4F48B

The x-ray structural of fimxeal-c-di-gmp-pilz complexes from xanthomonas campestris
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
97
Chain Sequence
QGILSLALKDKAALYSAYMPFVKSGGIFVPTPKRYMLGDEVFLLLTLPDSSERLPVAGKVVWTTPAGANRAAGIGVQFPDGPEGEAVRNKIETLLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural polymorphism of c-di-GMP bound to an EAL domain and in complex with a type II PilZ-domain protein
doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Signaling protein
total genus 21
structure length 97
sequence length 99
ec nomenclature
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07238 PilZ PilZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 4f48B00
5EJLA 1YWUA 4RT0A 2L74A 3DSGA 4HG6A 5KEDA 4P00A 4XRNA 5EJ1A 5EJZA 1YLNA 3KYGA 3KYFA 5KGOA 5EIYA 3CNRA 5KECA 4F48B 4P02A 4I86A 2RDEA 4FOUC 4RT1A 2GJGA
chains in the Genus database with same CATH superfamily
4GAWA 1ZSKA 3QN7A 1FUJA 2VIQA 3TH2H 1AMHA 1LCYA 3M7UA 1C2GA 1NRPH 2VGCC 1NPMA 1G3BA 3KQEA 1DXPA 2TGDA 1LVMA 2O8UA 2M2AA 2ZEBA 1SGFA 2ZCHP 5B6OA 3URDA 3F9EA 3PYHA 2UUJB 2WPDD 3KQCA 4O03A 1SHHB 1MCVA 1O5AB 2ALVA 1VR1H 3RC5A 1O3KA 1XX9A 4UD9H 3RMMH 1GI1A 1TE0A 2PLXA 3ATKA 2HVXA 1EX3A 1BMMH 1AIXH 3JZ1B 1EATA 4RT0A 2CV3A 3KQ5A 5FPSA 1MTUA 2ILNA 3MOCA 1AUTC 1Y5BT 3MU0A 3A84A 1QGFA 3MH7A 3A8AA 1WBGB 1NFXA 6CHAC 2ZFFH 4FOUC 4KGAA 3LOXA 3MTYA 1SGPE 4F55A 4JYVH 1LHGH 1KY9A 1YPHE 1ZTKA 3DT0H 1GJ4H 1W3CA 1HBTH 2ZO3H 1LHEH 1V2NT 5HIZA 1QL8A 3Q00A 1CSOE 1DUAA 4QT8C 3OY5U 4WJG2 7GCHF 1V2PT 5GNDA 1LVOA 1THPB 2O9QA 3RXAA 1SC8U 4DJZB 1IHSH 1V2TT 2IPHA 4FUJA 3RXHA 4SGBE 1GMHG 2A4GA 1ZHPA 1O3EA 1T31A 3O8BA 1SGDE 4WY3A 2SNVA 1TBZH 2BVRH 4NA9H 1ZMNA 1AZZA 1FDPA 3ZZDA 3U1IB 2GZ7A 5TJXA 3LC3A 3RDZA 3ZZ5A 2Z94A 1LMWB 4OS1A 1XUJA 2V6NA 2WZQA 2Z3DA 2FIRH 2Z9IA 4INKA 4FUDA 2ZGHA 4E06H 1OKXA 1DWBH 4YO9A 1AD8H 3RXGA 3A80A 3W94A 4FUBA 1BRAA 3BIVH 2XCNA 1FN6A 1P2QA 3WY8A 2XNIA 1GBEA 2AFQB 1FY4A 5E8EH 2ZCLP 1FMGA 2J9NA 4ASUD 1O2PA 3B9FH 1ELVA 2XC5A 3CNRA 1MCTA 5LGOA 2JDID 1GPZA 2FS8A 1ZRKA 3OU0A 1OOKB 4MDSA 5BPEA 3UR9A 3KNXA 1RS0A 4A5TS 3GY4A 1O3OA 3AK5A 3RXBA 2AGGX 2YMSD 1LHDH 2ZQ1A 3GY3A 1W12U 2J95A 2PWXA 7ESTE 1G36A 1ZSJA 1MD7A 2BD5A 2GDEH 4NCYA 1YKTA 3VFEA 3RXKA 1BQYA 1ZGIA 1MU6B 3Q3YA 5HKKD 3I78A 4Y0ZE 1CA0C 1T32A 3MU1A 5JBBS 1MZDA 2BX4A 1SHYA 2ZGJA 4Y8ZA 2ODPA 1TGSZ 1IQNA 3ATLA 5DKMA 1SLUB 1LQDB 2FI3E 4HI3A 5I25A 2GKVE 2VU8E 4GCHF 1C5XB 2PUQH 1ABIH 3ZVDA 2G5NA 4JZEH 3GCOA 1VKYA 2KAIA 4XSKU 2F43B 1NTPA 4ZROA 2FDAA 2ALPA 1EASA 1ELCA 1O3LA 1UVTH 1O2OA 2G00A 1GHYH 2ZPRA 1KTSB 1GWAA 1O2SA 1LHCH 1TBRH 1UMAH 4IN2A 3UIRA 1CA8B 1LDTT 3RXVA 2IOTA 3PV4A 4AX9H 2ZKSA 1O34A 3OAAD 2CN0H 3LGYA 4FU9A 1OWJA 1QJ6B 1NY22 2ZDLA 1GHXH 2V0BA 1BJVA 1J17T 3CS0A 1A0HB 5EQQA 2VWNA 5FBIA 5C5OA 1XXDA 3PLPA 2GX4A 2W3KA 3RLWH 3SV9A 1D4PB 1FLEE 1C5WB 1N8OC 4X8UH 2ANWA 2KAIB 5ESBA 2XW9A 4UDWH 1AN1E 5TCAA 1GHAF 2FTLE 4YT7H 2BD4A 2GVFA 4DIIH 4HG6A 3T26A 1TRYA 3K9XB 4KP0A 1YLNA 4KTCA 1TIOA 3UQVA 5ESTE 1DWDH 3FFGA 3A8CA 3SUGA 1DXWA 3M5LA 3P8GA 1F5RA 3KCGH 2ULLA 5G4BA 1C2MA 1O2ZA 2CGAA 4UFDH 2OQUA 2AYWA 3D62A 3GYMA 3LGUA 3M7TA 4NIVA 1NROH 5FX6A 1CHGA 2TRMA 4XBBA 3R0FA 3SV8A 1L4DA 2STBE 2LP6A 1C9PA 2WPJS 1O5FH 4AFZA 1FI8A 3SU3A 3AAUA 1CE5A 3GY7A 3M5MA 2BVSH 5E2PA 4NSVA 2J34A 1Z7KA 4BAMB 2FYRA 1WQSA 1GHZA 2OC8A 2V3HH 3GOVB 1GBJA 1O2NA 4U32A 1HAXB 1MTNC 3JZ2B 1MKXH 1TMUH 1W0ZU 4O97A 1AFQC 1T7CA 1DSTA 3FAOA 3FZZA 1FV9A 1GDQA 1XMNB 1UTJA 1K1JA 2EI6A 2QY0B 1ZMLA 4RKJB 3KHVA 1TA6A 1C1MA 3SHAH 3SNBA 1UTNA 2ANKH 1AU8A 3M3SA 1SGEE 1A2CH 2IJOB 1EZSC 3RU4E 1PQ7A 4RT1A 1BT7A 2VIPA 1CT2E 1NO9H 2FYQA 5HGGA 4FUCA 3OEHD 1B0FA 1RTKA 2BD7A 2WV4A 1SQTA 4ZXXH 1TYNA 1SOZA 4D8NA 2P93A 4H42U 2FI5E 1TQ0B 2RDLA 3HPTB 2J4IA 3RUOA 1SBWA 3RXJA 4BAHB 1FQ3A 3SQEE 1YGCH 2SGFE 2ODYB 1GBTA 2TGTA 1GI3A 3V3MA 3FP6E 1C4V2 1WV7H 3EDXB 3BTME 2OTVA 1J9CH 1C1WH 4AFUA 1A0LA 2B8OH 8ESTE 1EAIA 2P3TB 4FU7A 2D1JA 1LPGB 2SNWA 4FU8A 5E0GA 2SGDE 3AW1A 4GUXA 3K65B 2Y82A 3QZQA 3S9BA 4IBLH 1HV7A 1SLVB 1O37A 1Y3WA 2PGQB 3UUZA 1DM4B 1N8OB 2NU2E 2BZ6H 5DPAA 2UWPA 2BD2A 1JIMA 1O3HA 1SLWB 1HJAC 1BZXE 1PQ8A 2PV9B 1TLDA 1LKBA 3MO3A 1A5GH 2FOHA 2R3YA 1IQIA 1E38B 1GVKB 1C4U2 3NUMA 1WSSH 1ANDA 2VVCA 2QF0A 4Q7ZA 4GVUA 1FY1A 3UQOA 1TFXA 1SOTA 1ELTA 1O32A 5I46H 3P8FA 2XWBI 1LQEA 4FUFA 3KQDA 2QAAA 5DSFA 1IQKA 5IYTA 5KGOA 1EPTC 1EZQA 2WV9A 2GCHG 4YM9A 5JDUB 3SUDA 4DT7B 3A81A 1K2I1 1KMHB 1XKBC 1GCDA 1P04A 3SNCA 3MNCA 1QIXB 2QXGA 3PLKA 1F2SE 1YYY1 4LZ1H 1MAXA 3H5CB 3GDVA 4GLYA 1GBIA 3SU6A 5KEDA 3RP2A 4ABIA 1ORFA 3P17H 1CHOG 5F53A 2YOLA 1T4VH 4Y7AA 4ZKNU 4I8LA 3PROA 3HKJB 1MQ5A 1BBRE 1EJNA 5EODA 4BTTB 2C8ZB 1G2MA 1IQHA 4X2VA 2TGAA 1Z8JB 1NZQH 2F9PA 2D2DA 3BN9A 2FI4E 1QBVH 2FZZA 3DSGA 2BDGA 3BIUH 2WHXA 1TMTH 1IQLA 4X6PA 3EE7A 1YF4A 3TJVA 3F9FA 3EYDA 3FVFB 4Y76A 1EJAA 4MQAA 1SI5H 8GCHF 2OLGA 1BBRH 2OQ5A 3U28C 3T29A 4LOYH 4ABJA 1UTQA 1VITH 3S7HB 2ZGBH 1C2HA 2ZQ2A 4XBDA 1GVLA 1GJ8B 1HFDA 4BTIB 4WXIA 1S6HA 4INLA 5EXMA 4H6SB 1BMNH 1MKWK 1QY6A 1C1RA 4O3UA 5T3HA 3HKIB 1FAKH 3SJKA 5AFZH 1E34B 4JMYA 4K1EA 1BRCE 6ESTA 3RMLH 4WVPE 2F91A 4D7GA 5C1YA 1EJMA 1G3EA 3BTFE 1NRSH 4NFEA 2F9BH 3ZVCA 1F0RA 3BTQE 1YLDA 1BJUA 1ZJDA 2ZNKH 4XFQA 2BY5X 4ZHAA 3URCA 1YWUA 1HJAB 4KKDA 1OWEA 2EI8A 2VJ1A 2O8LA 1K9OE 3LT3A 1VZQH 1AFEH 1QRWA 1TOMH 1VJ9U 1FIZA 3GY5A 4BNRA 4MPVA 1YPGH 4XE4A 2BTCE 1E35B 5KECA 3VB3A 4AG2A 1WCZA 4PROA 2YMSB 2PP6A 4M7GA 3AAVA 2H1UA 1UCYK 1ETSH 3KQBA 1A61H 4AGJA 3H7OA 2ZGXH 1EPTB 1ID5H 1SFIA 4H4FA 2VWLA 1EKBB 4INHA 1C2EA 7KMEH 4ZKRU 1UK4A 4ZKOU 1H8ED 3ZZ9A 2Z9GA 4AFQA 4CRDA 3MO9A 1PPGE 4Y79A 1FY8E 1IQEA 2LPRA 1F92A 2JKHA 2ZU3A 2QE7D 3BSQA 1TGNA 1C2DA 4TPIZ 1AB9C 1DITH 1DUEA 5GCHG 4D9QA 5LPFA 5TCCA 1XUGA 1CGIE 4Q7XA 2C3SA 3UNSA 4FUEA 4HZHA 3SV6A 4CBOA 5C17A 2CXVA 2OC7A 2L74A 2XBXA 2FTMA 2A5KA 2QYIA 1C1TA 4NWLA 2FOEA 2SGAA 5A8XA 5GWZA 3LGTA 2R2WU 1TPAE 1GL0E 1OYTH 3KEEA 1NM6A 3BG8A 2BYAX 1Y5AT 3QK1A 3EA7A 2J92A 5HYOA 3PMBB 2ZP0H 4RN6A 2F3CE 1FY3A 1ZLRA 4XDEA 2Y5FA 3O8RA 3SUEA 1RTFB 2ZFRH 1P12E 2PTCE 1BTWA 3ZV8A 1Q2WA 1TNKA 4M9FA 1F0SA 4Y71A 3E3TA 1C5PA 3LPRA 1O3BA 1ELDE 3F0PA 1NRNH 4LXBH 4WH8A 5FL7D 3NXPA 5T1VA 3QDZB 3RLYH 1W2KH 4O9VA 4OS4A 2OK5A 1V3XA 1C4Y2 2LELA 2H6MA 3A8BA 3F9HA 3ZVFA 2FM2A 5C0TA 3ENSB 2RCEA 2G4UA 4I8KA 1LHFH 2XCFA 1RJXB 1ZJKA 1IQFA 2Y5HA 3OSYA 3ZVAA 1TRMA 2Q6DA 1UTOA 1DLEA 2IN2A 4Z1MD 2VIVA 3UAIC 1T8LA 1WTGH 1GMHF 4E7RG 2D8WA 4X8VH 4RKOB 5C20A 1ELGA 3Q3KA 3SI3H 1P3CA 2XNDD 1N1LA 3GISB 3A86A 3PWBA 2TBSA 5JB8S 1UHBA 2Z3EA 3GCTG 5F8ZA 1Y3UA 2ZDMA 5F8TA 5AVDA 1GI0A 2XTTB 1BMLA 1O2XA 3ZYEA 2JH6D 1RGQA 2NU0E 4ABFA 4OS5A 1FN8A 4Q63A 1KLTA 1P11E 1IOEA 3EE0B 1MMJN 2W6ID 5JB9S 2Y7ZA 1CGJE 1OWKA 5L6NH 2KCYA 4ISHH 1BRUP 4X2YA 3T5FH 1FPHH 3VGCC 3TH4H 1HRTH 2FOMB 1AB9B 1UK2A 2GZ9A 4I31A 3SU5A 5EIYA 5LH8A 2ZU5A 1UHBB 4K8YA 1K1OA 1GMDF 4MPXA 2TIOA 4I86A 3SUFA 4ZKSU 1K1NA 1EOJA 1PFXC 1V2UT 4LK4A 4XOJA 5J4SA 1O35A 2AGIX 1F5LA 3SBKA 1PPZA 1GJCB 4Y7BA 3RC4A 5FCRA 3LC5A 1F0TA 1GL1A 2QIQA 1MBMA 1C5QA 4DCDA 5LPRA 1F0UA 4TWYA 1V2VT 4GPGA 5EJ1A 1DOJA 1A3EH 1WOFA 1FZZA 1LPZB 1VITF 2H5DA 2PUXB 4BANB 1QBNA 5ETXA 2THFB 1C1QA 2BY9X 1VGCB 3BTKE 4CR5A 1XVOA 2P59A 3F2GA 2KX4A 1E37B 4IS5A 2NU4E 1XKAC 1QR3E 3T2NA 1AI8H 5GDSH 3QLPH 1GBKA 3UB0A 1GJ9B 1P9SA 1ESTA 3UNRA 1NN6A 1UVOA 4K2YA 4Q80A 3S0NA 1O2JA 1YPLH 5EOKA 4CRFA 1IQMA 1ZPZA 2W3IA 2JETC 2DE8A 4HTCH 5A2MH 4BTUB 1E1RD 1O3CA 2A1DB 1AHTH 1QL7A 4Y0YE 2FX4A 3FN8A 4YOGA 2RA3A 1Y8TA 3PB1E 3F2FA 1MD8A 2FEQH 4E7NA 1KYNA 1C2LA 1GI2A 1HAVA 2R9PA 4I8HA 5A8ZA 1TONA 2P8OC 1T8OA 3NK8A 3BEUA 3DD2H 3C27B 4IW4E 3GDUA 2OBQA 4K3JA 2FWWA 4X6NA 3PM3A 1WDIA 1HXEH 4FUIA 2KR7A 3E8LA 1DWCH 4BXSA 2RG3A 2HNTC 4JYUH 3RXTA 2GGVB 1H9HE 1ZPCA 3TGIE 3UNQA 2HALA 3S69A 1AWHB 2KCAA 1GI8B 1QB1A 2QXHA 2YNBA 1AE8H 2FPZA 4NG9H 1AE5A 2EEKA 4YOJA 2CF9H 4KTSA 1CT4E 3A83A 3VGCB 1HAVB 2FXRA 3SNEA 3AVZA 4ACBA 1KXAA 5CDFE 1AVGH 2FODA 2GJGA 2RFKC 1O2WA 4K8BA 3RM0H 3K2UA 1W7XH 2R0LA 2PKSB 2BHGA 2C8YB 2Z9KA 3F1SB 4MG3A 1MUEB 3QGNB 2QC2A 3PWCA 4ZHMU 3A89A 2Z9LA 1C5TA 3RXSA 4NZQA 2BMGB 3A7WA 3L33A 3HGPA 2FP7B 4D7FA 4P02A 3E91A 4MLFB 3OX7U 3VG8A 3D65E 1QHRB 5EXLA 1BOQA 4IC6A 4BAKB 4NIWA 5GJ4B 3ZVEA 2A5AA 2ZTZA 4YTAA 2BB4A 1ZHMA 2FLBH 2WPIS 1Z6JH 2AIPA 1O2QA 1KSNA 2AERH 2STAE 1P06A 1O31A 4VGCC 3KYGA 3M36A 5EPYA 4Y11E 2BD8A 1QQUA 2V7QD 2BQWB 2B5TB 2KCOA 1ZHRA 4TT3D 3H7TA 1C1VH 1XM1A 2TPIZ 3VPKA 1BDAA 2SGEE 3KIDU 1P2KA 3PO1B 5EQRA 1Y3XA 2A45B 1EAXA 2WUCA 2YNAA 1KXEA 3LIWA 3SN8A 5JBTA 3MU8A 1L1JA 1SR5C 4I7YH 1W11U 2JETB 1PPEE 4GCHG 3B8JA 4P00A 1ZRBA 1NFUA 1L2EA 2JH0D 1P2NA 7LPRA 2ZA5A 2OBOA 1RD3B 4ISNA 3D23A 3Q77A 1D3TB 1AO5A 1EP6A 2XXLA 3OYPA 1TAWA 3P70B 3A7XA 2M5TA 3PMJA 2XRCA 1HB0B 2ZTYA 4RSPA 2CMYA 3RXCA 1L0ZA 2P8OB 1JBUH 3AASA 3ODDA 1ZMJA 3ZZ6A 1O5GH 1P3EA 3BTHE 2A31A 1SGRE 2BDAA 3DFLA 4JZDH 1W0YH 5EPNA 1DE7H 3FP8E 4A92A 2BVXH 2VNTA 5C1UA 2VH0A 3LH3A 4B2AA 3D49H 3F9GA 1CU1A 2IJD1 1MQ6A 1XVMA 1GHAG 1HJ8A 2XC4A 1YPJH 1C5YB 2HLCA 2ZI2H 2V3OH 8LPRA 1MTSA 4IGDA 1DDJA 4A7IB 3MO6A 2A4OA 1PPBH 2ZFTA 4X1PU 3IWMA 4AC9A 4ZHLU 1DS2E 4R8TB 1J8AA 3KL6A 3RXEA 2ZCKP 2OC0A 3RC6A 1ELEE 2C4FH 1O5CB 2J5UA 2NWNA 1OP2A 4AB9A 1QB6A 2J38A 3BG4B 2HNTE 3GY8A 4J1YA 4NSYA 1BHXB 1O3IA 2F4LA 2GCHF 3TVJB 1MU8B 1W0JD 1JMOH 1XUKA 3HK3B 1O2GH 1IHTH 4TSFD 3CS7A 1O2VA 5L2YH 5JYIA 3DUXH 2DUCA 2H9TH 1S85A 3SJOA 1Y59T 2BQ7B 2K8IA 3U1JB 4IN1A 3RXQA 3IITA 1IQGA 2J98A 3RXPA 1EXFA 1HJ9A 1RXPA 2FO9A 5AF9H 1TWXB 3A7VA 1PJPA 6GCHF 3OEED 3LGWA 1GJ5H 1BTHH 1CHOF 2GV6A 4ACAA 1EAUA 3TH3H 3V13A 3F2HA 5B6LA 3T62A 2O8WA 2BOKA 3OTJE 2XOKD 3ZZ3A 4VGCB 2GTBA 5CE1A 1P10A 3ZZBA 3PMHB 9LPRA 5GPIB 4AYVB 5EJLA 1HPGA 2OC1A 1GMCG 5F8XA 3SJ8A 2YMSC 3S9CA 1A1RA 5EXNA 5C94A 4UFEH 4B75A 1S81A 4FXGH 1TALA 4XRNA 4B71A 4ISIH 4Y10E 5GIBA 2WV5A 4WWYA 1GBMA 1Z8IB 3CP7A 1TGBA 3KYFA 1BITA 1ACBE 1V2KT 1G30B 1FJSA 3ZIAD 3SGAE 2J98B 1NT1A 1DX5M 2VWOA 1WXRA 2GT8A 1C1UH 1TB6H 1Z8GA 1OS8A 3U9AH 2RA0A 2ODQA 1SB1H 2P95A 5JPMH 3E90B 1DLKB 1MTWA 1OHHD 4BAOB 5LPEA 4U01A 1EQ9A 1INCA 3NKKA 3UWJH 2HGTH 2V35A 2D26C 1W14U 2AEIH 3TNTA 1C1PA 5DGJA 4Z0KA 4FVDA 5A0CA 1YCPK 2Z6BD 3B23B 1SPJA 2VB0A 3N7EA 1HLTH 3PTNA 3QTOH 2CJIA 2OXSA 1WUNH 1OSSA 3SOSA 1BUIA 1P2IA 3VXEH 3ZZAA 1TGTA 4DURA 3LJJA 1E79D 1O0DH 3ESTA 2ZGCA 1S84A 2EI7A 4YOIA 3T27A 1P09A 1DY9A 4BOHA 1Z71A 2A4QA 5DP4A 2SFAA 5FPTA 1BCUH 3ZZ4A 2GV7A 1RTLA 1B5GH 1V2WT 4NGAH 4WF8A 2RDEA 4ZXYH 3E6PH 1V6DA 1C5NH 4X6OA 1QA0A 3EA9A 4H6TA 1L1NA 1C5UA 2H2ZA 3I77A 3ZZCA 1H8DH 1ANCA 2ZG0H 4CRAA 4A1XA 5ABWA 2XWAA 1DT2A 1SKYE 4FUHA 4B74A 1D6WA 3U8RH 1PQAA 5A0AE 3SORA 4ESTE 2ZHDA 5EJZA 3SU2A 1AZ8A 2ASUB 3DFJA 1K0HA 1DPOA 5HM9A 5H4IB 1HAGE 3V0XA 1W7GH 3SHCH 3ZZ8A 1XUIA 3TK6A 4B1TA 1O30A 2G52A 2ZDVH 3U98H 2QGRA 5DP9A 1GHBF 3WWBA 2ESTE 2WPKS 3ODFA 3LJOA 1BTXA 1FXYA 5GCHF 3EAJA 3VEQB 1LO6A 1A7SA 4IMZA 4HFPB 1L4ZA 4DG4A 1EAWA 3FZDA 3SZNA 1H4WA 1QRXA 3M3TA 1QQ4A 4X8TH 5HMAA 2BXUH 4A6LA 3ELAH 3QX5H 2EY4C 4CHAB 1BTUA 1VCWA 1D3QB 2PSYA 1HNEE 1BTZA 4AZ2B 3QUMP 3MHWU 4K69A 1NS3A 2O8MA 1SGNE 1L1GA 2GDDA 1TX8A 4B73A 1NBMD 1EB2A 1J16A 3RU4T 3FANA 3QGJA 5EU8A 5EW2H 4AG1A 9ESTA 2P3UB 4KTUA 3OY6U 1UK3A 1OP8A 3A88A 1MH0A 1O5EH 1LTOA 1O2MA 1GJ6A 4TY6A 5BRRE 1GBBA 2BY8X 4DGJA 4Y8YA 5FX5A 1NC6A 1V2OT 1GI5A 3PLBA 3SNDA 3F68H 3N7DA 1NESE 4XBCA 2CK3D 1BIOA 1D3PB 2FOGA 3ATWA 3NCLA 3RU4D 1IAUA 2PW8H 2P94A 1O3MA 1JRTA 4UFFH 3MH4A 1CT0E 2PKAA 2AMQA 2ZFSA 1O3DA 4UEHH 3A85A 1H1BA 2ZHQH 3STIA 2VINA 5DP7A 1GGDB 1P2OA 1OX1A 1K1MA 3UREA 1YCPH 1HXFH 1S6LA 3STJA 4ZUHA 2FOFA 2A4RA 2VIDA 2ZECA 1HCGA 1VGCC 1WQVH 4WH6A 1TPOA 3GCTF 1UO6A 1PYTD 2ZU2A 3OFND 1GG6B 1HDTH 1M9UA 2I6QA 5C2ZA 4HGCA 1COWD 2JH5D 1C1SA 4ABGA 1DVAH 1A4WH 2A2QH 4ABDA 1A46H 1GJBB 5K7RA 3QO6A 1HAYB 2PKAB 4FUGA 2ZC9H 3EGKH 1O3NA 3Q76A 2GCTB 2JIZD 4IMQA 5C67A 4MNWA 1B0EA 2HNTF 2PTNA 1BTPA 3F3BA 2A0QB 3PV5A 1SGQE 1AY6H 2WPMS 3G01A 2P3FH 5A09A 3RXMA 3L3TA 1MKWH 3OTPA 1C2JA 3SGBE 1U6QA 3MU5A 1C1OA 4JYTA 3NWUA 1UW7A 4MVNA 1UCYE 1AGJA 1SLXB 1UVUH 2C93B 1BHXF 1CBWB 2HOBA 1RRKA 2ZFPH 1F5KU 3M3VA 1UTKA 5EG4A 1SQAA 3GS9A 1TNGA 2G55A 1SG8B 4X1NU 1GCTB 4A1TA 4ABEA 4THNH 1GVZA 2IPQX 4ZAEA 2ZIQH 1T8NA 1P2JA 4J2YB 3VB4A 5SGAE 5DP8A 3SGQE 1AVWA 1EZUC 5HM2A 1C2FA 2R3UA 3RXDA 3W1EA 1VJAU 2EQNA 2K0QA 1TNLA 1SVPA 1UCYH 2Z9JA 2WYGA 2BDYA 2K1QA 1O2IA 1PPHE 2PR3A 4DY7B 2W26A 3LONA 2UWLA 1BA8B 1N6YA 4JZIA 4CREA 2BD3A 1GBHA 1G2LA 2QF5A 1WAYB 2PKSC 5EW1H 1EZXC 5T6FA 4X2WA 4X1SU 3NPSA 4X8SH 4AB8A 5FCKA 3TITA 2UUYA 4JK6A 1O2HA 3M37A 2Z3CA 3MFJA 1DWEH 3K6YA 2VIOA 1ETRH 1B7XB 5C1XA 2CHAC 1MZAA 2OCVB 1QB9A 1MBQA 1DANH 3HATH 3QZRA 1P2MA 1KLIH 3QWCH 4K1TA 1ARBA 2KM0A 1WTHD 1Z6EA 3O8DA 3RXRA 2ANYA 3GY2A 5E0HA 2JJ1D 3A7ZA 3ZYDA 5C3NA 1K1PA 1QZ8A 1S0RA 1QURH 3U8TH 1FX0B 4DVAU 4CBNA 5DG6A 2ZWLH 2DE9A 4ABAA 3U69H 1TOCB 3BEIB 4YT6H 5DO4H 2H5CA 4B2CA 1MAYA 2A5IA 1TX7A 3M61U 1X7AC 1Q3XA 3KF2A 2BD9A 1CGHA 2G8TA 1V2ST 3UOUA 3UY9A 5A0BA 2EC9H 1Q31A 2XC0A 5CHAB 2FOCA 2ZDAH 3SNAA 1T4UH 3PO1C 1O2UA 1QJ7B 3TLOA 1P9UA 1UVPA 1Z1IA 1P0SH 5DP3A 1ZTLA 4U30A 3O8CA 4RI0A 1G3CA 1KLJH 2BDIA 2BLVA 2FESH 3DCLA 4YLQH 3MNXA 5DN6D 1C5VA 4MNYA 1C5MD 3Q3XA 1JWTA 1GBAA 7GCHG 4Q4LA 1YCPM 2Q1JA 1YPEH 1GMDG 1JXPA 1C5LH 3PTBA 1HAHH 1MKXK 2VGCB 1KXCA 2A32A 4OS7A 1Y3VA 4NWKA 4K5ZA 2GT7A 1ELFA 1W8BH 1HAZB 1EP5A 1G32B 1GHWH 3ITIA 3KGPA 2W7SA 1GI7B 3ZVBA 5L2ZH 1TGCA 4XD7D 3BTWE 1VITG 1DICA 1BMAA 3TGKE 4KELA 2G81E 3EQ0H 2Z7FE 1QBOA 3NZIA 1THRH 1QCPA 4A1VA 1KTTB 1OXGA 3CENA 5AHGH 1NFYA 2W6JD 3ZVGA 5AFYH 4TPYA 3S9AA 2ZDKA 4OS6A 3L6PA 5EQSA 5IDKA 3GDSA 2SGQE 4E05H 4MNXA 5A8YA 6CHAB 4GSOA 4U2WA 3N99A 2BOHB 4NA8A 1Y3YA 3BG4C 2BZAA 5DK1A 4I8GA 2FLRH 2ZU4A 1PYTC 2BQ6B 3TJUA 1YC0A 3MH5A 4MNVA 1HUTH 1CVWH 3TK5A 4D9RA 1OP0A 1HGTH 1KXFA 1O3FA 1OWIA 2CHAB 3ATIA 5GXPA 1XUHA 2NU1E 4AOQA 1O36A 2F83A 1OYQA 1KIGH 1SGCA 4F4OC 3FOAA 3GCNA 1ABJH 3IG6B 1UJ1A 4NZLA 1Z8RA 2BY7X 2OD3B 2GD4B 2JJ2D 3SU1A 2HPPH 3C1KA 1D3DB 2ZTXA 1SL3A 2Q6GA 4JZFH 3UR6A 3GY6A 3SO3A 4K60A 3MNSA 1ZZZA 4CH8B 2B0FA 2WINI 3P6ZB 1P02A 4CR9A 1TX6A 3A8DA 3S7KB 1O3PB 2P16A 2W5EA 1MABB 4NIYA 2BY6X 3EA8A 5HXFA 2FOAA 4AN7A 4LZ4B 1LVYA 1SQOA 1G37A 5FXLA 1YPKH 3VXFH 3M7QA 1P01A 2A7JA 1C5OH 1LVBA 4ABBA 2BX3A 1TBQH 3LU9B 4Q7YA 4UONA 2H9EH 3LGVA 3RMNH 3SZEA 1O38A 3VB6A 1W0KD 1GJDB 5FPYA 2L6OA 4ZMAH 1GDUA 1WYKA 4YZUA 1TNHA 1WU1A 1GBCA 1ZSLA 1K21H 2OP9A 2AH4X 2PGBB 3MU4A 3VB5A 3MQKC 5CHBA 2VH6A 1NFWA 1E36B 1BB0B 4ASHA 1QJ1B 4I32A 1KXDA 5F03A 1A5IA 1DSUA 1EFRD 1PPFE 2BXTH 3TGJE 1TA2A 1G9IE 3RXUA 1LKAA 2B9LA 1O2LA 1FY5A 1NBME 3MYWA 5DP6A 2R2MB 1HAOH 5JBAS 2FOBA 5L30H 4O3TA 1K1LA 1K22H 4CRGA 2VVUA 3SQHE 1QRZA 3GCHC 4ISLA 1O39A 2AIQA 1N6XA 1C1NA 4BXWA 1S82A 1BRBE 1GMCF 2PFEA 1CA0B 4FVBA 1FPCH 1AKSA 1BBRK 2GMTC 5FAHA 3OE7D 4ISOA 1A0JA 1C5ZB 4I8JA 1DFPA 2I6SA 3SI4H 2G4TA 1ZPBA 2OUAA 2WPHS 2ZF0H 2VBCA 4F48B 4NA7A 2A7CA 1ZR0A 2AHME 5IK2D 1AVXA 2Q6FA 3K6ZA 5J4QA 1C5SA 1W10U 2ZDNA 3ZV9A 4X1QU 3SU0A 1E1QD 4Q2KA 3MI4A 3UFAA 4YESB 2HRVA 2ZHWH 2BLQA 3TJNA 1S0QA 3UTUH 3LH1A 1K28D 2AS9A 2F9UA 1GBLA 4JZ1A 1O33A 2ANMH 4JCNA 3SU4A 2KZ4A 1OPHB 1YP9A 4ZCNA 5T6DA 5PTPA 1NU9A 1AKSB 4X0WU 1EUFA 3RXIA 3SW2B 3H09A 2G5VA 4Y8XA 3SYJA 2WPLS 2VVVA 3GYLB 1V2RT 1NRRH 4ZH8A 1SGTA 1CQQA 2F9OA 2J2UA 4CHAC 2AGEX 1TMBH 1F7ZA 2ZHFH 3FP7E 1ETTH 4X6MA 1J15A 2ZU1A 3M5NA 3UPEA 2QF3A 2TGPZ 2GP9B 2HVYB 3BF6H 3R3GB 4K1SA 4CH2B 1ANEA 1S6FA 2UWOA 3SV7A 3DA9B 4X1RU 3TK9A 1A3BH 1O5BB 2J97A 1T8MA 3LKWA 2C90B 1GI6A 1O2YA 3KN2A 2LNCA 1C2KA 1ZOMA 2A7HA 3RXOA 1TPSA 1QFKH 1ESBA 1V2QT 1AQ7A 3PMAB 1A5HA 2XBYA 1HYLA 4CRCA 1SQRA 1YBWA 1ARCA 3A82A 3BTDE 3NRLA 3V12A 1O2TA 3FO8D 5EGMA 5F6MA 1GI4A 2BDBA 2QF4A 3MWIU 1YLCA 3RMOH 6LPRA 3SJ9A 1TQ7B 3F0OA 2PHBA 4X2XA 1AUJA 1JRSA 1D6RA 2C8XB 2ZFQH 5E0JA 2R0KA 2UUKB 4OGYA 3M35A 2FS9A 6GCHG 4I33A 5DJ7A 1H9LB 1O2RA 1OWHA 1SGFG 2Y80A 1TRNA 1GGDC 1GI9B 1MTNB 1AFQB 2Y81A 3E1XB 4MTBA 1QNJA 3A7YA 3BEFB 1ELBA 3BTGE 3GCHB 1VCPA 1ZGVA 2PSXA 1GBFA 2ZZUH 2F9NA 2FMJA 4DOQA 1HAIH 4B6EA 1SFQB 2GMTB 3RXFA 1UVSH 1YPMH 4WMDA 4ABHA 1IQJA 3TIUA 1GG6C 4NFFA 4DT4A 3V7TA 2QN5T 4MPWA 1P8VC 5T6GA 3A7TA 3BV9B 4WMEA 4DIHH 2XYAA 1E0FD 2CF8H 3DSOA 3MNBA 3VB7A 3SV2H 3HK6B 1C5RA 3N7OA 4SGAE 3WWFA 1O5DH 4JK5A 2BDCA 8KME2 2G51A 3T28A 1J14A 2GCTC 1Z1JA 1TNJA 4OGXA 3M5OA 4AORA 1RIWC 2QXIA 2QV1A 4GHTA 5JBCS 2Y7XA 5C0UA 1YY3A 4AFSA 2HLDD 1CO7E 2W7UA 1HIAA 2EA3A 1C2IA 3F6UH 1YM0A 1EPTA 2Y6TA 4AGKA 2HPQH 5FHTA 1UTPA 3P8NA 5E2OA 2AMPA 3E16B 2O8TA 1BMFD 1CBWC 2GZ8A 2H9HA 2V3MA 3PRBA 3QTVH 4NIXA 2UUFB 1MTVA 1PQ5A 2Y5GA 4D76A 5HIYA 2WYJA 1THSH 3P95A 1SGYE 1O3JA 1V2MT 1SSXA 1V2LT 4OM9A 4TWWA 5CMXH 1GCTC 3TU7H 1LPKB 3UWIA 1GJAB 3PV2A 1YPHC 1H8HD 1EOLA 4R0IA 2WSSD 1W13U 4WMFA 1RFNA 3DHKH 3E0NB 3E0PB 1JIRA 8GCHG 1D9IA 4IC5A 1S83A 1TNIA 1HIAB 1NU7B 1QA7A 1SMFE 2NU3E 2C8WB 1K1IA 1GDNA 4B76A 4DW2U 3P8OA 4Y6DA 3BTTE 3TPIZ 1FAXA 1QTFA 1FIWA 2VWMA 1P05A 2ZPSA 3ZZ7A 1ANBA 3WW7A 2BM2A 1ZYOA 4AYYB 3HGNA 1H8IH 3UOPA 1ELAA 1PPCE 3MH6A 2QCYA 4UE7H 1KDQA 2FX6A 1O2KA 3W95A 1GHBG 1VCQA 1QL9A 1ZTJA 1UTLM 3LDXH 1DY8A 2A2XH 3PRDA 3LGIA 1OWDA 3I29A 4B6FA 4Z6AH 3A87A 4WXVA 2XBVA 1O3GA 2QA9E 3T25A 2HWLB 1XUFA 3TNSA 1GBDA 4B2BA 2VIWA 3MMGA 1O3AA 2BLWA 5C5NA 1EB1H 1GHVH 2ZPQA 4YXWD 1P57B 2B7DH 1FONA 4CRBA 1BTYA 1TPPA 2BLOA 1GJ7B 2BDHA 4TY7A 1AWFH 1FNIA 1Y5UT 2KFWA 1ESAA 4GHQA 5DP5A 2QXJA 2KCPA 1KDQB 4F49A 3SJIA 3RXLA 2ZHEH 1HAPH 3U8OH 1JOUB 2F9VA 1G3DA 4UFGH 1SGIB 4FETA 5CHAC 2WUBA 2J94A 3BTEE 4MPUA 3P92A 1V2JT 1TABE 1C9TA 1KXBA 3ATMA 1UTMA 1NRQH 4TYDA 1XXFA 1RIWB 4OS2A 3AW0A 3RM2H 5K0HA 3FKSD 1H9IE 5FBEA 2AMDA 2OINA 2XBWA 3GICB 4BAQB 1S5SA 3TJOA 2SGPE 3DSPA 4YLUA 1P03A
chains in the Genus database with same CATH topology
5EJLA 1YWUA 4RT0A 2L74A 3DSGA 4HG6A 5KEDA 4P00A 4XRNA 5EJ1A 5EJZA 1YLNA 3KYGA 3KYFA 5KGOA 5EIYA 3CNRA 5KECA 4F48B 4P02A 4I86A 2RDEA 4FOUC 4RT1A 2GJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJL A;  1YWU A;  4RT0 A;  2L74 A;  3DSG A;  4HG6 A;  5KED A;  4P00 A;  4XRN A;  5EJ1 A;  5EJZ A;  1YLN A;  3KYG A;  3KYF A;  5KGO A;  5EIY A;  3CNR A;  5KEC A;  4F48 B;  4P02 A;  4I86 A;  2RDE A;  4FOU C;  4RT1 A;  2GJG A; 
#chains in the Genus database with same CATH topology
 4GAW A;  1ZSK A;  3QN7 A;  1FUJ A;  2VIQ A;  3TH2 H;  1AMH A;  1LCY A;  3M7U A;  1C2G A;  1NRP H;  2VGC C;  1NPM A;  1G3B A;  3KQE A;  1DXP A;  2TGD A;  1LVM A;  2O8U A;  2M2A A;  2ZEB A;  1SGF A;  2ZCH P;  5B6O A;  3URD A;  3F9E A;  3PYH A;  2UUJ B;  2WPD D;  3KQC A;  4O03 A;  1SHH B;  1MCV A;  1O5A B;  2ALV A;  1VR1 H;  3RC5 A;  1O3K A;  1XX9 A;  4UD9 H;  3RMM H;  1GI1 A;  1TE0 A;  2PLX A;  3ATK A;  2HVX A;  1EX3 A;  1BMM H;  1AIX H;  3JZ1 B;  1EAT A;  4RT0 A;  2CV3 A;  3KQ5 A;  5FPS A;  1MTU A;  2ILN A;  3MOC A;  1AUT C;  1Y5B T;  3MU0 A;  3A84 A;  1QGF A;  3MH7 A;  3A8A A;  1WBG B;  1NFX A;  6CHA C;  2ZFF H;  4FOU C;  4KGA A;  3LOX A;  3MTY A;  1SGP E;  4F55 A;  4JYV H;  1LHG H;  1KY9 A;  1YPH E;  1ZTK A;  3DT0 H;  1GJ4 H;  1W3C A;  1HBT H;  2ZO3 H;  1LHE H;  1V2N T;  5HIZ A;  1QL8 A;  3Q00 A;  1CSO E;  1DUA A;  4QT8 C;  3OY5 U;  4WJG 2;  7GCH F;  1V2P T;  5GND A;  1LVO A;  1THP B;  2O9Q A;  3RXA A;  1SC8 U;  4DJZ B;  1IHS H;  1V2T T;  2IPH A;  4FUJ A;  3RXH A;  4SGB E;  1GMH G;  2A4G A;  1ZHP A;  1O3E A;  1T31 A;  3O8B A;  1SGD E;  4WY3 A;  2SNV A;  1TBZ H;  2BVR H;  4NA9 H;  1ZMN A;  1AZZ A;  1FDP A;  3ZZD A;  3U1I B;  2GZ7 A;  5TJX A;  3LC3 A;  3RDZ A;  3ZZ5 A;  2Z94 A;  1LMW B;  4OS1 A;  1XUJ A;  2V6N A;  2WZQ A;  2Z3D A;  2FIR H;  2Z9I A;  4INK A;  4FUD A;  2ZGH A;  4E06 H;  1OKX A;  1DWB H;  4YO9 A;  1AD8 H;  3RXG A;  3A80 A;  3W94 A;  4FUB A;  1BRA A;  3BIV H;  2XCN A;  1FN6 A;  1P2Q A;  3WY8 A;  2XNI A;  1GBE A;  2AFQ B;  1FY4 A;  5E8E H;  2ZCL P;  1FMG A;  2J9N A;  4ASU D;  1O2P A;  3B9F H;  1ELV A;  2XC5 A;  3CNR A;  1MCT A;  5LGO A;  2JDI D;  1GPZ A;  2FS8 A;  1ZRK A;  3OU0 A;  1OOK B;  4MDS A;  5BPE A;  3UR9 A;  3KNX A;  1RS0 A;  4A5T S;  3GY4 A;  1O3O A;  3AK5 A;  3RXB A;  2AGG X;  2YMS D;  1LHD H;  2ZQ1 A;  3GY3 A;  1W12 U;  2J95 A;  2PWX A;  7EST E;  1G36 A;  1ZSJ A;  1MD7 A;  2BD5 A;  2GDE H;  4NCY A;  1YKT A;  3VFE A;  3RXK A;  1BQY A;  1ZGI A;  1MU6 B;  3Q3Y A;  5HKK D;  3I78 A;  4Y0Z E;  1CA0 C;  1T32 A;  3MU1 A;  5JBB S;  1MZD A;  2BX4 A;  1SHY A;  2ZGJ A;  4Y8Z A;  2ODP A;  1TGS Z;  1IQN A;  3ATL A;  5DKM A;  1SLU B;  1LQD B;  2FI3 E;  4HI3 A;  5I25 A;  2GKV E;  2VU8 E;  4GCH F;  1C5X B;  2PUQ H;  1ABI H;  3ZVD A;  2G5N A;  4JZE H;  3GCO A;  1VKY A;  2KAI A;  4XSK U;  2F43 B;  1NTP A;  4ZRO A;  2FDA A;  2ALP A;  1EAS A;  1ELC A;  1O3L A;  1UVT H;  1O2O A;  2G00 A;  1GHY H;  2ZPR A;  1KTS B;  1GWA A;  1O2S A;  1LHC H;  1TBR H;  1UMA H;  4IN2 A;  3UIR A;  1CA8 B;  1LDT T;  3RXV A;  2IOT A;  3PV4 A;  4AX9 H;  2ZKS A;  1O34 A;  3OAA D;  2CN0 H;  3LGY A;  4FU9 A;  1OWJ A;  1QJ6 B;  1NY2 2;  2ZDL A;  1GHX H;  2V0B A;  1BJV A;  1J17 T;  3CS0 A;  1A0H B;  5EQQ A;  2VWN A;  5FBI A;  5C5O A;  1XXD A;  3PLP A;  2GX4 A;  2W3K A;  3RLW H;  3SV9 A;  1D4P B;  1FLE E;  1C5W B;  1N8O C;  4X8U H;  2ANW A;  2KAI B;  5ESB A;  2XW9 A;  4UDW H;  1AN1 E;  5TCA A;  1GHA F;  2FTL E;  4YT7 H;  2BD4 A;  2GVF A;  4DII H;  4HG6 A;  3T26 A;  1TRY A;  3K9X B;  4KP0 A;  1YLN A;  4KTC A;  1TIO A;  3UQV A;  5EST E;  1DWD H;  3FFG A;  3A8C A;  3SUG A;  1DXW A;  3M5L A;  3P8G A;  1F5R A;  3KCG H;  2ULL A;  5G4B A;  1C2M A;  1O2Z A;  2CGA A;  4UFD H;  2OQU A;  2AYW A;  3D62 A;  3GYM A;  3LGU A;  3M7T A;  4NIV A;  1NRO H;  5FX6 A;  1CHG A;  2TRM A;  4XBB A;  3R0F A;  3SV8 A;  1L4D A;  2STB E;  2LP6 A;  1C9P A;  2WPJ S;  1O5F H;  4AFZ A;  1FI8 A;  3SU3 A;  3AAU A;  1CE5 A;  3GY7 A;  3M5M A;  2BVS H;  5E2P A;  4NSV A;  2J34 A;  1Z7K A;  4BAM B;  2FYR A;  1WQS A;  1GHZ A;  2OC8 A;  2V3H H;  3GOV B;  1GBJ A;  1O2N A;  4U32 A;  1HAX B;  1MTN C;  3JZ2 B;  1MKX H;  1TMU H;  1W0Z U;  4O97 A;  1AFQ C;  1T7C A;  1DST A;  3FAO A;  3FZZ A;  1FV9 A;  1GDQ A;  1XMN B;  1UTJ A;  1K1J A;  2EI6 A;  2QY0 B;  1ZML A;  4RKJ B;  3KHV A;  1TA6 A;  1C1M A;  3SHA H;  3SNB A;  1UTN A;  2ANK H;  1AU8 A;  3M3S A;  1SGE E;  1A2C H;  2IJO B;  1EZS C;  3RU4 E;  1PQ7 A;  4RT1 A;  1BT7 A;  2VIP A;  1CT2 E;  1NO9 H;  2FYQ A;  5HGG A;  4FUC A;  3OEH D;  1B0F A;  1RTK A;  2BD7 A;  2WV4 A;  1SQT A;  4ZXX H;  1TYN A;  1SOZ A;  4D8N A;  2P93 A;  4H42 U;  2FI5 E;  1TQ0 B;  2RDL A;  3HPT B;  2J4I A;  3RUO A;  1SBW A;  3RXJ A;  4BAH B;  1FQ3 A;  3SQE E;  1YGC H;  2SGF E;  2ODY B;  1GBT A;  2TGT A;  1GI3 A;  3V3M A;  3FP6 E;  1C4V 2;  1WV7 H;  3EDX B;  3BTM E;  2OTV A;  1J9C H;  1C1W H;  4AFU A;  1A0L A;  2B8O H;  8EST E;  1EAI A;  2P3T B;  4FU7 A;  2D1J A;  1LPG B;  2SNW A;  4FU8 A;  5E0G A;  2SGD E;  3AW1 A;  4GUX A;  3K65 B;  2Y82 A;  3QZQ A;  3S9B A;  4IBL H;  1HV7 A;  1SLV B;  1O37 A;  1Y3W A;  2PGQ B;  3UUZ A;  1DM4 B;  1N8O B;  2NU2 E;  2BZ6 H;  5DPA A;  2UWP A;  2BD2 A;  1JIM A;  1O3H A;  1SLW B;  1HJA C;  1BZX E;  1PQ8 A;  2PV9 B;  1TLD A;  1LKB A;  3MO3 A;  1A5G H;  2FOH A;  2R3Y A;  1IQI A;  1E38 B;  1GVK B;  1C4U 2;  3NUM A;  1WSS H;  1AND A;  2VVC A;  2QF0 A;  4Q7Z A;  4GVU A;  1FY1 A;  3UQO A;  1TFX A;  1SOT A;  1ELT A;  1O32 A;  5I46 H;  3P8F A;  2XWB I;  1LQE A;  4FUF A;  3KQD A;  2QAA A;  5DSF A;  1IQK A;  5IYT A;  5KGO A;  1EPT C;  1EZQ A;  2WV9 A;  2GCH G;  4YM9 A;  5JDU B;  3SUD A;  4DT7 B;  3A81 A;  1K2I 1;  1KMH B;  1XKB C;  1GCD A;  1P04 A;  3SNC A;  3MNC A;  1QIX B;  2QXG A;  3PLK A;  1F2S E;  1YYY 1;  4LZ1 H;  1MAX A;  3H5C B;  3GDV A;  4GLY A;  1GBI A;  3SU6 A;  5KED A;  3RP2 A;  4ABI A;  1ORF A;  3P17 H;  1CHO G;  5F53 A;  2YOL A;  1T4V H;  4Y7A A;  4ZKN U;  4I8L A;  3PRO A;  3HKJ B;  1MQ5 A;  1BBR E;  1EJN A;  5EOD A;  4BTT B;  2C8Z B;  1G2M A;  1IQH A;  4X2V A;  2TGA A;  1Z8J B;  1NZQ H;  2F9P A;  2D2D A;  3BN9 A;  2FI4 E;  1QBV H;  2FZZ A;  3DSG A;  2BDG A;  3BIU H;  2WHX A;  1TMT H;  1IQL A;  4X6P A;  3EE7 A;  1YF4 A;  3TJV A;  3F9F A;  3EYD A;  3FVF B;  4Y76 A;  1EJA A;  4MQA A;  1SI5 H;  8GCH F;  2OLG A;  1BBR H;  2OQ5 A;  3U28 C;  3T29 A;  4LOY H;  4ABJ A;  1UTQ A;  1VIT H;  3S7H B;  2ZGB H;  1C2H A;  2ZQ2 A;  4XBD A;  1GVL A;  1GJ8 B;  1HFD A;  4BTI B;  4WXI A;  1S6H A;  4INL A;  5EXM A;  4H6S B;  1BMN H;  1MKW K;  1QY6 A;  1C1R A;  4O3U A;  5T3H A;  3HKI B;  1FAK H;  3SJK A;  5AFZ H;  1E34 B;  4JMY A;  4K1E A;  1BRC E;  6EST A;  3RML H;  4WVP E;  2F91 A;  4D7G A;  5C1Y A;  1EJM A;  1G3E A;  3BTF E;  1NRS H;  4NFE A;  2F9B H;  3ZVC A;  1F0R A;  3BTQ E;  1YLD A;  1BJU A;  1ZJD A;  2ZNK H;  4XFQ A;  2BY5 X;  4ZHA A;  3URC A;  1YWU A;  1HJA B;  4KKD A;  1OWE A;  2EI8 A;  2VJ1 A;  2O8L A;  1K9O E;  3LT3 A;  1VZQ H;  1AFE H;  1QRW A;  1TOM H;  1VJ9 U;  1FIZ A;  3GY5 A;  4BNR A;  4MPV A;  1YPG H;  4XE4 A;  2BTC E;  1E35 B;  5KEC A;  3VB3 A;  4AG2 A;  1WCZ A;  4PRO A;  2YMS B;  2PP6 A;  4M7G A;  3AAV A;  2H1U A;  1UCY K;  1ETS H;  3KQB A;  1A61 H;  4AGJ A;  3H7O A;  2ZGX H;  1EPT B;  1ID5 H;  1SFI A;  4H4F A;  2VWL A;  1EKB B;  4INH A;  1C2E A;  7KME H;  4ZKR U;  1UK4 A;  4ZKO U;  1H8E D;  3ZZ9 A;  2Z9G A;  4AFQ A;  4CRD A;  3MO9 A;  1PPG E;  4Y79 A;  1FY8 E;  1IQE A;  2LPR A;  1F92 A;  2JKH A;  2ZU3 A;  2QE7 D;  3BSQ A;  1TGN A;  1C2D A;  4TPI Z;  1AB9 C;  1DIT H;  1DUE A;  5GCH G;  4D9Q A;  5LPF A;  5TCC A;  1XUG A;  1CGI E;  4Q7X A;  2C3S A;  3UNS A;  4FUE A;  4HZH A;  3SV6 A;  4CBO A;  5C17 A;  2CXV A;  2OC7 A;  2L74 A;  2XBX A;  2FTM A;  2A5K A;  2QYI A;  1C1T A;  4NWL A;  2FOE A;  2SGA A;  5A8X A;  5GWZ A;  3LGT A;  2R2W U;  1TPA E;  1GL0 E;  1OYT H;  3KEE A;  1NM6 A;  3BG8 A;  2BYA X;  1Y5A T;  3QK1 A;  3EA7 A;  2J92 A;  5HYO A;  3PMB B;  2ZP0 H;  4RN6 A;  2F3C E;  1FY3 A;  1ZLR A;  4XDE A;  2Y5F A;  3O8R A;  3SUE A;  1RTF B;  2ZFR H;  1P12 E;  2PTC E;  1BTW A;  3ZV8 A;  1Q2W A;  1TNK A;  4M9F A;  1F0S A;  4Y71 A;  3E3T A;  1C5P A;  3LPR A;  1O3B A;  1ELD E;  3F0P A;  1NRN H;  4LXB H;  4WH8 A;  5FL7 D;  3NXP A;  5T1V A;  3QDZ B;  3RLY H;  1W2K H;  4O9V A;  4OS4 A;  2OK5 A;  1V3X A;  1C4Y 2;  2LEL A;  2H6M A;  3A8B A;  3F9H A;  3ZVF A;  2FM2 A;  5C0T A;  3ENS B;  2RCE A;  2G4U A;  4I8K A;  1LHF H;  2XCF A;  1RJX B;  1ZJK A;  1IQF A;  2Y5H A;  3OSY A;  3ZVA A;  1TRM A;  2Q6D A;  1UTO A;  1DLE A;  2IN2 A;  4Z1M D;  2VIV A;  3UAI C;  1T8L A;  1WTG H;  1GMH F;  4E7R G;  2D8W A;  4X8V H;  4RKO B;  5C20 A;  1ELG A;  3Q3K A;  3SI3 H;  1P3C A;  2XND D;  1N1L A;  3GIS B;  3A86 A;  3PWB A;  2TBS A;  5JB8 S;  1UHB A;  2Z3E A;  3GCT G;  5F8Z A;  1Y3U A;  2ZDM A;  5F8T A;  5AVD A;  1GI0 A;  2XTT B;  1BML A;  1O2X A;  3ZYE A;  2JH6 D;  1RGQ A;  2NU0 E;  4ABF A;  4OS5 A;  1FN8 A;  4Q63 A;  1KLT A;  1P11 E;  1IOE A;  3EE0 B;  1MMJ N;  2W6I D;  5JB9 S;  2Y7Z A;  1CGJ E;  1OWK A;  5L6N H;  2KCY A;  4ISH H;  1BRU P;  4X2Y A;  3T5F H;  1FPH H;  3VGC C;  3TH4 H;  1HRT H;  2FOM B;  1AB9 B;  1UK2 A;  2GZ9 A;  4I31 A;  3SU5 A;  5EIY A;  5LH8 A;  2ZU5 A;  1UHB B;  4K8Y A;  1K1O A;  1GMD F;  4MPX A;  2TIO A;  4I86 A;  3SUF A;  4ZKS U;  1K1N A;  1EOJ A;  1PFX C;  1V2U T;  4LK4 A;  4XOJ A;  5J4S A;  1O35 A;  2AGI X;  1F5L A;  3SBK A;  1PPZ A;  1GJC B;  4Y7B A;  3RC4 A;  5FCR A;  3LC5 A;  1F0T A;  1GL1 A;  2QIQ A;  1MBM A;  1C5Q A;  4DCD A;  5LPR A;  1F0U A;  4TWY A;  1V2V T;  4GPG A;  5EJ1 A;  1DOJ A;  1A3E H;  1WOF A;  1FZZ A;  1LPZ B;  1VIT F;  2H5D A;  2PUX B;  4BAN B;  1QBN A;  5ETX A;  2THF B;  1C1Q A;  2BY9 X;  1VGC B;  3BTK E;  4CR5 A;  1XVO A;  2P59 A;  3F2G A;  2KX4 A;  1E37 B;  4IS5 A;  2NU4 E;  1XKA C;  1QR3 E;  3T2N A;  1AI8 H;  5GDS H;  3QLP H;  1GBK A;  3UB0 A;  1GJ9 B;  1P9S A;  1EST A;  3UNR A;  1NN6 A;  1UVO A;  4K2Y A;  4Q80 A;  3S0N A;  1O2J A;  1YPL H;  5EOK A;  4CRF A;  1IQM A;  1ZPZ A;  2W3I A;  2JET C;  2DE8 A;  4HTC H;  5A2M H;  4BTU B;  1E1R D;  1O3C A;  2A1D B;  1AHT H;  1QL7 A;  4Y0Y E;  2FX4 A;  3FN8 A;  4YOG A;  2RA3 A;  1Y8T A;  3PB1 E;  3F2F A;  1MD8 A;  2FEQ H;  4E7N A;  1KYN A;  1C2L A;  1GI2 A;  1HAV A;  2R9P A;  4I8H A;  5A8Z A;  1TON A;  2P8O C;  1T8O A;  3NK8 A;  3BEU A;  3DD2 H;  3C27 B;  4IW4 E;  3GDU A;  2OBQ A;  4K3J A;  2FWW A;  4X6N A;  3PM3 A;  1WDI A;  1HXE H;  4FUI A;  2KR7 A;  3E8L A;  1DWC H;  4BXS A;  2RG3 A;  2HNT C;  4JYU H;  3RXT A;  2GGV B;  1H9H E;  1ZPC A;  3TGI E;  3UNQ A;  2HAL A;  3S69 A;  1AWH B;  2KCA A;  1GI8 B;  1QB1 A;  2QXH A;  2YNB A;  1AE8 H;  2FPZ A;  4NG9 H;  1AE5 A;  2EEK A;  4YOJ A;  2CF9 H;  4KTS A;  1CT4 E;  3A83 A;  3VGC B;  1HAV B;  2FXR A;  3SNE A;  3AVZ A;  4ACB A;  1KXA A;  5CDF E;  1AVG H;  2FOD A;  2GJG A;  2RFK C;  1O2W A;  4K8B A;  3RM0 H;  3K2U A;  1W7X H;  2R0L A;  2PKS B;  2BHG A;  2C8Y B;  2Z9K A;  3F1S B;  4MG3 A;  1MUE B;  3QGN B;  2QC2 A;  3PWC A;  4ZHM U;  3A89 A;  2Z9L A;  1C5T A;  3RXS A;  4NZQ A;  2BMG B;  3A7W A;  3L33 A;  3HGP A;  2FP7 B;  4D7F A;  4P02 A;  3E91 A;  4MLF B;  3OX7 U;  3VG8 A;  3D65 E;  1QHR B;  5EXL A;  1BOQ A;  4IC6 A;  4BAK B;  4NIW A;  5GJ4 B;  3ZVE A;  2A5A A;  2ZTZ A;  4YTA A;  2BB4 A;  1ZHM A;  2FLB H;  2WPI S;  1Z6J H;  2AIP A;  1O2Q A;  1KSN A;  2AER H;  2STA E;  1P06 A;  1O31 A;  4VGC C;  3KYG A;  3M36 A;  5EPY A;  4Y11 E;  2BD8 A;  1QQU A;  2V7Q D;  2BQW B;  2B5T B;  2KCO A;  1ZHR A;  4TT3 D;  3H7T A;  1C1V H;  1XM1 A;  2TPI Z;  3VPK A;  1BDA A;  2SGE E;  3KID U;  1P2K A;  3PO1 B;  5EQR A;  1Y3X A;  2A45 B;  1EAX A;  2WUC A;  2YNA A;  1KXE A;  3LIW A;  3SN8 A;  5JBT A;  3MU8 A;  1L1J A;  1SR5 C;  4I7Y H;  1W11 U;  2JET B;  1PPE E;  4GCH G;  3B8J A;  4P00 A;  1ZRB A;  1NFU A;  1L2E A;  2JH0 D;  1P2N A;  7LPR A;  2ZA5 A;  2OBO A;  1RD3 B;  4ISN A;  3D23 A;  3Q77 A;  1D3T B;  1AO5 A;  1EP6 A;  2XXL A;  3OYP A;  1TAW A;  3P70 B;  3A7X A;  2M5T A;  3PMJ A;  2XRC A;  1HB0 B;  2ZTY A;  4RSP A;  2CMY A;  3RXC A;  1L0Z A;  2P8O B;  1JBU H;  3AAS A;  3ODD A;  1ZMJ A;  3ZZ6 A;  1O5G H;  1P3E A;  3BTH E;  2A31 A;  1SGR E;  2BDA A;  3DFL A;  4JZD H;  1W0Y H;  5EPN A;  1DE7 H;  3FP8 E;  4A92 A;  2BVX H;  2VNT A;  5C1U A;  2VH0 A;  3LH3 A;  4B2A A;  3D49 H;  3F9G A;  1CU1 A;  2IJD 1;  1MQ6 A;  1XVM A;  1GHA G;  1HJ8 A;  2XC4 A;  1YPJ H;  1C5Y B;  2HLC A;  2ZI2 H;  2V3O H;  8LPR A;  1MTS A;  4IGD A;  1DDJ A;  4A7I B;  3MO6 A;  2A4O A;  1PPB H;  2ZFT A;  4X1P U;  3IWM A;  4AC9 A;  4ZHL U;  1DS2 E;  4R8T B;  1J8A A;  3KL6 A;  3RXE A;  2ZCK P;  2OC0 A;  3RC6 A;  1ELE E;  2C4F H;  1O5C B;  2J5U A;  2NWN A;  1OP2 A;  4AB9 A;  1QB6 A;  2J38 A;  3BG4 B;  2HNT E;  3GY8 A;  4J1Y A;  4NSY A;  1BHX B;  1O3I A;  2F4L A;  2GCH F;  3TVJ B;  1MU8 B;  1W0J D;  1JMO H;  1XUK A;  3HK3 B;  1O2G H;  1IHT H;  4TSF D;  3CS7 A;  1O2V A;  5L2Y H;  5JYI A;  3DUX H;  2DUC A;  2H9T H;  1S85 A;  3SJO A;  1Y59 T;  2BQ7 B;  2K8I A;  3U1J B;  4IN1 A;  3RXQ A;  3IIT A;  1IQG A;  2J98 A;  3RXP A;  1EXF A;  1HJ9 A;  1RXP A;  2FO9 A;  5AF9 H;  1TWX B;  3A7V A;  1PJP A;  6GCH F;  3OEE D;  3LGW A;  1GJ5 H;  1BTH H;  1CHO F;  2GV6 A;  4ACA A;  1EAU A;  3TH3 H;  3V13 A;  3F2H A;  5B6L A;  3T62 A;  2O8W A;  2BOK A;  3OTJ E;  2XOK D;  3ZZ3 A;  4VGC B;  2GTB A;  5CE1 A;  1P10 A;  3ZZB A;  3PMH B;  9LPR A;  5GPI B;  4AYV B;  5EJL A;  1HPG A;  2OC1 A;  1GMC G;  5F8X A;  3SJ8 A;  2YMS C;  3S9C A;  1A1R A;  5EXN A;  5C94 A;  4UFE H;  4B75 A;  1S81 A;  4FXG H;  1TAL A;  4XRN A;  4B71 A;  4ISI H;  4Y10 E;  5GIB A;  2WV5 A;  4WWY A;  1GBM A;  1Z8I B;  3CP7 A;  1TGB A;  3KYF A;  1BIT A;  1ACB E;  1V2K T;  1G30 B;  1FJS A;  3ZIA D;  3SGA E;  2J98 B;  1NT1 A;  1DX5 M;  2VWO A;  1WXR A;  2GT8 A;  1C1U H;  1TB6 H;  1Z8G A;  1OS8 A;  3U9A H;  2RA0 A;  2ODQ A;  1SB1 H;  2P95 A;  5JPM H;  3E90 B;  1DLK B;  1MTW A;  1OHH D;  4BAO B;  5LPE A;  4U01 A;  1EQ9 A;  1INC A;  3NKK A;  3UWJ H;  2HGT H;  2V35 A;  2D26 C;  1W14 U;  2AEI H;  3TNT A;  1C1P A;  5DGJ A;  4Z0K A;  4FVD A;  5A0C A;  1YCP K;  2Z6B D;  3B23 B;  1SPJ A;  2VB0 A;  3N7E A;  1HLT H;  3PTN A;  3QTO H;  2CJI A;  2OXS A;  1WUN H;  1OSS A;  3SOS A;  1BUI A;  1P2I A;  3VXE H;  3ZZA A;  1TGT A;  4DUR A;  3LJJ A;  1E79 D;  1O0D H;  3EST A;  2ZGC A;  1S84 A;  2EI7 A;  4YOI A;  3T27 A;  1P09 A;  1DY9 A;  4BOH A;  1Z71 A;  2A4Q A;  5DP4 A;  2SFA A;  5FPT A;  1BCU H;  3ZZ4 A;  2GV7 A;  1RTL A;  1B5G H;  1V2W T;  4NGA H;  4WF8 A;  2RDE A;  4ZXY H;  3E6P H;  1V6D A;  1C5N H;  4X6O A;  1QA0 A;  3EA9 A;  4H6T A;  1L1N A;  1C5U A;  2H2Z A;  3I77 A;  3ZZC A;  1H8D H;  1ANC A;  2ZG0 H;  4CRA A;  4A1X A;  5ABW A;  2XWA A;  1DT2 A;  1SKY E;  4FUH A;  4B74 A;  1D6W A;  3U8R H;  1PQA A;  5A0A E;  3SOR A;  4EST E;  2ZHD A;  5EJZ A;  3SU2 A;  1AZ8 A;  2ASU B;  3DFJ A;  1K0H A;  1DPO A;  5HM9 A;  5H4I B;  1HAG E;  3V0X A;  1W7G H;  3SHC H;  3ZZ8 A;  1XUI A;  3TK6 A;  4B1T A;  1O30 A;  2G52 A;  2ZDV H;  3U98 H;  2QGR A;  5DP9 A;  1GHB F;  3WWB A;  2EST E;  2WPK S;  3ODF A;  3LJO A;  1BTX A;  1FXY A;  5GCH F;  3EAJ A;  3VEQ B;  1LO6 A;  1A7S A;  4IMZ A;  4HFP B;  1L4Z A;  4DG4 A;  1EAW A;  3FZD A;  3SZN A;  1H4W A;  1QRX A;  3M3T A;  1QQ4 A;  4X8T H;  5HMA A;  2BXU H;  4A6L A;  3ELA H;  3QX5 H;  2EY4 C;  4CHA B;  1BTU A;  1VCW A;  1D3Q B;  2PSY A;  1HNE E;  1BTZ A;  4AZ2 B;  3QUM P;  3MHW U;  4K69 A;  1NS3 A;  2O8M A;  1SGN E;  1L1G A;  2GDD A;  1TX8 A;  4B73 A;  1NBM D;  1EB2 A;  1J16 A;  3RU4 T;  3FAN A;  3QGJ A;  5EU8 A;  5EW2 H;  4AG1 A;  9EST A;  2P3U B;  4KTU A;  3OY6 U;  1UK3 A;  1OP8 A;  3A88 A;  1MH0 A;  1O5E H;  1LTO A;  1O2M A;  1GJ6 A;  4TY6 A;  5BRR E;  1GBB A;  2BY8 X;  4DGJ A;  4Y8Y A;  5FX5 A;  1NC6 A;  1V2O T;  1GI5 A;  3PLB A;  3SND A;  3F68 H;  3N7D A;  1NES E;  4XBC A;  2CK3 D;  1BIO A;  1D3P B;  2FOG A;  3ATW A;  3NCL A;  3RU4 D;  1IAU A;  2PW8 H;  2P94 A;  1O3M A;  1JRT A;  4UFF H;  3MH4 A;  1CT0 E;  2PKA A;  2AMQ A;  2ZFS A;  1O3D A;  4UEH H;  3A85 A;  1H1B A;  2ZHQ H;  3STI A;  2VIN A;  5DP7 A;  1GGD B;  1P2O A;  1OX1 A;  1K1M A;  3URE A;  1YCP H;  1HXF H;  1S6L A;  3STJ A;  4ZUH A;  2FOF A;  2A4R A;  2VID A;  2ZEC A;  1HCG A;  1VGC C;  1WQV H;  4WH6 A;  1TPO A;  3GCT F;  1UO6 A;  1PYT D;  2ZU2 A;  3OFN D;  1GG6 B;  1HDT H;  1M9U A;  2I6Q A;  5C2Z A;  4HGC A;  1COW D;  2JH5 D;  1C1S A;  4ABG A;  1DVA H;  1A4W H;  2A2Q H;  4ABD A;  1A46 H;  1GJB B;  5K7R A;  3QO6 A;  1HAY B;  2PKA B;  4FUG A;  2ZC9 H;  3EGK H;  1O3N A;  3Q76 A;  2GCT B;  2JIZ D;  4IMQ A;  5C67 A;  4MNW A;  1B0E A;  2HNT F;  2PTN A;  1BTP A;  3F3B A;  2A0Q B;  3PV5 A;  1SGQ E;  1AY6 H;  2WPM S;  3G01 A;  2P3F H;  5A09 A;  3RXM A;  3L3T A;  1MKW H;  3OTP A;  1C2J A;  3SGB E;  1U6Q A;  3MU5 A;  1C1O A;  4JYT A;  3NWU A;  1UW7 A;  4MVN A;  1UCY E;  1AGJ A;  1SLX B;  1UVU H;  2C93 B;  1BHX F;  1CBW B;  2HOB A;  1RRK A;  2ZFP H;  1F5K U;  3M3V A;  1UTK A;  5EG4 A;  1SQA A;  3GS9 A;  1TNG A;  2G55 A;  1SG8 B;  4X1N U;  1GCT B;  4A1T A;  4ABE A;  4THN H;  1GVZ A;  2IPQ X;  4ZAE A;  2ZIQ H;  1T8N A;  1P2J A;  4J2Y B;  3VB4 A;  5SGA E;  5DP8 A;  3SGQ E;  1AVW A;  1EZU C;  5HM2 A;  1C2F A;  2R3U A;  3RXD A;  3W1E A;  1VJA U;  2EQN A;  2K0Q A;  1TNL A;  1SVP A;  1UCY H;  2Z9J A;  2WYG A;  2BDY A;  2K1Q A;  1O2I A;  1PPH E;  2PR3 A;  4DY7 B;  2W26 A;  3LON A;  2UWL A;  1BA8 B;  1N6Y A;  4JZI A;  4CRE A;  2BD3 A;  1GBH A;  1G2L A;  2QF5 A;  1WAY B;  2PKS C;  5EW1 H;  1EZX C;  5T6F A;  4X2W A;  4X1S U;  3NPS A;  4X8S H;  4AB8 A;  5FCK A;  3TIT A;  2UUY A;  4JK6 A;  1O2H A;  3M37 A;  2Z3C A;  3MFJ A;  1DWE H;  3K6Y A;  2VIO A;  1ETR H;  1B7X B;  5C1X A;  2CHA C;  1MZA A;  2OCV B;  1QB9 A;  1MBQ A;  1DAN H;  3HAT H;  3QZR A;  1P2M A;  1KLI H;  3QWC H;  4K1T A;  1ARB A;  2KM0 A;  1WTH D;  1Z6E A;  3O8D A;  3RXR A;  2ANY A;  3GY2 A;  5E0H A;  2JJ1 D;  3A7Z A;  3ZYD A;  5C3N A;  1K1P A;  1QZ8 A;  1S0R A;  1QUR H;  3U8T H;  1FX0 B;  4DVA U;  4CBN A;  5DG6 A;  2ZWL H;  2DE9 A;  4ABA A;  3U69 H;  1TOC B;  3BEI B;  4YT6 H;  5DO4 H;  2H5C A;  4B2C A;  1MAY A;  2A5I A;  1TX7 A;  3M61 U;  1X7A C;  1Q3X A;  3KF2 A;  2BD9 A;  1CGH A;  2G8T A;  1V2S T;  3UOU A;  3UY9 A;  5A0B A;  2EC9 H;  1Q31 A;  2XC0 A;  5CHA B;  2FOC A;  2ZDA H;  3SNA A;  1T4U H;  3PO1 C;  1O2U A;  1QJ7 B;  3TLO A;  1P9U A;  1UVP A;  1Z1I A;  1P0S H;  5DP3 A;  1ZTL A;  4U30 A;  3O8C A;  4RI0 A;  1G3C A;  1KLJ H;  2BDI A;  2BLV A;  2FES H;  3DCL A;  4YLQ H;  3MNX A;  5DN6 D;  1C5V A;  4MNY A;  1C5M D;  3Q3X A;  1JWT A;  1GBA A;  7GCH G;  4Q4L A;  1YCP M;  2Q1J A;  1YPE H;  1GMD G;  1JXP A;  1C5L H;  3PTB A;  1HAH H;  1MKX K;  2VGC B;  1KXC A;  2A32 A;  4OS7 A;  1Y3V A;  4NWK A;  4K5Z A;  2GT7 A;  1ELF A;  1W8B H;  1HAZ B;  1EP5 A;  1G32 B;  1GHW H;  3ITI A;  3KGP A;  2W7S A;  1GI7 B;  3ZVB A;  5L2Z H;  1TGC A;  4XD7 D;  3BTW E;  1VIT G;  1DIC A;  1BMA A;  3TGK E;  4KEL A;  2G81 E;  3EQ0 H;  2Z7F E;  1QBO A;  3NZI A;  1THR H;  1QCP A;  4A1V A;  1KTT B;  1OXG A;  3CEN A;  5AHG H;  1NFY A;  2W6J D;  3ZVG A;  5AFY H;  4TPY A;  3S9A A;  2ZDK A;  4OS6 A;  3L6P A;  5EQS A;  5IDK A;  3GDS A;  2SGQ E;  4E05 H;  4MNX A;  5A8Y A;  6CHA B;  4GSO A;  4U2W A;  3N99 A;  2BOH B;  4NA8 A;  1Y3Y A;  3BG4 C;  2BZA A;  5DK1 A;  4I8G A;  2FLR H;  2ZU4 A;  1PYT C;  2BQ6 B;  3TJU A;  1YC0 A;  3MH5 A;  4MNV A;  1HUT H;  1CVW H;  3TK5 A;  4D9R A;  1OP0 A;  1HGT H;  1KXF A;  1O3F A;  1OWI A;  2CHA B;  3ATI A;  5GXP A;  1XUH A;  2NU1 E;  4AOQ A;  1O36 A;  2F83 A;  1OYQ A;  1KIG H;  1SGC A;  4F4O C;  3FOA A;  3GCN A;  1ABJ H;  3IG6 B;  1UJ1 A;  4NZL A;  1Z8R A;  2BY7 X;  2OD3 B;  2GD4 B;  2JJ2 D;  3SU1 A;  2HPP H;  3C1K A;  1D3D B;  2ZTX A;  1SL3 A;  2Q6G A;  4JZF H;  3UR6 A;  3GY6 A;  3SO3 A;  4K60 A;  3MNS A;  1ZZZ A;  4CH8 B;  2B0F A;  2WIN I;  3P6Z B;  1P02 A;  4CR9 A;  1TX6 A;  3A8D A;  3S7K B;  1O3P B;  2P16 A;  2W5E A;  1MAB B;  4NIY A;  2BY6 X;  3EA8 A;  5HXF A;  2FOA A;  4AN7 A;  4LZ4 B;  1LVY A;  1SQO A;  1G37 A;  5FXL A;  1YPK H;  3VXF H;  3M7Q A;  1P01 A;  2A7J A;  1C5O H;  1LVB A;  4ABB A;  2BX3 A;  1TBQ H;  3LU9 B;  4Q7Y A;  4UON A;  2H9E H;  3LGV A;  3RMN H;  3SZE A;  1O38 A;  3VB6 A;  1W0K D;  1GJD B;  5FPY A;  2L6O A;  4ZMA H;  1GDU A;  1WYK A;  4YZU A;  1TNH A;  1WU1 A;  1GBC A;  1ZSL A;  1K21 H;  2OP9 A;  2AH4 X;  2PGB B;  3MU4 A;  3VB5 A;  3MQK C;  5CHB A;  2VH6 A;  1NFW A;  1E36 B;  1BB0 B;  4ASH A;  1QJ1 B;  4I32 A;  1KXD A;  5F03 A;  1A5I A;  1DSU A;  1EFR D;  1PPF E;  2BXT H;  3TGJ E;  1TA2 A;  1G9I E;  3RXU A;  1LKA A;  2B9L A;  1O2L A;  1FY5 A;  1NBM E;  3MYW A;  5DP6 A;  2R2M B;  1HAO H;  5JBA S;  2FOB A;  5L30 H;  4O3T A;  1K1L A;  1K22 H;  4CRG A;  2VVU A;  3SQH E;  1QRZ A;  3GCH C;  4ISL A;  1O39 A;  2AIQ A;  1N6X A;  1C1N A;  4BXW A;  1S82 A;  1BRB E;  1GMC F;  2PFE A;  1CA0 B;  4FVB A;  1FPC H;  1AKS A;  1BBR K;  2GMT C;  5FAH A;  3OE7 D;  4ISO A;  1A0J A;  1C5Z B;  4I8J A;  1DFP A;  2I6S A;  3SI4 H;  2G4T A;  1ZPB A;  2OUA A;  2WPH S;  2ZF0 H;  2VBC A;  4F48 B;  4NA7 A;  2A7C A;  1ZR0 A;  2AHM E;  5IK2 D;  1AVX A;  2Q6F A;  3K6Z A;  5J4Q A;  1C5S A;  1W10 U;  2ZDN A;  3ZV9 A;  4X1Q U;  3SU0 A;  1E1Q D;  4Q2K A;  3MI4 A;  3UFA A;  4YES B;  2HRV A;  2ZHW H;  2BLQ A;  3TJN A;  1S0Q A;  3UTU H;  3LH1 A;  1K28 D;  2AS9 A;  2F9U A;  1GBL A;  4JZ1 A;  1O33 A;  2ANM H;  4JCN A;  3SU4 A;  2KZ4 A;  1OPH B;  1YP9 A;  4ZCN A;  5T6D A;  5PTP A;  1NU9 A;  1AKS B;  4X0W U;  1EUF A;  3RXI A;  3SW2 B;  3H09 A;  2G5V A;  4Y8X A;  3SYJ A;  2WPL S;  2VVV A;  3GYL B;  1V2R T;  1NRR H;  4ZH8 A;  1SGT A;  1CQQ A;  2F9O A;  2J2U A;  4CHA C;  2AGE X;  1TMB H;  1F7Z A;  2ZHF H;  3FP7 E;  1ETT H;  4X6M A;  1J15 A;  2ZU1 A;  3M5N A;  3UPE A;  2QF3 A;  2TGP Z;  2GP9 B;  2HVY B;  3BF6 H;  3R3G B;  4K1S A;  4CH2 B;  1ANE A;  1S6F A;  2UWO A;  3SV7 A;  3DA9 B;  4X1R U;  3TK9 A;  1A3B H;  1O5B B;  2J97 A;  1T8M A;  3LKW A;  2C90 B;  1GI6 A;  1O2Y A;  3KN2 A;  2LNC A;  1C2K A;  1ZOM A;  2A7H A;  3RXO A;  1TPS A;  1QFK H;  1ESB A;  1V2Q T;  1AQ7 A;  3PMA B;  1A5H A;  2XBY A;  1HYL A;  4CRC A;  1SQR A;  1YBW A;  1ARC A;  3A82 A;  3BTD E;  3NRL A;  3V12 A;  1O2T A;  3FO8 D;  5EGM A;  5F6M A;  1GI4 A;  2BDB A;  2QF4 A;  3MWI U;  1YLC A;  3RMO H;  6LPR A;  3SJ9 A;  1TQ7 B;  3F0O A;  2PHB A;  4X2X A;  1AUJ A;  1JRS A;  1D6R A;  2C8X B;  2ZFQ H;  5E0J A;  2R0K A;  2UUK B;  4OGY A;  3M35 A;  2FS9 A;  6GCH G;  4I33 A;  5DJ7 A;  1H9L B;  1O2R A;  1OWH A;  1SGF G;  2Y80 A;  1TRN A;  1GGD C;  1GI9 B;  1MTN B;  1AFQ B;  2Y81 A;  3E1X B;  4MTB A;  1QNJ A;  3A7Y A;  3BEF B;  1ELB A;  3BTG E;  3GCH B;  1VCP A;  1ZGV A;  2PSX A;  1GBF A;  2ZZU H;  2F9N A;  2FMJ A;  4DOQ A;  1HAI H;  4B6E A;  1SFQ B;  2GMT B;  3RXF A;  1UVS H;  1YPM H;  4WMD A;  4ABH A;  1IQJ A;  3TIU A;  1GG6 C;  4NFF A;  4DT4 A;  3V7T A;  2QN5 T;  4MPW A;  1P8V C;  5T6G A;  3A7T A;  3BV9 B;  4WME A;  4DIH H;  2XYA A;  1E0F D;  2CF8 H;  3DSO A;  3MNB A;  3VB7 A;  3SV2 H;  3HK6 B;  1C5R A;  3N7O A;  4SGA E;  3WWF A;  1O5D H;  4JK5 A;  2BDC A;  8KME 2;  2G51 A;  3T28 A;  1J14 A;  2GCT C;  1Z1J A;  1TNJ A;  4OGX A;  3M5O A;  4AOR A;  1RIW C;  2QXI A;  2QV1 A;  4GHT A;  5JBC S;  2Y7X A;  5C0U A;  1YY3 A;  4AFS A;  2HLD D;  1CO7 E;  2W7U A;  1HIA A;  2EA3 A;  1C2I A;  3F6U H;  1YM0 A;  1EPT A;  2Y6T A;  4AGK A;  2HPQ H;  5FHT A;  1UTP A;  3P8N A;  5E2O A;  2AMP A;  3E16 B;  2O8T A;  1BMF D;  1CBW C;  2GZ8 A;  2H9H A;  2V3M A;  3PRB A;  3QTV H;  4NIX A;  2UUF B;  1MTV A;  1PQ5 A;  2Y5G A;  4D76 A;  5HIY A;  2WYJ A;  1THS H;  3P95 A;  1SGY E;  1O3J A;  1V2M T;  1SSX A;  1V2L T;  4OM9 A;  4TWW A;  5CMX H;  1GCT C;  3TU7 H;  1LPK B;  3UWI A;  1GJA B;  3PV2 A;  1YPH C;  1H8H D;  1EOL A;  4R0I A;  2WSS D;  1W13 U;  4WMF A;  1RFN A;  3DHK H;  3E0N B;  3E0P B;  1JIR A;  8GCH G;  1D9I A;  4IC5 A;  1S83 A;  1TNI A;  1HIA B;  1NU7 B;  1QA7 A;  1SMF E;  2NU3 E;  2C8W B;  1K1I A;  1GDN A;  4B76 A;  4DW2 U;  3P8O A;  4Y6D A;  3BTT E;  3TPI Z;  1FAX A;  1QTF A;  1FIW A;  2VWM A;  1P05 A;  2ZPS A;  3ZZ7 A;  1ANB A;  3WW7 A;  2BM2 A;  1ZYO A;  4AYY B;  3HGN A;  1H8I H;  3UOP A;  1ELA A;  1PPC E;  3MH6 A;  2QCY A;  4UE7 H;  1KDQ A;  2FX6 A;  1O2K A;  3W95 A;  1GHB G;  1VCQ A;  1QL9 A;  1ZTJ A;  1UTL M;  3LDX H;  1DY8 A;  2A2X H;  3PRD A;  3LGI A;  1OWD A;  3I29 A;  4B6F A;  4Z6A H;  3A87 A;  4WXV A;  2XBV A;  1O3G A;  2QA9 E;  3T25 A;  2HWL B;  1XUF A;  3TNS A;  1GBD A;  4B2B A;  2VIW A;  3MMG A;  1O3A A;  2BLW A;  5C5N A;  1EB1 H;  1GHV H;  2ZPQ A;  4YXW D;  1P57 B;  2B7D H;  1FON A;  4CRB A;  1BTY A;  1TPP A;  2BLO A;  1GJ7 B;  2BDH A;  4TY7 A;  1AWF H;  1FNI A;  1Y5U T;  2KFW A;  1ESA A;  4GHQ A;  5DP5 A;  2QXJ A;  2KCP A;  1KDQ B;  4F49 A;  3SJI A;  3RXL A;  2ZHE H;  1HAP H;  3U8O H;  1JOU B;  2F9V A;  1G3D A;  4UFG H;  1SGI B;  4FET A;  5CHA C;  2WUB A;  2J94 A;  3BTE E;  4MPU A;  3P92 A;  1V2J T;  1TAB E;  1C9T A;  1KXB A;  3ATM A;  1UTM A;  1NRQ H;  4TYD A;  1XXF A;  1RIW B;  4OS2 A;  3AW0 A;  3RM2 H;  5K0H A;  3FKS D;  1H9I E;  5FBE A;  2AMD A;  2OIN A;  2XBW A;  3GIC B;  4BAQ B;  1S5S A;  3TJO A;  2SGP E;  3DSP A;  4YLU A;  1P03 A; 
#chains in the Genus database with same CATH homology
 5EJL A;  1YWU A;  4RT0 A;  2L74 A;  3DSG A;  4HG6 A;  5KED A;  4P00 A;  4XRN A;  5EJ1 A;  5EJZ A;  1YLN A;  3KYG A;  3KYF A;  5KGO A;  5EIY A;  3CNR A;  5KEC A;  4F48 B;  4P02 A;  4I86 A;  2RDE A;  4FOU C;  4RT1 A;  2GJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...