4F48B

The x-ray structural of fimxeal-c-di-gmp-pilz complexes from xanthomonas campestris
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
97
Chain Sequence
QGILSLALKDKAALYSAYMPFVKSGGIFVPTPKRYMLGDEVFLLLTLPDSSERLPVAGKVVWTTPAGANRAAGIGVQFPDGPEGEAVRNKIETLLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Putative uncharacterized protein
publication title Structural polymorphism of c-di-GMP bound to an EAL domain and in complex with a type II PilZ-domain protein
doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 21
structure length 97
sequence length 99
ec nomenclature
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07238 PilZ PilZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 4f48B00
4P02A 3CNRA 5EJLA 4RT1A 5EJ1A 3KYGA 4HG6A 3DSGA 4XRNA 4P00A 5EIYA 5KECA 3KYFA 2RDEA 4F48B 4FOUC 5EJZA 1YLNA 5KEDA 4I86A 2L74A 1YWUA 5KGOA 4RT0A 2GJGA
chains in the Genus database with same CATH superfamily
1BMAA 2FX4A 6CHAB 1MQ6A 2K1QA 5I46H 3M3VA 4XBDA 1O2LA 3MO6A 5T6DA 4CHAC 4Y7BA 1CSOE 1UMAH 1UVTH 1SOZA 1Q31A 3H7OA 4I8LA 1QA0A 3KQDA 1S5SA 1IQJA 2OQ5A 4OS1A 2AGIX 2R3UA 1LPKB 3F9HA 1O3CA 2AEIH 2HPPH 3O8RA 1O0DH 4JK6A 5IK2D 4ISNA 1J8AA 2QCYA 3SI4H 5DSFA 1DDJA 2ODPA 3K6ZA 1EJNA 2XOKD 2FOMB 4JZDH 1TONA 2PSYA 6CHAC 3ATKA 1F0TA 3AW0A 3PM3A 1UK3A 3BV9B 4TYDA 1FDPA 1V2WT 3UY9A 3QZQA 4K1TA 1EQ9A 1SGTA 2KCOA 4NCYA 1ZOMA 2CV3A 4K8BA 3SGAE 1WXRA 4I86A 1EJAA 5TCCA 2F91A 2WPDD 2AGEX 1OHHD 3SJKA 1A0HB 3TK9A 2PR3A 3KHVA 4MPXA 1GJCB 5F8XA 1W8BH 1ESTA 1QURH 4Y79A 2FDAA 1O2ZA 4QT8C 1YF4A 1UCYE 3ZZ7A 5C3NA 3ZZCA 2F9BH 3KCGH 1P01A 2VIWA 2PWXA 4FUJA 4XFQA 1BMNH 1G2MA 5FX6A 1V2KT 2YMSD 4YM9A 3MQKC 1TB6H 1WQVH 3RXSA 2H9HA 1XXFA 3A8BA 1XXDA 2G55A 3T27A 4YOJA 3A7XA 4ABAA 3MO3A 5HKKD 3MWIU 3UQOA 1TNLA 1P2QA 3GCTG 4CRFA 3C27B 4ZHMU 2PTCE 2AFQB 4AB9A 3NKKA 3ZZ8A 1C4Y2 1TA2A 4RSPA 1FIWA 5EW1H 3DUXH 3SNEA 5FCRA 2WZQA 4DT7B 1SVPA 1ZRKA 3PV4A 3BTQE 2STAE 4K5ZA 1THPB 3SUDA 1SGFA 1C1MA 5F8TA 2Q6GA 2QA9E 1DXPA 3F3BA 1NN6A 1O35A 1E35B 3BF6H 5T3HA 3A7ZA 3GY2A 1WUNH 1V2RT 5A8ZA 3M5OA 1T8MA 1AB9B 3QDZB 3TH3H 2TBSA 1ABIH 3MTYA 1BITA 1UVUH 2BY9X 5A0BA 1GHAG 1L1GA 2XYAA 1KLJH 4AYYB 3RM0H 2ZHWH 1AWFH 4I33A 1DLEA 3P8FA 2OQUA 2XWBI 4Y8ZA 4I32A 4A7IB 3F6UH 4X1QU 1CHOF 2ZU4A 1P57B 4P02A 1N8OB 3PMAB 2GX4A 3P8OA 4AC9A 1CVWH 3Q3YA 4YXWD 1FN8A 3ZZ5A 3SHCH 4Y7AA 1AB9C 1GI9B 2W5EA 2A5AA 1HAPH 1YCPK 2VINA 5JBTA 1TPAE 3L33A 1TLDA 1O3HA 3BTFE 5E0GA 1C1TA 1LHFH 3EQ0H 2ZDMA 1V2JT 1W14U 2GZ7A 1Y3UA 2XBXA 1BTZA 5A0CA 3SQHE 1BBRE 1O2JA 1HFDA 1FY4A 1FY8E 8KME2 3MYWA 1V2NT 2QXJA 3SUFA 4JYVH 4A1VA 3VB3A 1F2SE 1N8OC 3CP7A 2KCYA 1AQ7A 1K1IA 3SV6A 1C2FA 2H1UA 3QTOH 4Y0YE 2G5VA 1GBLA 1HAIH 2G5NA 4DURA 1SG8B 4NWLA 3DSPA 1SHHB 2IPHA 4I8GA 3RC4A 2OK5A 1GMCG 1BTPA 2VNTA 3C1KA 1ELGA 4RN6A 1XUIA 2Y81A 1E37B 3RM2H 2UWPA 1WSSH 4SGBE 1TWXB 2ZG0H 1FUJA 3GDUA 5A2MH 2V0BA 2R3YA 1AZ8A 5FL7D 4YT7H 5GCHG 3AW1A 4ISOA 3E0NB 1O3BA 4HG6A 3P6ZB 3RMOH 3SI3H 2ZC9H 1RTKA 1BMMH 3FZZA 5HIZA 3UWJH 2KCAA 5DGJA 2FI5E 2D1JA 2ZPSA 1VCPA 4MPWA 5KEDA 1ANCA 3QN7A 1TA6A 1EP6A 1EAIA 1FXYA 4Q7XA 4LXBH 2BQWB 4FUCA 1AN1E 1IAUA 3TGJE 1P2NA 1DUAA 1UVPA 3DFLA 3TNSA 5EGMA 4E7RG 3URDA 2CK3D 5CE1A 1W12U 3BEUA 1TGTA 2W7UA 1HIAA 1MABB 2F43B 2IOTA 1RD3B 3KQCA 2FTMA 1L0ZA 3VB5A 1GBDA 1H8DH 1GMHF 4Y11E 3BN9A 4CREA 1GI7B 3URCA 1LVOA 1SLUB 1GJAB 1NFXA 2HALA 5C2ZA 3M7UA 4B1TA 2AS9A 5DPAA 1QZ8A 2V6NA 5E2OA 3RXAA 1GG6B 2K0QA 1DY9A 2G00A 3A82A 2XCFA 3GY3A 2PKAB 1GI1A 2ZU5A 1P2IA 5EU8A 2W6ID 1NTPA 1C5MD 1QB1A 3HKJB 4OS6A 1QHRB 4AFQA 1HAOH 5C20A 1EAWA 1VKYA 1HAHH 3MNCA 2XBWA 1D3TB 2BDGA 2O8UA 1QRZA 1XUKA 2SGDE 3K9XB 4INLA 4CRGA 5HM9A 2ZFRH 2BVRH 4BXWA 3SO3A 4OGXA 2BDIA 1DWEH 2GVFA 5L30H 1LHCH 3T25A 1GG6C 1Y3YA 3GICB 4B73A 1DE7H 1D9IA 1C9TA 1YCPM 1UK4A 1T31A 2EI7A 1S83A 1E34B 1SGPE 1D3QB 2JETB 2J38A 4UDWH 3JZ2B 3W94A 5L2ZH 2ZECA 1U6QA 4O3UA 1F0UA 1TRMA 1TOCB 5LH8A 2BHGA 1NPMA 1O33A 1GL1A 4B6FA 1TBRH 4Q4LA 1A0LA 5EOKA 1SFQB 2EC9H 3SN8A 1NU7B 1Z8JB 1P2OA 1NBME 4M7GA 4O97A 1NRSH 3K2UA 1OSSA 3QLPH 2OXSA 3FFGA 1XUGA 1FNIA 3RXGA 1H1BA 2Q1JA 1AKSB 2BD3A 1A3EH 4X1NU 3E1XB 2BDBA 2XNIA 3BEIB 2HLDD 4FUIA 2WUBA 1HAGE 1MKWH 2JJ2D 2J34A 2JETC 5HMAA 4X1PU 5TJXA 2L74A 1CGIE 3MMGA 5KGOA 1ELBA 2ZCHP 3KF2A 3VB4A 1C5OH 1O3AA 3R3GB 1SGDE 1FX0B 2O9QA 3U9AH 1O30A 1QNJA 3FOAA 1V6DA 1O5BB 1ZGIA 5AFZH 5IDKA 4NSVA 1MTNB 4GHQA 5FCKA 2FI3E 3DSGA 2SGAA 1FONA 1GJ7B 3A7TA 1PPFE 4CH8B 2TGAA 1C2IA 4X6PA 2ZDKA 5B6LA 2BY5X 4HFPB 3AK5A 4BTUB 3PO1B 1DWDH 3NZIA 1P04A 2HVXA 2VWLA 5GDSH 2C93B 1B0FA 2QY0B 4Y10E 2ANWA 2R9PA 2K8IA 3A88A 1A46H 4AFSA 1GHZA 3CS7A 3TPIZ 1K2I1 2QF5A 3PRBA 1EB1H 5C1UA 3B9FH 5JPMH 3NK8A 1MTNC 1BMFD 3MNSA 4GCHF 4MNXA 2HNTC 4XOJA 4F48B 1Z6EA 4B2CA 2PW8H 3ELAH 1C5UA 3O8BA 2XC0A 2I6QA 3BSQA 2DUCA 2OC0A 1MD8A 1W3CA 1Z1IA 2EA3A 3PO1C 1HCGA 4ISIH 4VGCB 1C5WB 3ATLA 3G01A 2QAAA 3F0PA 2ZDVH 3UB0A 1HRTH 1ETRH 2BVSH 3TNTA 1NZQH 3ZVBA 5C1XA 1TBZH 3OSYA 1QL7A 4FXGH 1AD8H 2AIQA 1ELVA 2Z9GA 1UCYK 1H8ED 1V2VT 3LGUA 2ZGCA 3SV8A 4FUFA 6ESTA 2CN0H 4FVDA 4F55A 3ODFA 3PLBA 1SFIA 2OBOA 1XM1A 3SV7A 3OY6U 2NU1E 2DE8A 1ELAA 3PWCA 4VGCC 3GS9A 2FPZA 3SNCA 3SU3A 3T26A 1KXBA 3GY5A 2ANYA 1QA7A 3OEED 2AMPA 1P3EA 1BT7A 2O8LA 2L6OA 2TGTA 1EP5A 5HXFA 1ABJH 1O3KA 1RIWB 4F49A 1QRXA 1FN6A 1FY3A 2Y5GA 2V3MA 5J4SA 1DANH 2GCTB 1E1RD 1W0YH 1B0EA 4DJZB 1YPGH 4UD9H 1VZQH 1F0SA 2YMSB 1NRPH 3TJNA 1TOMH 2GZ8A 1CGJE 1OYTH 3LGYA 2R0LA 5KECA 1XKAC 1BRUP 1BTUA 7GCHF 4I8KA 4NWKA 1BOQA 4SGAE 3LJOA 2B0FA 3BG4B 5GNDA 5EPYA 1O2MA 4B6EA 2M5TA 3M7TA 1ANDA 1RIWC 1EX3A 3OX7U 1SOTA 2Z9IA 5GIBA 4IBLH 3W1EA 5BPEA 1H9IE 2ESTE 2JDID 2GCTC 2ZU3A 1WYKA 2BZ6H 3V7TA 2SNWA 3S7KB 1A5IA 2YMSC 2H6MA 3VXFH 4D8NA 2LP6A 1MCVA 2BD2A 4CRCA 1HAXB 5EJZA 3U1IB 2BVXH 1A3BH 3BG4C 2V3OH 2ULLA 1EZSC 2BX4A 2FLRH 1SGQE 6GCHF 5ETXA 1S0QA 1BBRK 1KXDA 1GCTB 1ZJDA 2GZ9A 4AYVB 3ZZAA 2BXUH 1QBNA 1DUEA 1IQEA 2FWWA 2ZHQH 4AG2A 3KYGA 4ISLA 2UWOA 4FU8A 2HRVA 2WPHS 2OINA 7LPRA 4WVPE 4BANB 4ZMAH 2RDEA 4KELA 5EODA 2Z7FE 3F9EA 1AGJA 3LH3A 1HXEH 3VPKA 4DCDA 2FODA 1MKXK 1FV9A 3BTDE 3LC3A 3U98H 2F3CE 4YOIA 3E90B 1E36B 4CRDA 2P3FH 1QY6A 3H7TA 1DVAH 5T1VA 1SC8U 1K1LA 2LELA 4JYUH 1P09A 1BB0B 1OOKB 5CMXH 4E05H 3DT0H 1PQ7A 2PGQB 1WAYB 4TY6A 1QGFA 2JJ1D 5DP8A 3Q76A 2XNDD 1YCPH 1DOJA 3H5CB 1UHBA 4GLYA 2W26A 3LONA 1DLKB 3FN8A 1IQMA 2PUXB 3IWMA 3ZZBA 1XVOA 3SYJA 2A31A 2IJD1 2LNCA 4ZXXH 1GMDG 1XUJA 3ZZ4A 2FOHA 1HNEE 1YKTA 1HAYB 1EKBB 2WHXA 3UOPA 4DY7B 3OYPA 3OAAD 4Y71A 3ZVFA 1BCUH 1YPEH 1UVOA 2VWNA 2GV7A 2FX6A 3ITIA 3VEQB 4K1EA 2RA0A 4X1SU 3A81A 1TNJA 2JH6D 4NFFA 1UTLM 2FOEA 5L2YH 5PTPA 2AYWA 3LGTA 4TT3D 1OP8A 1MTWA 2J94A 1C5XB 3P8GA 1T8OA 3ZZ6A 2C90B 1H8IH 1C9PA 1KXAA 1KXCA 3SZEA 5EXMA 3ATIA 3S7HB 4RT0A 1VITF 5EW2H 3M3TA 1RTLA 2ZFQH 1W2KH 1MCTA 3SU2A 3RMNH 1O34A 3ZIAD 1BUIA 2H2ZA 4ASUD 1O5CB 8GCHG 2VH6A 3UNQA 3PTNA 4A5TS 3SUGA 1YPJH 2H9EH 1Q2WA 3BIUH 1KTTB 1N1LA 3OTJE 3NPSA 1C4V2 1RS0A 1NFWA 4BNRA 2FEQH 1DT2A 5J4QA 5DP9A 3FZDA 5GJ4B 4WXIA 5FHTA 1KMHB 2A7HA 1HUTH 2BY6X 3A8DA 2ALVA 4BAQB 5A8XA 3L6PA 2C4FH 1C5ZB 4WF8A 3GCNA 3PMJA 1GJ9B 4JZEH 3V12A 4MNWA 2OD3B 5AVDA 2OC8A 1DICA 4ZUHA 3A87A 1BTYA 1Z8IB 2H5CA 1MD7A 3SJ9A 3ZZDA 3A7WA 1GDQA 4A1XA 6LPRA 1SGIB 3SV2H 1GHBF 1SHYA 2XBYA 5GWZA 1O2VA 1OP0A 2OUAA 3TJUA 1QR3E 2A7JA 1EAXA 2Y7XA 3A8AA 1OKXA 1DFPA 3GCHB 3M3SA 4NA7A 1O3PB 1ARBA 2C8XB 1B5GH 2QXHA 4B71A 3Q3XA 3PV5A 3RXIA 2EEKA 1AVWA 3UIRA 1MUEB 4MQAA 2P3UB 1O2IA 1TRYA 2ODYB 2BLWA 4WJG2 3UPEA 1MTUA 5DP5A 1H9HE 1O3GA 5EPNA 1GPZA 3TJOA 1JMOH 2P94A 5DP7A 4BAHB 3PTBA 3MI4A 1GI5A 3KEEA 1YP9A 3EE7A 1EAUA 4JYTA 2BDAA 1J14A 3GCHC 3RMMH 2ASUB 3DFJA 2SFAA 3T5FH 1MQ5A 1TPSA 4XDEA 2ZGHA 2NU3E 2RA3A 1P05A 4OS4A 4DOQA 1O3JA 2ZFTA 4ZKOU 4MDSA 4IMZA 5HGGA 2TPIZ 3A80A 4HGCA 1F0RA 1Q3XA 1HJ8A 1GI4A 1UK2A 5A8YA 2FZZA 2PLXA 5G4BA 1ELCA 1D3PB 2FOAA 3BTEE 4K3JA 1IQFA 2R2WU 3CS0A 3ESTA 2Z9KA 1Z7KA 4MPVA 1DITH 1NY22 3A86A 2HWLB 1NU9A 2FMJA 2BXTH 3LKWA 2KAIB 1PPBH 1DX5M 1KIGH 2FTLE 1TBQH 2BZAA 3QZRA 2Y80A 3RXTA 3PMHB 1MZDA 1WQSA 3K65B 1CT0E 2TGPZ 1LVBA 4XBBA 1LQDB 1O3OA 2FOGA 1RJXB 2ZPRA 3ATMA 1OS8A 5CDFE 4FU7A 1TX7A 3ZV9A 3EDXB 1FQ3A 3KL6A 2J4IA 3AVZA 1SGRE 4X8VH 5FAHA 3RXEA 2J97A 2QF0A 3OU0A 3O8DA 1QL9A 3QO6A 3N99A 3FO8D 1OWEA 1B7XB 2QC2A 1ZHPA 1QB6A 2Q6DA 1ZR0A 4ZXYH 3PRDA 3TJVA 2FS9A 1LKAA 1EZUC 2FOBA 1IQHA 2KR7A 2Q6FA 2TGDA 2ZFSA 2ZIQH 1CT2E 2XC4A 4YLQH 4CRAA 4U01A 1HB0B 2VIDA 5C0TA 5GPIB 1ZTKA 1BHXF 3F68H 1TQ7B 2ZGXH 1DWCH 3MU1A 3P70B 1G37A 1BRBE 1JRSA 3BTWE 5C17A 4H6TA 1AI8H 1ZYOA 3TGIE 4AFZA 3FP7E 2GCHG 4AFUA 1CGHA 2VVCA 2A2XH 5C0UA 1PQ5A 3FVFB 4B76A 1DXWA 4GVUA 2ZEBA 1IQIA 4YO9A 1JRTA 1UTNA 1UCYH 1EOJA 1LVMA 4ESTE 3KQEA 2QYIA 1AUJA 1FLEE 4O3TA 1HJAB 1GBHA 1C5QA 1H8HD 2WV4A 3LDXH 1BRCE 4WH8A 1OX1A 2J2UA 1O37A 1OXGA 4U32A 5FXLA 4FU9A 4OS7A 1O2RA 3UR9A 1TGCA 1V2UT 1TGNA 4YT6H 5DP4A 2VWOA 2BB4A 1SGEE 2J92A 1O2WA 5DO4H 1AVGH 3VXEH 1MAYA 1YGCH 2O8TA 4R0IA 1IHTH 1QJ1B 4ZKNU 3PV2A 3RXLA 2FOFA 3WWFA 1VJ9U 4ZHAA 1HJAC 4JCNA 1PYTD 3ATWA 1ZZZA 3F2HA 1MZAA 1OWDA 1G9IE 2Y7ZA 5EQRA 3UOUA 3M37A 3DD2H 2NWNA 3ZVGA 4DG4A 4K1SA 2HLCA 1F5RA 5ESTE 1AIXH 3SU5A 1ZTLA 4NFEA 1GI3A 2NU2E 3GYLB 1XMNB 4AN7A 1L4DA 1O2GH 2FP7B 4ZCNA 2IJOB 3S69A 2Z6BD 1DWBH 2WPIS 1C5VA 1ELEE 4U30A 3MO9A 1ZSKA 4NA9H 1V2TT 1Z1JA 2WPKS 3HPTB 4Y8YA 1C1SA 1GVZA 3GY7A 3U8RH 2PKSB 1T7CA 3LC5A 3FP6E 5TCAA 2O8WA 3T62A 2SGPE 1QL8A 2ZGJA 1ID5H 3M5MA 4Z1MD 3ENSB 4D9RA 2ZDNA 3A85A 3BIVH 4NZLA 1ZMLA 1AWHB 3RC5A 1AKSA 4FUGA 3O8CA 2ANMH 2TIOA 1S82A 3AAVA 1T4UH 2D2DA 4AG1A 1E1QD 2QIQA 5L6NH 2QE7D 1UTQA 1CHOG 2PKSC 5F03A 1BBRH 1C1PA 1L1JA 1GJ6A 3TH4H 3TK5A 2A7CA 3ODDA 1TALA 4H4FA 1H4WA 2HNTE 3RU4E 1S84A 2XW9A 1AVXA 1TNIA 4KKDA 3EAJA 3RMLH 1FZZA 4FUHA 1AY6H 2QN5T 1TPPA 1GJBB 2A4QA 1WBGB 3UR6A 1MKXH 3SORA 2ZO3H 3MU5A 4X8SH 1G30B 2XBVA 1LVYA 4ABGA 2A5IA 2CHAB 2VH0A 3D62A 1D6RA 5JB9S 3EA9A 5JBCS 3VB7A 1THRH 3Q77A 3VFEA 2BDHA 3MFJA 4KP0A 2VJ1A 1T4VH 5EG4A 1O2UA 5I25A 1CHGA 3OFND 3A7VA 3U28C 1PFXC 1TNKA 4JZIA 1SSXA 1MAXA 1QTFA 1ZMJA 1ZSLA 3SZNA 1W0ZU 3NCLA 3RXVA 1MBQA 4MG3A 1ZTJA 3KN2A 5AF9H 8ESTE 2P3TB 2ZFFH 2J9NA 1TMBH 4NIYA 3RXJA 1ZPCA 4K2YA 3SW2B 1AZZA 4NZQA 2CHAC 5DP3A 1GBJA 3SBKA 4ABHA 3M35A 5C5NA 1SLXB 4O9VA 1GDNA 4UFGH 4DGJA 3ZVDA 1EATA 4KGAA 1FJSA 3KGPA 4IN2A 1IQGA 1MMJN 2ZU1A 4X8UH 3SJIA 3EYDA 1JXPA 1MU8B 2A1DB 1QFKH 1LDTT 1S0RA 2CF8H 2JKHA 3F1SB 1QJ7B 2F83A 4JZFH 4TY7A 1F92A 3E3TA 4RI0A 2C8YB 4ZROA 5T6FA 4D9QA 1Z8GA 3D49H 4DVAU 1EFRD 5K7RA 5DJ7A 2ZHEH 1BRAA 4J2YB 3EGKH 1GMHG 1K1NA 1W7XH 3IITA 1G3CA 4BTTB 4NSYA 1BQYA 1C2DA 4K8YA 5EQSA 2BY7X 5A09A 4WH6A 5FPSA 1E0FD 3MH4A 1QBVH 1CT4E 5HYOA 4ACBA 3EA8A 1YPLH 4Q7YA 1HAVA 3UWIA 1C1WH 2F4LA 2ZTYA 1YYY1 3MU0A 1ETSH 3LGVA 1C2KA 2FLBH 1TIOA 4AGKA 1AFEH 5JBBS 1IQKA 1O5GH 1GHWH 4BAMB 3N7EA 1H9LB 1NC6A 1BMLA 1OYQA 1XKBC 4RKJB 1CU1A 1SGNE 1MH0A 4RT1A 4AGJA 7KMEH 4JZ1A 2B9LA 1ELTA 3KQBA 5E2PA 3QUMP 1EPTA 4X6MA 3A89A 4OM9A 3PROA 2W7SA 7ESTE 1KXEA 1NO9H 1X7AC 2ZGBH 1INCA 1C1RA 3CNRA 4BOHA 1GBFA 3HK6B 2CF9H 3N7OA 3CENA 1BJVA 1UTKA 2W3KA 1V3XA 2XCNA 3STJA 4OS2A 2B8OH 2AHME 4GHTA 3PLKA 3E8LA 2D8WA 2XXLA 1C1UH 1KY9A 2Z3CA 1A0JA 1SGFG 2P59A 2B7DH 2GP9B 1TMUH 1HJ9A 3MH5A 2V35A 2NU0E 1RXPA 3M36A 1FPCH 2ZF0H 3SQEE 5E0HA 2ZHFH 5BRRE 2BLQA 2G4UA 2BOKA 4JK5A 1HLTH 4I31A 2BD8A 1SQTA 2ZNKH 4ACAA 1VCWA 2A4OA 2YNBA 1P2JA 4X0WU 3GCTF 1AE5A 1VJAU 3GOVB 1YBWA 1DPOA 4CRBA 3VG8A 1SPJA 3SGQE 2ZDLA 1TNGA 1L2EA 2BLOA 2OC7A 1GBIA 3E6PH 4TWYA 2PGBB 3EE0B 4K60A 5C5OA 4AZ2B 3VGCB 1KXFA 1MTVA 4NA8A 1FI8A 1AHTH 5EJLA 1GHVH 2CMYA 2JH5D 1GJ8B 1GCTC 2CXVA 4MVNA 1TX6A 4TWWA 4XD7D 4YLUA 2HVYB 3SV9A 2QGRA 2EQNA 3LJJA 1SBWA 3Q00A 5EXLA 1HAZB 2WPLS 3T29A 1K0HA 2GMTB 2ZU2A 1QCPA 3MU4A 1ZHMA 1PJPA 4AB8A 5DK1A 4YOGA 1C5YB 1O3IA 5EQQA 4ABFA 2IN2A 2EY4C 4X8TH 1O2PA 1GHAF 4GCHG 4XBCA 1O2TA 5HIYA 1Y8TA 2GDDA 3B8JA 3VGCC 1GVLA 1LHEH 2Y82A 1KTSB 1SI5H 1WOFA 2J5UA 4AX9H 3PLPA 3B23B 4KTUA 4MNVA 1ACBE 1GHYH 1NBMD 1JWTA 5LPEA 1RGQA 1RRKA 2BQ6B 3TIUA 1P03A 2GMTC 3QK1A 1J17T 1FAXA 1LQEA 4J1YA 1K9OE 4ZKSU 1KLTA 2GTBA 2ZFPH 2FXRA 4CR9A 1C5LH 1O2OA 1YM0A 4BAKB 2Y5HA 4DT4A 2J98B 1KDQB 1O5AB 2UUKB 2HPQH 3PYHA 1G36A 2Z94A 1BTWA 1O31A 2AIPA 3SU6A 1O2HA 4NIXA 3ZZ9A 3S0NA 4AORA 4M9FA 3GY4A 4MLFB 3TLOA 4R8TB 4ZKRU 1SQAA 1A1RA 1BHXB 1O38A 1TX8A 2GGVB 2WUCA 1AE8H 1GJ5H 2FOCA 1P2MA 1D4PB 3SJOA 5ABWA 2I6SA 4FUDA 2RDLA 1DS2E 1GMCF 1O5DH 1DY8A 5DN6D 3N7DA 1EXFA 2OCVB 4ISHH 3HKIB 4NGAH 1W10U 3FP8E 3PMBB 1FAKH 1ZJKA 2R0KA 2BTCE 1P02A 3H09A 2ZCLP 4LZ4B 2BD9A 2A0QB 1A61H 1MBMA 5CHAB 1NT1A 2QXIA 5GCHF 3LOXA 3UREA 1BA8B 1AUTC 2OP9A 4ASHA 4FUBA 8LPRA 2GCHF 5CHBA 1Y3VA 1GBKA 1WTHD 3SUEA 7GCHG 4TSFD 1ZPZA 1EB2A 1Y3XA 2WV9A 1O3LA 1C2EA 1UTMA 2LPRA 1AU8A 3RXUA 2QXGA 2VVUA 2EI6A 1Y5BT 1ELFA 2A45B 3RUOA 1C2HA 1YPMH 2A2QH 3AAUA 3DCLA 5K0HA 2VIVA 2F9VA 3RXMA 1UVSH 1NRRH 1SGCA 2C8WB 2GD4B 2ZQ2A 5CHAC 4LK4A 1ORFA 3T28A 1RFNA 1UTOA 3UNSA 1GBCA 1PYTC 1S6LA 1MU6B 1DSTA 2ZDAH 2YNAA 1P9SA 1BZXE 2VGCB 1GJ4H 1PPGE 1VCQA 3WW7A 2GDEH 2BD4A 3LU9B 3RLWH 5E0JA 4Y8XA 3ZVCA 1Y59T 3I78A 4Q63A 4P00A 1ZRBA 1TABE 6GCHG 4IW4E 1JIMA 1W0KD 1Y3WA 3P92A 4UEHH 1LHDH 2BY8X 3F2FA 4YESB 3SNAA 5LGOA 1P3CA 2HGTH 1K1MA 3SU1A 1C5RA 4XE4A 4Q2KA 2C3SA 2W3IA 1O2XA 1AFQB 1SKYE 2WPMS 1K28D 2RG3A 3D23A 4PROA 3AASA 2R2MB 3R0FA 2VGCC 1HGTH 3QGJA 1Y5AT 4FUEA 3ZYEA 4BTIB 2WYJA 1S81A 3NUMA 1BTXA 1S6HA 5FX5A 3M5NA 5JBAS 4I8HA 3S9BA 5FBEA 5DKMA 2ALPA 4FOUC 4Z0KA 1XUHA 1GBMA 2DE9A 1GWAA 1S85A 1FMGA 1ANBA 2XTTB 3S9AA 4ABIA 4IC5A 3TGKE 1P9UA 3SGBE 2TRMA 2KAIA 3K6YA 4D7FA 4A6LA 1AFQC 1P11E 2YOLA 1J15A 4HTCH 1JBUH 3F0OA 4D7GA 1G2LA 5EIYA 2VU8E 2PUQH 3QX5H 4K69A 3RXOA 2KZ4A 1AO5A 4B2BA 1VGCB 3A83A 3IG6B 1ESBA 4CH2B 2VBCA 4BXSA 3S9CA 4A1TA 1NFUA 4X6NA 1ARCA 2GV6A 3A84A 3GY6A 3GY8A 1Z8RA 1EZQA 2VB0A 3TH2H 2J95A 3OEHD 1A5HA 2BD5A 1NM6A 1G3EA 1LCYA 3I29A 3MNBA 1SMFE 4FETA 1IQNA 4KTCA 1ANEA 4Z6AH 3E0PB 4GAWA 1HXFH 1C1QA 1VGCC 3FKSD 1NS3A 1EUFA 4I8JA 1YPKH 2JH0D 1HBTH 4THNH 3RLYH 1PPCE 2A4RA 3M61U 4H6SB 1E79D 3UFAA 2KFWA 2PFEA 3RC6A 1SB1H 5F53A 2F9NA 3V13A 4DW2U 5FPYA 1J16A 1K1PA 4MNYA 4INHA 3WY8A 1C1VH 1VITG 2BOHB 1K1OA 2OTVA 2GKVE 2SGFE 3MH7A 2AERH 4KTSA 1KSNA 1K1JA 2BDYA 2GT7A 3UNRA 3RP2A 1O5EH 2WSSD 4ZH8A 1Z71A 1A2CH 4HI3A 3SU4A 1GI2A 1O39A 1WV7H 2BLVA 9LPRA 1QJ6B 1VR1H 3LT3A 3GYMA 2P16A 1O2YA 1V2OT 3NRLA 1T32A 2H9TH 1A4WH 3KYFA 2D26C 1W7GH 1C4U2 5C1YA 1M9UA 3RXDA 1V2LT 3RXPA 2BYAX 3PB1E 3UUZA 1KYNA 1ZSJA 5F6MA 2UUJB 1SQOA 3DA9B 1A7SA 4ZAEA 3FAOA 2Z9JA 1A5GH 4IMQA 3U8OH 1THSH 2PKAA 4A92A 2VIQA 4OS5A 1GHBG 1GI6A 1J9CH 3LGWA 1OWKA 3E91A 1GHXH 2F9PA 1F5LA 1IHSH 4MTBA 3UQVA 4ABEA 1C1OA 4Y76A 1P2KA 1EZXC 1HIAB 1PPEE 1PQAA 1SL3A 4ABDA 1HDTH 3OTPA 4DIHH 2QF4A 1BTHH 3A7YA 2C8ZB 1BJUA 1QIXB 1TFXA 5ESBA 5FBIA 1W13U 1CA0B 4YTAA 2ODQA 1FPHH 3RXFA 1O2NA 3T2NA 3GDSA 3BTHE 3GDVA 3M7QA 1K21H 4X2YA 3QTVH 1L1NA 3MOCA 1CBWB 1TE0A 3F9FA 3A8CA 1YC0A 2GT8A 1WTGH 4UFDH 4UFEH 3ZV8A 1C5NH 2PTNA 3E16B 1WDIA 2NU4E 2BMGB 2SGEE 1GVKB 2G51A 3TK6A 1C2MA 2BM2A 1CA0C 4UFFH 1G3BA 5EJ1A 2VWMA 1QB9A 4DIIH 4X2XA 2G52A 1F7ZA 2PP6A 3BTME 1YLCA 1NROH 2AGGX 3MNXA 1TGSZ 1P06A 3TITA 1DSUA 1G3DA 1AMHA 3LPRA 4B74A 1GL0E 1CBWC 4OGYA 4INKA 2QV1A 3ZVAA 3RU4T 4RKOB 3RXCA 3U1JB 2UUFB 2ZHDA 4FVBA 1O32A 4WWYA 4WMDA 2AH4X 2M2AA 3KNXA 1P10A 3F9GA 3JZ1B 2KCPA 1ELDE 1CQQA 1GI0A 4YZUA 1ZLRA 1CO7E 4BAOB 2H5DA 3W95A 1OWIA 5JYIA 3LIWA 1PPHE 1GI8B 1OPHB 4X6OA 4Y0ZE 1TMTH 5A0AE 2G8TA 1KLIH 3U69H 5C67A 2B5TB 2ZQ1A 2VVVA 3OE7D 1D3DB 1C5SA 2CGAA 3BTTE 5IYTA 1O3FA 1O3MA 3WWBA 5E8EH 2ANKH 2ZPQA 3QGNB 2W6JD 4Q80A 1TNHA 2Y5FA 1LTOA 4IC6A 4Y6DA 2P8OB 2QF3A 3Q3KA 1XUFA 1TQ0B 1V2MT 4H42U 5DP6A 1JOUB 1NRQH 1SLWB 3RXRA 5B6OA 5DG6A 1UJ1A 2PHBA 3ZZ3A 3P95A 2ZTZA 1GBAA 1WCZA 4LZ1H 3ZYDA 3SNBA 3RXBA 3VB6A 2Z3DA 2ILNA 2KX4A 2HOBA 3L3TA 1O2QA 5HM2A 1E38B 4WY3A 1O3DA 4JMYA 4ZHLU 5EXNA 1OP2A 2F9UA 3LGIA 1N6XA 2P8OC 2Z3EA 2A4GA 2JIZD 3MH6A 3I77A 3DSOA 2Z9LA 1C5TA 1YLDA 1HYLA 2OLGA 2ZZUH 1DM4B 4F4OC 1LMWB 4TPIZ 4GSOA 2SNVA 1FY5A 1GMDF 1O36A 4WMEA 2AMQA 3SOSA 3UTUH 3RXQA 4IGDA 2P95A 1ZHRA 2FI4E 4NIVA 3F2GA 1IOEA 1L4ZA 1PPZA 4Q7ZA 2RCEA 2UWLA 2WV5A 4O03A 1XVMA 2AMDA 1TPOA 3RDZA 3HATH 2IPQX 4I7YH 1OWJA 2ZTXA 4CR5A 4B75A 1C2LA 1RTFB 1XX9A 2WPJS 3PWBA 2P93A 1W0JD 3BTKE 1C2GA 4X2WA 4AOQA 2VIOA 1NFYA 5FPTA 1QQUA 1CE5A 1C1NA 1P8VC 2VIPA 1CA8B 1ZMNA 3STIA 2FYRA 4XRNA 2ZKSA 1P12E 2EI8A 2THFB 2G81E 1TYNA 2WINI 1IQLA 1O3EA 3GCOA 1UO6A 2RFKC 3BTGE 1GJDB 1YLNA 1GBBA 4NIWA 3NWUA 1HAVB 8GCHF 2FO9A 4X2VA 1T8LA 1SLVB 1UTJA 5C94A 1P0SH 1HPGA 4B2AA 4HZHA 4WMFA 1UTPA 2BQ7B 4X1RU 2XRCA 1O2SA 1TAWA 1O2KA 2OBQA 2G4TA 3LH1A 1LKBA 1D6WA 1W11U 2FM2A 3SJ8A 1TRNA 2A32A 1C5PA 4IN1A 2O8MA 2OC1A 3FANA 3U8TH 1EPTB 1JIRA 1OWHA 1QRWA 2A5KA 1GBEA 1GGDB 5JB8S 1HV7A 2FYQA 1FIZA 2FESH 4GPGA 1S6FA 3NXPA 2UUYA 1LPGB 3RXHA 3UAIC 5AFYH 5JDUB 2F9OA 1Z6JH 1ETTH 1SGYE 1LO6A 3MU8A 5SGAE 1YY3A 1Y5UT 3TVJB 3SHAH 1G32B 4ABBA 1YWUA 5F8ZA 3QWCH 1QQ4A 3DHKH 2FIRH 1EPTC 2CJIA 4CBOA 1BIOA 1NESE 3HGNA 1GGDC 1O5FH 1MKWK 3OY5U 2BD7A 2FS8A 4E06H 1EOLA 1YPHE 3SNDA 3ZVEA 1V2QT 2PV9B 1TGBA 5LPRA 2HNTF 2SGQE 1BDAA 2ZWLH 3P8NA 4UONA 2BX3A 1UW7A 4GUXA 3D65E 1SR5C 2ZI2H 3RXKA 1LHGH 1WU1A 4LOYH 2KM0A 1VITH 2XWAA 2STBE 2ZA5A 2ZP0H 1O3NA 1C2JA 1N6YA 1ESAA 3KIDU 3HGPA 3KQ5A 4MPUA 5GXPA 9ESTA 1V2ST 2PSXA 3V0XA 4ABJA 1QBOA 1ZPBA 2J98A 1COWD 1KDQA 5T6GA 2GJGA 2BDCA 3EA7A 5H4IB 3RU4D 1K22H 4XSKU 3BEFB 3P17H 4CHAB 1V2PT 1GDUA 1EJMA 4WXVA 5AHGH 2V3HH 4UE7H 5LPFA 1UHBB 2Y6TA 3V3MA 2WYGA 3GISB 1FY1A 3M5LA 3SU0A 4IS5A 1T8NA 1YPHC 2XC5A 1LPZB 4CBNA 4E7NA 1F5KU 1PQ8A 4U2WA 3HK3B 1MTSA 4TPYA 3TU7H 3MHWU 1SQRA 1GBTA 2ZCKP 1ZGVA 2V7QD 1NRNH 1EASA 1GCDA 3BG8A 4NG9H 4D76A
chains in the Genus database with same CATH topology
4P02A 3CNRA 5EJLA 4RT1A 5EJ1A 3KYGA 4HG6A 3DSGA 4XRNA 4P00A 5EIYA 5KECA 3KYFA 2RDEA 4F48B 4FOUC 5EJZA 1YLNA 5KEDA 4I86A 2L74A 1YWUA 5KGOA 4RT0A 2GJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P02 A;  3CNR A;  5EJL A;  4RT1 A;  5EJ1 A;  3KYG A;  4HG6 A;  3DSG A;  4XRN A;  4P00 A;  5EIY A;  5KEC A;  3KYF A;  2RDE A;  4F48 B;  4FOU C;  5EJZ A;  1YLN A;  5KED A;  4I86 A;  2L74 A;  1YWU A;  5KGO A;  4RT0 A;  2GJG A; 
#chains in the Genus database with same CATH topology
 1BMA A;  2FX4 A;  6CHA B;  1MQ6 A;  2K1Q A;  5I46 H;  3M3V A;  4XBD A;  1O2L A;  3MO6 A;  5T6D A;  4CHA C;  4Y7B A;  1CSO E;  1UMA H;  1UVT H;  1SOZ A;  1Q31 A;  3H7O A;  4I8L A;  1QA0 A;  3KQD A;  1S5S A;  1IQJ A;  2OQ5 A;  4OS1 A;  2AGI X;  2R3U A;  1LPK B;  3F9H A;  1O3C A;  2AEI H;  2HPP H;  3O8R A;  1O0D H;  4JK6 A;  5IK2 D;  4ISN A;  1J8A A;  2QCY A;  3SI4 H;  5DSF A;  1DDJ A;  2ODP A;  3K6Z A;  1EJN A;  2XOK D;  2FOM B;  4JZD H;  1TON A;  2PSY A;  6CHA C;  3ATK A;  1F0T A;  3AW0 A;  3PM3 A;  1UK3 A;  3BV9 B;  4TYD A;  1FDP A;  1V2W T;  3UY9 A;  3QZQ A;  4K1T A;  1EQ9 A;  1SGT A;  2KCO A;  4NCY A;  1ZOM A;  2CV3 A;  4K8B A;  3SGA E;  1WXR A;  4I86 A;  1EJA A;  5TCC A;  2F91 A;  2WPD D;  2AGE X;  1OHH D;  3SJK A;  1A0H B;  3TK9 A;  2PR3 A;  3KHV A;  4MPX A;  1GJC B;  5F8X A;  1W8B H;  1EST A;  1QUR H;  4Y79 A;  2FDA A;  1O2Z A;  4QT8 C;  1YF4 A;  1UCY E;  3ZZ7 A;  5C3N A;  3ZZC A;  2F9B H;  3KCG H;  1P01 A;  2VIW A;  2PWX A;  4FUJ A;  4XFQ A;  1BMN H;  1G2M A;  5FX6 A;  1V2K T;  2YMS D;  4YM9 A;  3MQK C;  1TB6 H;  1WQV H;  3RXS A;  2H9H A;  1XXF A;  3A8B A;  1XXD A;  2G55 A;  3T27 A;  4YOJ A;  3A7X A;  4ABA A;  3MO3 A;  5HKK D;  3MWI U;  3UQO A;  1TNL A;  1P2Q A;  3GCT G;  4CRF A;  3C27 B;  4ZHM U;  2PTC E;  2AFQ B;  4AB9 A;  3NKK A;  3ZZ8 A;  1C4Y 2;  1TA2 A;  4RSP A;  1FIW A;  5EW1 H;  3DUX H;  3SNE A;  5FCR A;  2WZQ A;  4DT7 B;  1SVP A;  1ZRK A;  3PV4 A;  3BTQ E;  2STA E;  4K5Z A;  1THP B;  3SUD A;  1SGF A;  1C1M A;  5F8T A;  2Q6G A;  2QA9 E;  1DXP A;  3F3B A;  1NN6 A;  1O35 A;  1E35 B;  3BF6 H;  5T3H A;  3A7Z A;  3GY2 A;  1WUN H;  1V2R T;  5A8Z A;  3M5O A;  1T8M A;  1AB9 B;  3QDZ B;  3TH3 H;  2TBS A;  1ABI H;  3MTY A;  1BIT A;  1UVU H;  2BY9 X;  5A0B A;  1GHA G;  1L1G A;  2XYA A;  1KLJ H;  4AYY B;  3RM0 H;  2ZHW H;  1AWF H;  4I33 A;  1DLE A;  3P8F A;  2OQU A;  2XWB I;  4Y8Z A;  4I32 A;  4A7I B;  3F6U H;  4X1Q U;  1CHO F;  2ZU4 A;  1P57 B;  4P02 A;  1N8O B;  3PMA B;  2GX4 A;  3P8O A;  4AC9 A;  1CVW H;  3Q3Y A;  4YXW D;  1FN8 A;  3ZZ5 A;  3SHC H;  4Y7A A;  1AB9 C;  1GI9 B;  2W5E A;  2A5A A;  1HAP H;  1YCP K;  2VIN A;  5JBT A;  1TPA E;  3L33 A;  1TLD A;  1O3H A;  3BTF E;  5E0G A;  1C1T A;  1LHF H;  3EQ0 H;  2ZDM A;  1V2J T;  1W14 U;  2GZ7 A;  1Y3U A;  2XBX A;  1BTZ A;  5A0C A;  3SQH E;  1BBR E;  1O2J A;  1HFD A;  1FY4 A;  1FY8 E;  8KME 2;  3MYW A;  1V2N T;  2QXJ A;  3SUF A;  4JYV H;  4A1V A;  3VB3 A;  1F2S E;  1N8O C;  3CP7 A;  2KCY A;  1AQ7 A;  1K1I A;  3SV6 A;  1C2F A;  2H1U A;  3QTO H;  4Y0Y E;  2G5V A;  1GBL A;  1HAI H;  2G5N A;  4DUR A;  1SG8 B;  4NWL A;  3DSP A;  1SHH B;  2IPH A;  4I8G A;  3RC4 A;  2OK5 A;  1GMC G;  1BTP A;  2VNT A;  3C1K A;  1ELG A;  4RN6 A;  1XUI A;  2Y81 A;  1E37 B;  3RM2 H;  2UWP A;  1WSS H;  4SGB E;  1TWX B;  2ZG0 H;  1FUJ A;  3GDU A;  5A2M H;  2V0B A;  2R3Y A;  1AZ8 A;  5FL7 D;  4YT7 H;  5GCH G;  3AW1 A;  4ISO A;  3E0N B;  1O3B A;  4HG6 A;  3P6Z B;  3RMO H;  3SI3 H;  2ZC9 H;  1RTK A;  1BMM H;  3FZZ A;  5HIZ A;  3UWJ H;  2KCA A;  5DGJ A;  2FI5 E;  2D1J A;  2ZPS A;  1VCP A;  4MPW A;  5KED A;  1ANC A;  3QN7 A;  1TA6 A;  1EP6 A;  1EAI A;  1FXY A;  4Q7X A;  4LXB H;  2BQW B;  4FUC A;  1AN1 E;  1IAU A;  3TGJ E;  1P2N A;  1DUA A;  1UVP A;  3DFL A;  3TNS A;  5EGM A;  4E7R G;  3URD A;  2CK3 D;  5CE1 A;  1W12 U;  3BEU A;  1TGT A;  2W7U A;  1HIA A;  1MAB B;  2F43 B;  2IOT A;  1RD3 B;  3KQC A;  2FTM A;  1L0Z A;  3VB5 A;  1GBD A;  1H8D H;  1GMH F;  4Y11 E;  3BN9 A;  4CRE A;  1GI7 B;  3URC A;  1LVO A;  1SLU B;  1GJA B;  1NFX A;  2HAL A;  5C2Z A;  3M7U A;  4B1T A;  2AS9 A;  5DPA A;  1QZ8 A;  2V6N A;  5E2O A;  3RXA A;  1GG6 B;  2K0Q A;  1DY9 A;  2G00 A;  3A82 A;  2XCF A;  3GY3 A;  2PKA B;  1GI1 A;  2ZU5 A;  1P2I A;  5EU8 A;  2W6I D;  1NTP A;  1C5M D;  1QB1 A;  3HKJ B;  4OS6 A;  1QHR B;  4AFQ A;  1HAO H;  5C20 A;  1EAW A;  1VKY A;  1HAH H;  3MNC A;  2XBW A;  1D3T B;  2BDG A;  2O8U A;  1QRZ A;  1XUK A;  2SGD E;  3K9X B;  4INL A;  4CRG A;  5HM9 A;  2ZFR H;  2BVR H;  4BXW A;  3SO3 A;  4OGX A;  2BDI A;  1DWE H;  2GVF A;  5L30 H;  1LHC H;  3T25 A;  1GG6 C;  1Y3Y A;  3GIC B;  4B73 A;  1DE7 H;  1D9I A;  1C9T A;  1YCP M;  1UK4 A;  1T31 A;  2EI7 A;  1S83 A;  1E34 B;  1SGP E;  1D3Q B;  2JET B;  2J38 A;  4UDW H;  3JZ2 B;  3W94 A;  5L2Z H;  2ZEC A;  1U6Q A;  4O3U A;  1F0U A;  1TRM A;  1TOC B;  5LH8 A;  2BHG A;  1NPM A;  1O33 A;  1GL1 A;  4B6F A;  1TBR H;  4Q4L A;  1A0L A;  5EOK A;  1SFQ B;  2EC9 H;  3SN8 A;  1NU7 B;  1Z8J B;  1P2O A;  1NBM E;  4M7G A;  4O97 A;  1NRS H;  3K2U A;  1OSS A;  3QLP H;  2OXS A;  3FFG A;  1XUG A;  1FNI A;  3RXG A;  1H1B A;  2Q1J A;  1AKS B;  2BD3 A;  1A3E H;  4X1N U;  3E1X B;  2BDB A;  2XNI A;  3BEI B;  2HLD D;  4FUI A;  2WUB A;  1HAG E;  1MKW H;  2JJ2 D;  2J34 A;  2JET C;  5HMA A;  4X1P U;  5TJX A;  2L74 A;  1CGI E;  3MMG A;  5KGO A;  1ELB A;  2ZCH P;  3KF2 A;  3VB4 A;  1C5O H;  1O3A A;  3R3G B;  1SGD E;  1FX0 B;  2O9Q A;  3U9A H;  1O30 A;  1QNJ A;  3FOA A;  1V6D A;  1O5B B;  1ZGI A;  5AFZ H;  5IDK A;  4NSV A;  1MTN B;  4GHQ A;  5FCK A;  2FI3 E;  3DSG A;  2SGA A;  1FON A;  1GJ7 B;  3A7T A;  1PPF E;  4CH8 B;  2TGA A;  1C2I A;  4X6P A;  2ZDK A;  5B6L A;  2BY5 X;  4HFP B;  3AK5 A;  4BTU B;  3PO1 B;  1DWD H;  3NZI A;  1P04 A;  2HVX A;  2VWL A;  5GDS H;  2C93 B;  1B0F A;  2QY0 B;  4Y10 E;  2ANW A;  2R9P A;  2K8I A;  3A88 A;  1A46 H;  4AFS A;  1GHZ A;  3CS7 A;  3TPI Z;  1K2I 1;  2QF5 A;  3PRB A;  1EB1 H;  5C1U A;  3B9F H;  5JPM H;  3NK8 A;  1MTN C;  1BMF D;  3MNS A;  4GCH F;  4MNX A;  2HNT C;  4XOJ A;  4F48 B;  1Z6E A;  4B2C A;  2PW8 H;  3ELA H;  1C5U A;  3O8B A;  2XC0 A;  2I6Q A;  3BSQ A;  2DUC A;  2OC0 A;  1MD8 A;  1W3C A;  1Z1I A;  2EA3 A;  3PO1 C;  1HCG A;  4ISI H;  4VGC B;  1C5W B;  3ATL A;  3G01 A;  2QAA A;  3F0P A;  2ZDV H;  3UB0 A;  1HRT H;  1ETR H;  2BVS H;  3TNT A;  1NZQ H;  3ZVB A;  5C1X A;  1TBZ H;  3OSY A;  1QL7 A;  4FXG H;  1AD8 H;  2AIQ A;  1ELV A;  2Z9G A;  1UCY K;  1H8E D;  1V2V T;  3LGU A;  2ZGC A;  3SV8 A;  4FUF A;  6EST A;  2CN0 H;  4FVD A;  4F55 A;  3ODF A;  3PLB A;  1SFI A;  2OBO A;  1XM1 A;  3SV7 A;  3OY6 U;  2NU1 E;  2DE8 A;  1ELA A;  3PWC A;  4VGC C;  3GS9 A;  2FPZ A;  3SNC A;  3SU3 A;  3T26 A;  1KXB A;  3GY5 A;  2ANY A;  1QA7 A;  3OEE D;  2AMP A;  1P3E A;  1BT7 A;  2O8L A;  2L6O A;  2TGT A;  1EP5 A;  5HXF A;  1ABJ H;  1O3K A;  1RIW B;  4F49 A;  1QRX A;  1FN6 A;  1FY3 A;  2Y5G A;  2V3M A;  5J4S A;  1DAN H;  2GCT B;  1E1R D;  1W0Y H;  1B0E A;  4DJZ B;  1YPG H;  4UD9 H;  1VZQ H;  1F0S A;  2YMS B;  1NRP H;  3TJN A;  1TOM H;  2GZ8 A;  1CGJ E;  1OYT H;  3LGY A;  2R0L A;  5KEC A;  1XKA C;  1BRU P;  1BTU A;  7GCH F;  4I8K A;  4NWK A;  1BOQ A;  4SGA E;  3LJO A;  2B0F A;  3BG4 B;  5GND A;  5EPY A;  1O2M A;  4B6E A;  2M5T A;  3M7T A;  1AND A;  1RIW C;  1EX3 A;  3OX7 U;  1SOT A;  2Z9I A;  5GIB A;  4IBL H;  3W1E A;  5BPE A;  1H9I E;  2EST E;  2JDI D;  2GCT C;  2ZU3 A;  1WYK A;  2BZ6 H;  3V7T A;  2SNW A;  3S7K B;  1A5I A;  2YMS C;  2H6M A;  3VXF H;  4D8N A;  2LP6 A;  1MCV A;  2BD2 A;  4CRC A;  1HAX B;  5EJZ A;  3U1I B;  2BVX H;  1A3B H;  3BG4 C;  2V3O H;  2ULL A;  1EZS C;  2BX4 A;  2FLR H;  1SGQ E;  6GCH F;  5ETX A;  1S0Q A;  1BBR K;  1KXD A;  1GCT B;  1ZJD A;  2GZ9 A;  4AYV B;  3ZZA A;  2BXU H;  1QBN A;  1DUE A;  1IQE A;  2FWW A;  2ZHQ H;  4AG2 A;  3KYG A;  4ISL A;  2UWO A;  4FU8 A;  2HRV A;  2WPH S;  2OIN A;  7LPR A;  4WVP E;  4BAN B;  4ZMA H;  2RDE A;  4KEL A;  5EOD A;  2Z7F E;  3F9E A;  1AGJ A;  3LH3 A;  1HXE H;  3VPK A;  4DCD A;  2FOD A;  1MKX K;  1FV9 A;  3BTD E;  3LC3 A;  3U98 H;  2F3C E;  4YOI A;  3E90 B;  1E36 B;  4CRD A;  2P3F H;  1QY6 A;  3H7T A;  1DVA H;  5T1V A;  1SC8 U;  1K1L A;  2LEL A;  4JYU H;  1P09 A;  1BB0 B;  1OOK B;  5CMX H;  4E05 H;  3DT0 H;  1PQ7 A;  2PGQ B;  1WAY B;  4TY6 A;  1QGF A;  2JJ1 D;  5DP8 A;  3Q76 A;  2XND D;  1YCP H;  1DOJ A;  3H5C B;  1UHB A;  4GLY A;  2W26 A;  3LON A;  1DLK B;  3FN8 A;  1IQM A;  2PUX B;  3IWM A;  3ZZB A;  1XVO A;  3SYJ A;  2A31 A;  2IJD 1;  2LNC A;  4ZXX H;  1GMD G;  1XUJ A;  3ZZ4 A;  2FOH A;  1HNE E;  1YKT A;  1HAY B;  1EKB B;  2WHX A;  3UOP A;  4DY7 B;  3OYP A;  3OAA D;  4Y71 A;  3ZVF A;  1BCU H;  1YPE H;  1UVO A;  2VWN A;  2GV7 A;  2FX6 A;  3ITI A;  3VEQ B;  4K1E A;  2RA0 A;  4X1S U;  3A81 A;  1TNJ A;  2JH6 D;  4NFF A;  1UTL M;  2FOE A;  5L2Y H;  5PTP A;  2AYW A;  3LGT A;  4TT3 D;  1OP8 A;  1MTW A;  2J94 A;  1C5X B;  3P8G A;  1T8O A;  3ZZ6 A;  2C90 B;  1H8I H;  1C9P A;  1KXA A;  1KXC A;  3SZE A;  5EXM A;  3ATI A;  3S7H B;  4RT0 A;  1VIT F;  5EW2 H;  3M3T A;  1RTL A;  2ZFQ H;  1W2K H;  1MCT A;  3SU2 A;  3RMN H;  1O34 A;  3ZIA D;  1BUI A;  2H2Z A;  4ASU D;  1O5C B;  8GCH G;  2VH6 A;  3UNQ A;  3PTN A;  4A5T S;  3SUG A;  1YPJ H;  2H9E H;  1Q2W A;  3BIU H;  1KTT B;  1N1L A;  3OTJ E;  3NPS A;  1C4V 2;  1RS0 A;  1NFW A;  4BNR A;  2FEQ H;  1DT2 A;  5J4Q A;  5DP9 A;  3FZD A;  5GJ4 B;  4WXI A;  5FHT A;  1KMH B;  2A7H A;  1HUT H;  2BY6 X;  3A8D A;  2ALV A;  4BAQ B;  5A8X A;  3L6P A;  2C4F H;  1C5Z B;  4WF8 A;  3GCN A;  3PMJ A;  1GJ9 B;  4JZE H;  3V12 A;  4MNW A;  2OD3 B;  5AVD A;  2OC8 A;  1DIC A;  4ZUH A;  3A87 A;  1BTY A;  1Z8I B;  2H5C A;  1MD7 A;  3SJ9 A;  3ZZD A;  3A7W A;  1GDQ A;  4A1X A;  6LPR A;  1SGI B;  3SV2 H;  1GHB F;  1SHY A;  2XBY A;  5GWZ A;  1O2V A;  1OP0 A;  2OUA A;  3TJU A;  1QR3 E;  2A7J A;  1EAX A;  2Y7X A;  3A8A A;  1OKX A;  1DFP A;  3GCH B;  3M3S A;  4NA7 A;  1O3P B;  1ARB A;  2C8X B;  1B5G H;  2QXH A;  4B71 A;  3Q3X A;  3PV5 A;  3RXI A;  2EEK A;  1AVW A;  3UIR A;  1MUE B;  4MQA A;  2P3U B;  1O2I A;  1TRY A;  2ODY B;  2BLW A;  4WJG 2;  3UPE A;  1MTU A;  5DP5 A;  1H9H E;  1O3G A;  5EPN A;  1GPZ A;  3TJO A;  1JMO H;  2P94 A;  5DP7 A;  4BAH B;  3PTB A;  3MI4 A;  1GI5 A;  3KEE A;  1YP9 A;  3EE7 A;  1EAU A;  4JYT A;  2BDA A;  1J14 A;  3GCH C;  3RMM H;  2ASU B;  3DFJ A;  2SFA A;  3T5F H;  1MQ5 A;  1TPS A;  4XDE A;  2ZGH A;  2NU3 E;  2RA3 A;  1P05 A;  4OS4 A;  4DOQ A;  1O3J A;  2ZFT A;  4ZKO U;  4MDS A;  4IMZ A;  5HGG A;  2TPI Z;  3A80 A;  4HGC A;  1F0R A;  1Q3X A;  1HJ8 A;  1GI4 A;  1UK2 A;  5A8Y A;  2FZZ A;  2PLX A;  5G4B A;  1ELC A;  1D3P B;  2FOA A;  3BTE E;  4K3J A;  1IQF A;  2R2W U;  3CS0 A;  3EST A;  2Z9K A;  1Z7K A;  4MPV A;  1DIT H;  1NY2 2;  3A86 A;  2HWL B;  1NU9 A;  2FMJ A;  2BXT H;  3LKW A;  2KAI B;  1PPB H;  1DX5 M;  1KIG H;  2FTL E;  1TBQ H;  2BZA A;  3QZR A;  2Y80 A;  3RXT A;  3PMH B;  1MZD A;  1WQS A;  3K65 B;  1CT0 E;  2TGP Z;  1LVB A;  4XBB A;  1LQD B;  1O3O A;  2FOG A;  1RJX B;  2ZPR A;  3ATM A;  1OS8 A;  5CDF E;  4FU7 A;  1TX7 A;  3ZV9 A;  3EDX B;  1FQ3 A;  3KL6 A;  2J4I A;  3AVZ A;  1SGR E;  4X8V H;  5FAH A;  3RXE A;  2J97 A;  2QF0 A;  3OU0 A;  3O8D A;  1QL9 A;  3QO6 A;  3N99 A;  3FO8 D;  1OWE A;  1B7X B;  2QC2 A;  1ZHP A;  1QB6 A;  2Q6D A;  1ZR0 A;  4ZXY H;  3PRD A;  3TJV A;  2FS9 A;  1LKA A;  1EZU C;  2FOB A;  1IQH A;  2KR7 A;  2Q6F A;  2TGD A;  2ZFS A;  2ZIQ H;  1CT2 E;  2XC4 A;  4YLQ H;  4CRA A;  4U01 A;  1HB0 B;  2VID A;  5C0T A;  5GPI B;  1ZTK A;  1BHX F;  3F68 H;  1TQ7 B;  2ZGX H;  1DWC H;  3MU1 A;  3P70 B;  1G37 A;  1BRB E;  1JRS A;  3BTW E;  5C17 A;  4H6T A;  1AI8 H;  1ZYO A;  3TGI E;  4AFZ A;  3FP7 E;  2GCH G;  4AFU A;  1CGH A;  2VVC A;  2A2X H;  5C0U A;  1PQ5 A;  3FVF B;  4B76 A;  1DXW A;  4GVU A;  2ZEB A;  1IQI A;  4YO9 A;  1JRT A;  1UTN A;  1UCY H;  1EOJ A;  1LVM A;  4EST E;  3KQE A;  2QYI A;  1AUJ A;  1FLE E;  4O3T A;  1HJA B;  1GBH A;  1C5Q A;  1H8H D;  2WV4 A;  3LDX H;  1BRC E;  4WH8 A;  1OX1 A;  2J2U A;  1O37 A;  1OXG A;  4U32 A;  5FXL A;  4FU9 A;  4OS7 A;  1O2R A;  3UR9 A;  1TGC A;  1V2U T;  1TGN A;  4YT6 H;  5DP4 A;  2VWO A;  2BB4 A;  1SGE E;  2J92 A;  1O2W A;  5DO4 H;  1AVG H;  3VXE H;  1MAY A;  1YGC H;  2O8T A;  4R0I A;  1IHT H;  1QJ1 B;  4ZKN U;  3PV2 A;  3RXL A;  2FOF A;  3WWF A;  1VJ9 U;  4ZHA A;  1HJA C;  4JCN A;  1PYT D;  3ATW A;  1ZZZ A;  3F2H A;  1MZA A;  1OWD A;  1G9I E;  2Y7Z A;  5EQR A;  3UOU A;  3M37 A;  3DD2 H;  2NWN A;  3ZVG A;  4DG4 A;  4K1S A;  2HLC A;  1F5R A;  5EST E;  1AIX H;  3SU5 A;  1ZTL A;  4NFE A;  1GI3 A;  2NU2 E;  3GYL B;  1XMN B;  4AN7 A;  1L4D A;  1O2G H;  2FP7 B;  4ZCN A;  2IJO B;  3S69 A;  2Z6B D;  1DWB H;  2WPI S;  1C5V A;  1ELE E;  4U30 A;  3MO9 A;  1ZSK A;  4NA9 H;  1V2T T;  1Z1J A;  2WPK S;  3HPT B;  4Y8Y A;  1C1S A;  1GVZ A;  3GY7 A;  3U8R H;  2PKS B;  1T7C A;  3LC5 A;  3FP6 E;  5TCA A;  2O8W A;  3T62 A;  2SGP E;  1QL8 A;  2ZGJ A;  1ID5 H;  3M5M A;  4Z1M D;  3ENS B;  4D9R A;  2ZDN A;  3A85 A;  3BIV H;  4NZL A;  1ZML A;  1AWH B;  3RC5 A;  1AKS A;  4FUG A;  3O8C A;  2ANM H;  2TIO A;  1S82 A;  3AAV A;  1T4U H;  2D2D A;  4AG1 A;  1E1Q D;  2QIQ A;  5L6N H;  2QE7 D;  1UTQ A;  1CHO G;  2PKS C;  5F03 A;  1BBR H;  1C1P A;  1L1J A;  1GJ6 A;  3TH4 H;  3TK5 A;  2A7C A;  3ODD A;  1TAL A;  4H4F A;  1H4W A;  2HNT E;  3RU4 E;  1S84 A;  2XW9 A;  1AVX A;  1TNI A;  4KKD A;  3EAJ A;  3RML H;  1FZZ A;  4FUH A;  1AY6 H;  2QN5 T;  1TPP A;  1GJB B;  2A4Q A;  1WBG B;  3UR6 A;  1MKX H;  3SOR A;  2ZO3 H;  3MU5 A;  4X8S H;  1G30 B;  2XBV A;  1LVY A;  4ABG A;  2A5I A;  2CHA B;  2VH0 A;  3D62 A;  1D6R A;  5JB9 S;  3EA9 A;  5JBC S;  3VB7 A;  1THR H;  3Q77 A;  3VFE A;  2BDH A;  3MFJ A;  4KP0 A;  2VJ1 A;  1T4V H;  5EG4 A;  1O2U A;  5I25 A;  1CHG A;  3OFN D;  3A7V A;  3U28 C;  1PFX C;  1TNK A;  4JZI A;  1SSX A;  1MAX A;  1QTF A;  1ZMJ A;  1ZSL A;  3SZN A;  1W0Z U;  3NCL A;  3RXV A;  1MBQ A;  4MG3 A;  1ZTJ A;  3KN2 A;  5AF9 H;  8EST E;  2P3T B;  2ZFF H;  2J9N A;  1TMB H;  4NIY A;  3RXJ A;  1ZPC A;  4K2Y A;  3SW2 B;  1AZZ A;  4NZQ A;  2CHA C;  5DP3 A;  1GBJ A;  3SBK A;  4ABH A;  3M35 A;  5C5N A;  1SLX B;  4O9V A;  1GDN A;  4UFG H;  4DGJ A;  3ZVD A;  1EAT A;  4KGA A;  1FJS A;  3KGP A;  4IN2 A;  1IQG A;  1MMJ N;  2ZU1 A;  4X8U H;  3SJI A;  3EYD A;  1JXP A;  1MU8 B;  2A1D B;  1QFK H;  1LDT T;  1S0R A;  2CF8 H;  2JKH A;  3F1S B;  1QJ7 B;  2F83 A;  4JZF H;  4TY7 A;  1F92 A;  3E3T A;  4RI0 A;  2C8Y B;  4ZRO A;  5T6F A;  4D9Q A;  1Z8G A;  3D49 H;  4DVA U;  1EFR D;  5K7R A;  5DJ7 A;  2ZHE H;  1BRA A;  4J2Y B;  3EGK H;  1GMH G;  1K1N A;  1W7X H;  3IIT A;  1G3C A;  4BTT B;  4NSY A;  1BQY A;  1C2D A;  4K8Y A;  5EQS A;  2BY7 X;  5A09 A;  4WH6 A;  5FPS A;  1E0F D;  3MH4 A;  1QBV H;  1CT4 E;  5HYO A;  4ACB A;  3EA8 A;  1YPL H;  4Q7Y A;  1HAV A;  3UWI A;  1C1W H;  2F4L A;  2ZTY A;  1YYY 1;  3MU0 A;  1ETS H;  3LGV A;  1C2K A;  2FLB H;  1TIO A;  4AGK A;  1AFE H;  5JBB S;  1IQK A;  1O5G H;  1GHW H;  4BAM B;  3N7E A;  1H9L B;  1NC6 A;  1BML A;  1OYQ A;  1XKB C;  4RKJ B;  1CU1 A;  1SGN E;  1MH0 A;  4RT1 A;  4AGJ A;  7KME H;  4JZ1 A;  2B9L A;  1ELT A;  3KQB A;  5E2P A;  3QUM P;  1EPT A;  4X6M A;  3A89 A;  4OM9 A;  3PRO A;  2W7S A;  7EST E;  1KXE A;  1NO9 H;  1X7A C;  2ZGB H;  1INC A;  1C1R A;  3CNR A;  4BOH A;  1GBF A;  3HK6 B;  2CF9 H;  3N7O A;  3CEN A;  1BJV A;  1UTK A;  2W3K A;  1V3X A;  2XCN A;  3STJ A;  4OS2 A;  2B8O H;  2AHM E;  4GHT A;  3PLK A;  3E8L A;  2D8W A;  2XXL A;  1C1U H;  1KY9 A;  2Z3C A;  1A0J A;  1SGF G;  2P59 A;  2B7D H;  2GP9 B;  1TMU H;  1HJ9 A;  3MH5 A;  2V35 A;  2NU0 E;  1RXP A;  3M36 A;  1FPC H;  2ZF0 H;  3SQE E;  5E0H A;  2ZHF H;  5BRR E;  2BLQ A;  2G4U A;  2BOK A;  4JK5 A;  1HLT H;  4I31 A;  2BD8 A;  1SQT A;  2ZNK H;  4ACA A;  1VCW A;  2A4O A;  2YNB A;  1P2J A;  4X0W U;  3GCT F;  1AE5 A;  1VJA U;  3GOV B;  1YBW A;  1DPO A;  4CRB A;  3VG8 A;  1SPJ A;  3SGQ E;  2ZDL A;  1TNG A;  1L2E A;  2BLO A;  2OC7 A;  1GBI A;  3E6P H;  4TWY A;  2PGB B;  3EE0 B;  4K60 A;  5C5O A;  4AZ2 B;  3VGC B;  1KXF A;  1MTV A;  4NA8 A;  1FI8 A;  1AHT H;  5EJL A;  1GHV H;  2CMY A;  2JH5 D;  1GJ8 B;  1GCT C;  2CXV A;  4MVN A;  1TX6 A;  4TWW A;  4XD7 D;  4YLU A;  2HVY B;  3SV9 A;  2QGR A;  2EQN A;  3LJJ A;  1SBW A;  3Q00 A;  5EXL A;  1HAZ B;  2WPL S;  3T29 A;  1K0H A;  2GMT B;  2ZU2 A;  1QCP A;  3MU4 A;  1ZHM A;  1PJP A;  4AB8 A;  5DK1 A;  4YOG A;  1C5Y B;  1O3I A;  5EQQ A;  4ABF A;  2IN2 A;  2EY4 C;  4X8T H;  1O2P A;  1GHA F;  4GCH G;  4XBC A;  1O2T A;  5HIY A;  1Y8T A;  2GDD A;  3B8J A;  3VGC C;  1GVL A;  1LHE H;  2Y82 A;  1KTS B;  1SI5 H;  1WOF A;  2J5U A;  4AX9 H;  3PLP A;  3B23 B;  4KTU A;  4MNV A;  1ACB E;  1GHY H;  1NBM D;  1JWT A;  5LPE A;  1RGQ A;  1RRK A;  2BQ6 B;  3TIU A;  1P03 A;  2GMT C;  3QK1 A;  1J17 T;  1FAX A;  1LQE A;  4J1Y A;  1K9O E;  4ZKS U;  1KLT A;  2GTB A;  2ZFP H;  2FXR A;  4CR9 A;  1C5L H;  1O2O A;  1YM0 A;  4BAK B;  2Y5H A;  4DT4 A;  2J98 B;  1KDQ B;  1O5A B;  2UUK B;  2HPQ H;  3PYH A;  1G36 A;  2Z94 A;  1BTW A;  1O31 A;  2AIP A;  3SU6 A;  1O2H A;  4NIX A;  3ZZ9 A;  3S0N A;  4AOR A;  4M9F A;  3GY4 A;  4MLF B;  3TLO A;  4R8T B;  4ZKR U;  1SQA A;  1A1R A;  1BHX B;  1O38 A;  1TX8 A;  2GGV B;  2WUC A;  1AE8 H;  1GJ5 H;  2FOC A;  1P2M A;  1D4P B;  3SJO A;  5ABW A;  2I6S A;  4FUD A;  2RDL A;  1DS2 E;  1GMC F;  1O5D H;  1DY8 A;  5DN6 D;  3N7D A;  1EXF A;  2OCV B;  4ISH H;  3HKI B;  4NGA H;  1W10 U;  3FP8 E;  3PMB B;  1FAK H;  1ZJK A;  2R0K A;  2BTC E;  1P02 A;  3H09 A;  2ZCL P;  4LZ4 B;  2BD9 A;  2A0Q B;  1A61 H;  1MBM A;  5CHA B;  1NT1 A;  2QXI A;  5GCH F;  3LOX A;  3URE A;  1BA8 B;  1AUT C;  2OP9 A;  4ASH A;  4FUB A;  8LPR A;  2GCH F;  5CHB A;  1Y3V A;  1GBK A;  1WTH D;  3SUE A;  7GCH G;  4TSF D;  1ZPZ A;  1EB2 A;  1Y3X A;  2WV9 A;  1O3L A;  1C2E A;  1UTM A;  2LPR A;  1AU8 A;  3RXU A;  2QXG A;  2VVU A;  2EI6 A;  1Y5B T;  1ELF A;  2A45 B;  3RUO A;  1C2H A;  1YPM H;  2A2Q H;  3AAU A;  3DCL A;  5K0H A;  2VIV A;  2F9V A;  3RXM A;  1UVS H;  1NRR H;  1SGC A;  2C8W B;  2GD4 B;  2ZQ2 A;  5CHA C;  4LK4 A;  1ORF A;  3T28 A;  1RFN A;  1UTO A;  3UNS A;  1GBC A;  1PYT C;  1S6L A;  1MU6 B;  1DST A;  2ZDA H;  2YNA A;  1P9S A;  1BZX E;  2VGC B;  1GJ4 H;  1PPG E;  1VCQ A;  3WW7 A;  2GDE H;  2BD4 A;  3LU9 B;  3RLW H;  5E0J A;  4Y8X A;  3ZVC A;  1Y59 T;  3I78 A;  4Q63 A;  4P00 A;  1ZRB A;  1TAB E;  6GCH G;  4IW4 E;  1JIM A;  1W0K D;  1Y3W A;  3P92 A;  4UEH H;  1LHD H;  2BY8 X;  3F2F A;  4YES B;  3SNA A;  5LGO A;  1P3C A;  2HGT H;  1K1M A;  3SU1 A;  1C5R A;  4XE4 A;  4Q2K A;  2C3S A;  2W3I A;  1O2X A;  1AFQ B;  1SKY E;  2WPM S;  1K28 D;  2RG3 A;  3D23 A;  4PRO A;  3AAS A;  2R2M B;  3R0F A;  2VGC C;  1HGT H;  3QGJ A;  1Y5A T;  4FUE A;  3ZYE A;  4BTI B;  2WYJ A;  1S81 A;  3NUM A;  1BTX A;  1S6H A;  5FX5 A;  3M5N A;  5JBA S;  4I8H A;  3S9B A;  5FBE A;  5DKM A;  2ALP A;  4FOU C;  4Z0K A;  1XUH A;  1GBM A;  2DE9 A;  1GWA A;  1S85 A;  1FMG A;  1ANB A;  2XTT B;  3S9A A;  4ABI A;  4IC5 A;  3TGK E;  1P9U A;  3SGB E;  2TRM A;  2KAI A;  3K6Y A;  4D7F A;  4A6L A;  1AFQ C;  1P11 E;  2YOL A;  1J15 A;  4HTC H;  1JBU H;  3F0O A;  4D7G A;  1G2L A;  5EIY A;  2VU8 E;  2PUQ H;  3QX5 H;  4K69 A;  3RXO A;  2KZ4 A;  1AO5 A;  4B2B A;  1VGC B;  3A83 A;  3IG6 B;  1ESB A;  4CH2 B;  2VBC A;  4BXS A;  3S9C A;  4A1T A;  1NFU A;  4X6N A;  1ARC A;  2GV6 A;  3A84 A;  3GY6 A;  3GY8 A;  1Z8R A;  1EZQ A;  2VB0 A;  3TH2 H;  2J95 A;  3OEH D;  1A5H A;  2BD5 A;  1NM6 A;  1G3E A;  1LCY A;  3I29 A;  3MNB A;  1SMF E;  4FET A;  1IQN A;  4KTC A;  1ANE A;  4Z6A H;  3E0P B;  4GAW A;  1HXF H;  1C1Q A;  1VGC C;  3FKS D;  1NS3 A;  1EUF A;  4I8J A;  1YPK H;  2JH0 D;  1HBT H;  4THN H;  3RLY H;  1PPC E;  2A4R A;  3M61 U;  4H6S B;  1E79 D;  3UFA A;  2KFW A;  2PFE A;  3RC6 A;  1SB1 H;  5F53 A;  2F9N A;  3V13 A;  4DW2 U;  5FPY A;  1J16 A;  1K1P A;  4MNY A;  4INH A;  3WY8 A;  1C1V H;  1VIT G;  2BOH B;  1K1O A;  2OTV A;  2GKV E;  2SGF E;  3MH7 A;  2AER H;  4KTS A;  1KSN A;  1K1J A;  2BDY A;  2GT7 A;  3UNR A;  3RP2 A;  1O5E H;  2WSS D;  4ZH8 A;  1Z71 A;  1A2C H;  4HI3 A;  3SU4 A;  1GI2 A;  1O39 A;  1WV7 H;  2BLV A;  9LPR A;  1QJ6 B;  1VR1 H;  3LT3 A;  3GYM A;  2P16 A;  1O2Y A;  1V2O T;  3NRL A;  1T32 A;  2H9T H;  1A4W H;  3KYF A;  2D26 C;  1W7G H;  1C4U 2;  5C1Y A;  1M9U A;  3RXD A;  1V2L T;  3RXP A;  2BYA X;  3PB1 E;  3UUZ A;  1KYN A;  1ZSJ A;  5F6M A;  2UUJ B;  1SQO A;  3DA9 B;  1A7S A;  4ZAE A;  3FAO A;  2Z9J A;  1A5G H;  4IMQ A;  3U8O H;  1THS H;  2PKA A;  4A92 A;  2VIQ A;  4OS5 A;  1GHB G;  1GI6 A;  1J9C H;  3LGW A;  1OWK A;  3E91 A;  1GHX H;  2F9P A;  1F5L A;  1IHS H;  4MTB A;  3UQV A;  4ABE A;  1C1O A;  4Y76 A;  1P2K A;  1EZX C;  1HIA B;  1PPE E;  1PQA A;  1SL3 A;  4ABD A;  1HDT H;  3OTP A;  4DIH H;  2QF4 A;  1BTH H;  3A7Y A;  2C8Z B;  1BJU A;  1QIX B;  1TFX A;  5ESB A;  5FBI A;  1W13 U;  1CA0 B;  4YTA A;  2ODQ A;  1FPH H;  3RXF A;  1O2N A;  3T2N A;  3GDS A;  3BTH E;  3GDV A;  3M7Q A;  1K21 H;  4X2Y A;  3QTV H;  1L1N A;  3MOC A;  1CBW B;  1TE0 A;  3F9F A;  3A8C A;  1YC0 A;  2GT8 A;  1WTG H;  4UFD H;  4UFE H;  3ZV8 A;  1C5N H;  2PTN A;  3E16 B;  1WDI A;  2NU4 E;  2BMG B;  2SGE E;  1GVK B;  2G51 A;  3TK6 A;  1C2M A;  2BM2 A;  1CA0 C;  4UFF H;  1G3B A;  5EJ1 A;  2VWM A;  1QB9 A;  4DII H;  4X2X A;  2G52 A;  1F7Z A;  2PP6 A;  3BTM E;  1YLC A;  1NRO H;  2AGG X;  3MNX A;  1TGS Z;  1P06 A;  3TIT A;  1DSU A;  1G3D A;  1AMH A;  3LPR A;  4B74 A;  1GL0 E;  1CBW C;  4OGY A;  4INK A;  2QV1 A;  3ZVA A;  3RU4 T;  4RKO B;  3RXC A;  3U1J B;  2UUF B;  2ZHD A;  4FVB A;  1O32 A;  4WWY A;  4WMD A;  2AH4 X;  2M2A A;  3KNX A;  1P10 A;  3F9G A;  3JZ1 B;  2KCP A;  1ELD E;  1CQQ A;  1GI0 A;  4YZU A;  1ZLR A;  1CO7 E;  4BAO B;  2H5D A;  3W95 A;  1OWI A;  5JYI A;  3LIW A;  1PPH E;  1GI8 B;  1OPH B;  4X6O A;  4Y0Z E;  1TMT H;  5A0A E;  2G8T A;  1KLI H;  3U69 H;  5C67 A;  2B5T B;  2ZQ1 A;  2VVV A;  3OE7 D;  1D3D B;  1C5S A;  2CGA A;  3BTT E;  5IYT A;  1O3F A;  1O3M A;  3WWB A;  5E8E H;  2ANK H;  2ZPQ A;  3QGN B;  2W6J D;  4Q80 A;  1TNH A;  2Y5F A;  1LTO A;  4IC6 A;  4Y6D A;  2P8O B;  2QF3 A;  3Q3K A;  1XUF A;  1TQ0 B;  1V2M T;  4H42 U;  5DP6 A;  1JOU B;  1NRQ H;  1SLW B;  3RXR A;  5B6O A;  5DG6 A;  1UJ1 A;  2PHB A;  3ZZ3 A;  3P95 A;  2ZTZ A;  1GBA A;  1WCZ A;  4LZ1 H;  3ZYD A;  3SNB A;  3RXB A;  3VB6 A;  2Z3D A;  2ILN A;  2KX4 A;  2HOB A;  3L3T A;  1O2Q A;  5HM2 A;  1E38 B;  4WY3 A;  1O3D A;  4JMY A;  4ZHL U;  5EXN A;  1OP2 A;  2F9U A;  3LGI A;  1N6X A;  2P8O C;  2Z3E A;  2A4G A;  2JIZ D;  3MH6 A;  3I77 A;  3DSO A;  2Z9L A;  1C5T A;  1YLD A;  1HYL A;  2OLG A;  2ZZU H;  1DM4 B;  4F4O C;  1LMW B;  4TPI Z;  4GSO A;  2SNV A;  1FY5 A;  1GMD F;  1O36 A;  4WME A;  2AMQ A;  3SOS A;  3UTU H;  3RXQ A;  4IGD A;  2P95 A;  1ZHR A;  2FI4 E;  4NIV A;  3F2G A;  1IOE A;  1L4Z A;  1PPZ A;  4Q7Z A;  2RCE A;  2UWL A;  2WV5 A;  4O03 A;  1XVM A;  2AMD A;  1TPO A;  3RDZ A;  3HAT H;  2IPQ X;  4I7Y H;  1OWJ A;  2ZTX A;  4CR5 A;  4B75 A;  1C2L A;  1RTF B;  1XX9 A;  2WPJ S;  3PWB A;  2P93 A;  1W0J D;  3BTK E;  1C2G A;  4X2W A;  4AOQ A;  2VIO A;  1NFY A;  5FPT A;  1QQU A;  1CE5 A;  1C1N A;  1P8V C;  2VIP A;  1CA8 B;  1ZMN A;  3STI A;  2FYR A;  4XRN A;  2ZKS A;  1P12 E;  2EI8 A;  2THF B;  2G81 E;  1TYN A;  2WIN I;  1IQL A;  1O3E A;  3GCO A;  1UO6 A;  2RFK C;  3BTG E;  1GJD B;  1YLN A;  1GBB A;  4NIW A;  3NWU A;  1HAV B;  8GCH F;  2FO9 A;  4X2V A;  1T8L A;  1SLV B;  1UTJ A;  5C94 A;  1P0S H;  1HPG A;  4B2A A;  4HZH A;  4WMF A;  1UTP A;  2BQ7 B;  4X1R U;  2XRC A;  1O2S A;  1TAW A;  1O2K A;  2OBQ A;  2G4T A;  3LH1 A;  1LKB A;  1D6W A;  1W11 U;  2FM2 A;  3SJ8 A;  1TRN A;  2A32 A;  1C5P A;  4IN1 A;  2O8M A;  2OC1 A;  3FAN A;  3U8T H;  1EPT B;  1JIR A;  1OWH A;  1QRW A;  2A5K A;  1GBE A;  1GGD B;  5JB8 S;  1HV7 A;  2FYQ A;  1FIZ A;  2FES H;  4GPG A;  1S6F A;  3NXP A;  2UUY A;  1LPG B;  3RXH A;  3UAI C;  5AFY H;  5JDU B;  2F9O A;  1Z6J H;  1ETT H;  1SGY E;  1LO6 A;  3MU8 A;  5SGA E;  1YY3 A;  1Y5U T;  3TVJ B;  3SHA H;  1G32 B;  4ABB A;  1YWU A;  5F8Z A;  3QWC H;  1QQ4 A;  3DHK H;  2FIR H;  1EPT C;  2CJI A;  4CBO A;  1BIO A;  1NES E;  3HGN A;  1GGD C;  1O5F H;  1MKW K;  3OY5 U;  2BD7 A;  2FS8 A;  4E06 H;  1EOL A;  1YPH E;  3SND A;  3ZVE A;  1V2Q T;  2PV9 B;  1TGB A;  5LPR A;  2HNT F;  2SGQ E;  1BDA A;  2ZWL H;  3P8N A;  4UON A;  2BX3 A;  1UW7 A;  4GUX A;  3D65 E;  1SR5 C;  2ZI2 H;  3RXK A;  1LHG H;  1WU1 A;  4LOY H;  2KM0 A;  1VIT H;  2XWA A;  2STB E;  2ZA5 A;  2ZP0 H;  1O3N A;  1C2J A;  1N6Y A;  1ESA A;  3KID U;  3HGP A;  3KQ5 A;  4MPU A;  5GXP A;  9EST A;  1V2S T;  2PSX A;  3V0X A;  4ABJ A;  1QBO A;  1ZPB A;  2J98 A;  1COW D;  1KDQ A;  5T6G A;  2GJG A;  2BDC A;  3EA7 A;  5H4I B;  3RU4 D;  1K22 H;  4XSK U;  3BEF B;  3P17 H;  4CHA B;  1V2P T;  1GDU A;  1EJM A;  4WXV A;  5AHG H;  2V3H H;  4UE7 H;  5LPF A;  1UHB B;  2Y6T A;  3V3M A;  2WYG A;  3GIS B;  1FY1 A;  3M5L A;  3SU0 A;  4IS5 A;  1T8N A;  1YPH C;  2XC5 A;  1LPZ B;  4CBN A;  4E7N A;  1F5K U;  1PQ8 A;  4U2W A;  3HK3 B;  1MTS A;  4TPY A;  3TU7 H;  3MHW U;  1SQR A;  1GBT A;  2ZCK P;  1ZGV A;  2V7Q D;  1NRN H;  1EAS A;  1GCD A;  3BG8 A;  4NG9 H;  4D76 A; 
#chains in the Genus database with same CATH homology
 4P02 A;  3CNR A;  5EJL A;  4RT1 A;  5EJ1 A;  3KYG A;  4HG6 A;  3DSG A;  4XRN A;  4P00 A;  5EIY A;  5KEC A;  3KYF A;  2RDE A;  4F48 B;  4FOU C;  5EJZ A;  1YLN A;  5KED A;  4I86 A;  2L74 A;  1YWU A;  5KGO A;  4RT0 A;  2GJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...