5LPFA

Kallikrein-related peptidase 10
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
203
Chain Sequence
PCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDQGEQLRRTTRSVVHPKYTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTANKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-10
publication title Structural basis for the Zn2+ inhibition of the zymogen-like kallikrein-related peptidase 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 203
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2016-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpfA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpfA02
3A7ZA 2BLVA 5EGMA 1W0YH 1V2OT 4K1SA 2VIWA 2EI8A 2VVVA 1CBWC 4JK6A 3N7OA 3QUMP 3SV2H 1TX8A 1QQ4A 1TMTH 5A0BA 4LZ4B 1O5GH 2A5IA 4ABGA 2P94A 3RXDA 3P92A 3TH3H 1ZGVA 3F9FA 3SORA 1GGDC 1MKWH 1TLDA 1O5EH 1MD8A 4YTAA 1WV7H 1TABE 1YP9A 3KQBA 3VPKA 2PW8H 1KXFA 1THPB 3UNRA 1HV7A 3NXPA 4OS5A 1P57B 3A8CA 1GDNA 4ISIH 1NFYA 3CP7A 1SGQE 4O03A 4B74A 1MZAA 3ATLA 1SLVB 2RA3A 1GBFA 1VGCB 4GHTA 1QTFA 1Z6JH 1EP5A 2R0KA 2BTCE 3JZ2B 4CBNA 1C9PA 3MO6A 2PGQB 1LPGB 3KQCA 1MD7A 1TGBA 2W5EA 1P3EA 4ZHLU 1V2LT 2PKAB 2AH4X 1YM0A 4ESTE 3LC5A 4JZIA 2GT7A 1SGFA 2BY6X 4A1TA 3Q76A 1JIMA 1FAKH 1AMHA 2GZ9A 4WH6A 1HAVA 1NRSH 3MMGA 4ZKNU 2HPQH 1TYNA 2BVRH 5B6OA 3LONA 5FPSA 1FN8A 2AMDA 1BBRE 3ZV8A 2BX4A 3M5NA 1ESBA 4Y7BA 1V3XA 1CA0C 1AY6H 2BD4A 1Q3XA 2G00A 2P95A 1C5SA 4GAWA 2PTNA 3EYDA 1GMDF 1O2KA 2JH5D 1W2KH 3RMNH 3F9EA 3PV4A 2XTTB 5DJ7A 1CE5A 1SGEE 5LH8A 1SG8B 2C90B 4YZUA 4MPVA 1E36B 1O2GH 2LPRA 1ZPBA 2FESH 3E3TA 5EW1H 2P3TB 3GYLB 1QL9A 9LPRA 1AUJA 5EPYA 2IN2A 2AGGX 1IQHA 4ZKRU 1G3CA 3IWMA 2BY8X 1P01A 5E2PA 2A2XH 1LVOA 1V2MT 3TJNA 1DT2A 1FY8E 3RLWH 2PSYA 1HUTH 2CV3A 3ZZ7A 1GHAG 1ZSJA 2FI5E 2ESTE 2WYJA 3PLKA 1IAUA 1UTQA 6CHAB 2STAE 4LZ1H 1O0DH 4NZLA 1GJ6A 3R3GB 2FMJA 3DA9B 3PWCA 4K8BA 3GY6A 3SN8A 4AOQA 3A82A 3SJOA 1P9UA 2QGRA 1MUEB 3GY5A 2YNBA 2ZU5A 5J4SA 4MDSA 4K1TA 1O2OA 4BXSA 4IC6A 1SHHB 1V2WT 3FAOA 1ELFA 4I7YH 2ZU4A 3EGKH 2BDYA 3M7TA 4JZ1A 2OBOA 1CT2E 2SGPE 1FV9A 2P8OB 2THFB 1GHVH 4KTCA 1QRZA 4YO9A 4Y79A 4CRAA 1ZTKA 4OGXA 4LK4A 1A0JA 1O2VA 1GJ5H 3A7VA 2H2ZA 1GJDB 4OS4A 3M5MA 1DUEA 5GDSH 1KSNA 1PYTD 1F0UA 1BRAA 1HAOH 3AVZA 7KMEH 1UTJA 2SNVA 1K2I1 7GCHF 2VIPA 1N8OC 5FPTA 2RA0A 1GBHA 1ZJDA 1NFUA 2NU3E 1QA7A 2ZGHA 4NSYA 3GCTF 1EXFA 1GJ8B 1G3EA 3RXBA 2BDCA 1HJAC 1PJPA 3SI4H 2ZA5A 3UOUA 1XUGA 3GCNA 1O35A 1SGRE 2ZHQH 5C3NA 5EQQA 1O5BB 1GI7B 1GBAA 1OXGA 4WXIA 2HPPH 4Y10E 4Y8XA 1ANBA 5HXFA 2GCTB 1O5AB 1TNLA 3PTBA 2PKAA 2ZIQH 1UTLM 2W3KA 3PO1C 3PMAB 3AW0A 3RXRA 1NESE 3IG6B 1A5GH 1MCTA 3EE0B 1ZRBA 1W14U 1ZMJA 1CGIE 2FOCA 1UTMA 4YLUA 5T6GA 2ZQ2A 5GPIB 1OYQA 1SI5H 1MU6B 6CHAC 2ANWA 1QL7A 1MTVA 1QNJA 1AO5A 1AUTC 2Q6FA 1Y3UA 1EAXA 1O2XA 1YPMH 1EQ9A 1ZTLA 2BDHA 3M5LA 4ISHH 1C5PA 4MPUA 4X8TH 1ZYOA 3SU1A 2Y81A 3KEEA 3QZQA 4AYVB 1B7XB 3MO9A 4NG9H 2GT8A 3M3SA 2TBSA 4IW4E 3SNDA 3STIA 3QK1A 4TPIZ 4DG4A 1L1JA 2ZFSA 3MFJA 1IQGA 3H7OA 3M61U 1ETTH 1P2KA 4WMEA 4B75A 1HBTH 2F83A 6GCHG 4SGAE 1O3MA 3A8DA 3RXJA 5LPEA 1OKXA 3TU7H 1C5QA 1BTHH 1MTSA 1PPGE 3EA7A 3H7TA 2A32A 5K0HA 1MTUA 2Y5HA 4BAKB 1QRXA 2OTVA 3S7KB 1BITA 2C8XB 1OWHA 2ZFFH 3BTME 4FUHA 2BD3A 1KXBA 2FOBA 3MI4A 2HNTC 3RUOA 1SFQB 1EZSC 1FI8A 2CJIA 3TJVA 1ETRH 2PKSB 1XUFA 1GI6A 3ENSB 2Z9JA 3RP2A 1GBEA 1NRNH 1OP8A 1C5OH 3SU2A 1MAYA 1VCPA 3A80A 1ZHRA 1O38A 2UWPA 1IQIA 1BRBE 4BNRA 2BX3A 3UNSA 2BY9X 2GGVB 1KIGH 3BG4B 1CVWH 1A61H 1G2LA 1QB6A 2H5DA 2C93B 1C5VA 1FY3A 1IHTH 2AERH 1O3BA 1HXEH 1GBTA 1MMJN 4MPXA 1N6YA 2G8TA 4NA7A 2KAIB 1TB6H 1C5NH 1C5XB 4XSKU 2GX4A 4AB8A 3A7WA 1EPTC 1S81A 3SU3A 1SB1H 1SFIA 1BJVA 4YOGA 2R3YA 3UR9A 4O3UA 1B0EA 3C27B 1AWHB 2QXHA 3HGNA 3B23B 4MNXA 3CS0A 1FY5A 1RIWC 2ZPQA 2V3OH 4E05H 5HGGA 1EX3A 2HGTH 1O3IA 2J92A 1ANDA 1C1WH 1DS2E 2GMTB 3BTFE 2A4RA 1BTUA 2RG3A 3BG8A 1T32A 2LNCA 1G3DA 4X1RU 3D23A 1IQLA 1EZXC 3RXKA 3SW2B 3ODFA 3GISB 5EPNA 5A09A 1P9SA 1PQ5A 4WF8A 5AHGH 1HFDA 3SV8A 2CF9H 4NCYA 2FEQH 2QC2A 1JIRA 2AFQB 2VWMA 1HGTH 1YYY1 3RXMA 3A89A 2HOBA 3TNSA 1V2UT 1LMWB 5DP3A 3TK6A 2V35A 5A8YA 4RN6A 1QB1A 5EXLA 2PKSC 1S0QA 3OYPA 4LXBH 2GVFA 1F5RA 3M7UA 1AD8H 3BTWE 1SMFE 3U69H 1EPTA 5FX6A 1O2YA 1D3PB 1QJ6B 1K9OE 2CF8H 1DOJA 2B5TB 3S7HB 4J1YA 1C1TA 3E0PB 3VGCB 2F9OA 3E91A 5T3HA 1DLEA 4GSOA 1W8BH 1TNJA 1O3HA 2WPMS 2Y7ZA 3GCHC 4GCHG 2PUXB 1DM4B 2FLRH 5DP6A 3F6UH 5F03A 1WTGH 1ABIH 1FZZA 1FAXA 3GDVA 3P70B 4ZHMU 1DSUA 1GDQA 4RSPA 3SNEA 1LHEH 2WV5A 3O8BA 1C2HA 1C9TA 1TQ7B 7ESTE 2G5NA 1ELGA 2BD2A 4Z6AH 2W26A 1KTTB 1O2WA 1O3LA 3GCOA 3LJJA 1INCA 1NU7B 2BM2A 1C2MA 1EOLA 3ZVBA 1C2DA 2SFAA 2WV4A 1BMNH 1MU8B 2F9NA 1AWFH 2Y7XA 3I78A 1C1VH 2J2UA 1F0RA 2PV9B 5GWZA 3MO3A 4YT6H 1WOFA 4IMZA 2OUAA 1SL3A 3RXLA 2CXVA 3MH5A 2BOKA 1HLTH 2VWLA 1OPHB 4ASHA 1O5DH 1VJAU 1ESAA 3S69A 1K1OA 1EAIA 3T27A 1A1RA 3ZVDA 2ZPSA 2B8OH 1UK4A 2ZU3A 4ZXXH 2XNIA 2Z7FE 1VITF 2XC4A 1C1SA 1O2TA 2QIQA 1RXPA 5A0CA 3L6PA 4MQAA 1SLWB 3TNTA 5A8ZA 1Z8IB 4ZXYH 4ZKSU 1J17T 1P03A 4O9VA 3S0NA 2Z3DA 3P17H 3RLYH 4K3JA 3SUFA 4AB9A 2KAIA 3ESTA 4UE7H 4WMDA 3PLBA 3AAVA 4KELA 1LDTT 5F8ZA 2AMPA 3DFJA 3UQOA 3BTHE 1OWEA 4HZHA 1XXDA 2STBE 1ZJKA 2BLWA 1C2FA 1D9IA 1TMUH 1QR3E 3E16B 1LVYA 1O2IA 4FUDA 2PTCE 4X6OA 3RXVA 3RXQA 4O3TA 3T25A 3SNCA 1ZSLA 3TK5A 1TOCB 3KHVA 3PMBB 4AG1A 3FVFB 3R0FA 3GY2A 1BTXA 1HCGA 4ABAA 1HAPH 1DXPA 3TJUA 1GJAB 3FP8E 2GP9B 5C1UA 1P11E 1TPPA 1UVSH 1CHGA 2FWWA 1K21H 1LVMA 2BXUH 1ELTA 1LHFH 1YPKH 1UHBB 1MCVA 1BMAA 4YESB 1O2HA 3ODDA 3SNAA 1TNIA 1TRYA 3G01A 2J95A 3SV7A 3RXOA 4JCNA 1ZLRA 4CHAB 2ZHEH 4J2YB 1LQDB 2BD9A 1ELEE 2BDBA 1L4ZA 5EG4A 4IBLH 3V12A 3SHAH 2AIPA 1K1NA 1TBZH 1ORFA 3MNCA 4FUGA 3QLPH 1WCZA 2VWNA 4AORA 1CA0B 1EAUA 1LCYA 2ANKH 2F9PA 1GBJA 3NZIA 1SOTA 2AS9A 4RKOB 3VB4A 5JB9S 1YCPK 2UWLA 1CQQA 4OS7A 4Y8ZA 4AN7A 1GHXH 1JOUB 3I77A 3RMLH 2ILNA 1H8DH 3PB1E 3FP7E 2WPHS 2G4UA 1CHOG 1NZQH 2FOEA 4NIYA 4NWKA 5JBTA 1C2LA 3LT3A 2FTLE 1C5UA 4X2WA 3ZV9A 1V2JT 5DP8A 4AFUA 3LGWA 1P2JA 1K1JA 4KGAA 1P8VC 2GDDA 3LPRA 1NY22 3A84A 1QBOA 1ID5H 4UFDH 1V6DA 4BTUB 4B1TA 3M35A 3RXEA 4X6PA 1DWBH 2FXRA 2BY5X 1E0FD 4X1QU 3BTQE 1MBMA 3NUMA 3RXPA 3JZ1B 1G30B 3NPSA 1GCTC 1EB2A 2BZ6H 3ATKA 3V0XA 3RC6A 2ZQ1A 5A8XA 2G55A 4NWLA 4DIIH 1C1PA 3FANA 2P3FH 2FS9A 4NIWA 4X8VH 4A1XA 4B2CA 3NK8A 3DHKH 2JH0D 1YPJH 4JK5A 1SGDE 2A2QH 4JYUH 1GBIA 2HALA 4X6NA 1F92A 4D9RA 3DD2H 1GMHF 4NZQA 4K60A 1BRCE 1SGTA 4K8YA 1C2GA 2ZHDA 2A7CA 3RMOH 4CHAC 1T8NA 2Z9GA 4NA9H 4CBOA 1C5TA 3EQ0H 2IJOB 1WQVH 1E34B 1O2JA 1O5CB 2BQ7B 4X2YA 2VNTA 1CT4E 1ZR0A 5DP9A 1V2TT 4MTBA 2IOTA 3WY8A 4Q7ZA 1C1OA 1Z71A 1JWTA 3MU5A 1HAHH 2HRVA 3KQDA 1A0LA 1N8OB 1TX6A 2HLCA 1V2KT 1EZUC 3PMJA 3BTTE 3ZZBA 1K1PA 2P93A 3F1SB 4MNYA 2J9NA 3I29A 1HJAB 1O5FH 1TOMH 2NU4E 4MG3A 4TYDA 2ZTZA 1O2SA 1QA0A 3QTVH 1A5IA 1RTLA 4WJG2 2OQUA 3RXSA 1H4WA 1LO6A 1FPCH 1VR1H 3PO1B 2TPIZ 1ZMLA 3M7QA 5ESTE 3RM0H 1UO6A 1A46H 1A3EH 1UHBA 1GVZA 2OC0A 4IGDA 3PMHB 4M7GA 4ZUHA 1GHYH 5DP4A 3SQHE 1HAGE 1O3OA 1IQKA 1T4UH 1BT7A 1TE0A 5BPEA 4X1PU 1KXAA 1SR5C 3FZZA 2SGEE 1T8MA 2NWNA 4FVBA 4X1NU 1GL0E 2EI7A 5ETXA 2ZF0H 4DIHH 1GI1A 1P2IA 1TGNA 1PQ8A 1UTOA 4BTTB 5A2MH 1ARCA 1GL1A 3SU0A 2HVXA 3RXUA 1YF4A 3ATWA 4Q7YA 8GCHF 1SGPE 1IHSH 1OOKB 1AGJA 2P3UB 4E06H 4HFPB 1DWDH 3BSQA 2Z3EA 4FU7A 5DG6A 5G4BA 1DX5M 2VWOA 2VINA 4ISLA 1UMAH 2OCVB 2GV6A 1SHYA 3VXEH 1S85A 2GZ7A 1EASA 1S84A 3MNSA 4Y71A 3QGNB 5AF9H 1GPZA 4VGCC 1P04A 5DP5A 1DITH 2F3CE 1TBQH 3U8OH 2SGQE 1KXEA 4H6TA 2C3SA 3OSYA 1BZXE 2VH0A 4H6SB 4X6MA 2FOMB 3E1XB 1VZQH 3K9XB 3QX5H 2ANYA 4HTCH 1G32B 1RS0A 5EU8A 3MH7A 4AG2A 2BY7X 3LGVA 5F8TA 4BAQB 4SGBE 2PLXA 2BDAA 1P2QA 1GBMA 3STJA 5K7RA 1KDQA 2AMQA 8LPRA 1QY6A 1BJUA 1GBLA 1TMBH 1AQ7A 5F8XA 1GHZA 3BIVH 3PM3A 5FHTA 2H9EH 3UWJH 2Q1JA 3HPTB 2J4IA 4I8JA 4NFFA 1GI5A 4UEHH 1RGQA 1O2RA 5IYTA 1V2QT 2F91A 1KLIH 2R2MB 3ELAH 3K65B 1SLXB 5GCHG 3S9CA 2BVSH 1EPTB 4ABJA 3RXHA 4ABIA 3K2UA 1VJ9U 1GBKA 4K2YA 1Y3VA 4X8UH 5E8EH 3RU4D 4D7FA 5DK1A 1THRH 1UK3A 1RIWB 3UPEA 3NCLA 2JKHA 4D9QA 3ZZCA 3SNBA 4AFSA 1AVXA 1HAXB 4I8KA 1O3PB 3UIRA 3VXFH 2BQ6B 2FYRA 1P3CA 4KTUA 1QRWA 5JDUB 1GI3A 1NPMA 3SV6A 2SGFE 2Y6TA 3LGUA 3ZYEA 4KP0A 5DPAA 3ZZ6A 3ZZDA 4B73A 1GHBF 4B76A 1A7SA 4DCDA 3A86A 1TALA 4NFEA 1FPHH 1DFPA 1AVGH 2Z9IA 2XBYA 1AIXH 1BIOA 1O2ZA 5AFYH 3RXGA 4Y8YA 1AKSB 3LGYA 2NU1E 1ANEA 2QA9E 1S82A 1V2VT 2VJ1A 1IQNA 4AX9H 1G2MA 3QDZB 1BQYA 1EP6A 2C8YB 2TGPZ 4XDEA 3HGPA 1GI9B 2UUJB 1J14A 3Q3KA 3VEQB 3SJIA 5C20A 3O8RA 1HPGA 5CHAC 1PPZA 2DUCA 4NA8A 1FIWA 1C4U2 2O8UA 4JZEH 2Z94A 2IPHA 2ANMH 1TX7A 2QAAA 3ZZ3A 3W94A 1GJBB 1AZ8A 3Q3YA 4AFZA 4OGYA 1ANCA 4GLYA 1DE7H 1LQEA 1XUJA 5DGJA 1A0HB 2XCNA 2OC8A 1ELAA 3BTEE 1A2CH 1SQAA 2ZHWH 1C5YB 1GJ4H 1OP0A 4FUCA 1JBUH 3GY4A 1J16A 2Z9LA 1ZGIA 3GCHB 1C4V2 2GZ8A 3RC4A 2PR3A 1TA6A 3UQVA 1TPOA 3PYHA 4OS1A 2BVXH 2FIRH 4TWWA 5C2ZA 5FX5A 3FZDA 5AFZH 5PTPA 1PPCE 3GDSA 1D6WA 1E37B 1QB9A 3V13A 2ZGJA 1TWXB 2FS8A 5C1XA 4JZDH 2F9VA 5EQSA 2QF3A 2WPLS 3URCA 3UREA 2TGDA 1Z7KA 3RXAA 1KXDA 1BHXB 2OP9A 2PHBA 1N1LA 5E0GA 2XC5A 2M5TA 2XBXA 1C1RA 3D62A 2FX4A 1C2EA 3LOXA 1YLCA 2BDGA 2H5CA 2HWLB 1GI8B 1XMNB 5J4QA 1XX9A 5ABWA 2QYIA 4AFQA 3AASA 1F7ZA 5TCCA 3SJ8A 1AFQC 1YBWA 1CSOE 1KXCA 4ZMAH 1CO7E 1EOJA 2ZCHP 3LIWA 3VB5A 5JBAS 1O39A 1FY1A 2BZAA 3ZVGA 5TCAA 1DICA 5L2ZH 1K1IA 2XXLA 3SI3H 1GJCB 3NWUA 3EA8A 2ZWLH 2QN5T 1ZMNA 3Q77A 1GVLA 1MTWA 2WPJS 3FFGA 1ELVA 3RXTA 2SGDE 2FM2A 2A4OA 2EC9H 1D3TB 1EJAA 5HM2A 2A4QA 1UTKA 2UUYA 1RJXB 3BTGE 3UNQA 1O30A 3MU8A 1GI0A 1EUFA 2TGAA 1S0RA 1SVPA 1Q2WA 2ZDLA 4THNH 1OSSA 2R0LA 2G5VA 2BYAX 1XKBC 1RRKA 4R0IA 5DKMA 3LGIA 4WVPE 3EA9A 1UVOA 2ZFRH 1SSXA 1THSH 2VIOA 2ZHFH 2H1UA 1DANH 1FIZA 4CH8B 6GCHF 3S9BA 4UFFH 3SQEE 1BTPA 4IC5A 3TIUA 5FAHA 1O2QA 1BUIA 4MNWA 2ZFQH 1G36A 1HRTH 5HM9A 1SC8U 1AKSA 4K5ZA 1UVPA 1HYLA 3P8NA 3OU0A 5CE1A 2CHAC 4CR5A 1ZPCA 2TRMA 4U30A 1SGIB 2A4GA 1TRNA 3ZZAA 1GDUA 1BTYA 1GMCF 3Q00A 5C1YA 1C5MD 3TVJB 4INHA 1DLKB 1XUHA 3KL6A 3HK6B 2ZZUH 1O2LA 1O3NA 1W11U 1DUAA 1O3KA 1V2PT 1AZZA 1WSSH 2I6SA 3ZZ8A 5CMXH 1L1NA 6ESTA 2OINA 1B0FA 3ZVFA 4Y7AA 1EKBB 2PWXA 1O2MA 1HAIH 1SGFG 3T26A 2XYAA 3Q3XA 1C2KA 1TAWA 1O3FA 3SBKA 5JYIA 1W10U 4XOJA 4I33A 3DFLA 1ZPZA 1VITH 2BB4A 1GMHG 3A7TA 4AYYB 1M9UA 2ASUB 2ALVA 2VIDA 2FPZA 3U1JB 4ZAEA 4NIVA 4GVUA 4IS5A 1C1MA 1P2NA 1S5SA 1BCUH 4NIXA 3SO3A 1FQ3A 2ZECA 2XBVA 4MVNA 3E6PH 4D8NA 2Z9KA 2ZFPH 1RFNA 5T6DA 1CU1A 8ESTE 3CS7A 1NT1A 1LKAA 1BOQA 1GCTB 2ZDMA 1GMDG 2GCHF 5GXPA 1SQOA 3VB7A 1AU8A 1UVTH 1MKXK 1W7XH 4YLQH 3MU0A 1JRSA 1O3CA 4ISOA 2QCYA 2QV1A 3KF2A 3E0NB 1O31A 1CGHA 4GHQA 1XKAC 1AN1E 3RXCA 2XC0A 3U1IB 3FP6E 4NGAH 2WINI 4TWYA 1MKXH 3BEFB 1D3QB 3SGQE 3LGTA 1W13U 3MTYA 1UK2A 2VGCB 2C4FH 5C5NA 1LVBA 1P05A 2FDAA 3B9FH 3SHCH 4FUIA 5F6MA 4BOHA 2OC7A 1K28D 4YM9A 3K6ZA 5FCRA 4YOJA 5AVDA 3CENA 1V2ST 2PFEA 2ZFTA 5JBCS 1EJNA 1AE5A 1H1BA 4X8SH 3SZNA 2WPIS 1P10A 2A31A 4A92A 3F9GA 1F5KU 1K22H 2TGTA 2F9UA 1NROH 1NO9H 2VVUA 5LPFA 5LPRA 1PPBH 2O8MA 2XRCA 2Y5GA 1YCPH 3GY8A 1MAXA 1H9LB 2VIQA 3MHWU 4F4OC 1F2SE 4GCHF 8GCHG 1HDTH 1D4PB 3OX7U 3ZZ4A 3M37A 2EEKA 1NU9A 1MH0A 3SU6A 1HIAB 3HKIB 2UWOA 1O3AA 1AB9B 3T28A 4YOIA 2BLQA 2O8TA 4I8HA 2Y5FA 3HKJB 4WH8A 4XFQA 3GYMA 1SGNE 1ZHMA 4GUXA 6LPRA 1E38B 1YCPM 1BRUP 1XXFA 2BOHB 2XWBI 1Q31A 3PWBA 2PUQH 1IQEA 1NRPH 7GCHG 1KYNA 1QFKH 1O3EA 3P6ZB 5I25A 2ZPRA 2DE8A 1KDQB 2DE9A 3MNBA 3GCTG 1AI8H 3L3TA 3UY9A 1FUJA 4XE4A 2Y80A 1C5WB 1P2MA 2BDIA 2TIOA 3EAJA 4CH2B 1ELCA 1T4VH 1DY9A 1GWAA 3BEIB 3P95A 3L33A 1K1MA 2ZTXA 3TGJE 3BN9A 1C5RA 2GKVE 2ODYB 1TPAE 5HMAA 2VGCC 1P02A 1DY8A 4BAOB 4VGCB 2R2WU 1PPEE 3UTUH 2ZDNA 2OLGA 3T2NA 2GTBA 3RU4E 1Y5AT 3W95A 2XW9A 2YOLA 1Y3XA 2FOGA 2UUFB 1RTKA 1UTNA 3NKKA 1ESTA 3LU9B 4XBDA 4I32A 2ZC9H 5H4IB 5A0AE 1G9IE 2C8ZB 4HGCA 5EXMA 5BRRE 1UJ1A 9ESTA 1GVKB 4FU9A 3AW1A 3SUDA 4YT7H 3GDUA 2J34A 4O97A 4Y6DA 3AAUA 2D26C 4GPGA 1KLTA 1A5HA 1Y59T 3KNXA 1HAZB 2XBWA 1GHBG 1Y3YA 2O8LA 1LTOA 4B2AA 1F5LA 1EZQA 3MH6A 2K1QA 1KLJH 5L6NH 2FOAA 4XBBA 1AB9C 1DSTA 3HK3B 1EJMA 3SU4A 3PLPA 1NRQH 4I8LA 1Z8JB 2B0FA 1PPFE 3QN7A 2ZEBA 2ZI2H 2FTMA 1G3BA 1WU1A 4Q2KA 1YKTA 3RMMH 1NN6A 4X0WU 4NSVA 3UWIA 2Q6DA 3U8TH 1O2NA 1OX1A 4CRBA 3QWCH 3A8AA 4Y0YE 5E2OA 2XWAA 4D7GA 2OQ5A 3ZZ9A 2SNWA 1BMMH 3MH4A 1YPGH 1C5ZB 1E35B 2BD7A 5DO4H 1L1GA 2A45B 4D76A 2WUBA 3LH3A 1ETSH 7LPRA 1UCYE 2NU2E 1AFEH 3BTKE 4I31A 3UFAA 4E7NA 1VGCC 3M3VA 2VVCA 3QZRA 2A0QB 1O2UA 3SGAE 1CHOF 3F68H 1O33A 1N6XA 2ZDAH 2ZO3H 2AGEX 2FI4E 1U6QA 3GY3A 2C8WB 1QHRB 2CGAA 3T62A 1W7GH 5EXNA 4KTSA 4HI3A 1ZHPA 1QGFA 1FLEE 1NS3A 2NU0E 5SGAE 4TY6A 1WUNH 1D6RA 2BD5A 1HJ8A 3BV9B 3RC5A 1FXYA 2P16A 1HIAA 1J9CH 1QL8A 1C4Y2 4JYTA 4UD9H 2G4TA 1L2EA 5CHAB 3E90B 3KGPA 4DJZB 3OY5U 5FBIA 3A88A 2VB0A 1IOEA 3TITA 3F9HA 4A6LA 3A8BA 4A7IB 4DGJA 2V3HH 1CGJE 4FUEA 3TGKE 1KTSB 4FU8A 2VIVA 5FXLA 3O8CA 5HYOA 2J94A 2GV7A 4MPWA 4FUBA 1YPHE 3QO6A 3LC3A 4DY7B 1C5LH 2AGIX 2O8WA 1HNEE 1TNGA 3ZVCA 3RDZA 1QJ1B 1QQUA 4UDWH 1QJ7B 3KCGH 3A87A 2ZP0H 1P0SH 3ATMA 4WMFA 4ABDA 1WBGB 1QBVH 3A81A 3GY7A 1FONA 5TJXA 1GG6B 1OWDA 1X7AC 3SJKA 1SGYE 2BD8A 3UUZA 1NRRH 2V0BA 4WWYA 2B7DH 1FY4A 1YC0A 2SGAA 3TPIZ 1YPLH 4K1EA 3IITA 3GICB 2D2DA 2JETB 1T8LA 5FPYA 5L30H 2A7HA 2F9BH 3A85A 1GCDA 1TONA 2A7JA 1P2OA 1PQ7A 4PROA 1FMGA 3UOPA 3VFEA 5EQRA 1AFQB 5E0HA 2VH6A 4DT7B 2ZGCA 1HJ9A 4ZROA 1TRMA 1GJ9B 2OD3B 4BANB 1Y5BT 1A4WH 1XUIA 2GDEH 1MTNB 1GJ7B 3M3TA 2R3UA 4CRFA 4TPYA 2BLOA 3T5FH 1MQ5A 2G81E 2QY0B 2XCFA 4Q80A 2P8OC 5IDKA 2FOFA 1Y3WA 2ZGBH 3BTDE 3UR6A 2W3IA 2EA3A 4U32A 1O3DA 4WXVA 1O37A 2WUCA 3VB3A 1C1UH 1GHAF 2BMGB 1H9HE 1Z1JA 2FLBH 4B2BA 1F0SA 1T7CA 4AGJA 1LPZB 3LKWA 4BAHB 3U98H 2G52A 4UFGH 2Q6GA 4MLFB 4IMQA 1W12U 1FN6A 1GMCG 1JXPA 4U01A 1FNIA 4ZHAA 1DVAH 1QURH 1O32A 4Y76A 1SPJA 2W7UA 4CRCA 4WY3A 1QBNA 3SGBE 2ZDVH 1BMLA 2RCEA 4AGKA 4CREA 1SQTA 1P09A 1NTPA 2CN0H 3BF6H 1IQMA 1L0ZA 1VITG 5DP7A 4ABHA 3E8LA 2A5AA 3TH4H 1AE8H 1GG6C 1B5GH 2JH6D 3K6YA 3SOSA 1TNKA 4KKDA 2GCTC 3URDA 3ZZ5A 3D49H 2ZKSA 1NFWA 3SU5A 1WYKA 1W0ZU 2Z3CA 3DT0H 4CRDA 1OWIA 5JB8S 1HXFH 1CT0E 3ITIA 1PFXC 2CHAB 2Z6BD 3TJOA 1DXWA 1P06A 2HNTF 2JETC 1F0TA 1S6HA 1EATA 3A83A 1PYTC 1AHTH 2O9QA 3SUGA 4A5TS 8KME2 4Z0KA 2FODA 2OBQA 3RM2H 2ZTYA 2I6QA 1TQ0B 1YLDA 4INKA 4FVDA 1O3GA 2AYWA 2ZDKA 4FXGH 1UTPA 4JZFH 4UFEH 1AVWA 1UVUH 1GI4A 2GCHG 2UUKB 1TPSA 1S83A 1NC6A 1BDAA 1ELDE 1O3JA 1GBBA 1MTNC 2ZNKH 5E0JA 1BB0B 2AIQA 1QIXB 1OWKA 1ABJH 2EI6A 2GD4B 1DPOA 3P8OA 1V2NT 2ZCLP 5EW2H 2QXIA 4H42U 3C1KA 2OXSA 4FUFA 5C5OA 3P8FA 1TA2A 2ZG0H 3M36A 1K1LA 5FCKA 3OY6U 3OTJE 2OC1A 2H9TH 4F49A 1HAYB 1C2IA 4Q7XA 5EODA 5JPMH 3MWIU 4AZ2B 3LDXH 4RKJB 1DWEH 1LHGH 1LHDH 1TGCA 1SOZA 5GCHF 1IQJA 3MU4A 3MNXA 2YNAA 3QTOH 4MNVA 4ABFA 4BAMB 5C67A 2QXGA 1Z8GA 1LKBA 1O2PA 4FUJA 4X2VA 5ESBA 3RXFA 4E7RG 1C2JA 3B8JA 1GI2A 3D65E 3BIUH 2RDLA 1LPKB 1OS8A 4DVAU 2ODPA 2G51A 3P8GA 1PQAA 2ZU1A 5GJ4B 4CRGA 2ULLA 1WQSA 1RD3B 1NM6A 1DDJA 2FYQA 3ZVEA 3TGIE 1FDPA 1O34A 1EB1H 4IN2A 4INLA 3S9AA 1H9IE 4H4FA 3QGJA 3BG4C 3U8RH 1XVOA 1BBRK 3ZVAA 4CR9A 1ACBE 3A7YA 3TK9A 4BXWA 2FZZA 1MZDA 1WAYB 3RU4T 2WYGA 2FX6A 1GBDA 1GBCA 4ZKOU 1Z8RA 2VU8E 2BQWB 3ATIA 2H6MA 3ZYDA 4R8TB 1TGTA 1ELBA 5JBBS 3A7XA 2ZU2A 1J8AA 4JMYA 3TH2H 2CMYA 1IQFA 5GIBA 4UONA 1BBRH 2ZGXH 4BTIB 1T31A 3KQEA 1XM1A 4LOYH 3M5OA 4I8GA 1SLUB 2P59A 1ZOMA 1YGCH 3HATH 4IN1A 4X1SU 1P12E 1TFXA 1O36A 1FJSA 4TY7A 4DOQA 3LH1A 1Y8TA 1V2RT 3LJOA 1TIOA 2BXTH 2ZCKP 1MQ6A 4QT8C 1DWCH 2A1DB 4DW2U 2GMTC 4OS6A 1HB0B 1CBWB 3V3MA 3VB6A 3SV9A 3BEUA 1XUKA 1ZZZA 1PPHE 1C1QA 1OYTH 4A1VA 1HAVB 4B71A 2WPKS 4Y11E 5I46H 1Y5UT 1D3DB 1BHXF 2A5KA 3MU1A 4X2XA 1LHCH 1TGSZ 5LGOA 1BTWA 1GGDB 3V7TA 1A3BH 1RTFB 1UCYK 1S6FA 2D8WA 1GHWH 2BHGA 3SUEA 2ODQA 1SGCA 2B9LA 2D1JA 4K69A 1JRTA 2H9HA 1ZSKA 1KY9A 1XVMA 2W7SA 4ABEA 2J38A 1SBWA 1JMOH 1W3CA 1Z6EA 5EOKA 1L4DA 3RXIA 3GOVB 5T6FA 3SJ9A 1UCYH 1TNHA 2ALPA 1Z1IA 1C1NA 4ISNA 3VGCC 1YPHC 4OS2A 2PGBB 2FO9A 1J15A 1WTHD 1YPEH 3H5CB 4XBCA 1CA8B 1H8IH 1G37A 3U9AH 2QF0A 1QCPA 2R9PA 3O8DA 3PROA 2AEIH 5FBEA 4ZH8A 1ZRKA 3PTNA 3EDXB 2FI3E 1T8OA 1VCWA 1OP2A 2V6NA 2HNTE 1EAWA 4JYVH 4U2WA 4Y0ZE 1MBQA 3TLOA 4DURA 2PSXA 3KIDU 2QXJA 1BTZA 1OWJA 5L2YH 2Y82A 3T29A 2FP7B 3DUXH 1ARBA 3MYWA 1TBRH 2FOHA 3KN2A 3MOCA 1NFXA 4ABBA 1BA8B 1MKWK 1VCQA 1ZTJA
chains in the Genus database with same CATH superfamily
3A7ZA 2BLVA 5EGMA 1W0YH 1V2OT 4K1SA 2VIWA 2EI8A 2VVVA 1CBWC 4JK6A 3N7OA 3QUMP 3SV2H 1TX8A 1QQ4A 1TMTH 5A0BA 4LZ4B 1O5GH 2A5IA 4ABGA 2P94A 3RXDA 3P92A 3TH3H 1ZGVA 3F9FA 3SORA 1GGDC 1MKWH 1TLDA 1O5EH 3CNRA 1MD8A 4YTAA 1WV7H 1TABE 1YP9A 3KQBA 2KM0A 3VPKA 5GNDA 2PW8H 1KXFA 1THPB 3UNRA 1HV7A 3NXPA 3W1EA 1COWD 4OS5A 1P57B 3A8CA 1GDNA 4ISIH 1NFYA 3CP7A 1SGQE 4O03A 4B74A 1MZAA 3ATLA 1SLVB 2RA3A 1GBFA 1VGCB 4GHTA 1QTFA 1Z6JH 1EP5A 2R0KA 2BTCE 3JZ2B 4CBNA 1C9PA 3MO6A 3DSOA 4ZCNA 2PGQB 1LPGB 3KQCA 1MD7A 1TGBA 2W5EA 1P3EA 4ZHLU 1V2LT 2PKAB 2AH4X 1YM0A 4ESTE 3LC5A 4JZIA 2GT7A 1SGFA 2BY6X 4A1TA 3Q76A 1JIMA 1FAKH 1AMHA 2GZ9A 4WH6A 1HAVA 1NRSH 3MMGA 4ZKNU 2HPQH 1TYNA 2BVRH 5B6OA 3LONA 5FPSA 2KZ4A 1FN8A 2AMDA 1BBRE 3ZV8A 2BX4A 3M5NA 1ESBA 4Y7BA 1V3XA 1CA0C 1AY6H 2BD4A 1Q3XA 2G00A 2P95A 1C5SA 4GAWA 2PTNA 3EYDA 2J98A 1GMDF 1O2KA 2JH5D 1W2KH 3RMNH 3F9EA 3PV4A 2XTTB 5DJ7A 1CE5A 1SGEE 5LH8A 1SG8B 2C90B 4YZUA 4MPVA 1E36B 1O2GH 3N7DA 1S6LA 1ZPBA 2FESH 2LPRA 3E3TA 5EW1H 2P3TB 3GYLB 1QL9A 9LPRA 1AUJA 5EPYA 2IN2A 2AGGX 1IQHA 4ZKRU 1G3CA 3IWMA 2BY8X 1P01A 2F43B 5E2PA 2A2XH 1LVOA 4DT4A 1V2MT 3TJNA 1DT2A 1FY8E 3RLWH 2PSYA 3N99A 4RT1A 1HUTH 2CV3A 3ZZ7A 1GHAG 1ZSJA 2FI5E 2ESTE 2WYJA 3PLKA 1IAUA 1UTQA 6CHAB 2STAE 4LZ1H 1O0DH 4NZLA 1GJ6A 3R3GB 2FMJA 3DA9B 3PWCA 4K8BA 3GY6A 3SN8A 4AOQA 3A82A 3SJOA 1P9UA 2QGRA 1MUEB 3GY5A 2YNBA 5EJZA 2ZU5A 3UAIC 5J4SA 4MDSA 4K1TA 1O2OA 4BXSA 4IC6A 1SHHB 1V2WT 3FAOA 1ELFA 4I7YH 2ZU4A 3EGKH 2BDYA 3M7TA 4JZ1A 2OBOA 1CT2E 2SGPE 1FV9A 2P8OB 2THFB 1GHVH 4KTCA 1QRZA 4YO9A 4Y79A 1H8HD 4CRAA 1ZTKA 4OGXA 4LK4A 1A0JA 1O2VA 1GJ5H 3A7VA 2H2ZA 1GJDB 4OS4A 3M5MA 1DUEA 5GDSH 1KSNA 1PYTD 1F0UA 1BRAA 1HAOH 3AVZA 7KMEH 1UTJA 2SNVA 1K2I1 7GCHF 2VIPA 4P02A 1N8OC 5FPTA 2RA0A 1GBHA 1ZJDA 1NFUA 2NU3E 1QA7A 2ZGHA 4NSYA 3GCTF 1EXFA 1GJ8B 1G3EA 3RXBA 2BDCA 1HJAC 1PJPA 3SI4H 2ZA5A 3UOUA 1XUGA 3GCNA 1O35A 1SGRE 2ZHQH 1E1QD 5C3NA 5EQQA 1O5BB 1GI7B 1GBAA 2YMSD 1OXGA 4WXIA 2HPPH 4Y10E 4Y8XA 1ANBA 2L74A 5HXFA 2GCTB 1O5AB 1TNLA 3PTBA 2PKAA 2ZIQH 1UTLM 2W3KA 3PO1C 3PMAB 3AW0A 3RXRA 1NESE 3IG6B 1A5GH 3KYFA 1MCTA 3EE0B 1ZRBA 1W14U 1ZMJA 1CGIE 2FOCA 1UTMA 4YLUA 5T6GA 2ZQ2A 5GPIB 1OYQA 1SI5H 1MU6B 6CHAC 2ANWA 1QL7A 1MTVA 1QNJA 1AO5A 1AUTC 2Q6FA 1Y3UA 1EAXA 1O2XA 1YPMH 1EQ9A 1ZTLA 2BDHA 3M5LA 4ISHH 1C5PA 4MPUA 4X8TH 1ZYOA 3SU1A 2Y81A 3KEEA 3QZQA 4AYVB 1B7XB 3MO9A 4NG9H 1NBME 2GT8A 3M3SA 2TBSA 4IW4E 3SNDA 3STIA 3QK1A 4TPIZ 4DG4A 1L1JA 2ZFSA 3MFJA 3DSPA 1IQGA 3H7OA 3M61U 1ETTH 1P2KA 4WMEA 4B75A 1HBTH 2F83A 6GCHG 4SGAE 1O3MA 3A8DA 3RXJA 5LPEA 1OKXA 3TU7H 1C5QA 3DCLA 1BTHH 1MTSA 1PPGE 3EA7A 3H7TA 2A32A 5K0HA 1MTUA 2Y5HA 4BAKB 1QRXA 2OTVA 3S7KB 1BITA 2C8XB 1OWHA 2ZFFH 3BTME 4FUHA 2BD3A 1KXBA 2FOBA 3MI4A 2HNTC 3RUOA 1SFQB 1EZSC 1FI8A 2CJIA 3TJVA 1ETRH 1XUFA 2PKSB 1GI6A 3ENSB 2Z9JA 3RP2A 1GBEA 1NRNH 1OP8A 1C5OH 3SU2A 1MAYA 1VCPA 3A80A 1ZHRA 1O38A 2UWPA 1IQIA 1BRBE 4BNRA 2BX3A 3UNSA 2BY9X 2GGVB 1KIGH 3BG4B 1CVWH 1A61H 1G2LA 1QB6A 2CK3D 2H5DA 2C93B 1C5VA 1FY3A 1IHTH 2AERH 1O3BA 4Q4LA 1HXEH 1GBTA 1MMJN 4MPXA 1N6YA 2G8TA 4NA7A 2KAIB 1TB6H 1C5NH 1C5XB 4XSKU 2GX4A 4AB8A 3A7WA 1EPTC 1S81A 3SU3A 1SB1H 1SFIA 1BJVA 4YOGA 2R3YA 3UR9A 4O3UA 1B0EA 3C27B 1AWHB 2QXHA 3HGNA 3B23B 4MNXA 3CS0A 1FY5A 1RIWC 1OHHD 2ZPQA 2V3OH 4E05H 5HGGA 1EX3A 2HGTH 1O3IA 2J92A 1ANDA 1C1WH 3WWFA 2WZQA 1DS2E 2GMTB 3BTFE 2A4RA 1BTUA 2RG3A 3BG8A 1T32A 2LNCA 1G3DA 4X1RU 3D23A 4RT0A 1IQLA 1EZXC 3RXKA 3SW2B 3ODFA 3GISB 5EPNA 5A09A 1P9SA 1PQ5A 4WF8A 5AHGH 1HFDA 3SV8A 2CF9H 4NCYA 2FEQH 2QC2A 1JIRA 2AFQB 2VWMA 1HGTH 1YYY1 3RXMA 3A89A 2HOBA 3TNSA 3H09A 1V2UT 1LMWB 5DP3A 1YWUA 3TK6A 2V35A 5A8YA 4RN6A 1QB1A 5EXLA 2PKSC 1S0QA 3OYPA 4LXBH 2GVFA 1F5RA 3M7UA 1AD8H 3BTWE 1SMFE 3U69H 1EPTA 5FX6A 1O2YA 3F2GA 1D3PB 1QJ6B 1K9OE 2CF8H 1DOJA 2B5TB 3S7HB 1YY3A 4J1YA 1C1TA 3E0PB 3VGCB 2F9OA 3E91A 5T3HA 1DLEA 4GSOA 1W8BH 1TNJA 1O3HA 2WPMS 2Y7ZA 3GCHC 4GCHG 2PUXB 3OFND 1DM4B 2FLRH 5DP6A 3F6UH 5F03A 1WTGH 1ABIH 1FZZA 2QF4A 1FAXA 3GDVA 3P70B 4ZHMU 1DSUA 1GDQA 4RSPA 3SNEA 1LHEH 2LELA 2WV5A 3O8BA 1C2HA 1C9TA 1TQ7B 7ESTE 2G5NA 1ELGA 2V3MA 2BD2A 4Z6AH 2W26A 4TT3D 1KTTB 1O2WA 1O3LA 3GCOA 3LJJA 1INCA 1NU7B 2BM2A 4XRNA 1C2MA 1EOLA 3ZVBA 1C2DA 2SFAA 2WV4A 1BMNH 1MU8B 2F9NA 1AWFH 2Y7XA 3I78A 1C1VH 2J2UA 1F0RA 2PV9B 5GWZA 3MO3A 4YT6H 1WOFA 3PV2A 4IMZA 3ZIAD 2OUAA 1SL3A 3RXLA 2CXVA 3MH5A 2BOKA 1HLTH 2VWLA 1OPHB 4ASHA 1O5DH 1VJAU 1ESAA 3S69A 1K1OA 4Z1MD 1EAIA 3T27A 1A1RA 3ZVDA 4ACBA 2ZPSA 2B8OH 3F0OA 1UK4A 5C0TA 2ZU3A 4ZXXH 2XNIA 2Z7FE 1VITF 2XC4A 1C1SA 1O2TA 2QIQA 3EE7A 1RXPA 5A0CA 3L6PA 4MQAA 1SLWB 3TNTA 5A8ZA 1Z8IB 4ZXYH 4ZKSU 1J17T 1P03A 4O9VA 3S0NA 2Z3DA 3P17H 3RLYH 4K3JA 3SUFA 4AB9A 2KAIA 3ESTA 4UE7H 4WMDA 3PLBA 3AAVA 4KELA 1LDTT 5F8ZA 2AMPA 3FN8A 3DFJA 3UQOA 3BTHE 1OWEA 4HZHA 1XXDA 2STBE 1ZJKA 2BLWA 1C2FA 1D9IA 1TMUH 1QR3E 3E16B 1LVYA 1O2IA 4FUDA 2PTCE 4X6OA 3RXVA 3RXQA 4O3TA 3T25A 3SNCA 1ZSLA 3TK5A 1TOCB 3KHVA 3PMBB 4AG1A 3FVFB 3R0FA 3GY2A 1BTXA 1HCGA 4ABAA 1HAPH 1DXPA 3TJUA 1GJAB 3FP8E 2GP9B 5C1UA 1P11E 1TPPA 1UVSH 1CHGA 5CDFE 2FWWA 1K21H 1LVMA 2BXUH 1ELTA 1LHFH 4HG6A 1YPKH 1UHBB 1MCVA 1BMAA 4YESB 1O2HA 3ODDA 3SNAA 1TNIA 3PV5A 1TRYA 3G01A 2J95A 3SV7A 3FO8D 3RXOA 4JCNA 1ZLRA 4CHAB 2ZHEH 4J2YB 1LQDB 2BD9A 1ELEE 2BDBA 1L4ZA 5EG4A 4IBLH 3V12A 3SHAH 2AIPA 1K1NA 1TBZH 1ORFA 3MNCA 4FUGA 3QLPH 1WCZA 2VWNA 4AORA 2GJGA 1CA0B 1EAUA 1LCYA 2ANKH 2F9PA 1GBJA 3NZIA 1SOTA 2AS9A 4RKOB 3VB4A 5JB9S 1YCPK 2UWLA 1CQQA 4OS7A 4Y8ZA 4AN7A 1GHXH 1JOUB 3I77A 3RMLH 2ILNA 1H8DH 3PB1E 3FP7E 2WPHS 2G4UA 1CHOG 1NZQH 2FOEA 4NIYA 4NWKA 5JBTA 1C2LA 3LT3A 2FTLE 1C5UA 4X2WA 3ZV9A 1V2JT 5DP8A 4AFUA 3LGWA 3WWBA 1P2JA 1K1JA 4KGAA 1P8VC 2GDDA 3LPRA 1NY22 3A84A 1QBOA 1ID5H 1BMFD 4UFDH 1V6DA 2IJD1 4BTUB 4B1TA 3M35A 3RXEA 4X6PA 1DWBH 2FXRA 2BY5X 1E0FD 4X1QU 3BTQE 1MBMA 3NUMA 3RXPA 3JZ1B 2OK5A 1G30B 3NPSA 1GCTC 1EB2A 2BZ6H 3ATKA 3V0XA 3RC6A 2ZQ1A 4TSFD 2G55A 4NWLA 5A8XA 1C1PA 3FANA 4DIIH 2P3FH 2W6JD 2FS9A 4NIWA 4X8VH 4A1XA 4B2CA 3NK8A 3DHKH 2JH0D 1YPJH 3PRBA 4JK5A 1SGDE 2A2QH 4JYUH 1GBIA 2HALA 4X6NA 1F92A 4D9RA 3DD2H 1GMHF 4NZQA 4K60A 1BRCE 1SGTA 4K8YA 5C0UA 1C2GA 2ZHDA 2A7CA 3RMOH 4CHAC 1T8NA 2Z9GA 4NA9H 4CBOA 1C5TA 3EQ0H 2IJOB 1WQVH 1E34B 1O2JA 1O5CB 2BQ7B 4X2YA 2VNTA 1CT4E 1ZR0A 5DP9A 1V2TT 4MTBA 3OEED 2IOTA 3WY8A 4Q7ZA 1C1OA 1Z71A 1JWTA 3MU5A 5EIYA 1HAHH 2HRVA 3KQDA 1A0LA 1N8OB 1TX6A 3U28C 2HLCA 1V2KT 1EZUC 1H8ED 3PMJA 3BTTE 3ZZBA 1K1PA 2P93A 3F1SB 4MNYA 2J9NA 3I29A 1HJAB 1O5FH 1TOMH 2NU4E 4MG3A 4TYDA 2ZTZA 1O2SA 1QA0A 3QTVH 2EY4C 1A5IA 1RTLA 4WJG2 2OQUA 5C17A 3RXSA 1H4WA 1LO6A 1FPCH 1WDIA 1VR1H 3PO1B 2TPIZ 1ZMLA 5T1VA 3M7QA 5ESTE 3RM0H 1UO6A 1A46H 1A3EH 1UHBA 1GVZA 2OC0A 4IGDA 3PMHB 4M7GA 4ZUHA 1GHYH 5DP4A 4M9FA 3SQHE 1HAGE 1O3OA 1IQKA 1T4UH 2RDEA 1BT7A 1TE0A 5BPEA 4X1PU 1KXAA 1SR5C 3FZZA 2SGEE 1T8MA 2NWNA 4FVBA 3F2HA 4X1NU 1GL0E 2EI7A 2J97A 2ZF0H 5ETXA 4DIHH 1GI1A 1P2IA 1TGNA 1PQ8A 1UTOA 2W6ID 4BTTB 5A2MH 1ARCA 1GL1A 3SU0A 2K8IA 2HVXA 3RXUA 1YF4A 3ATWA 4Q7YA 8GCHF 1SGPE 1IHSH 1OOKB 1AGJA 2P3UB 4E06H 4HFPB 1DWDH 3BSQA 2Z3EA 2J5UA 1SQRA 4FU7A 5DG6A 5G4BA 1DX5M 2EQNA 2VWOA 2VINA 4ISLA 3VG8A 1UMAH 2OCVB 2GV6A 1SHYA 3VXEH 1S85A 2GZ7A 1EASA 1S84A 3MNSA 4Y71A 3QGNB 5AF9H 1GPZA 4VGCC 1P04A 5DP5A 1DITH 2F3CE 1TBQH 3U8OH 1FX0B 2SGQE 1KXEA 4H6TA 2C3SA 3OSYA 1BZXE 2JJ1D 2VH0A 4H6SB 4X6MA 2FOMB 3E1XB 1VZQH 3K9XB 3QX5H 2ANYA 4HTCH 1G32B 1RS0A 5EU8A 3MH7A 4AG2A 2BY7X 3LGVA 5F8TA 4BAQB 3OEHD 4SGBE 2PLXA 2BDAA 4AC9A 1P2QA 2KX4A 4F48B 1GBMA 3STJA 2RFKC 2XNDD 5K7RA 1KDQA 4YXWD 3KYGA 2AMQA 8LPRA 1QY6A 1BJUA 1GBLA 1TMBH 3OE7D 1AQ7A 5F8XA 1GHZA 3BIVH 3PM3A 5FHTA 2H9EH 3UWJH 2Q1JA 3HPTB 2J4IA 4I8JA 4NFFA 1GI5A 4UEHH 1RGQA 1O2RA 5IYTA 1V2QT 2F91A 2KFWA 1KLIH 2R2MB 3ELAH 3K65B 1SLXB 5GCHG 3S9CA 2BVSH 1EPTB 4ABJA 2F4LA 5KGOA 3RXHA 4ABIA 3K2UA 1VJ9U 1GBKA 4K2YA 1Y3VA 4X8UH 5E8EH 3RU4D 4D7FA 5DK1A 1THRH 1UK3A 1RIWB 3UPEA 3NCLA 2JKHA 4D9QA 2HVYB 3ZZCA 3SNBA 4AFSA 1AVXA 1HAXB 4I8KA 1O3PB 3UIRA 3VXFH 2BQ6B 2FYRA 1P3CA 4KTUA 1QRWA 5JDUB 1GI3A 1NPMA 3SV6A 2SGFE 2Y6TA 3LGUA 3ZYEA 4KP0A 5DPAA 3ZZ6A 3ZZDA 4B73A 1GHBF 4B76A 1A7SA 4DCDA 2PP6A 3A86A 1TALA 4NFEA 1FPHH 1DFPA 1AVGH 2Z9IA 2XBYA 1AIXH 1BIOA 1O2ZA 5AFYH 3RXGA 4Y8YA 1AKSB 3LGYA 2NU1E 1ANEA 2QA9E 3SZEA 1S82A 1V2VT 2VJ1A 1IQNA 4AX9H 1G2MA 3QDZB 2WHXA 1BQYA 1EP6A 2C8YB 2TGPZ 4XDEA 3HGPA 5DSFA 3SYJA 1GI9B 2UUJB 1J14A 3Q3KA 3VEQB 3SJIA 5C20A 3O8RA 1HPGA 5CHAC 1PPZA 2DUCA 4NA8A 1FIWA 1C4U2 2O8UA 4JZEH 2Z94A 2IPHA 2ANMH 4B6EA 1TX7A 2QAAA 2IPQX 3ZZ3A 3W94A 1GJBB 1AZ8A 3Q3YA 4AFZA 4OGYA 1ANCA 4GLYA 1DE7H 1LQEA 1XUJA 5DGJA 1A0HB 2XCNA 4ASUD 2JIZD 2OC8A 1ELAA 3BTEE 1A2CH 1SQAA 2ZHWH 1C5YB 1GJ4H 1OP0A 2KCOA 4FUCA 1JBUH 3GY4A 1J16A 2Z9LA 1ZGIA 3GCHB 1C4V2 2GZ8A 3RC4A 2PR3A 1TA6A 3UQVA 1TPOA 3PYHA 4OS1A 2BVXH 2FIRH 4TWWA 5C2ZA 5FX5A 3FZDA 5AFZH 5PTPA 2QE7D 5KECA 1PPCE 3GDSA 1D6WA 1E37B 1QB9A 3NRLA 3V13A 2ZGJA 1TWXB 2FS8A 5C1XA 4JZDH 2F9VA 5EQSA 2QF3A 2WPLS 3URCA 5DN6D 2LP6A 3UREA 2TGDA 1Z7KA 3RXAA 1KXDA 1BHXB 2OP9A 2PHBA 1N1LA 5E0GA 2XC5A 2M5TA 2VBCA 4Q63A 2XBXA 1C1RA 3D62A 2FX4A 1C2EA 3LOXA 1E79D 1YLCA 2BDGA 2H5CA 4OM9A 2HWLB 1GI8B 3DSGA 1XMNB 5J4QA 3MQKC 1XX9A 5ABWA 2QYIA 4AFQA 3AASA 1F7ZA 5TCCA 3SJ8A 1AFQC 1YBWA 1CSOE 1KXCA 4ZMAH 1CO7E 1EOJA 2ZCHP 3LIWA 3VB5A 5JBAS 1O39A 1FY1A 2BZAA 3ZVGA 5TCAA 1DICA 5L2ZH 1K1IA 2XXLA 2YMSC 3SI3H 1GJCB 3NWUA 3EA8A 2ZWLH 1MABB 2QN5T 1ZMNA 3Q77A 1GVLA 1MTWA 2WPJS 3FFGA 1ELVA 3RXTA 2SGDE 2FM2A 2A4OA 2EC9H 1D3TB 1EJAA 5HM2A 2A4QA 1UTKA 2UUYA 1RJXB 3BTGE 2WPDD 2KCAA 1O30A 3UNQA 3MU8A 1GI0A 1EUFA 2TGAA 1S0RA 1SVPA 1Q2WA 2ZDLA 4THNH 1OSSA 2R0LA 2G5VA 2BYAX 1XKBC 1RRKA 4R0IA 5DKMA 3LGIA 4WVPE 3EA9A 2AHME 1UVOA 2ZFRH 1SSXA 1THSH 2VIOA 2HLDD 2ZHFH 3PRDA 1NBMD 2H1UA 1DANH 1FIZA 4CH8B 6GCHF 3S9BA 4UFFH 3SQEE 1BTPA 4IC5A 3TIUA 5FAHA 1O2QA 1BUIA 4MNWA 2ZFQH 1G36A 1HRTH 5HM9A 1SC8U 1AKSA 4K5ZA 1UVPA 1HYLA 3P8NA 3OU0A 5CE1A 2CHAC 4CR5A 4B6FA 1ZPCA 2TRMA 4U30A 1SGIB 2A4GA 1TRNA 3ZZAA 1GDUA 1BTYA 1GMCF 3Q00A 5C1YA 1C5MD 3TVJB 4INHA 1DLKB 1XUHA 3KL6A 3HK6B 2ZZUH 1O2LA 1O3NA 1W11U 1DUAA 1O3KA 1V2PT 1AZZA 1WSSH 2I6SA 3ZZ8A 5CMXH 1KMHB 1L1NA 6ESTA 2OINA 1B0FA 3ZVFA 4Y7AA 1EKBB 5F53A 2PWXA 1O2MA 1HAIH 1EFRD 1SGFG 3T26A 2XYAA 2L6OA 3Q3XA 1C2KA 1TAWA 1O3FA 3SBKA 5JYIA 1W10U 4XOJA 4I33A 3DFLA 1ZPZA 1VITH 2BB4A 1GMHG 2M2AA 3A7TA 4AYYB 1M9UA 2ASUB 2ALVA 1E1RD 2VIDA 2FPZA 3U1JB 4ZAEA 4NIVA 4GVUA 4IS5A 1C1MA 1P2NA 1S5SA 1BCUH 4NIXA 3SO3A 1FQ3A 2ZECA 2XBVA 4MVNA 3E6PH 4D8NA 2Z9KA 2ZFPH 1RFNA 5T6DA 1CU1A 8ESTE 3CS7A 1NT1A 1LKAA 1BOQA 1GCTB 2ZDMA 1W0JD 1GMDG 2GCHF 5GXPA 1SQOA 4FETA 3VB7A 1AU8A 1UVTH 1MKXK 1W7XH 4YLQH 3MU0A 1JRSA 1O3CA 4ISOA 2QCYA 2QV1A 3KF2A 3E0NB 2WV9A 1O31A 1CGHA 4GHQA 1XKAC 1AN1E 3RXCA 2XC0A 3U1IB 3FP6E 4NGAH 2WINI 4TWYA 1MKXH 3BEFB 1D3QB 1SKYE 3SGQE 3LGTA 1W13U 3MTYA 1UK2A 2KCPA 2VGCB 2C4FH 3UB0A 5C5NA 1LVBA 1P05A 2FDAA 3B9FH 3SHCH 4FUIA 5F6MA 4BOHA 2OC7A 1K28D 4YM9A 3K6ZA 5FCRA 4YOJA 5C94A 5AVDA 3CENA 1V2ST 2PFEA 2ZFTA 5JBCS 1EJNA 1AE5A 1H1BA 4X8SH 3SZNA 2WPIS 1P10A 2A31A 4A92A 3F9GA 1F5KU 1K22H 2TGTA 2F9UA 1NROH 1NO9H 2VVUA 5LPFA 5LPRA 1PPBH 2O8MA 2XRCA 2Y5GA 1YCPH 3GY8A 1MAXA 1H9LB 2VIQA 3MHWU 4F4OC 1F2SE 4GCHF 8GCHG 1HDTH 1D4PB 3OX7U 3ZZ4A 1UW7A 3M37A 2EEKA 1NU9A 1MH0A 3SU6A 1HIAB 3HKIB 2UWOA 1O3AA 1AB9B 3T28A 4YOIA 2BLQA 2O8TA 4I8HA 2Y5FA 3HKJB 4WH8A 4XFQA 3GYMA 1SGNE 1ZHMA 4GUXA 6LPRA 1E38B 1YCPM 1BRUP 1XXFA 2BOHB 2XWBI 1Q31A 3PWBA 2PUQH 1IQEA 1NRPH 7GCHG 1KYNA 1QFKH 1O3EA 3P6ZB 5I25A 4ACAA 2ZPRA 2DE8A 1KDQB 2DE9A 3MNBA 3GCTG 1AI8H 3L3TA 3UY9A 1FUJA 4XE4A 2Y80A 5EJ1A 1C5WB 1P2MA 2BDIA 2TIOA 3EAJA 4CH2B 1YLNA 1ELCA 1T4VH 1DY9A 1GWAA 3BEIB 3P95A 3L33A 1K1MA 4FOUC 2ZTXA 3TGJE 3BN9A 1C5RA 2GKVE 2ODYB 1TPAE 5HMAA 2V7QD 2VGCC 1P02A 1DY8A 4BAOB 4VGCB 2R2WU 1PPEE 3UTUH 2ZDNA 2OLGA 3T2NA 2GTBA 3RU4E 1Y5AT 3W95A 2XW9A 2YOLA 1Y3XA 2FOGA 2UUFB 1RTKA 1UTNA 3NKKA 1ESTA 3LU9B 4XBDA 4I32A 2ZC9H 5H4IB 5A0AE 1G9IE 2C8ZB 4HGCA 5EXMA 5BRRE 1UJ1A 9ESTA 2K0QA 1GVKB 4FU9A 3AW1A 3SUDA 4YT7H 3GDUA 2J34A 4O97A 4Y6DA 3AAUA 2D26C 4GPGA 1KLTA 1A5HA 1Y59T 3KNXA 1HAZB 2XBWA 1GHBG 1Y3YA 2O8LA 1LTOA 4B2AA 1F5LA 1EZQA 3MH6A 2K1QA 1KLJH 5L6NH 2FOAA 4XBBA 1AB9C 1DSTA 3HK3B 1EJMA 3SU4A 3PLPA 1NRQH 4I8LA 1Z8JB 2B0FA 1PPFE 3QN7A 2ZEBA 2ZI2H 2FTMA 1G3BA 1WU1A 4Q2KA 1YKTA 3RMMH 1NN6A 4X0WU 4NSVA 3UWIA 3OAAD 2Q6DA 3U8TH 1O2NA 1OX1A 4CRBA 3QWCH 3A8AA 4Y0YE 5E2OA 2XWAA 4D7GA 2OQ5A 3ZZ9A 2SNWA 1BMMH 3MH4A 1YPGH 1C5ZB 1E35B 2BD7A 5DO4H 1L1GA 2A45B 4D76A 2WUBA 3LH3A 1ETSH 7LPRA 1UCYE 2NU2E 1AFEH 3BTKE 4I31A 3UFAA 4E7NA 1VGCC 3M3VA 2VVCA 3QZRA 2A0QB 1O2UA 4P00A 3SGAE 1CHOF 3F68H 1O33A 1N6XA 2ZDAH 2ZO3H 2AGEX 2FI4E 1U6QA 3GY3A 2C8WB 1QHRB 2CGAA 3T62A 1W7GH 5EXNA 4KTSA 4HI3A 1ZHPA 1QGFA 1FLEE 1NS3A 2NU0E 5SGAE 4TY6A 1WUNH 1D6RA 2BD5A 1HJ8A 3BV9B 3RC5A 1FXYA 2P16A 1HIAA 1J9CH 1QL8A 1C4Y2 4JYTA 4UD9H 2G4TA 1L2EA 5CHAB 3E90B 3KGPA 4DJZB 3OY5U 5FBIA 3A88A 2VB0A 1IOEA 3TITA 3F9HA 1WXRA 4A6LA 3A8BA 4A7IB 4DGJA 2V3HH 1CGJE 4FUEA 3TGKE 1KTSB 4FU8A 2VIVA 5FXLA 3O8CA 5HYOA 2J94A 2GV7A 4MPWA 4FUBA 1YPHE 3OTPA 3QO6A 3LC3A 4DY7B 1C5LH 2AGIX 2O8WA 1HNEE 1TNGA 3ZVCA 3RDZA 1QJ1B 1QQUA 4UDWH 1QJ7B 3KCGH 5HIZA 3A87A 2ZP0H 1P0SH 3ATMA 4WMFA 4ABDA 1WBGB 1QBVH 3A81A 3GY7A 1FONA 5TJXA 1GG6B 1OWDA 1X7AC 3SJKA 1SGYE 2BD8A 3UUZA 1NRRH 2V0BA 4WWYA 2B7DH 1FY4A 1YC0A 2SGAA 3TPIZ 1YPLH 4K1EA 3IITA 3GICB 2D2DA 2JETB 1T8LA 5FPYA 5L30H 2A7HA 2KCYA 2F9BH 3A85A 1GCDA 3FOAA 1TONA 2A7JA 5HIYA 1P2OA 1PQ7A 3F0PA 4PROA 1FMGA 3UOPA 3VFEA 4F55A 5EQRA 1AFQB 5E0HA 2VH6A 4DT7B 2ZGCA 1HJ9A 4ZROA 1TRMA 1GJ9B 2OD3B 4BANB 1Y5BT 1A4WH 5CHBA 1XUIA 2GDEH 5B6LA 1MTNB 1GJ7B 2YMSB 3M3TA 2R3UA 4CRFA 4TPYA 2BLOA 3T5FH 1MQ5A 2G81E 2QY0B 1QZ8A 2XCFA 5IK2D 4Q80A 2P8OC 5IDKA 2FOFA 1Y3WA 2ZGBH 3BTDE 3UR6A 2W3IA 2EA3A 4XD7D 4U32A 1O3DA 4WXVA 1O37A 2WUCA 3VB3A 1C1UH 1GHAF 1VKYA 2BMGB 1H9HE 1Z1JA 2FLBH 4B2BA 1F0SA 1T7CA 4AGJA 1LPZB 3LKWA 4BAHB 3U98H 2G52A 4UFGH 2Q6GA 4MLFB 4IMQA 1W12U 1FN6A 1GMCG 1JXPA 4U01A 1FNIA 4ZHAA 1DVAH 1QURH 1O32A 4Y76A 1SPJA 2W7UA 4CRCA 4WY3A 1QBNA 3SGBE 2ZDVH 1BMLA 2RCEA 4AGKA 4CREA 1SQTA 1P09A 1NTPA 2CN0H 3BF6H 1IQMA 1L0ZA 1VITG 5DP7A 4ABHA 3E8LA 2A5AA 3TH4H 1AE8H 1GG6C 1B5GH 2JH6D 3K6YA 3SOSA 1TNKA 4KKDA 2GCTC 3URDA 3ZZ5A 3D49H 2ZKSA 1NFWA 3SU5A 1WYKA 1W0ZU 2Z3CA 3DT0H 2QF5A 4CRDA 1OWIA 5JB8S 1HXFH 1CT0E 3ITIA 1PFXC 2CHAB 2Z6BD 3TJOA 1DXWA 1P06A 2HNTF 2JETC 1F0TA 1S6HA 1EATA 3A83A 1PYTC 1AHTH 2O9QA 3SUGA 4A5TS 8KME2 4Z0KA 2FODA 2OBQA 3RM2H 2ZTYA 2I6QA 1TQ0B 3N7EA 1YLDA 4INKA 4FVDA 1O3GA 2AYWA 2ZDKA 4FXGH 1UTPA 3GS9A 4JZFH 4UFEH 1AVWA 1UVUH 1GI4A 2GCHG 2UUKB 1TPSA 1S83A 1NC6A 1BDAA 1ELDE 1O3JA 1GBBA 1MTNC 2ZNKH 5E0JA 1BB0B 2AIQA 1QIXB 1OWKA 1ABJH 2EI6A 2GD4B 1DPOA 3P8OA 1V2NT 2ZCLP 5EW2H 2QXIA 4H42U 4I86A 3C1KA 2OXSA 4FUFA 5C5OA 3AK5A 2WSSD 3P8FA 1TA2A 2ZG0H 3M36A 1K1LA 5FCKA 3OY6U 3WW7A 1K0HA 3OTJE 2OC1A 2H9TH 4F49A 1HAYB 1C2IA 4Q7XA 5EODA 5JPMH 2JJ2D 3MWIU 4AZ2B 3LDXH 4RKJB 1DWEH 1LHGH 1LHDH 5EJLA 1TGCA 1SOZA 5GCHF 1IQJA 3MU4A 3MNXA 2YNAA 3QTOH 4MNVA 4ABFA 4BAMB 5C67A 2QXGA 1Z8GA 5KEDA 1LKBA 1O2PA 4FUJA 4X2VA 5ESBA 3RXFA 4E7RG 1C2JA 3B8JA 1GI2A 3D65E 3BIUH 3F3BA 2RDLA 1LPKB 1OS8A 4DVAU 2ODPA 2G51A 3P8GA 1PQAA 2ZU1A 5GJ4B 5FL7D 4CRGA 2ULLA 1WQSA 1RD3B 1NM6A 1DDJA 2FYQA 3ZVEA 3TGIE 1FDPA 1O34A 1EB1H 4IN2A 4INLA 3S9AA 1H9IE 4H4FA 3QGJA 3BG4C 3U8RH 2KR7A 1XVOA 1BBRK 3ZVAA 4CR9A 1ACBE 3A7YA 3TK9A 4BXWA 2FZZA 1MZDA 3KQ5A 1WAYB 3RU4T 2WYGA 2FX6A 1GBDA 1GBCA 4ZKOU 1Z8RA 2VU8E 2BQWB 3ATIA 2H6MA 3ZYDA 4R8TB 1TGTA 1ELBA 5JBBS 3A7XA 2ZU2A 1J8AA 4JMYA 2XOKD 3TH2H 2CMYA 1IQFA 5GIBA 4UONA 1BBRH 2ZGXH 4BTIB 1T31A 3KQEA 1XM1A 4LOYH 3M5OA 4I8GA 1SLUB 2P59A 1ZOMA 1YGCH 3HATH 4IN1A 4X1SU 1P12E 1TFXA 1O36A 1FJSA 4TY7A 4DOQA 3LH1A 1Y8TA 1V2RT 3LJOA 1TIOA 2BXTH 2ZCKP 1MQ6A 4QT8C 1DWCH 2A1DB 4DW2U 2GMTC 4OS6A 1HB0B 1CBWB 3V3MA 3VB6A 3SV9A 3BEUA 1XUKA 1ZZZA 1PPHE 2JDID 1C1QA 1OYTH 4A1VA 1HAVB 4B71A 2WPKS 4Y11E 5I46H 1Y5UT 1D3DB 1BHXF 2A5KA 3MU1A 5HKKD 4X2XA 1LHCH 1TGSZ 5LGOA 1BTWA 1GGDB 3V7TA 1A3BH 1RTFB 1UCYK 1S6FA 2D8WA 1GHWH 2BHGA 3SUEA 2ODQA 1SGCA 2B9LA 2D1JA 4K69A 1JRTA 2H9HA 1ZSKA 1KY9A 1XVMA 2W7SA 4ABEA 2J98B 2J38A 1SBWA 1JMOH 1W3CA 1Z6EA 4RI0A 1L4DA 5EOKA 3RXIA 3GOVB 5T6FA 3SJ9A 1UCYH 1TNHA 3FKSD 2ALPA 1Z1IA 1C1NA 4ISNA 3VGCC 1YPHC 4OS2A 2PGBB 2FO9A 1J15A 1WTHD 1YPEH 3H5CB 4XBCA 1CA8B 1H8IH 1G37A 3U9AH 2QF0A 1QCPA 2R9PA 3O8DA 3PROA 2AEIH 5FBEA 4ZH8A 1ZRKA 3PTNA 3F2FA 3EDXB 2FI3E 1T8OA 1VCWA 1OP2A 2V6NA 2HNTE 1EAWA 4JYVH 4U2WA 1W0KD 4Y0ZE 1MBQA 3TLOA 4DURA 2PSXA 3KIDU 2QXJA 1BTZA 1OWJA 5L2YH 2Y82A 3T29A 2FP7B 3DUXH 1ARBA 3MYWA 1TBRH 2FOHA 3KN2A 3MOCA 1NFXA 4ABBA 1BA8B 1MKWK 1VCQA 1ZTJA
chains in the Genus database with same CATH topology
3A7ZA 2BLVA 5EGMA 1W0YH 1V2OT 4K1SA 2VIWA 2EI8A 2VVVA 1CBWC 4JK6A 3N7OA 3QUMP 3SV2H 1TX8A 1QQ4A 1TMTH 5A0BA 4LZ4B 1O5GH 2A5IA 4ABGA 2P94A 3RXDA 3P92A 3TH3H 1ZGVA 3F9FA 3SORA 1GGDC 1MKWH 1TLDA 1O5EH 1MD8A 4YTAA 1WV7H 1TABE 1YP9A 3KQBA 3VPKA 2PW8H 1KXFA 1THPB 3UNRA 1HV7A 3NXPA 4OS5A 1P57B 3A8CA 1GDNA 4ISIH 1NFYA 3CP7A 1SGQE 4O03A 4B74A 1MZAA 3ATLA 1SLVB 2RA3A 1GBFA 1VGCB 4GHTA 1QTFA 1Z6JH 1EP5A 2R0KA 2BTCE 3JZ2B 4CBNA 1C9PA 3MO6A 2PGQB 1LPGB 3KQCA 1MD7A 1TGBA 2W5EA 1P3EA 4ZHLU 1V2LT 2PKAB 2AH4X 1YM0A 4ESTE 3LC5A 4JZIA 2GT7A 1SGFA 2BY6X 4A1TA 3Q76A 1JIMA 1FAKH 1AMHA 2GZ9A 4WH6A 1HAVA 1NRSH 3MMGA 4ZKNU 2HPQH 1TYNA 2BVRH 5B6OA 3LONA 5FPSA 1FN8A 2AMDA 1BBRE 3ZV8A 2BX4A 3M5NA 1ESBA 4Y7BA 1V3XA 1CA0C 1AY6H 2BD4A 1Q3XA 2G00A 2P95A 1C5SA 4GAWA 2PTNA 3EYDA 1GMDF 1O2KA 2JH5D 1W2KH 3RMNH 3F9EA 3PV4A 2XTTB 5DJ7A 1CE5A 1SGEE 5LH8A 1SG8B 2C90B 4YZUA 4MPVA 1E36B 1O2GH 2LPRA 1ZPBA 2FESH 3E3TA 5EW1H 2P3TB 3GYLB 1QL9A 9LPRA 1AUJA 5EPYA 2IN2A 2AGGX 1IQHA 4ZKRU 1G3CA 3IWMA 2BY8X 1P01A 5E2PA 2A2XH 1LVOA 1V2MT 3TJNA 1DT2A 1FY8E 3RLWH 2PSYA 1HUTH 2CV3A 3ZZ7A 1GHAG 1ZSJA 2FI5E 2ESTE 2WYJA 3PLKA 1IAUA 1UTQA 6CHAB 2STAE 4LZ1H 1O0DH 4NZLA 1GJ6A 3R3GB 2FMJA 3DA9B 3PWCA 4K8BA 3GY6A 3SN8A 4AOQA 3A82A 3SJOA 1P9UA 2QGRA 1MUEB 3GY5A 2YNBA 2ZU5A 5J4SA 4MDSA 4K1TA 1O2OA 4BXSA 4IC6A 1SHHB 1V2WT 3FAOA 1ELFA 4I7YH 2ZU4A 3EGKH 2BDYA 3M7TA 4JZ1A 2OBOA 1CT2E 2SGPE 1FV9A 2P8OB 2THFB 1GHVH 4KTCA 1QRZA 4YO9A 4Y79A 4CRAA 1ZTKA 4OGXA 4LK4A 1A0JA 1O2VA 1GJ5H 3A7VA 2H2ZA 1GJDB 4OS4A 3M5MA 1DUEA 5GDSH 1KSNA 1PYTD 1F0UA 1BRAA 1HAOH 3AVZA 7KMEH 1UTJA 2SNVA 1K2I1 7GCHF 2VIPA 1N8OC 5FPTA 2RA0A 1GBHA 1ZJDA 1NFUA 2NU3E 1QA7A 2ZGHA 4NSYA 3GCTF 1EXFA 1GJ8B 1G3EA 3RXBA 2BDCA 1HJAC 1PJPA 3SI4H 2ZA5A 3UOUA 1XUGA 3GCNA 1O35A 1SGRE 2ZHQH 5C3NA 5EQQA 1O5BB 1GI7B 1GBAA 1OXGA 4WXIA 2HPPH 4Y10E 4Y8XA 1ANBA 5HXFA 2GCTB 1O5AB 1TNLA 3PTBA 2PKAA 2ZIQH 1UTLM 2W3KA 3PO1C 3PMAB 3AW0A 3RXRA 1NESE 3IG6B 1A5GH 1MCTA 3EE0B 1ZRBA 1W14U 1ZMJA 1CGIE 2FOCA 1UTMA 4YLUA 5T6GA 2ZQ2A 5GPIB 1OYQA 1SI5H 1MU6B 6CHAC 2ANWA 1QL7A 1MTVA 1QNJA 1AO5A 1AUTC 2Q6FA 1Y3UA 1EAXA 1O2XA 1YPMH 1EQ9A 1ZTLA 2BDHA 3M5LA 4ISHH 1C5PA 4MPUA 4X8TH 1ZYOA 3SU1A 2Y81A 3KEEA 3QZQA 4AYVB 1B7XB 3MO9A 4NG9H 2GT8A 3M3SA 2TBSA 4IW4E 3SNDA 3STIA 3QK1A 4TPIZ 4DG4A 1L1JA 2ZFSA 3MFJA 1IQGA 3H7OA 3M61U 1ETTH 1P2KA 4WMEA 4B75A 1HBTH 2F83A 6GCHG 4SGAE 1O3MA 3A8DA 3RXJA 5LPEA 1OKXA 3TU7H 1C5QA 1BTHH 1MTSA 1PPGE 3EA7A 3H7TA 2A32A 5K0HA 1MTUA 2Y5HA 4BAKB 1QRXA 2OTVA 3S7KB 1BITA 2C8XB 1OWHA 2ZFFH 3BTME 4FUHA 2BD3A 1KXBA 2FOBA 3MI4A 2HNTC 3RUOA 1SFQB 1EZSC 1FI8A 2CJIA 3TJVA 1ETRH 2PKSB 1XUFA 1GI6A 3ENSB 2Z9JA 3RP2A 1GBEA 1NRNH 1OP8A 1C5OH 3SU2A 1MAYA 1VCPA 3A80A 1ZHRA 1O38A 2UWPA 1IQIA 1BRBE 4BNRA 2BX3A 3UNSA 2BY9X 2GGVB 1KIGH 3BG4B 1CVWH 1A61H 1G2LA 1QB6A 2H5DA 2C93B 1C5VA 1FY3A 1IHTH 2AERH 1O3BA 1HXEH 1GBTA 1MMJN 4MPXA 1N6YA 2G8TA 4NA7A 2KAIB 1TB6H 1C5NH 1C5XB 4XSKU 2GX4A 4AB8A 3A7WA 1EPTC 1S81A 3SU3A 1SB1H 1SFIA 1BJVA 4YOGA 2R3YA 3UR9A 4O3UA 1B0EA 3C27B 1AWHB 2QXHA 3HGNA 3B23B 4MNXA 3CS0A 1FY5A 1RIWC 2ZPQA 2V3OH 4E05H 5HGGA 1EX3A 2HGTH 1O3IA 2J92A 1ANDA 1C1WH 1DS2E 2GMTB 3BTFE 2A4RA 1BTUA 2RG3A 3BG8A 1T32A 2LNCA 1G3DA 4X1RU 3D23A 1IQLA 1EZXC 3RXKA 3SW2B 3ODFA 3GISB 5EPNA 5A09A 1P9SA 1PQ5A 4WF8A 5AHGH 1HFDA 3SV8A 2CF9H 4NCYA 2FEQH 2QC2A 1JIRA 2AFQB 2VWMA 1HGTH 1YYY1 3RXMA 3A89A 2HOBA 3TNSA 1V2UT 1LMWB 5DP3A 3TK6A 2V35A 5A8YA 4RN6A 1QB1A 5EXLA 2PKSC 1S0QA 3OYPA 4LXBH 2GVFA 1F5RA 3M7UA 1AD8H 3BTWE 1SMFE 3U69H 1EPTA 5FX6A 1O2YA 1D3PB 1QJ6B 1K9OE 2CF8H 1DOJA 2B5TB 3S7HB 4J1YA 1C1TA 3E0PB 3VGCB 2F9OA 3E91A 5T3HA 1DLEA 4GSOA 1W8BH 1TNJA 1O3HA 2WPMS 2Y7ZA 3GCHC 4GCHG 2PUXB 1DM4B 2FLRH 5DP6A 3F6UH 5F03A 1WTGH 1ABIH 1FZZA 1FAXA 3GDVA 3P70B 4ZHMU 1DSUA 1GDQA 4RSPA 3SNEA 1LHEH 2WV5A 3O8BA 1C2HA 1C9TA 1TQ7B 7ESTE 2G5NA 1ELGA 2BD2A 4Z6AH 2W26A 1KTTB 1O2WA 1O3LA 3GCOA 3LJJA 1INCA 1NU7B 2BM2A 1C2MA 1EOLA 3ZVBA 1C2DA 2SFAA 2WV4A 1BMNH 1MU8B 2F9NA 1AWFH 2Y7XA 3I78A 1C1VH 2J2UA 1F0RA 2PV9B 5GWZA 3MO3A 4YT6H 1WOFA 4IMZA 2OUAA 1SL3A 3RXLA 2CXVA 3MH5A 2BOKA 1HLTH 2VWLA 1OPHB 4ASHA 1O5DH 1VJAU 1ESAA 3S69A 1K1OA 1EAIA 3T27A 1A1RA 3ZVDA 2ZPSA 2B8OH 1UK4A 2ZU3A 4ZXXH 2XNIA 2Z7FE 1VITF 2XC4A 1C1SA 1O2TA 2QIQA 1RXPA 5A0CA 3L6PA 4MQAA 1SLWB 3TNTA 5A8ZA 1Z8IB 4ZXYH 4ZKSU 1J17T 1P03A 4O9VA 3S0NA 2Z3DA 3P17H 3RLYH 4K3JA 3SUFA 4AB9A 2KAIA 3ESTA 4UE7H 4WMDA 3PLBA 3AAVA 4KELA 1LDTT 5F8ZA 2AMPA 3DFJA 3UQOA 3BTHE 1OWEA 4HZHA 1XXDA 2STBE 1ZJKA 2BLWA 1C2FA 1D9IA 1TMUH 1QR3E 3E16B 1LVYA 1O2IA 4FUDA 2PTCE 4X6OA 3RXVA 3RXQA 4O3TA 3T25A 3SNCA 1ZSLA 3TK5A 1TOCB 3KHVA 3PMBB 4AG1A 3FVFB 3R0FA 3GY2A 1BTXA 1HCGA 4ABAA 1HAPH 1DXPA 3TJUA 1GJAB 3FP8E 2GP9B 5C1UA 1P11E 1TPPA 1UVSH 1CHGA 2FWWA 1K21H 1LVMA 2BXUH 1ELTA 1LHFH 1YPKH 1UHBB 1MCVA 1BMAA 4YESB 1O2HA 3ODDA 3SNAA 1TNIA 1TRYA 3G01A 2J95A 3SV7A 3RXOA 4JCNA 1ZLRA 4CHAB 2ZHEH 4J2YB 1LQDB 2BD9A 1ELEE 2BDBA 1L4ZA 5EG4A 4IBLH 3V12A 3SHAH 2AIPA 1K1NA 1TBZH 1ORFA 3MNCA 4FUGA 3QLPH 1WCZA 2VWNA 4AORA 1CA0B 1EAUA 1LCYA 2ANKH 2F9PA 1GBJA 3NZIA 1SOTA 2AS9A 4RKOB 3VB4A 5JB9S 1YCPK 2UWLA 1CQQA 4OS7A 4Y8ZA 4AN7A 1GHXH 1JOUB 3I77A 3RMLH 2ILNA 1H8DH 3PB1E 3FP7E 2WPHS 2G4UA 1CHOG 1NZQH 2FOEA 4NIYA 4NWKA 5JBTA 1C2LA 3LT3A 2FTLE 1C5UA 4X2WA 3ZV9A 1V2JT 5DP8A 4AFUA 3LGWA 1P2JA 1K1JA 4KGAA 1P8VC 2GDDA 3LPRA 1NY22 3A84A 1QBOA 1ID5H 4UFDH 1V6DA 4BTUB 4B1TA 3M35A 3RXEA 4X6PA 1DWBH 2FXRA 2BY5X 1E0FD 4X1QU 3BTQE 1MBMA 3NUMA 3RXPA 3JZ1B 1G30B 3NPSA 1GCTC 1EB2A 2BZ6H 3ATKA 3V0XA 3RC6A 2ZQ1A 5A8XA 2G55A 4NWLA 4DIIH 1C1PA 3FANA 2P3FH 2FS9A 4NIWA 4X8VH 4A1XA 4B2CA 3NK8A 3DHKH 2JH0D 1YPJH 4JK5A 1SGDE 2A2QH 4JYUH 1GBIA 2HALA 4X6NA 1F92A 4D9RA 3DD2H 1GMHF 4NZQA 4K60A 1BRCE 1SGTA 4K8YA 1C2GA 2ZHDA 2A7CA 3RMOH 4CHAC 1T8NA 2Z9GA 4NA9H 4CBOA 1C5TA 3EQ0H 2IJOB 1WQVH 1E34B 1O2JA 1O5CB 2BQ7B 4X2YA 2VNTA 1CT4E 1ZR0A 5DP9A 1V2TT 4MTBA 2IOTA 3WY8A 4Q7ZA 1C1OA 1Z71A 1JWTA 3MU5A 1HAHH 2HRVA 3KQDA 1A0LA 1N8OB 1TX6A 2HLCA 1V2KT 1EZUC 3PMJA 3BTTE 3ZZBA 1K1PA 2P93A 3F1SB 4MNYA 2J9NA 3I29A 1HJAB 1O5FH 1TOMH 2NU4E 4MG3A 4TYDA 2ZTZA 1O2SA 1QA0A 3QTVH 1A5IA 1RTLA 4WJG2 2OQUA 3RXSA 1H4WA 1LO6A 1FPCH 1VR1H 3PO1B 2TPIZ 1ZMLA 3M7QA 5ESTE 3RM0H 1UO6A 1A46H 1A3EH 1UHBA 1GVZA 2OC0A 4IGDA 3PMHB 4M7GA 4ZUHA 1GHYH 5DP4A 3SQHE 1HAGE 1O3OA 1IQKA 1T4UH 1BT7A 1TE0A 5BPEA 4X1PU 1KXAA 1SR5C 3FZZA 2SGEE 1T8MA 2NWNA 4FVBA 4X1NU 1GL0E 2EI7A 5ETXA 2ZF0H 4DIHH 1GI1A 1P2IA 1TGNA 1PQ8A 1UTOA 4BTTB 5A2MH 1ARCA 1GL1A 3SU0A 2HVXA 3RXUA 1YF4A 3ATWA 4Q7YA 8GCHF 1SGPE 1IHSH 1OOKB 1AGJA 2P3UB 4E06H 4HFPB 1DWDH 3BSQA 2Z3EA 4FU7A 5DG6A 5G4BA 1DX5M 2VWOA 2VINA 4ISLA 1UMAH 2OCVB 2GV6A 1SHYA 3VXEH 1S85A 2GZ7A 1EASA 1S84A 3MNSA 4Y71A 3QGNB 5AF9H 1GPZA 4VGCC 1P04A 5DP5A 1DITH 2F3CE 1TBQH 3U8OH 2SGQE 1KXEA 4H6TA 2C3SA 3OSYA 1BZXE 2VH0A 4H6SB 4X6MA 2FOMB 3E1XB 1VZQH 3K9XB 3QX5H 2ANYA 4HTCH 1G32B 1RS0A 5EU8A 3MH7A 4AG2A 2BY7X 3LGVA 5F8TA 4BAQB 4SGBE 2PLXA 2BDAA 1P2QA 1GBMA 3STJA 5K7RA 1KDQA 2AMQA 8LPRA 1QY6A 1BJUA 1GBLA 1TMBH 1AQ7A 5F8XA 1GHZA 3BIVH 3PM3A 5FHTA 2H9EH 3UWJH 2Q1JA 3HPTB 2J4IA 4I8JA 4NFFA 1GI5A 4UEHH 1RGQA 1O2RA 5IYTA 1V2QT 2F91A 1KLIH 2R2MB 3ELAH 3K65B 1SLXB 5GCHG 3S9CA 2BVSH 1EPTB 4ABJA 3RXHA 4ABIA 3K2UA 1VJ9U 1GBKA 4K2YA 1Y3VA 4X8UH 5E8EH 3RU4D 4D7FA 5DK1A 1THRH 1UK3A 1RIWB 3UPEA 3NCLA 2JKHA 4D9QA 3ZZCA 3SNBA 4AFSA 1AVXA 1HAXB 4I8KA 1O3PB 3UIRA 3VXFH 2BQ6B 2FYRA 1P3CA 4KTUA 1QRWA 5JDUB 1GI3A 1NPMA 3SV6A 2SGFE 2Y6TA 3LGUA 3ZYEA 4KP0A 5DPAA 3ZZ6A 3ZZDA 4B73A 1GHBF 4B76A 1A7SA 4DCDA 3A86A 1TALA 4NFEA 1FPHH 1DFPA 1AVGH 2Z9IA 2XBYA 1AIXH 1BIOA 1O2ZA 5AFYH 3RXGA 4Y8YA 1AKSB 3LGYA 2NU1E 1ANEA 2QA9E 1S82A 1V2VT 2VJ1A 1IQNA 4AX9H 1G2MA 3QDZB 1BQYA 1EP6A 2C8YB 2TGPZ 4XDEA 3HGPA 1GI9B 2UUJB 1J14A 3Q3KA 3VEQB 3SJIA 5C20A 3O8RA 1HPGA 5CHAC 1PPZA 2DUCA 4NA8A 1FIWA 1C4U2 2O8UA 4JZEH 2Z94A 2IPHA 2ANMH 1TX7A 2QAAA 3ZZ3A 3W94A 1GJBB 1AZ8A 3Q3YA 4AFZA