5LGOA

Trypsin inhibitors for the treatment of pancreatitis - cpd 15
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin inhibitors for the treatment of pancreatitis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lgoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lgoA02
1DSTA 1YPLH 2XNIA 3IG6B 4XOJA 2FZZA 2J4IA 4BAQB 1YPGH 5FBIA 4AGJA 4AG1A 2UUJB 3DFJA 3UWIA 4IN2A 2Z94A 2Q6GA 4TPYA 4NG9H 3HGNA 1QNJA 2XC5A 1MQ5A 2A32A 1GJDB 1WTGH 4YM9A 3SU0A 1A61H 1C1RA 3RXFA 1IQKA 3UQOA 1T8NA 2P8OC 1XVOA 2ANMH 1C1MA 1N8OB 2ODQA 1V2RT 1YCPH 1RIWC 5J4SA 1EPTA 3PM3A 2ZZUH 1LPKB 1UCYH 1SL3A 4YLQH 1EP5A 1ZRBA 2W26A 1FN8A 3F9HA 2RA3A 3M37A 3EA8A 3PWCA 1NFWA 1O0DH 1O3DA 1AZZA 1O2PA 2PGBB 3RU4T 1ABIH 3QWCH 2FOCA 3SV2H 1FIWA 3GICB 4Y0ZE 2VWOA 3BN9A 2Q6FA 7GCHG 1T7CA 1OWJA 4B76A 5E8EH 3SO3A 1ELAA 1C1OA 2CMYA 1K1NA 2J38A 2XWBI 2QGRA 5C67A 3BTQE 3DT0H 4DW2U 3O8DA 3SBKA 2O9QA 1KLIH 1V2MT 3RU4E 3VXEH 5L30H 3HKJB 1G2LA 1LQEA 2A4QA 3A7TA 1AFQC 1AD8H 1MQ6A 3NCLA 1AIXH 1H9IE 1IHSH 5TJXA 3AASA 1ZZZA 1BUIA 1CHOF 2ANWA 1DLKB 2FWWA 2FXRA 1VCWA 4Y7AA 4JYUH 4LZ4B 3ZYEA 1DSUA 3C1KA 1GJ4H 1O39A 2SNVA 2VB0A 1T4VH 1LPGB 1G3CA 4FUDA 3SJ8A 3OTJE 4K5ZA 3UNRA 1T32A 1O5AB 2BMGB 5L2YH 3QUMP 3NZIA 2ANKH 1YPKH 4M7GA 3P8NA 2PGQB 3PROA 3E90B 3E0NB 5A2MH 2SGPE 4O3TA 1A5IA 1G37A 2VGCB 4Q7XA 1NT1A 3SJOA 1GI0A 3EQ0H 5PTPA 4AX9H 1WOFA 2BD4A 1FY4A 1K1LA 5ESBA 1XUIA 2J2UA 3AAUA 1ACBE 4BXWA 1TFXA 4OS2A 4X6MA 3TNTA 3QO6A 2BLVA 1O3KA 1WYKA 3M5LA 1PYTD 1THSH 1PPCE 3E3TA 1XX9A 5SGAE 2K1QA 1OOKB 1EZQA 1GMDG 2GZ9A 3F6UH 1P2OA 1W13U 3OSYA 1JXPA 1D6RA 5A0AE 2XW9A 5EW2H 8KME2 1TRYA 4ABGA 2B0FA 2HNTF 2HGTH 1TAWA 3MU8A 1TRNA 1Y59T 3FP6E 3ODDA 2OC0A 4Y71A 4FU7A 3LGTA 4JZIA 1SQTA 2WUBA 3SQEE 4X6OA 1EOLA 4TWWA 1X7AC 3BTHE 3SUFA 3GDSA 1IHTH 1BRCE 1AGJA 2SFAA 4K2YA 1T4UH 2EI8A 2SGDE 3B9FH 1T31A 3KEEA 1GVLA 2G5VA 3MH6A 2G51A 3P70B 5EPNA 3SU1A 1QQUA 2ZDMA 1AWFH 1GMHF 3HPTB 1S83A 2Y5HA 1W3CA 4A7IB 3S9AA 1H8IH 2ZHFH 3RXSA 4MPVA 2UUKB 2OINA 1O3BA 5AF9H 1UCYK 3H7TA 4A6LA 3SQHE 1D3TB 2O8MA 1EB2A 1NFYA 1F2SE 1ID5H 2Z9KA 3GCTF 1DICA 4NWLA 1C1VH 1TBZH 2Y6TA 1Z8JB 4HI3A 2QIQA 1FMGA 1XKAC 1XUHA 7GCHF 1XKBC 8GCHF 1IQGA 1P3CA 2F9NA 2VNTA 1GJBB 1LHCH 2ZEBA 3RLWH 2XBYA 4X1QU 4R0IA 2XCNA 1LHEH 1O31A 1IAUA 1LO6A 1GWAA 1K2I1 4J2YB 4DIHH 3SV7A 4CHAC 1HAHH 4B75A 1FN6A 5A0BA 5GXPA 4CRCA 3L6PA 2R3YA 3W94A 1AVGH 2ZCLP 3OY5U 2BQ6B 1FNIA 5JB8S 4MNWA 1O2NA 1O3AA 1EJMA 4CRGA 1C2GA 1DWEH 3ZZ7A 2J34A 5L2ZH 1GVZA 1WTHD 1AHTH 2Y81A 3PMJA 1EAUA 1MTSA 3GOVB 4LOYH 1O3MA 2JETB 4FVBA 4FXGH 4WF8A 5FCKA 3MH7A 5BPEA 5K0HA 1YCPM 3I78A 1G2MA 4ABAA 2Z7FE 2HPPH 1TPAE 1HAVA 3U8TH 2OXSA 4LZ1H 5LGOA 2WV5A 1O3LA 1OYQA 3LGUA 4NA9H 1MBQA 2O8UA 3VB7A 3MO6A 1KXBA 1C4Y2 1HPGA 1ZMLA 2CHAC 3MI4A 7KMEH 1O36A 2A7HA 2WPLS 6LPRA 2D2DA 4MNYA 2NU4E 3S9BA 1NS3A 2OUAA 1SGDE 4JMYA 2YNBA 4AYYB 3SUEA 1P8VC 3TGKE 1BMMH 1DANH 1UTLM 2XBWA 1H1BA 4X8UH 2Y82A 2CXVA 3D23A 2XCFA 1P04A 4B71A 4GVUA 2R2WU 2A0QB 1SGPE 3N7OA 1AU8A 1BTYA 3DA9B 3NPSA 3ATLA 4X2VA 3TK6A 1GMDF 3ZZ4A 2FOHA 3TPIZ 5JBTA 4INLA 1GBIA 2QY0B 2D8WA 3A8DA 3T28A 2ZU1A 5EOKA 1KLTA 2BDYA 6GCHG 1SPJA 5GPIB 2VIQA 2ZDLA 1INCA 3BEFB 1WUNH 4WVPE 1P57B 4K8YA 1IQJA 1O3CA 3LGWA 2BD3A 1C2MA 4AB8A 3B23B 1XUGA 4HFPB 1RTFB 5C20A 3T25A 3A87A 5GDSH 3P6ZB 2ZGXH 3GY4A 3S0NA 1UHBA 2GVFA 4LK4A 1UVUH 3M5MA 2ZFTA 3ZZ3A 1HYLA 1UK3A 2SNWA 3SOSA 5FX6A 3AW1A 4BTIB 1KIGH 2V0BA 3BSQA 5HGGA 3S7KB 1SGRE 4D76A 4NZQA 1HJAB 4OS4A 2VJ1A 1XVMA 3A7XA 1TNLA 4JCNA 1O2MA 1SQOA 2YOLA 1C1QA 2BX4A 2AGIX 3HATH 1C1WH 1K1MA 2BLQA 3F68H 3UOPA 3H5CB 1TMTH 2D1JA 1YPEH 3SU5A 3KHVA 2GP9B 2A4OA 3MNCA 1GI2A 3EE0B 4MVNA 4U2WA 2CGAA 3PO1C 1TMUH 4BAHB 1FY5A 1O2LA 1UTNA 2FLRH 2PV9B 4IW4E 2VINA 1GMCG 4I33A 2A4GA 1D6WA 2VVCA 1QA7A 3KQEA 3GDUA 2BOKA 2VIPA 1CVWH 1JMOH 1CA8B 1CGIE 1FONA 1RRKA 3GY6A 1DWBH 2GKVE 1HRTH 2CV3A 1MU6B 1IQEA 4NA8A 1MZAA 3A7ZA 4AORA 1Z71A 3EGKH 1Q2WA 2GCHF 1OXGA 1W10U 4E7RG 2A45B 1ELDE 2ODPA 1LVMA 3GY8A 2Y7ZA 1YPMH 2W3KA 1TQ7B 2FYQA 5A8XA 3BTFE 1BHXF 1F0RA 1MU8B 3ATWA 3UPEA 2GCTC 2GGVB 4IMQA 5G4BA 2THFB 4ZUHA 1Z8GA 4Y7BA 2BY9X 4UFDH 1LVBA 4KELA 1CA0C 4QT8C 1K1IA 4AZ2B 2Z3EA 2PW8H 1C1PA 2OC1A 4I7YH 4X8TH 5T6DA 1S85A 2BHGA 1O3HA 2P3UB 2AIQA 3ZVCA 1NRNH 2STBE 1Y5BT 4IN1A 1SHHB 1VCQA 1W14U 3T5FH 1JWTA 1ARBA 2ZU4A 4DJZB 2Q1JA 4K1TA 1AUTC 4I8KA 2GMTB 1B7XB 5LPRA 1HXFH 1ZR0A 3VFEA 2AMQA 3ZVFA 1YLDA 5DKMA 2J94A 5CHAC 3VB4A 1FQ3A 3ITIA 1SOTA 3TGIE 2OCVB 1O37A 2A1DB 1FY8E 4ISHH 4Q80A 4CH8B 2RDLA 1C5YB 4RKOB 1C5WB 1NPMA 1THPB 2VVUA 4YTAA 4DY7B 1YPJH 2ZDVH 2GX4A 1GBLA 4JK5A 1HNEE 2ZQ1A 4AN7A 1YCPK 3RLYH 1SLVB 1D4PB 1C2DA 1QRZA 2RA0A 1CE5A 1DWCH 1KSNA 4K1EA 1EJNA 2NU1E 1PQ5A 2W3IA 3RC5A 3A8AA 2QF3A 2A5KA 3GYMA 1JIMA 2I6SA 1TMBH 2JH0D 3MU5A 2VWLA 1ZMNA 1YYY1 1BDAA 4A1VA 1C9TA 5FPYA 2BQWB 5LPEA 3VGCC 3SJ9A 3U1IB 2P8OB 1ANCA 1EOJA 4NA7A 2VIDA 3ZV9A 2C8XB 1K9OE 2ZHQH 3SGBE 1O5CB 2CN0H 4THNH 1A0JA 4YT6H 1FUJA 3M5OA 2UWOA 2AMPA 4NIWA 1O2UA 1IQLA 4ZAEA 5GWZA 3M35A 1GPZA 3KQDA 4JK6A 1HJ8A 3A80A 3TGJE 2BDGA 3DHKH 1XUJA 5C2ZA 1BRUP 1MCTA 2WPIS 2PKAA 1DXWA 1KDQB 2ESTE 3RMMH 4AOQA 1SGTA 2C93B 5DP8A 3SHAH 5BRRE 4CRAA 1SSXA 3A82A 1IQMA 3SHCH 1IQNA 5JBAS 1ZSKA 1BHXB 3GYLB 2B8OH 1YBWA 1KY9A 1SGCA 4JZFH 1UVTH 4YZUA 1JRSA 3M7TA 1QRWA 3SORA 1PJPA 4ISNA 3ZZDA 5FBEA 5AVDA 1C5UA 1NZQH 3S9CA 1ANEA 5H4IB 3MH5A 1BT7A 1MAXA 1O3PB 5EXLA 3U98H 1JRTA 2FS9A 1BTPA 3ZZ9A 1W2KH 2WV4A 3SV8A 3ZZBA 2ZP0H 1MKXK 1P03A 1GCTB 1UJ1A 1J14A 3TU7H 1Q31A 5AHGH 1Y3XA 3PLPA 3RXJA 2PKSC 5GCHF 1DOJA 2QAAA 1UCYE 2EA3A 3F1SB 1FLEE 1GI6A 1U6QA 1QL7A 1A3BH 2GV7A 1TIOA 3L3TA 1ZJKA 3RXVA 4E05H 2BDBA 1WCZA 1AE8H 1DITH 4OS5A 2F9BH 4ZROA 1BRBE 2VIWA 2G00A 1TOCB 4TPIZ 1D9IA 4X8VH 5F8TA 4GCHG 5HYOA 4I32A 3U69H 1UTMA 3MOCA 2D26C 3M3VA 1OP2A 1BTUA 4DVAU 2H5DA 2FTLE 1O5FH 2B7DH 3AW0A 1K22H 4UFEH 5EQSA 1LHFH 4CRFA 1O3IA 3AAVA 3R3GB 1PQAA 5C5NA 1UO6A 1TALA 1O3NA 4I31A 1NU9A 1DE7H 2JETC 1TGNA 3BEIB 3GISB 1NM6A 5EQRA 1KLJH 1AI8H 3LOXA 2HRVA 1GHWH 1TLDA 3KQBA 2FS8A 1O2OA 4JYVH 1WQVH 2VGCC 5DP9A 4X2XA 2BVSH 3OU0A 1ZPZA 1ABJH 4K3JA 1IQHA 3HK6B 1YLCA 3MU4A 1XUFA 5FXLA 3ENSB 1YC0A 1QCPA 4ASHA 1MUEB 4CRDA 1Y3UA 5DP7A 1XMNB 4TY6A 2ZDKA 1Z8IB 3L33A 2Y5FA 5I46H 4XBDA 1H9HE 5C1XA 5DP3A 3TNSA 3F9GA 1K1PA 1O2JA 1BTZA 1FAKH 3ESTA 1F7ZA 1MD8A 3Q00A 4F49A 4RN6A 4Y8ZA 3IITA 3U8OH 1IQFA 1FV9A 3RXHA 1F92A 5HXFA 1BB0B 1C5OH 1TPPA 3U1JB 1SFQB 4B73A 1AVWA 2A31A 2WINI 2AERH 3LJOA 4WH8A 3EDXB 3TLOA 2H9HA 1TB6H 2VWMA 3Q77A 1BMAA 4X0WU 2FEQH 1NFUA 2ZPSA 1SLWB 4UEHH 1OP8A 1O2KA 4TYDA 1HJAC 3ZZ8A 2ZGBH 1EP6A 1BTWA 8ESTE 3H7OA 3RDZA 1QL8A 2XC4A 3HGPA 1WV7H 4K1SA 1ESBA 1C2IA 2IN2A 1A3EH 4ABIA 4GUXA 4MPWA 2ODYB 1O2HA 1KDQA 1SQAA 1HUTH 8LPRA 1MTUA 2XRCA 1GI1A 3FVFB 1P01A 2IOTA 2PR3A 2G55A 5A8ZA 1J8AA 1A4WH 3ZZCA 3D49H 3WY8A 1DFPA 4DCDA 3KQCA 1W7XH 4KKDA 3RC4A 3I77A 3PMAB 2GZ8A 2BZAA 3SZNA 1OKXA 1T8LA 1TRMA 2FPZA 1MZDA 2BY7X 1WAYB 3TVJB 4ABDA 4DT7B 1QBVH 1VITG 3A86A 1SFIA 1DPOA 3NK8A 3OX7U 2F9UA 2ZU5A 4A1TA 4IC5A 1C2JA 1WSSH 2ZU2A 3E8LA 1J17T 1SGEE 2AIPA 1HAOH 4YESB 1AO5A 4MTBA 5DP6A 3RXEA 1SGFA 1BMLA 1SR5C 4R8TB 1KXCA 1J15A 1XXDA 5EGMA 3GCTG 3SNAA 1LPZB 3RXBA 1OWIA 1PYTC 5ABWA 1AKSA 1LHGH 3LKWA 4FUCA 5EODA 4RSPA 3UWJH 2FOFA 1RD3B 2EI7A 1MKWK 4Y8XA 3RXOA 1NY22 1QB9A 2ZECA 2ALPA 4DURA 3MMGA 1SLXB 1C5TA 2TRMA 1HAIH 4INHA 4HTCH 3FANA 5DO4H 1BMNH 4ISIH 3UUZA 2J92A 2Y80A 3K6YA 2M5TA 1GI3A 2NU3E 1AKSB 1QJ6B 1TNKA 1PPBH 3RMOH 5HM9A 1MTWA 4CBOA 2ZTYA 3ZVBA 3BIUH 4UONA 1BBRH 4WMEA 1FPHH 1O2QA 1H8DH 4MDSA 1DDJA 2V3HH 1LMWB 3KNXA 1W11U 3PTBA 1Y8TA 3DD2H 4GHQA 1ELFA 1EX3A 1ZJDA 1S82A 3M7UA 1XUKA 1QBNA 2G8TA 1SGIB 4AB9A 1L0ZA 2ZG0H 2GD4B 3HKIB 4I8GA 3UQVA 2WPHS 1GCDA 1EKBB 4ZMAH 2HNTE 9LPRA 3ELAH 1DM4B 1VR1H 2GT8A 1RTLA 1MCVA 1T8MA 3MNBA 1TX8A 3O8CA 1C5ZB 1GBBA 1P12E 1RJXB 4ZH8A 3SNCA 1QRXA 3QGJA 2FOEA 1CQQA 2KAIB 1C5PA 1ZSLA 1YM0A 4FUHA 1VJAU 1K28D 2ZHWH 1GJAB 4Z0KA 3O8BA 4BANB 1C2FA 1FAXA 3T29A 4KTUA 3LH1A 1KXEA 2A2QH 2P59A 1O32A 1SC8U 2G81E 1GBTA 4NIYA 4MQAA 2BDAA 3TK9A 1LKBA 5EW1H 3P17H 2P3TB 1UTKA 3M3TA 1JBUH 2TGDA 3TJOA 1ARCA 4D9RA 2VH6A 1VCPA 2BDCA 5A8YA 4ZKNU 1AB9B 3E1XB 1EAWA 1ELVA 5FPSA 1ZMJA 1SGYE 2OP9A 1C5SA 1L1JA 1GHBG 4BOHA 4H6SB 1SMFE 2PKSB 1L1NA 3JZ1B 5I25A 4ABJA 3MNXA 2AEIH 5C5OA 2ZCHP 3KN2A 2ULLA 2FESH 4BXSA 1DWDH 1SGQE 2GTBA 2J95A 1UVPA 5HMAA 3PMHB 1IQIA 2G5NA 4INKA 4X1NU 3O8RA 1GI8B 2P16A 3A81A 4BTTB 1EAXA 1L2EA 4FUEA 1T8OA 2OBOA 3P8OA 2BD8A 4J1YA 4YT7H 1C1NA 2SGFE 1RIWB 1P9UA 1DT2A 2BB4A 2FI4E 1O2ZA 4WH6A 3KGPA 4ZKOU 4ESTE 3BTDE 2Z9GA 2CJIA 2TGTA 1F0UA 2GZ7A 5E0JA 1VGCB 1XXFA 2KAIA 4AGKA 3FP7E 1S0QA 3ATKA 2UWPA 5EQQA 1ZGVA 1ZOMA 2Q6DA 2A4RA 3T62A 2PTCE 4JZ1A 2ZFSA 3BG8A 1OSSA 5FHTA 2VIVA 5DK1A 2XWAA 1YF4A 4FVDA 4GHTA 1A0LA 2AGEX 4AFSA 6ESTA 3PYHA 1C9PA 5E0HA 1FDPA 1V2TT 3M5NA 1KYNA 3MU0A 1BBRK 4NFEA 3GCHB 1A46H 3TH3H 3RXRA 4ZXYH 4NCYA 6CHAB 1DS2E 4FUGA 1HB0B 2RCEA 2F83A 5E2PA 2C90B 2PHBA 3C27B 3FAOA 3B8JA 1FPCH 1JOUB 1E34B 5DP5A 2BTCE 1C5RA 1GBKA 4AFQA 5ETXA 1ZRKA 2J9NA 1H4WA 3SI3H 3URCA 1J9CH 4UFGH 1P10A 1SGFG 7ESTE 2G4TA 3SNDA 1ANBA 3CP7A 2F9PA 1ZSJA 2P3FH 1GHAF 4D9QA 5F8XA 5DPAA 1ZGIA 2F9OA 1GBAA 3GY7A 2W7SA 1EZXC 1EQ9A 1ELGA 2ZHEH 3F9FA 1GDUA 3FFGA 3PO1B 5FX5A 2G4UA 2IPHA 4X8SH 2QV1A 3STJA 4CHAB 3PLBA 3RXLA 4XBCA 1QFKH 2QCYA 2WUCA 3PB1E 3ATMA 3T2NA 2OC8A 3K2UA 3BTME 1G32B 5DJ7A 4NSYA 1YP9A 1P06A 5CHAB 1BQYA 1YPHE 1C2LA 3CS7A 1O3EA 1OWDA 2VVVA 4K69A 2QN5T 1HIAB 3SN8A 3TITA 4AYVB 2FMJA 1MD7A 4B1TA 3QDZB 2ZGJA 1GHYH 5FPTA 1OWHA 3FZDA 3MNSA 1HXEH 2CF9H 1BOQA 1C5MD 3HK3B 3LPRA 5EU8A 3SJKA 2AH4X 3EA9A 4H6TA 2PKAB 4DOQA 3VEQB 5CMXH 1TBRH 5JPMH 1C1TA 2PSYA 2BVXH 4U01A 1E35B 1PFXC 5T3HA 4U32A 3LDXH 4FUFA 1CHGA 1VGCC 1MH0A 3LIWA 4Y79A 3UFAA 3RXAA 2ALVA 2SGQE 2HALA 3RM0H 4FU8A 2A7CA 1Z1JA 1P2JA 4FUBA 4I8LA 1FZZA 1ZPBA 2QA9E 2ZI2H 5EXMA 4Q7ZA 2V35A 2FX4A 3Q3YA 1TPOA 1XM1A 1EJAA 2AFQB 1EPTC 1V2LT 1VITF 1Y5AT 2AYWA 2H9EH 4YOIA 1KXDA 3U9AH 5E0GA 2FOMB 2SGEE 1V3XA 1VJ9U 5IYTA 1S84A 1TGSZ 3E0PB 4GAWA 1O2TA 1UTPA 1P11E 2H1UA 1HJ9A 2XBVA 1TGTA 2VU8E 1P9SA 4ABFA 3TH4H 1V2PT 1QHRB 4JZDH 1MMJN 3EA7A 1C1UH 1LCYA 2R9PA 2ZDAH 4UFFH 1QL9A 2JH6D 4XDEA 4OS7A 1P02A 2IJOB 1E36B 4I8HA 1LDTT 1DXPA 3U8RH 4XFQA 2GT7A 3TJVA 2P93A 2STAE 1C5LH 1GBFA 1C2HA 1GBEA 1OPHB 3BEUA 1BA8B 3KCGH 2ZNKH 2WYGA 1AY6H 1TONA 1TABE 3V3MA 1O33A 4X1PU 3T26A 3QTVH 1B0FA 2QC2A 1W7GH 1MTNB 1H9LB 4K8BA 5E2OA 3NUMA 1P05A 3RUOA 2ZGHA 1Y5UT 1OYTH 1PQ8A 1O34A 2ZGCA 4TWYA 2ZKSA 1BIOA 2BDHA 2BD2A 4IBLH 3QN7A 1FXYA 1TA2A 1K1JA 1N8OC 4ZKSU 3RXMA 3OYPA 2GMTC 4K60A 3SU2A 1GBHA 1N6XA 1AB9C 4X2WA 1QQ4A 1MBMA 4AFZA 2BD9A 2BVRH 1NC6A 2FYRA 1Z6EA 1C5XB 1ZTLA 3MO3A 1TNHA 1TPSA 1QIXB 4ZHLU 3TH2H 3M61U 2H6MA 1YPHC 3BF6H 4SGAE 3IWMA 1HIAA 1GMHG 1WU1A 1ELBA 1ZHRA 1GCTC 2PUQH 3SGAE 1UTOA 3RXQA 1C5NH 1GHVH 3I29A 4OS1A 4WMDA 1QBOA 2PWXA 3ZYDA 1A5GH 1K21H 1AZ8A 2Z9JA 1G3BA 1HLTH 1ZPCA 1ZLRA 1DLEA 1ELCA 3LONA 6GCHF 2FO9A 1D3PB 1GGDB 2R3UA 1GBMA 8GCHG 1ESAA 2GV6A 4FUJA 1QY6A 1EAIA 1HAZB 4ZXXH 1L4ZA 4LXBH 4CH2B 3BTKE 1TNIA 4DGJA 4H42U 4TY7A 1GMCF 1HBTH 4IC6A 5J4QA 2FOBA 2ZU3A 2UUFB 3V7TA 1W0YH 1NESE 3LGYA 4YLUA 3SU3A 3ZV8A 2AGGX 2DUCA 1O35A 2WPMS 2BZ6H 4WY3A 2FI5E 1HAXB 1C5VA 2P95A 1Y3YA 1BBRE 1P2NA 1C2EA 2R0KA 1QA0A 3QZQA 3RMNH 1GJ7B 3BG4B 1F0TA 1GI9B 1ETSH 1P09A 1Z1IA 4KP0A 1GHXH 4XSKU 5F8ZA 1GG6B 1GJ9B 1SI5H 1GGDC 4IMZA 1HV7A 2BYAX 5GJ4B 3SJIA 4X6NA 2OBQA 3M3SA 4AG2A 2A7JA 1GDNA 1QJ7B 3V0XA 2V3OH 3LC3A 6CHAC 1O30A 3QGNB 3ZVEA 1GI5A 4MG3A 1ELEE 3ZZAA 4YOJA 1NN6A 1IOEA 1BTXA 1HDTH 1V2VT 3A8CA 3D65E 3P92A 1AFQB 1PPFE 2BXTH 1GHZA 2XC0A 1CT2E 1O2YA 4CBNA 2ZFPH 1GBCA 2QF0A 3PWBA 4D7FA 3SUDA 2WPKS 3BG4C 3E16B 5JB9S 3V12A 1NRSH 1RS0A 4VGCC 1CO7E 1GI4A 3EAJA 3GY2A 2ZPRA 3TK5A 1EATA 3BIVH 4Y10E 1F5KU 4BTUB 3GCNA 2LPRA 4SGBE 1SVPA 3UNSA 4KTCA 1AWHB 1OWKA 4CREA 3SW2B 2C8WB 2O8WA 1AUJA 2Y7XA 3JZ2B 1ZYOA 5TCCA 2TGAA 1HFDA 1HAYB 2WPJS 2JKHA 5ESTE 3MH4A 2W7UA 1AN1E 1EXFA 2TGPZ 4E7NA 5JDUB 4UDWH 1BTHH 4NIXA 1EZUC 2BLWA 1BZXE 3UIRA 2H5CA 1TE0A 4CR9A 1O38A 1E38B 2OQ5A 1RXPA 1V2UT 1O2XA 1Q3XA 1TGCA 1Y3VA 2ZTZA 3PTNA 4GPGA 3NXPA 5T6GA 3VPKA 4A5TS 1SOZA 2OLGA 1THRH 4F4OC 1LVOA 2XYAA 1YKTA 1J16A 3LGIA 1CBWB 1F0SA 3A8BA 1HAVB 2Y5GA 3M7QA 1V2JT 2HNTC 2EI6A 1ZTKA 2NU0E 5DG6A 2F91A 1JIRA 1DX5M 1TOMH 2R0LA 2QXGA 1M9UA 4WWYA 1AVXA 4NGAH 1FY3A 2QXHA 2ZA5A 1KXFA 2FLBH 1P2MA 2HOBA 2Z6BD 2ILNA 1AE5A 3OY6U 3KF2A 1N6YA 1OWEA 2FOGA 1QB6A 4FU9A 2TIOA 2FM2A 4UD9H 5LH8A 1NO9H 1C2KA 1DUAA 2F3CE 2ZWLH 4ZHAA 4BAKB 4YOGA 3LC5A 4OGXA 2AMDA 3SNEA 4O3UA 3P95A 4Z6AH 1FI8A 2O8TA 4Y11E 1LQDB 3VB6A 2W5EA 3K6ZA 1WQSA 2RG3A 4Q2KA 9ESTA 1KTSB 4WXIA 1GBDA 2BY5X 4KTSA 5JYIA 3RU4D 3LU9B 1E37B 1NROH 4DIIH 2V6NA 3ZVGA 1MTNC 3SNBA 1QURH 1QB1A 1F5LA 2C8YB 2ZIQH 1PQ7A 4JZEH 1GG6C 4ZKRU 4IS5A 1GJ6A 1ZHMA 4MNXA 1P3EA 3GY5A 2HVXA 3A85A 1CSOE 2BLOA 3FZZA 2H2ZA 1EASA 1RFNA 1SB1H 2CF8H 1BJUA 1G3DA 1MKWH 2BX3A 2HPQH 2FODA 2PFEA 4NIVA 3T27A 4CRBA 1UK4A 3ZVDA 1S5SA 2ZCKP 2HLCA 1GJCB 1WBGB 1GHAG 4WJG2 4A1XA 1LTOA 3TJUA 2BM2A 4PROA 3VXFH 1D3QB 4X6PA 1TA6A 2QXJA 3K9XB 1MTVA 2Z3CA 1GL0E 3UR9A 1B5GH 3CS0A 5K7RA 1ELTA 1TGBA 4MNVA 3GCHC 3P8GA 2ZO3H 3GY3A 2WYJA 5CE1A 1CGJE 2FI3E 1S6FA 1HAPH 3G01A 1GHBF 2PUXB 1O2VA 5L6NH 3Q3XA 4Y8YA 2ZFRH 3ZVAA 2VWNA 1O2WA 2GDEH 2VH0A 3KIDU 4KGAA 3DFLA 1V2KT 3UREA 1L1GA 4JYTA 3UOUA 5T6FA 1N1LA 2P94A 3BV9B 2C4FH 1BJVA 3SI4H 5LPFA 4I8JA 4NZLA 2FDAA 1TYNA 1UTQA 3NKKA 5EG4A 3RXGA 1TX7A 4O03A 2DE9A 4O97A 1TWXB 2G52A 3UTUH 1V2ST 3VGCB 2HWLB 3RMLH 2A5AA 4UE7H 4Y6DA 1L4DA 5AFYH 5EPYA 2OC7A 1UVOA 1LHDH 1NU7B 3VB5A 5GCHG 3M36A 3FP8E 2BY8X 3NWUA 1TX6A 1ZTJA 4BAOB 3RXIA 2C3SA 1C1SA 3RXDA 2QXIA 3A7VA 3P8FA 4X1SU 3PLKA 1UVSH 1DY9A 1AMHA 1QR3E 2ZDNA 1W8BH 1CA0B 2ZHDA 5A0CA 1G30B 2UWLA 2FOAA 3MWIU 5B6OA 1UHBB 2EC9H 3RC6A 2BXUH 4HGCA 4A92A 5JBBS 4ABBA 3MTYA 1Y3WA 4ISLA 1PPGE 2BDIA 3A89A 4HZHA 3ZZ6A 2PLXA 1TNJA 5JBCS 3QTOH 2H9TH 4WXVA 1NRPH 4O9VA 2NU2E 1O2IA 1G36A 3RXKA 2DE8A 1O3OA 3LGVA 4ABEA 4D7GA 3D62A 3MHWU 1P2QA 1PPEE 1FIZA 1A1RA 1SLUB 3ZZ5A 1E0FD 2ZQ2A 1CHOG 1G9IE 1ZHPA 3QZRA 2ASUB 5TCAA 1O2GH 4B2CA 1O5GH 3SV9A 1S6HA 3SU4A 1W12U 4IGDA 1C5QA 3KL6A 5F03A 1A2CH 4ISOA 1EZSC 1KXAA 3W95A 1QGFA 2AS9A 1OS8A 1RGQA 1DVAH 3A83A 5C1YA 3SU6A 3RXTA 2Z9LA 1S81A 3RP2A 4XBBA 2XTTB 1EPTB 1GDQA 1OX1A 1SHYA 1OP0A 1BITA 1ESTA 4DG4A 1FJSA 5AFZH 1LVYA 1V2NT 3A84A 4B2BA 2ZPQA 3BTEE 2LNCA 1VZQH 1Z6JH 2ANYA 2QYIA 3E6PH 3MFJA 5A09A 2UUYA 1QJ1B 1GJ8B 3LT3A 5C3NA 5EXNA 1ETRH 1A0HB 1O5EH 1MAYA 1CGHA 1V6DA 3CENA 1O2RA 3MYWA 1O5BB 2F9VA 1V2QT 3BTTE 4U30A 1V2WT 7LPRA 1B0EA 1VITH 4B2AA 2BQ7B 4NWKA 1PPZA 1DUEA 3EYDA 3V13A 1BRAA 2PSXA 1CBWC 3UR6A 1HCGA 4CR5A 2GCTB 1O3JA 1C4U2 1O2SA 3URDA 1A7SA 1D3DB 2BY6X 2ZFQH 2O8LA 2Z3DA 3TIUA 3RXPA 1NFXA 3QK1A 3SGQE 2NWNA 5HM2A 4GCHF 2ZC9H 1O3GA 3SV6A 3S7HB 1O5DH 3RXUA 3STIA 2I6QA 2ZFFH 5DP4A 3AVZA 2CHAB 1ORFA 3GCOA 1ANDA 1EB1H 1UK2A 2YNAA 2JH5D 1GVKB 2B5TB 4Q7YA 2FX6A 2ZF0H 4RKJB 3TJNA 1NRRH 2C8ZB 1P0SH 2SGAA 4XE4A 4GLYA 3UNQA 2OTVA 3RM2H 4OS6A 3LH3A 3RXCA 2Z9IA 3PV4A 1MKXH 1BCUH 5GIBA 1EUFA 3S69A 3QLPH 1SGNE 3K65B 1NTPA 1AFEH 1RTKA 1UMAH 4BNRA 4ABHA 2GDDA 1AQ7A 1TNGA 3VB3A 1F5RA 1SG8B 1CT4E 3GDVA 1V2OT 3E91A 2TBSA 2TPIZ 2OQUA 4YO9A 3ATIA 3ODFA 1TQ0B 5FAHA 1YGCH 4OGYA 1HGTH 1K1OA 3MU1A 1GJ5H 2XXLA 3UY9A 1KTTB 2XBXA 3QX5H 4X1RU 5FCRA 3SUGA 4AFUA 1ETTH 1W0ZU 1C4V2 1P2KA 3R0FA 1Z8RA 1A5HA 2BOHB 2GCHG 4NSVA 5C1UA 3BTGE 4D8NA 3PMBB 2BD5A 4MLFB 1P2IA 1G3EA 4VGCB 1PPHE 2A5IA 2FP7B 3DUXH 1CT0E 2A2XH 1CU1A 4NFFA 3BTWE 2ZTXA 4FUIA 4E06H 5IDKA 1NRQH 2BD7A 3LJJA 3MO9A 1GI7B 2EEKA 5DGJA 4H4FA 5F6MA 3A7WA 1HAGE 1GL1A 3A88A 1GBJA 3A7YA 2R2MB 1FY1A 3F9EA 4MPUA 4Y0YE 1QTFA 1SBWA 1Z7KA 1S0RA 4X2YA 4B74A 3Q3KA 4ZHMU 4MPXA 2VIOA 4Y76A 1O3FA 4GSOA 1DY8A 2OD3B 1LKAA 2FIRH 4WMFA 1UTJA 4BAMB 1TBQH 2PTNA 3Q76A 2FTMA 2B9LA
chains in the Genus database with same CATH superfamily
1DSTA 1YPLH 2XNIA 3IG6B 4TT3D 4XOJA 2FZZA 2J4IA 4BAQB 1YPGH 5FBIA 4AGJA 4AG1A 2UUJB 3DFJA 3MQKC 3UWIA 4IN2A 2Z94A 2Q6GA 4TPYA 4NG9H 3HGNA 4B6EA 1QNJA 3OFND 2XC5A 1MQ5A 2A32A 1GJDB 1WTGH 4YM9A 3SU0A 1A61H 1C1RA 3RXFA 1IQKA 3F0PA 1T8NA 2P8OC 3UQOA 1XVOA 2ANMH 1C1MA 1N8OB 2ODQA 1V2RT 3F3BA 1YCPH 1RIWC 5J4SA 1EPTA 2WZQA 3PM3A 2ZZUH 1LPKB 1UCYH 1SL3A 4YLQH 1EP5A 1ZRBA 2W26A 1FN8A 3F9HA 2RA3A 3M37A 3EA8A 2HVYB 3PWCA 4I86A 1NFWA 1O0DH 1O3DA 1AZZA 1O2PA 2PGBB 3RU4T 1ABIH 3QWCH 2FOCA 3NRLA 3SV2H 1FIWA 3GICB 4Y0ZE 2VWOA 3BN9A 4B6FA 2Q6FA 7GCHG 1T7CA 2JIZD 1OWJA 4B76A 1UW7A 5E8EH 3SO3A 1ELAA 1C1OA 2CMYA 1K1NA 2J38A 2XWBI 2QGRA 5C67A 3BTQE 3DT0H 4DW2U 3O8DA 3SBKA 2O9QA 2J97A 1KLIH 1V2MT 3RU4E 3VXEH 5L30H 3HKJB 2KR7A 1G2LA 1LQEA 2A4QA 3A7TA 1AFQC 1AD8H 1MQ6A 3NCLA 1AIXH 1H9IE 1IHSH 5TJXA 3AASA 1ZZZA 1BUIA 1CHOF 2ANWA 1DLKB 2FWWA 2FXRA 1VCWA 4Y7AA 4JYUH 4LZ4B 3ZYEA 1DSUA 3C1KA 1GJ4H 1O39A 2SNVA 2VB0A 1T4VH 1LPGB 1G3CA 4FUDA 3SJ8A 3OTJE 4K5ZA 3UNRA 1T32A 1O5AB 2BMGB 5L2YH 3QUMP 3NZIA 2ANKH 1YPKH 4M7GA 2PP6A 3P8NA 2PGQB 3PROA 3E90B 3E0NB 5A2MH 2SGPE 4O3TA 1A5IA 1G37A 2VGCB 4Q7XA 1NT1A 3SJOA 1GI0A 3EQ0H 5PTPA 4AX9H 3OE7D 2YMSC 1WOFA 2BD4A 1FY4A 1K1LA 5ESBA 1XUIA 2J2UA 3AAUA 1ACBE 4BXWA 1TFXA 4OS2A 4X6MA 3TNTA 3QO6A 2BLVA 1O3KA 1WYKA 3M5LA 1PYTD 1THSH 1PPCE 3E3TA 1XX9A 5SGAE 2K1QA 1OOKB 1EZQA 1GMDG 2GZ9A 3F6UH 1P2OA 1W13U 3OSYA 1JXPA 1D6RA 5A0AE 2XW9A 5EW2H 8KME2 1TRYA 4ABGA 2B0FA 1SKYE 2HNTF 2HGTH 1TAWA 3MU8A 1TRNA 1Y59T 3FP6E 3ODDA 2OC0A 4Y71A 2KFWA 4FU7A 3LGTA 4JZIA 2KCOA 1SQTA 2WUBA 5EJ1A 3SQEE 4X6OA 1EOLA 4TWWA 1X7AC 3BTHE 3SUFA 3GDSA 1IHTH 1BRCE 1AGJA 2SFAA 4K2YA 1T4UH 1VKYA 2EI8A 2SGDE 3B9FH 1T31A 3KEEA 1GVLA 2G5VA 3MH6A 2G51A 3P70B 5EPNA 3SU1A 1QQUA 2ZDMA 1AWFH 1GMHF 3HPTB 1S83A 2Y5HA 1W3CA 4A7IB 3S9AA 1H8IH 2ZHFH 3RXSA 4MPVA 2UUKB 2OINA 1O3BA 5AF9H 1UCYK 3H7TA 4A6LA 3SQHE 1D3TB 1FX0B 2O8MA 1EB2A 1NFYA 1F2SE 1ID5H 1MABB 2Z9KA 3GCTF 1DICA 4NWLA 1C1VH 1TBZH 2Y6TA 1Z8JB 4HI3A 2QIQA 1FMGA 1XKAC 1XUHA 7GCHF 1XKBC 8GCHF 1IQGA 1P3CA 2F9NA 2VNTA 1GJBB 1LHCH 2ZEBA 3RLWH 2XBYA 4ZCNA 4X1QU 4R0IA 2XCNA 1LHEH 1O31A 1IAUA 1LO6A 1GWAA 1K2I1 4J2YB 4DIHH 3SV7A 4CHAC 1HAHH 4B75A 1FN6A 5A0BA 5GXPA 4CRCA 3L6PA 2R3YA 3W94A 1AVGH 2ZCLP 3OY5U 2BQ6B 1FNIA 5JB8S 4MNWA 1O2NA 1O3AA 1EJMA 4CRGA 1C2GA 1DWEH 3ZZ7A 2J34A 3U28C 5L2ZH 1GVZA 1WTHD 1AHTH 2Y81A 3PMJA 4YXWD 1EAUA 1MTSA 3AK5A 3GOVB 4LOYH 1O3MA 2JETB 4FVBA 4FXGH 4WF8A 5FCKA 3MH7A 5BPEA 5K0HA 5HIYA 1YCPM 3I78A 1G2MA 2L74A 4ABAA 2Z7FE 2HPPH 1TPAE 1HAVA 3U8TH 2OXSA 4LZ1H 5LGOA 2WV5A 1O3LA 1OYQA 3LGUA 4NA9H 1MBQA 2O8UA 3VB7A 3MO6A 1KXBA 1C4Y2 1HPGA 1ZMLA 2CHAC 3MI4A 5HIZA 1O36A 7KMEH 2A7HA 2WPLS 6LPRA 2D2DA 4MNYA 2NU4E 3S9BA 2QE7D 1NS3A 2OUAA 1SGDE 4JMYA 2YNBA 4AYYB 3SUEA 1P8VC 3TGKE 1BMMH 1DANH 1UTLM 2XBWA 1H1BA 4X8UH 2Y82A 2CXVA 3D23A 2XCFA 1P04A 4B71A 4GVUA 2R2WU 2A0QB 1SGPE 3N7OA 1AU8A 1BTYA 3DA9B 3NPSA 3ATLA 4X2VA 3TK6A 1GMDF 3ZZ4A 2FOHA 3TPIZ 5JBTA 4INLA 1GBIA 2QY0B 2D8WA 3A8DA 3T28A 2ZU1A 1W0JD 1KLTA 5EOKA 2BDYA 6GCHG 1SPJA 5GPIB 2VIQA 2ZDLA 1INCA 3BEFB 1WUNH 4WVPE 1P57B 4K8YA 1IQJA 1O3CA 3LGWA 2BD3A 1C2MA 4AB8A 3B23B 1XUGA 4HFPB 1RTFB 5C20A 3T25A 3A87A 5GDSH 3P6ZB 2ZGXH 3GY4A 3S0NA 1UHBA 2GVFA 4LK4A 1UVUH 3M5MA 2ZFTA 3ZZ3A 1HYLA 1UK3A 2SNWA 3SOSA 5FX6A 3AW1A 4BTIB 1KIGH 2V0BA 3BSQA 5HGGA 3S7KB 1SGRE 4D76A 4NZQA 1HJAB 4OS4A 2VJ1A 1XVMA 3A7XA 1TNLA 4JCNA 1O2MA 4FOUC 1SQOA 2YOLA 1C1QA 2BX4A 2AGIX 3HATH 1C1WH 1K1MA 2BLQA 3F68H 4XD7D 3UOPA 3H5CB 1TMTH 2D1JA 1YPEH 3SU5A 3KHVA 2GP9B 2A4OA 3MNCA 1GI2A 3EE0B 4MVNA 4U2WA 2CGAA 3PO1C 1TMUH 2KCPA 4BAHB 1FY5A 1O2LA 1EFRD 1UTNA 4AC9A 2FLRH 2PV9B 4IW4E 2VINA 1GMCG 4I33A 2A4GA 1D6WA 2VVCA 1QA7A 3KQEA 3GDUA 2BOKA 2VIPA 1CVWH 1JMOH 1CA8B 1CGIE 1FONA 1RRKA 3GY6A 1DWBH 2GKVE 1HRTH 2CV3A 1MU6B 1IQEA 4NA8A 1MZAA 3A7ZA 4AORA 1Z71A 3EGKH 1Q2WA 2GCHF 1OXGA 1W10U 4E7RG 2A45B 1ELDE 2ODPA 1LVMA 3GY8A 2Y7ZA 1YPMH 2W3KA 1TQ7B 2FYQA 5A8XA 3BTFE 1BHXF 1F0RA 1MU8B 3ATWA 3UPEA 2GCTC 2GGVB 4IMQA 5G4BA 2THFB 4ZUHA 1Z8GA 4Y7BA 2BY9X 3DCLA 3FOAA 4UFDH 1LVBA 4KELA 1CA0C 4QT8C 5IK2D 1K1IA 4AZ2B 2Z3EA 2PW8H 1C1PA 2OC1A 4I7YH 4X8TH 5T6DA 1S85A 2BHGA 1O3HA 2P3UB 2AIQA 3ZVCA 1NRNH 2STBE 1Y5BT 4IN1A 2YMSD 1SHHB 1VCQA 1W14U 3UB0A 3T5FH 1JWTA 1ARBA 2ZU4A 4DJZB 2Q1JA 4K1TA 1AUTC 4I8KA 2GMTB 1B7XB 5LPRA 1HXFH 1ZR0A 3VFEA 2AMQA 3ZVFA 1YLDA 5DKMA 2J94A 5CHAC 3VB4A 4ACBA 1FQ3A 3ITIA 1WDIA 1SOTA 3TGIE 2OCVB 1O37A 2A1DB 1FY8E 4ISHH 4Q80A 4CH8B 2RDLA 1C5YB 4Z1MD 4RKOB 1C5WB 1NPMA 1THPB 3FN8A 2VVUA 4YTAA 4DY7B 1YPJH 2ZDVH 2GX4A 1GBLA 4JK5A 1HNEE 2ZQ1A 4AN7A 1YCPK 3RLYH 1SLVB 1D4PB 1C2DA 1QRZA 2RA0A 1CE5A 1DWCH 1KSNA 4K1EA 1EJNA 2NU1E 1PQ5A 2W3IA 3RC5A 3A8AA 5EIYA 2QF3A 5DSFA 2A5KA 3GYMA 1JIMA 2I6SA 1TMBH 2JH0D 3MU5A 2VWLA 1ZMNA 1YYY1 1BDAA 4A1VA 1C9TA 5FPYA 2BQWB 5LPEA 3WW7A 3VGCC 3SJ9A 3U1IB 2P8OB 1ANCA 1EOJA 4NA7A 2VIDA 3ZV9A 2C8XB 1K9OE 2ZHQH 3SGBE 1O5CB 2CN0H 4THNH 1A0JA 5HKKD 4YT6H 1FUJA 3M5OA 2UWOA 2AMPA 4NIWA 1O2UA 1IQLA 4ZAEA 5GWZA 3M35A 1GPZA 3KQDA 4JK6A 5KGOA 1HJ8A 3A80A 3TGJE 2BDGA 3DHKH 1XUJA 5C2ZA 1BRUP 1MCTA 2WPIS 2PKAA 1DXWA 1KDQB 2ESTE 3RMMH 4AOQA 1SGTA 2C93B 5DP8A 3SHAH 5BRRE 4CRAA 2W6JD 1SSXA 3A82A 1IQMA 3SHCH 1IQNA 5JBAS 1ZSKA 1BHXB 3GYLB 2B8OH 1YBWA 1KY9A 1SGCA 4JZFH 1UVTH 4YZUA 1JRSA 3M7TA 1QRWA 3SORA 1PJPA 4ISNA 3ZZDA 5FBEA 3EE7A 5AVDA 1C5UA 1NZQH 3S9CA 1ANEA 5H4IB 3MH5A 1BT7A 1MAXA 1O3PB 5EXLA 5C0TA 3U98H 1JRTA 2FS9A 1BTPA 3ZZ9A 1W2KH 2WV4A 3SV8A 3ZZBA 2ZP0H 1MKXK 2J98B 1P03A 1GCTB 1UJ1A 1J14A 3TU7H 1Q31A 5AHGH 1Y3XA 3PLPA 3RXJA 1K0HA 2PKSC 5GCHF 1DOJA 2QAAA 1UCYE 2EA3A 3F1SB 1FLEE 1GI6A 3N7DA 1U6QA 1QL7A 3N99A 1A3BH 2GV7A 1TIOA 3L3TA 1ZJKA 3RXVA 4E05H 2BDBA 1WCZA 1AE8H 1DITH 4OS5A 2F9BH 4ZROA 1BRBE 2VIWA 2G00A 1TOCB 4TPIZ 1D9IA 4X8VH 5F8TA 4GCHG 5HYOA 4I32A 3U69H 1UTMA 3MOCA 2D26C 3M3VA 1OP2A 1BTUA 4DVAU 2H5DA 3OEHD 2FTLE 1O5FH 2B7DH 3AW0A 1K22H 4UFEH 5EQSA 1LHFH 4CRFA 1O3IA 3AAVA 3R3GB 1PQAA 5C5NA 1UO6A 1TALA 1O3NA 4I31A 1NU9A 1DE7H 2JETC 1TGNA 3BEIB 3GISB 1NM6A 5EQRA 1KLJH 1AI8H 3LOXA 1E1RD 2HRVA 1GHWH 1TLDA 3KQBA 3PV5A 2FS8A 1O2OA 4JYVH 1WQVH 2VGCC 5DP9A 4X2XA 2BVSH 3OU0A 1ZPZA 1ABJH 4K3JA 1IQHA 3HK6B 1YLCA 3MU4A 1XUFA 5FXLA 3ENSB 1YC0A 1QCPA 4ASHA 1MUEB 4CRDA 1Y3UA 5DP7A 1XMNB 4TY6A 2ZDKA 2IJD1 1Z8IB 3L33A 2Y5FA 5I46H 4XBDA 1H9HE 5C1XA 5DP3A 3TNSA 3F9GA 1K1PA 1O2JA 1BTZA 1FAKH 3ESTA 1F7ZA 1MD8A 3Q00A 4F49A 4RN6A 4Y8ZA 3IITA 3U8OH 1IQFA 1FV9A 3RXHA 1F92A 5HXFA 1BB0B 1C5OH 1TPPA 3U1JB 1SFQB 4B73A 1AVWA 5DN6D 2A31A 2WINI 2AERH 2F43B 3LJOA 4WH8A 3EDXB 3TLOA 2H9HA 1TB6H 2VWMA 3Q77A 1BMFD 3W1EA 2JJ1D 1BMAA 4X0WU 2FEQH 1NFUA 2ZPSA 1SLWB 4UEHH 1OP8A 1O2KA 4TYDA 1HJAC 1SQRA 3ZZ8A 2ZGBH 1EP6A 1BTWA 8ESTE 3H7OA 3RDZA 1QL8A 2XC4A 3HGPA 1WV7H 4K1SA 1ESBA 1C2IA 2IN2A 1A3EH 4ABIA 4GUXA 4MPWA 2ODYB 1O2HA 1KDQA 1SQAA 1HUTH 8LPRA 1MTUA 2XRCA 1GI1A 5F53A 3FVFB 1P01A 2IOTA 2PR3A 2G55A 5A8ZA 1J8AA 1A4WH 3ZZCA 3D49H 3WY8A 1DFPA 5GNDA 4DCDA 3KQCA 1W7XH 4KKDA 3RC4A 3I77A 3PMAB 2GZ8A 2BZAA 3SZNA 1OKXA 1T8LA 1TRMA 2FPZA 1MZDA 2BY7X 1WAYB 3TVJB 4ABDA 4DT7B 2IPQX 1QBVH 1VITG 3A86A 1SFIA 1DPOA 3NK8A 3OX7U 2F9UA 2ZU5A 4A1TA 4IC5A 1C2JA 1WSSH 2ZU2A 3E8LA 1J17T 1SGEE 2AIPA 1HAOH 2KCAA 4YESB 1AO5A 5FL7D 4RT0A 4MTBA 5DP6A 3RXEA 1SGFA 1BMLA 1SR5C 4R8TB 1KXCA 1J15A 1XXDA 5EGMA 3GCTG 3SNAA 1LPZB 3RXBA 1OWIA 1PYTC 5ABWA 1AKSA 1LHGH 3LKWA 4F55A 4FUCA 5EODA 4RSPA 3UWJH 2FOFA 1RD3B 2EI7A 1MKWK 3F2HA 4Y8XA 3RXOA 1NY22 1QB9A 2ZECA 2ALPA 4DURA 3MMGA 1SLXB 1C5TA 2TRMA 4RT1A 1HAIH 4INHA 4HTCH 3FANA 5DO4H 1BMNH 4ISIH 3UUZA 2J92A 2Y80A 3K6YA 2M5TA 1GI3A 2NU3E 1AKSB 1QJ6B 1TNKA 1PPBH 3RMOH 5HM9A 4ASUD 1MTWA 2L6OA 4CBOA 2ZTYA 3ZVBA 3BIUH 4UONA 1BBRH 4WMEA 1FPHH 1O2QA 1H8DH 4MDSA 1DDJA 2V3HH 1LMWB 3KNXA 1W11U 3PTBA 1Y8TA 3DD2H 4GHQA 1ELFA 1EX3A 1ZJDA 1S82A 3M7UA 1XUKA 1QBNA 2G8TA 1SGIB 4M9FA 4AB9A 1KMHB 1L0ZA 2ZG0H 2GD4B 3HKIB 4I8GA 3UQVA 2WPHS 1GCDA 2QF5A 1EKBB 4ZMAH 2HNTE 9LPRA 3ELAH 1DM4B 1VR1H 2GT8A 1RTLA 1MCVA 1T8MA 3MNBA 1TX8A 3O8CA 1C5ZB 1GBBA 1P12E 1RJXB 4ZH8A 3SNCA 1QRXA 3QGJA 2FOEA 2RDEA 1CQQA 2KAIB 1C5PA 1ZSLA 1YM0A 4FUHA 1VJAU 1K28D 2ZHWH 1GJAB 4Z0KA 3O8BA 5B6LA 4BANB 1C2FA 1FAXA 3T29A 4KTUA 3LH1A 1KXEA 2A2QH 2P59A 1O32A 1SC8U 1W0KD 1GBTA 2G81E 4MQAA 4NIYA 2BDAA 3TK9A 1LKBA 1H8HD 5EW1H 3P17H 2P3TB 1WXRA 1UTKA 3M3TA 1JBUH 2TGDA 3TJOA 1ARCA 4D9RA 2VH6A 1VCPA 2BDCA 5A8YA 4ZKNU 1AB9B 3E1XB 1EAWA 1ELVA 5FPSA 1ZMJA 1SGYE 2OP9A 1C5SA 1L1JA 1GHBG 4BOHA 4H6SB 1SMFE 2PKSB 1L1NA 3JZ1B 5I25A 4ABJA 3MNXA 2AEIH 5C5OA 2ZCHP 3KN2A 2ULLA 1YWUA 3DSGA 2FESH 4BXSA 1DWDH 1SGQE 2GTBA 2J95A 2WHXA 1UVPA 5HMAA 3PMHB 1IQIA 2G5NA 4INKA 4X1NU 3O8RA 1GI8B 2P16A 2KX4A 3A81A 4BTTB 1EAXA 1L2EA 4FUEA 1T8OA 2OBOA 3P8OA 2BD8A 4J1YA 4YT7H 1C1NA 2SGFE 1RIWB 3F0OA 3KQ5A 1P9UA 1DT2A 2BB4A 2FI4E 1O2ZA 5CDFE 4WH6A 3KGPA 4ZKOU 4ESTE 3BTDE 2Z9GA 2CJIA 2TGTA 1F0UA 2GZ7A 5E0JA 1VGCB 1XXFA 2KAIA 4AGKA 5C17A 3FP7E 1S0QA 3ATKA 2UWPA 5EQQA 1ZGVA 1ZOMA 2Q6DA 3SYJA 2A4RA 3T62A 3GS9A 2PTCE 4JZ1A 2ZFSA 3BG8A 3KYFA 1OSSA 3KYGA 5FHTA 2VIVA 5DK1A 2XWAA 1YF4A 4FVDA 5EJLA 4GHTA 1A0LA 2AGEX 4AFSA 6ESTA 3PYHA 1C9PA 5E0HA 1FDPA 1V2TT 3M5NA 1KYNA 3MU0A 1BBRK 4NFEA 3GCHB 1A46H 3TH3H 3RXRA 4ZXYH 4NCYA 6CHAB 1DS2E 4FUGA 1HB0B 2RCEA 2F83A 5E2PA 2C90B 2PHBA 3C27B 3FAOA 3B8JA 1FPCH 1JOUB 1E34B 5DP5A 2BTCE 1C5RA 1GBKA 2LELA 4AFQA 5ETXA 1ZRKA 2J9NA 1H4WA 3SI3H 3URCA 1J9CH 4UFGH 1P10A 1SGFG 7ESTE 2G4TA 3SNDA 1ANBA 3CP7A 2F9PA 1ZSJA 2P3FH 1GHAF 4D9QA 5F8XA 5DPAA 1ZGIA 2F9OA 1GBAA 3GY7A 2W7SA 1EZXC 1EQ9A 1ELGA 2ZHEH 3F9FA 1GDUA 3FFGA 3PO1B 5FX5A 3PRBA 2G4UA 2IPHA 4X8SH 2QV1A 3STJA 4CHAB 3PLBA 3RXLA 4XBCA 1QFKH 2QCYA 2WUCA 3PB1E 3ATMA 3T2NA 2OC8A 3K2UA 3BTME 1G32B 5DJ7A 4NSYA 1YP9A 1P06A 5CHAB 1BQYA 1YPHE 1C2LA 3WWBA 3CS7A 1O3EA 1OWDA 2VVVA 4K69A 2QN5T 1HIAB 3SN8A 3TITA 4AYVB 2FMJA 1MD7A 4B1TA 3QDZB 2ZGJA 1GHYH 5FPTA 1OWHA 3FZDA 3MNSA 1HXEH 2CF9H 1BOQA 1C5MD 3HK3B 3LPRA 5EU8A 1H8ED 3SJKA 2AH4X 3EA9A 4H6TA 2PKAB 4DOQA 3VEQB 5CMXH 1TBRH 5JPMH 1C1TA 2PSYA 1NBMD 2BVXH 4U01A 1E35B 1PFXC 5T3HA 4U32A 3LDXH 4FUFA 1CHGA 1VGCC 1MH0A 3LIWA 4Y79A 3UFAA 3RXAA 2ALVA 2SGQE 2HALA 3RM0H 4FU8A 2A7CA 1Z1JA 1P2JA 4FUBA 4I8LA 1FZZA 1ZPBA 2QA9E 2ZI2H 5EXMA 3PV2A 4Q7ZA 2V35A 2FX4A 3Q3YA 1TPOA 1XM1A 1EJAA 2AFQB 1EPTC 1V2LT 1VITF 1Y5AT 2AYWA 2H9EH 4YOIA 1KXDA 3U9AH 5E0GA 2FOMB 2SGEE 1V3XA 1VJ9U 5IYTA 1S84A 1TGSZ 3E0PB 4GAWA 1O2TA 1UTPA 1P11E 2H1UA 1HJ9A 2XBVA 1TGTA 2VU8E 1P9SA 4ABFA 3TH4H 1V2PT 1QHRB 4JZDH 1MMJN 3EA7A 1C1UH 1LCYA 2R9PA 2ZDAH 4UFFH 1QL9A 2JH6D 4XDEA 4OS7A 1P02A 2IJOB 1E36B 4I8HA 1LDTT 1DXPA 3U8RH 4XFQA 2KCYA 2GT7A 3TJVA 2P93A 2STAE 1C5LH 1GBFA 1C2HA 1GBEA 1OPHB 3BEUA 1BA8B 3KCGH 2ZNKH 2WYGA 1AY6H 2HLDD 1TONA 1TABE 3V3MA 1O33A 3OTPA 4X1PU 3T26A 3QTVH 1B0FA 2JJ2D 2QC2A 1W7GH 1MTNB 1H9LB 2EQNA 4K8BA 5E2OA 4P02A 3NUMA 3F2FA 1P05A 3RUOA 2ZGHA 1Y5UT 1OYTH 1PQ8A 1O34A 2ZGCA 4TWYA 2ZKSA 3H09A 1BIOA 2F4LA 2BDHA 2BD2A 4IBLH 3QN7A 1FXYA 1TA2A 1K1JA 1N8OC 4ZKSU 3RXMA 3OYPA 4Q63A 2GMTC 4ACAA 4K60A 3SU2A 1GBHA 1N6XA 1AB9C 4X2WA 1QQ4A 1MBMA 4AFZA 2BD9A 2BVRH 1NC6A 2FYRA 1Z6EA 1C5XB 1ZTLA 3MO3A 4XRNA 1TNHA 1TPSA 1QIXB 4ZHLU 3TH2H 3M61U 2H6MA 1YPHC 3BF6H 4SGAE 3IWMA 1HIAA 1GMHG 1WU1A 1ELBA 1ZHRA 1GCTC 2PUQH 3SGAE 1UTOA 3RXQA 1C5NH 1GHVH 3I29A 4OS1A 4WMDA 1QBOA 2PWXA 3ZYDA 1A5GH 1K21H 1AZ8A 2Z9JA 1G3BA 1HLTH 1ZPCA 1ZLRA 1DLEA 1ELCA 3LONA 6GCHF 2FO9A 1D3PB 1GGDB 2R3UA 1GBMA 8GCHG 1ESAA 2GV6A 4FUJA 1QY6A 1EAIA 1HAZB 3CNRA 4ZXXH 1L4ZA 4LXBH 4CH2B 3BTKE 1TNIA 4DGJA 4H42U 4TY7A 1GMCF 1HBTH 4IC6A 5J4QA 2FOBA 2ZU3A 2UUFB 3V7TA 1W0YH 1NESE 3LGYA 4YLUA 3SU3A 3ZV8A 2AGGX 2DUCA 1O35A 2WPMS 2BZ6H 4WY3A 2FI5E 1HAXB 1C5VA 2P95A 1Y3YA 2YMSB 1BBRE 1P2NA 1C2EA 2R0KA 1QA0A 3QZQA 3RMNH 3OEED 1GJ7B 3BG4B 1F0TA 1GI9B 1ETSH 1P09A 1Z1IA 4KP0A 1GHXH 5C94A 5KECA 4XSKU 5F8ZA 1GG6B 1GJ9B 1SI5H 4RI0A 1GGDC 4IMZA 1HV7A 2BYAX 2J98A 5GJ4B 3SJIA 4X6NA 2OBQA 3M3SA 4AG2A 2A7JA 1GDNA 1QJ7B 3V0XA 2V3OH 3LC3A 6CHAC 2K0QA 1O30A 3QGNB 2KM0A 3ZVEA 1GI5A 4MG3A 1ELEE 4Q4LA 2GJGA 3ZZAA 4YOJA 1NN6A 1IOEA 1BTXA 1HDTH 1V2VT 3A8CA 3D65E 3P92A 1AFQB 1PPFE 2BXTH 1GHZA 2XC0A 1CT2E 1O2YA 4CBNA 2ZFPH 1GBCA 2QF0A 3PWBA 4D7FA 3SUDA 2WPKS 3BG4C 3E16B 5JB9S 3V12A 1NRSH 1RS0A 3OAAD 4VGCC 1CO7E 1GI4A 3EAJA 3GY2A 2K8IA 2ZPRA 3TK5A 1EATA 3BIVH 4Y10E 1F5KU 4BTUB 3GCNA 2LPRA 4SGBE 5CHBA 1SVPA 4P00A 3UNSA 4KTCA 1AWHB 1OWKA 4CREA 3SW2B 2C8WB 2O8WA 1AUJA 2Y7XA 3JZ2B 1ZYOA 5C0UA 5TCCA 2TGAA 1HFDA 2WPDD 1HAYB 2WPJS 2JKHA 5ESTE 3MH4A 2WV9A 2W7UA 1AN1E 1EXFA 2TGPZ 4E7NA 2V3MA 4UDWH 5JDUB 1BTHH 4NIXA 2XNDD 1EZUC 2BLWA 2JDID 1BZXE 3UIRA 2H5CA 1TE0A 4CR9A 1O38A 1E38B 1E1QD 2OQ5A 1RXPA 1V2UT 1O2XA 1Q3XA 1TGCA 1Y3VA 2ZTZA 3PTNA 4GPGA 3NXPA 5T6GA 3VPKA 4A5TS 1SOZA 2OLGA 2OK5A 1THRH 3SZEA 4F4OC 1LVOA 4TSFD 2EY4C 2XYAA 1QZ8A 2AHME 1YKTA 2LP6A 1J16A 3LGIA 1CBWB 1F0SA 3A8BA 1HAVB 2Y5GA 3M7QA 1V2JT 2HNTC 2EI6A 1ZTKA 2NU0E 5DG6A 2F91A 1JIRA 1DX5M 1TOMH 2R0LA 2QXGA 1M9UA 4WWYA 1AVXA 4NGAH 1FY3A 2QXHA 2ZA5A 1KXFA 2FLBH 1P2MA 2HOBA 2Z6BD 2ILNA 1AE5A 3OY6U 3KF2A 1N6YA 1OWEA 2FOGA 1QB6A 4FU9A 2TIOA 2FM2A 4UD9H 5LH8A 3F2GA 1NO9H 1C2KA 1DUAA 2F3CE 2ZWLH 4ZHAA 4BAKB 4YOGA 3LC5A 4OGXA 2AMDA 3SNEA 4O3UA 3P95A 4Z6AH 1FI8A 2O8TA 4Y11E 1LQDB 1YLNA 3VB6A 2W5EA 3K6ZA 1WQSA 2RG3A 4Q2KA 9ESTA 1KTSB 4WXIA 1GBDA 2WSSD 2BY5X 4KTSA 5JYIA 3RU4D 3LU9B 1E37B 1NROH 4DIIH 2V6NA 3ZVGA 1MTNC 3SNBA 1QURH 1QB1A 1F5LA 2C8YB 2ZIQH 1PQ7A 4F48B 4JZEH 1GG6C 4ZKRU 4IS5A 1GJ6A 1ZHMA 4DT4A 4MNXA 1P3EA 3GY5A 2HVXA 3A85A 1CSOE 2BLOA 3FZZA 2H2ZA 1EASA 1RFNA 1SB1H 2CF8H 1BJUA 1G3DA 1MKWH 2BX3A 2HPQH 2FODA 2PFEA 4NIVA 3T27A 4CRBA 1UK4A 3ZVDA 1S5SA 2ZCKP 2HLCA 1GJCB 1WBGB 1GHAG 4WJG2 4A1XA 1LTOA 3TJUA 2BM2A 4PROA 3VXFH 1D3QB 4X6PA 1TA6A 2QXJA 3K9XB 1MTVA 2Z3CA 1GL0E 3UR9A 1B5GH 3CS0A 5K7RA 1ELTA 1TGBA 4MNVA 3GCHC 3P8GA 2ZO3H 3GY3A 2WYJA 5CE1A 1CGJE 2FI3E 1S6FA 1HAPH 3G01A 1GHBF 2PUXB 1O2VA 5L6NH 3Q3XA 4Y8YA 2ZFRH 3ZVAA 2VWNA 1O2WA 2GDEH 2VH0A 3KIDU 4KGAA 2KZ4A 3DFLA 1V2KT 3UREA 1L1GA 4JYTA 3UOUA 5T6FA 2J5UA 1N1LA 2P94A 3BV9B 2C4FH 3WWFA 1BJVA 3SI4H 5LPFA 4I8JA 4NZLA 3UAIC 2FDAA 1TYNA 1UTQA 3NKKA 5EG4A 3RXGA 1TX7A 4O03A 2RFKC 2DE9A 4O97A 1TWXB 2G52A 4FETA 3UTUH 1V2ST 3VGCB 2HWLB 3RMLH 2A5AA 4UE7H 4Y6DA 1L4DA 5AFYH 3ZIAD 5EPYA 2OC7A 1UVOA 1LHDH 1NU7B 3VB5A 5GCHG 3M36A 3FP8E 2BY8X 3NWUA 1TX6A 1ZTJA 4BAOB 3RXIA 2C3SA 1C1SA 3RXDA 2QXIA 3A7VA 3P8FA 4X1SU 3PLKA 1UVSH 1DY9A 1AMHA 1QR3E 2ZDNA 1W8BH 1CA0B 2ZHDA 5A0CA 1G30B 2UWLA 2FOAA 3MWIU 5B6OA 1UHBB 2EC9H 3RC6A 2BXUH 4HGCA 4A92A 5JBBS 4ABBA 3MTYA 1Y3WA 4ISLA 1PPGE 2BDIA 3A89A 4HZHA 3ZZ6A 2PLXA 1TNJA 5JBCS 3QTOH 2H9TH 4WXVA 1NRPH 4O9VA 3DSOA 2NU2E 1O2IA 1G36A 5KEDA 3RXKA 2DE8A 1O3OA 3LGVA 4ABEA 4D7GA 3D62A 3MHWU 1P2QA 1PPEE 3VG8A 1FIZA 1A1RA 1SLUB 3ZZ5A 1E0FD 2ZQ2A 4HG6A 1CHOG 1G9IE 1ZHPA 3QZRA 2ASUB 2VBCA 1O2GH 5TCAA 4B2CA 1O5GH 3SV9A 1S6HA 3FO8D 1W12U 3SU4A 3N7EA 4IGDA 1C5QA 3KL6A 5F03A 1A2CH 5EJZA 4ISOA 1EZSC 1KXAA 3W95A 1QGFA 2AS9A 1E79D 2QF4A 1OS8A 1RGQA 1DVAH 3A83A 5C1YA 3SU6A 3RXTA 2Z9LA 1S81A 3RP2A 4XBBA 2XTTB 1EPTB 1GDQA 1OX1A 1SHYA 1OP0A 1BITA 1ESTA 4DG4A 1FJSA 5AFZH 1LVYA 1V2NT 3A84A 4B2BA 2ZPQA 3BTEE 2LNCA 1VZQH 1Z6JH 2ANYA 2QYIA 3E6PH 3MFJA 5A09A 2UUYA 1QJ1B 1GJ8B 3LT3A 5C3NA 5EXNA 1ETRH 1A0HB 1O5EH 1MAYA 1CGHA 1V6DA 3CENA 1O2RA 3MYWA 1O5BB 2F9VA 1V2QT 3BTTE 4U30A 1V2WT 7LPRA 1B0EA 1VITH 4B2AA 2BQ7B 4NWKA 1PPZA 1DUEA 3EYDA 3V13A 1BRAA 2PSXA 1CBWC 3UR6A 1HCGA 4CR5A 2GCTB 1O3JA 1C4U2 1O2SA 3URDA 1A7SA 1D3DB 2BY6X 2ZFQH 2O8LA 2Z3DA 3TIUA 3RXPA 1NFXA 3QK1A 3SGQE 2NWNA 5HM2A 4GCHF 2ZC9H 1O3GA 3SV6A 3S7HB 1O5DH 3RXUA 3STIA 2I6QA 2ZFFH 5DP4A 3AVZA 2CHAB 1ORFA 3GCOA 1ANDA 1EB1H 1UK2A 2YNAA 2CK3D 2JH5D 1GVKB 2B5TB 4Q7YA 2FX6A 2ZF0H 4RKJB 3TJNA 1NRRH 2C8ZB 1P0SH 2SGAA 4XE4A 4GLYA 3UNQA 2OTVA 3RM2H 4OS6A 3LH3A 3RXCA 2Z9IA 3PV4A 1MKXH 1BCUH 5GIBA 1EUFA 3S69A 5T1VA 3QLPH 1SGNE 3K65B 1NTPA 1AFEH 1RTKA 1UMAH 2W6ID 4BNRA 4ABHA 2GDDA 1AQ7A 1TNGA 3VB3A 1F5RA 1SG8B 1CT4E 3GDVA 1V2OT 3E91A 2TBSA 2TPIZ 2OQUA 4YO9A 3ATIA 3ODFA 1TQ0B 5FAHA 1YGCH 4OGYA 1HGTH 1K1OA 3MU1A 1GJ5H 2XXLA 3UY9A 1OHHD 1KTTB 2XBXA 3QX5H 4X1RU 5FCRA 3SUGA 4AFUA 1ETTH 1W0ZU 1C4V2 2XOKD 1P2KA 3R0FA 1Z8RA 1A5HA 1S6LA 2BOHB 2GCHG 4NSVA 5C1UA 3BTGE 4D8NA 3PMBB 2BD5A 4MLFB 1P2IA 1G3EA 4VGCB 1PPHE 2A5IA 2FP7B 3DUXH 1CT0E 2A2XH 1CU1A 4NFFA 3BTWE 2ZTXA 4FUIA 4E06H 5IDKA 1NRQH 2BD7A 3DSPA 3LJJA 3MO9A 1NBME 1GI7B 2EEKA 3FKSD 5DGJA 4H4FA 5F6MA 3A7WA 1HAGE 4OM9A 1GL1A 3A88A 1GBJA 3A7YA 2R2MB 1FY1A 3F9EA 4MPUA 4Y0YE 1QTFA 1SBWA 1Z7KA 1S0RA 2V7QD 4X2YA 4B74A 3Q3KA 1YY3A 4MPXA 4ZHMU 2VIOA 4Y76A 1O3FA 4GSOA 1DY8A 2OD3B 1LKAA 3PRDA 2FIRH 4WMFA 1UTJA 1COWD 4BAMB 1TBQH 2PTNA 3Q76A 2FTMA 2B9LA 2M2AA
chains in the Genus database with same CATH topology
1DSTA 1YPLH 2XNIA 3IG6B 4XOJA 2FZZA 2J4IA 4BAQB 1YPGH 5FBIA 4AGJA 4AG1A 2UUJB 3DFJA 3UWIA 4IN2A 2Z94A 2Q6GA 4TPYA 4NG9H 3HGNA 1QNJA 2XC5A 1MQ5A 2A32A 1GJDB 1WTGH 4YM9A 3SU0A 1A61H 1C1RA 3RXFA 1IQKA 3UQOA 1T8NA 2P8OC 1XVOA 2ANMH 1C1MA 1N8OB 2ODQA 1V2RT 1YCPH 1RIWC 5J4SA 1EPTA 3PM3A 2ZZUH 1LPKB 1UCYH 1SL3A 4YLQH 1EP5A 1ZRBA 2W26A 1FN8A 3F9HA 2RA3A 3M37A 3EA8A 3PWCA 1NFWA 1O0DH 1O3DA 1AZZA 1O2PA 2PGBB 3RU4T 1ABIH 3QWCH 2FOCA 3SV2H 1FIWA 3GICB 4Y0ZE 2VWOA 3BN9A 2Q6FA 7GCHG 1T7CA 1OWJA 4B76A 5E8EH 3SO3A 1ELAA 1C1OA 2CMYA 1K1NA 2J38A 2XWBI 2QGRA 5C67A 3BTQE 3DT0H 4DW2U 3O8DA 3SBKA 2O9QA 1KLIH 1V2MT 3RU4E 3VXEH 5L30H 3HKJB 1G2LA 1LQEA 2A4QA 3A7TA 1AFQC 1AD8H 1MQ6A 3NCLA 1AIXH 1H9IE 1IHSH 5TJXA 3AASA 1ZZZA 1BUIA 1CHOF 2ANWA 1DLKB 2FWWA 2FXRA 1VCWA 4Y7AA 4JYUH 4LZ4B 3ZYEA 1DSUA 3C1KA 1GJ4H 1O39A 2SNVA 2VB0A 1T4VH 1LPGB 1G3CA 4FUDA 3SJ8A 3OTJE 4K5ZA 3UNRA 1T32A 1O5AB 2BMGB 5L2YH 3QUMP 3NZIA 2ANKH 1YPKH 4M7GA 3P8NA 2PGQB 3PROA 3E90B 3E0NB 5A2MH 2SGPE 4O3TA 1A5IA 1G37A 2VGCB 4Q7XA 1NT1A 3SJOA 1GI0A 3EQ0H 5PTPA 4AX9H 1WOFA 2BD4A 1FY4A 1K1LA 5ESBA 1XUIA 2J2UA 3AAUA 1ACBE 4BXWA 1TFXA 4OS2A 4X6MA 3TNTA 3QO6A 2BLVA 1O3KA 1WYKA 3M5LA 1PYTD 1THSH 1PPCE 3E3TA 1XX9A 5SGAE 2K1QA 1OOKB 1EZQA 1GMDG 2GZ9A 3F6UH 1P2OA 1W13U 3OSYA 1JXPA 1D6RA 5A0AE 2XW9A 5EW2H 8KME2 1TRYA 4ABGA 2B0FA 2HNTF 2HGTH 1TAWA 3MU8A 1TRNA 1Y59T 3FP6E 3ODDA 2OC0A 4Y71A 4FU7A 3LGTA 4JZIA 1SQTA 2WUBA 3SQEE 4X6OA 1EOLA 4TWWA 1X7AC 3BTHE 3SUFA 3GDSA 1IHTH 1BRCE 1AGJA 2SFAA 4K2YA 1T4UH 2EI8A 2SGDE 3B9FH 1T31A 3KEEA 1GVLA 2G5VA 3MH6A 2G51A 3P70B 5EPNA 3SU1A 1QQUA 2ZDMA 1AWFH 1GMHF 3HPTB 1S83A 2Y5HA 1W3CA 4A7IB 3S9AA 1H8IH 2ZHFH 3RXSA 4MPVA 2UUKB 2OINA 1O3BA 5AF9H 1UCYK 3H7TA 4A6LA 3SQHE 1D3TB 2O8MA 1EB2A 1NFYA 1F2SE 1ID5H 2Z9KA 3GCTF 1DICA 4NWLA 1C1VH 1TBZH 2Y6TA 1Z8JB 4HI3A 2QIQA 1FMGA 1XKAC 1XUHA 7GCHF 1XKBC 8GCHF 1IQGA 1P3CA 2F9NA 2VNTA 1GJBB 1LHCH 2ZEBA 3RLWH 2XBYA 4X1QU 4R0IA 2XCNA 1LHEH 1O31A 1IAUA 1LO6A 1GWAA 1K2I1 4J2YB 4DIHH 3SV7A 4CHAC 1HAHH 4B75A 1FN6A 5A0BA 5GXPA 4CRCA 3L6PA 2R3YA 3W94A 1AVGH 2ZCLP 3OY5U 2BQ6B 1FNIA 5JB8S 4MNWA 1O2NA 1O3AA 1EJMA 4CRGA 1C2GA 1DWEH 3ZZ7A 2J34A 5L2ZH 1GVZA 1WTHD 1AHTH 2Y81A 3PMJA 1EAUA 1MTSA 3GOVB 4LOYH 1O3MA 2JETB 4FVBA 4FXGH 4WF8A 5FCKA 3MH7A 5BPEA 5K0HA 1YCPM 3I78A 1G2MA 4ABAA 2Z7FE 2HPPH 1TPAE 1HAVA 3U8TH 2OXSA 4LZ1H 5LGOA 2WV5A 1O3LA 1OYQA 3LGUA 4NA9H 1MBQA 2O8UA 3VB7A 3MO6A 1KXBA 1C4Y2 1HPGA 1ZMLA 2CHAC 3MI4A 7KMEH 1O36A 2A7HA 2WPLS 6LPRA 2D2DA 4MNYA 2NU4E 3S9BA 1NS3A 2OUAA 1SGDE 4JMYA 2YNBA 4AYYB 3SUEA 1P8VC 3TGKE 1BMMH 1DANH 1UTLM 2XBWA 1H1BA 4X8UH 2Y82A 2CXVA 3D23A 2XCFA 1P04A 4B71A 4GVUA 2R2WU 2A0QB 1SGPE 3N7OA 1AU8A 1BTYA 3DA9B 3NPSA 3ATLA 4X2VA 3TK6A 1GMDF 3ZZ4A 2FOHA 3TPIZ 5JBTA 4INLA 1GBIA 2QY0B 2D8WA 3A8DA 3T28A 2ZU1A 5EOKA 1KLTA 2BDYA 6GCHG 1SPJA 5GPIB 2VIQA 2ZDLA 1INCA 3BEFB 1WUNH 4WVPE 1P57B 4K8YA 1IQJA 1O3CA 3LGWA 2BD3A 1C2MA 4AB8A 3B23B 1XUGA 4HFPB 1RTFB 5C20A 3T25A 3A87A 5GDSH 3P6ZB 2ZGXH 3GY4A 3S0NA 1UHBA 2GVFA 4LK4A 1UVUH 3M5MA 2ZFTA 3ZZ3A 1HYLA 1UK3A 2SNWA 3SOSA 5FX6A 3AW1A 4BTIB 1KIGH 2V0BA 3BSQA 5HGGA 3S7KB 1SGRE 4D76A 4NZQA 1HJAB 4OS4A 2VJ1A 1XVMA 3A7XA 1TNLA 4JCNA 1O2MA 1SQOA 2YOLA 1C1QA 2BX4A 2AGIX 3HATH 1C1WH 1K1MA 2BLQA 3F68H 3UOPA 3H5CB 1TMTH 2D1JA 1YPEH 3SU5A 3KHVA 2GP9B 2A4OA 3MNCA 1GI2A 3EE0B 4MVNA 4U2WA 2CGAA 3PO1C 1TMUH 4BAHB 1FY5A 1O2LA 1UTNA 2FLRH 2PV9B 4IW4E 2VINA 1GMCG 4I33A 2A4GA 1D6WA 2VVCA 1QA7A 3KQEA 3GDUA 2BOKA 2VIPA 1CVWH 1JMOH 1CA8B 1CGIE 1FONA 1RRKA 3GY6A 1DWBH 2GKVE 1HRTH 2CV3A 1MU6B 1IQEA 4NA8A 1MZAA 3A7ZA 4AORA 1Z71A 3EGKH 1Q2WA 2GCHF 1OXGA 1W10U 4E7RG 2A45B 1ELDE 2ODPA 1LVMA 3GY8A 2Y7ZA 1YPMH 2W3KA 1TQ7B 2FYQA 5A8XA 3BTFE 1BHXF 1F0RA 1MU8B 3ATWA 3UPEA 2GCTC 2GGVB 4IMQA 5G4BA 2THFB 4ZUHA 1Z8GA 4Y7BA 2BY9X 4UFDH 1LVBA 4KELA 1CA0C 4QT8C 1K1IA 4AZ2B 2Z3EA 2PW8H 1C1PA 2OC1A 4I7YH 4X8TH 5T6DA 1S85A 2BHGA 1O3HA 2P3UB 2AIQA 3ZVCA 1NRNH 2STBE 1Y5BT 4IN1A 1SHHB 1VCQA 1W14U 3T5FH 1JWTA 1ARBA 2ZU4A 4DJZB 2Q1JA 4K1TA 1AUTC 4I8KA 2GMTB 1B7XB 5LPRA 1HXFH 1ZR0A 3VFEA 2AMQA 3ZVFA 1YLDA 5DKMA 2J94A 5CHAC 3VB4A 1FQ3A 3ITIA 1SOTA 3TGIE 2OCVB 1O37A 2A1DB 1FY8E 4ISHH 4Q80A 4CH8B 2RDLA 1C5YB 4RKOB 1C5WB 1NPMA 1THPB 2VVUA 4YTAA 4DY7B 1YPJH 2ZDVH 2GX4A 1GBLA 4JK5A 1HNEE 2ZQ1A 4AN7A 1YCPK 3RLYH 1SLVB 1D4PB 1C2DA 1QRZA 2RA0A 1CE5A 1DWCH 1KSNA 4K1EA 1EJNA 2NU1E 1PQ5A 2W3IA 3RC5A 3A8AA 2QF3A 2A5KA 3GYMA 1JIMA 2I6SA 1TMBH 2JH0D 3MU5A 2VWLA 1ZMNA 1YYY1 1BDAA 4A1VA 1C9TA 5FPYA 2BQWB 5LPEA 3VGCC 3SJ9A 3U1IB 2P8OB 1ANCA 1EOJA 4NA7A 2VIDA 3ZV9A 2C8XB 1K9OE 2ZHQH 3SGBE 1O5CB 2CN0H 4THNH 1A0JA 4YT6H 1FUJA 3M5OA 2UWOA 2AMPA 4NIWA 1O2UA 1IQLA 4ZAEA 5GWZA 3M35A 1GPZA 3KQDA 4JK6A 1HJ8A 3A80A 3TGJE 2BDGA 3DHKH 1XUJA 5C2ZA 1BRUP 1MCTA 2WPIS 2PKAA 1DXWA 1KDQB 2ESTE 3RMMH 4AOQA 1SGTA 2C93B 5DP8A 3SHAH 5BRRE 4CRAA 1SSXA 3A82A 1IQMA 3SHCH 1IQNA 5JBAS 1ZSKA 1BHXB 3GYLB 2B8OH 1YBWA 1KY9A 1SGCA 4JZFH 1UVTH 4YZUA 1JRSA 3M7TA 1QRWA 3SORA 1PJPA 4ISNA 3ZZDA 5FBEA 5AVDA 1C5UA 1NZQH 3S9CA 1ANEA 5H4IB 3MH5A 1BT7A 1MAXA 1O3PB 5EXLA 3U98H 1JRTA 2FS9A 1BTPA 3ZZ9A 1W2KH 2WV4A 3SV8A 3ZZBA 2ZP0H 1MKXK 1P03A 1GCTB 1UJ1A 1J14A 3TU7H 1Q31A 5AHGH 1Y3XA 3PLPA 3RXJA 2PKSC 5GCHF 1DOJA 2QAAA 1UCYE 2EA3A 3F1SB 1FLEE 1GI6A 1U6QA 1QL7A 1A3BH 2GV7A 1TIOA 3L3TA 1ZJKA 3RXVA 4E05H 2BDBA 1WCZA 1AE8H 1DITH 4OS5A 2F9BH 4ZROA 1BRBE 2VIWA 2G00A 1TOCB 4TPIZ 1D9IA 4X8VH 5F8TA 4GCHG 5HYOA 4I32A 3U69H 1UTMA 3MOCA 2D26C 3M3VA 1OP2A 1BTUA 4DVAU 2H5DA 2FTLE 1O5FH 2B7DH 3AW0A 1K22H 4UFEH 5EQSA 1LHFH 4CRFA 1O3IA 3AAVA 3R3GB 1PQAA 5C5NA 1UO6A 1TALA 1O3NA 4I31A 1NU9A 1DE7H 2JETC 1TGNA 3BEIB 3GISB 1NM6A 5EQRA 1KLJH 1AI8H 3LOXA 2HRVA 1GHWH 1TLDA 3KQBA 2FS8A 1O2OA 4JYVH 1WQVH 2VGCC 5DP9A 4X2XA 2BVSH 3OU0A 1ZPZA 1ABJH 4K3JA 1IQHA 3HK6B 1YLCA 3MU4A 1XUFA 5FXLA 3ENSB 1YC0A 1QCPA 4ASHA 1MUEB 4CRDA 1Y3UA 5DP7A 1XMNB 4TY6A 2ZDKA 1Z8IB 3L33A 2Y5FA 5I46H 4XBDA 1H9HE 5C1XA 5DP3A 3TNSA 3F9GA 1K1PA 1O2JA 1BTZA 1FAKH 3ESTA 1F7ZA 1MD8A 3Q00A 4F49A 4RN6A 4Y8ZA 3IITA 3U8OH 1IQFA 1FV9A 3RXHA 1F92A 5HXFA 1BB0B 1C5OH 1TPPA 3U1JB 1SFQB 4B73A 1AVWA 2A31A 2WINI 2AERH 3LJOA 4WH8A 3EDXB 3TLOA 2H9HA 1TB6H 2VWMA 3Q77A 1BMAA 4X0WU 2FEQH 1NFUA 2ZPSA 1SLWB 4UEHH 1OP8A 1O2KA 4TYDA 1HJAC 3ZZ8A 2ZGBH 1EP6A 1BTWA 8ESTE 3H7OA 3RDZA 1QL8A 2XC4A 3HGPA 1WV7H 4K1SA 1ESBA 1C2IA 2IN2A 1A3EH 4ABIA 4GUXA 4MPWA 2ODYB 1O2HA 1KDQA 1SQAA 1HUTH 8LPRA 1MTUA 2XRCA 1GI1A 3FVFB 1P01A 2IOTA 2PR3A 2G55A 5A8ZA 1J8AA 1A4WH 3ZZCA 3D49H 3WY8A 1DFPA 4DCDA 3KQCA 1W7XH 4KKDA 3RC4A 3I77A 3PMAB 2GZ8A 2BZAA 3SZNA 1OKXA 1T8LA 1TRMA 2FPZA 1MZDA 2BY7X 1WAYB 3TVJB 4ABDA 4DT7B 1QBVH 1VITG 3A86A 1SFIA 1DPOA 3NK8A 3OX7U 2F9UA 2ZU5A 4A1TA 4IC5A 1C2JA 1WSSH 2ZU2A 3E8LA 1J17T 1SGEE 2AIPA 1HAOH 4YESB 1AO5A 4MTBA 5DP6A 3RXEA 1SGFA 1BMLA 1SR5C 4R8TB 1KXCA 1J15A 1XXDA 5EGMA 3GCTG 3SNAA 1LPZB 3RXBA 1OWIA 1PYTC 5ABWA 1AKSA 1LHGH 3LKWA 4FUCA 5EODA 4RSPA 3UWJH 2FOFA 1RD3B 2EI7A 1MKWK 4Y8XA 3RXOA 1NY22 1QB9A 2ZECA 2ALPA 4DURA 3MMGA 1SLXB 1C5TA 2TRMA 1HAIH 4INHA 4HTCH 3FANA 5DO4H 1BMNH 4ISIH 3UUZA 2J92A 2Y80A 3K6YA 2M5TA 1GI3A 2NU3E 1AKSB 1QJ6B 1TNKA 1PPBH 3RMOH 5HM9A 1MTWA 4CBOA 2ZTYA 3ZVBA 3BIUH 4UONA 1BBRH 4WMEA 1FPHH 1O2QA 1H8DH 4MDSA 1DDJA 2V3HH 1LMWB 3KNXA 1W11U 3PTBA 1Y8TA 3DD2H 4GHQA 1ELFA 1EX3A 1ZJDA 1S82A 3M7UA 1XUKA 1QBNA 2G8TA 1SGIB 4AB9A 1L0ZA 2ZG0H 2GD4B 3HKIB 4I8GA 3UQVA 2WPHS 1GCDA 1EKBB 4ZMAH 2HNTE 9LPRA 3ELAH 1DM4B 1VR1H 2GT8A 1RTLA 1MCVA 1T8MA 3MNBA 1TX8A 3O8CA 1C5ZB 1GBBA 1P12E 1RJXB 4ZH8A 3SNCA 1QRXA 3QGJA 2FOEA 1CQQA 2KAIB 1C5PA 1ZSLA 1YM0A 4FUHA 1VJAU 1K28D 2ZHWH 1GJAB 4Z0KA 3O8BA 4BANB 1C2FA 1FAXA 3T29A 4KTUA 3LH1A 1KXEA 2A2QH 2P59A 1O32A 1SC8U 2G81E 1GBTA 4NIYA 4MQAA 2BDAA 3TK9A 1LKBA 5EW1H 3P17H 2P3TB 1UTKA 3M3TA 1JBUH 2TGDA 3TJOA 1ARCA 4D9RA 2VH6A 1VCPA 2BDCA 5A8YA 4ZKNU 1AB9B 3E1XB 1EAWA 1ELVA 5FPSA 1ZMJA 1SGYE 2OP9A 1C5SA 1L1JA 1GHBG 4BOHA 4H6SB 1SMFE 2PKSB 1L1NA 3JZ1B 5I25A 4ABJA