5LPFA

Kallikrein-related peptidase 10
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
203
Chain Sequence
PCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDQGEQLRRTTRSVVHPKYTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTANKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Kallikrein-10
publication title Structural basis for the Zn2+ inhibition of the zymogen-like kallikrein-related peptidase 10.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 203
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2016-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpfA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpfA02
3ZVGA 1MU8B 1LPKB 3MU5A 1O3AA 4RN6A 2QYIA 3QUMP 1UVTH 1ZTLA 3RU4T 1KYNA 1V2JT 2CGAA 2WPKS 1ESAA 2AGIX 2SNVA 4YESB 1SBWA 3S9AA 1HAVA 5EOKA 3EDXB 2PR3A 2XYAA 4I8HA 4UD9H 1HDTH 3LJJA 1OWEA 1SG8B 3R0FA 1EOLA 1EX3A 1TGBA 1ZSKA 3DFJA 3LOXA 4ASHA 2OBQA 3RLWH 1D9IA 3P8OA 5JYIA 1B0FA 3LGWA 1BRBE 3UPEA 1LVOA 1DWDH 3K65B 1ABIH 3DFLA 8GCHF 2EA3A 5JBAS 3RC5A 3RXGA 4AYYB 3DD2H 2GMTC 1V2LT 3QX5H 4F49A 1RIWB 2CJIA 2BOKA 1P01A 4JZIA 2HVXA 1ID5H 1ZGVA 1JWTA 3IG6B 3UTUH 2B0FA 1HAGE 1GJ8B 3LDXH 5FCKA 4H6TA 3TH3H 1D6RA 1O3KA 4H4FA 5EW2H 2C8ZB 3RXIA 3U9AH 1ANEA 1CBWB 2ZFPH 4U01A 1JMOH 1G3CA 2XBXA 1A0JA 2RA0A 3ZZ6A 3KGPA 5EQRA 1XVMA 4MNWA 2HWLB 4CH2B 4ABDA 4ZUHA 1S6HA 4Y6DA 1JBUH 2ZCLP 3MH5A 1K1MA 3BF6H 2V3OH 3OSYA 5DJ7A 1GBTA 1QJ1B 1QRXA 2FTLE 2QAAA 4XOJA 3GCHC 2W3KA 1OWJA 4JZDH 4CRBA 3TGJE 2D26C 1BTXA 3VGCC 3C27B 3GY4A 2VVCA 4XSKU 1C1SA 2UUFB 3LT3A 3VEQB 2BLVA 1P04A 2ZI2H 3UR6A 1GI1A 5FXLA 2V35A 2ANKH 1ZYOA 1W0ZU 2ZFFH 3E6PH 3T62A 3MU1A 1T8LA 1XX9A 3TVJB 5C20A 5I25A 2SGEE 1KXAA 3M5LA 1ZLRA 3PMJA 5F8XA 1HAOH 1DPOA 2ZQ1A 2ZNKH 4BNRA 1FPHH 1O5FH 1GMHG 1C1WH 2Z9KA 1S82A 2OQ5A 2O9QA 3B8JA 4FU9A 1FLEE 1RTFB 1ZTKA 4J2YB 3HKJB 5DP3A 3FP8E 1B7XB 1GBMA 1UK3A 3O8CA 1GHXH 1FPCH 1S0QA 4K60A 1MKXK 1UHBB 2BLWA 1BIOA 1TABE 3RXLA 3O8DA 3TH4H 4HZHA 4NA9H 4JZ1A 1SQTA 4Y8ZA 3SU2A 4A92A 2WYGA 2GT7A 1WUNH 3NKKA 1YPHE 2EC9H 1O3EA 1C5UA 7GCHF 4LZ1H 1O2XA 1TBRH 5HGGA 3RXEA 1GVKB 3D23A 1JIMA 4TWWA 2BDHA 4KTUA 1CBWC 1F0RA 3MU0A 4BTIB 3P70B 2VH6A 2F9UA 2VU8E 3MNXA 2KAIB 4FUIA 3OTJE 3ZZ4A 2Y80A 1JRSA 1RGQA 2FOEA 1SHHB 1WCZA 1TIOA 1NFYA 5JPMH 1XKAC 5JBBS 1F2SE 1ETSH 2HPPH 3I77A 3MTYA 5DK1A 1H9LB 4I33A 1C1OA 5JBCS 3HATH 3LIWA 2GVFA 5CE1A 1GMDF 1CSOE 1O2WA 3NWUA 1L4ZA 3MHWU 1F0TA 1NU7B 1HAZB 4B71A 1EOJA 4X8SH 2FIRH 3ATKA 1EAWA 4LK4A 4KELA 1FIWA 1LKAA 4JZEH 1LCYA 1PPGE 3V3MA 4Y8YA 4ISLA 5FAHA 3MNBA 2Z9LA 4ZHAA 1TNIA 3ODFA 3Q77A 1O3PB 1TA2A 1P2MA 3NZIA 1O3HA 1OSSA 1VITH 2ZHEH 1C5YB 1BTWA 1GJ9B 3SJ8A 1M9UA 4DURA 1FY1A 2GCHG 1BMNH 3QTVH 3P8GA 1QB6A 1OWDA 2SNWA 4MVNA 2UUKB 3BN9A 5EXNA 3A7XA 3Q00A 4KKDA 1T4UH 5FBEA 1HAVB 1O2IA 4Y76A 2B5TB 1W7GH 1EUFA 2Z3EA 2F91A 1Y3WA 2C8WB 2IN2A 4DGJA 4O3UA 2ALPA 1ZGIA 1G37A 1GCTB 1O3BA 3S7KB 3A88A 3U8OH 2G4UA 4BAHB 2R3UA 1OOKB 4JK5A 1T8NA 4B76A 3RMLH 2FLBH 5L6NH 5FX5A 1T32A 2CF9H 3ZV9A 1WAYB 1KXBA 1C1RA 1D4PB 1HFDA 2R0KA 4Y8XA 2A1DB 4I7YH 4A1VA 1FXYA 1O2TA 3BTKE 1AIXH 3SV6A 4NGAH 1LMWB 1NU9A 1S85A 2JKHA 1D3QB 4HI3A 4CRDA 3RM2H 1HGTH 1FQ3A 5G4BA 1GHVH 3FP6E 3BTEE 1GBHA 3A8BA 4DIIH 1DDJA 1XUIA 4UONA 4AN7A 3ZZ3A 1UTOA 5DP5A 1SGNE 1AE8H 3M7QA 4OS4A 1GMHF 2FESH 1AFEH 1V2RT 1TBZH 4CRAA 3S0NA 1C5SA 4MTBA 1FAXA 2OLGA 2NU0E 4X1QU 5LPEA 4OS1A 1Y3VA 1SGQE 4O97A 1LVMA 1DWCH 3BTGE 1HXEH 2FM2A 1E34B 4FUDA 4WH8A 4NCYA 2ZFRH 1N6XA 2PUXB 4X2VA 3BEUA 1UVOA 1ELCA 2O8MA 4ZAEA 4M7GA 1LVBA 1T31A 5EG4A 5IDKA 4I8KA 1EQ9A 2W3IA 2FZZA 5DP6A 3PMHB 2V0BA 3D49H 2ZO3H 2Q6FA 4RKJB 2CHAC 1YPKH 5EQQA 5PTPA 5EXLA 4Y71A 3A80A 1VCQA 1G32B 4ABGA 1EKBB 3ATIA 2VWMA 1V6DA 1O2QA 2ODPA 3SQHE 4TY7A 2PKSC 2GV6A 1TX7A 1NRRH 4VGCB 1O33A 2W26A 1NZQH 2FOAA 4F4OC 1GMCF 2R3YA 1K2I1 1GHAF 1P2OA 3MH4A 2AIQA 3PWBA 1FI8A 1O2GH 1AY6H 1TALA 2R0LA 4MG3A 3M5OA 1HXFH 4JYVH 5HXFA 1G2LA 4BAMB 1GI3A 3F9FA 3Q3XA 1GCTC 1RTKA 2JH0D 3AASA 2AMDA 2FWWA 3EA8A 2C4FH 1ARBA 3P6ZB 2P94A 1DSUA 1GL1A 3KQEA 1VZQH 5EGMA 1XUKA 4CBOA 2TGTA 1GL0E 3TNTA 2NU4E 5DP7A 4OS6A 3HGNA 4BXWA 4YLQH 2GD4B 3SNEA 3RXOA 1LQEA 3HK3B 1CGJE 1LHGH 4NFFA 3L33A 1ESTA 1BUIA 1ZHRA 1O2KA 3VB6A 1DE7H 2BY8X 1TGCA 2WPMS 3P8FA 4CRFA 4NZQA 2ZIQH 1J14A 4GPGA 4Y7AA 3GY3A 2GZ7A 2O8LA 1HRTH 2VGCC 1CO7E 1PYTC 1TX6A 3E90B 3TK5A 1NESE 2BM2A 2Z9GA 1W14U 2XRCA 3IITA 2F9VA 2WUBA 3UREA 1RFNA 2P95A 2SGQE 5TCAA 4D7FA 1MUEB 4O3TA 3SV8A 1P10A 1C4Y2 2CXVA 4Y7BA 2WINI 1SOTA 1UJ1A 2A5KA 3BSQA 2VB0A 1IOEA 1L4DA 1C2GA 2BY9X 1PQ5A 1OP0A 1AO5A 1LKBA 1HJ8A 3PO1B 4I32A 3SU0A 1C2HA 4YT7H 1BMAA 2FOHA 1V2TT 3ZYDA 1ZSLA 4IMZA 1GBKA 3VXEH 2ZDLA 3GCTF 8GCHG 2BD7A 4AG2A 1TPOA 1C5MD 4B2AA 3PB1E 4AG1A 2PWXA 3ZZ7A 2H9EH 1GDNA 2BD5A 3GY8A 9LPRA 1AB9C 3RXRA 1RD3B 1YCPH 3TIUA 1ANDA 5LGOA 6CHAC 2BB4A 1ZMLA 1KXCA 1ZPZA 4DW2U 1C2KA 1P9UA 1DANH 1N1LA 2OTVA 2ZCKP 1DT2A 3LKWA 2ZTYA 3E8LA 1PQ8A 4CHAC 3PROA 2C90B 4B73A 4MDSA 3RXAA 1FMGA 4ZHLU 2J4IA 2HGTH 1TOCB 4FUCA 1YLCA 2Y7XA 1UMAH 2R2WU 1IQNA 1GJDB 3OYPA 4AFUA 1O36A 5FPTA 1GHYH 5T3HA 3GDVA 1V2QT 2SFAA 4K1EA 1A46H 1O2MA 2XWBI 1UHBA 1E0FD 5F6MA 2J38A 2EEKA 4OGYA 2ZCHP 3SHAH 3RXUA 2QV1A 3GYLB 3A8AA 3UOUA 1O5GH 2F9PA 3RXDA 2G52A 2Y82A 1SPJA 1PJPA 2JETC 3RXMA 3T27A 4XBCA 1HIAA 2KAIA 1O3JA 3VB3A 3ZVCA 4A6LA 3CP7A 3AW1A 3M7UA 1LDTT 2AERH 4K1SA 3S7HB 3UWIA 3NK8A 5C2ZA 3UFAA 1C9TA 1DWEH 2VIDA 1UTQA 1MMJN 2FI4E 4ISIH 5C1XA 1MAYA 1Z1JA 1QCPA 1GJBB 5T6DA 5GJ4B 2A2QH 4MLFB 3A85A 1ZOMA 1NROH 2A7JA 1C2EA 4K8BA 4NA7A 4NWLA 1SQOA 1XUGA 3E0PB 1C9PA 1K1OA 1MD8A 4LXBH 1P02A 3LC3A 3PO1C 4IN2A 2VIWA 2ZGHA 1XXDA 3W94A 1N8OB 1ZR0A 3MU8A 3PV4A 3MO6A 1J15A 1GBBA 1H8DH 3E16B 1YPMH 5A0BA 2ULLA 1GWAA 1G36A 3GYMA 2ODYB 1C2LA 2VWLA 1GBJA 1C1VH 5DKMA 2OCVB 1MKWH 1GHWH 1P9SA 5F8TA 1HYLA 4LZ4B 5DPAA 1C5XB 3D62A 7KMEH 1FN8A 1O2JA 1GI5A 3SI4H 3VFEA 1QR3E 1SSXA 1O0DH 2ZPSA 1BJVA 7GCHG 3U1JB 1QQ4A 1PPBH 2QN5T 1VGCC 4GSOA 4I8LA 4JK6A 4DT7B 4THNH 1EAUA 1O31A 1TRMA 1QBVH 3GY2A 4AB9A 1TYNA 2DE9A 3SNDA 1BCUH 2FS9A 4IBLH 1A3EH 1GI8B 1LPZB 5EODA 1O32A 1DOJA 1GI9B 4BANB 4X6PA 4BAKB 2LPRA 4ZXXH 5HM9A 3ATMA 3MH6A 3LGTA 2HALA 3DUXH 1EAIA 1AUTC 1TMBH 2GZ9A 1ANCA 1GBDA 3A7TA 3PTBA 3SO3A 4NA8A 2B7DH 1W2KH 1GI7B 1AVGH 1JRTA 3A8DA 3BG4C 2ZGJA 1G3EA 4X2WA 1GGDB 3FANA 2P3UB 1GMDG 1O3NA 3E0NB 4A7IB 5C5OA 2PGQB 1C5OH 5FX6A 1TNGA 4X1RU 1EASA 1C5QA 1T7CA 1GDUA 3UIRA 2B8OH 1YPGH 1MQ6A 3V13A 3AW0A 1FY4A 5BPEA 1JOUB 1GVZA 2BDBA 3LGYA 1P2QA 3TITA 2HNTC 1ZPBA 2G81E 2C8XB 4E05H 1ZRKA 2Z94A 4TPIZ 1O3CA 1C2IA 1JXPA 2UWLA 2IOTA 2PGBB 4AOQA 4NZLA 1DFPA 4IC6A 1GBAA 2ZG0H 4H42U 3BTHE 4X6MA 3M5MA 2BVXH 1SGFG 3U69H 1ZRBA 4B2BA 4CRCA 2ZP0H 3FFGA 1EXFA 1OP8A 1BHXF 2BDIA 5HMAA 5ESBA 1TQ0B 3HGPA 1YCPK 2THFB 1N8OC 1KLJH 2BXUH 3DT0H 3GY7A 1GBFA 3N7OA 4Q2KA 1EPTB 1P11E 2HRVA 1QTFA 3F9GA 1O5CB 3E1XB 1O3IA 2ASUB 5E0GA 1ELVA 1SGFA 2AIPA 1ELDE 5EU8A 1ELAA 2FOBA 3HK6B 2FI3E 1BA8B 1C4U2 3ZVFA 1O2YA 1QL7A 2PUQH 1UTJA 1AWFH 1C5TA 3HKIB 1SB1H 3SGQE 3K6YA 1LO6A 1F92A 3A87A 2VWNA 2BZAA 3LJOA 1O3FA 4ZROA 2XBYA 4K2YA 4XFQA 3PMAB 3ZVAA 1TBQH 4J1YA 2FYQA 1MTSA 1BTUA 2BTCE 1S84A 1C5NH 3OY6U 1S83A 1D6WA 3K9XB 1GHZA 3LH3A 3V0XA 5TCCA 4WMFA 4D8NA 2XC0A 3ODDA 5JB9S 4UFEH 3VB5A 1THSH 1BB0B 1YPEH 1GGDC 3KCGH 3ATLA 2G5NA 1TPAE 1QQUA 4DG4A 4CH8B 5A0CA 1MZAA 3RXKA 2V3HH 1NT1A 2QF0A 2A0QB 3LPRA 3CS0A 2AEIH 2Y6TA 1OP2A 1O2VA 1SHYA 1W10U 3SUEA 1EZUC 5JDUB 3Q3YA 5DP4A 3SBKA 1G2MA 3BTTE 5GCHF 2C8YB 1BRCE 1HIAB 4GVUA 2SGPE 3RXPA 1PPZA 1QRWA 1S5SA 1H9IE 3PLPA 1MU6B 1HAYB 5F03A 1BHXB 1K22H 2QXGA 1F5KU 2HPQH 2OC8A 1BTHH 2OUAA 3M3TA 2Z6BD 4YTAA 1SGYE 1MKWK 1MZDA 1GMCG 2A4OA 1W3CA 1GHAG 1V2VT 4E7RG 1UTPA 4MNYA 2ANYA 1NTPA 5A0AE 1A5HA 1DITH 5A8XA 4B2CA 4BTTB 1Z8GA 2VVVA 3V7TA 1IQIA 2OC1A 1WSSH 2QF3A 3H7TA 5GIBA 4ZMAH 1NRSH 2WPIS 3RXJA 2FPZA 1IQEA 2ZFTA 1WQSA 1EPTC 1BJUA 3AAVA 1DICA 2P8OC 5ABWA 2VIPA 1AKSB 4GHTA 1ZJDA 4MQAA 2CHAB 3RMMH 5L2ZH 2AFQB 1FY8E 2BY5X 3SU1A 2ZHWH 6LPRA 2XTTB 5FPYA 1O37A 1QJ7B 2WPLS 1ELFA 4CREA 1BBRH 4Q7XA 3VB7A 4BTUB 2ZPRA 1BRAA 3M5NA 1INCA 1LTOA 2PKSB 1HJAB 3RXVA 5C67A 3TGIE 1QIXB 1BTYA 1O2NA 3SJIA 3U1IB 5FBIA 1WU1A 2FTMA 3M3SA 3PTNA 2TGAA 2OP9A 1J9CH 3KL6A 4JZFH 1SFQB 4X6OA 1Z6EA 4Y0ZE 2W7SA 1L1GA 1O2RA 4FVBA 4MPVA 3ZZDA 4AGKA 2XC4A 2XC5A 1AUJA 3LU9B 1TFXA 4Y11E 4ABBA 4D76A 4YOGA 2ZGCA 3L3TA 1BRUP 4LOYH 2PSXA 3SI3H 2A4QA 3ZVBA 3KQBA 1UCYH 3ZVEA 3C1KA 3VPKA 3UR9A 3SU5A 1DXPA 2TBSA 4DOQA 1SLXB 1EATA 3QZRA 2OC0A 1GJAB 5C1UA 3T2NA 1W8BH 2PTCE 3A7YA 4I8JA 3SV2H 3F9HA 1QBNA 2PTNA 3LGIA 4XBDA 3ZZBA 4WY3A 1SLUB 2ZKSA 3GCTG 3TNSA 2H2ZA 1RTLA 2C3SA 3SQEE 3ZYEA 2CMYA 2VGCB 2BD8A 2Z9IA 1IHTH 2G5VA 3K2UA 2FLRH 1HBTH 3EAJA 1RXPA 2FX6A 3ESTA 9ESTA 1TOMH 2SGAA 3T28A 3KEEA 1P8VC 4AORA 1TNJA 1BMLA 1LVYA 2AS9A 4ZHMU 2OD3B 2ZGBH 3ZZAA 1HAHH 1YLDA 3GDSA 1WOFA 5DP9A 3PMBB 4DVAU 1FY3A 1KXDA 4IW4E 1GVLA 2BYAX 3M61U 3M37A 4X8TH 1FZZA 2R9PA 2ESTE 3MI4A 1HV7A 2UWPA 3KNXA 5GPIB 3PM3A 3KN2A 3FZDA 5T6GA 4E06H 1P2NA 1H8IH 2G8TA 4ZH8A 1IQLA 2GX4A 1C5ZB 2HLCA 1MCVA 1LHCH 1AGJA 2QCYA 4K1TA 4RSPA 4FUGA 1SL3A 1P06A 1SGTA 4X2XA 3JZ1B 4YOIA 2K1QA 4IGDA 3SNAA 1DY9A 3SJOA 1A61H 1GG6C 2M5TA 2GCTC 2P93A 4BXSA 2GTBA 1AB9B 1TNHA 1HJAC 5ETXA 3P8NA 2VIVA 6CHAB 3WY8A 1HLTH 2ANWA 1THRH 2ZU1A 4FUHA 1AVWA 2BMGB 2TPIZ 2A5AA 2ZDMA 4CHAB 1HUTH 2BXTH 1Z8IB 2ZFQH 3NXPA 4ZKOU 1CHGA 1C1TA 2FO9A 1KIGH 1TGNA 1O2SA 1FY5A 2H5DA 3AVZA 4R8TB 4X1NU 2A4RA 2YOLA 1ZMJA 5A09A 2EI8A 1ZSJA 1SFIA 4PROA 2P59A 2H9HA 1RRKA 1F7ZA 3MWIU 1SLVB 1NN6A 1TLDA 1T8OA 2QY0B 2XW9A 1MAXA 1G30B 1GBCA 4KP0A 2FMJA 3A83A 3QGJA 4CR5A 2Z3CA 4GLYA 1MQ5A 2JETB 2ZDNA 3RDZA 3SJ9A 2CV3A 2ZQ2A 3B9FH 1W12U 1F0UA 1O34A 1IQFA 4NIWA 2H9TH 3SUGA 3QWCH 3IWMA 1BTZA 2ZGXH 5HM2A 2PSYA 5GXPA 4X8UH 2AMQA 2Z7FE 3A7ZA 4GHQA 1WQVH 5C3NA 1H4WA 4OGXA 3UUZA 2BVRH 3SNCA 1BOQA 2YNAA 1Q31A 1A5GH 2P3TB 2ZFSA 4TWYA 2BHGA 5AHGH 1YF4A 3LC5A 4I31A 1EPTA 1TB6H 2ZEBA 4WF8A 1WV7H 1KXFA 5EQSA 1N6YA 3SW2B 4QT8C 1K1LA 1F0SA 2R2MB 1L2EA 1O38A 3TJOA 3RC6A 4MPUA 4AYVB 4Z0KA 1PPFE 2BZ6H 1D3TB 2V6NA 4FUBA 1SLWB 1PFXC 3BTFE 1AZ8A 3GCOA 1A7SA 1VGCB 1AE5A 4Q80A 4KTCA 1FV9A 1QB1A 4AFZA 1AVXA 4WVPE 1TPSA 2NU3E 4FUJA 1WTHD 2FX4A 2STAE 5GDSH 3SZNA 2A31A 2BD4A 1VITG 3EE0B 3E91A 2ZC9H 1SOZA 1T4VH 5J4SA 1HPGA 3BG4B 3Q76A 2FP7B 3RXBA 1XUHA 1TGSZ 2C93B 2ZHDA 1CT2E 3SJKA 1KTSB 3T26A 2AGEX 1C2FA 4Q7ZA 5ESTE 1GPZA 1ORFA 5AF9H 4IN1A 1VCWA 2OXSA 3MNSA 3RP2A 1P12E 2FXRA 1EJMA 4ABFA 5J4QA 1KXEA 4BAQB 1SI5H 1GJ5H 1IHSH 2GDEH 2D2DA 1C1NA 4ISNA 2I6SA 1S6FA 1YPJH 1L1NA 2GP9B 1KDQA 1KY9A 3SV7A 2ZZUH 4SGBE 3RUOA 5HYOA 1KLTA 4KGAA 3OY5U 1ZJKA 1NFXA 1P09A 3BV9B 3EGKH 1C2MA 1CA0B 4UFDH 1BZXE 1LHFH 1ETTH 1QY6A 2G51A 1WYKA 4GUXA 4Y79A 6ESTA 2HNTE 1T8MA 2I6QA 3MU4A 1AU8A 2XWAA 2PLXA 2QC2A 2ZU4A 3F9EA 4IMQA 1S0RA 5A8YA 4ABHA 3BIVH 1AHTH 1AKSA 3UY9A 4DCDA 4B75A 2G55A 2GDDA 4AFQA 3TJUA 3VXFH 1BQYA 4Q7YA 1NM6A 1VR1H 1C4V2 4UFGH 3BTDE 1O39A 1E35B 1F5LA 3H5CB 1C1PA 1IQGA 1YPLH 4R0IA 1W11U 2H6MA 2B9LA 2BD3A 4X0WU 4GCHF 3MYWA 1NRQH 3ATWA 2H1UA 3RC4A 1QFKH 2ZA5A 1C2DA 1UVUH 1PQAA 4Z6AH 1W7XH 3MNCA 2OC7A 5GCHG 4UFFH 4SGAE 3U98H 2BOHB 1AN1E 2BLOA 2Q6GA 1NPMA 2P3FH 4D7GA 4WH6A 1W13U 3TU7H 1UVSH 3UOPA 4ISHH 1ESBA 1HJ9A 1O3MA 1XKBC 1Y5AT 1CGIE 2WUCA 2VVUA 4K69A 3SU3A 1E36B 2OQUA 3SNBA 4X1PU 1UTLM 1C5WB 2PFEA 1SGIB 1WTGH 1O2ZA 3A7WA 4MNXA 3UNRA 3UWJH 1YGCH 4CRGA 8LPRA 5LPFA 1GJ7B 1O2OA 1MTNC 5AFZH 1A2CH 2BD9A 3LGUA 2EI7A 2DE8A 8ESTE 6GCHF 2FOGA 2VH0A 4WWYA 1C1MA 1V2OT 3ZZCA 3GDUA 1RS0A 5H4IB 5L2YH 2ZWLH 5IYTA 1EZXC 4OS5A 4BAOB 1VITF 1CA0C 3MO3A 3E3TA 1QL9A 4IC5A 1J16A 3ELAH 1GBLA 5C5NA 1SGEE 3LGVA 1HAIH 1CHOF 7LPRA 3NUMA 5K0HA 5LH8A 3AAUA 1E37B 2BDYA 3FAOA 1YYY1 1IQMA 1LPGB 2W7UA 1P3EA 1QL8A 2A5IA 2P16A 4WXIA 1MD7A 1UO6A 2F9BH 2NU2E 3M3VA 3SV9A 1UK2A 5AVDA 1B5GH 3STJA 2BVSH 1AFQC 2ZU5A 2ZECA 4NWKA 2RA3A 2LNCA 1K1JA 2NU1E 3QN7A 1GDQA 3SUFA 1OYTH 1GHBF 2P8OB 2YNBA 4ABJA 1A1RA 1QGFA 2AGGX 4INHA 1QBOA 4K8YA 1TRYA 1K1IA 2XBWA 1V2UT 1YKTA 1EB2A 2UUJB 5FPSA 1CA8B 1AI8H 1MCTA 1UK4A 2QXHA 3A81A 7ESTE 4WMEA 4WJG2 2PKAB 3ZZ8A 5BRRE 1L1JA 1F5RA 1O5EH 1L0ZA 1YBWA 1FIZA 5AFYH 1OWIA 1P2KA 1O30A 2RCEA 1Q2WA 3V12A 3BTWE 4YM9A 3TJVA 2TRMA 2CF8H 5T6FA 3L6PA 2SGDE 3TK9A 3QDZB 1GJ6A 3LONA 1BT7A 4MPWA 3F1SB 1MTUA 4HTCH 3S69A 4DJZB 1HAPH 2Q1JA 3BG8A 5DGJA 3LH1A 1V2WT 2XCFA 2A2XH 1K9OE 4NSYA 3TH2H 5CMXH 1QNJA 3UQOA 2ZHFH 1FDPA 3GICB 2FDAA 3K6ZA 4FUEA 4ABAA 3O8BA 4AFSA 1V2KT 1P2JA 5LPRA 4O03A 3HPTB 3SOSA 2VNTA 2G4TA 3SGAE 3RXTA 1NY22 1ZTJA 5GWZA 4I8GA 1DUEA 4H6SB 2TIOA 1EJAA 1DSTA 5C1YA 3SU4A 4AB8A 1ZHMA 2F9OA 1Y5UT 4MNVA 1QURH 2TGPZ 1ETRH 2ZDAH 1RIWC 2BX4A 1BBRE 2J92A 3RMOH 2GZ8A 5FCRA 1FAKH 1O5AB 1SMFE 5SGAE 1TQ7B 2Y5HA 5A2MH 1XVOA 2ZDKA 1KDQB 2A45B 1P2IA 1NRNH 3EA9A 2AYWA 2XBVA 2OBOA 3GISB 4ABIA 1TONA 2H5CA 2BQWB 3R3GB 1YCPM 1GJCB 2ZU2A 1FONA 3OU0A 1FNIA 2WPJS 4NG9H 1Y5BT 1P3CA 2ALVA 1EJNA 3Q3KA 2A7CA 1BTPA 3RMNH 2F83A 1B0EA 1TMTH 5EPNA 2ZHQH 3GY5A 2UWOA 2FOFA 1UCYE 1U6QA 3RLYH 2IJOB 1HNEE 4HFPB 1V2NT 2O8TA 2Q6DA 4X8VH 1GBEA 2PV9B 4ISOA 1V2MT 1J8AA 1NO9H 1UVPA 1LHDH 1BDAA 4U2WA 5JB8S 1AD8H 2WPHS 2SGFE 2VIOA 1EZQA 1D3DB 1GG6B 2GCTB 3RM0H 1OXGA 2AMPA 4OS2A 4INKA 1ABJH 4X6NA 2BDCA 4K5ZA 1SC8U 1QA7A 1TRNA 4UDWH 1DLEA 4ZKRU 1J17T 1O2UA 3FP7E 4K3JA 1GI0A 2FS8A 1QHRB 1X7AC 4Y10E 1TX8A 3KQDA 2GGVB 2Z3DA 1BMMH 3KIDU 1WBGB 3MFJA 3QO6A 5DG6A 1HAXB 1OX1A 1Z8JB 1OWHA 1AWHB 8KME2 4U32A 3M7TA 2VIQA 3STIA 2XXLA 2QIQA 1QB9A 4NIXA 2WV5A 1Z8RA 1MTWA 2BQ6B 1MTVA 1VCPA 3T29A 1C1QA 1YPHC 1A0LA 2FOCA 3I29A 1OYQA 1MH0A 1UTKA 3GY6A 4YOJA 3A86A 3EQ0H 5E2PA 1YM0A 2DUCA 1AMHA 4AX9H 1ZMNA 4FU8A 2ODQA 3ZVDA 4YT6H 4B74A 1EAXA 2CN0H 1PQ7A 4NIYA 2RDLA 4XDEA 1OPHB 1YP9A 1KTTB 3OX7U 4D9QA 2Z9JA 5EXMA 3SORA 1NS3A 3KF2A 2Y81A 1CQQA 3RXSA 2A32A 5E2OA 4NSVA 1C1UH 4WXVA 2JH6D 2Y5FA 3RXCA 2J95A 1ELTA 1CVWH 2HOBA 2W5EA 1Q3XA 1Y3YA 1NRPH 3T25A 1C5PA 2BQ7B 2ZF0H 2BD2A 1O2HA 2WYJA 2FEQH 3W95A 1QRZA 2XNIA 1DX5M 3ZZ9A 1DUAA 2WV4A 3MMGA 3KHVA 4UEHH 1H1BA 2J9NA 1SGRE 1GJ4H 3BEIB 3JZ2B 4AGJA 1ARCA 4XBBA 4YZUA 1QA0A 2FODA 3QGNB 3A7VA 1AZZA 2VINA 3ENSB 1CE5A 3NCLA 1V2PT 2J2UA 3RU4E 1O3DA 1XM1A 3MOCA 3S9BA 3A84A 4OS7A 5E8EH 5K7RA 3H7OA 1TA6A 4GAWA 4JYUH 1G3BA 4TYDA 1SVPA 3VB4A 1CT0E 4ZKSU 2ZTZA 4ESTE 1DVAH 1Z71A 1GI4A 1SGDE 1GI2A 1DM4B 1Z6JH 4IS5A 4YO9A 1G3DA 3SGBE 5TJXA 1VJ9U 1ZPCA 1K1NA 1CGHA 2D1JA 1MBMA 1EZSC 4D9RA 1TPPA 4INLA 3URCA 2QGRA 5A8ZA 3UNQA 5EW1H 2ZDVH 1K28D 1QJ6B 3FVFB 3FZZA 1FUJA 4NFEA 1GI6A 1P57B 2A7HA 3EYDA 2F9NA 1EP5A 4NIVA 3MH7A 4A5TS 3T5FH 4RKOB 2Y5GA 1Z7KA 2QXIA 1C5VA 3PWCA 5CHAB 4TY6A 1FN6A 1NC6A 1O35A 5JBTA 1IQKA 5L30H 1O3GA 1O5DH 3DHKH 3MO9A 1K1PA 2NWNA 5EPYA 4MPXA 3DA9B 1TE0A 1Y59T 2GCHF 4AZ2B 3PLKA 3TK6A 3P95A 2O8UA 1IAUA 2RG3A 1O2PA 4GCHG 1ELBA 4FVDA 3ITIA 2ZTXA 1A4WH 1XMNB 3A82A 1DY8A 3QLPH 1G9IE 1O3LA 2Y7ZA 1BBRK 1THPB 1SGPE 1C2JA 1PYTD 1D3PB 1V2ST 1PPHE 2BLQA 2BDGA 1K21H 1IQJA 2JH5D 1MBQA 4B1TA 3F6UH 3U8TH 1GCDA 3P17H 2HNTF 3A8CA 4JYTA 4X1SU 2PHBA 4JMYA 1HCGA 1UTMA 3BEFB 5F8ZA 1ELEE 2VJ1A 4YLUA 1LQDB 2FYRA 3SUDA 1BITA 2PKAA 1W0YH 1TWXB 2QXJA 3M35A 2G00A 3M36A 3RU4D 4TPYA 5DP8A 6GCHG 1PPEE 1DXWA 2UUYA 1NFUA 1UCYK 3RXQA 1KLIH 2A4GA 3TJNA 1KSNA 3EA7A 2STBE 4O9VA 3ZZ5A 1P05A 1TMUH 4HGCA 3RXHA 2FI5E 4WMDA 1SR5C 1NFWA 3B23B 1FJSA 1ZHPA 3F68H 2ZU3A 1E38B 1OS8A 1TGTA 1DWBH 4JCNA 4A1TA 5DO4H 1XUJA 4ZKNU 1VJAU 4VGCC 1C5LH 1Y3UA 3D65E 1DS2E 1H9HE 1JIRA 3QTOH 1CHOG 3BTQE 1EP6A 3NPSA 1YC0A 4A1XA 5FHTA 1P0SH 1Y3XA 5E0HA 3U8RH 1C5RA 4KTSA 3URDA 2VWOA 1ACBE 3QK1A 2ZPQA 2BX3A 1OKXA 1ELGA 1A3BH 1MTNB 1PPCE 3G01A 4E7NA 1CT4E 1EB1H 5CHAC 2ILNA 1O2LA 1O5BB 3O8RA 1Z1IA 1GHBG 1ANBA 1AQ7A 3SU6A 2EI6A 1XXFA 4ABEA 1TNLA 3CENA 1UTNA 1Y8TA 2GMTB 2TGDA 3TGKE 1ZZZA 1RJXB 3UNSA 3PLBA 1OWKA 1TNKA 5I46H 4FU7A 1IQHA 1P03A 4X2YA 3KQCA 2OINA 1A5IA 2QA9E 2GKVE 2J34A 3P92A 3ZV8A 3BIUH 4UE7H 1LHEH 4DY7B 2ANMH 2XCNA 1MKXH 4FUFA 3QZQA 2BDAA 1AFQB 3BTME 4FXGH 1XUFA 2GV7A 3S9CA 3GOVB 1TAWA 2O8WA 3UQVA 1DLKB 1HB0B 1V3XA 4Y0YE 5E0JA 2PW8H 4CBNA 3GCNA 3I78A 5B6OA 3RXFA 4BOHA 4CR9A 2J94A 3TLOA 3TPIZ 3GCHB 2D8WA 4ZXYH 4U30A 1SQAA 3PYHA 1SGCA 2FOMB 2GT8A 2IPHA 3A89A 3SN8A 3VGCB 1S81A 2BY7X 3SHCH 1CU1A 1A0HB 3CS7A 4XE4A 2BY6X 4DIHH 1GBIA 1O3OA 2AH4X 2F3CE
chains in the Genus database with same CATH superfamily
1YY3A 3ZVGA 1MU8B 1LPKB 2KFWA 3MU5A 1O3AA 4RN6A 2QYIA 3QUMP 1UVTH 1ZTLA 3RU4T 1KYNA 1V2JT 2CGAA 2WPKS 1ESAA 2AGIX 2SNVA 4YESB 1SBWA 3S9AA 1HAVA 5EOKA 3EDXB 2PR3A 2XYAA 4I8HA 4OM9A 4UD9H 1HDTH 3LJJA 1OWEA 1SG8B 4TSFD 3R0FA 1EOLA 1EX3A 1TGBA 1ZSKA 3DFJA 3LOXA 4ASHA 2OBQA 3RLWH 5C0UA 1D9IA 3P8OA 5JYIA 4HG6A 1B0FA 3LGWA 1BRBE 3UPEA 1LVOA 1DWDH 3K65B 1ABIH 3DFLA 8GCHF 2EA3A 5JBAS 3RC5A 3RXGA 4AYYB 3DD2H 2GMTC 1V2LT 3QX5H 4F49A 1RIWB 2CJIA 2BOKA 1P01A 4JZIA 2HVXA 3DSOA 1ID5H 1ZGVA 1JWTA 3IG6B 3UTUH 2B0FA 1HAGE 1GJ8B 3LDXH 5FCKA 4H6TA 3TH3H 1D6RA 1O3KA 4H4FA 5EW2H 2C8ZB 3RXIA 3U9AH 1ANEA 1CBWB 2ZFPH 3OEHD 4U01A 1JMOH 1G3CA 2XBXA 1A0JA 2RA0A 3ZZ6A 3KGPA 5EQRA 1XVMA 4MNWA 2HWLB 4CH2B 4ABDA 3NRLA 4ZUHA 1S6HA 4Y6DA 1JBUH 2ZCLP 3MH5A 3H09A 1K1MA 3BF6H 2V3OH 2V3MA 3OSYA 5DJ7A 1GBTA 1QJ1B 1QRXA 2FTLE 2QAAA 2VBCA 3GCHC 4XOJA 2W3KA 1OWJA 4JZDH 4CRBA 3TGJE 2D26C 1BTXA 2IJD1 3VGCC 3C27B 3GY4A 2VVCA 4XSKU 1C1SA 2UUFB 3LT3A 3VEQB 1SKYE 2BLVA 1P04A 2ZI2H 3FO8D 3UR6A 1GI1A 5FXLA 2V35A 2ANKH 1ZYOA 1W0ZU 2ZFFH 3E6PH 3T62A 3MU1A 1T8LA 1XX9A 3TVJB 5C20A 5I25A 2SGEE 3DSGA 1KXAA 3M5LA 1ZLRA 3PMJA 5F8XA 1HAOH 1NBME 1DPOA 2ZQ1A 2ZNKH 4BNRA 1FPHH 1O5FH 1GMHG 1C1WH 2Z9KA 1S82A 2OQ5A 2O9QA 3B8JA 4FU9A 1FLEE 1RTFB 1ZTKA 4J2YB 3HKJB 5DP3A 3FP8E 1B7XB 1GBMA 1UK3A 2J97A 3O8CA 1GHXH 1FPCH 1S0QA 4K60A 1MKXK 1UHBB 2BLWA 1BIOA 1TABE 3RXLA 3O8DA 3TH4H 4HZHA 4AC9A 4NA9H 4JZ1A 1SQTA 4Y8ZA 3SU2A 4A92A 2WYGA 2GT7A 1WUNH 3NKKA 1YPHE 2EC9H 1O3EA 1C5UA 7GCHF 4LZ1H 1O2XA 1TBRH 5HGGA 3RXEA 1GVKB 3D23A 1JIMA 4TWWA 2BDHA 4KTUA 1CBWC 1F0RA 3MU0A 4BTIB 3P70B 2VH6A 2F9UA 2VU8E 3MNXA 2KAIB 4FUIA 3OTJE 3ZZ4A 2Y80A 1JRSA 1RGQA 5T1VA 5HIYA 2FOEA 1SHHB 1WCZA 1TIOA 1NFYA 5JPMH 1XKAC 5JBBS 1F2SE 1ETSH 2HPPH 3I77A 3MTYA 5DK1A 1H9LB 4I33A 1C1OA 5JBCS 3HATH 3LIWA 2GVFA 5CE1A 2J5UA 1GMDF 1CSOE 1O2WA 3NWUA 1L4ZA 3MHWU 1F0TA 1NU7B 1HAZB 4B71A 1EOJA 4X8SH 2FIRH 3ATKA 1EAWA 3OAAD 4KELA 4LK4A 1FIWA 1LKAA 4JZEH 1LCYA 1PPGE 3V3MA 4Y8YA 4ISLA 4TT3D 3MNBA 2Z9LA 4ZHAA 5FAHA 1TNIA 3ODFA 3Q77A 3PV5A 1O3PB 1TA2A 1P2MA 3NZIA 1O3HA 1OSSA 1VITH 2ZHEH 1C5YB 1BTWA 1GJ9B 3SJ8A 1M9UA 4DURA 1FY1A 2GCHG 1BMNH 3QTVH 3P8GA 1QB6A 1OWDA 2SNWA 4MVNA 2UUKB 5F53A 3BN9A 5EXNA 3A7XA 3Q00A 4KKDA 1T4UH 5FBEA 1HAVB 1O2IA 4Y76A 2B5TB 1W7GH 1EUFA 1NBMD 2Z3EA 2F91A 1Y3WA 2C8WB 2IN2A 4DGJA 4O3UA 2ALPA 2RFKC 1ZGIA 2YMSB 1G37A 1GCTB 1O3BA 3S7KB 3A88A 3U8OH 3MQKC 2G4UA 4BAHB 2R3UA 1OOKB 4JK5A 1T8NA 4B76A 3RMLH 2FLBH 5L6NH 5FX5A 1T32A 2CF9H 3ZV9A 1WAYB 1KXBA 1C1RA 1D4PB 1HFDA 2R0KA 4Y8XA 2A1DB 4I7YH 4P00A 1FXYA 4A1VA 1O2TA 2L74A 3BTKE 1AIXH 3SV6A 4NGAH 1VKYA 1LMWB 1NU9A 1S85A 2JKHA 1D3QB 4HI3A 4CRDA 3FKSD 3RM2H 1HGTH 1FQ3A 5G4BA 1GHVH 3FP6E 3BTEE 1GBHA 3A8BA 4DIIH 1DDJA 1XUIA 4UONA 4AN7A 3ZZ3A 1UTOA 5DP5A 1SGNE 1AE8H 3M7QA 4OS4A 1GMHF 2FESH 1AFEH 1V2RT 1TBZH 4CRAA 3S0NA 1C5SA 4MTBA 1FAXA 2OLGA 2NU0E 4X1QU 5LPEA 4OS1A 1Y3VA 1SGQE 4O97A 1LVMA 4P02A 1DWCH 3BTGE 1HXEH 2FM2A 1E34B 4FUDA 4WH8A 4NCYA 2ZFRH 1MABB 1N6XA 2PUXB 1WXRA 4X2VA 3BEUA 1UVOA 1ELCA 2O8MA 4ZAEA 4M7GA 1LVBA 1T31A 5EG4A 5IDKA 4I8KA 1EQ9A 2W3IA 1OHHD 2FZZA 3N7EA 5DP6A 3PMHB 2V0BA 3D49H 2ZO3H 2Q6FA 4RKJB 2CHAC 1YPKH 5EQQA 5PTPA 4Q63A 5EXLA 4Y71A 3A80A 1VCQA 1G32B 4ABGA 1EKBB 3ATIA 3FOAA 2KCAA 2VWMA 1V6DA 1O2QA 2ODPA 3SQHE 4TY7A 2PKSC 2GV6A 1TX7A 1NRRH 4VGCB 1O33A 1YLNA 2W26A 1NZQH 2FOAA 4F4OC 1GMCF 2R3YA 1K2I1 1GHAF 1P2OA 3MH4A 2AIQA 4B6EA 3PWBA 1FI8A 1O2GH 1AY6H 1TALA 2R0LA 4MG3A 3M5OA 1HXFH 4JYVH 5HXFA 2YMSC 1G2LA 4BAMB 1GI3A 3F9FA 3Q3XA 1GCTC 1RTKA 2JH0D 3AASA 2AMDA 2FWWA 3EA8A 2C4FH 1ARBA 3P6ZB 2P94A 1DSUA 1GL1A 3KQEA 1VZQH 5EGMA 1XUKA 4CBOA 2TGTA 1GL0E 3TNTA 2NU4E 5DP7A 4OS6A 3HGNA 4BXWA 4YLQH 2GD4B 3SNEA 3RXOA 1LQEA 3HK3B 1CGJE 1LHGH 4NFFA 3L33A 1ESTA 1BUIA 1ZHRA 1O2KA 3VB6A 1DE7H 2BY8X 1TGCA 2WPMS 3P8FA 4CRFA 4NZQA 2ZIQH 1J14A 4GPGA 4Y7AA 3GY3A 2GZ7A 2O8LA 1HRTH 2VGCC 1CO7E 1PYTC 1TX6A 3E90B 3TK5A 1NESE 2BM2A 2Z9GA 1W14U 2XRCA 3IITA 2F9VA 2WUBA 3UREA 1RFNA 2P95A 2SGQE 5TCAA 4D7FA 1MUEB 4O3TA 5DSFA 3SV8A 1P10A 1YWUA 4RT1A 1C4Y2 2CXVA 4Y7BA 2WINI 1SOTA 1UJ1A 4F55A 2A5KA 3BSQA 2VB0A 1IOEA 1L4DA 1C2GA 2BY9X 1PQ5A 1OP0A 1AO5A 1LKBA 1HJ8A 3PO1B 4I32A 3SU0A 1C2HA 4YT7H 1BMAA 2FOHA 1V2TT 3ZYDA 1ZSLA 4IMZA 1GBKA 3VXEH 2ZDLA 3GCTF 8GCHG 2BD7A 4AG2A 1TPOA 1C5MD 4B2AA 3PB1E 4AG1A 2PWXA 3ZZ7A 2H9EH 1GDNA 2BD5A 3GY8A 9LPRA 1AB9C 3RXRA 1RD3B 1YCPH 3TIUA 1ANDA 2LELA 6CHAC 5LGOA 2BB4A 1ZMLA 1KXCA 1ZPZA 4DW2U 1C2KA 1P9UA 1DANH 1N1LA 2OTVA 2ZCKP 1DT2A 3LKWA 2ZTYA 3E8LA 1PQ8A 4CHAC 5DN6D 3PROA 2C90B 4B73A 4MDSA 3RXAA 1FMGA 4ZHLU 2J4IA 2HGTH 1TOCB 4FUCA 1YLCA 2Y7XA 1UMAH 2R2WU 1IQNA 1GJDB 3OYPA 4AFUA 1O36A 5FPTA 1GHYH 5T3HA 4ZCNA 3GDVA 1V2QT 2SFAA 4K1EA 1A46H 1O2MA 2XWBI 1UHBA 1E0FD 5F6MA 2J38A 2EEKA 4OGYA 2ZCHP 3SHAH 3RXUA 2QV1A 3GYLB 3A8AA 3UOUA 1O5GH 2F9PA 3RXDA 2G52A 2Y82A 1SPJA 1PJPA 2JETC 3RXMA 3T27A 4XBCA 1HIAA 2KAIA 1O3JA 3VB3A 3ZVCA 4A6LA 2V7QD 3CP7A 3AW1A 2K8IA 3M7UA 1LDTT 2AERH 4K1SA 3S7HB 3UWIA 3NK8A 5C2ZA 3UFAA 1C9TA 1DWEH 2VIDA 1UTQA 1MMJN 2FI4E 4ISIH 5C1XA 1MAYA 1Z1JA 1QCPA 1GJBB 5T6DA 5GJ4B 2A2QH 4MLFB 3A85A 4ASUD 1ZOMA 1NROH 2A7JA 1C2EA 4K8BA 4NA7A 4NWLA 1SQOA 1XUGA 3E0PB 1C9PA 1H8HD 1K1OA 1MD8A 4LXBH 2XNDD 1P02A 3LC3A 2XOKD 3PO1C 4IN2A 2VIWA 2ZGHA 1XXDA 3W94A 1N8OB 1ZR0A 3MU8A 3PV4A 3MO6A 1J15A 1GBBA 1H8DH 3E16B 1YPMH 5A0BA 2ULLA 1GWAA 1G36A 5C94A 3GYMA 2ODYB 1C2LA 2VWLA 1GBJA 1C1VH 5DKMA 2OCVB 1MKWH 1GHWH 3OE7D 1P9SA 5F8TA 1HYLA 4LZ4B 5DPAA 1C5XB 3D62A 7KMEH 1FN8A 1O2JA 1GI5A 3SI4H 3VFEA 1QR3E 1SSXA 1O0DH 2ZPSA 1BJVA 7GCHG 3U1JB 1QQ4A 1PPBH 2QN5T 1VGCC 4GSOA 4I8LA 4JK6A 4DT7B 4THNH 1EAUA 1O31A 1TRMA 1QBVH 3GY2A 4AB9A 1TYNA 2DE9A 3SNDA 1BCUH 2FS9A 4IBLH 1A3EH 1GI8B 1LPZB 5EODA 1O32A 1DOJA 1GI9B 4BANB 4X6PA 4BAKB 2LPRA 4ZXXH 5HM9A 5KECA 2PP6A 4FOUC 3ATMA 3MH6A 3LGTA 2HALA 3DUXH 1EAIA 1AUTC 1TMBH 2GZ9A 1ANCA 1GBDA 3A7TA 2KR7A 3PTBA 4NA8A 2B7DH 3SO3A 1W2KH 1GI7B 1AVGH 1JRTA 3A8DA 3BG4C 2ZGJA 2QE7D 1G3EA 4X2WA 1GGDB 3FANA 2P3UB 1GMDG 1O3NA 3E0NB 4A7IB 3F0PA 5C5OA 2PGQB 1C5OH 5FX6A 1TNGA 4X1RU 1EASA 1C5QA 1T7CA 1GDUA 2KCPA 3UIRA 2B8OH 2HVYB 1YPGH 1MQ6A 3V13A 3AW0A 1FY4A 5BPEA 1JOUB 1GVZA 2BDBA 3LGYA 1P2QA 3TITA 2HNTC 1ZPBA 2G81E 2C8XB 4E05H 1ZRKA 2Z94A 4TPIZ 5B6LA 1O3CA 1C2IA 1JXPA 2UWLA 2IOTA 2PGBB 5EJLA 2KZ4A 4AOQA 1QZ8A 4NZLA 1DFPA 4IC6A 1GBAA 3U28C 2ZG0H 4H42U 2KX4A 3BTHE 4X6MA 3M5MA 2BVXH 1E1RD 1SGFG 3U69H 1ZRBA 4B2BA 4CRCA 2ZP0H 3FFGA 1EXFA 1OP8A 1BHXF 2BDIA 5HMAA 5ESBA 1TQ0B 3HGPA 1YCPK 2THFB 1N8OC 1KLJH 2BXUH 3DT0H 3GY7A 1GBFA 3N7OA 4Q2KA 1EPTB 1P11E 2HRVA 1QTFA 3F9GA 1O5CB 3E1XB 1O3IA 2ASUB 3N7DA 1ELVA 5E0GA 1SGFA 1E79D 2AIPA 1ELDE 5EU8A 1ELAA 2FOBA 3HK6B 2FI3E 1BA8B 1C4U2 3ZVFA 1O2YA 1QL7A 2PUQH 1UTJA 1AWFH 1C5TA 3HKIB 1SB1H 5HIZA 3SGQE 3K6YA 1LO6A 1F92A 3A87A 2VWNA 2BZAA 3LJOA 3F2FA 1O3FA 4ZROA 2XBYA 4K2YA 4XFQA 4ACAA 3PMAB 3ZVAA 1TBQH 4J1YA 2FYQA 1MTSA 1BTUA 2BTCE 3GS9A 1S84A 3PV2A 1C5NH 3OY6U 1S83A 4Z1MD 1D6WA 3K9XB 1GHZA 3KYGA 3LH3A 3V0XA 5TCCA 4WMFA 4D8NA 2XC0A 3ODDA 5JB9S 4UFEH 2W6JD 3VB5A 1THSH 1BB0B 1YPEH 1GGDC 3KCGH 3ATLA 2G5NA 1TPAE 1QQUA 4DG4A 4CH8B 5A0CA 1MZAA 3RXKA 2V3HH 1NT1A 2QF0A 2A0QB 3LPRA 3CS0A 2F4LA 2AEIH 2Y6TA 1OP2A 1O2VA 1SHYA 1W10U 3SUEA 1EZUC 5JDUB 3Q3YA 5DP4A 3SBKA 1G2MA 3BTTE 5GCHF 2C8YB 1BRCE 1HIAB 4GVUA 2SGPE 3RXPA 1PPZA 1QRWA 1S5SA 1H9IE 3UAIC 3PLPA 1MU6B 1HAYB 5F03A 1BHXB 1K22H 2QXGA 1F5KU 2HPQH 4XRNA 3FN8A 2OC8A 1BTHH 2OUAA 3M3TA 2Z6BD 4YTAA 1SGYE 1MKWK 1MZDA 1GMCG 2A4OA 1W3CA 1GHAG 1V2VT 4E7RG 1UTPA 2L6OA 3SYJA 4MNYA 2ANYA 1NTPA 5A0AE 1A5HA 1DITH 5A8XA 4B2CA 4BTTB 1Z8GA 2VVVA 3V7TA 1IQIA 2OC1A 1WSSH 2QF3A 3H7TA 5GIBA 4ZMAH 1NRSH 2WPIS 3RXJA 3WW7A 2FPZA 1IQEA 2ZFTA 1WQSA 1EPTC 1BJUA 3AAVA 1DICA 2P8OC 5ABWA 2VIPA 1AKSB 4GHTA 1ZJDA 4MQAA 2CHAB 3RMMH 5L2ZH 2AFQB 1FY8E 2BY5X 3SU1A 2ZHWH 6LPRA 2XTTB 5FPYA 1W0KD 1O37A 1QJ7B 2WPLS 1ELFA 4CREA 1BBRH 4Q7XA 3VB7A 4BTUB 2ZPRA 1BRAA 5FL7D 3M5NA 1INCA 1LTOA 2PKSB 1HJAB 3RXVA 5C67A 3TGIE 1QIXB 1BTYA 1O2NA 3SJIA 3U1IB 5FBIA 1WU1A 4RI0A 2FTMA 3M3SA 3PTNA 2TGAA 2OP9A 1J9CH 3KL6A 4JZFH 1SFQB 4X6OA 1Z6EA 4Y0ZE 2W7SA 1L1GA 1O2RA 4FVBA 4MPVA 3ZZDA 4AGKA 2XC4A 2XC5A 1AUJA 3LU9B 1TFXA 4Y11E 4ABBA 4D76A 4YOGA 2ZGCA 3L3TA 1BRUP 4LOYH 2PSXA 3SI3H 2A4QA 3ZVBA 3KQBA 1UCYH 3ZVEA 3C1KA 3VPKA 1BMFD 4ACBA 3UR9A 3SU5A 1DXPA 2TBSA 4DOQA 1SLXB 1EATA 3QZRA 3DCLA 2OC0A 1GJAB 5C1UA 3T2NA 1W8BH 2PTCE 4RT0A 3A7YA 4I8JA 3SV2H 3F9HA 1QBNA 2PTNA 3LGIA 4XBDA 2GJGA 3ZZBA 4WY3A 1SLUB 2ZKSA 3GCTG 3TNSA 2H2ZA 1RTLA 2C3SA 3SQEE 2EQNA 3ZYEA 2CMYA 2VGCB 2BD8A 2Z9IA 1IHTH 2G5VA 3K2UA 2FLRH 3PRDA 1HBTH 3EAJA 1RXPA 1SQRA 2FX6A 3ESTA 9ESTA 1TOMH 2SGAA 3T28A 3KEEA 1P8VC 4AORA 1TNJA 1BMLA 1LVYA 2AS9A 4ZHMU 2OD3B 2ZGBH 3ZZAA 1HAHH 2RDEA 1YLDA 3GDSA 1WOFA 5DP9A 3PMBB 4DVAU 1FY3A 1KXDA 4IW4E 1GVLA 2BYAX 3M61U 3M37A 4X8TH 1FZZA 2R9PA 2ESTE 3MI4A 1HV7A 2UWPA 3KNXA 1W0JD 5GPIB 3PM3A 3KN2A 3FZDA 5T6GA 4E06H 1P2NA 1H8IH 2G8TA 4ZH8A 1IQLA 2GX4A 1C5ZB 2HLCA 1MCVA 1LHCH 1AGJA 2QCYA 4K1TA 4RSPA 4FUGA 1SL3A 1P06A 1SGTA 4X2XA 3JZ1B 4YOIA 2K1QA 5KGOA 4IGDA 3SNAA 1DY9A 3SJOA 1A61H 1GG6C 2M5TA 2GCTC 5EJZA 2P93A 4YXWD 4BXSA 2GTBA 1AB9B 1TNHA 1HJAC 3PRBA 5ETXA 3P8NA 2VIVA 6CHAB 3WY8A 1HLTH 2ANWA 1THRH 2ZU1A 4FUHA 1AVWA 2BMGB 2TPIZ 2A5AA 2ZDMA 4CHAB 1HUTH 2BXTH 1Z8IB 2ZFQH 3NXPA 2JDID 4ZKOU 1CHGA 1C1TA 2FO9A 1KIGH 1TGNA 2JJ1D 1O2SA 1FY5A 3WWBA 2H5DA 3EE7A 3AVZA 3F3BA 4R8TB 4X1NU 4XD7D 2A4RA 2YOLA 1ZMJA 5A09A 2EI8A 4I86A 1ZSJA 1SFIA 4PROA 2P59A 2H9HA 1RRKA 1F7ZA 2F43B 3MWIU 1SLVB 1NN6A 1TLDA 1T8OA 2QY0B 2KCYA 2XW9A 1MAXA 1G30B 1GBCA 4KP0A 3F0OA 2FMJA 3A83A 3QGJA 4CR5A 2Z3CA 4GLYA 3SZEA 1MQ5A 2JETB 2ZDNA 3RDZA 3SJ9A 2CV3A 2ZQ2A 3B9FH 1W12U 5C17A 1F0UA 1O34A 1IQFA 4NIWA 2H9TH 5IK2D 3SUGA 3QWCH 3IWMA 1BTZA 2ZGXH 5HM2A 2PSYA 5GXPA 4X8UH 2AMQA 2Z7FE 3A7ZA 4GHQA 2JJ2D 1WQVH 3AK5A 5C3NA 1H4WA 4OGXA 3UUZA 2BVRH 3SNCA 1BOQA 2YNAA 1Q31A 1A5GH 2P3TB 2ZFSA 4TWYA 2BHGA 5AHGH 1YF4A 3LC5A 4I31A 1EPTA 1TB6H 2IPQX 2ZEBA 4WF8A 1WV7H 1KXFA 5EQSA 1N6YA 3SW2B 1S6LA 4QT8C 1K1LA 1F0SA 2R2MB 3DSPA 1L2EA 1O38A 3TJOA 3RC6A 4MPUA 4AYVB 4Z0KA 1PPFE 2BZ6H 1D3TB 1WDIA 2V6NA 4FUBA 1SLWB 1PFXC 3BTFE 2OK5A 1AZ8A 3GCOA 1A7SA 1VGCB 1AE5A 4Q80A 4KTCA 1FV9A 1QB1A 4AFZA 1AVXA 4WVPE 1TPSA 2NU3E 1COWD 4FUJA 1WTHD 2FX4A 2JIZD 2STAE 2W6ID 5GDSH 3SZNA 2A31A 2BD4A 1VITG 3EE0B 3E91A 2ZC9H 1SOZA 3F2GA 1T4VH 5J4SA 2K0QA 1HPGA 3BG4B 3Q76A 2FP7B 3RXBA 1XUHA 1EFRD 1TGSZ 2C93B 2ZHDA 1CT2E 3SJKA 1KTSB 3KQ5A 3T26A 2AGEX 1C2FA 4Q7ZA 5ESTE 1GPZA 1ORFA 5AF9H 4IN1A 1VCWA 2OXSA 3MNSA 3RP2A 1P12E 2FXRA 1EJMA 4ABFA 5J4QA 1KXEA 4BAQB 1SI5H 1GJ5H 1IHSH 2GDEH 2D2DA 1C1NA 4ISNA 2I6SA 1S6FA 1YPJH 1L1NA 2GP9B 1KDQA 1KY9A 3SV7A 2ZZUH 4SGBE 3RUOA 5HYOA 1KLTA 4KGAA 3OY5U 1ZJKA 1NFXA 1P09A 3BV9B 3EGKH 1C2MA 1CA0B 4UFDH 1BZXE 1LHFH 1ETTH 1QY6A 2G51A 1WYKA 4GUXA 4Y79A 6ESTA 2HNTE 1T8MA 2I6QA 3OTPA 3MU4A 1AU8A 2J98B 2XWAA 2PLXA 2QC2A 2ZU4A 5CDFE 3F9EA 3CNRA 1S0RA 4IMQA 5A8YA 4ABHA 3BIVH 1AHTH 1AKSA 3UY9A 1UW7A 4DCDA 4B75A 2G55A 2GDDA 4AFQA 5C0TA 3TJUA 3VXFH 1BQYA 4Q7YA 1NM6A 1VR1H 1C4V2 4UFGH 3BTDE 1O39A 1E35B 1K0HA 1F5LA 3H5CB 1C1PA 1IQGA 1YPLH 4R0IA 1W11U 2H6MA 2B9LA 2BD3A 4X0WU 2M2AA 4GCHF 3MYWA 1NRQH 3ATWA 2H1UA 3F2HA 3RC4A 1QFKH 2ZA5A 1C2DA 1UVUH 1PQAA 4Z6AH 1W7XH 3MNCA 2OC7A 5GCHG 4UFFH 4SGAE 3U98H 2BOHB 1AN1E 2BLOA 2Q6GA 1NPMA 2P3FH 4D7GA 4WH6A 1W13U 3TU7H 1UVSH 3UOPA 4ISHH 1ESBA 1HJ9A 1O3MA 1XKBC 1Y5AT 1CGIE 2WUCA 2VVUA 4K69A 3SU3A 1E36B 2OQUA 3SNBA 4X1PU 1UTLM 2QF4A 1C5WB 2PFEA 1SGIB 1WTGH 1O2ZA 3A7WA 4MNXA 3UNRA 3UWJH 1YGCH 4CRGA 8LPRA 5LPFA 1GJ7B 1O2OA 1MTNC 5AFZH 1A2CH 2BD9A 3LGUA 2EI7A 2DE8A 8ESTE 6GCHF 2FOGA 2VH0A 4WWYA 2KM0A 1C1MA 1V2OT 3ZZCA 3GDUA 1RS0A 5H4IB 5L2YH 2ZWLH 5IYTA 1EZXC 1FX0B 4OS5A 4BAOB 1VITF 1CA0C 3MO3A 3E3TA 1QL9A 4IC5A 1J16A 3ELAH 1GBLA 5C5NA 1SGEE 3LGVA 1HAIH 1CHOF 7LPRA 3NUMA 5K0HA 5LH8A 3UB0A 3AAUA 1E37B 2BDYA 3FAOA 1YYY1 1IQMA 1LPGB 2W7UA 1P3EA 1QL8A 2A5IA 2P16A 4WXIA 1MD7A 1UO6A 2F9BH 2NU2E 3M3VA 3SV9A 1UK2A 5AVDA 1B5GH 3STJA 2BVSH 1AFQC 2ZU5A 2ZECA 4NWKA 2RA3A 2LNCA 1K1JA 2NU1E 3QN7A 1GDQA 3SUFA 1OYTH 1GHBF 2P8OB 2YNBA 4ABJA 1A1RA 1QGFA 2AGGX 4INHA 1QBOA 4K8YA 1TRYA 1K1IA 2XBWA 1V2UT 1YKTA 1EB2A 2UUJB 5FPSA 1CA8B 1AI8H 1MCTA 1UK4A 2QXHA 3A81A 7ESTE 4WMEA 4WJG2 2PKAB 3ZZ8A 5BRRE 1L1JA 1F5RA 1O5EH 1L0ZA 1YBWA 1FIZA 2KCOA 5AFYH 1OWIA 1P2KA 1O30A 2RCEA 1Q2WA 3V12A 3BTWE 2LP6A 4YM9A 3TJVA 2TRMA 2CF8H 5T6FA 3L6PA 2SGDE 3TK9A 3QDZB 1GJ6A 3LONA 1BT7A 4MPWA 3ZIAD 3F1SB 1MTUA 4HTCH 3S69A 4DJZB 1HAPH 2Q1JA 3BG8A 5DGJA 3LH1A 1V2WT 2XCFA 2A2XH 1K9OE 2WZQA 4NSYA 3TH2H 5CMXH 1H8ED 1QNJA 3UQOA 2ZHFH 1FDPA 3GICB 2FDAA 3K6ZA 4FUEA 4ABAA 3O8BA 4AFSA 1V2KT 1P2JA 5LPRA 4O03A 3HPTB 3SOSA 2VNTA 2G4TA 3SGAE 3RXTA 1NY22 1ZTJA 5GWZA 4I8GA 1DUEA 4H6SB 2TIOA 1EJAA 1DSTA 5C1YA 3SU4A 4AB8A 1ZHMA 2F9OA 1Y5UT 4MNVA 1QURH 2TGPZ 1ETRH 2ZDAH 1RIWC 2BX4A 1BBRE 2J92A 3RMOH 2GZ8A 5FCRA 1FAKH 1O5AB 1SMFE 5SGAE 1TQ7B 2Y5HA 5A2MH 1XVOA 2ZDKA 1KDQB 2A45B 1P2IA 2WSSD 1NRNH 3EA9A 2AYWA 2XBVA 2OBOA 3GISB 4ABIA 1TONA 2H5CA 2BQWB 3R3GB 1YCPM 1GJCB 2ZU2A 1FONA 3OU0A 1FNIA 2WPJS 4NG9H 2WV9A 1Y5BT 1P3CA 2ALVA 1EJNA 2QF5A 3Q3KA 2A7CA 1BTPA 2AHME 3RMNH 2F83A 1B0EA 1TMTH 5EPNA 2ZHQH 3GY5A 2UWOA 2FOFA 1UCYE 1U6QA 3RLYH 2IJOB 1HNEE 4HFPB 1V2NT 2O8TA 2Q6DA 4X8VH 1GBEA 2PV9B 4ISOA 1V2MT 1J8AA 1NO9H 3W1EA 1UVPA 1LHDH 1BDAA 4U2WA 5JB8S 1AD8H 2WPHS 2SGFE 2VIOA 1EZQA 1D3DB 1GG6B 2GCTB 3RM0H 1OXGA 2AMPA 4OS2A 4INKA 1ABJH 4X6NA 2BDCA 4K5ZA 2CK3D 1SC8U 1QA7A 1TRNA 4UDWH 1DLEA 4ZKRU 1J17T 1O2UA 3FP7E 4K3JA 1GI0A 2FS8A 1QHRB 4M9FA 1X7AC 4Y10E 5KEDA 1TX8A 3KQDA 2GGVB 2Z3DA 1BMMH 3KIDU 1WBGB 3MFJA 3QO6A 5DG6A 1HAXB 1OX1A 1Z8JB 1OWHA 1AWHB 8KME2 4U32A 3M7TA 2VIQA 3STIA 2XXLA 2QIQA 1QB9A 4NIXA 2WV5A 1Z8RA 1MTWA 2BQ6B 1MTVA 1VCPA 3T29A 1C1QA 1YPHC 1A0LA 2FOCA 3I29A 1OYQA 1MH0A 1UTKA 3GY6A 4YOJA 3A86A 3EQ0H 5E2PA 1YM0A 2DUCA 1AMHA 4AX9H 1ZMNA 4FU8A 2ODQA 3ZVDA 4YT6H 4B74A 1EAXA 2CN0H 1PQ7A 4NIYA 2RDLA 4XDEA 1OPHB 1YP9A 1KTTB 3OX7U 4D9QA 2Z9JA 5EXMA 3SORA 1NS3A 3KF2A 2EY4C 2Y81A 1CQQA 3RXSA 2A32A 5E2OA 4NSVA 1C1UH 4WXVA 2JH6D 2Y5FA 3RXCA 2J95A 1ELTA 1CVWH 2HOBA 2J98A 1Q3XA 1E1QD 2W5EA 1Y3YA 1NRPH 3T25A 1C5PA 2BQ7B 2ZF0H 2BD2A 1O2HA 4Q4LA 2WYJA 2FEQH 3W95A 1QRZA 2XNIA 1DX5M 3ZZ9A 1DUAA 2WV4A 3MMGA 3KHVA 4UEHH 1H1BA 2J9NA 1SGRE 1GJ4H 3BEIB 3JZ2B 4AGJA 1ARCA 4XBBA 4YZUA 1QA0A 2FODA 3QGNB 3A7VA 1AZZA 2VINA 3ENSB 1CE5A 3NCLA 1V2PT 2J2UA 3RU4E 1O3DA 1XM1A 3MOCA 3S9BA 3A84A 4OS7A 5E8EH 5K7RA 3H7OA 1TA6A 4GAWA 4JYUH 1G3BA 4TYDA 1SVPA 3VB4A 2HLDD 1CT0E 4ZKSU 2ZTZA 4ESTE 2WPDD 1DVAH 1Z71A 1GI4A 1SGDE 1GI2A 1DM4B 1Z6JH 4IS5A 4YO9A 1G3DA 3SGBE 3VG8A 5TJXA 1VJ9U 1ZPCA 1K1NA 1CGHA 2D1JA 1MBMA 1EZSC 4D9RA 1TPPA 4INLA 3URCA 2QGRA 5A8ZA 3UNQA 5EW1H 2ZDVH 1K28D 5EIYA 1QJ6B 3FVFB 3FZZA 1FUJA 4NFEA 1GI6A 1P57B 2A7HA 2YMSD 3EYDA 2F9NA 1EP5A 4NIVA 3MH7A 4A5TS 3T5FH 4RKOB 4DT4A 2Y5GA 1Z7KA 2QXIA 1C5VA 3PWCA 4FETA 5CHAB 5EJ1A 4TY6A 5HKKD 1FN6A 1NC6A 1O35A 5JBTA 1IQKA 5L30H 1O3GA 1O5DH 3DHKH 3MO9A 1K1PA 2NWNA 5EPYA 4MPXA 3DA9B 1TE0A 1Y59T 2GCHF 4AZ2B 3PLKA 3TK6A 3P95A 2O8UA 1IAUA 2RG3A 1O2PA 4GCHG 1ELBA 4FVDA 3ITIA 2ZTXA 1A4WH 1XMNB 3A82A 1DY8A 3OEED 3QLPH 1G9IE 1O3LA 2Y7ZA 1BBRK 1THPB 1SGPE 1C2JA 1PYTD 1D3PB 1V2ST 1PPHE 2BLQA 2BDGA 1K21H 5GNDA 1IQJA 2JH5D 1MBQA 4B1TA 3F6UH 4F48B 3U8TH 1GCDA 3P17H 2HNTF 3A8CA 4JYTA 4X1SU 2PHBA 4JMYA 1HCGA 1UTMA 3BEFB 5F8ZA 1ELEE 2VJ1A 4YLUA 1LQDB 2FYRA 3SUDA 1BITA 2PKAA 1W0YH 1TWXB 2QXJA 3M35A 2G00A 3M36A 3RU4D 4TPYA 5DP8A 6GCHG 1PPEE 1DXWA 2UUYA 1NFUA 1UCYK 3RXQA 1KLIH 2A4GA 3TJNA 1KSNA 3EA7A 2STBE 4O9VA 3ZZ5A 1P05A 1TMUH 4HGCA 3RXHA 2FI5E 4WMDA 1SR5C 1NFWA 3B23B 1FJSA 1ZHPA 3F68H 2ZU3A 1E38B 1OS8A 1TGTA 1DWBH 4JCNA 4A1TA 5DO4H 1XUJA 4ZKNU 1VJAU 4VGCC 1C5LH 1Y3UA 3D65E 1DS2E 1H9HE 1JIRA 4B6FA 3QTOH 1CHOG 3BTQE 1EP6A 3NPSA 1YC0A 4A1XA 5FHTA 1P0SH 1Y3XA 5E0HA 3U8RH 1C5RA 4KTSA 3URDA 2VWOA 1ACBE 3QK1A 2ZPQA 2BX3A 1OKXA 1ELGA 1A3BH 1MTNB 1PPCE 3G01A 4E7NA 1CT4E 1KMHB 1EB1H 5CHAC 5CHBA 2ILNA 1O2LA 1O5BB 3O8RA 1Z1IA 1GHBG 1ANBA 1AQ7A 3SU6A 2EI6A 1XXFA 4ABEA 1TNLA 3OFND 3CENA 1UTNA 1Y8TA 2GMTB 2TGDA 3TGKE 1ZZZA 1RJXB 3UNSA 3PLBA 1OWKA 1TNKA 5I46H 4FU7A 1IQHA 1P03A 4X2YA 3KQCA 2OINA 1A5IA 2QA9E 2GKVE 2J34A 3P92A 3ZV8A 3BIUH 4UE7H 1LHEH 3N99A 4DY7B 2ANMH 2XCNA 1MKXH 4FUFA 3QZQA 2BDAA 1AFQB 3BTME 4FXGH 1XUFA 2GV7A 3S9CA 3GOVB 1TAWA 2O8WA 3UQVA 1DLKB 1HB0B 1V3XA 4Y0YE 5E0JA 2PW8H 4CBNA 3GCNA 3KYFA 3I78A 5B6OA 3RXFA 4BOHA 4CR9A 2J94A 3TLOA 3TPIZ 3GCHB 2D8WA 4ZXYH 4U30A 1SQAA 3PYHA 1SGCA 2FOMB 2GT8A 2IPHA 3A89A 3SN8A 3VGCB 2WHXA 1S81A 2BY7X 3SHCH 1CU1A 1A0HB 3CS7A 4XE4A 3WWFA 2BY6X 4DIHH 1GBIA 1O3OA 2AH4X 2F3CE
chains in the Genus database with same CATH topology
3ZVGA 1MU8B 1LPKB 3MU5A 1O3AA 4RN6A 2QYIA 3QUMP 1UVTH 1ZTLA 3RU4T 1KYNA 1V2JT 2CGAA 2WPKS 1ESAA 2AGIX 2SNVA 4YESB 1SBWA 3S9AA 1HAVA 5EOKA 3EDXB 2PR3A 2XYAA 4I8HA 4UD9H 1HDTH 3LJJA 1OWEA 1SG8B 3R0FA 1EOLA 1EX3A 1TGBA 1ZSKA 3DFJA 3LOXA 4ASHA 2OBQA 3RLWH 1D9IA 3P8OA 5JYIA 1B0FA 3LGWA 1BRBE 3UPEA 1LVOA 1DWDH 3K65B 1ABIH 3DFLA 8GCHF 2EA3A 5JBAS 3RC5A 3RXGA 4AYYB 3DD2H 2GMTC 1V2LT 3QX5H 4F49A 1RIWB 2CJIA 2BOKA 1P01A 4JZIA 2HVXA 1ID5H 1ZGVA 1JWTA 3IG6B 3UTUH 2B0FA 1HAGE 1GJ8B 3LDXH 5FCKA 4H6TA 3TH3H 1D6RA 1O3KA 4H4FA 5EW2H 2C8ZB 3RXIA 3U9AH 1ANEA 1CBWB 2ZFPH 4U01A 1JMOH 1G3CA 2XBXA 1A0JA 2RA0A 3ZZ6A 3KGPA 5EQRA 1XVMA 4MNWA 2HWLB 4CH2B 4ABDA 4ZUHA 1S6HA 4Y6DA 1JBUH 2ZCLP 3MH5A 1K1MA 3BF6H 2V3OH 3OSYA 5DJ7A 1GBTA 1QJ1B 1QRXA 2FTLE 2QAAA 4XOJA 3GCHC 2W3KA 1OWJA 4JZDH 4CRBA 3TGJE 2D26C 1BTXA 3VGCC 3C27B 3GY4A 2VVCA 4XSKU 1C1SA 2UUFB 3LT3A 3VEQB 2BLVA 1P04A 2ZI2H 3UR6A 1GI1A 5FXLA 2V35A 2ANKH 1ZYOA 1W0ZU 2ZFFH 3E6PH 3T62A 3MU1A 1T8LA 1XX9A 3TVJB 5C20A 5I25A 2SGEE 1KXAA 3M5LA 1ZLRA 3PMJA 5F8XA 1HAOH 1DPOA 2ZQ1A 2ZNKH 4BNRA 1FPHH 1O5FH 1GMHG 1C1WH 2Z9KA 1S82A 2OQ5A 2O9QA 3B8JA 4FU9A 1FLEE 1RTFB 1ZTKA 4J2YB 3HKJB 5DP3A 3FP8E 1B7XB 1GBMA 1UK3A 3O8CA 1GHXH 1FPCH 1S0QA 4K60A 1MKXK 1UHBB 2BLWA 1BIOA 1TABE 3RXLA 3O8DA 3TH4H 4HZHA 4NA9H 4JZ1A 1SQTA 4Y8ZA 3SU2A 4A92A 2WYGA 2GT7A 1WUNH 3NKKA 1YPHE 2EC9H 1O3EA 1C5UA 7GCHF 4LZ1H 1O2XA 1TBRH 5HGGA 3RXEA 1GVKB 3D23A 1JIMA 4TWWA 2BDHA 4KTUA 1CBWC 1F0RA 3MU0A 4BTIB 3P70B 2VH6A 2F9UA 2VU8E 3MNXA 2KAIB 4FUIA 3OTJE 3ZZ4A 2Y80A 1JRSA 1RGQA 2FOEA 1SHHB 1WCZA 1TIOA 1NFYA 5JPMH 1XKAC 5JBBS 1F2SE 1ETSH 2HPPH 3I77A 3MTYA 5DK1A 1H9LB 4I33A 1C1OA 5JBCS 3HATH 3LIWA 2GVFA 5CE1A 1GMDF 1CSOE 1O2WA 3NWUA 1L4ZA 3MHWU 1F0TA 1NU7B 1HAZB 4B71A 1EOJA 4X8SH 2FIRH 3ATKA 1EAWA 4LK4A 4KELA 1FIWA 1LKAA 4JZEH 1LCYA 1PPGE 3V3MA 4Y8YA 4ISLA 5FAHA 3MNBA 2Z9LA 4ZHAA 1TNIA 3ODFA 3Q77A 1O3PB 1TA2A 1P2MA 3NZIA 1O3HA 1OSSA 1VITH 2ZHEH 1C5YB 1BTWA 1GJ9B 3SJ8A 1M9UA 4DURA 1FY1A 2GCHG 1BMNH 3QTVH 3P8GA 1QB6A 1OWDA 2SNWA 4MVNA 2UUKB 3BN9A 5EXNA 3A7XA 3Q00A 4KKDA 1T4UH 5FBEA 1HAVB 1O2IA 4Y76A 2B5TB 1W7GH 1EUFA 2Z3EA 2F91A 1Y3WA 2C8WB 2IN2A 4DGJA 4O3UA 2ALPA 1ZGIA 1G37A 1GCTB 1O3BA 3S7KB 3A88A 3U8OH 2G4UA 4BAHB 2R3UA 1OOKB 4JK5A 1T8NA 4B76A 3RMLH 2FLBH 5L6NH 5FX5A 1T32A 2CF9H 3ZV9A 1WAYB 1KXBA 1C1RA 1D4PB 1HFDA 2R0KA 4Y8XA 2A1DB 4I7YH 4A1VA 1FXYA 1O2TA 3BTKE 1AIXH 3SV6A 4NGAH 1LMWB 1NU9A 1S85A 2JKHA 1D3QB 4HI3A 4CRDA 3RM2H 1HGTH 1FQ3A 5G4BA 1GHVH 3FP6E 3BTEE 1GBHA 3A8BA 4DIIH 1DDJA 1XUIA 4UONA 4AN7A 3ZZ3A 1UTOA 5DP5A 1SGNE 1AE8H 3M7QA 4OS4A 1GMHF 2FESH 1AFEH 1V2RT 1TBZH 4CRAA 3S0NA 1C5SA 4MTBA 1FAXA 2OLGA 2NU0E 4X1QU 5LPEA 4OS1A 1Y3VA 1SGQE 4O97A 1LVMA 1DWCH 3BTGE 1HXEH 2FM2A 1E34B 4FUDA 4WH8A 4NCYA 2ZFRH 1N6XA 2PUXB 4X2VA 3BEUA 1UVOA 1ELCA 2O8MA 4ZAEA 4M7GA 1LVBA 1T31A 5EG4A 5IDKA 4I8KA 1EQ9A 2W3IA 2FZZA 5DP6A 3PMHB 2V0BA 3D49H 2ZO3H 2Q6FA 4RKJB 2CHAC 1YPKH 5EQQA 5PTPA 5EXLA 4Y71A 3A80A 1VCQA 1G32B 4ABGA 1EKBB 3ATIA 2VWMA 1V6DA 1O2QA 2ODPA 3SQHE 4TY7A 2PKSC 2GV6A 1TX7A 1NRRH 4VGCB 1O33A 2W26A 1NZQH 2FOAA 4F4OC 1GMCF 2R3YA 1K2I1 1GHAF 1P2OA 3MH4A 2AIQA 3PWBA 1FI8A 1O2GH 1AY6H 1TALA 2R0LA 4MG3A 3M5OA 1HXFH 4JYVH 5HXFA 1G2LA 4BAMB 1GI3A 3F9FA 3Q3XA 1GCTC 1RTKA 2JH0D 3AASA 2AMDA 2FWWA 3EA8A 2C4FH 1ARBA 3P6ZB 2P94A 1DSUA 1GL1A 3KQEA 1VZQH 5EGMA 1XUKA 4CBOA 2TGTA 1GL0E 3TNTA 2NU4E 5DP7A 4OS6A 3HGNA 4BXWA 4YLQH 2GD4B 3SNEA 3RXOA 1LQEA 3HK3B 1CGJE 1LHGH 4NFFA 3L33A 1ESTA 1BUIA 1ZHRA 1O2KA 3VB6A 1DE7H 2BY8X 1TGCA 2WPMS 3P8FA 4CRFA 4NZQA 2ZIQH 1J14A 4GPGA 4Y7AA 3GY3A 2GZ7A 2O8LA 1HRTH 2VGCC 1CO7E 1PYTC 1TX6A 3E90B 3TK5A 1NESE 2BM2A 2Z9GA 1W14U 2XRCA 3IITA 2F9VA 2WUBA 3UREA 1RFNA 2P95A 2SGQE 5TCAA 4D7FA 1MUEB 4O3TA 3SV8A 1P10A 1C4Y2 2CXVA 4Y7BA 2WINI 1SOTA 1UJ1A 2A5KA 3BSQA 2VB0A 1IOEA 1L4DA 1C2GA 2BY9X 1PQ5A 1OP0A 1AO5A 1LKBA 1HJ8A 3PO1B 4I32A 3SU0A 1C2HA 4YT7H 1BMAA 2FOHA 1V2TT 3ZYDA 1ZSLA 4IMZA 1GBKA 3VXEH 2ZDLA 3GCTF 8GCHG 2BD7A 4AG2A 1TPOA 1C5MD 4B2AA 3PB1E 4AG1A 2PWXA 3ZZ7A 2H9EH 1GDNA 2BD5A 3GY8A 9LPRA 1AB9C 3RXRA 1RD3B 1YCPH 3TIUA 1ANDA 5LGOA 6CHAC 2BB4A 1ZMLA 1KXCA 1ZPZA 4DW2U 1C2KA 1P9UA 1DANH 1N1LA 2OTVA 2ZCKP 1DT2A 3LKWA 2ZTYA 3E8LA 1PQ8A 4CHAC 3PROA 2C90B 4B73A 4MDSA 3RXAA 1FMGA 4ZHLU 2J4IA 2HGTH 1TOCB 4FUCA 1YLCA 2Y7XA 1UMAH 2R2WU 1IQNA 1GJDB 3OYPA 4AFUA 1O36A 5FPTA 1GHYH 5T3HA 3GDVA 1V2QT 2SFAA 4K1EA 1A46H 1O2MA 2XWBI 1UHBA 1E0FD 5F6MA 2J38A 2EEKA 4OGYA 2ZCHP 3SHAH 3RXUA 2QV1A 3GYLB 3A8AA 3UOUA 1O5GH 2F9PA 3RXDA 2G52A 2Y82A 1SPJA 1PJPA 2JETC 3RXMA 3T27A 4XBCA 1HIAA 2KAIA 1O3JA 3VB3A 3ZVCA 4A6LA 3CP7A 3AW1A 3M7UA 1LDTT 2AERH 4K1SA 3S7HB 3UWIA 3NK8A 5C2ZA 3UFAA 1C9TA 1DWEH 2VIDA 1UTQA 1MMJN 2FI4E 4ISIH 5C1XA 1MAYA 1Z1JA 1QCPA 1GJBB 5T6DA 5GJ4B 2A2QH 4MLFB 3A85A 1ZOMA 1NROH 2A7JA 1C2EA 4K8BA 4NA7A 4NWLA 1SQOA 1XUGA 3E0PB 1C9PA 1K1OA 1MD8A 4LXBH 1P02A 3LC3A 3PO1C 4IN2A 2VIWA 2ZGHA 1XXDA 3W94A 1N8OB 1ZR0A 3MU8A 3PV4A 3MO6A 1J15A 1GBBA 1H8DH 3E16B 1YPMH 5A0BA 2ULLA 1GWAA 1G36A 3GYMA 2ODYB 1C2LA 2VWLA 1GBJA 1C1VH 5DKMA 2OCVB 1MKWH 1GHWH 1P9SA 5F8TA 1HYLA 4LZ4B 5DPAA 1C5XB 3D62A 7KMEH 1FN8A 1O2JA 1GI5A 3SI4H 3VFEA 1QR3E 1SSXA 1O0DH 2ZPSA 1BJVA 7GCHG 3U1JB 1QQ4A 1PPBH 2QN5T 1VGCC 4GSOA 4I8LA 4JK6A 4DT7B 4THNH 1EAUA 1O31A 1TRMA 1QBVH 3GY2A 4AB9A 1TYNA 2DE9A 3SNDA 1BCUH 2FS9A 4IBLH 1A3EH 1GI8B 1LPZB 5EODA 1O32A 1DOJA 1GI9B 4BANB 4X6PA 4BAKB 2LPRA 4ZXXH 5HM9A 3ATMA 3MH6A 3LGTA 2HALA 3DUXH 1EAIA 1AUTC 1TMBH 2GZ9A 1ANCA 1GBDA 3A7TA 3PTBA 3SO3A 4NA8A 2B7DH 1W2KH 1GI7B 1AVGH 1JRTA 3A8DA 3BG4C 2ZGJA 1G3EA 4X2WA 1GGDB 3FANA 2P3UB 1GMDG 1O3NA 3E0NB 4A7IB 5C5OA 2PGQB 1C5OH 5FX6A 1TNGA 4X1RU 1EASA 1C5QA 1T7CA 1GDUA 3UIRA 2B8OH 1YPGH 1MQ6A 3V13A 3AW0A 1FY4A 5BPEA 1JOUB 1GVZA 2BDBA 3LGYA 1P2QA 3TITA 2HNTC 1ZPBA 2G81E 2C8XB 4E05H 1ZRKA 2Z94A 4TPIZ 1O3CA 1C2IA 1JXPA 2UWLA 2IOTA 2PGBB 4AOQA 4NZLA 1DFPA 4IC6A 1GBAA 2ZG0H 4H42U 3BTHE 4X6MA 3M5MA 2BVXH 1SGFG 3U69H 1ZRBA 4B2BA 4CRCA 2ZP0H 3FFGA 1EXFA 1OP8A 1BHXF 2BDIA 5HMAA 5ESBA 1TQ0B 3HGPA 1YCPK 2THFB 1N8OC 1KLJH 2BXUH 3DT0H 3GY7A 1GBFA 3N7OA 4Q2KA 1EPTB 1P11E 2HRVA 1QTFA 3F9GA 1O5CB 3E1XB 1O3IA 2ASUB 5E0GA 1ELVA 1SGFA 2AIPA 1ELDE 5EU8A 1ELAA 2FOBA 3HK6B 2FI3E 1BA8B 1C4U2 3ZVFA 1O2YA 1QL7A 2PUQH 1UTJA 1AWFH 1C5TA 3HKIB 1SB1H 3SGQE 3K6YA 1LO6A 1F92A 3A87A 2VWNA 2BZAA 3LJOA 1O3FA 4ZROA 2XBYA 4K2YA 4XFQA 3PMAB 3ZVAA 1TBQH 4J1YA 2FYQA 1MTSA 1BTUA 2BTCE 1S84A 1C5NH 3OY6U 1S83A 1D6WA 3K9XB 1GHZA 3LH3A 3V0XA 5TCCA 4WMFA 4D8NA 2XC0A 3ODDA 5JB9S 4UFEH 3VB5A 1THSH 1BB0B 1YPEH 1GGDC 3KCGH 3ATLA 2G5NA 1TPAE 1QQUA 4DG4A 4CH8B 5A0CA 1MZAA 3RXKA 2V3HH 1NT1A 2QF0A 2A0QB 3LPRA 3CS0A 2AEIH 2Y6TA 1OP2A 1O2VA 1SHYA 1W10U 3SUEA 1EZUC 5JDUB 3Q3YA 5DP4A 3SBKA 1G2MA 3BTTE 5GCHF 2C8YB 1BRCE 1HIAB 4GVUA 2SGPE 3RXPA 1PPZA 1QRWA 1S5SA 1H9IE 3PLPA 1MU6B 1HAYB 5F03A 1BHXB 1K22H 2QXGA 1F5KU 2HPQH 2OC8A 1BTHH 2OUAA 3M3TA 2Z6BD 4YTAA 1SGYE 1MKWK 1MZDA 1GMCG 2A4OA 1W3CA 1GHAG 1V2VT 4E7RG 1UTPA 4MNYA 2ANYA 1NTPA 5A0AE 1A5HA 1DITH 5A8XA 4B2CA 4BTTB 1Z8GA 2VVVA 3V7TA 1IQIA 2OC1A 1WSSH 2QF3A 3H7TA 5GIBA 4ZMAH 1NRSH 2WPIS 3RXJA 2FPZA 1IQEA 2ZFTA 1WQSA 1EPTC 1BJUA 3AAVA 1DICA 2P8OC 5ABWA 2VIPA 1AKSB 4GHTA 1ZJDA 4MQAA 2CHAB 3RMMH 5L2ZH 2AFQB 1FY8E 2BY5X 3SU1A 2ZHWH 6LPRA 2XTTB 5FPYA 1O37A 1QJ7B 2WPLS 1ELFA 4CREA 1BBRH 4Q7XA 3VB7A 4BTUB 2ZPRA 1BRAA 3M5NA 1INCA 1LTOA 2PKSB 1HJAB 3RXVA 5C67A 3TGIE 1QIXB 1BTYA 1O2NA 3SJIA 3U1IB 5FBIA 1WU1A 2FTMA 3M3SA 3PTNA 2TGAA 2OP9A 1J9CH 3KL6A 4JZFH 1SFQB 4X6OA 1Z6EA 4Y0ZE 2W7SA 1L1GA 1O2RA 4FVBA 4MPVA 3ZZDA 4AGKA 2XC4A 2XC5A 1AUJA 3LU9B 1TFXA 4Y11E 4ABBA 4D76A 4YOGA 2ZGCA 3L3TA 1BRUP 4LOYH 2PSXA 3SI3H 2A4QA 3ZVBA 3KQBA 1UCYH 3ZVEA 3C1KA 3VPKA 3UR9A 3SU5A 1DXPA 2TBSA 4DOQA 1SLXB 1EATA 3QZRA 2OC0A 1GJAB 5C1UA 3T2NA 1W8BH 2PTCE 3A7YA 4I8JA 3SV2H 3F9HA 1QBNA 2PTNA 3LGIA 4XBDA 3ZZBA 4WY3A 1SLUB 2ZKSA 3GCTG 3TNSA 2H2ZA 1RTLA 2C3SA 3SQEE