA 1VGCB 1GDQA 2V35A 2PHBA 3M37A 4ISIH 1FLEE 2R3YA 3ZVDA 1GVLA 2EI7A 1C2HA 1QB9A 2ZTYA 4A1VA 1AGJA 5AFYH 4Y10E 1ZZZA 3ITIA 1CT0E 2P16A 3GOVB 4TWYA 5E0JA 3URCA 1JXPA 3BEIB 4WH6A 4AFQA 1GJBB 2O8TA 1NZQH 2IN2A 1V2JT 1FZZA 3PLBA 3SV6A 4ZMAH 1EJNA 2F9NA 5BPEA 3UNQA 2CF8H 3M5NA 5DPAA 1IAUA 4A1XA 2W7SA 1KSNA 5B6OA 4WJG2 4AGKA 4BTIB 3SV8A 1O2TA 3EGKH 3PWBA 3RXHA 2FODA 2XBVA 5L2ZH 3DUXH 5A8ZA 3Q76A 2ZO3H 1WTHD 4O3UA 3LU9B 4NIWA 1S0RA 1AHTH 1XVMA 1BITA 1Z6EA 2BZ6H 3HK6B 1EAXA 1W14U 3ODFA 5GCHF 1JMOH 2BYAX 2FDAA 1CBWC 1IQNA 1A4WH 3MNCA 2FO9A 5DGJA 2GV7A 3O8DA 2FTLE 5IYTA 4WH8A 4NG9H 2HNTF 1T8OA 3RLYH 1SQAA 3PROA 4MQAA 2ZGCA 3TJUA 1QRXA 4HFPB 3TK5A 1C2LA 2ULLA 1P09A 1A0HB 3A8BA 4JYUH 5DG6A 4Y7AA 1KXFA 3UFAA 4D7GA 1B0FA 3GDVA 3E1XB 5C1YA 1V2QT 3LONA 1C1WH 1YGCH 1AVWA 6GCHG 4B73A 1LHGH 1MKXH 2Z9KA 1DSTA 4IMZA 2QXHA 4E06H 4DURA 1BTPA 1YPEH 1HAYB 1FJSA 2FOGA 4D7FA 3G01A 1ZYOA 1JIRA 1QBNA 2I6SA 2H5CA 1LPGB 2ZFQH 1YLCA 2FS9A 1F0UA 5ETXA 1GI6A 1VITH 2GMTB 3RXKA 4IGDA 1NFUA 1ZPCA 2GV6A 2ZFPH 4UFEH 3SQEE 5EQQA 1O2QA 4X6PA 1Y3WA 1A3BH 4IBLH 2J92A 4AZ2B 1VJ9U 5GDSH 1DM4B 2BY5X 2BLVA 4Y71A 1TNKA 3GY3A 1BHXB 2BDIA 9LPRA 2QC2A 4WMEA 5FBIA 2IOTA 2PV9B 3TGJE 1ZSKA 1WCZA 5EGMA 2CGAA 2G4UA 2O8LA 1JWTA 1CBWB 1YPHC 4AB8A 4JK5A 1O3MA 2GVFA 1O2HA 2CHAB 2VH0A 4NIXA 3SNCA 3GY6A 3EA7A 4YTAA 1SGYE 3FZDA 3A80A 3A87A 1IQHA 1D6WA 4DCDA 1HIAB 3F9HA 3PMJA 3AAVA 3UUZA 2V3HH 1DWCH 2XWAA 3F68H 1QL8A 5FX6A 1EZQA 5FAHA 3GY8A 2WPIS 4ZKSU 3TGIE 2FESH 3Q3KA 1VCQA 1O2YA 5K7RA 2ZU2A 1F5RA 4YLUA 1K1OA 3LGIA 2AMPA 2OBQA 5LGOA 1EOLA 1EB1H 1KLTA 1P3EA 1WOFA 3O8RA 2BOHB 3A82A 2XNIA 1O33A 2GP9B 1RXPA 1ZTLA 3GYMA 1SLXB 2P95A 4B2BA 2NU0E 3MNSA 4F49A 1INCA 3TU7H 1XVOA 2WV4A 5A0AE 1O2JA 1WBGB 2B9LA 3A7WA 3SU6A 3KQEA 5EQSA 1O39A 3RXMA 1SB1H 2G51A 4FUDA 1HJ9A 2BVRH 5EPYA 2F9PA 3RXRA 3PLPA 4MPUA 5LH8A 4BANB 3LGTA 1ESAA 1O2GH 3UWIA 2FZZA 3RXGA 1BRBE 3MYWA 2VWLA 2AS9A 1ACBE 2Q6DA 1P2KA 3MH4A 3LGVA 1MU8B 1GHZA 1F5KU 2CN0H 1ANCA 1NPMA 3OY6U 5EPNA 3HK3B 3VB4A 5PTPA 2A0QB 2BY8X 4LK4A 1QGFA 1C2KA 1D6RA 2JH5D 3GY4A 3M3SA 1HGTH 1EP6A 1C4U2 1ANBA 3PWCA 2GTBA 1LPKB 5BRRE 2ZWLH 1PPBH 3V7TA 4KP0A 1UMAH 2O8MA 1C1RA 3F9GA 1MD7A 5EG4A 4FUGA 3GY7A 3PMHB 1FY5A 2HVXA 2W3IA 2WYJA 5DK1A 1L1NA 4O3TA 3K6YA 3R3GB 1NFYA 1BT7A 2ZPSA 3NWUA 2WPHS 3F6UH 3ZZ9A 1CE5A 1HAVB 1CGIE 1YPGH 2GD4B 1W8BH 5LPEA 1O2SA 3MHWU 1HUTH 1WSSH 3ZV8A 1MAXA 2ZGHA 1A3EH 4JZIA 1C1OA 4XBCA 4GUXA 4MNYA 4JK6A
chains in the Genus database with same CATH superfamily
1GI5A 2ASUB 2P59A 1NS3A 2G81E 1T8MA 4Q80A 1P57B 5HIZA 4ABJA 5EJ1A 3KQCA 3BF6H 1UCYH 1QCPA 3GCOA 3OAAD 1C4Y2 5IK2D 2GT7A 1OXGA 3SQHE 2ZU1A 4X1SU 1GMDF 1FUJA 3QTOH 2K1QA 2SNVA 2FOBA 3OYPA 1COWD 1QRZA 1GMHG 2FI4E 1N6XA 3ZIAD 2PKSC 4NFEA 2Z3DA 1NRRH 2ZI2H 1OS8A 1PPEE 1T4UH 3SU1A 5FBEA 1BCUH 1YPKH 1TOCB 3SHAH 3VEQB 3UTUH 3MO9A 2BD8A 5CHBA 3M5OA 2H2ZA 2O8UA 2FPZA 3A8DA 2FOEA 3E0PB 3SYJA 1YY3A 1ZSLA 1OWIA 1W7GH 1BIOA 1NT1A 3F3BA 3RMLH 1KXAA 1OPHB 3KGPA 3A86A 1NTPA 1CSOE 4FUJA 1Y3UA 5E2PA 3TNSA 1QQUA 1KYNA 1LVOA 2VIVA 3DFJA 2QF3A 2XRCA 2YMSB 1TQ0B 2J98B 1UTKA 1AUJA 4Q2KA 1HIAA 1A46H 4K8BA 1GI1A 1NBMD 3JZ2B 3KCGH 1E37B 2F3CE 2QY0B 1EKBB 3A8CA 3VPKA 2AGEX 3S9BA 1SG8B 1UCYE 4B2CA 3U8TH 4LXBH 1XUJA 3PM3A 4I7YH 5EXLA 1O2WA 1C5YB 1SMFE 1C5WB 3OFND 1AVXA 5E8EH 3ELAH 1K2I1 3KIDU 3VB6A 3RDZA 1NFXA 7ESTE 2WUBA 1THSH 2ZDMA 1YKTA 2BD7A 1HAXB 1YPJH 4Q7ZA 2JIZD 2Z9JA 3E6PH 1WYKA 2BLWA 3IITA 1O5EH 4WY3A 3VXFH 1W11U 7GCHF 1GHYH 2BVSH 3GCHB 2A4GA 3SJIA 3C1KA 5AFZH 1BMNH 2PKSB 4R0IA 1HPGA 4RT1A 1AB9C 2BQWB 3PMAB 2PGQB 1O2OA 4B74A 2IJD1 3P8FA 1SOTA 1XXFA 1NFWA 1H8HD 3RC6A 1SGDE 1TGNA 3W95A 2PKAB 1MBMA 3O8BA 4JMYA 2ZDKA 1C1QA 2XWBI 2CV3A 6LPRA 1SFIA 1O2RA 1TRYA 2F9BH 1F0TA 1IHTH 2J2UA 1GJAB 4SGAE 4OS2A 1ZPBA 2XNDD 4A6LA 1P2QA 2O8WA 4D76A 2ZCHP 4Y8XA 1TBZH 1GJ8B 2FWWA 3CP7A 3KQDA 2VH6A 1O5AB 2AMQA 2FTMA 1Q3XA 1Y59T 2W26A 4CRCA 2KCOA 2ZECA 1HAPH 1YM0A 2OQ5A 5T6FA 3U8OH 2FMJA 1BJUA 1QTFA 3P92A 3NXPA 2BB4A 1GBHA 4THNH 5C20A 2Z9IA 1O3NA 3UAIC 1NBME 5EU8A 3NK8A 3GS9A 4HTCH 1XM1A 1Z1IA 3TVJB 1GHBF 1UK2A 1IQKA 5EJLA 4WVPE 1MTWA 2CMYA 1FY4A 2ZA5A 2W6JD 3BTEE 1C1VH 4NZLA 5C0UA 2AYWA 4DIIH 9ESTA 2F91A 4XSKU 1S6HA 1BTHH 1RD3B 1DXWA 2RDLA 3ZZ6A 2P3TB 4ISOA 3ZZ3A 1DUAA 3I77A 1XKAC 4K3JA 1AB9B 1VITF 1TMBH 3L6PA 3ATWA 3M5MA 2ZKSA 2J97A 2C8ZB 4GHQA 2G8TA 4INHA 5JYIA 3ESTA 4ABAA 4KTUA 1TPSA 3SNEA 1UTLM 2BDCA 4CBNA 2LNCA 4BAKB 4B71A 1FIZA 1HAZB 1S85A 1TOMH 5IDKA 2TGDA 1RTLA 3BIUH 2XYAA 1BRCE 4FU8A 1QY6A 3B9FH 1HYLA 2ZQ1A 2D2DA 4X1NU 1GGDC 3EAJA 2RA0A 3F0PA 2ZTXA 3RXJA 5E0GA 4A92A 1TALA 1PJPA 3U98H 1S82A 2ZHEH 1VGCC 3S69A 1IQMA 3T28A 1D9IA 1SOZA 3VB3A 3BEUA 4WXVA 1AFQB 4RKOB 3DSGA 1C5QA 4I8GA 8GCHF 2Z3CA 1WV7H 1C9PA 3VGCB 4X2WA 2WPJS 1GBFA 1SGQE 4U2WA 1O3LA 1W0JD 3RXCA 1O5BB 4K1EA 4Y7BA 1O5CB 2FX4A 3SI3H 4Y79A 3OTPA 1LMWB 1V2TT 2VU8E 2XW9A 4IC5A 5J4QA 1CGHA 1VCWA 3RXSA 5ABWA 4TYDA 2SNWA 1ELTA 1FIWA 1O30A 3OTJE 3RXFA 1MTVA 1C2GA 1LQDB 2BX3A 1UVOA 1O3JA 3DHKH 2BLOA 4NA8A 3GCTF 1HBTH 2GCTC 3BTKE 5ESBA 4GAWA 2VVUA 3N7DA 1UTPA 1SSXA 4LZ1H 2A7JA 5C1UA 1MKWK 1GJCB 4FUHA 1O31A 1TFXA 2QXJA 2G5VA 4HGCA 3URDA 4VGCC 4X0WU 1QJ7B 1A0LA 3BIVH 4ZUHA 3FFGA 2BOKA 2AIQA 1OP8A 4FUIA 4Q7YA 2VGCC 1T32A 1EZXC 3EE7A 4XD7D 1F7ZA 3C27B 1EAUA 1GGDB 2SGDE 1GMCG 1D4PB 4X6OA 3SZEA 5A0CA 2ZZUH 1TNJA 5C5OA 2JH6D 1DITH 1ABJH 3MO3A 2OC0A 3T2NA 2QYIA 3Q00A 4JZEH 4ABHA 3SGQE 1BJVA 5EOKA 1O3KA 4XE4A 1GJ6A 1HLTH 3BTDE 1C1NA 1P2IA 2EI6A 1C5SA 1ZMNA 4FU7A 2PWXA 5HM2A 2C8WB 1K1MA 2J95A 1QJ6B 3LGUA 1RIWC 1A61H 4GPGA 2UUYA 1W13U 2A45B 3GDSA 3ZZBA 3SORA 3TK9A 3LT3A 1V2ST 2ZQ2A 1SLVB 1S6FA 1MKWH 2HVYB 2FS8A 2GMTC 1EP5A 1TRMA 2XC0A 1PPHE 1H9HE 1K9OE 3BN9A 3PYHA 1V2PT 1TRNA 3WWBA 5A2MH 3UQVA 2P93A 4X2XA 1ZHMA 4YESB 3M7UA 1ELFA 2RDEA 1FAKH 2BQ7B 4AFUA 1LDTT 4B2AA 2AEIH 2C3SA 4CH2B 3QZQA 3SJ9A 1KDQA 3RLWH 3FP6E 2WPMS 2ZGBH 1GBTA 1LTOA 2GCTB 5GIBA 1LKAA 1BTWA 1O3EA 1F2SE 1KMHB 3HATH 2A5KA 2CHAC 2VVCA 6ESTA 1H1BA 2ANMH 2GZ7A 4VGCB 1BHXF 4Y8YA 1P3CA 2QGRA 3Q77A 1ZJKA 4R8TB 1GWAA 2VGCB 2BXUH 3A7TA 5E2OA 1AZ8A 5JBBS 2ZGXH 4YXWD 4CHAC 1W0KD 4X1RU 4DW2U 1KTTB 1ZOMA 3U8RH 1UJ1A 5C3NA 1Q31A 3LJJA 4RSPA 1TNIA 3O8CA 2HPPH 2ZHFH 1D3DB 1BA8B 2DE8A 1C5RA 1TGCA 1CVWH 3KF2A 1DT2A 1HXEH 2H5DA 2C93B 2ZCKP 5GCHG 2ODQA 4XRNA 2HWLB 1E35B 1AFEH 1HJAC 2R3UA 4SGBE 1QRWA 3B8JA 1AVGH 1ELVA 1Y8TA 1Q2WA 2P8OC 2OINA 3UNSA 4XDEA 1C5LH 1RIWB 2F4LA 2ZC9H 5JPMH 1PPFE 2BD4A 3PV4A 4ISHH 4FUFA 1C5MD 1WQVH 4P00A 4FUEA 2FOHA 1LVMA 3U1IB 4OS7A 3P8NA 1FY1A 2KAIA 1KTSB 1RFNA 1P2MA 3OY5U 3T5FH 2M5TA 1C1UH 4Y11E 4WWYA 2Y81A 3TK6A 3UWJH 2ODPA 2ZPRA 2PW8H 4X1PU 5HGGA 1K1JA 2ZDLA 2KFWA 2Z6BD 1O2VA 1ZLRA 1NC6A 4Y6DA 2Y5HA 5ESTE 3P8OA 3LOXA 1LHDH 1AZZA 1TQ7B 2QIQA 3PV5A 2WUCA 5FL7D 2D1JA 3TITA 5CMXH 1PYTD 1ELCA 2A4OA 2I6QA 4AFSA 2A1DB 1ARCA 1CU1A 1WUNH 1SC8U 5C5NA 1QJ1B 3AAUA 2RA3A 4I8KA 3W94A 1OWDA 4GLYA 4D9QA 2VIPA 2PUQH 1NRQH 1GCTC 1AE8H 1LHCH 2HRVA 4CHAB 3K9XB 1Z8IB 1SKYE 3E8LA 2F43B 2PSYA 1W3CA 3BTWE 4CRFA 4K69A 1DUEA 3L33A 3GICB 1HJAB 3MU5A 4ISLA 1SQRA 2OXSA 3A89A 1IQJA 5HM9A 1FV9A 1GVZA 4I33A 1YPMH 2P8OB 4IN1A 1E1RD 4O97A 3SI4H 1W12U 3P6ZB 3ZZ4A 2FI3E 1C2DA 6CHAC 1GBDA 2ZFSA 2R9PA 4FVDA 2VIWA 1DOJA 2Y6TA 3ZZ5A 1TMUH 4JZFH 3B23B 3LDXH 2FLBH 2SGFE 1NESE 2XC4A 4YT6H 1QHRB 1BTZA 2BX4A 1O2UA 1FXYA 3BG4C 4JYTA 2ZFTA 3Q3XA 4KTSA 2VIOA 3NZIA 1FMGA 1S83A 1EASA 4FOUC 1PPZA 1W10U 4Y0YE 1CT2E 2XCFA 5JBAS 2PTCE 1BBRK 1RTFB 2WINI 1NO9H 3HKJB 1E1QD 1SGFA 3IG6B 2ANWA 3BEFB 3H7TA 2WPKS 3A8AA 3ZZAA 3ZVFA 2OTVA 1KXCA 3RXQA 1GBAA 5HYOA 1J9CH 8LPRA 1O5GH 4MPXA 2IJOB 4CBOA 1NU9A 1GI8B 4UFGH 3PMBB 4WXIA 3MNXA 2FOMB 2JDID 3UR6A 1BMLA 2OCVB 3SOSA 1GCTB 2KX4A 2J38A 2Y7ZA 1OWHA 2AGIX 5EXNA 1O2NA 5FX5A 1TAWA 2STAE 3SJ8A 7LPRA 3T29A 1FONA 2OP9A 1DANH 4DT7B 3HGPA 4CRBA 8ESTE 3ZVAA 2V3OH 2FOAA 2G5NA 2TGTA 2O9QA 3QWCH 5DP3A 5F03A 2H9EH 2XXLA 3DSOA 5CHAC 2QXIA 4UONA 1CHOF 2KR7A 3IWMA 2ZU3A 4ACBA 4GCHF 3SUFA 1QA7A 3KYGA 2G52A 2ZDVH 3SJKA 1G9IE 2FYQA 1K21H 1KLIH 4U30A 6CHAB 1JRSA 2QF4A 1GI3A 3QUMP 4DY7B 2RFKC 1ZHRA 5CE1A 4TT3D 3PRDA 3QX5H 1UHBB 1NRNH 4X2YA 3UQOA 3ZYDA 1VR1H 4Q7XA 1S6LA 1TYNA 4CRGA 2NU2E 3BG4B 5EIYA 3PV2A 4B1TA 1K1NA 1MU6B 3GCHC 2BXTH 4NCYA 1BTXA 1GHAF 3QDZB 3FO8D 3BTFE 1NM6A 1J16A 1O2KA 2PUXB 1ARBA 3RMMH 3BTQE 2SGQE 3HKIB 1AKSB 1BQYA 1BTUA 1GHVH 1AU8A 1FN6A 2Y80A 2Q1JA 4CH8B 4E7RG 4ZXXH 2FLRH 5C17A 2AGGX 1YF4A 5L6NH 3TGKE 1OWJA 1K22H 1QNJA 5F8XA 3RXEA 2QV1A 2HPQH 1TGBA 1GMDG 2OC7A 1OYTH 1PPGE 1YCPK 2HGTH 1HRTH 2B8OH 2ZHQH 1EPTC 5AHGH 1BBRE 3A88A 1ZGIA 3RU4D 1A7SA 1C9TA 3U1JB 3PTNA 3SZNA 2VWNA 1BMAA 3ODDA 1AI8H 5CHAB 1BRUP 1BTYA 1ETSH 3M35A 5T3HA 3ZZCA 3M36A 3PB1E 2F9UA 2YOLA 5JDUB 3RMOH 3Q3YA 3ATKA 3EQ0H 4K5ZA 3RU4T 2BDHA 2Z7FE 2QCYA 5DP7A 1FI8A 2THFB 1V2RT 1GBMA 1YWUA 1J14A 4B6FA 1S0QA 2BHGA 3AVZA 2H1UA 3P70B 4BAOB 2G55A 4HZHA 1RTKA 3MH6A 1P05A 4BXSA 1MTSA 4TSFD 1PQ8A 1YCPM 4FUCA 1IQLA 1LCYA 4KKDA 2LP6A 3KQBA 4MVNA 1O3PB 1G3DA 1HNEE 4AG1A 4YOIA 2Q6GA 1IOEA 3VG8A 3KYFA 1C5PA 2P94A 4Y76A 4U01A 1ZRBA 1HJ8A 4H6SB 3RXPA 1YBWA 2Y82A 3TPIZ 5SGAE 2D26C 2GX4A 5EJZA 3PRBA 5TCCA 1N1LA 5EW2H 1GI9B 2KCPA 1F0RA 4WMDA 4X2VA 1X7AC 1ZTJA 1T8NA 7GCHG 1JIMA 1EPTB 2Z9GA 5I46H 4BXWA 1E36B 3RXTA 4BTTB 3GISB 1OSSA 1EAIA 2P3UB 5EODA 2ALVA 4YM9A 2ZIQH 1TNHA 3S7HB 5JB9S 1Z8GA 4DJZB 3AW0A 2Q6FA 1DY9A 1SGNE 3RXLA 2IPQX 2WV9A 4CRDA 1C5XB 3VB5A 1AFQC 5AVDA 3E90B 3RU4E 3SU4A 3F2HA 5K0HA 1RGQA 3KL6A 3S9CA 3HGNA 2BY6X 1OWEA 1TA2A 1EJMA 2QF0A 4KGAA 3WW7A 3ZVBA 3VGCC 2FYRA 1P03A 1HAVA 1P2JA 2UUKB 3SO3A 5FHTA 2HALA 2BY9X 1UVPA 1CO7E 3SNAA 4ZKNU 1UHBA 1Y5UT 5TJXA 2QN5T 5GWZA 5L2YH 1AY6H 3N7OA 2AMDA 3ZYEA 1JOUB 1DX5M 1E38B 1TB6H 4YO9A 4K1TA 2ZDNA 2PP6A 1GJDB 4I8HA 1FN8A 1GHBG 1OOKB 4A1TA 2J5UA 3NCLA 3MTYA 4ZXYH 2EY4C 1L1GA 1ELEE 3RP2A 1FDPA 4AN7A 1AKSA 5FCKA 1W0YH 2A4RA 3T25A 3CENA 4I8LA 1UTMA 1ABIH 1Y5BT 3UOPA 3K65B 2J94A 3BTTE 2BLQA 1AQ7A 4DG4A 3MNBA 4ZHLU 2L6OA 3ATIA 4NSVA 3MH7A 2ESTE 1VITG 1V2MT 1Y3VA 1GDNA 1TX7A 1L0ZA 1YLDA 3DA9B 2R0KA 2W3KA 1TX6A 3LGYA 4H4FA 2J98A 4D8NA 5KECA 4QT8C 1PQAA 1VCPA 4FXGH 3STJA 1PYTC 2Z94A 1CA8B 3P17H 1Y3XA 1MZDA 4DVAU 1TNGA 1N6YA 3K2UA 1FAXA 2JETC 2AH4X 3A81A 3RC4A 2BM2A 2WZQA 1QL9A 4XBBA 2XBYA 4OS1A 3FZZA 2V6NA 3SV9A 1MQ6A 1GI0A 1MBQA 2A31A 2BD3A 2VB0A 3EE0B 1O35A 4B6EA 4F48B 3MO6A 3QN7A 5H4IB 2FOCA 3TH3H 3SUDA 2FX6A 2QF5A 1QZ8A 2ZP0H 1DDJA 2R2WU 1EFRD 1K1IA 5C1XA 3DD2H 1KXDA 4XFQA 4IS5A 3ZVGA 1P01A 8GCHG 3MU8A 1O2PA 1NRPH 3BTHE 3E3TA 4GHTA 1F5LA 5EXMA 1MUEB 4Z0KA 3QGJA 4AX9H 4X6MA 3VXEH 1OYQA 1LHEH 2WV5A 2VVVA 3ENSB 4YOGA 1CGJE 3I78A 1CA0C 4Z1MD 2QA9E 1PPCE 1VJAU 1IQFA 2GCHF 2A2XH 4BAQB 2PKAA 1V2NT 1V3XA 1GPZA 1O37A 4NGAH 1GI7B 4FETA 1WDIA 2TGPZ 4ABIA 1P9UA 4ZHAA 4B75A 3EA9A 2SGPE 4MNWA 2ZCLP 2AFQB 3VB7A 1GBCA 1GBEA 1AN1E 1EPTA 1TE0A 3GCTG 3MU0A 1W0ZU 1C1TA 3LGWA 5E0HA 2V3MA 3BV9B 3LKWA 4DOQA 1HV7A 1IHSH 3BTME 3M3VA 3ATMA 1LO6A 1MD8A 1P8VC 2CXVA 1MZAA 2C8XB 1OWKA 2BMGB 1P2NA 1DICA 1UVTH 3OU0A 5HIYA 4AGJA 3N99A 1FX0B 4K8YA 1RS0A 1GBKA 2BDYA 3ZVCA 1T31A 2F83A 3K6ZA 4AYYB 1IQGA 5DP9A 1AE5A 1G37A 2ZTZA 1SPJA 2JETB 5DP4A 1A2CH 3QGNB 3SUEA 2G4TA 3SU5A 4M7GA 1P02A 2ANKH 4UFFH 2WSSD 1J17T 5EW1H 2UWOA 1XXDA 1ESTA 4OGYA 3FOAA 4X6NA 1NRSH 2F9VA 1TPAE 3RM2H 5C2ZA 1Z1JA 4AORA 1BUIA 4Y0ZE 1E0FD 5J4SA 1C2FA 1AD8H 2NWNA 1IQIA 3SBKA 1QB6A 4YZUA 1CA0B 1MKXK 2TRMA 1RRKA 1FPHH 1TNLA 1WAYB 1ELGA 1C1MA 3ATLA 2L74A 2HNTC 2BD2A 1G3CA 5A09A 1PQ5A 3KNXA 1O2MA 1MH0A 1W2KH 6GCHF 4Q63A 5LPRA 1HAHH 5JBCS 2ZF0H 4NWLA 2OUAA 1UTOA 1UO6A 2UUFB 4BTUB 1G32B 2OQUA 2A5IA 1EOJA 1DY8A 4YLQH 4UDWH 1DWBH 4BOHA 1F0SA 1C2EA 2HLCA 1TBQH 2PGBB 5EQRA 4CR9A 1O3GA 3CS7A 2A7HA 1OX1A 4NSYA 2JJ2D 1ELDE 3EYDA 1SHHB 2GZ8A 1TIOA 1D3PB 3AW1A 3CNRA 3JZ1B 4X1QU 1G2LA 1BZXE 2EI8A 2ANYA 5DP8A 4ZAEA 1C5TA 1O36A 2PTNA 4AFZA 1K28D 3MI4A 4OS4A 5DKMA 1B7XB 1NROH 3TH4H 1H8DH 1O5DH 2P3FH 3SHCH 3V13A 3LJOA 4AYVB 5T6GA 4RKJB 3I29A 3UY9A 2GT8A 1O32A 4UD9H 1FNIA 1O0DH 1GDUA 1GBIA 2CJIA 2FXRA 3U9AH 2TPIZ 1ZR0A 1J8AA 1P06A 4X8VH 1GJ5H 1DLEA 4NIYA 4KELA 3RXUA 3S0NA 1BDAA 1DWDH 2FEQH 1VZQH 3TJNA 1TA6A 1YYY1 3ZZ7A 1LHFH 1Y3YA 3DT0H 3GY2A 1YPLH 2OBOA 2A4QA 4J2YB 4B76A 1ZRKA 1HDTH 3BSQA 4IN2A 1O3FA 1P9SA 2QAAA 3T26A 1OP0A 4XBDA 3TJOA 2ZHWH 5KGOA 1WQSA 3MOCA 4NA9H 1V2VT 3RXVA 1TWXB 1P12E 1MCVA 2ZGJA 4JCNA 5G4BA 2RCEA 1TBRH 4Y8ZA 1A5HA 1RJXB 1UTJA 1ZJDA 1SHYA 1XMNB 2DUCA 2RG3A 3HPTB 3L3TA 4WF8A 3STIA 3TJVA 1DWEH 1KLJH 1SGIB 2C90B 3D49H 2BDAA 2C8YB 3FP8E 4MG3A 4X8SH 3FVFB 5TCAA 4NA7A 1GVKB 1QQ4A 4ISNA 1QL7A 2GGVB 1E34B 1C4V2 3RUOA 5JB8S 1S84A 2GZ9A 2R0LA 5GXPA 2Z3EA 1FPCH 5DSFA 1C5VA 3S7KB 3MU4A 2AHME 1XUHA 1Y5AT 1SGTA 1GI4A 4A5TS 2YNBA 1MTUA 1VKYA 3UREA 1K0HA 1ELAA 1AMHA 3QK1A 3N7EA 1G3EA 1C5ZB 3E91A 3MU1A 1P11E 2DE9A 3MMGA 2ZPQA 5T6DA 4ZHMU 3H5CB 1HAIH 2H9HA 4YT7H 5FPTA 1EZUC 4FU9A 2FOFA 1TABE 2TIOA 1MTNC 1TMTH 1P0SH 1HCGA 1H9IE 1S5SA 2W7UA 1HB0B 3SW2B 2XBWA 1H4WA 1XUGA 4CRAA 4OS6A 3UIRA 1AIXH 4F4OC 3NUMA 1UW7A 3RXBA 2PR3A 2ZU5A 1Z8JB 2FIRH 2BD9A 3KEEA 2Y7XA 1UCYK 1G2MA 1PFXC 1TONA 3F1SB 1LKBA 1DVAH 4KTCA 1SL3A 5F8TA 1LQEA 3M7TA 4I8JA 3LPRA 1BBRH 2Y5GA 3TIUA 2ZU4A 4ZKRU 1LPZB 1S81A 3UNRA 1G3BA 2Z9LA 1MAYA 1GBLA 1UVSH 2QXGA 4U32A 1UVUH 2R2MB 3LC3A 1V2UT 3A83A 1QFKH 2BQ6B 2ZDAH 4GSOA 1DS2E 3SJOA 2WYGA 4TPIZ 4TWWA 2KZ4A 4HI3A 1O2IA 3SNDA 4IC6A 1D3TB 4ESTE 4OM9A 1EZSC 1EAWA 2A5AA 1GMHF 4UEHH 1YP9A 1CQQA 2YNAA 3RMNH 3SU3A 1ELBA 3D65E 3F2FA 4J1YA 2J4IA 1O3IA 1OP2A 4ZROA 2OD3B 1CHOG 2B0FA 4I86A 4GCHG 4NWKA 1ETTH 1GHWH 1EQ9A 1GBBA 2PFEA 1KXEA 1L4DA 3SU2A 5GJ4B 3FKSD 2VJ1A 2W5EA 3F9EA 2STBE 4HG6A 4NFFA 5HKKD 4CREA 1ZPZA 3F0OA 2VWMA 5AF9H 3GY5A 1HAOH 1KXBA 4O03A 3M3TA 1MTNB 3SV7A 2ZFFH 3MH5A 1L1JA 1EJAA 4BAHB 3PO1C 4OS5A 4JYVH 3V0XA 2GDDA 4UFDH 3MFJA 1XUKA 1GHAG 1C1PA 1O2LA 4MNXA 1WU1A 1C5UA 1NN6A 1ZSJA 4K2YA 1Z71A 5L30H 1EB2A 3KHVA 4INLA 1QA0A 1QURH 2EA3A 3LIWA 3RXOA 3TLOA 3U69H 2PLXA 1XUFA 1QBOA 2V0BA 1BMMH 1ZGVA 1EUFA 2G00A 1GJ4H 3FANA 3LC5A 3H7OA 1B0EA 1L4ZA 1V2LT 5GPIB 2OC1A 1P04A 4RN6A 1C2JA 2A2QH 1C5OH 5DO4H 1V6DA 1T7CA 4FUBA 3F9FA 5F6MA 2BDGA 1Z6JH 2WPDD 2CF9H 3BTGE 5FPYA 4BAMB 4JZDH 2VBCA 4ASHA 3OSYA 1MABB 1KY9A 2F9OA 3P8GA 4AOQA 2ZHDA 4JZ1A 3PLKA 3LH1A 1T4VH 1YCPH 1GI2A 4H42U 1Z8RA 3RM0H 3PTBA 3RC5A 2ZEBA 2HOBA 3T27A 3E16B 3A84A 4AB9A 2UUJB 4ZKOU 1ANEA 1CHGA 2HNTE 4IMQA 1DSUA 1O5FH 3DFLA 1MQ5A 3SGAE 1WXRA 4IW4E 4LZ4B 1GL1A 5FPSA 3NRLA 4ZH8A 1V2OT 4XOJA 5DP5A 1GG6C 3ZZDA 1SFQB 3QO6A 3PO1B 1THRH 3AASA 2ILNA 4DGJA 3A7VA 2SGAA 3KN2A 1SGRE 3ZV9A 5HXFA 3DCLA 2TBSA 4OGXA 1HFDA 1ORFA 4ABEA 1HXFH 2JJ1D 1O2XA 4P02A 2JH0D 2VIDA 2BD5A 4ABDA 1MMJN 1AO5A 1DPOA 1FQ3A 1ID5H 3OX7U 1K1LA 1ZMLA 3UOUA 1BB0B 1O3AA 1GL0E 4MLFB 1F92A 5I25A 2EC9H 1GHXH 4TY7A 1XUIA 2LELA 4F55A 1V2WT 2VIQA 1UTNA 1D3QB 1EXFA 1V2KT 4UE7H 3GCNA 1SGCA 4CR5A 1ZTKA 3TH2H 2WHXA 4X8UH 3SV2H 1G30B 5A8XA 1FY8E 1SI5H 1SLUB 1P2OA 4E7NA 1A5GH 5LPFA 3M7QA 1QB1A 4RT0A 2FP7B 2W6ID 2EEKA 4AG2A 1O3BA 4DIHH 4I32A 2BDBA 3FP7E 3A7ZA 1TGSZ 2JKHA 2VNTA 4WMFA 3LH3A 2K8IA 1C2MA 2BVXH 1SBWA 1H8ED 1Z7KA 2J9NA 3A7YA 1EX3A 1UK4A 2UWPA 4MPWA 4E05H 1TGTA 1WTGH 2ZFRH 1LVBA 3WY8A 1GBJA 1SVPA 1W7XH 2GDEH 1LVYA 3GDUA 4I31A 2ODYB 1DFPA 8KME2 1ETRH 2TGAA 3CS0A 2B5TB 1XX9A 1KDQB 1TPPA 1YPHE 3E0NB 1GCDA 1GG6B 5FCRA 2D8WA 3SGBE 2BZAA 1L2EA 2YMSD 1ANDA 1DE7H 1SR5C 1SQOA 3RXIA 5JBTA 1AUTC 1KIGH 1QR3E 1QIXB 2XTTB 4ABGA 3VFEA 1M9UA 3QZRA 1ESBA 2FI5E 1GJ9B 3D62A 1C1SA 1YC0A 3QLPH 1A1RA 1N8OC 3R0FA 3UB0A 1O3OA 2A32A 3P95A 3M61U 5C94A 2SFAA 3ZVEA 1MCTA 2XOKD 3KQ5A 4MDSA 4ABBA 4YOJA 3SUGA 3TNTA 5DJ7A 2XBXA 2OLGA 4MTBA 1BRAA 1UK3A 1O3CA 3D23A 1J15A 2H9TH 4O9VA 1A0JA 5KEDA 1A5IA 1ZHPA 2OK5A 5A0BA 3EDXB 4ACAA 5C0TA 3UR9A 4PROA 1C5NH 1H8IH 2ZG0H 2KM0A 1TLDA 3T62A 4H6TA 3EA8A 2C4FH 1B5GH 3FAOA 1P10A 2OC8A 3NKKA 1SGPE 5FXLA 2AIPA 1PQ7A 1JBUH 2NU3E 2NU4E 3BG8A 3SU0A 3DSPA 4NZQA 5DP6A 2XC5A 1IQEA 1FY3A 2BY7X 1O3HA 3F2GA 3MWIU 5C67A 2KAIB 1C2IA 3A85A 1SLWB 1QBVH 4GVUA 4K60A 2VINA 4MPVA 3M5LA 2XCNA 1AWFH 1SQTA 1U6QA 4INKA 4LOYH 3NPSA 3A7XA 4Z6AH 2VWOA 4TPYA 1G36A 1NY22 7KMEH 2FM2A 3SN8A 2V7QD 3V3MA 1GJ7B 1SGEE 1TPOA 2A7CA 4AC9A 1O38A 4X8TH 4ABFA 4FVBA 4RI0A 1DXPA 1GMCF 1HAGE 1O34A 2H6MA 2B7DH 3ZZ8A 3RXAA 1T8LA 3GYLB 2WPLS 4TY6A 3SNBA 3UPEA 2UWLA 1XKBC 2ALPA 4BNRA 2Y5FA 1BOQA 5HMAA 4A7IB 1O2ZA 2IPHA 1ZMJA 3RXDA 2LPRA 1UTQA 1K1PA 1N8OB 2SGEE 1SGFG 1CT4E 2GKVE 1EATA 2GCHG 1JRTA 3S9AA 4NIVA 1TX8A 2J34A 2PSXA 1THPB 3V12A 4K1SA 1O3DA 2AERH 2NU1E 4D9RA 1H9LB 5A8YA 1AWHB 3QTVH 1NU7B 4MNVA 1DLKB 1OKXA 2BTCE 2ZNKH 5F8ZA 1VGCB 1GDQA 2V35A 2PHBA 3M37A 4ISIH 5CDFE 1FLEE 2R3YA 3ZVDA 1GVLA 2EI7A 1C2HA 1QB9A 2ZTYA 4A1VA 1AGJA 5AFYH 4Y10E 1ZZZA 3ITIA 1CT0E 2P16A 3GOVB 4TWYA 5E0JA 3URCA 1JXPA 3BEIB 4ASUD 3AK5A 4WH6A 4AFQA 1GJBB 2O8TA 2M2AA 1NZQH 2IN2A 1V2JT 1FZZA 3PLBA 3SV6A 4ZMAH 1EJNA 2F9NA 5BPEA 3UNQA 2CF8H 3M5NA 5DPAA 1IAUA 4A1XA 2W7SA 1KSNA 5B6OA 2KCYA 1BMFD 4WJG2 4AGKA 4BTIB 3SV8A 1O2TA 3EGKH 3PWBA 3RXHA 2FODA 2XBVA 5L2ZH 3DUXH 5A8ZA 3Q76A 2ZO3H 1WTHD 4O3UA 3LU9B 4NIWA 1S0RA 3OEED 1AHTH 1XVMA 1BITA 1Z6EA 2BZ6H 3HK6B 1EAXA 5DN6D 1W14U 3ODFA 5GCHF 1JMOH 2BYAX 2FDAA 1CBWC 1IQNA 1A4WH 1YLNA 2EQNA 2FO9A 3MNCA 5DGJA 2GV7A 3O8DA 2FTLE 5IYTA 4WH8A 4NG9H 2HNTF 1T8OA 3RLYH 1SQAA 3PROA 4MQAA 2ZGCA 3TJUA 1QRXA 4HFPB 3TK5A 1C2LA 2ULLA 1P09A 1A0HB 3A8BA 3OE7D 4JYUH 5DG6A 4Y7AA 1KXFA 3UFAA 4D7GA 1B0FA 3GDVA 3E1XB 5C1YA 1V2QT 5GNDA 3LONA 1C1WH 1YGCH 1AVWA 6GCHG 4B73A 1LHGH 1MKXH 2Z9KA 1DSTA 4IMZA 2QXHA 4E06H 4DURA 1BTPA 1YPEH 4DT4A 1HAYB 1FJSA 2CK3D 2FOGA 4D7FA 3G01A 1ZYOA 1JIRA 1QBNA 2I6SA 2H5CA 1LPGB 2ZFQH 1YLCA 2FS9A 1F0UA 5ETXA 1GI6A 1VITH 2GMTB 4M9FA 3RXKA 4IGDA 1NFUA 1ZPCA 2GV6A 2ZFPH 4UFEH 3SQEE 5EQQA 1O2QA 4X6PA 1Y3WA 1A3BH 4IBLH 2J92A 4AZ2B 1VJ9U 5GDSH 5T1VA 1DM4B 2BY5X 2BLVA 4Y71A 1TNKA 3GY3A 3U28C 1BHXB 2BDIA 1E79D 9LPRA 2QC2A 4WMEA 5FBIA 2IOTA 2PV9B 3TGJE 1ZSKA 1WCZA 5EGMA 2CGAA 2G4UA 2O8LA 1JWTA 1CBWB 1YPHC 4AB8A 4JK5A 1O3MA 2GVFA 1O2HA 3WWFA 2CHAB 2VH0A 4NIXA 3SNCA 3GY6A 3EA7A 4YTAA 1SGYE 5B6LA 2K0QA 3FZDA 3A80A 3A87A 1IQHA 1D6WA 4DCDA 1HIAB 3F9HA 3PMJA 3AAVA 3UUZA 2V3HH 1DWCH 2XWAA 3F68H 3MQKC 1QL8A 2KCAA 5FX6A 1EZQA 5FAHA 3GY8A 2WPIS 4ZKSU 3TGIE 2FESH 3Q3KA 1VCQA 1O2YA 2QE7D 5K7RA 2ZU2A 1F5RA 4YLUA 1K1OA 3LGIA 2AMPA 2OBQA 5LGOA 1EOLA 1EB1H 1KLTA 1P3EA 1WOFA 3O8RA 2BOHB 3A82A 2XNIA 3H09A 1O33A 2GP9B 1RXPA 1ZTLA 3GYMA 1SLXB 2P95A 4B2BA 2NU0E 3MNSA 4F49A 1INCA 3TU7H 1XVOA 2WV4A 5A0AE 3OEHD 1O2JA 1OHHD 1WBGB 2B9LA 2GJGA 3A7WA 3SU6A 3KQEA 5EQSA 1O39A 3RXMA 1SB1H 2G51A 4FUDA 1HJ9A 2BVRH 5EPYA 2F9PA 3RXRA 3PLPA 4MPUA 5LH8A 4BANB 3LGTA 1ESAA 1O2GH 3UWIA 2FZZA 5F53A 3RXGA 1BRBE 3MYWA 2VWLA 2AS9A 1ACBE 2Q6DA 1P2KA 3MH4A 3LGVA 1MU8B 1GHZA 3W1EA 1F5KU 2CN0H 1ANCA 1NPMA 2HLDD 3OY6U 5EPNA 3HK3B 3VB4A 5PTPA 2A0QB 2BY8X 4LK4A 1QGFA 1C2KA 1D6RA 2JH5D 3GY4A 3M3SA 1HGTH 1EP6A 1C4U2 1ANBA 3PWCA 2GTBA 1LPKB 5BRRE 2ZWLH 1PPBH 3V7TA 4KP0A 1UMAH 2O8MA 1C1RA 3F9GA 1MD7A 5EG4A 4FUGA 3GY7A 3PMHB 4Q4LA 1FY5A 2HVXA 2W3IA 2YMSC 2WYJA 5DK1A 1L1NA 4O3TA 3K6YA 3R3GB 4ZCNA 1NFYA 3FN8A 1BT7A 2ZPSA 3NWUA 2WPHS 3F6UH 3ZZ9A 1CE5A 1HAVB 1CGIE 1YPGH 2GD4B 1W8BH 5LPEA 1O2SA 3MHWU 1HUTH 1WSSH 3ZV8A 1MAXA 2ZGHA 1A3EH 4JZIA 1C1OA 4XBCA 4GUXA 4MNYA 4JK6A
chains in the Genus database with same CATH topology
1GI5A 2ASUB 2P59A 1NS3A 2G81E 1T8MA 4Q80A 1P57B 4ABJA 3KQCA 3BF6H 1UCYH 1QCPA 3GCOA 1C4Y2 2GT7A 1OXGA 3SQHE 2ZU1A 4X1SU 1GMDF 1FUJA 3QTOH 2K1QA 2SNVA 2FOBA 3OYPA 1QRZA 1GMHG 2FI4E 1N6XA 2PKSC 4NFEA 2Z3DA 1NRRH 2ZI2H 1OS8A 1PPEE 1T4UH 3SU1A 5FBEA 1BCUH 1YPKH 1TOCB 3SHAH 3VEQB 3UTUH 3MO9A 2BD8A 3M5OA 2H2ZA 2O8UA 2FPZA 3A8DA 2FOEA 3E0PB 1ZSLA 1OWIA 1W7GH 1BIOA 1NT1A 3RMLH 1KXAA 1OPHB 3KGPA 3A86A 1NTPA 1CSOE 4FUJA 1Y3UA 5E2PA 3TNSA 1QQUA 1KYNA 1LVOA 2VIVA 3DFJA 2QF3A 2XRCA 4Q2KA 1TQ0B 1UTKA 1AUJA 1HIAA 1A46H 4K8BA 1GI1A 3JZ2B 3KCGH 1E37B 2F3CE 2QY0B 1EKBB 3A8CA 3VPKA 2AGEX 3S9BA 1SG8B 1UCYE 4B2CA 3U8TH 4LXBH 1XUJA 3PM3A 4I7YH 5EXLA 1O2WA 1C5YB 1SMFE 1C5WB 1AVXA 5E8EH 3ELAH 1K2I1 3KIDU 3VB6A 3RDZA 1NFXA 7ESTE 2WUBA 1THSH 2ZDMA 1YKTA 2BD7A 1HAXB 1YPJH 4Q7ZA 3E6PH 2Z9JA 3IITA 1WYKA 2BLWA 4WY3A 1O5EH 3VXFH 7GCHF 1W11U 1GHYH 2BVSH 3GCHB 2A4GA 3SJIA 3C1KA 5AFZH 1BMNH 2PKSB 4R0IA 1HPGA 1AB9C 2BQWB 3PMAB 2PGQB 1O2OA 4B74A 3P8FA 1SOTA 1XXFA 1NFWA 3RC6A 1SGDE 1TGNA 3W95A 2PKAB 1MBMA 3O8BA 4JMYA 2ZDKA 1C1QA 2XWBI 2CV3A 6LPRA 1SFIA 1O2RA 1TRYA 2F9BH 1F0TA 1IHTH 2J2UA 1GJAB 4SGAE 4OS2A 1ZPBA 4A6LA 1P2QA 2O8WA 4D76A 2ZCHP 4Y8XA 1TBZH 1GJ8B 2FWWA 3CP7A 3KQDA 2VH6A 1O5AB 2AMQA 2FTMA 1Q3XA 1Y59T 2W26A 4CRCA 2ZECA 1HAPH 1YM0A 2OQ5A 5T6FA 3U8OH 2FMJA 1BJUA 1QTFA 3P92A 3NXPA 2BB4A 1GBHA 4THNH 5C20A 2Z9IA 1O3NA 5EU8A 3NK8A 4HTCH 3TVJB 1XM1A 1Z1IA 1GHBF 1UK2A 1IQKA 4WVPE 1MTWA 2CMYA 1FY4A 2ZA5A 3BTEE 1C1VH 4NZLA 2AYWA 4DIIH 9ESTA 2F91A 4XSKU 1S6HA 1BTHH 1RD3B 1DXWA 2RDLA 3ZZ6A 2P3TB 4ISOA 3ZZ3A 1DUAA 3I77A 1XKAC 4K3JA 1AB9B 1VITF 1TMBH 3L6PA 3ATWA 3M5MA 2ZKSA 4GHQA 2C8ZB 2G8TA 4INHA 5JYIA 3ESTA 4ABAA 4KTUA 1TPSA 3SNEA 1UTLM 2BDCA 4CBNA 2LNCA 4BAKB 4B71A 1FIZA 1HAZB 1S85A 1TOMH 5IDKA 2TGDA 1RTLA 3BIUH 2XYAA 1BRCE 4FU8A 1QY6A 3B9FH 1HYLA 2ZQ1A 2D2DA 4X1NU 1GGDC 3EAJA 2RA0A 2ZTXA 3RXJA 5E0GA 4A92A 1TALA 1PJPA 3U98H 1S82A 2ZHEH 1VGCC 3S69A 1IQMA 3T28A 1D9IA 1SOZA 3VB3A 3BEUA 4WXVA 1AFQB 4RKOB 1C5QA 4I8GA 8GCHF 2Z3CA 1WV7H 1C9PA 3VGCB 4X2WA 2WPJS 1GBFA 1SGQE 4U2WA 1O3LA 3RXCA 1O5BB 4K1EA 4Y7BA 1O5CB 2FX4A 3SI3H 4Y79A 1LMWB 1V2TT 2VU8E 2XW9A 4IC5A 5J4QA 1CGHA 1VCWA 3RXSA 5ABWA 4TYDA 2SNWA 1ELTA 1FIWA 1O30A 3OTJE 3RXFA 1MTVA 1C2GA 1LQDB 2BX3A 1UVOA 1O3JA 3DHKH 2BLOA 4NA8A 3GCTF 1HBTH 2GCTC 3BTKE 5ESBA 4GAWA 2VVUA 1UTPA 1SSXA 4LZ1H 2A7JA 5C1UA 1MKWK 1GJCB 4FUHA 1O31A 1TFXA 2QXJA 2G5VA 4HGCA 3URDA 4VGCC 4X0WU 1QJ7B 1A0LA 3BIVH 4ZUHA 3FFGA 2BOKA 2AIQA 1OP8A 4FUIA 4Q7YA 2VGCC 1T32A 1EZXC 1F7ZA 3C27B 1EAUA 1GGDB 2SGDE 1GMCG 1D4PB 4X6OA 5A0CA 2ZZUH 1TNJA 5C5OA 2JH6D 1DITH 1ABJH 3MO3A 2OC0A 3T2NA 2QYIA 3Q00A 4JZEH 4ABHA 3SGQE 1BJVA 5EOKA 1O3KA 4XE4A 1GJ6A 1HLTH 3BTDE 1C1NA 1P2IA 2EI6A 1C5SA 1ZMNA 4FU7A 2PWXA 5HM2A 2C8WB 1K1MA 2J95A 1QJ6B 3LGUA 1RIWC 1A61H 4GPGA 2UUYA 1W13U 2A45B 3GDSA 3ZZBA 3SORA 3TK9A 3LT3A 1V2ST 2ZQ2A 1SLVB 1S6FA 1MKWH 2FS8A 2GMTC 1EP5A 1TRMA 2XC0A 1PPHE 1H9HE 1K9OE 3BN9A 3PYHA 1V2PT 1TRNA 5A2MH 3UQVA 2P93A 4X2XA 1ZHMA 4YESB 3M7UA 1ELFA 1FAKH 2BQ7B 4AFUA 1LDTT 4B2AA 2AEIH 2C3SA 4CH2B 3QZQA 3SJ9A 1KDQA 3RLWH 3FP6E 2WPMS 2ZGBH 1GBTA 1LTOA 2GCTB 5GIBA 1LKAA 1BTWA 1O3EA 1F2SE 3HATH 2A5KA 2CHAC 2VVCA 6ESTA 1H1BA 2ANMH 2GZ7A 4VGCB 1BHXF 4Y8YA 1P3CA 2QGRA 3Q77A 1ZJKA 4R8TB 1GWAA 2VGCB 2BXUH 3A7TA 5E2OA 1AZ8A 5JBBS 2ZGXH 4CHAC 4X1RU 4DW2U 1KTTB 1ZOMA 3U8RH 1UJ1A 5C3NA 1Q31A 3LJJA 4RSPA 1TNIA 3O8CA 2HPPH 2ZHFH 1D3DB 1BA8B 2DE8A 1C5RA 1TGCA 1CVWH 3KF2A 1DT2A 1HXEH 2H5DA 2C93B 2ZCKP 5GCHG 2ODQA 2HWLB 1E35B 1AFEH 1HJAC 2R3UA 4SGBE 1QRWA 3B8JA 1AVGH 1ELVA 1Y8TA 1Q2WA 2P8OC 2OINA 3UNSA 4XDEA 1C5LH 1RIWB 2ZC9H 5JPMH 1PPFE 2BD4A 3PV4A 4ISHH 4FUFA 1C5MD 1WQVH 4FUEA 2FOHA 1LVMA 3U1IB 4OS7A 3P8NA 1FY1A 2KAIA 1KTSB 1RFNA 1P2MA 3OY5U 3T5FH 2M5TA 1C1UH 4Y11E 4WWYA 2Y81A 3TK6A 3UWJH 2ODPA 2ZPRA 2PW8H 4X1PU 5HGGA 1K1JA 2ZDLA 2Z6BD 1O2VA 1ZLRA 1NC6A 4Y6DA 2Y5HA 5ESTE 3P8OA 3LOXA 1LHDH 1AZZA 1TQ7B 2QIQA 2WUCA 3TITA 2D1JA 5CMXH 1PYTD 1ELCA 2A4OA 2I6QA 4AFSA 2A1DB 1ARCA 1CU1A 1WUNH 1SC8U 5C5NA 1QJ1B 3AAUA 2RA3A 4I8KA 3W94A 1OWDA 4GLYA 4D9QA 2VIPA 2PUQH 1NRQH 1GCTC 1AE8H 1LHCH 2HRVA 4CHAB 3K9XB 1Z8IB 3E8LA 2PSYA 1W3CA 3BTWE 4CRFA 4K69A 1DUEA 3L33A 3GICB 1HJAB 3MU5A 4ISLA 2OXSA 3A89A 1IQJA 5HM9A 1FV9A 1GVZA 4I33A 1YPMH 2P8OB 4IN1A 4O97A 3SI4H 1W12U 3P6ZB 3ZZ4A 2FI3E 1C2DA 6CHAC 1GBDA 2ZFSA 2R9PA 4FVDA 2VIWA 1DOJA 2Y6TA 3ZZ5A 1TMUH 4JZFH 3B23B 3LDXH 2FLBH 2SGFE 1NESE 2XC4A 4YT6H 1QHRB 1BTZA 2BX4A 1O2UA 1FXYA 3BG4C 4JYTA 2ZFTA 3Q3XA 4KTSA 2VIOA 3NZIA 1FMGA 1S83A 1EASA 1PPZA 1W10U 4Y0YE 1CT2E 2XCFA 5JBAS 2PTCE 1BBRK 1RTFB 2WINI 1NO9H 3HKJB 1SGFA 3IG6B 2ANWA 3BEFB 3H7TA 2WPKS 3A8AA 3ZZAA 3ZVFA 2OTVA 1KXCA 3RXQA 1GBAA 5HYOA 1J9CH 8LPRA 1O5GH 4MPXA 2IJOB 4CBOA 1NU9A 1GI8B 4UFGH 3PMBB 4WXIA 3MNXA 2FOMB 3UR6A 1BMLA 2OCVB 3SOSA 1GCTB 2J38A 2Y7ZA 1OWHA 2AGIX 5EXNA 1O2NA 5FX5A 1TAWA 2STAE 3SJ8A 7LPRA 3T29A 1FONA 2OP9A 1DANH 4DT7B 3HGPA 4CRBA 8ESTE 3ZVAA 2V3OH 2FOAA 2G5NA 2TGTA 2O9QA 3QWCH 5DP3A 5F03A 2H9EH 2XXLA 5CHAC 2QXIA 4UONA 1CHOF 3IWMA 2ZU3A 4GCHF 3SUFA 1QA7A 2G52A 2ZDVH 3SJKA 1G9IE 2FYQA 1K21H 1KLIH 4U30A 6CHAB 1JRSA 1GI3A 3QUMP 4DY7B 1ZHRA 5CE1A 3QX5H 1UHBB 1NRNH 4X2YA 3UQOA 3ZYDA 1VR1H 4Q7XA 1TYNA 4CRGA 2NU2E 3BG4B 4B1TA 1K1NA 1MU6B 3GCHC 2BXTH 4NCYA 1BTXA 1GHAF 3QDZB 3BTFE 1NM6A 1J16A 1O2KA 2PUXB 1ARBA 3RMMH 3BTQE 2SGQE 3HKIB 1AKSB 1BQYA 1BTUA 1GHVH 1AU8A 1FN6A 2Y80A 2Q1JA 4CH8B 4E7RG 4ZXXH 2FLRH 2AGGX 1YF4A 5L6NH 3TGKE 1OWJA 1K22H 1QNJA 5F8XA 3RXEA 2QV1A 2HPQH 1TGBA 1GMDG 2OC7A 1OYTH 1PPGE 1YCPK 2HGTH 1HRTH 2B8OH 2ZHQH 1EPTC 5AHGH 1BBRE 3A88A 1ZGIA 3RU4D 1A7SA 1C9TA 3U1JB 3PTNA 3SZNA 2VWNA 1BMAA 3ODDA 1AI8H 5CHAB 1BRUP 1BTYA 1ETSH 3M35A 5T3HA 3ZZCA 3M36A 3PB1E 2F9UA 2YOLA 5JDUB 3RMOH 3Q3YA 3ATKA 3EQ0H 4K5ZA 3RU4T 2BDHA 2Z7FE 2QCYA 5DP7A 1FI8A 2THFB 1V2RT 1GBMA 1J14A 1S0QA 2BHGA 3AVZA 2H1UA 3P70B 4BAOB 2G55A 4HZHA 1RTKA 3MH6A 1P05A 4BXSA 1MTSA 1PQ8A 1YCPM 4FUCA 1IQLA 1LCYA 4KKDA 3KQBA 4MVNA 1O3PB 1G3DA 1HNEE 4AG1A 4YOIA 2Q6GA 1IOEA 1C5PA 2P94A 4Y76A 4U01A 1ZRBA 1HJ8A 4H6SB 3RXPA 1YBWA 2Y82A 3TPIZ 5SGAE 2D26C 2GX4A 5TCCA 1N1LA 5EW2H 1GI9B 1F0RA 4WMDA 4X2VA 1X7AC 1ZTJA 1T8NA 7GCHG 1JIMA 1EPTB 2Z9GA 5I46H 4BXWA 1E36B 3RXTA 4BTTB 3GISB 1OSSA 1EAIA 2P3UB 5EODA 2ALVA 4YM9A 2ZIQH 1TNHA 3S7HB 5JB9S 1Z8GA 4DJZB 3AW0A 2Q6FA 1DY9A 1SGNE 3RXLA 4CRDA 1C5XB 3VB5A 1AFQC 5AVDA 3E90B 3RU4E 3SU4A 5K0HA 1RGQA 3KL6A 3S9CA 3HGNA 2BY6X 1OWEA 1TA2A 1EJMA 2QF0A 4KGAA 3ZVBA 3VGCC 2FYRA 1P03A 1HAVA 1P2JA 2UUKB 3SO3A 5FHTA 2HALA 2BY9X 1UVPA 1CO7E 3SNAA 4ZKNU 1UHBA 1Y5UT 5TJXA 2QN5T 5GWZA 5L2YH 1AY6H 3N7OA 2AMDA 3ZYEA 1JOUB 1DX5M 1E38B 1TB6H 4YO9A 4K1TA 2ZDNA 1GJDB 4I8HA 1FN8A 1GHBG 1OOKB 4A1TA 3NCLA 3MTYA 4ZXYH 1L1GA 1ELEE 3RP2A 1FDPA 4AN7A 1AKSA 5FCKA 1W0YH 2A4RA 3T25A 3CENA 4I8LA 1UTMA 1ABIH 1Y5BT 3UOPA 3K65B 2J94A 3BTTE 2BLQA 1AQ7A 4DG4A 3MNBA 4ZHLU 3ATIA 4NSVA 3MH7A 2ESTE 1VITG 1V2MT 1Y3VA 1GDNA 1TX7A 1L0ZA 1YLDA 3DA9B 2R0KA 2W3KA 1TX6A 3LGYA 4H4FA 4D8NA 4QT8C 1PQAA 1VCPA 4FXGH 3STJA 1PYTC 2Z94A 1CA8B 3P17H 1Y3XA 1MZDA 4DVAU 1TNGA 1N6YA 3K2UA 1FAXA 2AH4X 2JETC 3A81A 3RC4A 2BM2A 4XBBA 1QL9A 2XBYA 4OS1A 3FZZA 2V6NA 3SV9A 1MQ6A 1GI0A 1MBQA 2A31A 2BD3A 2VB0A 3EE0B 1O35A 3MO6A 3QN7A 5H4IB 2FOCA 3TH3H 3SUDA 2FX6A 2ZP0H 1DDJA 2R2WU 1K1IA 5C1XA 3DD2H 1KXDA 4XFQA 4IS5A 3ZVGA 1P01A 8GCHG 3MU8A 1O2PA 1NRPH 3BTHE 3E3TA 4GHTA 1F5LA 5EXMA 1MUEB 4Z0KA 3QGJA 4AX9H 4X6MA 3VXEH 1OYQA 1LHEH 2WV5A 2VVVA 3ENSB 4YOGA 1CGJE 3I78A 1CA0C 2QA9E 1PPCE 1VJAU 1IQFA 2GCHF 2A2XH 4BAQB 2PKAA 1V2NT 1V3XA 1GPZA 1O37A 4NGAH 1GI7B 2TGPZ 4ABIA 1P9UA 4ZHAA 4B75A 3EA9A 2SGPE 4MNWA 2ZCLP 2AFQB 3VB7A 1GBCA 1GBEA 1AN1E 1EPTA 1TE0A 3GCTG 3MU0A 1W0ZU 1C1TA 3LGWA 5E0HA 3BV9B 3LKWA 4DOQA 1HV7A 1IHSH 3BTME 3M3VA 3ATMA 1LO6A 1MD8A 1P8VC 2CXVA 1MZAA 2C8XB 1OWKA 2BMGB 1P2NA 1DICA 1UVTH 3OU0A 4AGJA 4K8YA 1RS0A 1GBKA 2BDYA 3ZVCA 1T31A 2F83A 3K6ZA 4AYYB 1IQGA 5DP9A 1AE5A 1G37A 2ZTZA 1SPJA 2JETB 5DP4A 1A2CH