5LGOA

Trypsin inhibitors for the treatment of pancreatitis - cpd 15
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Trypsin inhibitors for the treatment of pancreatitis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lgoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lgoA02
3M7UA 1OWDA 1EX3A 1F5RA 3OYPA 3ZZDA 1IQEA 4INHA 1LPZB 5HXFA 3U1JB 1GGDB 1AY6H 4K1TA 3PMAB 4NWKA 1O37A 1EQ9A 1F0TA 1IHSH 1DANH 3P8NA 3SV8A 2J34A 1PPGE 1C4U2 1QFKH 2WV5A 2QGRA 1BTWA 1GHZA 1DT2A 5CHAC 1FAXA 2BHGA 3M5NA 1VITG 1J17T 2BTCE 2HLCA 4ABHA 1Z71A 3TK5A 1V2VT 5FX5A 4IGDA 1A4WH 1DICA 2WPIS 3A8CA 2UUKB 3BG4B 4IN2A 1QJ7B 1Y5BT 2ZHWH 2V35A 5E0HA 3AVZA 2AFQB 3D49H 4Y8ZA 3TH4H 5E2PA 5AF9H 3A7WA 3S9BA 3LIWA 5TCCA 3VGCB 4IN1A 2BY7X 1C2LA 1O3OA 1K1OA 1NFWA 1QTFA 3FANA 5F03A 4X1SU 1MCVA 2ZKSA 3BG8A 4NG9H 4WY3A 4J2YB 1OP8A 1YC0A 4QT8C 2VVCA 2F9NA 1Y3WA 3NUMA 2OP9A 1BTZA 3QGNB 3BSQA 3MTYA 3LH3A 3S9CA 1ELGA 3LGYA 1CBWC 2ZQ2A 1MCTA 1NESE 2BLOA 1PPEE 1TABE 2A5AA 1AIXH 3FZDA 1BRUP 1QRZA 3SJIA 3SU0A 1P11E 3LGWA 3UREA 4OGYA 1P01A 1TRNA 5L2ZH 4Y7BA 5A2MH 1HAIH 5G4BA 1HJAB 1AUTC 1BBRK 3A88A 2BD4A 2SGFE 2GZ8A 1G9IE 1ZHPA 2H9TH 1C5NH 1WTHD 1XKAC 1UK3A 5K7RA 2P3UB 1W0ZU 2UUFB 4B73A 1K2I1 1P2QA 1RTLA 5FX6A 4CR5A 1TGCA 4GHQA 1QL9A 3LC5A 1HFDA 4AX9H 2Q6DA 2WPKS 1C2HA 3DT0H 4CRGA 1ZHRA 2ZI2H 1IOEA 2VINA 1C5UA 2A7JA 2KAIA 3A84A 1L1JA 2R3YA 3S7HB 4UFDH 4E7NA 2BXTH 3VB3A 3FVFB 2ZU1A 1BMMH 1DY8A 2QXGA 1NRRH 1RFNA 2ZFSA 2CJIA 1C2GA 1V2PT 1DWDH 3O8BA 2ZO3H 1SPJA 3U8TH 1P2IA 2XWBI 3B8JA 2G4UA 1SQOA 1UHBB 2A2XH 4UONA 1UTJA 4GLYA 1TLDA 8LPRA 1BHXB 7GCHF 1HCGA 2G52A 4WXIA 4TYDA 2QF3A 4WH8A 4UFGH 3FFGA 4CBNA 4AYYB 1CO7E 8GCHG 3RP2A 1OWJA 4R0IA 1ESBA 1P2OA 3SUDA 1EP6A 3LT3A 1QR3E 5FBIA 3TGKE 1HDTH 1SFQB 4ZXYH 4IC6A 1O3FA 3E90B 1FQ3A 2PSXA 4JK6A 2AMQA 1MQ5A 2DE8A 2EA3A 1FDPA 3K9XB 1C5MD 1YPHE 1KLJH 1GJ4H 1JRSA 2Z3EA 3T26A 2Y7ZA 1MTWA 1QB6A 1JIMA 3RU4T 1FLEE 2O8WA 1GDUA 3GY3A 4I8JA 1O2SA 4X6OA 1H8DH 4DOQA 1J9CH 3UQOA 2PWXA 1FI8A 2C90B 3UR9A 1JIRA 3K6ZA 1HPGA 1O3PB 1G2LA 1XVMA 4X2XA 4BANB 4X8SH 3RXIA 4MTBA 1F92A 5CHAB 1UVSH 2A31A 3O8DA 1SR5C 1PYTC 3GCHB 1C5WB 3F9FA 1O2UA 1GMDF 3UUZA 1Y3VA 3M36A 1NS3A 3F6UH 3A86A 2PKSC 2ZTXA 2XYAA 1QBNA 1ANEA 3LGIA 2EI7A 1GL0E 1G30B 1TNLA 1UTKA 2OQ5A 1HIAB 2A45B 4I8KA 1O34A 7KMEH 1XXDA 3M3TA 3B23B 5EODA 1UCYE 1XUJA 2QXJA 4HFPB 1H8IH 1SGFA 4WMDA 1K1MA 5DO4H 4CR9A 2H1UA 2PTNA 2FODA 2OQUA 5SGAE 1LCYA 2A7CA 5DP7A 5AVDA 1ZTJA 3A81A 5A0BA 3A80A 1GHYH 1CBWB 1CHOF 1E0FD 1XMNB 2JETC 5I46H 4BTIB 1GMCF 1O3BA 4WWYA 1K1NA 1IQNA 4CBOA 3UOPA 3EYDA 1NTPA 4Q80A 1M9UA 3Q3KA 1WU1A 1C2DA 3Q3XA 1AMHA 3ZZ3A 2PSYA 2XC0A 2AMPA 1MQ6A 2TIOA 4FU9A 1LHFH 1LMWB 1O3AA 1WYKA 5GPIB 1UVPA 4YOIA 3RM2H 1ZGIA 4GCHG 3RMOH 1BQYA 1PQ5A 1UTNA 3SU2A 1ZMJA 4AB8A 1C5TA 1AB9C 4FVDA 2HNTC 2TBSA 1TNHA 3PMJA 1TOMH 1Z8IB 2BDHA 2H5DA 3NK8A 3Q00A 2ASUB 3MH4A 5TJXA 4B75A 1W14U 2WUBA 2QA9E 3PB1E 1HRTH 3GCOA 3SNDA 5EXNA 2BY6X 4CH8B 2FP7B 1SGEE 1F0RA 3BTHE 1SGIB 5ESBA 1TMUH 5PTPA 5ETXA 2XRCA 3A82A 1W11U 4NIVA 1BHXF 1IAUA 1QIXB 2BM2A 2C8WB 3MU4A 1E37B 3MO3A 1ZPZA 2FTLE 1LQEA 1BOQA 3OX7U 5GCHF 1DSUA 2VIDA 1QL7A 2ANMH 1O5DH 3QN7A 6GCHF 1YPGH 4SGBE 1K28D 1CGIE 5DKMA 1TWXB 1CA8B 3ZYDA 4ISOA 4FU8A 3GY2A 1N8OC 2BXUH 3W94A 2AERH 2BVRH 1ZTKA 2ZG0H 3C27B 4F4OC 1OWKA 2BD5A 3UTUH 4WXVA 2GDEH 3A7TA 1TA6A 2P8OB 4X6MA 4B71A 3RLYH 1L1NA 3ZVGA 1C1TA 1K1LA 3FP6E 4K8YA 3MHWU 2JH6D 1GBEA 3F9GA 3PTNA 5EW1H 1SVPA 4WH6A 1TONA 2OD3B 2F9VA 1EP5A 1ANCA 2ZA5A 3QZRA 3LKWA 3MWIU 2G8TA 2BDYA 1C5QA 1EAUA 2Q6FA 5F8XA 3KN2A 4UE7H 8KME2 1DITH 1NT1A 3Q76A 3HGNA 1RIWC 1AVWA 1L4DA 3Q3YA 4OS7A 2AMDA 2ZDNA 1A1RA 1AU8A 4JZ1A 5A0AE 2A4GA 3ATIA 4AORA 1F5LA 3UNSA 2CHAB 4YLQH 3SZNA 1GI9B 2RA3A 4AYVB 3CS0A 1AFQC 5HM9A 4ZHAA 3V3MA 3RXJA 2VWMA 3PLBA 2W3KA 4WMEA 3FZZA 5I25A 2M5TA 1IQFA 2PKSB 1ZSJA 2ZZUH 1ZMNA 1O3EA 1SL3A 4YZUA 5C5OA 1YPKH 3ZV8A 9LPRA 3QO6A 1MKWH 2WINI 3VB4A 2A2QH 1O2NA 3QX5H 1TMBH 3QK1A 2SGQE 1HAYB 1WCZA 3I29A 2J95A 1IQIA 1LKBA 2GDDA 1RGQA 3PLKA 3TVJB 2W7UA 2VJ1A 4YLUA 2SGAA 1OX1A 3RXLA 4I8LA 2FOBA 3KQDA 3ODDA 1DE7H 4Q7XA 1CSOE 1INCA 2FX6A 5FAHA 1LPKB 1BRAA 1CHGA 2JETB 2QXIA 2VIQA 4OS2A 1G2MA 1LHCH 3P8GA 2H6MA 1ETRH 3MU0A 2CXVA 2ZHFH 1N1LA 4IS5A 2J92A 1J16A 2QY0B 2XCNA 3ZZ8A 3B9FH 1B0FA 1BMNH 4ABAA 4YT7H 1BUIA 1QJ6B 2J38A 1F5KU 3DUXH 4ABDA 4A7IB 1KIGH 3MU8A 3URCA 3ZZCA 1C5YB 3SGQE 1UVUH 3M3SA 1ZMLA 1T7CA 4X0WU 4I8GA 1TBQH 2WV4A 1TQ0B 3UNRA 3E91A 5F8ZA 3BF6H 4DG4A 3M5MA 3PYHA 4JZDH 4MPUA 3KF2A 4JCNA 1KXDA 4NFEA 1HBTH 4YM9A 2F9BH 1YPHC 1P10A 5DP3A 2AYWA 3M37A 4UEHH 3UY9A 1N6YA 1GPZA 5GIBA 2EI6A 4BAHB 2OC0A 2GVFA 2WPJS 2OC7A 1FMGA 3E6PH 3M35A 2QN5T 4AFZA 4K8BA 4A1TA 1HAZB 3URDA 2D2DA 4BAQB 2BQ6B 1K1PA 3UWJH 2FYRA 1BA8B 1PPFE 3A7ZA 3P17H 3OU0A 1C1MA 1V2UT 2PKAB 1HJ8A 4Q2KA 1G32B 2Z9LA 1YCPH 1SGNE 1W12U 1XUKA 2CGAA 3NKKA 4ABEA 3MI4A 1ELEE 4HI3A 2A5KA 2CV3A 1VR1H 3U9AH 1FPHH 3T25A 1O35A 1GVLA 3R0FA 3QTVH 2BD3A 1C2MA 3EDXB 2VGCC 1SOZA 2BDAA 1P06A 2FLRH 5HM2A 1PPCE 7GCHG 2ESTE 2ZU3A 2ZDMA 4D8NA 1ID5H 2ULLA 4WVPE 4CH2B 1TNKA 2Y5FA 1O3JA 3F9HA 3SHCH 2CN0H 1V2NT 1HUTH 4FUHA 1EZUC 5DPAA 1FONA 2VWOA 4B74A 4MLFB 1SHYA 4ZKSU 2TGAA 3EAJA 4I8HA 4ISNA 3M7TA 2GMTB 1CT0E 3E0NB 1K1IA 3GY4A 5GJ4B 1G3CA 1UCYK 2ZGJA 3K2UA 2ZGBH 2VH6A 3H7OA 1MBQA 1O33A 3HPTB 1HXEH 2ZP0H 3I77A 1LVYA 2R0KA 4NSVA 4JZFH 1TRYA 3MNXA 2GKVE 1O2RA 1L1GA 1Z7KA 2B5TB 1THPB 3L33A 3SNAA 3OTJE 2VIWA 1GMDG 1DM4B 3KIDU 5H4IB 4Y11E 1RTKA 2ALPA 2KAIB 1TYNA 4NIYA 4XDEA 3R3GB 3V13A 1WOFA 2NU4E 4MNXA 2RG3A 1CGHA 3GCNA 1WQSA 1NFYA 3ODFA 1SMFE 2C8XB 4ZHLU 4ZKNU 3RC6A 1LDTT 1TNJA 2SNVA 4NFFA 2F9OA 1EAXA 2HNTF 3BN9A 4K1EA 4DGJA 3RMLH 1YYY1 1O3IA 2P59A 2PGQB 2PKAA 4MPXA 3SJKA 1WAYB 1YCPK 1GBHA 2ODPA 3SI3H 5T6FA 5FBEA 1KDQA 3U69H 3ZZBA 2AGEX 1O38A 1QL8A 1UTOA 1J8AA 2WYGA 4X2VA 1E35B 2XBWA 1CHOG 1V2OT 2LPRA 1MU6B 2FS9A 1GMCG 2SGPE 4ISIH 1JXPA 5DK1A 1FN6A 1H1BA 2OBQA 5J4SA 3MH7A 1O2IA 2SGDE 2F83A 2FTMA 4BNRA 2FLBH 1EZQA 4AZ2B 4FUBA 2Z9KA 1GHVH 1SHHB 1VGCC 4DJZB 1EAIA 1K1JA 4AGKA 3SNCA 3RXEA 1UK2A 2ZEBA 3DD2H 2O8TA 1EAWA 5GDSH 2HPPH 3A8BA 3JZ2B 4JYVH 2TGPZ 1MAXA 1DLEA 4RKJB 1TE0A 3QTOH 4HTCH 3SW2B 4KELA 2BYAX 4IMZA 2RDLA 2V0BA 2A4OA 4VGCC 1TBZH 1QURH 1O30A 3HK6B 2FX4A 1NZQH 5EW2H 4SGAE 2YNAA 1ANBA 2ANWA 1GVKB 4DIIH 1O2GH 1EPTC 3M61U 4XFQA 4ZMAH 2AIQA 2Y5HA 1LQDB 3FAOA 4BXWA 3TIUA 4KP0A 2XC5A 3SGAE 5FCKA 5L6NH 1O3NA 3BEFB 1ZHMA 2B9LA 4ZH8A 2ZECA 1P8VC 3LJJA 1UTLM 4AB9A 6GCHG 5IDKA 3SN8A 1GVZA 2GP9B 2VGCB 2K1QA 1C9PA 4O9VA 1SGQE 2BMGB 2ZDKA 3DA9B 5LPEA 3IITA 2WPMS 3BTKE 3UQVA 4Z6AH 5TCAA 1GBFA 2P3FH 4K3JA 1BTXA 1P3EA 1ZTLA 3UR6A 1SGCA 1FY3A 3G01A 3TJVA 3M3VA 1Z1JA 4BTTB 3LGUA 1NC6A 3D65E 2WUCA 5C1YA 3C1KA 1ZJDA 1S0RA 2A7HA 4X8VH 4BTUB 1C1SA 1C2FA 5DP5A 1LKAA 1A0LA 3KCGH 1BMAA 1ZSLA 1A0HB 1WSSH 1ARCA 2O8MA 1NRNH 2ZPRA 2HGTH 4GHTA 3RMNH 1V2LT 1CA0B 1CVWH 2ZIQH 2ZTYA 3D62A 4X2WA 3A89A 4UFFH 5HMAA 2ZFTA 3BTQE 1B7XB 1ZPBA 1SI5H 3KQBA 3MH5A 1NPMA 2BOHB 3SU5A 1IQJA 1GHAF 2ZC9H 3AASA 3ZVAA 2TRMA 5AFZH 3WY8A 2D26C 2FPZA 1O5GH 1GHBF 2BVSH 2NU0E 2PGBB 3QLPH 3QZQA 1BJUA 5A0CA 1GG6C 3EGKH 7LPRA 1OYTH 1ETSH 2PHBA 2ZU2A 4B2AA 1PFXC 4JMYA 1BITA 2V6NA 1BMLA 4OS4A 2IN2A 1YLCA 1ELDE 2FOMB 2ODYB 4TY6A 3CP7A 4X2YA 1UTQA 3VFEA 2FMJA 4H4FA 6LPRA 1GJDB 1YGCH 4BAKB 5JBBS 5JB8S 4Y79A 1H9IE 3BTTE 3LGVA 1O3GA 4ZKOU 1IQGA 2ZWLH 1IQKA 3SHAH 3E8LA 1VCPA 2FOCA 2C93B 2GZ7A 1EB1H 1UTPA 1A46H 3RXHA 2HOBA 2H5CA 1MTVA 2HVXA 2PTCE 1O2KA 5FPYA 3VB7A 1ORFA 2Z9GA 1TPOA 2RCEA 5CE1A 1GWAA 1C1RA 2Z7FE 2Y5GA 1BRBE 2ZU4A 2ZQ1A 1KLIH 2XCFA 1D6WA 1EB2A 1QBOA 1Y8TA 1V2TT 3SJ9A 2JH0D 2VWLA 3OY6U 3GDUA 3KGPA 2FDAA 4CRBA 3AAUA 1MAYA 1D9IA 1VGCB 3BV9B 1C1UH 1UVTH 2R2WU 4A1VA 1EXFA 4BXSA 1T8LA 1ELTA 4LXBH 3NXPA 2C8YB 1XUFA 3P92A 3KQEA 4B2CA 2P95A 3DHKH 1KLTA 5EQRA 1EJMA 1W0YH 3TJOA 1TFXA 1AFEH 2NWNA 1SLUB 2J4IA 4X1QU 1C9TA 3QGJA 1Q3XA 2W7SA 2XBYA 1L0ZA 4Y10E 4KTSA 1TGBA 5AFYH 4MVNA 5DP9A 3UPEA 4X1PU 4CREA 3UFAA 1SGPE 2ZDVH 3GOVB 4WJG2 2WPHS 1D3DB 1GBBA 2FM2A 2FEQH 4FU7A 4X8UH 1FY4A 4ZROA 1IHTH 1ELAA 4YESB 5EXMA 5LPRA 2VIOA 4TPYA 1KSNA 1VCQA 5EPYA 5LGOA 4HZHA 1C2EA 1H9LB 2TPIZ 4K60A 4Y8YA 1GBKA 3LOXA 1ELFA 1TOCB 1B5GH 1KXBA 1O31A 3NPSA 4XBCA 3RC5A 3VPKA 4XBDA 1G37A 3T62A 1U6QA 1C2JA 5GWZA 2V3HH 3EA8A 3SUEA 4RN6A 1UK4A 4LZ1H 4U32A 4HGCA 3OSYA 1GJ8B 3PWBA 4J1YA 4CHAC 3EA7A 1WUNH 1D3QB 4X1RU 2AS9A 3AW1A 2XTTB 4Y76A 5EPNA 2Y81A 1G36A 2ZDLA 4BOHA 1GMHF 4I31A 3MU1A 1O3KA 2GV7A 1O2YA 1MZDA 3TK9A 1GI4A 1H4WA 2ZNKH 1DWBH 3A8DA 1UTMA 1XUGA 2VB0A 1P2NA 1C5RA 4IMQA 5L30H 1P3CA 1RS0A 4ZUHA 4INLA 1FN8A 3TITA 1BBRE 1SG8B 1W10U 1RRKA 3A85A 1YPEH 2JKHA 1HGTH 2ODQA 1RTFB 1QCPA 4B2BA 1BDAA 3VB6A 3LONA 2Z94A 4MDSA 4B1TA 1A5IA 3MU5A 2XXLA 3P8OA 1GJ6A 1IQHA 1QA0A 1TNGA 1LHGH 1EJNA 3GCTG 2ZDAH 4A6LA 4ABFA 1NRQH 5J4QA 1S82A 1Y5UT 3ZVFA 1V2JT 1AZZA 1DLKB 4AG1A 8GCHF 2Y82A 2LNCA 8ESTE 1GI0A 3BEIB 1MU8B 2ZHQH 3UWIA 3ATMA 1YPLH 2ANKH 4D7FA 1SGTA 3S0NA 5ABWA 2NU1E 3PMHB 2GCTC 1Q2WA 2D1JA 1EPTA 2AIPA 1ETTH 2FOAA 5BPEA 3MFJA 1GBJA 4GUXA 5FHTA 2Y80A 1CGJE 1UO6A 3RU4D 1DXPA 2Q1JA 4FUGA 3BTFE 3GDVA 2R3UA 1ARBA 1AVGH 1GCTC 2AGGX 1GI7B 3V0XA 1FAKH 1QGFA 1ZLRA 3SGBE 1C1QA 5C20A 3A7YA 1KXFA 3SV9A 3SU6A 2TGTA 2GT8A 3RXVA 1MD8A 1P2KA 1GGDC 5DG6A 2P94A 1A5HA 2ZGHA 1O39A 4UDWH 4X1NU 1TA2A 2R2MB 2NU3E 1EATA 1S81A 1BTYA 4ESTE 2SNWA 2BDBA 3MOCA 3E0PB 1GI6A 1MH0A 1CE5A 2BY9X 1GJ9B 2BDIA 1MTSA 2B0FA 1EKBB 3T27A 1Z8GA 4OS1A 3SU4A 2G51A 6CHAC 1C5LH 4GVUA 2HRVA 3BG4C 1AB9B 1O3DA 2SGEE 3GYMA 2J9NA 1KTSB 3QDZB 1VJAU 1OXGA 1T4VH 1GBTA 1P0SH 1UCYH 1P05A 2YNBA 3GICB 1C4V2 3HGPA 2Y6TA 1BTHH 3ZV9A 2XWAA 4FUJA 3SU1A 2BZ6H 4NZLA 2XBVA 1O5BB 1BB0B 4H6SB 1ABJH 2BD8A 4ABJA 1OWEA 5EOKA 1P2MA 4DIHH 1DXWA 1CT2E 2GTBA 1AQ7A 1OWIA 1S84A 4CRFA 1S85A 1EOLA 3TGIE 1CQQA 1BCUH 2GCHF 1D6RA 1W7XH 4LK4A 3CENA 5L2YH 4FVBA 1DPOA 1LHDH 1GJ7B 3MH6A 2F9PA 2DE9A 4CHAB 1AVXA 1MTNC 5JBTA 1HJAC 1AZ8A 1P2JA 3P70B 1N8OB 1QJ1B 1HYLA 2G55A 2F3CE 1AKSA 4AFQA 3UOUA 1E36B 4FUEA 2PLXA 1SGRE 2EC9H 1KDQB 4BAOB 2OCVB 2FOHA 1DWEH 1PQAA 2XC4A 5B6OA 1O5FH 1RD3B 4O03A 2OTVA 1FIWA 1SB1H 1ESTA 4KTCA 4AFUA 1Z8RA 1TGSZ 1BZXE 1EUFA 1Z6EA 2V3OH 3ZVBA 3V12A 3RXGA 1O2TA 1O5EH 4I32A 3T28A 1QB1A 4FUIA 3M5LA 1SSXA 2J94A 1JMOH 1AE8H 3MO6A 4NA9H 2NU2E 5FPSA 3ENSB 4U2WA 5HGGA 5T6GA 2B7DH 1KXAA 1RIWB 1XUIA 1GI2A 2G5VA 1AWFH 2TGDA 1GL1A 2J2UA 3SV7A 1VJ9U 3STIA 2ZFFH 1GHAG 1ZPCA 1P02A 4ASHA 1G3BA 1S5SA 4XSKU 1GI8B 1AFQB 1A3BH 1CT4E 3VXEH 1K21H 1QA7A 1GHBG 1EZSC 1GHXH 2P3TB 4KGAA 1XKBC 4Y7AA 3GY8A 3RC4A 1TBRH 2GZ9A 3TNSA 4RKOB 3RUOA 1C2KA 1O5CB 2BQ7B 1QB9A 1EASA 1PYTD 3RXAA 3U98H 1T31A 2UWPA 1DSTA 3E16B 4CRCA 4TWWA 3W95A 1ELCA 4I33A 1C1NA 1F0UA 3QUMP 4DURA 1TIOA 3PMBB 2ALVA 4NIXA 4Q7ZA 3ESTA 3BIVH 1WBGB 4INKA 3TJNA 3BTDE 2A32A 3K6YA 1HAXB 2FOFA 5C1XA 5DP6A 4YO9A 1WQVH 1C1VH 1BTUA 1NROH 2XNIA 5C5NA 2QC2A 2R0LA 3SV2H 1D3PB 3PROA 4ZAEA 1O5AB 3ZYEA 1DUEA 1FIZA 1SGDE 1GJCB 3FP8E 4AGJA 1DFPA 3F9EA 1ZR0A 3VEQB 3RXOA 2CMYA 1NN6A 4O97A 1O2LA 1SOTA 3AW0A 5AHGH 3GCHC 4AG2A 4KTUA 3BTGE 3LJOA 1YLDA 6CHAB 5DGJA 2BZAA 1YCPM 1GDQA 1Y59T 1MMJN 1P03A 2BB4A 1HAOH 5C3NA 1V2ST 1OOKB 3I78A 4O3UA 3RXTA 1ZRKA 1O2VA 1OPHB 2PW8H 1ZRBA 2VVUA 4X6PA 1T8NA 3SO3A 1A3EH 4Y0YE 3SJOA 3RXPA 3RMMH 1Q31A 3PTBA 1S83A 1O2OA 3ATLA 3A8AA 5E0GA 4CRDA 3ZVCA 2OXSA 4JYTA 4KKDA 1NRSH 1O2HA 2STAE 4Z0KA 2C8ZB 4E7RG 1KXEA 1SGFG 2DUCA 2P93A 1PJPA 2YOLA 3MNBA 5F6MA 5FXLA 1HAPH 2QXHA 4NA8A 1T4UH 3RXCA 1SC8U 1TAWA 1YPMH 1T8MA 1EZXC 1IQLA 2BOKA 1MTNB 3MMGA 2PV9B 4JYUH 1SQTA 5JPMH 2Z6BD 4THNH 3MO9A 4AFSA 2HPQH 5DJ7A 3SQEE 2F91A 1C1WH 1MKXH 1NFUA 5GCHG 1AHTH 1QQUA 1QQ4A 1YBWA 5EG4A 1SQAA 3NCLA 1HV7A 1DOJA 1A7SA 2O8UA 4F49A 4OGXA 1AUJA 4ABIA 2OBOA 1UVOA 5DP8A 2Z3DA 2CF9H 2STBE 1ELVA 2ZHEH 1HAVB 1MUEB 1V3XA 3Q77A 2FXRA 1K22H 4ZXXH 2A0QB 1GMHG 2IPHA 5DP4A 3ITIA 1P12E 1S6FA 3PWCA 4CRAA 1BJVA 3HKIB 2GD4B 1ZYOA 1TPSA 2HALA 1XX9A 1VZQH 3LH1A 2AGIX 1W13U 2VIVA 1NY22 1ACBE 3K65B 4JK5A 3O8RA 4X6NA 3T29A 3RXFA 3RXUA 1PQ8A 2ZCLP 2AEIH 4DT7B 1AN1E 3L6PA 3GY6A 4YOGA 3SU3A 4Y8XA 3U8OH 2ZHDA 3ATKA 2C4FH 5JBCS 3KHVA 5BRRE 1LTOA 2JH5D 3D23A 1SLVB 4NSYA 4O3TA 4D76A 3RXSA 1G3EA 2EEKA 3PV4A 1HLTH 4OS5A 2ZU5A 1C5XB 3TLOA 2BX4A 5EQQA 1O3HA 3OY5U 3RXDA 4UD9H 2P8OC 1OP0A 3ZZ6A 1MBMA 3QWCH 1QHRB 5EQSA 5EGMA 4U30A 1JBUH 2H2ZA 2VH0A 2FESH 4A1XA 1F2SE 1A2CH 4NZQA 2O9QA 2FOGA 4I7YH 1TX7A 2O8LA 1HB0B 1OYQA 3T5FH 4XE4A 5A09A 4DVAU 1T8OA 2VU8E 3U1IB 2VVVA 4ZKRU 3LPRA 1LPGB 3HK3B 1ABIH 3M7QA 2ZFPH 2PUQH 4LOYH 1Y3XA 3GDSA 1X7AC 2QF0A 3BTWE 2I6SA 2RA0A 4E06H 4MNYA 1H9HE 3ATWA 1GJ5H 1S0QA 3E1XB 5C2ZA 1LVMA 1VCWA 4Y71A 1F7ZA 2BD9A 1MKXK 1JOUB 1TNIA 7ESTE 4IW4E 1W7GH 2CHAC 1GDNA 5GXPA 2GGVB 4BAMB 4GSOA 5EXLA 1HJ9A 2Z9JA 3SUFA 1OSSA 3V7TA 1TRMA 1GI1A 2FI3E 3GYLB 5F8TA 1MZAA 1O2PA 4E05H 1C1OA 1Y3YA 1HAVA 1SBWA 1VITF 1ZGVA 3ZZ7A 1Z6JH 3LC3A 2BDGA 4ISHH 1W2KH 1TMTH 1KXCA 1O0DH 2GT7A 1L2EA 4OS6A 1C5PA 2AH4X 1A0JA 2QYIA 4FUDA 4WF8A 4U01A 2Z3CA 1J14A 4NIWA 3SV6A 2PFEA 1QBVH 2GV6A 2G00A 3A87A 2H9EH 1PPBH 2IOTA 3EA9A 2Q6GA 1UMAH 5T3HA 1SLWB 3ZZ9A 1KYNA 1P9UA 4Y0ZE 1SLXB 1OKXA 1EOJA 1THRH 2FO9A 4DCDA 1UHBA 2WYJA 4D9RA 2ZCHP 1O3MA 2FIRH 3MNSA 4VGCB 1TX8A 1UJ1A 3NWUA 1V2WT 3SUGA 4ISLA 3IWMA 1O32A 3TNTA 3O8CA 3DFLA 3PO1C 3PLPA 2FOEA 3GISB 1EPTB 3BTEE 3KEEA 3ZVDA 4K2YA 4MQAA 2QAAA 1FY5A 2ZTZA 2GCHG 4D7GA 3AAVA 1XUHA 1FXYA 3MYWA 1TPPA 3TH2H 4YOJA 1PPZA 3RXRA 2I6QA 3RXMA 3E3TA 2W5EA 4GPGA 3RXBA 1XVOA 4X8TH 1ANDA 3S7KB 3RU4E 1O3CA 1IQMA 2QCYA 2FI5E 1OS8A 1Z1IA 1ESAA 1TB6H 2ILNA 2OC8A 3LU9B 4FXGH 1AGJA 1GJAB 2ZCKP 2ZF0H 5C1UA 1GBIA 9ESTA 1YPJH 1EJAA 4WMFA 1OP2A 2UUYA 3BTME 4MNWA 1D4PB 3A7VA 1J15A 1KTTB 4K69A 2XW9A 4IC5A 1QRWA 1T32A 4A92A 2FI4E 1C5ZB 1HIAA 2Y7XA 1GI3A 4MG3A 4FUFA 1JWTA 2FYQA 1C4Y2 1DY9A 4ZHMU 1LO6A 4B76A 5JYIA 3STJA 5LPFA 5JBAS 2BX3A 1RXPA 2W3IA 1GG6B 4PROA 2OUAA 5JB9S 1AI8H 1HAGE 1FV9A 3HATH 3RLWH 4K5ZA 2D8WA 1LVOA 1A61H 3FP7E 1V2MT 4NGAH 4MPVA 4FUCA 1W3CA 4DW2U 2F9UA 1A5GH 5LH8A 5CMXH 2OINA 3JZ1B 1N6XA 2ZFQH 2UWOA 1AE5A 2UWLA 3SNBA 2FS8A 1GBLA 4AN7A 1VITH 2QV1A 2GMTC 1AKSB 3SNEA 2A4RA 1XXFA 2P16A 3GY5A 4Q7YA 5E2OA 1O2JA 3BEUA 1NU7B 3LGTA 3SJ8A 1P09A 1P57B 2BVXH 3UIRA 2ZGXH 1O2MA 1K9OE 1O2ZA 3H7TA 1DUAA 2VIPA 3RDZA 1ELBA 3EE0B 3SBKA 1NFXA 3S69A 1E38B 1C5VA 1PPHE 3P95A 2PR3A 5A8ZA 1G3DA 2H9HA 2BLQA 1E34B 4TY7A 1YM0A 2BQWB 4YTAA 1Y5AT 2G4TA 2OC1A 2B8OH 5T6DA 1O3LA 1OWHA 2BLWA 4MNVA 4UFEH 5A8YA 3RXQA 1C5SA 1NRPH 2SFAA 2A1DB 1O36A 1Y3UA 1TALA 3P8FA 1GBDA 4H42U 1ZSKA 2CF8H 1B0EA 3U8RH 2GX4A 1MTUA 1P9SA 1S6HA 3NZIA 2IJOB 4A5TS 3ELAH 4NA7A 1FY1A 1AD8H 1XM1A 1TPAE 3PO1B 2BY5X 4LZ4B 4D9QA 1C2IA 3VGCC 2HWLB 4K1SA 1JRTA 1DX5M 1HAHH 1O2XA 4IBLH 4JZEH 2G81E 2W26A 1GBCA 1AWHB 3KL6A 1QY6A 2QIQA 5JDUB 1GHWH 1C5OH 3SI4H 5A8XA 5EU8A 1Z8JB 2WPLS 1TGNA 3BIUH 1DVAH 3DFJA 4GCHF 4XOJA 2A5IA 1V6DA 1KY9A 3PM3A 1GCDA 1BT7A 2FZZA 1D3TB 3M5OA 5K0HA 4YT6H 1LVBA 4TWYA 5IYTA 3SORA 4M7GA 2XBXA 5HYOA 1AO5A 3GY7A 6ESTA 1O2WA 2A4QA 2EI8A 4JZIA 4XBBA 2G5NA 1TGTA 1ZOMA 3ZZ5A 2ANYA 3F1SB 3SQHE 1GJBB 1P04A 1TQ7B 2VNTA 3SOSA 3KQCA 1V2KT 1BIOA 5ESTE 4ABBA 4RSPA 5E0JA 3EQ0H 5E8EH 3UNQA 1DDJA 3IG6B 3A7XA 3ZZAA 2UUJB 4NWLA 4MPWA 4Y6DA 1FJSA 1GI5A 4NCYA 2ZFRH 2C3SA 3TJUA 1LHEH 1MKWK 3TH3H 1GBAA 3KNXA 3T2NA 1V2QT 3F68H 1TX6A 5C67A 1C1PA 1ZJKA 1GBMA 1YKTA 4H6TA 2BLVA 2BD2A 3N7OA 1FY8E 1YF4A 3LDXH 5FPTA 1BRCE 1F0SA 1O2QA 1QRXA 3TK6A 3VB5A 3MNCA 4R8TB 1SGYE 3TPIZ 2PUXB 1MD7A 1WV7H 2R9PA 1FPCH 3S9AA 1NM6A 4TPIZ 3ZVEA 3ZZ4A 1PQ7A 2BDCA 1HNEE 2OLGA 3RM0H 2ZGCA 1BTPA 1HXFH 3P6ZB 3L3TA 1RJXB 1DS2E 2HNTE 1V2RT 1FUJA 2Z9IA 1W8BH 2GCTB 1QNJA 2BD7A 3VXFH 1CU1A 4AOQA 1NO9H 2THFB 1THSH 1FZZA 2ZPQA 3H5CB 1ZZZA 4GAWA 1SFIA 1BBRH 1DWCH 1NU9A 3CS7A 1FNIA 5FCRA 3RXKA 2ZPSA 1WTGH 2BY8X 3TU7H 3HKJB 1CA0C 3GCTF 2VWNA 1GCTB 1YP9A 4ABGA 2FWWA 3TGJE 3A83A 4DY7B 1L4ZA
chains in the Genus database with same CATH superfamily
3M7UA 1OWDA 1EX3A 1F5RA 3OYPA 3ZZDA 1IQEA 4INHA 1LPZB 5HXFA 3U1JB 1GGDB 1AY6H 4K1TA 3PMAB 4NWKA 1O37A 1EQ9A 1F0TA 1IHSH 1DANH 3P8NA 2J98A 3SV8A 2J34A 1PPGE 1C4U2 1QFKH 2WV5A 2QGRA 1BTWA 1GHZA 1DT2A 5CHAC 1FAXA 2BHGA 3M5NA 1VITG 1J17T 2BTCE 2HLCA 4ABHA 2VBCA 1Z71A 3TK5A 2AHME 1V2VT 5FX5A 4IGDA 1A4WH 1DICA 2WPIS 3A8CA 2UUKB 3BG4B 4IN2A 1QJ7B 1Y5BT 1WDIA 2ZHWH 2V35A 5E0HA 3SYJA 3AVZA 2AFQB 3D49H 4Y8ZA 3TH4H 5E2PA 5AF9H 3A7WA 3S9BA 3LIWA 5TCCA 3VGCB 4IN1A 2BY7X 1C2LA 1O3OA 1K1OA 1NFWA 1QTFA 3FANA 5F03A 4X1SU 1MCVA 2ZKSA 3BG8A 4NG9H 4WY3A 4J2YB 1OP8A 1YC0A 4QT8C 2VVCA 2F9NA 1Y3WA 3NUMA 2OP9A 1BTZA 3QGNB 3BSQA 3MTYA 3LH3A 3S9CA 1ELGA 3LGYA 1CBWC 2ZQ2A 1MCTA 1NESE 3F0PA 2BLOA 1PPEE 1TABE 2A5AA 1AIXH 3FZDA 1BRUP 1QRZA 3SJIA 3SU0A 1P11E 3LGWA 3UREA 4OGYA 1P01A 1TRNA 5L2ZH 4Y7BA 5A2MH 1HAIH 5G4BA 1HJAB 1AUTC 1BBRK 3A88A 2BD4A 2SGFE 2GZ8A 1G9IE 1ZHPA 2H9TH 1C5NH 1WTHD 1XKAC 1UK3A 5K7RA 2P3UB 1W0ZU 2UUFB 4B73A 1YY3A 2HLDD 1K2I1 1P2QA 1RTLA 5FX6A 4CR5A 1TGCA 4GHQA 1QL9A 3LC5A 1HFDA 4AX9H 2Q6DA 2WPKS 1C2HA 3DT0H 3F2FA 4CRGA 1ZHRA 2ZI2H 1IOEA 2VINA 1C5UA 3EE7A 1KMHB 2A7JA 2KAIA 3A84A 1W0JD 1L1JA 2R3YA 3S7HB 2HVYB 4UFDH 4E7NA 2BXTH 3VB3A 3FVFB 2ZU1A 1BMMH 1DY8A 2QXGA 1NRRH 1RFNA 2ZFSA 3MQKC 2CJIA 1C2GA 1V2PT 1DWDH 3O8BA 2ZO3H 1SPJA 3U8TH 1P2IA 2KCPA 2XWBI 3B8JA 2G4UA 1SQOA 1UHBB 2A2XH 4UONA 1UTJA 2M2AA 4GLYA 1TLDA 8LPRA 1BHXB 7GCHF 1HCGA 2G52A 4WXIA 4TYDA 2QF3A 4WH8A 4UFGH 3FFGA 4CBNA 4AYYB 1CO7E 8GCHG 3RP2A 1OWJA 2W6JD 4R0IA 1ESBA 1P2OA 3SUDA 1EP6A 3LT3A 1QR3E 5FBIA 3TGKE 1HDTH 1SFQB 4ZXYH 4IC6A 1O3FA 3E90B 1FQ3A 2PSXA 4JK6A 2AMQA 1MQ5A 2DE8A 2EA3A 1FDPA 3KYFA 3K9XB 3F0OA 1C5MD 1YPHE 1KLJH 1GJ4H 1JRSA 2Z3EA 3T26A 2Y7ZA 1MTWA 1QB6A 1JIMA 3RU4T 1FLEE 2O8WA 1GDUA 3GY3A 4I8JA 1O2SA 4X6OA 1H8DH 4DOQA 1J9CH 3UQOA 2PWXA 1FI8A 2C90B 3UR9A 1JIRA 3K6ZA 1HPGA 1O3PB 1G2LA 1XVMA 4X2XA 4BANB 4X8SH 3RXIA 4MTBA 1F92A 5CHAB 1UVSH 2A31A 3O8DA 1SR5C 1PYTC 1SKYE 3GCHB 1C5WB 3F9FA 1O2UA 1GMDF 3UUZA 1Y3VA 3M36A 1NS3A 3F6UH 3A86A 2PKSC 2ZTXA 2XYAA 1QBNA 1ANEA 3LGIA 2EI7A 1GL0E 1G30B 1TNLA 5T1VA 1UTKA 2OQ5A 1HIAB 2A45B 4I8KA 1O34A 7KMEH 1XXDA 3N99A 4P02A 1EFRD 3M3TA 3B23B 5EODA 1UCYE 1XUJA 2QXJA 4HFPB 1H8IH 1SGFA 4WMDA 1K1MA 5DO4H 4CR9A 2H1UA 2PTNA 2FODA 2OQUA 5SGAE 1LCYA 2A7CA 5DP7A 5AVDA 1ZTJA 3A81A 5A0BA 3A80A 1GHYH 1CBWB 1CHOF 1E0FD 1XMNB 2JETC 5I46H 4BTIB 1GMCF 1O3BA 4WWYA 1K1NA 1IQNA 3W1EA 4CBOA 3UOPA 3PRDA 3EYDA 1NTPA 4Q80A 1M9UA 3Q3KA 3F2GA 1WU1A 1C2DA 3Q3XA 1AMHA 3ZZ3A 2PSYA 2XC0A 2AMPA 1MQ6A 2TIOA 4FU9A 1LHFH 1LMWB 1O3AA 1WYKA 5GPIB 1UVPA 4YOIA 3RM2H 1ZGIA 4GCHG 3RMOH 1BQYA 1PQ5A 1UTNA 3SU2A 1ZMJA 4AB8A 1C5TA 1AB9C 4FVDA 2K8IA 2HNTC 3WWFA 2TBSA 1TNHA 3PMJA 1TOMH 1Z8IB 2BDHA 2H5DA 3NK8A 3Q00A 2ASUB 3MH4A 5TJXA 4B75A 1W14U 2WUBA 2QA9E 3PB1E 1HRTH 3GCOA 3SNDA 5EXNA 2BY6X 4CH8B 2FP7B 1SGEE 1F0RA 3BTHE 1SGIB 5ESBA 1TMUH 5PTPA 5ETXA 2XRCA 3A82A 1W11U 4NIVA 1BHXF 1IAUA 1QIXB 2BM2A 2C8WB 3MU4A 1E37B 3MO3A 1ZPZA 2FTLE 1LQEA 1BOQA 3OX7U 5GCHF 1DSUA 2VIDA 1QL7A 2ANMH 1O5DH 3QN7A 6GCHF 1YPGH 4SGBE 1K28D 1CGIE 5DKMA 1TWXB 1CA8B 3ZYDA 4ISOA 4FU8A 3GY2A 1N8OC 2BXUH 3W94A 2AERH 2BVRH 1ZTKA 2ZG0H 3C27B 4F4OC 1OWKA 2BD5A 3UTUH 4WXVA 2GDEH 3A7TA 1TA6A 2P8OB 4X6MA 4B71A 3RLYH 1L1NA 3ZVGA 1C1TA 1K1LA 3FP6E 4K8YA 3MHWU 2JH6D 1GBEA 3F9GA 3PTNA 5EW1H 5C0TA 1SVPA 4WH6A 1TONA 2OD3B 2F9VA 1EP5A 1ANCA 2ZA5A 3QZRA 3LKWA 3MWIU 2G8TA 2BDYA 1C5QA 1EAUA 2Q6FA 5F8XA 5GNDA 3KN2A 4UE7H 8KME2 1DITH 1NT1A 3Q76A 3HGNA 1RIWC 1AVWA 1L4DA 3Q3YA 4OS7A 2AMDA 2ZDNA 1A1RA 1AU8A 4JZ1A 5A0AE 2A4GA 3ATIA 4AORA 1F5LA 3UNSA 2CHAB 3F3BA 4YLQH 3SZNA 1GI9B 1S6LA 2RA3A 4AYVB 3CS0A 1AFQC 5HM9A 4ZHAA 3V3MA 3RXJA 2J5UA 2VWMA 2W3KA 3PLBA 4WMEA 3FZZA 5I25A 2M5TA 1IQFA 2PKSB 1ZSJA 2ZZUH 2K0QA 1ZMNA 1K0HA 2WV9A 1O3EA 1SL3A 4YZUA 1VKYA 5C5OA 1YPKH 3ZV8A 4ACBA 9LPRA 3QO6A 1MKWH 2WINI 3VB4A 1SQRA 2A2QH 1O2NA 3QX5H 1TMBH 3QK1A 2SGQE 1HAYB 1WCZA 3I29A 2J95A 1IQIA 1LKBA 2GDDA 1RGQA 3PLKA 3TVJB 2W7UA 2VJ1A 4YLUA 2SGAA 1OX1A 3RXLA 4I8LA 2FOBA 3KQDA 2PP6A 2YMSC 3ODDA 1DE7H 4Q7XA 1CSOE 1INCA 2FX6A 5FAHA 1LPKB 1BRAA 1CHGA 2JETB 2QXIA 2VIQA 1BMFD 4OS2A 1G2MA 1LHCH 3P8GA 2H6MA 1ETRH 3MU0A 2CXVA 2ZHFH 1N1LA 4IS5A 2J92A 1J16A 2QY0B 2XCNA 4RI0A 3ZZ8A 3B9FH 1B0FA 1BMNH 4ABAA 4YT7H 1BUIA 1QJ6B 2J38A 1F5KU 3DUXH 4ABDA 4A7IB 1KIGH 2JJ2D 3MU8A 3URCA 3ZZCA 1C5YB 3OEED 3SGQE 1UVUH 3M3SA 1ZMLA 5FL7D 1T7CA 4X0WU 4I8GA 1TBQH 2WV4A 1TQ0B 5EJZA 3UNRA 3E91A 3AK5A 2KZ4A 5F8ZA 4F48B 3BF6H 4DG4A 3M5MA 3PYHA 4JZDH 4MPUA 2J98B 3KF2A 4JCNA 1KXDA 4NFEA 1HBTH 4YM9A 2F9BH 1YPHC 1P10A 5DP3A 4I86A 2AYWA 3M37A 4UEHH 3UY9A 1N6YA 1GPZA 5GIBA 2EI6A 4BAHB 2OC0A 2GVFA 3OEHD 2WPJS 2OC7A 1FMGA 3E6PH 3M35A 2KM0A 2QN5T 4AFZA 4K8BA 4A1TA 1HAZB 4ZCNA 3URDA 2D2DA 4BAQB 2BQ6B 1K1PA 3UWJH 1QZ8A 2FYRA 1BA8B 1PPFE 3A7ZA 3P17H 3OU0A 1C1MA 1V2UT 2PKAB 1HJ8A 4Q2KA 1G32B 2Z9LA 1YCPH 1SGNE 4XD7D 3DCLA 1W12U 1XUKA 2CGAA 4M9FA 3NKKA 4ABEA 3MI4A 1ELEE 4HI3A 2A5KA 2CV3A 1VR1H 3U9AH 1FPHH 3T25A 1O35A 3CNRA 2V7QD 1GVLA 3R0FA 3QTVH 2BD3A 1C2MA 3EDXB 2VGCC 1SOZA 2BDAA 1P06A 2FLRH 5HM2A 1PPCE 7GCHG 2ESTE 2ZU3A 2ZDMA 4D8NA 2GJGA 1ID5H 2ULLA 4WVPE 4CH2B 1TNKA 2Y5FA 1O3JA 3F9HA 3SHCH 2CN0H 1V2NT 1HUTH 4FUHA 1EZUC 5DPAA 1FONA 2VWOA 4B74A 4MLFB 1SHYA 4ZKSU 2LP6A 2TGAA 3EAJA 4I8HA 2XOKD 4ISNA 3M7TA 2GMTB 1CT0E 3E0NB 1K1IA 1NBMD 3GY4A 5GJ4B 1G3CA 1UCYK 2ZGJA 3K2UA 2ZGBH 2VH6A 3H7OA 1MBQA 1O33A 2KCAA 3HPTB 1HXEH 1YLNA 2ZP0H 3I77A 1LVYA 2R0KA 4NSVA 4JZFH 1TRYA 3MNXA 2GKVE 1O2RA 1L1GA 1Z7KA 2B5TB 1THPB 3L33A 3SNAA 3OTJE 2VIWA 1GMDG 1DM4B 3KIDU 5H4IB 4Y11E 1RTKA 2ALPA 2KAIB 1TYNA 4NIYA 4XDEA 3R3GB 3V13A 1WOFA 2NU4E 4MNXA 2RG3A 1CGHA 3GCNA 1WQSA 1NFYA 3ODFA 1SMFE 2C8XB 4ZHLU 4ZKNU 3RC6A 1LDTT 1TNJA 2SNVA 4NFFA 2F9OA 1EAXA 2HNTF 3BN9A 4K1EA 4DGJA 3RMLH 1YYY1 1O3IA 2P59A 2PGQB 2PKAA 4MPXA 3SJKA 1WAYB 1YCPK 1GBHA 2ODPA 3SI3H 5T6FA 5FBEA 1KDQA 3U69H 3N7DA 3ZZBA 2AGEX 1O38A 1QL8A 1UTOA 1J8AA 2WYGA 2W6ID 1E35B 4X2VA 2XBWA 1CHOG 1V2OT 2LPRA 1MU6B 2FS9A 1GMCG 2SGPE 4ISIH 1JXPA 5DK1A 1FN6A 1H1BA 2OBQA 5J4SA 3MH7A 1O2IA 2SGDE 2F83A 2FTMA 4BNRA 2FLBH 1EZQA 4AZ2B 4FUBA 2Z9KA 1GHVH 1SHHB 1VGCC 4DJZB 1EAIA 1K1JA 4AGKA 3SNCA 3RXEA 1UK2A 2ZEBA 3DD2H 2O8TA 1EAWA 5GDSH 2HPPH 3A8BA 3JZ2B 4JYVH 2TGPZ 1MAXA 1DLEA 4RKJB 1TE0A 3QTOH 4HTCH 3SW2B 5KECA 4KELA 2BYAX 4IMZA 2RDLA 2V0BA 2A4OA 4VGCC 1TBZH 1QURH 1O30A 3HK6B 2FX4A 3FN8A 1NZQH 5EW2H 4SGAE 2YNAA 1ANBA 2ANWA 1GVKB 4DIIH 1O2GH 1EPTC 2IJD1 3M61U 4XFQA 4ZMAH 2AIQA 2Y5HA 1LQDB 3FAOA 4BXWA 3TIUA 4KP0A 2XC5A 3SGAE 5FCKA 5L6NH 1O3NA 3BEFB 1ZHMA 2B9LA 4ZH8A 2ZECA 1P8VC 3LJJA 1UTLM 4AB9A 6GCHG 5IDKA 3SN8A 1GVZA 2GP9B 2VGCB 2K1QA 1C9PA 4O9VA 1SGQE 2BMGB 2ZDKA 3DA9B 5LPEA 3IITA 2WPMS 3BTKE 3UQVA 4Z6AH 5TCAA 1GBFA 2P3FH 4K3JA 4AC9A 1BTXA 1P3EA 1ZTLA 3UR6A 1SGCA 1FY3A 3G01A 3TJVA 3M3VA 1Z1JA 4BTTB 3LGUA 1NC6A 3D65E 2WUCA 5C1YA 3C1KA 3U28C 1ZJDA 1S0RA 2A7HA 4X8VH 4BTUB 1C1SA 1C2FA 5DP5A 1LKAA 1A0LA 3KCGH 1BMAA 1ZSLA 1A0HB 1WSSH 1ARCA 2O8MA 1NRNH 2ZPRA 2HGTH 4GHTA 3RMNH 1V2LT 1CA0B 1CVWH 2ZIQH 2ZTYA 3D62A 4X2WA 4ASUD 4DT4A 3A89A 4UFFH 5HMAA 2ZFTA 3BTQE 1B7XB 1ZPBA 1SI5H 3KQBA 3MH5A 1NPMA 2BOHB 3SU5A 1IQJA 1GHAF 2ZC9H 3AASA 3ZVAA 2TRMA 5AFZH 3WY8A 2D26C 2FPZA 1O5GH 1GHBF 2BVSH 2NU0E 2PGBB 3QLPH 3QZQA 1BJUA 5A0CA 5C17A 1GG6C 3EGKH 7LPRA 5KGOA 1OYTH 1ETSH 2PHBA 2J97A 2ZU2A 4B2AA 1PFXC 4JMYA 1BITA 2V6NA 1BMLA 4OS4A 2IN2A 4XRNA 1YLCA 2KCYA 1ELDE 2FOMB 2ODYB 4TY6A 3CP7A 4X2YA 1UTQA 3VFEA 2FMJA 4H4FA 6LPRA 1GJDB 1YGCH 5KEDA 4BAKB 5JBBS 5JB8S 4Y79A 1H9IE 3BTTE 3LGVA 1O3GA 4ZKOU 4HG6A 1IQGA 2ZWLH 1IQKA 1MABB 3SHAH 3E8LA 1VCPA 2KCOA 2FOCA 2C93B 2GZ7A 1EB1H 1UTPA 1A46H 2CK3D 3RXHA 2HOBA 2H5CA 1MTVA 2HVXA 2PTCE 1O2KA 3FOAA 5FPYA 3VB7A 1ORFA 2Z9GA 1TPOA 2RCEA 3OE7D 5CE1A 1GWAA 1C1RA 2Z7FE 2Y5GA 1BRBE 2ZU4A 2ZQ1A 1KLIH 2XCFA 1D6WA 1EB2A 1QBOA 1Y8TA 1V2TT 3SJ9A 2JH0D 2VWLA 3OY6U 3GDUA 3KGPA 2FDAA 4CRBA 3AAUA 1MAYA 1D9IA 1VGCB 3BV9B 1C1UH 1UVTH 2R2WU 1E1QD 4A1VA 1EXFA 4BXSA 1T8LA 1ELTA 4LXBH 3NXPA 2C8YB 1XUFA 3P92A 3KQEA 4B2CA 2P95A 3DHKH 1KLTA 2JDID 5EQRA 1EJMA 1W0YH 3TJOA 1TFXA 1AFEH 2NWNA 1SLUB 2J4IA 4X1QU 1C9TA 3QGJA 1Q3XA 2W7SA 2XBYA 1L0ZA 4Y10E 4KTSA 1TGBA 5AFYH 4MVNA 5DP9A 3UPEA 4Q4LA 5EJLA 4X1PU 4CREA 3UFAA 1SGPE 2ZDVH 3GOVB 4WJG2 2WPHS 1D3DB 1GBBA 2FM2A 2FEQH 4FU7A 4X8UH 1FY4A 4ZROA 1IHTH 1ELAA 4YESB 5EXMA 5LPRA 2VIOA 4TPYA 1KSNA 1VCQA 5EPYA 5LGOA 4HZHA 1C2EA 1H9LB 2TPIZ 4K60A 4Y8YA 1GBKA 3LOXA 1ELFA 1TOCB 1B5GH 1KXBA 1O31A 3NPSA 4XBCA 3RC5A 3VPKA 4XBDA 1G37A 3T62A 1U6QA 1C2JA 5GWZA 2V3HH 1COWD 3EA8A 3SUEA 4F55A 4RN6A 1UK4A 4LZ1H 4U32A 4HGCA 3OAAD 2IPQX 3OSYA 1GJ8B 3PWBA 4J1YA 4CHAC 3EA7A 1WUNH 1D3QB 4X1RU 2AS9A 3AW1A 2XTTB 4Y76A 5EPNA 2Y81A 1G36A 2ZDLA 4BOHA 1GMHF 4I31A 3MU1A 1O3KA 2GV7A 1O2YA 1MZDA 3TK9A 1GI4A 1H4WA 2ZNKH 1DWBH 3A8DA 1UTMA 1XUGA 2EY4C 1P2NA 2VB0A 1C5RA 3F2HA 4IMQA 5L30H 1P3CA 1RS0A 4ZUHA 4INLA 1FN8A 3TITA 1BBRE 1SG8B 1W10U 3FO8D 1RRKA 3A85A 1YPEH 2JKHA 1HGTH 2ODQA 3KQ5A 1RTFB 1QCPA 4B2BA 1E1RD 1BDAA 3VB6A 3LONA 2Z94A 4MDSA 4B1TA 1A5IA 3MU5A 2XXLA 3P8OA 1GJ6A 1IQHA 1QA0A 5CHBA 1TNGA 1LHGH 1EJNA 3GCTG 2ZDAH 4A6LA 4ABFA 1NRQH 5J4QA 1S82A 1Y5UT 3ZVFA 1V2JT 1AZZA 1DLKB 4AG1A 8GCHF 2Y82A 2LNCA 8ESTE 3UB0A 4RT1A 1GI0A 3BEIB 1MU8B 2WHXA 2ZHQH 3UWIA 1WXRA 3ATMA 1YPLH 2ANKH 4D7FA 1SGTA 3S0NA 5ABWA 2NU1E 3PMHB 2GCTC 1Q2WA 2D1JA 1EPTA 2AIPA 1ETTH 2FOAA 5BPEA 3MFJA 1GBJA 4GUXA 5FHTA 2Y80A 1CGJE 1UO6A 3RU4D 2F43B 1DXPA 3WWBA 2Q1JA 4FUGA 3BTFE 3GDVA 2R3UA 1ARBA 1AVGH 1GCTC 2AGGX 1GI7B 3V0XA 5HKKD 1FAKH 1QGFA 1ZLRA 3SGBE 1C1QA 5C20A 3A7YA 1KXFA 3SV9A 3SU6A 2TGTA 2GT8A 3RXVA 1MD8A 1P2KA 1GGDC 5DG6A 2P94A 1A5HA 4B6EA 2ZGHA 1O39A 4UDWH 4X1NU 1TA2A 2R2MB 2NU3E 1EATA 1S81A 1BTYA 4ESTE 2SNWA 2BDBA 3MOCA 3E0PB 1GI6A 1W0KD 1MH0A 1CE5A 2BY9X 1GJ9B 2BDIA 1MTSA 2B0FA 1EKBB 3T27A 1Z8GA 4OS1A 3SU4A 2G51A 2F4LA 2L74A 6CHAC 1C5LH 4GVUA 2HRVA 3BG4C 1AB9B 1O3DA 2SGEE 3GYMA 2J9NA 1KTSB 3QDZB 1VJAU 1OXGA 4FETA 1T4VH 1GBTA 1P0SH 1UCYH 1P05A 2YNBA 3GICB 1C4V2 2OK5A 3HGPA 2Y6TA 1BTHH 3ZV9A 2XWAA 4YXWD 4FUJA 2JIZD 3SU1A 2BZ6H 4NZLA 2XBVA 1O5BB 1BB0B 4H6SB 1ABJH 2BD8A 4ABJA 1OWEA 5EOKA 1P2MA 1NBME 4DIHH 1DXWA 1CT2E 2GTBA 1AQ7A 1OWIA 1S84A 4CRFA 3PV5A 5C94A 1S85A 1EOLA 3TGIE 1CQQA 1BCUH 2GCHF 1D6RA 1W7XH 4LK4A 3CENA 5L2YH 4FVBA 1DPOA 2KR7A 1LHDH 1GJ7B 3MH6A 2F9PA 2DE9A 4CHAB 1AVXA 1MTNC 5JBTA 1HJAC 1AZ8A 1P2JA 3P70B 1N8OB 1QJ1B 1HYLA 2G55A 2F3CE 2RDEA 1AKSA 4AFQA 3UOUA 1E36B 4FUEA 2PLXA 1SGRE 2EC9H 1KDQB 4FOUC 4BAOB 2OCVB 2FOHA 4Q63A 1DWEH 1PQAA 2XC4A 5B6OA 1O5FH 1RD3B 4O03A 2OTVA 1FIWA 4OM9A 1SB1H 1ESTA 4KTCA 4AFUA 1Z8RA 1TGSZ 1BZXE 1EUFA 1Z6EA 2V3OH 3ZVBA 3V12A 3RXGA 2LELA 1O2TA 1O5EH 4I32A 3T28A 1QB1A 4FUIA 3M5LA 1SSXA 2J94A 1JMOH 1AE8H 3MO6A 4NA9H 2NU2E 2WZQA 5FPSA 3ENSB 4U2WA 5HGGA 5T6GA 2B7DH 2WSSD 5F53A 1KXAA 1RIWB 1XUIA 1UW7A 1GI2A 2G5VA 1AWFH 2TGDA 1GL1A 2J2UA 3SV7A 1VJ9U 3STIA 2ZFFH 1GHAG 1ZPCA 1P02A 4ASHA 1G3BA 1S5SA 4XSKU 1GI8B 1AFQB 1A3BH 1CT4E 3VXEH 1K21H 1QA7A 1GHBG 1EZSC 1GHXH 2P3TB 4KGAA 1XKBC 4Y7AA 1OHHD 3GY8A 1TBRH 2GZ9A 3RC4A 4RKOB 3RUOA 3TNSA 1C2KA 1O5CB 3H09A 2BQ7B 1QB9A 1EASA 1PYTD 3RXAA 3U98H 1T31A 2UWPA 1DSTA 3E16B 4CRCA 4TWWA 3W95A 1ELCA 4I33A 1C1NA 1F0UA 3QUMP 4DURA 1TIOA 3PMBB 2ALVA 4NIXA 4Q7ZA 3ESTA 4Z1MD 3BIVH 1WBGB 4INKA 3TJNA 3BTDE 2A32A 3K6YA 1HAXB 2FOFA 5C1XA 5DP6A 4YO9A 1WQVH 1C1VH 1BTUA 2YMSB 1NROH 2XNIA 5C5NA 2QC2A 2R0LA 3VG8A 3SV2H 2QF4A 1D3PB 3PROA 4ZAEA 1O5AB 3ZYEA 1DUEA 1FIZA 4B6FA 1SGDE 1GJCB 3FP8E 4AGJA 1DFPA 3F9EA 1ZR0A 3DSOA 4TT3D 3VEQB 3RXOA 2CMYA 1NN6A 4O97A 1O2LA 1SOTA 3AW0A 5AHGH 1H8ED 3GCHC 4AG2A 4KTUA 3BTGE 3LJOA 1YLDA 6CHAB 5DGJA 2BZAA 1YCPM 1GDQA 1Y59T 1MMJN 1P03A 2BB4A 1HAOH 5C3NA 1V2ST 1OOKB 3I78A 4O3UA 3RXTA 1ZRKA 1O2VA 1OPHB 2PW8H 1ZRBA 2VVUA 4X6PA 1T8NA 3SO3A 1A3EH 4Y0YE 3SJOA 3RXPA 3RMMH 1Q31A 3PTBA 1S83A 1O2OA 3ATLA 3A8AA 5E0GA 4CRDA 3ZVCA 2OXSA 4JYTA 4KKDA 1NRSH 1O2HA 2STAE 4Z0KA 2C8ZB 4E7RG 1KXEA 1SGFG 2DUCA 2P93A 5DSFA 1PJPA 2YOLA 3MNBA 3OTPA 2RFKC 5F6MA 2XNDD 5FXLA 1HAPH 2QXHA 1E79D 4NA8A 1T4UH 3RXCA 1SC8U 1TAWA 1YPMH 1T8MA 1EZXC 1IQLA 2BOKA 1MTNB 3MMGA 2PV9B 4JYUH 1SQTA 5JPMH 2Z6BD 4THNH 3FKSD 3MO9A 4AFSA 2HPQH 5DJ7A 3SQEE 2F91A 1C1WH 1MKXH 1NFUA 5GCHG 1AHTH 1QQUA 1QQ4A 1YBWA 5EG4A 1SQAA 3NCLA 1HV7A 1DOJA 1A7SA 2O8UA 4F49A 4OGXA 1AUJA 4ABIA 2OBOA 1UVOA 5DP8A 2Z3DA 2CF9H 2STBE 1ELVA 2ZHEH 1HAVB 1MUEB 1V3XA 3Q77A 2FXRA 1K22H 2WPDD 2A0QB 4ZXXH 1GMHG 2IPHA 5DP4A 3ITIA 1P12E 1S6FA 3PWCA 4CRAA 1BJVA 3HKIB 2GD4B 1ZYOA 1TPSA 2HALA 1XX9A 1VZQH 2KFWA 3LH1A 2AGIX 1W13U 2VIVA 1NY22 1ACBE 3K65B 4JK5A 3O8RA 4X6NA 3T29A 1H8HD 3RXFA 3RXUA 1PQ8A 2ZCLP 2AEIH 3GS9A 5CDFE 4DT7B 1AN1E 3L6PA 3GY6A 4YOGA 3SU3A 4Y8XA 3U8OH 2ZHDA 3ATKA 2C4FH 5JBCS 3KHVA 5BRRE 1LTOA 2JH5D 3D23A 1SLVB 4NSYA 4O3TA 4D76A 3RXSA 1G3EA 2EEKA 5IK2D 3PV4A 1HLTH 4OS5A 2ZU5A 1C5XB 3TLOA 2BX4A 5EQQA 1O3HA 3OY5U 3RXDA 4UD9H 2P8OC 1OP0A 3ZZ6A 1MBMA 3ZIAD 3QWCH 1QHRB 5EQSA 3N7EA 5EGMA 3DSPA 4U30A 1JBUH 2H2ZA 2VH0A 3NRLA 2FESH 4A1XA 1F2SE 1A2CH 4NZQA 2O9QA 2FOGA 4I7YH 1TX7A 2O8LA 1HB0B 1OYQA 3T5FH 4XE4A 5A09A 4DVAU 3UAIC 1T8OA 2VU8E 3U1IB 2VVVA 4ZKRU 3LPRA 1LPGB 3HK3B 1ABIH 3M7QA 2ZFPH 2PUQH 4LOYH 1Y3XA 3GDSA 1X7AC 2QF0A 3BTWE 2I6SA 2RA0A 4E06H 4MNYA 1H9HE 3ATWA 1GJ5H 1S0QA 3E1XB 5C2ZA 1LVMA 1VCWA 4Y71A 1F7ZA 2BD9A 2YMSD 1MKXK 1JOUB 1TNIA 7ESTE 4IW4E 1W7GH 2CHAC 1GDNA 5HIZA 5GXPA 2GGVB 4BAMB 4GSOA 5EXLA 1HJ9A 2Z9JA 3SUFA 1OSSA 3V7TA 1TRMA 1GI1A 2FI3E 3GYLB 5F8TA 1MZAA 1O2PA 4E05H 1C1OA 1Y3YA 1HAVA 1SBWA 1VITF 1ZGVA 3ZZ7A 1Z6JH 3LC3A 2L6OA 2BDGA 4ISHH 1W2KH 1TMTH 1KXCA 1O0DH 2GT7A 1L2EA 4OS6A 1C5PA 2AH4X 1A0JA 2QYIA 4FUDA 4WF8A 4U01A 2Z3CA 1J14A 4NIWA 3SV6A 2PFEA 1QBVH 2GV6A 2G00A 3A87A 2H9EH 1PPBH 2IOTA 3EA9A 2Q6GA 1UMAH 5T3HA 1SLWB 3ZZ9A 1KYNA 4RT0A 1P9UA 4Y0ZE 1SLXB 1OKXA 1EOJA 1THRH 2FO9A 4DCDA 1UHBA 2WYJA 4D9RA 2ZCHP 3WW7A 1FX0B 1O3MA 2FIRH 3MNSA 4VGCB 1TX8A 1UJ1A 3NWUA 1V2WT 3SUGA 4ISLA 3IWMA 3KYGA 1O32A 3TNTA 3O8CA 3DFLA 3PO1C 3SZEA 3PLPA 2FOEA 3GISB 1EPTB 3BTEE 3KEEA 3ZVDA 2V3MA 4K2YA 4MQAA 2QAAA 1FY5A 2ZTZA 2GCHG 4D7GA 3AAVA 1XUHA 1FXYA 3MYWA 1TPPA 3TH2H 4YOJA 1PPZA 3RXRA 2I6QA 3RXMA 3E3TA 2W5EA 4GPGA 3RXBA 1XVOA 4X8TH 1ANDA 3S7KB 3RU4E 1O3CA 1IQMA 2QCYA 2FI5E 1OS8A 1Z1IA 1ESAA 1TB6H 2ILNA 2OC8A 3LU9B 4FXGH 1AGJA 1GJAB 2ZCKP 2ZF0H 5C1UA 1GBIA 9ESTA 1YPJH 1EJAA 4WMFA 1OP2A 2UUYA 1YWUA 3BTME 4MNWA 1D4PB 3A7VA 1J15A 1KTTB 4K69A 2XW9A 4IC5A 1QRWA 1T32A 4A92A 2FI4E 1C5ZB 1HIAA 2Y7XA 1GI3A 4MG3A 4FUFA 1JWTA 2FYQA 1C4Y2 1DY9A 4ZHMU 1LO6A 4B76A 5HIYA 5JYIA 3STJA 5LPFA 3PRBA 5JBAS 2BX3A 4TSFD 1RXPA 2W3IA 1GG6B 4PROA 2OUAA 5JB9S 1AI8H 5EJ1A 1HAGE 1FV9A 3HATH 3RLWH 4K5ZA 2D8WA 1LVOA 3DSGA 1A61H 3FP7E 1V2MT 4NGAH 4MPVA 4FUCA 1W3CA 4DW2U 2F9UA 1A5GH 5LH8A 5CMXH 2OINA 3JZ1B 1N6XA 2ZFQH 2UWOA 1AE5A 2UWLA 3SNBA 2FS8A 1GBLA 4AN7A 1VITH 2QV1A 2GMTC 1AKSB 3SNEA 2A4RA 1XXFA 2P16A 3GY5A 4Q7YA 5E2OA 1O2JA 3BEUA 1NU7B 3LGTA 3SJ8A 1P09A 1P57B 2BVXH 3UIRA 2ZGXH 1O2MA 1K9OE 1O2ZA 3H7TA 1DUAA 2VIPA 3RDZA 1ELBA 3EE0B 3SBKA 5C0UA 1NFXA 3S69A 1E38B 1C5VA 1PPHE 3P95A 2PR3A 5A8ZA 1G3DA 2H9HA 2BLQA 1E34B 4TY7A 1YM0A 2BQWB 4YTAA 1Y5AT 2G4TA 2B8OH 2OC1A 5T6DA 1O3LA 1OWHA 2BLWA 3OFND 4MNVA 4UFEH 4ACAA 5A8YA 3RXQA 1C5SA 5DN6D 1NRPH 2SFAA 2QE7D 2A1DB 1O36A 1Y3UA 1TALA 3P8FA 1GBDA 5B6LA 4H42U 1ZSKA 2CF8H 1B0EA 3U8RH 2GX4A 1MTUA 1P9SA 1S6HA 3NZIA 2IJOB 4A5TS 3ELAH 4NA7A 1FY1A 1AD8H 1XM1A 1TPAE 3PO1B 2BY5X 4P00A 4LZ4B 3PV2A 4D9QA 1C2IA 3VGCC 2HWLB 4K1SA 1JRTA 1DX5M 1HAHH 1O2XA 4IBLH 4JZEH 2G81E 2W26A 1GBCA 5EIYA 1AWHB 3KL6A 1QY6A 2QIQA 5JDUB 1GHWH 1C5OH 3SI4H 5A8XA 5EU8A 1Z8JB 2WPLS 1TGNA 3BIUH 1DVAH 3DFJA 4GCHF 4XOJA 2A5IA 1V6DA 1KY9A 3PM3A 1GCDA 1BT7A 2FZZA 1D3TB 3M5OA 5K0HA 4YT6H 1LVBA 4TWYA 5IYTA 3SORA 4M7GA 2XBXA 5HYOA 1AO5A 3GY7A 6ESTA 1O2WA 2A4QA 2EI8A 4JZIA 4XBBA 2G5NA 1TGTA 1ZOMA 3ZZ5A 2ANYA 3F1SB 3SQHE 1GJBB 1P04A 1TQ7B 2VNTA 3SOSA 3KQCA 1V2KT 1BIOA 5ESTE 2JJ1D 4ABBA 4RSPA 5E0JA 3EQ0H 5E8EH 3UNQA 1DDJA 3IG6B 3A7XA 3ZZAA 2UUJB 4NWLA 4MPWA 4Y6DA 1FJSA 1GI5A 4NCYA 2ZFRH 2C3SA 3TJUA 1LHEH 1MKWK 3TH3H 1GBAA 3KNXA 3T2NA 1V2QT 3F68H 1TX6A 2KX4A 5C67A 1C1PA 1ZJKA 1GBMA 1YKTA 4H6TA 2BLVA 2BD2A 3N7OA 1FY8E 1YF4A 3LDXH 5FPTA 2EQNA 1BRCE 1F0SA 1O2QA 1QRXA 3TK6A 3VB5A 3MNCA 4R8TB 2QF5A 1SGYE 3TPIZ 2PUXB 1MD7A 1WV7H 2R9PA 1FPCH 3S9AA 1NM6A 4TPIZ 3ZVEA 3ZZ4A 1PQ7A 2BDCA 1HNEE 2OLGA 3RM0H 2ZGCA 1BTPA 1HXFH 3P6ZB 3L3TA 1RJXB 1DS2E 2HNTE 1V2RT 1FUJA 2Z9IA 1W8BH 2GCTB 1QNJA 2BD7A 3VXFH 1CU1A 4AOQA 1NO9H 2THFB 1THSH 1FZZA 2ZPQA 3H5CB 1ZZZA 4GAWA 1SFIA 1BBRH 1DWCH 1NU9A 3CS7A 1FNIA 5FCRA 3RXKA 2ZPSA 1WTGH 2BY8X 3TU7H 3HKJB 1CA0C 3GCTF 2VWNA 1GCTB 1YP9A 4ABGA 2FWWA 3TGJE 3A83A 4DY7B 1L4ZA
chains in the Genus database with same CATH topology
3M7UA 1OWDA 1EX3A 1F5RA 3OYPA 3ZZDA 1IQEA 4INHA 1LPZB 5HXFA 3U1JB 1GGDB 1AY6H 4K1TA 3PMAB 4NWKA 1O37A 1EQ9A 1F0TA 1IHSH 1DANH 3P8NA 3SV8A 2J34A 1PPGE 1C4U2 1QFKH 2WV5A 2QGRA 1BTWA 1GHZA 1DT2A 5CHAC 1FAXA 2BHGA 3M5NA 1VITG 1J17T 2BTCE 2HLCA 4ABHA 1Z71A 3TK5A 1V2VT 5FX5A 4IGDA 1A4WH 1DICA 2WPIS 3A8CA 2UUKB 3BG4B 4IN2A 1QJ7B 1Y5BT 2ZHWH 2V35A 5E0HA 3AVZA 2AFQB 3D49H 4Y8ZA 3TH4H 5E2PA 5AF9H 3A7WA 3S9BA 3LIWA 5TCCA 3VGCB 4IN1A 2BY7X 1C2LA 1O3OA 1K1OA 1NFWA 1QTFA 3FANA 5F03A 4X1SU 1MCVA 2ZKSA 3BG8A 4NG9H 4WY3A 4J2YB 1OP8A 1YC0A 4QT8C 2VVCA 2F9NA 1Y3WA 3NUMA 2OP9A 1BTZA 3QGNB 3BSQA 3MTYA 3LH3A 3S9CA 1ELGA 3LGYA 1CBWC 2ZQ2A 1MCTA 1NESE 2BLOA 1PPEE 1TABE 2A5AA 1AIXH 3FZDA 1BRUP 1QRZA 3SJIA 3SU0A 1P11E 3LGWA 3UREA 4OGYA 1P01A 1TRNA 5L2ZH 4Y7BA 5A2MH 1HAIH 5G4BA 1HJAB 1AUTC 1BBRK 3A88A 2BD4A 2SGFE 2GZ8A 1G9IE 1ZHPA 2H9TH 1C5NH 1WTHD 1XKAC 1UK3A 5K7RA 2P3UB 1W0ZU 2UUFB 4B73A 1K2I1 1P2QA 1RTLA 5FX6A 4CR5A 1TGCA 4GHQA 1QL9A 3LC5A 1HFDA 4AX9H 2Q6DA 2WPKS 1C2HA 3DT0H 4CRGA 1ZHRA 2ZI2H 1IOEA 2VINA 1C5UA 2A7JA 2KAIA 3A84A 1L1JA 2R3YA 3S7HB 4UFDH 4E7NA 2BXTH 3VB3A 3FVFB 2ZU1A 1BMMH 1DY8A 2QXGA 1NRRH 1RFNA 2ZFSA 2CJIA 1C2GA 1V2PT 1DWDH 3O8BA 2ZO3H 1SPJA 3U8TH 1P2IA 2XWBI 3B8JA 2G4UA 1SQOA 1UHBB 2A2XH 4UONA 1UTJA 4GLYA 1TLDA 8LPRA 1BHXB 7GCHF 1HCGA 2G52A 4WXIA 4TYDA 2QF3A 4WH8A 4UFGH 3FFGA 4CBNA 4AYYB 1CO7E 8GCHG 3RP2A 1OWJA 4R0IA 1ESBA 1P2OA 3SUDA 1EP6A 3LT3A 1QR3E 5FBIA 3TGKE 1HDTH 1SFQB 4ZXYH 4IC6A 1O3FA 3E90B 1FQ3A 2PSXA 4JK6A 2AMQA 1MQ5A 2DE8A 2EA3A 1FDPA 3K9XB 1C5MD 1YPHE 1KLJH 1GJ4H 1JRSA 2Z3EA 3T26A 2Y7ZA 1MTWA 1QB6A 1JIMA 3RU4T 1FLEE 2O8WA 1GDUA 3GY3A 4I8JA 1O2SA 4X6OA 1H8DH 4DOQA 1J9CH 3UQOA 2PWXA 1FI8A 2C90B 3UR9A 1JIRA 3K6ZA 1HPGA 1O3PB 1G2LA 1XVMA 4X2XA 4BANB 4X8SH 3RXIA 4MTBA 1F92A 5CHAB 1UVSH 2A31A 3O8DA 1SR5C 1PYTC 3GCHB 1C5WB 3F9FA 1O2UA 1GMDF 3UUZA 1Y3VA 3M36A 1NS3A 3F6UH 3A86A 2PKSC 2ZTXA 2XYAA 1QBNA 1ANEA 3LGIA 2EI7A 1GL0E 1G30B 1TNLA 1UTKA 2OQ5A 1HIAB 2A45B 4I8KA 1O34A 7KMEH 1XXDA 3M3TA 3B23B 5EODA 1UCYE 1XUJA 2QXJA 4HFPB 1H8IH 1SGFA 4WMDA 1K1MA 5DO4H 4CR9A 2H1UA 2PTNA 2FODA 2OQUA 5SGAE 1LCYA 2A7CA 5DP7A 5AVDA 1ZTJA 3A81A 5A0BA 3A80A 1GHYH 1CBWB 1CHOF 1E0FD 1XMNB 2JETC 5I46H 4BTIB 1GMCF 1O3BA 4WWYA 1K1NA 1IQNA 4CBOA 3UOPA 3EYDA 1NTPA 4Q80A 1M9UA 3Q3KA 1WU1A 1C2DA 3Q3XA 1AMHA 3ZZ3A 2PSYA 2XC0A 2AMPA 1MQ6A 2TIOA 4FU9A 1LHFH 1LMWB 1O3AA 1WYKA 5GPIB 1UVPA 4YOIA 3RM2H 1ZGIA 4GCHG 3RMOH 1BQYA 1PQ5A 1UTNA 3SU2A 1ZMJA 4AB8A 1C5TA 1AB9C 4FVDA 2HNTC 2TBSA 1TNHA 3PMJA 1TOMH 1Z8IB 2BDHA 2H5DA 3NK8A 3Q00A 2ASUB 3MH4A 5TJXA 4B75A 1W14U 2WUBA 2QA9E 3PB1E 1HRTH 3GCOA 3SNDA 5EXNA 2BY6X 4CH8B 2FP7B 1SGEE 1F0RA 3BTHE 1SGIB 5ESBA 1TMUH 5PTPA 5ETXA 2XRCA 3A82A 1W11U 4NIVA 1BHXF 1IAUA 1QIXB 2BM2A 2C8WB 3MU4A 1E37B 3MO3A 1ZPZA 2FTLE 1LQEA 1BOQA 3OX7U 5GCHF 1DSUA 2VIDA 1QL7A 2ANMH 1O5DH 3QN7A 6GCHF 1YPGH 4SGBE 1K28D 1CGIE 5DKMA 1TWXB 1CA8B 3ZYDA 4ISOA 4FU8A 3GY2A 1N8OC 2BXUH 3W94A 2AERH 2BVRH 1ZTKA 2ZG0H 3C27B 4F4OC 1OWKA 2BD5A 3UTUH 4WXVA 2GDEH 3A7TA 1TA6A 2P8OB 4X6MA 4B71A 3RLYH 1L1NA 3ZVGA 1C1TA 1K1LA 3FP6E 4K8YA 3MHWU 2JH6D 1GBEA 3F9GA 3PTNA 5EW1H 1SVPA 4WH6A 1TONA 2OD3B 2F9VA 1EP5A 1ANCA 2ZA5A 3QZRA 3LKWA 3MWIU 2G8TA 2BDYA 1C5QA 1EAUA 2Q6FA 5F8XA 3KN2A 4UE7H 8KME2 1DITH 1NT1A 3Q76A 3HGNA 1RIWC 1AVWA 1L4DA 3Q3YA 4OS7A 2AMDA 2ZDNA 1A1RA 1AU8A 4JZ1A 5A0AE 2A4GA 3ATIA 4AORA 1F5LA 3UNSA 2CHAB 4YLQH 3SZNA 1GI9B 2RA3A 4AYVB 3CS0A 1AFQC 5HM9A 4ZHAA 3V3MA 3RXJA 2VWMA 3PLBA 2W3KA 4WMEA 3FZZA 5I25A 2M5TA 1IQFA 2PKSB 1ZSJA 2ZZUH 1ZMNA 1O3EA 1SL3A 4YZUA 5C5OA 1YPKH 3ZV8A 9LPRA 3QO6A 1MKWH 2WINI 3VB4A 2A2QH 1O2NA 3QX5H 1TMBH 3QK1A 2SGQE 1HAYB 1WCZA 3I29A 2J95A 1IQIA 1LKBA 2GDDA 1RGQA 3PLKA 3TVJB 2W7UA 2VJ1A 4YLUA 2SGAA 1OX1A 3RXLA 4I8LA 2FOBA 3KQDA 3ODDA 1DE7H 4Q7XA 1CSOE 1INCA 2FX6A 5FAHA 1LPKB 1BRAA 1CHGA 2JETB 2QXIA 2VIQA 4OS2A 1G2MA 1LHCH 3P8GA 2H6MA 1ETRH 3MU0A 2CXVA 2ZHFH 1N1LA 4IS5A 2J92A 1J16A 2QY0B 2XCNA 3ZZ8A 3B9FH 1B0FA 1BMNH 4ABAA 4YT7H 1BUIA 1QJ6B 2J38A 1F5KU 3DUXH 4ABDA 4A7IB 1KIGH 3MU8A 3URCA 3ZZCA 1C5YB 3SGQE 1UVUH 3M3SA 1ZMLA 1T7CA 4X0WU 4I8GA 1TBQH 2WV4A 1TQ0B 3UNRA 3E91A 5F8ZA 3BF6H 4DG4A 3M5MA 3PYHA 4JZDH 4MPUA 3KF2A 4JCNA 1KXDA 4NFEA 1HBTH 4YM9A 2F9BH 1YPHC 1P10A 5DP3A 2AYWA 3M37A 4UEHH 3UY9A 1N6YA 1GPZA 5GIBA 2EI6A 4BAHB 2OC0A 2GVFA 2WPJS 2OC7A 1FMGA 3E6PH 3M35A 2QN5T 4AFZA 4K8BA 4A1TA 1HAZB 3URDA 2D2DA 4BAQB 2BQ6B 1K1PA 3UWJH 2FYRA 1BA8B 1PPFE 3A7ZA 3P17H 3OU0A 1C1MA 1V2UT 2PKAB 1HJ8A 4Q2KA 1G32B 2Z9LA 1YCPH 1SGNE 1W12U 1XUKA 2CGAA 3NKKA 4ABEA 3MI4A 1ELEE 4HI3A 2A5KA 2CV3A 1VR1H 3U9AH 1FPHH 3T25A 1O35A 1GVLA 3R0FA 3QTVH 2BD3A 1C2MA 3EDXB 2VGCC 1SOZA 2BDAA 1P06A 2FLRH 5HM2A 1PPCE 7GCHG 2ESTE 2ZU3A 2ZDMA 4D8NA 1ID5H 2ULLA 4WVPE 4CH2B 1TNKA 2Y5FA 1O3JA 3F9HA 3SHCH 2CN0H 1V2NT 1HUTH 4FUHA 1EZUC 5DPAA 1FONA 2VWOA 4B74A 4MLFB 1SHYA 4ZKSU 2TGAA 3EAJA 4I8HA 4ISNA 3M7TA 2GMTB 1CT0E 3E0NB 1K1IA 3GY4A 5GJ4B 1G3CA 1UCYK 2ZGJA 3K2UA 2ZGBH 2VH6A 3H7OA 1MBQA 1O33A 3HPTB 1HXEH 2ZP0H 3I77A 1LVYA 2R0KA 4NSVA 4JZFH 1TRYA 3MNXA 2GKVE 1O2RA 1L1GA 1Z7KA 2B5TB 1THPB 3L33A 3SNAA 3OTJE 2VIWA 1GMDG 1DM4B 3KIDU 5H4IB 4Y11E 1RTKA 2ALPA 2KAIB 1TYNA 4NIYA 4XDEA 3R3GB 3V13A 1WOFA 2NU4E 4MNXA 2RG3A 1CGHA 3GCNA 1WQSA 1NFYA 3ODFA 1SMFE 2C8XB 4ZHLU 4ZKNU 3RC6A 1LDTT 1TNJA 2SNVA 4NFFA 2F9OA 1EAXA 2HNTF 3BN9A 4K1EA 4DGJA 3RMLH 1YYY1 1O3IA 2P59A 2PGQB 2PKAA 4MPXA 3SJKA 1WAYB 1YCPK 1GBHA 2ODPA 3SI3H 5T6FA 5FBEA 1KDQA 3U69H 3ZZBA 2AGEX 1O38A 1QL8A 1UTOA 1J8AA 2WYGA 4X2VA 1E35B 2XBWA 1CHOG 1V2OT 2LPRA 1MU6B 2FS9A 1GMCG 2SGPE 4ISIH 1JXPA 5DK1A 1FN6A 1H1BA 2OBQA 5J4SA 3MH7A 1O2IA 2SGDE 2F83A 2FTMA 4BNRA 2FLBH 1EZQA 4AZ2B 4FUBA 2Z9KA 1GHVH 1SHHB 1VGCC 4DJZB 1EAIA 1K1JA 4AGKA 3SNCA 3RXEA 1UK2A 2ZEBA 3DD2H 2O8TA 1EAWA 5GDSH 2HPPH 3A8BA 3JZ2B 4JYVH 2TGPZ 1MAXA 1DLEA 4RKJB 1TE0A 3QTOH 4HTCH 3SW2B 4KELA 2BYAX 4IMZA 2RDLA 2V0BA 2A4OA 4VGCC 1TBZH 1QURH 1O30A 3HK6B 2FX4A 1NZQH 5EW2H 4SGAE 2YNAA 1ANBA 2ANWA 1GVKB 4DIIH 1O2GH 1EPTC 3M61U 4XFQA 4ZMAH 2AIQA 2Y5HA 1LQDB 3FAOA 4BXWA 3TIUA 4KP0A 2XC5A 3SGAE 5FCKA 5L6NH 1O3NA 3BEFB 1ZHMA 2B9LA 4ZH8A 2ZECA 1P8VC 3LJJA 1UTLM 4AB9A 6GCHG 5IDKA 3SN8A 1GVZA 2GP9B 2VGCB 2K1QA 1C9PA 4O9VA 1SGQE 2BMGB 2ZDKA 3DA9B 5LPEA 3IITA 2WPMS 3BTKE 3UQVA 4Z6AH 5TCAA 1GBFA 2P3FH 4K3JA 1BTXA 1P3EA 1ZTLA 3UR6A 1SGCA 1FY3A 3G01A 3TJVA 3M3VA 1Z1JA 4BTTB 3LGUA 1NC6A 3D65E 2WUCA 5C1YA 3C1KA 1ZJDA 1S0RA 2A7HA 4X8VH 4BTUB 1C1SA 1C2FA 5DP5A 1LKAA 1A0LA 3KCGH 1BMAA 1ZSLA 1A0HB 1WSSH 1ARCA 2O8MA 1NRNH 2ZPRA 2HGTH 4GHTA 3RMNH 1V2LT 1CA0B 1CVWH 2ZIQH 2ZTYA 3D62A 4X2WA 3A89A 4UFFH 5HMAA 2ZFTA 3BTQE 1B7XB 1ZPBA 1SI5H 3KQBA 3MH5A 1NPMA 2BOHB 3SU5A 1IQJA 1GHAF 2ZC9H 3AASA 3ZVAA 2TRMA 5AFZH 3WY8A 2D26C 2FPZA 1O5GH 1GHBF 2BVSH 2NU0E 2PGBB 3QLPH 3QZQA 1BJUA 5A0CA 1GG6C 3EGKH 7LPRA 1OYTH 1ETSH 2PHBA 2ZU2A 4B2AA 1PFXC 4JMYA 1BITA 2V6NA 1BMLA 4OS4A 2IN2A 1YLCA 1ELDE 2FOMB 2ODYB 4TY6A 3CP7A 4X2YA 1UTQA 3VFEA 2FMJA 4H4FA 6LPRA 1GJDB 1YGCH 4BAKB 5JBBS 5JB8S 4Y79A 1H9IE 3BTTE 3LGVA 1O3GA 4ZKOU 1IQGA 2ZWLH 1IQKA 3SHAH 3E8LA 1VCPA 2FOCA 2C93B 2GZ7A 1EB1H 1UTPA 1A46H 3RXHA 2HOBA 2H5CA 1MTVA 2HVXA 2PTCE 1O2KA 5FPYA 3VB7A 1ORFA 2Z9GA 1TPOA 2RCEA 5CE1A 1GWAA 1C1RA 2Z7FE 2Y5GA 1BRBE 2ZU4A 2ZQ1A 1KLIH 2XCFA 1D6WA 1EB2A 1QBOA 1Y8TA 1V2TT 3SJ9A 2JH0D 2VWLA 3OY6U 3GDUA 3KGPA 2FDAA 4CRBA 3AAUA 1MAYA 1D9IA 1VGCB 3BV9B 1C1UH 1UVTH 2R2WU 4A1VA 1EXFA 4BXSA 1T8LA 1ELTA 4LXBH 3NXPA 2C8YB 1XUFA 3P92A 3KQEA 4B2CA 2P95A 3DHKH 1KLTA 5EQRA 1EJMA 1W0YH 3TJOA 1TFXA 1AFEH 2NWNA 1SLUB 2J4IA 4X1QU 1C9TA 3QGJA 1Q3XA 2W7SA 2XBYA 1L0ZA 4Y10E 4KTSA 1TGBA 5AFYH 4MVNA 5DP9A 3UPEA 4X1PU 4CREA 3UFAA 1SGPE 2ZDVH 3GOVB 4WJG2 2WPHS 1D3DB 1GBBA 2FM2A 2FEQH 4FU7A 4X8UH 1FY4A 4ZROA 1IHTH 1ELAA 4YESB 5EXMA 5LPRA 2VIOA 4TPYA 1KSNA 1VCQA 5EPYA 5LGOA 4HZHA 1C2EA 1H9LB 2TPIZ 4K60A 4Y8YA 1GBKA 3LOXA 1ELFA 1TOCB 1B5GH 1KXBA 1O31A 3NPSA 4XBCA 3RC5A 3VPKA 4XBDA 1G37A 3T62A 1U6QA <