4F48B

The x-ray structural of fimxeal-c-di-gmp-pilz complexes from xanthomonas campestris
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
97
Chain Sequence
QGILSLALKDKAALYSAYMPFVKSGGIFVPTPKRYMLGDEVFLLLTLPDSSERLPVAGKVVWTTPAGANRAAGIGVQFPDGPEGEAVRNKIETLLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural polymorphism of c-di-GMP bound to an EAL domain and in complex with a type II PilZ-domain protein
doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Signaling protein
molecule keywords Putative uncharacterized protein
total genus 21
structure length 97
sequence length 99
ec nomenclature
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07238 PilZ PilZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 4f48B00
5EJ1A 3CNRA 3KYFA 4I86A 5KGOA 5KECA 4F48B 2GJGA 5KEDA 5EIYA 4P00A 4RT1A 1YWUA 4P02A 4FOUC 3DSGA 5EJLA 4HG6A 3KYGA 2L74A 2RDEA 1YLNA 4XRNA 5EJZA 4RT0A
chains in the Genus database with same CATH superfamily
3PO1B 2KCPA 4MDSA 2FOFA 2ZDNA 1Z6EA 1P09A 4RKJB 2O9QA 4I86A 3BTKE 5FXLA 1AMHA 1EZXC 1Y3VA 2FM2A 2THFB 4IMZA 4AB9A 3BTWE 1Q2WA 2ZGBH 3ATLA 5LGOA 1GBBA 2I6QA 2OP9A 2R0LA 2QXJA 3BTHE 5E2PA 5A0AE 4SGBE 3T29A 3PV5A 1TNLA 3M37A 1OX1A 2A5AA 5TCAA 5IYTA 1GMCF 2DE9A 3EA9A 4KGAA 5G4BA 1QY6A 1WQSA 1P57B 4KELA 2FI4E 4CH2B 3EA7A 2BY7X 4Y10E 2VIDA 6GCHG 3TNTA 3MQKC 1OP8A 3E0NB 1TRNA 2B7DH 1FY4A 4M7GA 3FZDA 1A3EH 1YF4A 1P9SA 3UNQA 5FL7D 3V3MA 5JBBS 1GDNA 2STAE 3S0NA 1ZMLA 4I8KA 1ZTKA 2HLCA 3F3BA 4FVBA 3OYPA 1T8LA 2YNAA 4E7RG 1GHXH 3DD2H 2F9NA 1C2IA 1JOUB 2W7UA 1FMGA 1GBCA 3STIA 5E2OA 3SBKA 2JKHA 1GHBG 4IN1A 1EZUC 1THRH 4UFGH 1KXBA 1Y5BT 1E0FD 2TGTA 5FPYA 1ETTH 1TIOA 1HAVA 1EOLA 1QFKH 2FOGA 4FUCA 3AASA 3S9BA 1GCTB 3MH5A 3A7VA 1OP2A 4Q2KA 2SGPE 2FS8A 1YC0A 2C3SA 1GI9B 5GCHF 1MTNC 4NFEA 5AFZH 3MMGA 1INCA 1OWIA 4WMFA 1SQOA 1EZSC 1DY9A 1AE5A 1EX3A 1CGHA 3F1SB 1EFRD 4D8NA 3A8AA 1DS2E 7KMEH 2AHME 2C90B 1AI8H 1SGIB 3VG8A 2QF4A 1DLEA 3GOVB 4D9RA 2VVVA 1H8HD 7LPRA 2ZPRA 2WPJS 1WV7H 2RA3A 1Z8IB 1JRTA 2R2MB 4O9VA 4P00A 2ZCHP 3ZZ7A 1LVBA 5JBAS 1A5HA 2H5DA 4OM9A 3W95A 3GY3A 1OWDA 5BPEA 2Y6TA 3PV4A 4UONA 4D7GA 3NWUA 1XM1A 1EAIA 4B1TA 1ZOMA 5HIYA 1W14U 3ZIAD 2QN5T 1W11U 4ZMAH 1U6QA 1VCQA 3HKIB 2SGAA 1O5FH 2M5TA 3ZYDA 5FX6A 3RMMH 1BUIA 3UAIC 2ZEBA 2J94A 2GCTB 5EU8A 1MCTA 2VWMA 2M2AA 3F9HA 3QWCH 1AFQB 1W0KD 1FN6A 1D3QB 5J4QA 3ZZ5A 4H42U 1TA6A 5JB8S 2VBCA 1YCPK 1QURH 2F9UA 1MBQA 3DFJA 1O3HA 1BTZA 1AWFH 1P03A 3UTUH 1UTMA 4ISLA 5T3HA 4BXSA 1AN1E 1TPSA 3MNSA 1O3KA 1G2MA 1CVWH 3BG4B 2AIQA 3RXFA 2AGIX 4RI0A 5C17A 1C5XB 2KAIA 3TK9A 2UUFB 5LPFA 4GHTA 2Y7XA 4P02A 2VGCC 1P10A 3F9FA 3K6YA 1DITH 1Z1IA 1O3DA 3WWFA 1D3TB 1GBAA 1Q3XA 2A5IA 4X1SU 4MQAA 4VGCC 3RP2A 1TNIA 2ZNKH 3UOPA 5DO4H 3RXKA 2H2ZA 5JDUB 3FVFB 1EQ9A 2AMPA 2ALPA 4OS4A 3TJOA 1UCYH 2CF9H 5EPYA 2VNTA 3P70B 3BIVH 5ESBA 2GZ8A 1EP5A 1LQDB 5DSFA 3PROA 3BIUH 3SOSA 2VB0A 4A7IB 1AFQC 3FP6E 3PTBA 1WOFA 1HBTH 4IW4E 1VGCC 2J2UA 1TYNA 1W0YH 1GWAA 1W0ZU 2O8UA 4JK6A 3KHVA 2KCAA 3LGTA 3VXFH 3BTFE 1HV7A 1QRXA 1UTOA 5EQRA 2PTNA 8LPRA 1QNJA 3AAVA 1AB9C 4Y8ZA 2BX4A 3NUMA 2XCFA 4GCHG 1YPKH 5GDSH 2J5UA 3VGCC 1C1UH 1GCTC 1GDUA 4IS5A 3BTGE 2A1DB 4PROA 3DCLA 5EXNA 4R0IA 2OQ5A 2W3IA 3UR6A 4ZXYH 3P95A 1GI8B 1HB0B 1ACBE 2FX6A 2C8YB 3TNSA 1MKWK 1VITF 1F5LA 4BAQB 2OUAA 1GJDB 1B0FA 2ZCKP 2QIQA 1ELEE 1O3GA 3ATIA 3QUMP 1LKAA 2B9LA 3JZ1B 3UWIA 1C5WB 1EAUA 4I32A 1J15A 5DK1A 3U8RH 2G5VA 1GBDA 1V2KT 2BOHB 2HWLB 4ZH8A 1KXDA 3SJKA 5F8XA 1O5BB 4JZEH 4ABDA 1JXPA 4THNH 2FTLE 3O8CA 1P3CA 1XUGA 3BEUA 3F0OA 2XBYA 3EDXB 1A5IA 2ZDAH 5T1VA 1ABIH 1UTNA 1HJ8A 4NIWA 4UD9H 2ZKSA 2C93B 1SMFE 2RDEA 1H9IE 2GMTB 1O35A 4K60A 5T6GA 2KR7A 1EUFA 4CRFA 3GY7A 4FETA 1KXFA 3AW1A 4BAMB 3EE0B 1RTKA 1SGFG 2H9TH 2K0QA 1UHBA 3BTDE 1ZYOA 1DICA 4B2AA 3H7TA 3PRDA 2JH6D 2UWPA 5F03A 3DUXH 2F9VA 1O2WA 1P2NA 2ZTYA 2HOBA 2YMSC 1J9CH 3MH6A 4O3UA 4DCDA 2J92A 5CMXH 4FUBA 1K0HA 2FYQA 3A85A 2XXLA 3BV9B 1ZZZA 3LGVA 3ZV9A 1E1QD 4WH6A 3HGNA 3Q3KA 3GCHB 2J34A 1RIWB 2ESTE 3SQEE 2P3TB 2BVRH 5LPEA 2J95A 1HAGE 2P16A 3SGBE 1ARBA 4ZKRU 2GX4A 4K5ZA 5FBEA 2EA3A 1TGSZ 1V2RT 1OWJA 4I8HA 3IITA 1YGCH 1DWDH 2KCOA 4GAWA 3M5MA 4YTAA 1NFYA 2IJD1 1GG6B 4X2YA 1UVTH 1C4U2 1C5ZB 1OPHB 1YP9A 1KDQB 1E37B 1FDPA 4JZ1A 3FP7E 1UCYE 3RXCA 3M7UA 1C5OH 3KQDA 2GKVE 1BMFD 1NESE 3LGWA 3S69A 2H6MA 4B71A 3NXPA 1O37A 1C1TA 1T7CA 2XTTB 4MPVA 2NU0E 3SI4H 1S84A 4ZKOU 1O2UA 1W7GH 2RG3A 3GYLB 3P8FA 4WMDA 4AFQA 2G51A 4XDEA 2WPKS 1XUIA 7GCHF 1O2HA 3ZZ6A 1X7AC 2HNTE 3RDZA 1F0UA 2WPIS 1P01A 3F9EA 2CV3A 2XW9A 3T28A 1DUEA 6ESTA 1VZQH 2EI7A 4WXVA 1O2TA 2ZDMA 6CHAC 2V0BA 4JYTA 1C2HA 3LONA 1AO5A 5C5NA 1BTHH 1VCWA 1EAWA 2GDDA 4DT7B 5GCHG 2O8TA 1V2WT 1F2SE 1DVAH 4K2YA 3MH7A 1COWD 1TBQH 4NIVA 4OGYA 1HUTH 2ZTZA 4FUHA 5DG6A 1E34B 1V2PT 2QC2A 2OQUA 5EXLA 2A2XH 4TY7A 4MVNA 2ZTXA 1HIAB 1VR1H 3TITA 3UIRA 2GV7A 1GVLA 3SJ9A 1NC6A 1Y59T 2BX3A 3E16B 3SV7A 3UQVA 2GCHG 2GT8A 3A83A 4RKOB 4DW2U 4K69A 3QLPH 3K65B 1HFDA 1ZRKA 2QYIA 1QJ6B 3M5LA 2ZQ1A 1C2JA 1BB0B 1T8MA 1AKSB 4KKDA 1ORFA 3RXPA 3MNBA 2AIPA 1ELCA 1RXPA 2Q6DA 3MOCA 2GT7A 3M7QA 1TBZH 4CRDA 5DP3A 1RD3B 1TX8A 1H8ED 4BTTB 1Y3UA 1OXGA 1VJ9U 3L6PA 1PPBH 5IDKA 2PSXA 3FO8D 4I8LA 2QCYA 1FNIA 1GBFA 1T8OA 1TNHA 3KQBA 2YMSB 2ODPA 4TWYA 1PPGE 3RM2H 8ESTE 4X0WU 1A0LA 4B76A 3KL6A 2V6NA 2SGFE 2ZF0H 3FKSD 5C3NA 3LDXH 4J2YB 4A5TS 1C1WH 1NU7B 1BQYA 1O36A 1MQ5A 3DSOA 3WW7A 1AVXA 1GJ9B 5ABWA 1DPOA 1SVPA 3SNCA 4DOQA 1EZQA 4FVDA 3RU4D 1WDIA 3SUGA 1GMDF 1J8AA 2Z6BD 1J14A 4MNWA 4ZAEA 3A7TA 1ELBA 1HAYB 5EQSA 4ZXXH 3F2GA 2FEQH 2FI5E 1F0SA 1O5GH 3GDUA 1S5SA 1ELTA 1OYQA 1SHHB 3P92A 1G3CA 3V12A 2VIWA 3U28C 1NPMA 2XBXA 2FTMA 5A0BA 3F2FA 1GHZA 1NN6A 3T27A 4AZ2B 1GDQA 4B6FA 1FAKH 2Z3CA 4Q80A 3PLBA 3EE7A 3R3GB 3KQCA 3F9GA 2ZP0H 3M3SA 3OSYA 1XUFA 1BTPA 4ABIA 1MTWA 2TPIZ 5JPMH 1GJ6A 5KECA 3SUEA 3A81A 1K2I1 1IQJA 1SGCA 1GBEA 3LOXA 3ZZ8A 3A8DA 3GCNA 3M5NA 3IG6B 1RFNA 2KCYA 2ZDVH 1GI4A 1O3MA 2V3HH 2ZHDA 4AGKA 2AMDA 2ULLA 1H8DH 2W6ID 3LKWA 4O3TA 4CBNA 2OCVB 1BZXE 2PGBB 1P2IA 2Y7ZA 1K28D 1SGEE 1JMOH 2FYRA 4BANB 1N6YA 1ZSJA 1QIXB 1C5NH 2XC5A 1O5AB 2GZ9A 1NM6A 3ZVEA 2OTVA 4YZUA 1DT2A 2XBVA 1C2KA 1SQTA 3ZZAA 4Y8XA 1K1MA 2XOKD 1HYLA 1GJ4H 1KDQA 3PO1C 3A8BA 5HKKD 1GBKA 2LP6A 1JIRA 1W13U 4OGXA 3RU4E 3RXIA 3SV8A 3MYWA 1O0DH 3O8RA 3RXSA 1O2MA 1G9IE 5C2ZA 5EJLA 4HG6A 1BRBE 2NU2E 2Z94A 1G3BA 2HVYB 2PFEA 1HAXB 1TGBA 2KZ4A 1AHTH 2WZQA 4YXWD 3RXJA 3TIUA 4ZKSU 1ABJH 2R2WU 2BDBA 4FUEA 4DG4A 3GDSA 2VWLA 5EODA 1IQGA 5EIYA 1O2GH 1SPJA 1AQ7A 4NG9H 3HATH 1DLKB 1W0JD 3UR9A 2GGVB 1F0TA 2I6SA 3OY5U 1AIXH 3UREA 1IQEA 1A2CH 1C5VA 1GJ8B 5HM9A 2FODA 3F0PA 3SI3H 5T6DA 2STBE 3FAOA 1O30A 2IJOB 3UPEA 1YPEH 1SOZA 4TT3D 1L1JA 4FUJA 2ZU5A 5AVDA 1O2XA 1B7XB 3M61U 1CBWC 1QR3E 1ZPBA 9LPRA 2ZA5A 1Z6JH 3A7YA 1C1OA 4ISIH 1K1OA 2NU4E 1TQ7B 3LJJA 2R3UA 1BHXF 4DJZB 2Y5FA 1UVPA 2BD4A 2B8OH 3KYFA 4AFUA 2PP6A 2ZG0H 1VCPA 4YO9A 1S0QA 2QXHA 4E7NA 1MD8A 5C0UA 4K1EA 8GCHF 1D6RA 3R0FA 3DSPA 1YKTA 5F8ZA 2SFAA 2CN0H 2FPZA 4IC5A 5HYOA 3B9FH 1TNGA 1NROH 1FXYA 1NU9A 2FP7B 5L30H 3KCGH 4HZHA 1WUNH 2UWOA 1Z8RA 1D3DB 4AYVB 2ZPQA 4GLYA 3NRLA 2NU3E 3GY5A 3SNDA 3GISB 2BD8A 2TIOA 4XOJA 2D2DA 1P11E 4INHA 3PTNA 2PLXA 2BZ6H 1GBJA 4BNRA 2VH0A 3OEED 2BQ7B 3TVJB 1C2LA 2BDHA 5DPAA 2K1QA 3BG4C 3TJUA 1C4V2 1C5PA 4LZ4B 2ZU4A 3ZZCA 1W12U 1GG6C 4INLA 3A7XA 3FN8A 3MWIU 5FX5A 4Y0ZE 2A4OA 3LGIA 1E1RD 1LO6A 3S9AA 4B74A 3RXLA 2P8OB 1KY9A 2GDEH 3AK5A 3MU4A 5SGAE 3N7OA 1FX0B 1S6FA 4Z6AH 2KFWA 1SR5C 3STJA 3K9XB 4B73A 2AGEX 1TGNA 2BB4A 5KEDA 2HNTC 1BMNH 2ZDKA 1NRRH 1YWUA 3SU2A 1AZZA 1ZHPA 3GCHC 2A45B 1BJUA 1UCYK 4FU7A 3BN9A 1IQIA 3JZ2B 4RT0A 1MTUA 1BMAA 4NCYA 5FPSA 1T31A 1S81A 1SGRE 2CHAC 5DJ7A 2KM0A 2VWNA 2L6OA 1ZR0A 1PFXC 4HGCA 1G3EA 1YPLH 2ZU3A 1WCZA 2BM2A 1GI1A 2FI3E 2EC9H 1P2OA 1O2YA 2VIVA 4Y8YA 3I78A 5L2ZH 1GI5A 4NFFA 1H1BA 2AMQA 3QZQA 4BAHB 4GHQA 3LIWA 1CA8B 3EA8A 1RRKA 4D7FA 1L1GA 1KSNA 4CHAC 3TJNA 3BTTE 3VB5A 3TGIE 1LKBA 2FIRH 2KAIB 2Z9IA 2A32A 1C5MD 2HALA 1P06A 1NRPH 3RXDA 3M3TA 1EPTA 5AF9H 1IQMA 3UNRA 1T32A 1OHHD 5JBTA 3KNXA 4A92A 1SGFA 1BTWA 1DM4B 4XFQA 2TGDA 1NRNH 2BLVA 3MTYA 1KXCA 2F91A 2OLGA 2A4GA 3Q00A 2EQNA 1QL8A 1GGDB 1AVGH 4OS5A 2AS9A 3ATWA 1GGDC 4ABEA 1Y3YA 1C5QA 3EYDA 1TONA 3RXGA 4WY3A 1E79D 1SKYE 3BTEE 1PPFE 2P8OC 1BIOA 1K22H 5FAHA 1C9PA 1G37A 1N6XA 4ABGA 4U32A 1TNJA 3P8NA 4NIXA 2Z9KA 4XBCA 2JJ1D 4B2BA 4LXBH 4VGCB 2OXSA 1VITH 2ZZUH 1QA7A 1ZPCA 4IGDA 2Y5HA 3WWBA 9ESTA 3FOAA 1C2GA 4A6LA 2ZDLA 1P05A 1YCPM 1O2RA 1LHEH 3HPTB 1PYTD 3VEQB 4MPXA 1A0HB 3LPRA 1C1SA 1CU1A 4JK5A 2PTCE 1OS8A 2ODYB 1MABB 1P0SH 1SHYA 1KMHB 3LC5A 5C67A 3SNAA 3P8GA 3OU0A 4J1YA 4X2WA 2ALVA 3ITIA 1SI5H 3A7WA 3RM0H 1UTQA 1PPZA 2LPRA 1ZLRA 5GWZA 1PPHE 4K8YA 3SW2B 3TH3H 4CBOA 4TSFD 3H09A 2HVXA 1FY8E 1TLDA 1ZTJA 2Q6GA 1TAWA 2BDAA 1KTSB 2ILNA 5EW1H 4OS6A 4BXWA 2H9EH 2GD4B 1CHOG 3ENSB 4ACAA 1S6LA 3KIDU 2WV9A 1HJ9A 1O3LA 1VKYA 2XRCA 1DXPA 1LHDH 1DWCH 4MPWA 3F68H 2VU8E 5KGOA 4U01A 1F0RA 2ZPSA 2Q6FA 4FUDA 3TH4H 3C1KA 2WYGA 3KN2A 4SGAE 3MU5A 1GJBB 4WJG2 4AX9H 1J16A 1LMWB 2A4RA 2BTCE 1MQ6A 3F2HA 3VB7A 1EB2A 1O39A 1QJ7B 2G55A 4I8GA 3DA9B 4Y0YE 1ZMJA 1V6DA 4Q63A 4YOJA 2WHXA 2F3CE 2O8LA 2V7QD 4BAOB 3V7TA 4YM9A 1BBRK 1QBVH 1ESBA 1ID5H 2FX4A 1E36B 3GY8A 1HAIH 2P94A 4KTUA 4H4FA 5GNDA 4ZCNA 2FOCA 2C4FH 1B0EA 1FJSA 3AVZA 4X8VH 1GJAB 4AN7A 4ACBA 1GL1A 3CS7A 2SNVA 3ATMA 4RT1A 4CR9A 2GCTC 2XCNA 4X6MA 1HNEE 3SHCH 3HGPA 4F4OC 5DP7A 1EJMA 1SQAA 2J38A 1ZGIA 3PWBA 3RC6A 1DY8A 5FCRA 2WINI 3LH1A 2XC4A 2JETB 3BTME 1YPHE 1SGQE 1J17T 2CJIA 3SV2H 1AUJA 2P95A 2JETC 3ODDA 2Q1JA 3RXVA 4UE7H 1C5SA 3RXBA 2FOHA 3NPSA 1S85A 2ZFPH 5EOKA 1TALA 1IQKA 1FUJA 2BD5A 2W5EA 3ESTA 4ABHA 1WYKA 1Y3XA 2PWXA 1Z1JA 1DX5M 1N8OC 4KTCA 3FANA 1DSTA 5J4SA 3VPKA 1CE5A 3ZVGA 3OY6U 3UNSA 1RJXB 1RTLA 1HLTH 2TGAA 3URCA 3RC5A 1PQAA 5JBCS 5B6OA 2J9NA 3SNEA 1HDTH 5JYIA 3SGAE 1L1NA 3PRBA 1C1PA 2PHBA 4HTCH 5F6MA 4NIYA 1YPJH 2H5CA 1O3JA 3FZZA 1LHGH 2NU1E 3QTOH 4NA9H 2GCHF 4Z1MD 2A0QB 3A80A 1OWEA 3EGKH 1GJCB 5C0TA 1P02A 3Q3YA 1HJAB 3E6PH 4K8BA 1NO9H 1OWHA 4ISHH 1QGFA 1LVYA 2HPQH 2W7SA 3S7HB 1KLIH 2Z3DA 4BTUB 1MAYA 1C9TA 1CSOE 5CHAC 5LH8A 1T4VH 1CT0E 2ZIQH 1KYNA 3Q76A 1XXDA 1WU1A 1BBRH 1THSH 3SU0A 2HGTH 3ATKA 2BMGB 2B0FA 1BHXB 4HI3A 4Y76A 3SU5A 2A7CA 3ZVDA 2CXVA 3PMBB 3W94A 3ZZ3A 1HAVB 1EJAA 4FOUC 1W3CA 1OOKB 3PMJA 4YESB 4AOQA 1CT4E 1YPMH 2A7HA 2JIZD 1P2KA 3RXQA 3PB1E 2PV9B 5GJ4B 3ZVAA 1C2FA 1N8OB 1UTLM 2XBWA 5DP4A 4K1SA 5DN6D 5C1XA 2R0KA 7ESTE 3MU1A 4MTBA 1K1NA 1TOMH 4X8SH 4FUIA 3PYHA 4GCHF 3ZV8A 3TK6A 1A61H 1O3IA 2VIOA 1O5EH 3DHKH 1DWEH 4X1RU 1GBHA 2F9OA 1O5DH 3N7DA 4NA7A 5E0JA 2EI8A 1HAPH 4TY6A 1P2MA 1RTFB 3ZZ4A 2QXIA 3FP8E 3RXAA 5A8ZA 1C1NA 1V2UT 2F43B 2WPDD 1FIWA 3P6ZB 4X8TH 1A3BH 3RMOH 2PKSB 1TE0A 2DUCA 1SG8B 1O2SA 2ZHQH 1CBWB 2BQ6B 3A82A 3QN7A 1F5RA 1C2EA 2QV1A 1O2ZA 4Y7BA 1K1PA 2GZ7A 3UUZA 3UFAA 3OTPA 1T8NA 2TGPZ 1A4WH 3E8LA 1ZPZA 4K1TA 1O3OA 3CENA 1GHAF 1FPCH 1YPHC 3PV2A 3IWMA 1GI7B 1PQ8A 1E35B 4NWLA 3MU0A 4ZHLU 4E06H 2AH4X 3GYMA 4I31A 5EG4A 3K6ZA 4O03A 1P12E 2CK3D 3KQEA 1UTKA 2F4LA 1QQUA 4ISNA 4AG2A 1MAXA 2OC1A 5HIZA 1O3NA 4WWYA 3KGPA 2ASUB 1O33A 2QGRA 4WXIA 1EATA 1HRTH 4CRAA 4H6TA 1V2MT 2VINA 1YLCA 5A0CA 3OTJE 3U1IB 1ELDE 2ZFRH 2AGGX 4UFFH 1GHBF 3MNCA 1OWKA 3LGYA 3RXUA 1A7SA 4IMQA 3SGQE 1UJ1A 1A1RA 2C8WB 4ASHA 3N99A 1SFIA 2FDAA 1QBNA 3GS9A 1LQEA 3RXOA 3SU3A 5DP5A 1FN8A 1V2OT 7GCHG 2UUJB 1K1LA 2P59A 1LHFH 3MNXA 3RMNH 1GJ7B 1NRQH 3RUOA 1IQHA 1K9OE 3BEFB 2PKAA 2BZAA 2ZQ2A 2ANWA 3MO3A 1BA8B 3GY2A 1G2LA 2GP9B 1FQ3A 2BXUH 3BG8A 2Z9GA 3A86A 1HCGA 1QZ8A 3A87A 1OSSA 2BDCA 3PWCA 4MPUA 5DGJA 1HXFH 4YT6H 1ELFA 2BDGA 2R9PA 1TWXB 2VIPA 1LTOA 4DIHH 1Y3WA 1NY22 1FAXA 3MI4A 2BHGA 1NFWA 4X8UH 5FPTA 1E38B 4CR5A 5DP6A 3NZIA 1WTHD 5DP9A 5GPIB 3GICB 1SLUB 1PYTC 2IPQX 1XKAC 3TH2H 1LDTT 1NS3A 2JH0D 2SNWA 4X6NA 1BTYA 1FONA 3SJ8A 2ANYA 1TB6H 1O2IA 1TABE 3KF2A 1YPGH 2IOTA 4CRGA 3SU6A 3V0XA 4X2XA 5EJ1A 2XYAA 2JH5D 1O31A 1LHCH 3GY6A 3T25A 1H9LB 4O97A 1YY3A 1SGYE 2FESH 5E8EH 3HK3B 3BF6H 1DOJA 2QF3A 2BD3A 2F9BH 4FUFA 3QGJA 4B75A 3QX5H 2PW8H 2Z9JA 4X1PU 1QB1A 1IHSH 4F55A 4DGJA 3TPIZ 1ZRBA 3LH3A 4XBBA 2A5KA 1GHYH 1KLTA 2J98B 2SGQE 4KP0A 1BMMH 4ZHAA 1XUHA 1MU8B 2G81E 4A1VA 4OS2A 1O2JA 1G3DA 1JBUH 2BLOA 2BXTH 4Y7AA 1GBLA 4JCNA 3T26A 1UHBB 4WH8A 1SB1H 4ZHMU 2ZFTA 3U8OH 4MNXA 3UOUA 2RA0A 2Y81A 1GL0E 1TPOA 2UUKB 1ZSKA 2PSYA 4GVUA 1W8BH 1L4DA 4AFSA 2ZGXH 4ASUD 3B23B 2G4TA 2VIQA 1ANBA 1TGCA 1EPTB 1CO7E 1Z7KA 5F8TA 3ZVCA 4IC6A 4A1XA 2FOAA 1LVOA 1AFEH 2OINA 1F5KU 1AU8A 1VGCB 5CE1A 3EQ0H 1TA2A 1O2NA 3FFGA 1TMTH 3L3TA 2V3MA 6GCHF 4CREA 1O3EA 3C27B 2WPMS 3QO6A 2ZFFH 1V2JT 4ISOA 1KXAA 2W3KA 3SYJA 5A09A 3MFJA 3E3TA 2H1UA 1FI8A 1ANCA 4YLUA 1SFQB 4ABAA 1ZGVA 4MG3A 1XX9A 2Z7FE 1KIGH 4AYYB 1MBMA 3RC4A 3SQHE 3LGUA 2BLQA 2PUXB 4BTIB 1DFPA 5E0HA 3OX7U 1SSXA 1EOJA 3E1XB 3TK5A 1TGTA 5H4IB 1SGPE 4XBDA 4CH8B 4B6EA 3LC3A 5A8XA 1MZAA 2BVSH 2ANMH 5ETXA 2BQWB 1EB1H 3GDVA 1GJ5H 3Q3XA 3GCTG 1Z8JB 3A7ZA 2ZHEH 3P17H 1QCPA 1WAYB 2HRVA 3A89A 3OE7D 1WQVH 1DWBH 1OKXA 2G8TA 1G36A 2G4UA 1Z8GA 2XC0A 3DFLA 1WTGH 3SZNA 2O8MA 1ETSH 2D8WA 4XRNA 4ZROA 4AGJA 1UTJA 1UK2A 4XE4A 2PGQB 1KLJH 3D62A 3S7KB 1K21H 3P8OA 1MU6B 3VB6A 2QA9E 3TLOA 1HPGA 1GHAG 1C5YB 2J4IA 2UUYA 2WUBA 3RMLH 2Y80A 2RFKC 1D3PB 4AB8A 2R3YA 4XSKU 1K1IA 1O2PA 2BD9A 1F92A 3TGKE 2TRMA 4LOYH 2CGAA 5B6LA 2V35A 2QXGA 2BY8X 1IQLA 1GI6A 4HFPB 1XKBC 1BBRE 3K2UA 2ZGCA 1L0ZA 1D6WA 1V3XA 1FPHH 1CHGA 3MH4A 5PTPA 3B8JA 5HXFA 2J97A 2P93A 1F7ZA 1S82A 1C5RA 1TQ0B 1WSSH 5DP8A 1S0RA 3BSQA 2Z9LA 5TJXA 1GVZA 2PKSC 1GMHF 5I46H 1ETRH 2PUQH 1H9HE 4FXGH 4X1NU 2EEKA 4YOIA 3RLYH 2CHAB 5BRRE 2AEIH 1AE8H 1JWTA 4UEHH 2FS9A 1AUTC 4NZLA 1K1JA 2HLDD 3TGJE 1O3BA 1G30B 2HNTF 1YCPH 5K7RA 1SL3A 5GIBA 5DKMA 1PQ5A 2GVFA 2W6JD 1TMUH 4AFZA 2BD2A 3V13A 1XUJA 4Q7YA 1Z71A 4CHAB 2J98A 2LELA 2D1JA 1SLXB 2ZWLH 2CMYA 3M3VA 4TPYA 1WXRA 1TX7A 1V2ST 4Q7XA 1PPEE 1SGTA 2ODQA 1ZHRA 1HAZB 3NK8A 4D9QA 2Y82A 2L74A 4I8JA 1FY1A 1C1QA 1C1RA 4MLFB 4A1TA 5K0HA 1D9IA 2O8WA 3SU4A 1MKWH 3M5OA 2QAAA 1LVMA 1DSUA 4E05H 4XD7D 2WUCA 1H4WA 4ESTE 5C5OA 2HPPH 2BVXH 1BT7A 4Y79A 1MUEB 2DE8A 1UVSH 2BY9X 3NKKA 5E0GA 3SN8A 5L2YH 4CRCA 1G32B 1YM0A 1T4UH 1THPB 2ANKH 4U2WA 4ABFA 3ZZBA 2YMSD 3SV9A 1EJNA 2IN2A 3RLWH 1FZZA 1NT1A 4U30A 1H8IH 1M9UA 4AORA 1L4ZA 1ZJDA 1DXWA 1Q31A 1C5TA 5LPRA 3WY8A 1SLVB 2AERH 2FOBA 1ANDA 4M9FA 4FU9A 3UQOA 2WPHS 1CGIE 1BOQA 1MZDA 1P3EA 1QL9A 1O3CA 2VVUA 4D76A 2BYAX 2AFQB 1EKBB 1YLDA 1A5GH 2LNCA 1GVKB 4DIIH 2ZFQH 3ZZDA 2VVCA 2F9PA 3SV6A 1QRZA 1Y5UT 2WV4A 2CF8H 4ABBA 5L6NH 3U1JB 3RXMA 4ABJA 2WPLS 1SLWB 5HMAA 3A84A 1C4Y2 4JZDH 1MMJN 1CHOF 3DT0H 8GCHG 1IAUA 1AZ8A 1TNKA 3OAAD 2BY6X 2SGDE 3VXEH 2ZU1A 2OBQA 3E0PB 4X1QU 6LPRA 1KXEA 3MO6A 1UVUH 4X6OA 3SO3A 2K8IA 1UTPA 2XWBI 5HGGA 4B2CA 4F49A 2OC0A 5CHBA 4LZ1H 2C8XB 1NBMD 5FHTA 1ANEA 2FOEA 1TOCB 1GBMA 2G00A 5EPNA 2VGCB 2BDIA 2AYWA 1O2VA 1ELAA 4YT7H 1O2QA 2QF0A 1UMAH 3EAJA 3KYGA 3QDZB 1GBTA 1VJAU 4R8TB 2EI6A 1YLNA 1MTNB 1IOEA 2FO9A 1O2LA 8KME2 2FXRA 1UVOA 5JB9S 1CGJE 1PPCE 3QK1A 1TFXA 1P9UA 2Y5GA 5TCCA 1S6HA 4Y11E 4WMEA 3U8TH 4BOHA 3QZRA 1BITA 1A0JA 3U98H 3VB4A 4X6PA 1UO6A 4OS1A 2IPHA 3QTVH 1W7XH 5EQQA 3GY4A 2WSSD 4DURA 2GJGA 1XUKA 1P2JA 4FUGA 2F83A 1O34A 1P04A 2XNIA 2ZCLP 1SC8U 2B5TB 1V2QT 1O38A 2G5NA 2JJ2D 1AWHB 1TBRH 4F48B 4YOGA 3PMAB 3VB3A 1BRCE 3UWJH 2A7JA 1PQ7A 1FIZA 3AW0A 1ESAA 5CHAB 4JYVH 1QQ4A 2P3UB 2H9HA 3SNBA 3ZYEA 3BTQE 1V2NT 3KQ5A 2OC7A 3ZZ9A 1O3PB 3U69H 1AY6H 1QJ1B 1MKXH 3L33A 4IBLH 1XVOA 1HAHH 4Y6DA 2BLWA 1CQQA 4DY7B 3TJVA 1HJAC 1DANH 3PMHB 2W26A 1BTUA 1GI2A 1OP0A 3H5CB 1QTFA 3HK6B 4ZKNU 2OBOA 1IQNA 1FY5A 3PM3A 2A4QA 4JYUH 4ZUHA 3SUDA 1W2KH 4NGAH 1Y8TA 2ZGHA 1IHTH 1PJPA 1OYTH 3Q77A 5AHGH 1DDJA 1BTXA 1C2MA 2VH6A 1LCYA 1TRYA 1AGJA 1ESTA 1TMBH 4FU8A 2ZI2H 5HM2A 4DT4A 1TPAE 1V2VT 2QF5A 4RSPA 5EXMA 5FCKA 2YNBA 3A88A 4K3JA 2FWWA 3M7TA 1TX6A 3OEHD 1QB9A 1C5UA 4X2VA 2ZO3H 2D26C 3F6UH 3A8CA 3RXHA 4UFEH 3QGNB 1V2LT 1QHRB 3E91A 1Y5AT 1UK4A 5T6FA 4BAKB 2JDID 3DSGA 1FY3A 2A31A 1YBWA 4Q4LA 1ZJKA 1EP6A 3SJOA 3H7OA 1ZTLA 4AC9A 3CP7A 1AD8H 1GMDG 3SHAH 1BJVA 4NWKA 1QA0A 1TRMA 1EASA 3RU4T 4NZQA 1GMHG 4UFDH 3S9CA 2TBSA 5C1UA 1B5GH 2PKAB 1ELVA 1HIAA 3SUFA 5I25A 2FLRH 1O3FA 1TPPA 2SGEE 1QBOA 4TPIZ 1DUAA 5A8YA 4GUXA 3I77A 4LK4A 3TU7H 2RCEA 3N7EA 1CA0C 3UB0A 1AKSA 3OFND 4MNVA 1FLEE 1C2DA 1ZMNA 1CA0B 3RXTA 1SGNE 1SBWA 2BDYA 5F53A 2VWOA 3D65E 2ZU2A 1GCDA 1UK3A 1JRSA 3M36A 3T5FH 1FV9A 2FMJA 3O8BA 1SOTA 2XNDD 1NZQH 4TWWA 3LT3A 4CRBA 1GPZA 1O32A 2EY4C 1SQRA 1MH0A 2XWAA 4GSOA 4I33A 4JZIA 2ZHFH 1XVMA 5ESTE 3T2NA 3T62A 1NBME 1CT2E 3KEEA 3U9AH 1BCUH 1ZSLA 1KTTB 2A2QH 2G52A 3D23A 2FOMB 3RXRA 3CNRA 1O3AA 4UDWH 1EXFA 3RXEA 3BEIB 2ZECA 2P3FH 1O5CB 3NCLA 2C8ZB 2FLBH 1HGTH 3O8DA 1A46H 1YYY1 2RDLA 1GHVH 1L2EA 3ODFA 4KTSA 1GMCG 3LU9B 1RGQA 2FZZA 3E90B 4OS7A 1MTVA 1NTPA 1C1VH 2GV6A 3LJOA 1N1LA 3MO9A 4WF8A 3VGCB 1GI3A 3GCOA 5EJZA 2YOLA 1ELGA 1MD7A 1WBGB 1JIMA 4JMYA 1NRSH 1BRUP 3UY9A 3VFEA 1AB9B 2QE7D 1P8VC 1BMLA 2PR3A 1C5LH 4H6SB 1LPGB 1MTSA 1GI0A 3ELAH 3ZVBA 3PLPA 4Y71A 3I29A 1NFUA 2UWLA 1MCVA 3D49H 4DVAU 4Z0KA 3URDA 1D4PB 3SORA 3SU1A 1UW7A 1AVWA 2BD7A 2Z3EA 2VJ1A 4NSVA 1QRWA 3CS0A 1ZHMA 2ZC9H 1VITG 5C1YA 1RIWC 1QB6A 1LPKB 1O2KA 2BY5X 4NSYA 6CHAB 5FBIA 5GXPA 1W10U 1QL7A 2WV5A 3MHWU 1RS0A 2ZGJA 5AFYH 4IN2A 5A2MH 5C94A 1ARCA 4QT8C 4AG1A 4I7YH 3ZVFA 1C1MA 2KX4A 3AAUA 3PLKA 1S83A 1V2TT 3W1EA 1GHWH 1BRAA 5EW2H 1IQFA 1BDAA 4MNYA 1P2QA 1GBIA 1DE7H 1NFXA 4RN6A 5EGMA 1XMNB 3SJIA 1XXFA 1HXEH 5C20A 4GPGA 4TYDA 2GTBA 2OK5A 3SZEA 1HAOH 2OD3B 2V3OH 4NA8A 5CDFE 4WVPE 2ZFSA 3G01A 3GCTF 5IK2D 4Q7ZA 3HKJB 4JZFH 1EPTC 2QY0B 1LPZB 4INKA 2OC8A 1EAXA 3MU8A 2WYJA 1O2OA 2GMTC 1SGDE 2NWNA 2ZHWH 4YLQH 2BOKA 3M35A 1MKXK
chains in the Genus database with same CATH topology
5EJ1A 3CNRA 3KYFA 4I86A 5KGOA 5KECA 4F48B 2GJGA 5KEDA 5EIYA 4P00A 4RT1A 1YWUA 4P02A 4FOUC 3DSGA 5EJLA 4HG6A 3KYGA 2L74A 2RDEA 1YLNA 4XRNA 5EJZA 4RT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJ1 A;  3CNR A;  3KYF A;  4I86 A;  5KGO A;  5KEC A;  4F48 B;  2GJG A;  5KED A;  5EIY A;  4P00 A;  4RT1 A;  1YWU A;  4P02 A;  4FOU C;  3DSG A;  5EJL A;  4HG6 A;  3KYG A;  2L74 A;  2RDE A;  1YLN A;  4XRN A;  5EJZ A;  4RT0 A; 
#chains in the Genus database with same CATH topology
 3PO1 B;  2KCP A;  4MDS A;  2FOF A;  2ZDN A;  1Z6E A;  1P09 A;  4RKJ B;  2O9Q A;  4I86 A;  3BTK E;  5FXL A;  1AMH A;  1EZX C;  1Y3V A;  2FM2 A;  2THF B;  4IMZ A;  4AB9 A;  3BTW E;  1Q2W A;  2ZGB H;  3ATL A;  5LGO A;  1GBB A;  2I6Q A;  2OP9 A;  2R0L A;  2QXJ A;  3BTH E;  5E2P A;  5A0A E;  4SGB E;  3T29 A;  3PV5 A;  1TNL A;  3M37 A;  1OX1 A;  2A5A A;  5TCA A;  5IYT A;  1GMC F;  2DE9 A;  3EA9 A;  4KGA A;  5G4B A;  1QY6 A;  1WQS A;  1P57 B;  4KEL A;  2FI4 E;  4CH2 B;  3EA7 A;  2BY7 X;  4Y10 E;  2VID A;  6GCH G;  3TNT A;  3MQK C;  1OP8 A;  3E0N B;  1TRN A;  2B7D H;  1FY4 A;  4M7G A;  3FZD A;  1A3E H;  1YF4 A;  1P9S A;  3UNQ A;  5FL7 D;  3V3M A;  5JBB S;  1GDN A;  2STA E;  3S0N A;  1ZML A;  4I8K A;  1ZTK A;  2HLC A;  3F3B A;  4FVB A;  3OYP A;  1T8L A;  2YNA A;  4E7R G;  1GHX H;  3DD2 H;  2F9N A;  1C2I A;  1JOU B;  2W7U A;  1FMG A;  1GBC A;  3STI A;  5E2O A;  3SBK A;  2JKH A;  1GHB G;  4IN1 A;  1EZU C;  1THR H;  4UFG H;  1KXB A;  1Y5B T;  1E0F D;  2TGT A;  5FPY A;  1ETT H;  1TIO A;  1HAV A;  1EOL A;  1QFK H;  2FOG A;  4FUC A;  3AAS A;  3S9B A;  1GCT B;  3MH5 A;  3A7V A;  1OP2 A;  4Q2K A;  2SGP E;  2FS8 A;  1YC0 A;  2C3S A;  1GI9 B;  5GCH F;  1MTN C;  4NFE A;  5AFZ H;  3MMG A;  1INC A;  1OWI A;  4WMF A;  1SQO A;  1EZS C;  1DY9 A;  1AE5 A;  1EX3 A;  1CGH A;  3F1S B;  1EFR D;  4D8N A;  3A8A A;  1DS2 E;  7KME H;  2AHM E;  2C90 B;  1AI8 H;  1SGI B;  3VG8 A;  2QF4 A;  1DLE A;  3GOV B;  4D9R A;  2VVV A;  1H8H D;  7LPR A;  2ZPR A;  2WPJ S;  1WV7 H;  2RA3 A;  1Z8I B;  1JRT A;  2R2M B;  4O9V A;  4P00 A;  2ZCH P;  3ZZ7 A;  1LVB A;  5JBA S;  1A5H A;  2H5D A;  4OM9 A;  3W95 A;  3GY3 A;  1OWD A;  5BPE A;  2Y6T A;  3PV4 A;  4UON A;  4D7G A;  3NWU A;  1XM1 A;  1EAI A;  4B1T A;  1ZOM A;  5HIY A;  1W14 U;  3ZIA D;  2QN5 T;  1W11 U;  4ZMA H;  1U6Q A;  1VCQ A;  3HKI B;  2SGA A;  1O5F H;  2M5T A;  3ZYD A;  5FX6 A;  3RMM H;  1BUI A;  3UAI C;  2ZEB A;  2J94 A;  2GCT B;  5EU8 A;  1MCT A;  2VWM A;  2M2A A;  3F9H A;  3QWC H;  1AFQ B;  1W0K D;  1FN6 A;  1D3Q B;  5J4Q A;  3ZZ5 A;  4H42 U;  1TA6 A;  5JB8 S;  2VBC A;  1YCP K;  1QUR H;  2F9U A;  1MBQ A;  3DFJ A;  1O3H A;  1BTZ A;  1AWF H;  1P03 A;  3UTU H;  1UTM A;  4ISL A;  5T3H A;  4BXS A;  1AN1 E;  1TPS A;  3MNS A;  1O3K A;  1G2M A;  1CVW H;  3BG4 B;  2AIQ A;  3RXF A;  2AGI X;  4RI0 A;  5C17 A;  1C5X B;  2KAI A;  3TK9 A;  2UUF B;  5LPF A;  4GHT A;  2Y7X A;  4P02 A;  2VGC C;  1P10 A;  3F9F A;  3K6Y A;  1DIT H;  1Z1I A;  1O3D A;  3WWF A;  1D3T B;  1GBA A;  1Q3X A;  2A5I A;  4X1S U;  4MQA A;  4VGC C;  3RP2 A;  1TNI A;  2ZNK H;  3UOP A;  5DO4 H;  3RXK A;  2H2Z A;  5JDU B;  3FVF B;  1EQ9 A;  2AMP A;  2ALP A;  4OS4 A;  3TJO A;  1UCY H;  2CF9 H;  5EPY A;  2VNT A;  3P70 B;  3BIV H;  5ESB A;  2GZ8 A;  1EP5 A;  1LQD B;  5DSF A;  3PRO A;  3BIU H;  3SOS A;  2VB0 A;  4A7I B;  1AFQ C;  3FP6 E;  3PTB A;  1WOF A;  1HBT H;  4IW4 E;  1VGC C;  2J2U A;  1TYN A;  1W0Y H;  1GWA A;  1W0Z U;  2O8U A;  4JK6 A;  3KHV A;  2KCA A;  3LGT A;  3VXF H;  3BTF E;  1HV7 A;  1QRX A;  1UTO A;  5EQR A;  2PTN A;  8LPR A;  1QNJ A;  3AAV A;  1AB9 C;  4Y8Z A;  2BX4 A;  3NUM A;  2XCF A;  4GCH G;  1YPK H;  5GDS H;  2J5U A;  3VGC C;  1C1U H;  1GCT C;  1GDU A;  4IS5 A;  3BTG E;  2A1D B;  4PRO A;  3DCL A;  5EXN A;  4R0I A;  2OQ5 A;  2W3I A;  3UR6 A;  4ZXY H;  3P95 A;  1GI8 B;  1HB0 B;  1ACB E;  2FX6 A;  2C8Y B;  3TNS A;  1MKW K;  1VIT F;  1F5L A;  4BAQ B;  2OUA A;  1GJD B;  1B0F A;  2ZCK P;  2QIQ A;  1ELE E;  1O3G A;  3ATI A;  3QUM P;  1LKA A;  2B9L A;  3JZ1 B;  3UWI A;  1C5W B;  1EAU A;  4I32 A;  1J15 A;  5DK1 A;  3U8R H;  2G5V A;  1GBD A;  1V2K T;  2BOH B;  2HWL B;  4ZH8 A;  1KXD A;  3SJK A;  5F8X A;  1O5B B;  4JZE H;  4ABD A;  1JXP A;  4THN H;  2FTL E;  3O8C A;  1P3C A;  1XUG A;  3BEU A;  3F0O A;  2XBY A;  3EDX B;  1A5I A;  2ZDA H;  5T1V A;  1ABI H;  1UTN A;  1HJ8 A;  4NIW A;  4UD9 H;  2ZKS A;  2C93 B;  1SMF E;  2RDE A;  1H9I E;  2GMT B;  1O35 A;  4K60 A;  5T6G A;  2KR7 A;  1EUF A;  4CRF A;  3GY7 A;  4FET A;  1KXF A;  3AW1 A;  4BAM B;  3EE0 B;  1RTK A;  1SGF G;  2H9T H;  2K0Q A;  1UHB A;  3BTD E;  1ZYO A;  1DIC A;  4B2A A;  3H7T A;  3PRD A;  2JH6 D;  2UWP A;  5F03 A;  3DUX H;  2F9V A;  1O2W A;  1P2N A;  2ZTY A;  2HOB A;  2YMS C;  1J9C H;  3MH6 A;  4O3U A;  4DCD A;  2J92 A;  5CMX H;  4FUB A;  1K0H A;  2FYQ A;  3A85 A;  2XXL A;  3BV9 B;  1ZZZ A;  3LGV A;  3ZV9 A;  1E1Q D;  4WH6 A;  3HGN A;  3Q3K A;  3GCH B;  2J34 A;  1RIW B;  2EST E;  3SQE E;  2P3T B;  2BVR H;  5LPE A;  2J95 A;  1HAG E;  2P16 A;  3SGB E;  1ARB A;  4ZKR U;  2GX4 A;  4K5Z A;  5FBE A;  2EA3 A;  1TGS Z;  1V2R T;  1OWJ A;  4I8H A;  3IIT A;  1YGC H;  1DWD H;  2KCO A;  4GAW A;  3M5M A;  4YTA A;  1NFY A;  2IJD 1;  1GG6 B;  4X2Y A;  1UVT H;  1C4U 2;  1C5Z B;  1OPH B;  1YP9 A;  1KDQ B;  1E37 B;  1FDP A;  4JZ1 A;  3FP7 E;  1UCY E;  3RXC A;  3M7U A;  1C5O H;  3KQD A;  2GKV E;  1BMF D;  1NES E;  3LGW A;  3S69 A;  2H6M A;  4B71 A;  3NXP A;  1O37 A;  1C1T A;  1T7C A;  2XTT B;  4MPV A;  2NU0 E;  3SI4 H;  1S84 A;  4ZKO U;  1O2U A;  1W7G H;  2RG3 A;  3GYL B;  3P8F A;  4WMD A;  4AFQ A;  2G51 A;  4XDE A;  2WPK S;  1XUI A;  7GCH F;  1O2H A;  3ZZ6 A;  1X7A C;  2HNT E;  3RDZ A;  1F0U A;  2WPI S;  1P01 A;  3F9E A;  2CV3 A;  2XW9 A;  3T28 A;  1DUE A;  6EST A;  1VZQ H;  2EI7 A;  4WXV A;  1O2T A;  2ZDM A;  6CHA C;  2V0B A;  4JYT A;  1C2H A;  3LON A;  1AO5 A;  5C5N A;  1BTH H;  1VCW A;  1EAW A;  2GDD A;  4DT7 B;  5GCH G;  2O8T A;  1V2W T;  1F2S E;  1DVA H;  4K2Y A;  3MH7 A;  1COW D;  1TBQ H;  4NIV A;  4OGY A;  1HUT H;  2ZTZ A;  4FUH A;  5DG6 A;  1E34 B;  1V2P T;  2QC2 A;  2OQU A;  5EXL A;  2A2X H;  4TY7 A;  4MVN A;  2ZTX A;  1HIA B;  1VR1 H;  3TIT A;  3UIR A;  2GV7 A;  1GVL A;  3SJ9 A;  1NC6 A;  1Y59 T;  2BX3 A;  3E16 B;  3SV7 A;  3UQV A;  2GCH G;  2GT8 A;  3A83 A;  4RKO B;  4DW2 U;  4K69 A;  3QLP H;  3K65 B;  1HFD A;  1ZRK A;  2QYI A;  1QJ6 B;  3M5L A;  2ZQ1 A;  1C2J A;  1BB0 B;  1T8M A;  1AKS B;  4KKD A;  1ORF A;  3RXP A;  3MNB A;  2AIP A;  1ELC A;  1RXP A;  2Q6D A;  3MOC A;  2GT7 A;  3M7Q A;  1TBZ H;  4CRD A;  5DP3 A;  1RD3 B;  1TX8 A;  1H8E D;  4BTT B;  1Y3U A;  1OXG A;  1VJ9 U;  3L6P A;  1PPB H;  5IDK A;  2PSX A;  3FO8 D;  4I8L A;  2QCY A;  1FNI A;  1GBF A;  1T8O A;  1TNH A;  3KQB A;  2YMS B;  2ODP A;  4TWY A;  1PPG E;  3RM2 H;  8EST E;  4X0W U;  1A0L A;  4B76 A;  3KL6 A;  2V6N A;  2SGF E;  2ZF0 H;  3FKS D;  5C3N A;  3LDX H;  4J2Y B;  4A5T S;  1C1W H;  1NU7 B;  1BQY A;  1O36 A;  1MQ5 A;  3DSO A;  3WW7 A;  1AVX A;  1GJ9 B;  5ABW A;  1DPO A;  1SVP A;  3SNC A;  4DOQ A;  1EZQ A;  4FVD A;  3RU4 D;  1WDI A;  3SUG A;  1GMD F;  1J8A A;  2Z6B D;  1J14 A;  4MNW A;  4ZAE A;  3A7T A;  1ELB A;  1HAY B;  5EQS A;  4ZXX H;  3F2G A;  2FEQ H;  2FI5 E;  1F0S A;  1O5G H;  3GDU A;  1S5S A;  1ELT A;  1OYQ A;  1SHH B;  3P92 A;  1G3C A;  3V12 A;  2VIW A;  3U28 C;  1NPM A;  2XBX A;  2FTM A;  5A0B A;  3F2F A;  1GHZ A;  1NN6 A;  3T27 A;  4AZ2 B;  1GDQ A;  4B6F A;  1FAK H;  2Z3C A;  4Q80 A;  3PLB A;  3EE7 A;  3R3G B;  3KQC A;  3F9G A;  2ZP0 H;  3M3S A;  3OSY A;  1XUF A;  1BTP A;  4ABI A;  1MTW A;  2TPI Z;  5JPM H;  1GJ6 A;  5KEC A;  3SUE A;  3A81 A;  1K2I 1;  1IQJ A;  1SGC A;  1GBE A;  3LOX A;  3ZZ8 A;  3A8D A;  3GCN A;  3M5N A;  3IG6 B;  1RFN A;  2KCY A;  2ZDV H;  1GI4 A;  1O3M A;  2V3H H;  2ZHD A;  4AGK A;  2AMD A;  2ULL A;  1H8D H;  2W6I D;  3LKW A;  4O3T A;  4CBN A;  2OCV B;  1BZX E;  2PGB B;  1P2I A;  2Y7Z A;  1K28 D;  1SGE E;  1JMO H;  2FYR A;  4BAN B;  1N6Y A;  1ZSJ A;  1QIX B;  1C5N H;  2XC5 A;  1O5A B;  2GZ9 A;  1NM6 A;  3ZVE A;  2OTV A;  4YZU A;  1DT2 A;  2XBV A;  1C2K A;  1SQT A;  3ZZA A;  4Y8X A;  1K1M A;  2XOK D;  1HYL A;  1GJ4 H;  1KDQ A;  3PO1 C;  3A8B A;  5HKK D;  1GBK A;  2LP6 A;  1JIR A;  1W13 U;  4OGX A;  3RU4 E;  3RXI A;  3SV8 A;  3MYW A;  1O0D H;  3O8R A;  3RXS A;  1O2M A;  1G9I E;  5C2Z A;  5EJL A;  4HG6 A;  1BRB E;  2NU2 E;  2Z94 A;  1G3B A;  2HVY B;  2PFE A;  1HAX B;  1TGB A;  2KZ4 A;  1AHT H;  2WZQ A;  4YXW D;  3RXJ A;  3TIU A;  4ZKS U;  1ABJ H;  2R2W U;  2BDB A;  4FUE A;  4DG4 A;  3GDS A;  2VWL A;  5EOD A;  1IQG A;  5EIY A;  1O2G H;  1SPJ A;  1AQ7 A;  4NG9 H;  3HAT H;  1DLK B;  1W0J D;  3UR9 A;  2GGV B;  1F0T A;  2I6S A;  3OY5 U;  1AIX H;  3URE A;  1IQE A;  1A2C H;  1C5V A;  1GJ8 B;  5HM9 A;  2FOD A;  3F0P A;  3SI3 H;  5T6D A;  2STB E;  3FAO A;  1O30 A;  2IJO B;  3UPE A;  1YPE H;  1SOZ A;  4TT3 D;  1L1J A;  4FUJ A;  2ZU5 A;  5AVD A;  1O2X A;  1B7X B;  3M61 U;  1CBW C;  1QR3 E;  1ZPB A;  9LPR A;  2ZA5 A;  1Z6J H;  3A7Y A;  1C1O A;  4ISI H;  1K1O A;  2NU4 E;  1TQ7 B;  3LJJ A;  2R3U A;  1BHX F;  4DJZ B;  2Y5F A;  1UVP A;  2BD4 A;  2B8O H;  3KYF A;  4AFU A;  2PP6 A;  2ZG0 H;  1VCP A;  4YO9 A;  1S0Q A;  2QXH A;  4E7N A;  1MD8 A;  5C0U A;  4K1E A;  8GCH F;  1D6R A;  3R0F A;  3DSP A;  1YKT A;  5F8Z A;  2SFA A;  2CN0 H;  2FPZ A;  4IC5 A;  5HYO A;  3B9F H;  1TNG A;  1NRO H;  1FXY A;  1NU9 A;  2FP7 B;  5L30 H;  3KCG H;  4HZH A;  1WUN H;  2UWO A;  1Z8R A;  1D3D B;  4AYV B;  2ZPQ A;  4GLY A;  3NRL A;  2NU3 E;  3GY5 A;  3SND A;  3GIS B;  2BD8 A;  2TIO A;  4XOJ A;  2D2D A;  1P11 E;  4INH A;  3PTN A;  2PLX A;  2BZ6 H;  1GBJ A;  4BNR A;  2VH0 A;  3OEE D;  2BQ7 B;  3TVJ B;  1C2L A;  2BDH A;  5DPA A;  2K1Q A;  3BG4 C;  3TJU A;  1C4V 2;  1C5P A;  4LZ4 B;  2ZU4 A;  3ZZC A;  1W12 U;  1GG6 C;  4INL A;  3A7X A;  3FN8 A;  3MWI U;  5FX5 A;  4Y0Z E;  2A4O A;  3LGI A;  1E1R D;  1LO6 A;  3S9A A;  4B74 A;  3RXL A;  2P8O B;  1KY9 A;  2GDE H;  3AK5 A;  3MU4 A;  5SGA E;  3N7O A;  1FX0 B;  1S6F A;  4Z6A H;  2KFW A;  1SR5 C;  3STJ A;  3K9X B;  4B73 A;  2AGE X;  1TGN A;  2BB4 A;  5KED A;  2HNT C;  1BMN H;  2ZDK A;  1NRR H;  1YWU A;  3SU2 A;  1AZZ A;  1ZHP A;  3GCH C;  2A45 B;  1BJU A;  1UCY K;  4FU7 A;  3BN9 A;  1IQI A;  3JZ2 B;  4RT0 A;  1MTU A;  1BMA A;  4NCY A;  5FPS A;  1T31 A;  1S81 A;  1SGR E;  2CHA C;  5DJ7 A;  2KM0 A;  2VWN A;  2L6O A;  1ZR0 A;  1PFX C;  4HGC A;  1G3E A;  1YPL H;  2ZU3 A;  1WCZ A;  2BM2 A;  1GI1 A;  2FI3 E;  2EC9 H;  1P2O A;  1O2Y A;  2VIV A;  4Y8Y A;  3I78 A;  5L2Z H;  1GI5 A;  4NFF A;  1H1B A;  2AMQ A;  3QZQ A;  4BAH B;  4GHQ A;  3LIW A;  1CA8 B;  3EA8 A;  1RRK A;  4D7F A;  1L1G A;  1KSN A;  4CHA C;  3TJN A;  3BTT E;  3VB5 A;  3TGI E;  1LKB A;  2FIR H;  2KAI B;  2Z9I A;  2A32 A;  1C5M D;  2HAL A;  1P06 A;  1NRP H;  3RXD A;  3M3T A;  1EPT A;  5AF9 H;  1IQM A;  3UNR A;  1T32 A;  1OHH D;  5JBT A;  3KNX A;  4A92 A;  1SGF A;  1BTW A;  1DM4 B;  4XFQ A;  2TGD A;  1NRN H;  2BLV A;  3MTY A;  1KXC A;  2F91 A;  2OLG A;  2A4G A;  3Q00 A;  2EQN A;  1QL8 A;  1GGD B;  1AVG H;  4OS5 A;  2AS9 A;  3ATW A;  1GGD C;  4ABE A;  1Y3Y A;  1C5Q A;  3EYD A;  1TON A;  3RXG A;  4WY3 A;  1E79 D;  1SKY E;  3BTE E;  1PPF E;  2P8O C;  1BIO A;  1K22 H;  5FAH A;  1C9P A;  1G37 A;  1N6X A;  4ABG A;  4U32 A;  1TNJ A;  3P8N A;  4NIX A;  2Z9K A;  4XBC A;  2JJ1 D;  4B2B A;  4LXB H;  4VGC B;  2OXS A;  1VIT H;  2ZZU H;  1QA7 A;  1ZPC A;  4IGD A;  2Y5H A;  3WWB A;  9EST A;  3FOA A;  1C2G A;  4A6L A;  2ZDL A;  1P05 A;  1YCP M;  1O2R A;  1LHE H;  3HPT B;  1PYT D;  3VEQ B;  4MPX A;  1A0H B;  3LPR A;  1C1S A;  1CU1 A;  4JK5 A;  2PTC E;  1OS8 A;  2ODY B;  1MAB B;  1P0S H;  1SHY A;  1KMH B;  3LC5 A;  5C67 A;  3SNA A;  3P8G A;  3OU0 A;  4J1Y A;  4X2W A;  2ALV A;  3ITI A;  1SI5 H;  3A7W A;  3RM0 H;  1UTQ A;  1PPZ A;  2LPR A;  1ZLR A;  5GWZ A;  1PPH E;  4K8Y A;  3SW2 B;  3TH3 H;  4CBO A;  4TSF D;  3H09 A;  2HVX A;  1FY8 E;  1TLD A;  1ZTJ A;  2Q6G A;  1TAW A;  2BDA A;  1KTS B;  2ILN A;  5EW1 H;  4OS6 A;  4BXW A;  2H9E H;  2GD4 B;  1CHO G;  3ENS B;  4ACA A;  1S6L A;  3KID U;  2WV9 A;  1HJ9 A;  1O3L A;  1VKY A;  2XRC A;  1DXP A;  1LHD H;  1DWC H;  4MPW A;  3F68 H;  2VU8 E;  5KGO A;  4U01 A;  1F0R A;  2ZPS A;  2Q6F A;  4FUD A;  3TH4 H;  3C1K A;  2WYG A;  3KN2 A;  4SGA E;  3MU5 A;  1GJB B;  4WJG 2;  4AX9 H;  1J16 A;  1LMW B;  2A4R A;  2BTC E;  1MQ6 A;  3F2H A;  3VB7 A;  1EB2 A;  1O39 A;  1QJ7 B;  2G55 A;  4I8G A;  3DA9 B;  4Y0Y E;  1ZMJ A;  1V6D A;  4Q63 A;  4YOJ A;  2WHX A;  2F3C E;  2O8L A;  2V7Q D;  4BAO B;  3V7T A;  4YM9 A;  1BBR K;  1QBV H;  1ESB A;  1ID5 H;  2FX4 A;  1E36 B;  3GY8 A;  1HAI H;  2P94 A;  4KTU A;  4H4F A;  5GND A;  4ZCN A;  2FOC A;  2C4F H;  1B0E A;  1FJS A;  3AVZ A;  4X8V H;  1GJA B;  4AN7 A;  4ACB A;  1GL1 A;  3CS7 A;  2SNV A;  3ATM A;  4RT1 A;  4CR9 A;  2GCT C;  2XCN A;  4X6M A;  1HNE E;  3SHC H;  3HGP A;  4F4O C;  5DP7 A;  1EJM A;  1SQA A;  2J38 A;  1ZGI A;  3PWB A;  3RC6 A;  1DY8 A;  5FCR A;  2WIN I;  3LH1 A;  2XC4 A;  2JET B;  3BTM E;  1YPH E;  1SGQ E;  1J17 T;  2CJI A;  3SV2 H;  1AUJ A;  2P95 A;  2JET C;  3ODD A;  2Q1J A;  3RXV A;  4UE7 H;  1C5S A;  3RXB A;  2FOH A;  3NPS A;  1S85 A;  2ZFP H;  5EOK A;  1TAL A;  1IQK A;  1FUJ A;  2BD5 A;  2W5E A;  3EST A;  4ABH A;  1WYK A;  1Y3X A;  2PWX A;  1Z1J A;  1DX5 M;  1N8O C;  4KTC A;  3FAN A;  1DST A;  5J4S A;  3VPK A;  1CE5 A;  3ZVG A;  3OY6 U;  3UNS A;  1RJX B;  1RTL A;  1HLT H;  2TGA A;  3URC A;  3RC5 A;  1PQA A;  5JBC S;  5B6O A;  2J9N A;  3SNE A;  1HDT H;  5JYI A;  3SGA E;  1L1N A;  3PRB A;  1C1P A;  2PHB A;  4HTC H;  5F6M A;  4NIY A;  1YPJ H;  2H5C A;  1O3J A;  3FZZ A;  1LHG H;  2NU1 E;  3QTO H;  4NA9 H;  2GCH F;  4Z1M D;  2A0Q B;  3A80 A;  1OWE A;  3EGK H;  1GJC B;  5C0T A;  1P02 A;  3Q3Y A;  1HJA B;  3E6P H;  4K8B A;  1NO9 H;  1OWH A;  4ISH H;  1QGF A;  1LVY A;  2HPQ H;  2W7S A;  3S7H B;  1KLI H;  2Z3D A;  4BTU B;  1MAY A;  1C9T A;  1CSO E;  5CHA C;  5LH8 A;  1T4V H;  1CT0 E;  2ZIQ H;  1KYN A;  3Q76 A;  1XXD A;  1WU1 A;  1BBR H;  1THS H;  3SU0 A;  2HGT H;  3ATK A;  2BMG B;  2B0F A;  1BHX B;  4HI3 A;  4Y76 A;  3SU5 A;  2A7C A;  3ZVD A;  2CXV A;  3PMB B;  3W94 A;  3ZZ3 A;  1HAV B;  1EJA A;  4FOU C;  1W3C A;  1OOK B;  3PMJ A;  4YES B;  4AOQ A;  1CT4 E;  1YPM H;  2A7H A;  2JIZ D;  1P2K A;  3RXQ A;  3PB1 E;  2PV9 B;  5GJ4 B;  3ZVA A;  1C2F A;  1N8O B;  1UTL M;  2XBW A;  5DP4 A;  4K1S A;  5DN6 D;  5C1X A;  2R0K A;  7EST E;  3MU1 A;  4MTB A;  1K1N A;  1TOM H;  4X8S H;  4FUI A;  3PYH A;  4GCH F;  3ZV8 A;  3TK6 A;  1A61 H;  1O3I A;  2VIO A;  1O5E H;  3DHK H;  1DWE H;  4X1R U;  1GBH A;  2F9O A;  1O5D H;  3N7D A;  4NA7 A;  5E0J A;  2EI8 A;  1HAP H;  4TY6 A;  1P2M A;  1RTF B;  3ZZ4 A;  2QXI A;  3FP8 E;  3RXA A;  5A8Z A;  1C1N A;  1V2U T;  2F43 B;  2WPD D;  1FIW A;  3P6Z B;  4X8T H;  1A3B H;  3RMO H;  2PKS B;  1TE0 A;  2DUC A;  1SG8 B;  1O2S A;  2ZHQ H;  1CBW B;  2BQ6 B;  3A82 A;  3QN7 A;  1F5R A;  1C2E A;  2QV1 A;  1O2Z A;  4Y7B A;  1K1P A;  2GZ7 A;  3UUZ A;  3UFA A;  3OTP A;  1T8N A;  2TGP Z;  1A4W H;  3E8L A;  1ZPZ A;  4K1T A;  1O3O A;  3CEN A;  1GHA F;  1FPC H;  1YPH C;  3PV2 A;  3IWM A;  1GI7 B;  1PQ8 A;  1E35 B;  4NWL A;  3MU0 A;  4ZHL U;  4E06 H;  2AH4 X;  3GYM A;  4I31 A;  5EG4 A;  3K6Z A;  4O03 A;  1P12 E;  2CK3 D;  3KQE A;  1UTK A;  2F4L A;  1QQU A;  4ISN A;  4AG2 A;  1MAX A;  2OC1 A;  5HIZ A;  1O3N A;  4WWY A;  3KGP A;  2ASU B;  1O33 A;  2QGR A;  4WXI A;  1EAT A;  1HRT H;  4CRA A;  4H6T A;  1V2M T;  2VIN A;  1YLC A;  5A0C A;  3OTJ E;  3U1I B;  1ELD E;  2ZFR H;  2AGG X;  4UFF H;  1GHB F;  3MNC A;  1OWK A;  3LGY A;  3RXU A;  1A7S A;  4IMQ A;  3SGQ E;  1UJ1 A;  1A1R A;  2C8W B;  4ASH A;  3N99 A;  1SFI A;  2FDA A;  1QBN A;  3GS9 A;  1LQE A;  3RXO A;  3SU3 A;  5DP5 A;  1FN8 A;  1V2O T;  7GCH G;  2UUJ B;  1K1L A;  2P59 A;  1LHF H;  3MNX A;  3RMN H;  1GJ7 B;  1NRQ H;  3RUO A;  1IQH A;  1K9O E;  3BEF B;  2PKA A;  2BZA A;  2ZQ2 A;  2ANW A;  3MO3 A;  1BA8 B;  3GY2 A;  1G2L A;  2GP9 B;  1FQ3 A;  2BXU H;  3BG8 A;  2Z9G A;  3A86 A;  1HCG A;  1QZ8 A;  3A87 A;  1OSS A;  2BDC A;  3PWC A;  4MPU A;  5DGJ A;  1HXF H;  4YT6 H;  1ELF A;  2BDG A;  2R9P A;  1TWX B;  2VIP A;  1LTO A;  4DIH H;  1Y3W A;  1NY2 2;  1FAX A;  3MI4 A;  2BHG A;  1NFW A;  4X8U H;  5FPT A;  1E38 B;  4CR5 A;  5DP6 A;  3NZI A;  1WTH D;  5DP9 A;  5GPI B;  3GIC B;  1SLU B;  1PYT C;  2IPQ X;  1XKA C;  3TH2 H;  1LDT T;  1NS3 A;  2JH0 D;  2SNW A;  4X6N A;  1BTY A;  1FON A;  3SJ8 A;  2ANY A;  1TB6 H;  1O2I A;  1TAB E;  3KF2 A;  1YPG H;  2IOT A;  4CRG A;  3SU6 A;  3V0X A;  4X2X A;  5EJ1 A;  2XYA A;  2JH5 D;  1O31 A;  1LHC H;  3GY6 A;  3T25 A;  1H9L B;  4O97 A;  1YY3 A;  1SGY E;  2FES H;  5E8E H;  3HK3 B;  3BF6 H;  1DOJ A;  2QF3 A;  2BD3 A;  2F9B H;  4FUF A;  3QGJ A;  4B75 A;  3QX5 H;  2PW8 H;  2Z9J A;  4X1P U;  1QB1 A;  1IHS H;  4F55 A;  4DGJ A;  3TPI Z;  1ZRB A;  3LH3 A;  4XBB A;  2A5K A;  1GHY H;  1KLT A;  2J98 B;  2SGQ E;  4KP0 A;  1BMM H;  4ZHA A;  1XUH A;  1MU8 B;  2G81 E;  4A1V A;  4OS2 A;  1O2J A;  1G3D A;  1JBU H;  2BLO A;  2BXT H;  4Y7A A;  1GBL A;  4JCN A;  3T26 A;  1UHB B;  4WH8 A;  1SB1 H;  4ZHM U;  2ZFT A;  3U8O H;  4MNX A;  3UOU A;  2RA0 A;  2Y81 A;  1GL0 E;  1TPO A;  2UUK B;  1ZSK A;  2PSY A;  4GVU A;  1W8B H;  1L4D A;  4AFS A;  2ZGX H;  4ASU D;  3B23 B;  2G4T A;  2VIQ A;  1ANB A;  1TGC A;  1EPT B;  1CO7 E;  1Z7K A;  5F8T A;  3ZVC A;  4IC6 A;  4A1X A;  2FOA A;  1LVO A;  1AFE H;  2OIN A;  1F5K U;  1AU8 A;  1VGC B;  5CE1 A;  3EQ0 H;  1TA2 A;  1O2N A;  3FFG A;  1TMT H;  3L3T A;  2V3M A;  6GCH F;  4CRE A;  1O3E A;  3C27 B;  2WPM S;  3QO6 A;  2ZFF H;  1V2J T;  4ISO A;  1KXA A;  2W3K A;  3SYJ A;  5A09 A;  3MFJ A;  3E3T A;  2H1U A;  1FI8 A;  1ANC A;  4YLU A;  1SFQ B;  4ABA A;  1ZGV A;  4MG3 A;  1XX9 A;  2Z7F E;  1KIG H;  4AYY B;  1MBM A;  3RC4 A;  3SQH E;  3LGU A;  2BLQ A;  2PUX B;  4BTI B;  1DFP A;  5E0H A;  3OX7 U;  1SSX A;  1EOJ A;  3E1X B;  3TK5 A;  1TGT A;  5H4I B;  1SGP E;  4XBD A;  4CH8 B;  4B6E A;  3LC3 A;  5A8X A;  1MZA A;  2BVS H;  2ANM H;  5ETX A;  2BQW B;  1EB1 H;  3GDV A;  1GJ5 H;  3Q3X A;  3GCT G;  1Z8J B;  3A7Z A;  2ZHE H;  3P17 H;  1QCP A;  1WAY B;  2HRV A;  3A89 A;  3OE7 D;  1WQV H;  1DWB H;  1OKX A;  2G8T A;  1G36 A;  2G4U A;  1Z8G A;  2XC0 A;  3DFL A;  1WTG H;  3SZN A;  2O8M A;  1ETS H;  2D8W A;  4XRN A;  4ZRO A;  4AGJ A;  1UTJ A;  1UK2 A;  4XE4 A;  2PGQ B;  1KLJ H;  3D62 A;  3S7K B;  1K21 H;  3P8O A;  1MU6 B;  3VB6 A;  2QA9 E;  3TLO A;  1HPG A;  1GHA G;  1C5Y B;  2J4I A;  2UUY A;  2WUB A;  3RML H;  2Y80 A;  2RFK C;  1D3P B;  4AB8 A;  2R3Y A;  4XSK U;  1K1I A;  1O2P A;  2BD9 A;  1F92 A;  3TGK E;  2TRM A;  4LOY H;  2CGA A;  5B6L A;  2V35 A;  2QXG A;  2BY8 X;  1IQL A;  1GI6 A;  4HFP B;  1XKB C;  1BBR E;  3K2U A;  2ZGC A;  1L0Z A;  1D6W A;  1V3X A;  1FPH H;  1CHG A;  3MH4 A;  5PTP A;  3B8J A;  5HXF A;  2J97 A;  2P93 A;  1F7Z A;  1S82 A;  1C5R A;  1TQ0 B;  1WSS H;  5DP8 A;  1S0R A;  3BSQ A;  2Z9L A;  5TJX A;  1GVZ A;  2PKS C;  1GMH F;  5I46 H;  1ETR H;  2PUQ H;  1H9H E;  4FXG H;  4X1N U;  2EEK A;  4YOI A;  3RLY H;  2CHA B;  5BRR E;  2AEI H;  1AE8 H;  1JWT A;  4UEH H;  2FS9 A;  1AUT C;  4NZL A;  1K1J A;  2HLD D;  3TGJ E;  1O3B A;  1G30 B;  2HNT F;  1YCP H;  5K7R A;  1SL3 A;  5GIB A;  5DKM A;  1PQ5 A;  2GVF A;  2W6J D;  1TMU H;  4AFZ A;  2BD2 A;  3V13 A;  1XUJ A;  4Q7Y A;  1Z71 A;  4CHA B;  2J98 A;  2LEL A;  2D1J A;  1SLX B;  2ZWL H;  2CMY A;  3M3V A;  4TPY A;  1WXR A;  1TX7 A;  1V2S T;  4Q7X A;  1PPE E;  1SGT A;  2ODQ A;  1ZHR A;  1HAZ B;  3NK8 A;  4D9Q A;  2Y82 A;  2L74 A;  4I8J A;  1FY1 A;  1C1Q A;  1C1R A;  4MLF B;  4A1T A;  5K0H A;  1D9I A;  2O8W A;  3SU4 A;  1MKW H;  3M5O A;  2QAA A;  1LVM A;  1DSU A;  4E05 H;  4XD7 D;  2WUC A;  1H4W A;  4EST E;  5C5O A;  2HPP H;  2BVX H;  1BT7 A;  4Y79 A;  1MUE B;  2DE8 A;  1UVS H;  2BY9 X;  3NKK A;  5E0G A;  3SN8 A;  5L2Y H;  4CRC A;  1G32 B;  1YM0 A;  1T4U H;  1THP B;  2ANK H;  4U2W A;  4ABF A;  3ZZB A;  2YMS D;  3SV9 A;  1EJN A;  2IN2 A;  3RLW H;  1FZZ A;  1NT1 A;  4U30 A;  1H8I H;  1M9U A;  4AOR A;  1L4Z A;  1ZJD A;  1DXW A;  1Q31 A;  1C5T A;  5LPR A;  3WY8 A;  1SLV B;  2AER H;  2FOB A;  1AND A;  4M9F A;  4FU9 A;  3UQO A;  2WPH S;  1CGI E;  1BOQ A;  1MZD A;  1P3E A;  1QL9 A;  1O3C A;  2VVU A;  4D76 A;  2BYA X;  2AFQ B;  1EKB B;  1YLD A;  1A5G H;  2LNC A;  1GVK B;  4DII H;  2ZFQ H;  3ZZD A;  2VVC A;  2F9P A;  3SV6 A;  1QRZ A;  1Y5U T;  2WV4 A;  2CF8 H;  4ABB A;  5L6N H;  3U1J B;  3RXM A;  4ABJ A;  2WPL S;  1SLW B;  5HMA A;  3A84 A;  1C4Y 2;  4JZD H;  1MMJ N;  1CHO F;  3DT0 H;  8GCH G;  1IAU A;  1AZ8 A;  1TNK A;  3OAA D;  2BY6 X;  2SGD E;  3VXE H;  2ZU1 A;  2OBQ A;  3E0P B;  4X1Q U;  6LPR A;  1KXE A;  3MO6 A;  1UVU H;  4X6O A;  3SO3 A;  2K8I A;  1UTP A;  2XWB I;  5HGG A;  4B2C A;  4F49 A;  2OC0 A;  5CHB A;  4LZ1 H;  2C8X B;  1NBM D;  5FHT A;  1ANE A;  2FOE A;  1TOC B;  1GBM A;  2G00 A;  5EPN A;  2VGC B;  2BDI A;  2AYW A;  1O2V A;  1ELA A;  4YT7 H;  1O2Q A;  2QF0 A;  1UMA H;  3EAJ A;  3KYG A;  3QDZ B;  1GBT A;  1VJA U;  4R8T B;  2EI6 A;  1YLN A;  1MTN B;  1IOE A;  2FO9 A;  1O2L A;  8KME 2;  2FXR A;  1UVO A;  5JB9 S;  1CGJ E;  1PPC E;  3QK1 A;  1TFX A;  1P9U A;  2Y5G A;  5TCC A;  1S6H A;  4Y11 E;  4WME A;  3U8T H;  4BOH A;  3QZR A;  1BIT A;  1A0J A;  3U98 H;  3VB4 A;  4X6P A;  1UO6 A;  4OS1 A;  2IPH A;  3QTV H;  1W7X H;  5EQQ A;  3GY4 A;  2WSS D;  4DUR A;  2GJG A;  1XUK A;  1P2J A;  4FUG A;  2F83 A;  1O34 A;  1P04 A;  2XNI A;  2ZCL P;  1SC8 U;  2B5T B;  1V2Q T;  1O38 A;  2G5N A;  2JJ2 D;  1AWH B;  1TBR H;  4F48 B;  4YOG A;  3PMA B;  3VB3 A;  1BRC E;  3UWJ H;  2A7J A;  1PQ7 A;  1FIZ A;  3AW0 A;  1ESA A;  5CHA B;  4JYV H;  1QQ4 A;  2P3U B;  2H9H A;  3SNB A;  3ZYE A;  3BTQ E;  1V2N T;  3KQ5 A;  2OC7 A;  3ZZ9 A;  1O3P B;  3U69 H;  1AY6 H;  1QJ1 B;  1MKX H;  3L33 A;  4IBL H;  1XVO A;  1HAH H;  4Y6D A;  2BLW A;  1CQQ A;  4DY7 B;  3TJV A;  1HJA C;  1DAN H;  3PMH B;  2W26 A;  1BTU A;  1GI2 A;  1OP0 A;  3H5C B;  1QTF A;  3HK6 B;  4ZKN U;  2OBO A;  1IQN A;  1FY5 A;  3PM3 A;  2A4Q A;  4JYU H;  4ZUH A;  3SUD A;  1W2K H;  4NGA H;  1Y8T A;  2ZGH A;  1IHT H;  1PJP A;  1OYT H;  3Q77 A;  5AHG H;  1DDJ A;  1BTX A;  1C2M A;  2VH6 A;  1LCY A;  1TRY A;  1AGJ A;  1EST A;  1TMB H;  4FU8 A;  2ZI2 H;  5HM2 A;  4DT4 A;  1TPA E;  1V2V T;  2QF5 A;  4RSP A;  5EXM A;  5FCK A;  2YNB A;  3A88 A;  4K3J A;  2FWW A;  3M7T A;  1TX6 A;  3OEH D;  1QB9 A;  1C5U A;  4X2V A;  2ZO3 H;  2D26 C;  3F6U H;  3A8C A;  3RXH A;  4UFE H;  3QGN B;  1V2L T;  1QHR B;  3E91 A;  1Y5A T;  1UK4 A;  5T6F A;  4BAK B;  2JDI D;  3DSG A;  1FY3 A;  2A31 A;  1YBW A;  4Q4L A;  1ZJK A;  1EP6 A;  3SJO A;  3H7O A;  1ZTL A;  4AC9 A;  3CP7 A;  1AD8 H;  1GMD G;  3SHA H;  1BJV A;  4NWK A;  1QA0 A;  1TRM A;  1EAS A;  3RU4 T;  4NZQ A;  1GMH G;  4UFD H;  3S9C A;  2TBS A;  5C1U A;  1B5G H;  2PKA B;  1ELV A;  1HIA A;  3SUF A;  5I25 A;  2FLR H;  1O3F A;  1TPP A;  2SGE E;  1QBO A;  4TPI Z;  1DUA A;  5A8Y A;  4GUX A;  3I77 A;  4LK4 A;  3TU7 H;  2RCE A;  3N7E A;  1CA0 C;  3UB0 A;  1AKS A;  3OFN D;  4MNV A;  1FLE E;  1C2D A;  1ZMN A;  1CA0 B;  3RXT A;  1SGN E;  1SBW A;  2BDY A;  5F53 A;  2VWO A;  3D65 E;  2ZU2 A;  1GCD A;  1UK3 A;  1JRS A;  3M36 A;  3T5F H;  1FV9 A;  2FMJ A;  3O8B A;  1SOT A;  2XND D;  1NZQ H;  4TWW A;  3LT3 A;  4CRB A;  1GPZ A;  1O32 A;  2EY4 C;  1SQR A;  1MH0 A;  2XWA A;  4GSO A;  4I33 A;  4JZI A;  2ZHF H;  1XVM A;  5EST E;  3T2N A;  3T62 A;  1NBM E;  1CT2 E;  3KEE A;  3U9A H;  1BCU H;  1ZSL A;  1KTT B;  2A2Q H;  2G52 A;  3D23 A;  2FOM B;  3RXR A;  3CNR A;  1O3A A;  4UDW H;  1EXF A;  3RXE A;  3BEI B;  2ZEC A;  2P3F H;  1O5C B;  3NCL A;  2C8Z B;  2FLB H;  1HGT H;  3O8D A;  1A46 H;  1YYY 1;  2RDL A;  1GHV H;  1L2E A;  3ODF A;  4KTS A;  1GMC G;  3LU9 B;  1RGQ A;  2FZZ A;  3E90 B;  4OS7 A;  1MTV A;  1NTP A;  1C1V H;  2GV6 A;  3LJO A;  1N1L A;  3MO9 A;  4WF8 A;  3VGC B;  1GI3 A;  3GCO A;  5EJZ A;  2YOL A;  1ELG A;  1MD7 A;  1WBG B;  1JIM A;  4JMY A;  1NRS H;  1BRU P;  3UY9 A;  3VFE A;  1AB9 B;  2QE7 D;  1P8V C;  1BML A;  2PR3 A;  1C5L H;  4H6S B;  1LPG B;  1MTS A;  1GI0 A;  3ELA H;  3ZVB A;  3PLP A;  4Y71 A;  3I29 A;  1NFU A;  2UWL A;  1MCV A;  3D49 H;  4DVA U;  4Z0K A;  3URD A;  1D4P B;  3SOR A;  3SU1 A;  1UW7 A;  1AVW A;  2BD7 A;  2Z3E A;  2VJ1 A;  4NSV A;  1QRW A;  3CS0 A;  1ZHM A;  2ZC9 H;  1VIT G;  5C1Y A;  1RIW C;  1QB6 A;  1LPK B;  1O2K A;  2BY5 X;  4NSY A;  6CHA B;  5FBI A;  5GXP A;  1W10 U;  1QL7 A;  2WV5 A;  3MHW U;  1RS0 A;  2ZGJ A;  5AFY H;  4IN2 A;  5A2M H;  5C94 A;  1ARC A;  4QT8 C;  4AG1 A;  4I7Y H;  3ZVF A;  1C1M A;  2KX4 A;  3AAU A;  3PLK A;  1S83 A;  1V2T T;  3W1E A;  1GHW H;  1BRA A;  5EW2 H;  1IQF A;  1BDA A;  4MNY A;  1P2Q A;  1GBI A;  1DE7 H;  1NFX A;  4RN6 A;  5EGM A;  1XMN B;  3SJI A;  1XXF A;  1HXE H;  5C20 A;  4GPG A;  4TYD A;  2GTB A;  2OK5 A;  3SZE A;  1HAO H;  2OD3 B;  2V3O H;  4NA8 A;  5CDF E;  4WVP E;  2ZFS A;  3G01 A;  3GCT F;  5IK2 D;  4Q7Z A;  3HKJ B;  4JZF H;  1EPT C;  2QY0 B;  1LPZ B;  4INK A;  2OC8 A;  1EAX A;  3MU8 A;  2WYJ A;  1O2O A;  2GMT C;  1SGD E;  2NWN A;  2ZHW H;  4YLQ H;  2BOK A;  3M35 A;  1MKX K; 
#chains in the Genus database with same CATH homology
 5EJ1 A;  3CNR A;  3KYF A;  4I86 A;  5KGO A;  5KEC A;  4F48 B;  2GJG A;  5KED A;  5EIY A;  4P00 A;  4RT1 A;  1YWU A;  4P02 A;  4FOU C;  3DSG A;  5EJL A;  4HG6 A;  3KYG A;  2L74 A;  2RDE A;  1YLN A;  4XRN A;  5EJZ A;  4RT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...