5LPFA

Kallikrein-related peptidase 10
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
203
Chain Sequence
PCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDQGEQLRRTTRSVVHPKYTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTANKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the Zn2+ inhibition of the zymogen-like kallikrein-related peptidase 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Kallikrein-10
total genus 41
structure length 203
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2016-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpfA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpfA02
4ABGA 3RXHA 1CT0E 1C1OA 1O5CB 4I8LA 3GCTF 4RKOB 1LKBA 1VR1H 1QBNA 3RU4E 3BTFE 1H8IH 3RC6A 2H9TH 4CREA 4CBOA 3K6YA 4B74A 1NRPH 4Q7XA 2FPZA 5L6NH 3TNSA 2FI3E 1BA8B 1FN8A 4FU9A 2VIWA 3C27B 4BANB 2ZFFH 3UOPA 2GGVB 1RFNA 1BQYA 1TWXB 3M3TA 4UFEH 1FN6A 3PV4A 1O2IA 3AAVA 2DUCA 2FOGA 3SUDA 1BRBE 2HNTF 1YCPH 2ZHWH 3RC4A 3OYPA 1SLXB 3EGKH 2Z3DA 4H4FA 3V0XA 3LJJA 5H4IB 2PGBB 3T26A 1DX5M 3Q3XA 1GJAB 1TALA 1IQHA 3HATH 3PMBB 4UE7H 4IMQA 1Z1JA 2RDLA 3E3TA 1XVOA 4U01A 5EXNA 2A7JA 1C5YB 1H1BA 1O35A 4ABHA 1OPHB 2ZP0H 1E0FD 1ZMJA 4MNWA 1EPTA 4CH8B 1C5SA 1YPKH 3EE0B 4CRDA 2G5VA 1FY1A 2AH4X 3P92A 3ZVDA 1ZJDA 5CHAB 2A4OA 3RXRA 3RLWH 1ZTKA 2BQ7B 1GBTA 1GI7B 1AZ8A 1V2QT 2FTMA 3UREA 4ISOA 3LH1A 1FJSA 3FFGA 4O03A 1V2UT 1W14U 3GDVA 4X6PA 1KLIH 1KXCA 6ESTA 4LK4A 1C1UH 1UTOA 5FBIA 1C1VH 2QN5T 2ANYA 1HB0B 1PQ8A 4K8BA 5AFZH 1M9UA 4A1TA 3UQVA 1S0QA 3SU2A 9ESTA 2GT8A 3WY8A 1GDQA 1SHYA 2HGTH 2XWAA 2ZQ2A 4Y11E 3GY3A 3RXLA 1ETRH 1GI4A 5E0JA 1HJAC 2FX4A 2O8LA 5FPSA 3I77A 1EAXA 1LHCH 2A2XH 2RCEA 1ZMNA 4FUHA 4JYVH 1LVBA 4D7FA 1S85A 1BOQA 1Z8RA 1QL7A 1G36A 1Y5BT 5A8XA 4THNH 5DP7A 1GBKA 4MQAA 1TGTA 1TQ0B 4CH2B 5FPTA 4VGCB 1PPFE 4I32A 1PQAA 3V13A 3MH6A 2VIQA 2Z7FE 3GCTG 5AHGH 1BITA 1C5PA 3DUXH 2G4TA 2ILNA 1VITG 3MU1A 1NRRH 1Z7KA 4MNYA 1FXYA 2XRCA 2XBXA 3S7HB 3TK5A 1S6HA 1MH0A 2XBWA 3FAOA 4WMFA 2ZPQA 4DVAU 1TGSZ 4NG9H 1BDAA 3PMJA 2OC8A 1O5EH 1LPGB 3FVFB 1SGIB 3PROA 1TPOA 3SGBE 1GDUA 1B0EA 1P57B 3LGUA 1K1MA 1EOJA 5E2PA 1HIAB 1TNHA 1F7ZA 1XXFA 2ZEBA 1HDTH 1C4V2 1A3BH 2XYAA 2WUCA 2HLCA 2W5EA 2WYGA 2BDCA 1C2KA 3P8GA 1THSH 4GLYA 1IQFA 1GBIA 2ZTXA 2ZFRH 5GCHF 3O8RA 1C2GA 4KP0A 4B2CA 1GBCA 2Z9KA 3FZDA 1P05A 1MU6B 1F5LA 1A0LA 1JMOH 1E34B 1MAYA 1GG6C 4K5ZA 1SGYE 2ZDVH 3RXJA 1AN1E 1TQ7B 1T32A 2BDIA 3OX7U 2ZFPH 5HXFA 2C8ZB 1LHEH 3HK3B 3IITA 4ZXYH 1O3DA 5GXPA 2QF0A 4X6MA 1WSSH 4CR9A 4D7GA 4U30A 4HFPB 3F9FA 2P3UB 3GYMA 1GJ7B 1O2QA 1SBWA 1ANBA 4ZHMU 1GBDA 2F9VA 1GJ6A 1WBGB 1FY3A 1GGDC 1QBOA 1TONA 1YYY1 2FTLE 5F8TA 4ZXXH 2QCYA 4MLFB 1Q31A 1RS0A 5G4BA 4WH8A 3HGPA 4GPGA 1GI6A 3GICB 1J17T 1FV9A 2HRVA 3ZZDA 1WYKA 3E0NB 2XNIA 2QA9E 2XCFA 1QNJA 1DITH 2CGAA 5E2OA 3UNSA 4IC5A 4Z0KA 3MNBA 5GPIB 1JIRA 4ESTE 1C4Y2 2Y81A 2STAE 1K1NA 1WCZA 1ZPBA 1HRTH 2Z3CA 2ZTZA 5FHTA 2OTVA 3PO1B 3MNCA 2ZTYA 3EA7A 4GCHF 2BY8X 1DWCH 1O2UA 4NSVA 1QRZA 5DP4A 5F6MA 3VXFH 1OKXA 4XBDA 1GVLA 1PPEE 4E05H 4JK5A 1RIWC 2BDYA 3RU4T 3FZZA 3SHCH 4YLQH 1THRH 1QJ6B 4SGBE 3ZYEA 3BTEE 1LVMA 3F9EA 4OS4A 4NA9H 1TGNA 5FBEA 2WV5A 1EB1H 2ZNKH 2BX3A 1C5NH 2YNBA 1FMGA 1NROH 1DM4B 1CHOG 4IBLH 5DP3A 1O2PA 3FP6E 4INKA 1SGDE 3QK1A 3QWCH 3RXPA 3SV8A 1N8OC 4A92A 3FP8E 2FZZA 3NKKA 1GJCB 2OCVB 1VZQH 1EQ9A 1EKBB 1YPLH 2TGDA 2EA3A 3RXIA 1GI8B 4ZUHA 1CT4E 1IQNA 1BB0B 1SGEE 2J94A 3A88A 3NCLA 3MNXA 1G30B 2FWWA 4FUCA 2XWBI 1LO6A 1NT1A 2FXRA 3EAJA 3D62A 3KNXA 4LXBH 1QIXB 1AVGH 3SJIA 1BHXF 3KQBA 3KL6A 3KHVA 3SOSA 1O3AA 1UTKA 4INLA 1CU1A 1MMJN 2ZZUH 3UR6A 2ZF0H 3RXGA 3QLPH 2FLRH 1BCUH 2VWNA 1W13U 1O5AB 5L2ZH 1DT2A 5LH8A 4YT7H 2J4IA 1ANDA 1H9LB 1A46H 1MKXH 4MNVA 1QGFA 1V2TT 1GI9B 1TBZH 2OXSA 2C8XB 1TMUH 4OGYA 1GJDB 3RXDA 2AERH 3UR9A 1GBAA 1NRQH 2OC1A 2PKAB 2ZGXH 1Y3WA 1H4WA 2C3SA 3GOVB 3M5OA 4MPUA 1UVPA 1C2LA 2ZDMA 1C1PA 3MYWA 2UUKB 1GI5A 1MQ6A 2FOAA 3MO3A 3ZZ6A 4AG2A 4X2WA 5E0GA 1IQKA 3TJOA 1SQAA 4O3TA 3LGIA 3MNSA 1C1NA 1ELDE 1GG6B 1SB1H 2ZU5A 1FUJA 4ZKNU 2QC2A 1BTZA 1AWHB 2JH0D 2TGAA 5LGOA 3RXAA 2C93B 2QY0B 1WOFA 2ZHFH 3A7XA 3SU6A 1AHTH 1LQDB 2AMPA 3VB4A 3IWMA 3UY9A 3PWCA 5FAHA 3U9AH 2ZCKP 1HYLA 1P11E 6CHAB 1L1NA 1P2OA 2UUYA 4MNXA 2B5TB 1DUAA 3MI4A 3GY6A 1S6FA 1NC6A 2SGAA 2QF3A 1GHVH 4KGAA 2GMTB 1XUGA 4FVDA 1XUFA 1MTSA 3A89A 1S5SA 2FP7B 2GV6A 4Y0YE 3M35A 2P3FH 1EASA 4R0IA 2O8TA 1T4VH 1GJ5H 5HM9A 3M36A 1L1JA 1WQVH 1BTXA 2PUQH 1OSSA 1AKSA 2ALPA 2OQUA 1V2NT 2FO9A 3GY4A 5J4QA 4YLUA 1P9UA 3DT0H 3TGKE 6GCHF 4IS5A 3GY5A 3TNTA 1A2CH 2ZCHP 3UNRA 1RRKA 4NZQA 1SGRE 2YOLA 3GY2A 4Y71A 3RMMH 3PO1C 3GCHC 1C2EA 3MOCA 4X6OA 1YKTA 3HKJB 2PKSC 1Y3YA 1RTKA 2WYJA 1PPBH 3RXQA 4NGAH 2A1DB 1P0SH 1MAXA 2PFEA 2P8OC 1A61H 4YESB 3LC3A 1UK3A 3CS7A 2QXHA 2BD8A 1TNJA 2CJIA 2C8YB 2VIPA 1V3XA 1SFIA 4Y79A 1ZSLA 5EXLA 5FX6A 1D4PB 4UONA 2CHAB 1DSTA 4BAKB 3ATWA 3S9BA 4NIYA 1HXFH 5BRRE 2OBOA 4AYYB 1MZDA 1FONA 2A5IA 2STBE 3Q3YA 4Q2KA 1EJMA 3MO9A 3SU1A 1N6YA 1D3QB 3GISB 2ZFTA 2VVVA 1O3FA 1IQGA 2AGEX 3RXFA 3A8DA 5CE1A 2SGDE 1BRAA 2ZDKA 5C5NA 3RU4D 4TWWA 2V6NA 3V7TA 1WUNH 1GBMA 1MZAA 1D3TB 1OP2A 1C1RA 3KF2A 3PM3A 3LIWA 1GCTB 1NFXA 2FIRH 1O2HA 3TK6A 4OS2A 1DICA 3E90B 3JZ2B 2IOTA 1HNEE 1O2TA 2ANKH 4U2WA 1T31A 4AORA 1HAYB 3P8OA 3TH3H 1VJ9U 2VWMA 3QDZB 1A1RA 3SGQE 1ELVA 3A8AA 1XUHA 1ETSH 2PR3A 4GCHG 1NO9H 4NCYA 1FIZA 1BZXE 2P59A 2WPHS 2ZA5A 1P2QA 1JRSA 3UIRA 4JK6A 3HK6B 1OWIA 4AZ2B 1GBHA 2Z3EA 2BD3A 4UD9H 2GT7A 5E8EH 1EZQA 1JRTA 4NWLA 5FCKA 1O37A 2A31A 3Q00A 2TGTA 1KDQB 1O2JA 3OSYA 2PV9B 4JCNA 4MPWA 4XSKU 2ESTE 5AFYH 2R2WU 1T8OA 3SJ8A 3U8TH 2ZKSA 3NK8A 1O3BA 4I8JA 2HVXA 2ZWLH 2CN0H 4DJZB 2G52A 5T6GA 1MD8A 1V2MT 1TE0A 2P3TB 6GCHG 2GCTC 3ENSB 2ZECA 4Z6AH 3SV6A 1ABIH 4GSOA 3A7WA 3SZNA 1O2LA 5EU8A 1ZJKA 3EA8A 3A81A 4BXSA 1YPHE 1O2SA 1UTJA 1C2JA 1GL1A 1INCA 1AI8H 3M7TA 2FOEA 4X1QU 1V2RT 3GCNA 4CRAA 2LPRA 1W7GH 2ANMH 4X1NU 1BMMH 4JYUH 3TGJE 1FIWA 1BTYA 1K1OA 2H9HA 2HPPH 4X6NA 2V0BA 4ZH8A 4WMDA 1HV7A 3DHKH 3ZVBA 1AD8H 4WVPE 1UTLM 2AMQA 1UTPA 3SNBA 1NTPA 3FP7E 2W7UA 3MH4A 4Y8XA 3PTNA 2YNAA 1S84A 3SNCA 1YLCA 9LPRA 1C4U2 4KKDA 4ASHA 2ZU4A 2O8WA 3PTBA 2D1JA 3NZIA 3VB6A 3U1IB 3BIVH 3VXEH 4BTIB 1IHSH 1AY6H 2RA0A 4ISNA 1J8AA 4TPYA 1C5MD 1TMTH 2J34A 4UFFH 3BSQA 2ZU3A 4ABFA 4GAWA 3TH2H 1UVTH 1DWBH 3E16B 1BUIA 4JZEH 2CV3A 1V2VT 4FXGH 3BIUH 3TJVA 1TNGA 1G3EA 1GMHF 1O5BB 1O2WA 2GZ8A 1NZQH 2J95A 5J4SA 2ZGJA 1MTNB 1HAOH 2VWLA 1UHBA 1SLWB 2FLBH 3RLYH 3QGJA 4J1YA 1NESE 1AE8H 2FI4E 4DY7B 2F83A 2Z9GA 4F49A 1AIXH 4BNRA 2VVCA 3RM2H 1OYTH 1Z6EA 4X1PU 3QTVH 4B1TA 1D6RA 1FDPA 1HJAB 1CQQA 4D8NA 3P8FA 1BBRH 1GL0E 4NIXA 3SHAH 1PPGE 1KYNA 4LOYH 1GJ8B 4CHAB 2HALA 1LHFH 2XW9A 3BV9B 5C3NA 2Q1JA 2C8WB 3SQEE 1K9OE 4BTTB 5JBTA 5EPYA 1IQLA 1O2XA 2OUAA 1QCPA 2SGQE 4ABJA 1GBJA 4LZ1H 4Q7YA 1C5TA 1KXDA 4I8KA 5CMXH 2QXGA 1CGHA 3LGVA 4YO9A 3SN8A 7GCHG 7ESTE 1LPZB 1XMNB 1SL3A 4O97A 2HNTC 1QBVH 3MU5A 4Q80A 4YTAA 3UPEA 5GWZA 1K22H 3T25A 1DY8A 3RXKA 1G32B 1PPCE 1W2KH 1AVWA 3M5NA 5JYIA 1P02A 4DT7B 1B5GH 1NPMA 1MBQA 3O8BA 2ZDLA 4MDSA 3MH5A 5EGMA 3P6ZB 4B2AA 2XC0A 2WUBA 1ESTA 1MTUA 3P95A 1P04A 1YM0A 3EDXB 5K7RA 2OBQA 3MU8A 1TRMA 2B9LA 2OINA 7KMEH 4GVUA 3S7KB 4JZ1A 1S0RA 1WTHD 2Y7ZA 3BF6H 4ZKRU 5HGGA 1C2FA 5C5OA 2BDHA 1CHGA 2JETB 1ESBA 2BDBA 4MTBA 3ZV8A 1GHAG 1O5GH 3B8JA 1TYNA 1GHBF 1NFYA 1GI1A 3KEEA 3S69A 1HIAA 4FUFA 1AMHA 2A7CA 2BY7X 2XBVA 1ZOMA 3LPRA 4WWYA 1DWDH 1O33A 4ABIA 1G2MA 1ARBA 1UVOA 2ZHDA 8ESTE 1DXPA 1XKAC 1EZXC 3EYDA 5L2YH 4R8TB 1AWFH 2GDEH 1F92A 3GCOA 3VGCC 1G37A 2O8MA 4O3UA 1XVMA 4BXWA 1QB1A 1TPAE 1O2MA 1Y59T 3M5LA 1F0TA 3GY8A 2GP9B 1MUEB 1TPSA 1EXFA 1A5HA 2BD7A 4TWYA 1KLTA 5T3HA 4RKJB 3A7TA 2H2ZA 3MU0A 1PFXC 1TMBH 3DFJA 1KDQA 3UWIA 3AASA 4K1EA 3A7ZA 4WF8A 5HM2A 4I8HA 1C1TA 1SQTA 1GJ9B 2Y82A 1W8BH 1E35B 5EPNA 3UTUH 2BDAA 1Q3XA 2ZIQH 1AUJA 1KXBA 3FANA 1QA7A 1QL9A 3ZZBA 4O9VA 2ZGHA 2WPJS 1FPHH 3BG4C 1BJVA 1BRUP 2BY9X 2ZHQH 1O3PB 1BHXB 4I31A 2I6QA 2P95A 1DANH 3SW2B 1KTTB 2ZDAH 1OWJA 4GUXA 3RXMA 4A6LA 1IQJA 1YPJH 1QL8A 5F8XA 1Y8TA 1UCYK 1SHHB 1ELGA 3PLPA 1TA2A 1F0SA 1S83A 2BXUH 1Y3XA 2WV4A 3PLKA 3K65B 2NU3E 3LGYA 4ISIH 4E06H 1TRNA 3DA9B 3KIDU 3TPIZ 1RTFB 1EP5A 1C1QA 5DGJA 4YOJA 3VB7A 3SGAE 2UWLA 4XFQA 2FOHA 2RA3A 3PWBA 1P2MA 2PW8H 5JB8S 1LCYA 3U8RH 1FPCH 1AVXA 1QRWA 1A5IA 1SSXA 2GKVE 2XXLA 4IN2A 1MD7A 2AS9A 1AFEH 4X0WU 5GIBA 1F5KU 2GX4A 4BOHA 4DW2U 1SR5C 3F1SB 4K2YA 3O8CA 4B2BA 2F9PA 1ZRBA 2ASUB 1W7XH 1TGBA 1MCVA 3F9GA 1Z8JB 4OS6A 4H42U 2ANWA 2XCNA 3SORA 1HCGA 2H5CA 3RMOH 2VU8E 1TBRH 1LQEA 3BTKE 1V2JT 4GHTA 1LHGH 1L0ZA 4K1TA 3F9HA 1QB9A 3LGTA 3TITA 3RUOA 1Y3UA 2Y7XA 1SC8U 1G3CA 1E38B 2JH6D 1IOEA 1LVYA 1ZHMA 2TBSA 2G55A 1QR3E 2PUXB 6CHAC 4WJG2 1L4DA 1GCTC 1FI8A 1GMHG 3A7VA 3PMHB 1YF4A 1T8MA 4ZAEA 5GCHG 5ESBA 4DCDA 1O2KA 1O3HA 1DDJA 3VB3A 1A7SA 2FESH 1CA0B 3A8BA 2BLOA 1O5DH 1Y5UT 1FAXA 1TNKA 4XOJA 1OWKA 5EOKA 3NPSA 1ESAA 1L1GA 2A2QH 1KXFA 4FUIA 4ZHLU 3TU7H 1EX3A 3LT3A 2FDAA 4ZROA 5HYOA 2BD4A 1ZGVA 2IJOB 3M3SA 1ANEA 1ELTA 1DPOA 3BTDE 2R2MB 2CF9H 2BXTH 2BD5A 2Z9LA 1ZHRA 1YLDA 2A4QA 3BTME 3T29A 3A7YA 4K1SA 1D3PB 2BVRH 3PB1E 1A5GH 8GCHG 2DE9A 4B71A 1HPGA 4FUEA 1IQEA 7GCHF 1HAPH 2FYRA 2G5NA 1C2DA 5ABWA 1UMAH 1NM6A 2PSYA 3RXEA 5C20A 2C90B 4JZDH 1EAUA 1O2RA 1WV7H 2AGIX 3DFLA 1YC0A 5A8YA 5JBAS 3A85A 1P12E 4FU8A 1O3CA 3K9XB 4WH6A 2VH0A 2CF8H 1QTFA 3M5MA 3QO6A 1A4WH 2OLGA 3QZQA 1GWAA 4K60A 2BVSH 4NFEA 2Z9JA 1GCDA 2WINI 1ELEE 2FI5E 4Y6DA 1MQ5A 2BZAA 2AIPA 2JKHA 1H8DH 2O9QA 2GV7A 1TPPA 2AIQA 2A32A 5PTPA 2I6SA 2FM2A 1GHXH 2GZ9A 5DJ7A 1PYTC 5I46H 4ZMAH 3A83A 1GI0A 3M3VA 2ZI2H 1V2PT 1VCPA 1A3EH 2UWPA 1SGFG 2UWOA 3A8CA 3SJKA 2Y6TA 2FOBA 3SBKA 2ZPSA 1AKSB 1QB6A 3ELAH 4NSYA 1GI2A 1TLDA 3Q76A 3V12A 4E7NA 3S9AA 1G9IE 1UVSH 1K28D 4K8YA 3SUFA 5DO4H 4LZ4B 2QXJA 1N8OB 5JBCS 1FAKH 5EG4A 3KQEA 3ATIA 1SGCA 3MO6A 4TY7A 3ESTA 3M61U 1J16A 4MPVA 1EUFA 3GYLB 3L3TA 1NY22 3D23A 3QUMP 5FX5A 1LTOA 1AGJA 2AEIH 2ZFSA 3BG4B 4E7RG 1W3CA 3B23B 4UDWH 1GDNA 3RDZA 1P2NA 1SG8B 5T6FA 1GVZA 2VVUA 5CHAC 2FS9A 3ZZCA 4X8VH 3F68H 4DIHH 4HTCH 3OTJE 5DPAA 4BTUB 4F4OC 1F5RA 1GBFA 1JIMA 1NRSH 1C5VA 2OD3B 1UJ1A 2H9EH 1CBWB 1O3LA 1SI5H 1Z8GA 3QX5H 3RXUA 1O2GH 2NU4E 3PMAB 3K2UA 2GCHG 1EB2A 1RGQA 1O3NA 4FUGA 1BJUA 3MFJA 1CA8B 1ELFA 1VCWA 2ZCLP 3HKIB 2WPLS 2ZFQH 5ETXA 4WXIA 1RJXB 1OWHA 2AMDA 2GMTC 8LPRA 4OS1A 1TX8A 1TA6A 2IPHA 1QFKH 2BQWB 3ODFA 1L4ZA 1H9HE 1OWEA 1O2YA 1ZTLA 2BX4A 4YT6H 5DKMA 1TOCB 5LPFA 1C2IA 1VGCC 3AW1A 5LPRA 2NU0E 3I78A 4B73A 3RP2A 1ZSKA 3KQCA 2BVXH 2THFB 4TPIZ 3RXTA 4YOIA 1ZMLA 3T2NA 4I33A 1DLEA 1ETTH 4FUDA 1EOLA 1YPGH 4AFSA 4A1XA 4CR5A 2QIQA 1O2OA 3BG8A 2ULLA 3A84A 4Y76A 1C1MA 2W26A 1OP8A 1VITF 2FS8A 4KTUA 1ZR0A 1O3JA 5DK1A 3SV7A 2A45B 1PQ7A 4ABBA 1FZZA 1U6QA 4RN6A 1BIOA 1T4UH 2HNTE 3LONA 2SGEE 1S82A 3MMGA 2DE8A 1G2LA 3C1KA 5TCAA 1ZYOA 1P3EA 1CBWC 1O3OA 1QA0A 3QN7A 1HAIH 1LVOA 1D3DB 5C2ZA 1W12U 1YP9A 1BTPA 3LOXA 4GHQA 3RMLH 1CA0C 1SGFA 2G81E 4JZFH 1K1IA 4JYTA 1S81A 2FOMB 5EQRA 3KCGH 3MU4A 2QXIA 3MWIU 3W95A 4NZLA 5IYTA 1CO7E 1J9CH 1ELBA 2Q6GA 2VGCC 1P2KA 1TIOA 4J2YB 1XKBC 2ZU2A 2TRMA 1RIWB 1P2JA 2LNCA 4MPXA 3U69H 3VGCB 1ZGIA 2BB4A 4D76A 1WTGH 1J14A 2B8OH 1ZHPA 1O30A 1IQIA 4VGCC 5HMAA 3TJUA 4X1RU 2M5TA 2V35A 3TGIE 1HAGE 3KQDA 2CXVA 4U32A 2CHAC 2VINA 3AW0A 3OY6U 2AGGX 3M7UA 3UNQA 4Y7AA 3SO3A 1TABE 1C5RA 2J2UA 3ZZ5A 1Y3VA 1TAWA 5EW2H 4INHA 4KELA 4M7GA 2B7DH 3T5FH 1UVUH 3SJ9A 4I7YH 3HGNA 3ZVCA 4DURA 2NWNA 3ZVAA 1O5FH 2F91A 1P10A 5FCRA 1IHTH 4XE4A 4UFDH 2TGPZ 1V2ST 4OS7A 1C9TA 8GCHF 5JDUB 2IN2A 1WQSA 3ZVFA 4K3JA 2H1UA 3SU4A 1QURH 3GY7A 2BLQA 4X2VA 3QGNB 1P3CA 4AB8A 4AB9A 2C4FH 1QY6A 1Q2WA 3LDXH 1ACBE 2SNWA 1G3BA 1C5WB 3CENA 3STJA 1UO6A 2ODPA 1HLTH 2CMYA 1BBRK 1Z6JH 3U1JB 2UUFB 4XBCA 4DG4A 4NIWA 1LPKB 1PPHE 2Z9IA 2WPKS 2QAAA 2SGFE 1W0ZU 5DP5A 1TX6A 1O3GA 1C1WH 2QGRA 3LKWA 2VWOA 1BMNH 2SNVA 2BHGA 3MH7A 1TNIA 2BLVA 2VGCB 4YOGA 1DFPA 3TK9A 4AGJA 1SFQB 3E6PH 3URCA 4WY3A 5FPYA 3ITIA 3ZZ9A 3BEIB 2ZPRA 2V3HH 2EC9H 1DXWA 1YGCH 1BT7A 3ZZ8A 1B7XB 2OC0A 3T27A 5JBBS 1HJ9A 4A7IB 2P94A 2ZGBH 3E8LA 4NA8A 1OS8A 4AG1A 5A0BA 5BPEA 2FOFA 2BZ6H 2F3CE 3T28A 2VNTA 2A0QB 2W7SA 3UQOA 5AVDA 1TRYA 4ABDA 1TGCA 4AX9H 1ARCA 5DP9A 3DD2H 1MKXK 2D8WA 1EAWA 1K2I1 6LPRA 1OWDA 5ESTE 5DP6A 5EW1H 1C9PA 4WMEA 1AZZA 2BY5X 5DP8A 1Z8IB 1H9IE 2ODYB 1GJBB 2XTTB 1AB9B 1C5QA 3TVJB 4FU7A 1MU8B 1FY4A 3SNAA 5K0HA 3RXBA 1IQMA 1ELAA 3ZZ3A 3OU0A 1FLEE 1WU1A 1KIGH 5JPMH 2A5AA 2R3UA 3LC5A 1CVWH 1LKAA 2ALVA 2ZDNA 1NFWA 1O34A 2Y5HA 3ZVEA 1FY8E 2GD4B 5C1XA 3R3GB 3A87A 2OC7A 3RC5A 2EI8A 3ZZ7A 4AFUA 4Y10E 1DOJA 1SLUB 5B6OA 3GDSA 1GMCF 3H7TA 5A2MH 2FX6A 3F6UH 2A4GA 2F9UA 3SQHE 1F0UA 1V2KT 1P09A 1YBWA 4XBBA 3UOUA 1A0HB 3EA9A 7LPRA 1UCYH 3ZYDA 1Y5AT 2KAIA 1KLJH 1VJAU 2HOBA 1V2WT 5F03A 2FYQA 3CP7A 2AYWA 3SU0A 2XC4A 1ELCA 1N1LA 1O2NA 1KXAA 3A86A 1SGQE 2Q6DA 1CT2E 1AFQC 3MTYA 3E91A 4Y7BA 1DVAH 3H5CB 3LU9B 3RXCA 2J9NA 1EP6A 1ZPZA 1HAVA 2XC5A 1GMDF 4CRBA 4Y8YA 1SQOA 1AB9C 1NN6A 1UTNA 3ZV9A 4A5TS 1KSNA 2NU1E 3P8NA 3QTOH 4NIVA 4IGDA 3ZZAA 2R0KA 4AN7A 3LJOA 3ZVGA 1LMWB 1QJ1B 1UK2A 4X8SH 5EXMA 3SI4H 5C67A 1MTVA 1T8LA 2VH6A 3SNDA 4BAQB 1G3DA 3RXVA 4YM9A 2GCTB 3QZRA 1HAXB 4ZKSU 3BTWE 2ZHEH 1ZSJA 4FVBA 1CGIE 2FOCA 2BLWA 3Q3KA 3E1XB 4HI3A 1F2SE 1OP0A 4CHAC 2A4RA 1C5XB 1MCTA 1SOZA 3ZZ4A 1XUIA 2PHBA 4IC6A 1IAUA 3SU5A 1NU9A 2RG3A 1DWEH 1EJNA 1CHOF 2P93A 1V2OT 4D9RA 2HWLB 1SVPA 2GDDA 1BMAA 1EAIA 2VJ1A 4DGJA 5AF9H 1O31A 3MHWU 1NFUA 4CRFA 1OYQA 3RMNH 3VB5A 3SV9A 2VIDA 3NXPA 1HJ8A 4HZHA 1C1SA 1T8NA 4JMYA 3ATKA 1X7AC 5I25A 1KY9A 2AFQB 3V3MA 1SMFE 1TX7A 1YCPM 1SLVB 2Y5GA 3BTHE 2F9OA 3NWUA 1NRNH 1O32A 1QJ7B 1MBMA 2BDGA 1GBLA 1RTLA 1O0DH 1ZRKA 1O3KA 1O2ZA 2FMJA 1AFQB 1XXDA 1DUEA 2SFAA 1GHYH 3U8OH 1QHRB 1O2VA 1B0FA 2FEQH 1AU8A 1SGPE 1GPZA 2EEKA 1V2LT 1YPMH 3H7OA 4TYDA 1LHDH 3RXOA 2PTNA 3A82A 1PPZA 4AFQA 1SOTA 1JXPA 2J38A 2JETC 1GHZA 4AYVB 1ZPCA 1NU7B 3AVZA 1V6DA 3L33A 3S0NA 3D49H 1HAHH 1UHBB 3BEUA 2BMGB 3U98H 2G00A 3SUGA 4OGXA 1GHAF 1T7CA 1MTNC 3I29A 1GHBG 2Q6FA 1KTSB 1TNLA 1QQ4A 1N6XA 1EJAA 3UWJH 3UFAA 1P8VC 1C5LH 1SGNE 5A8ZA 5EQSA 4FUBA 2W3IA 4JZIA 2R9PA 2BD2A 2VIOA 1ORFA 1GVKB 1VCQA 2Z94A 2O8UA 4OS5A 4X8UH 3P70B 1O38A 1LDTT 3Q77A 5A0CA 3LH3A 2BTCE 3N7OA 3W94A 2A5KA 1HGTH 1UTMA 1NS3A 2QYIA 3BTTE 1XX9A 3G01A 1O3EA 2PSXA 1TOMH 1DLKB 1OX1A 1ZTJA 4ABAA 3RXSA 5E0HA 1HUTH 3BTGE 1EPTC 1MKWH 4YZUA 4UEHH 3ATMA 2BY6X 3GDUA 1VGCB 3SNEA 1K21H 4NA7A 4HGCA 1YPEH 5C1UA 4CBNA 1OXGA 4TY6A 5EQQA 4DOQA 4X2YA 1BTUA 1YPHC 1P01A 1Z71A 1UCYE 2D2DA 2R0LA 1FY5A 1HBTH 1GGDB 1RD3B 3VPKA 2BYAX 1MTWA 1W0YH 4FUJA 3ATLA 3PYHA 1DSUA 1Z1IA 3TH4H 4ZHAA 1EATA 4D9QA 4NWKA 3SU3A 3TLOA 1MKWK 2TIOA 3O8DA 3OY5U 1E36B 2PTCE 3CS0A 5JB9S 1A0JA 1BTHH 1XM1A 2PWXA 2BOHB 4A1VA 1OOKB 4CRCA 1BRCE 1CE5A 1CSOE 1DS2E 1XUJA 2JH5D 2F9BH 4KTSA 2ZU1A 3STIA 2PKAA 1C5ZB 3LGWA 1TBQH 4UFGH 1W11U 2ZO3H 4CRGA 4BAMB 1AQ7A 1ID5H 4AGKA 1THPB 2H6MA 1GBBA 5DG6A 3IG6B 3NUMA 4SGAE 2G51A 4K69A 4H6TA 1GJ4H 1J15A 3UUZA 1EZUC 4MG3A 5TJXA 5EODA 3SV2H 3BEFB 3TJNA 2ZG0H 3GCHB 3SUEA 2ODQA 4AFZA 2KAIB 4XDEA 5F8ZA 3TIUA 4H6SB 4B76A 1PJPA 1RXPA 1GMCG 4I8GA 4Y8ZA 2PKSB 4B75A 1PYTD 2OQ5A 4KTCA 3RM0H 2ZC9H 1P2IA 1HFDA 2F9NA 2QV1A 5TCCA 3L6PA 2J92A 1SPJA 2BM2A 1TFXA 1O3IA 2UUJB 2GVFA 3KGPA 2Y5FA 4QT8C 3B9FH 5LPEA 1HAVB 3AAUA 1P06A 1DE7H 2P16A 4X2XA 4IN1A 2G4UA 1C5UA 3BTQE 1XUKA 2HPQH 1JBUH 2D26C 2EI6A 2WPMS 2VB0A 1O39A 1HAZB 2R3YA 4PROA 1TB6H 1ZLRA 4ISHH 4AOQA 3D65E 8KME2 1C5OH 2FODA 1O36A 3T62A 1F0RA 4WXVA 1GMDG 4RSPA 1PQ5A 1GI3A 3EQ0H 1SGTA 2SGPE 1JOUB 1QQUA 5C1YA 1AE5A 1GHWH 4MVNA 1UK4A 5GJ4B 1KXEA 2EI7A 5IDKA 1AO5A 3PLBA 1JWTA 2GTBA 5A09A 1BMLA 2G8TA 1BBRE 4IW4E 3M7QA 3ODDA 4ISLA 4DIIH 1P9SA 2OP9A 2ZQ1A 3M37A 1E37B 3HPTB 1WAYB 1C2MA 1L2EA 2TPIZ 3R0FA 5L30H 1YCPK 1HXEH 5T6DA 1O3MA 3URDA 1AUTC 3P17H 2P8OB 1GBEA 2GCHF 4X1SU 3JZ1B 1K1PA 2B0FA 3K6ZA 1VITH 2V3OH 2GZ7A 2H5DA 4Y0ZE 1K1JA 3VEQB 2PLXA 4ZKOU 1FQ3A 5A0AE 4BAHB 2Y80A 3S9CA 2BOKA 2VIVA 2NU2E 2W3KA 1D9IA 2BD9A 1D6WA 2K1QA 2XBYA 1P03A 4ABEA 5FXLA 2A7HA 1BTWA 3E0PB 1ABJH 4X8TH 1EPTB 1W10U 1FNIA 3BN9A 5GDSH 4IMZA 2WPIS 1DY9A 1UTQA 1EZSC 2Z6BD 5SGAE 1ZZZA 3SJOA 3SI3H 2PGQB 1K1LA 3VFEA 4NFFA 2ZGCA 2BQ6B 1QRXA 1C2HA 3A80A 1CGJE 4BAOB 3KN2A 4Q7ZA 1ANCA
chains in the Genus database with same CATH superfamily
4ABGA 3RXHA 1CT0E 1C1OA 1O5CB 4I8LA 3GCTF 4RKOB 1LKBA 1VR1H 5T1VA 1QBNA 3RU4E 3BTFE 1H8IH 3RC6A 2H9TH 4CREA 4CBOA 3K6YA 2JDID 4B74A 1NRPH 4Q7XA 2FPZA 5L6NH 3TNSA 2FI3E 1BA8B 1FN8A 4FU9A 2VIWA 3C27B 4BANB 2ZFFH 3UOPA 2GGVB 1RFNA 1BQYA 1TWXB 3M3TA 4UFEH 1FN6A 3PV4A 1O2IA 3AAVA 2DUCA 2FOGA 3SUDA 1BRBE 2HNTF 1YCPH 2ZHWH 3RC4A 3OYPA 1SLXB 3EGKH 2Z3DA 4H4FA 3V0XA 3LJJA 5H4IB 2PGBB 3T26A 1DX5M 3Q3XA 1GJAB 1TALA 1IQHA 3HATH 3PMBB 4UE7H 4IMQA 1Z1JA 2RDLA 3E3TA 1XVOA 4U01A 5EXNA 2A7JA 1E1RD 1C5YB 4F48B 1H1BA 1O35A 4ABHA 1OPHB 2ZP0H 1E0FD 1ZMJA 4MNWA 1EPTA 4CH8B 1C5SA 1YPKH 3EE0B 4CRDA 2G5VA 1FY1A 5DSFA 2AH4X 3P92A 3ZVDA 1ZJDA 5CHAB 2A4OA 3RXRA 3RLWH 1ZTKA 2BQ7B 1GBTA 1GI7B 1AZ8A 1V2QT 2FTMA 3UREA 4ISOA 3LH1A 1FJSA 3FFGA 4O03A 1V2UT 1W14U 3GDVA 4X6PA 1KLIH 1KXCA 6ESTA 4LK4A 1C1UH 1UTOA 5FBIA 1C1VH 2QN5T 2ANYA 1HB0B 1PQ8A 4K8BA 5AFZH 1M9UA 4A1TA 3UQVA 1S0QA 3SU2A 9ESTA 2GT8A 3WY8A 1GDQA 1SHYA 2HGTH 2XWAA 2ZQ2A 4Y11E 3GY3A 3RXLA 1ETRH 1GI4A 5E0JA 1HJAC 2FX4A 2O8LA 5FPSA 3I77A 1EAXA 1LHCH 2A2XH 2RCEA 1ZMNA 4FUHA 4JYVH 1LVBA 4D7FA 1S85A 1BOQA 1Z8RA 1QL7A 1G36A 1Y5BT 5A8XA 4THNH 5DP7A 1GBKA 4MQAA 1TGTA 1TQ0B 4CH2B 5FPTA 4VGCB 1PPFE 4I32A 5B6LA 1PQAA 3V13A 3MH6A 2VIQA 2Z7FE 3GCTG 5AHGH 1BITA 1C5PA 3DUXH 2G4TA 2ILNA 1VITG 3MU1A 1NRRH 1Z7KA 4MNYA 1FXYA 2XRCA 2XBXA 3S7HB 3TK5A 1S6HA 1MH0A 2XBWA 3FAOA 3FKSD 2ZPQA 4WMFA 1TGSZ 4DVAU 4NG9H 1BDAA 1WXRA 3PMJA 2OC8A 1O5EH 1LPGB 3FVFB 1SGIB 3PROA 1TPOA 3SGBE 1GDUA 1B0EA 1P57B 3LGUA 1K1MA 1EOJA 5E2PA 1HIAB 1TNHA 1F7ZA 1XXFA 2ZEBA 1HDTH 1C4V2 1A3BH 2XYAA 2WUCA 2HLCA 2W5EA 2WYGA 2BDCA 1C2KA 3P8GA 1H8HD 1THSH 4GLYA 1IQFA 1GBIA 2ZTXA 2ZFRH 5GCHF 3O8RA 1C2GA 4KP0A 4B2CA 1GBCA 2Z9KA 3FZDA 1P05A 3U28C 1MU6B 1F5LA 1A0LA 1JMOH 1E34B 1MAYA 1GG6C 4K5ZA 1SGYE 2WV9A 2ZDVH 3RXJA 1AN1E 1TQ7B 1T32A 2BDIA 3OX7U 2ZFPH 5HXFA 2C8ZB 1LHEH 3HK3B 3IITA 4ZXYH 1O3DA 5GXPA 2QF0A 4X6MA 1WSSH 4CR9A 4ACBA 4D7GA 4U30A 4HFPB 3F9FA 2P3UB 3GYMA 1GJ7B 1O2QA 1SBWA 1ANBA 4ZHMU 1GBDA 2F9VA 1GJ6A 1WBGB 1FY3A 3N99A 1GGDC 1QBOA 1TONA 1YYY1 2FTLE 5F8TA 4ZXXH 1E79D 2QCYA 4MLFB 1Q31A 1RS0A 5G4BA 2V3MA 4WH8A 3HGPA 4GPGA 1GI6A 3GICB 1J17T 1FV9A 2HRVA 3ZZDA 1WYKA 3E0NB 2XNIA 2QA9E 2XCFA 1QNJA 1DITH 2CGAA 5E2OA 3UNSA 4IC5A 4Z0KA 3MNBA 5GPIB 1JIRA 4ESTE 2HVYB 1C4Y2 2Y81A 2STAE 1K1NA 1WCZA 1ZPBA 1HRTH 2Z3CA 2ZTZA 5FHTA 2OTVA 3PO1B 3MNCA 2ZTYA 3EA7A 4GCHF 2BY8X 1DWCH 1O2UA 4NSVA 1QRZA 5DP4A 5F6MA 3VXFH 1OKXA 4XBDA 1GVLA 1PPEE 4E05H 4JK5A 1RIWC 2BDYA 3RU4T 3FZZA 3SHCH 4YLQH 1THRH 1QJ6B 4SGBE 3ZYEA 3BTEE 1LVMA 3F9EA 4OS4A 4NA9H 1TGNA 5FBEA 2WV5A 1EB1H 2ZNKH 2BX3A 1C5NH 2YNBA 1FMGA 1NROH 1DM4B 1CHOG 2KR7A 4IBLH 5DP3A 1O2PA 3FP6E 4INKA 1SGDE 3QK1A 3QWCH 3RXPA 3SV8A 1N8OC 4A92A 3FP8E 2FZZA 3NKKA 5CHBA 1GJCB 5KECA 5KEDA 2OCVB 1VZQH 1EQ9A 1EKBB 1YPLH 2TGDA 5EJZA 1H8ED 2EA3A 4AC9A 3RXIA 1GI8B 4ZUHA 1CT4E 1IQNA 1BB0B 1SGEE 2J94A 3A88A 3NCLA 2F4LA 3MNXA 2IPQX 1G30B 2FWWA 4FUCA 2XWBI 1LO6A 1NT1A 2FXRA 2XOKD 3EAJA 3D62A 3KNXA 4LXBH 1QIXB 1AVGH 3SJIA 1BHXF 3KQBA 3KL6A 3KHVA 3SOSA 4ASUD 1O3AA 1UTKA 4INLA 1CU1A 1MMJN 2ZZUH 3UR6A 2ZF0H 3RXGA 3QLPH 2FLRH 1BCUH 2VWNA 1W13U 1O5AB 3FO8D 5L2ZH 1DT2A 5LH8A 4YT7H 2J4IA 1ANDA 1H9LB 1A46H 1MKXH 4MNVA 1QGFA 1V2TT 1GI9B 1TBZH 2OXSA 2C8XB 1TMUH 4OGYA 1GJDB 3RXDA 2AERH 3UR9A 1GBAA 1NRQH 2RFKC 2OC1A 2PKAB 2ZGXH 1Y3WA 1H4WA 2C3SA 3GOVB 3M5OA 4MPUA 1UVPA 1C2LA 2ZDMA 2KCAA 1C1PA 3MYWA 2UUKB 1GI5A 1MQ6A 2FOAA 3MO3A 3ZZ6A 4AG2A 4X2WA 5E0GA 1IQKA 3TJOA 1SQAA 4O3TA 3LGIA 3MNSA 1C1NA 1ELDE 1GG6B 1SB1H 2ZU5A 1FUJA 4ZKNU 2QC2A 1BTZA 1AWHB 2JH0D 2TGAA 5LGOA 3RXAA 2C93B 2QY0B 1WOFA 2ZHFH 3A7XA 3SU6A 1AHTH 1LQDB 2AMPA 3VB4A 3IWMA 3UY9A 3PWCA 5FAHA 3U9AH 2ZCKP 1HYLA 1P11E 6CHAB 1L1NA 1P2OA 2UUYA 4MNXA 5HIZA 2B5TB 1DUAA 3MI4A 3GY6A 1S6FA 1NC6A 2SGAA 2QF3A 1GHVH 4KGAA 2GJGA 2GMTB 1XUGA 4FVDA 1XUFA 1MTSA 3A89A 1S5SA 2FP7B 2GV6A 5IK2D 4Y0YE 3M35A 2P3FH 1EASA 4R0IA 2O8TA 1T4VH 1GJ5H 5EJLA 3M36A 5HM9A 1L1JA 1WQVH 2IJD1 1BTXA 2PUQH 1OSSA 2YMSB 1AKSA 2ALPA 2OQUA 1V2NT 2FO9A 3GY4A 5J4QA 4YLUA 1P9UA 3DT0H 3TGKE 6GCHF 4IS5A 3GY5A 3TNTA 1A2CH 2ZCHP 3UNRA 1RRKA 4NZQA 3N7DA 1SGRE 2YOLA 3GY2A 4Y71A 3RMMH 3PO1C 2KCOA 3GCHC 1C2EA 3MOCA 4X6OA 1YKTA 3HKJB 2PKSC 1Y3YA 1RTKA 2WYJA 1PPBH 2F43B 3RXQA 4NGAH 2A1DB 1P0SH 1MAXA 2PFEA 2P8OC 1QZ8A 1A61H 4YESB 3LC3A 1UK3A 3CS7A 2QXHA 2BD8A 1TNJA 2CJIA 2C8YB 2VIPA 1V3XA 1SFIA 4Y79A 1ZSLA 5EXLA 3VG8A 5FX6A 1D4PB 4UONA 2CHAB 1DSTA 4BAKB 3ATWA 3S9BA 4NIYA 1HXFH 5BRRE 2OBOA 4AYYB 1MZDA 2LELA 1FONA 3PV5A 2A5IA 2STBE 3Q3YA 4YXWD 4Q2KA 1EJMA 3MO9A 3SU1A 1N6YA 1D3QB 3GISB 2ZFTA 2VVVA 1O3FA 1IQGA 2AGEX 3RXFA 3A8DA 5CE1A 2SGDE 1BRAA 2ZDKA 5C5NA 3RU4D 4TWWA 2V6NA 3V7TA 1WUNH 1GBMA 1KMHB 1MZAA 1D3TB 1OP2A 1C1RA 3KF2A 3PM3A 3LIWA 1GCTB 1WDIA 2KX4A 1NFXA 2FIRH 1O2HA 3TK6A 4OS2A 1DICA 3E90B 2WHXA 3JZ2B 2IOTA 1HNEE 1O2TA 2ANKH 4U2WA 1T31A 4AORA 1HAYB 3P8OA 3TH3H 1VJ9U 2VWMA 3QDZB 1A1RA 2M2AA 3SGQE 1ELVA 3A8AA 1XUHA 1ETSH 2PR3A 4GCHG 1NO9H 4NCYA 1FIZA 1BZXE 3AK5A 2P59A 2WPHS 2ZA5A 1P2QA 1JRSA 3UIRA 4JK6A 3HK6B 1OWIA 4AZ2B 1GBHA 2Z3EA 2BD3A 2KCYA 4UD9H 2GT7A 5E8EH 1EZQA 1YY3A 1JRTA 4NWLA 3UAIC 5FCKA 1O37A 2A31A 3Q00A 2TGTA 1KDQB 1O2JA 3OSYA 2PV9B 4JCNA 4MPWA 4XSKU 2ESTE 5AFYH 2R2WU 1BMFD 2HLDD 1T8OA 3SJ8A 3U8TH 2ZKSA 3NK8A 1O3BA 4I8JA 2HVXA 2ZWLH 2CN0H 4DJZB 2G52A 5T6GA 1MD8A 1V2MT 1TE0A 2P3TB 6GCHG 2GCTC 3ENSB 2ZECA 4Z6AH 3SV6A 1ABIH 4GSOA 3A7WA 3SZNA 1O2LA 5EU8A 1ZJKA 3EA8A 3A81A 4BXSA 1YPHE 4ACAA 1O2SA 1UTJA 1C2JA 1GL1A 1INCA 1AI8H 3M7TA 2FOEA 4X1QU 1V2RT 3GCNA 4CRAA 2LPRA 1W7GH 2ANMH 4X1NU 1BMMH 4JYUH 3TGJE 1FIWA 1BTYA 1K1OA 2H9HA 2HPPH 4X6NA 2V0BA 4ZH8A 4WMDA 1HV7A 3DHKH 3ZVBA 1AD8H 4WVPE 1UTLM 2AMQA 1UTPA 3SNBA 1NTPA 3FP7E 2W7UA 3MH4A 4Y8XA 3PTNA 2YNAA 1S84A 2OK5A 3SNCA 1YLCA 9LPRA 1C4U2 4KKDA 4ASHA 2ZU4A 2O8WA 3PTBA 2D1JA 3NZIA 3VB6A 3U1IB 3BIVH 3VXEH 2QF5A 1IHSH 1AY6H 2RA0A 4ISNA 4BTIB 1J8AA 4TPYA 1C5MD 1TMTH 2J34A 4UFFH 3BSQA 2ZU3A 4ABFA 4GAWA 3TH2H 1UVTH 1DWBH 3E16B 1BUIA 4JZEH 2CV3A 1V2VT 4FXGH 3BIUH 1E1QD 3TJVA 1TNGA 1G3EA 1GMHF 1O5BB 1O2WA 2GZ8A 1NZQH 2J95A 5J4SA 2ZGJA 1MTNB 1HAOH 2VWLA 1UHBA 1SLWB 2FLBH 3RLYH 3QGJA 4J1YA 1NESE 1AE8H 2FI4E 4DY7B 2F83A 2Z9GA 4F49A 1AIXH 4BNRA 2VVCA 3RM2H 1OYTH 1Z6EA 4X1PU 3QTVH 4B1TA 1D6RA 1FDPA 1HJAB 1CQQA 4D8NA 3DSOA 3P8FA 1BBRH 1GL0E 4NIXA 3SHAH 1PPGE 1KYNA 4LOYH 1GJ8B 4CHAB 2HALA 1LHFH 2XW9A 3BV9B 5C3NA 2Q1JA 2C8WB 3SQEE 1K9OE 4BTTB 5JBTA 5EPYA 1IQLA 1O2XA 2OUAA 1QCPA 2SGQE 4ABJA 1GBJA 4LZ1H 4Q7YA 1C5TA 1KXDA 4I8KA 5CMXH 2QXGA 1CGHA 3LGVA 4YO9A 3SN8A 7GCHG 7ESTE 1LPZB 1XMNB 1SL3A 4O97A 2HNTC 1QBVH 3MU5A 4Q80A 4P00A 4YTAA 3UPEA 5GWZA 1K22H 3T25A 1DY8A 3RXKA 2EY4C 1G32B 1PPCE 1W2KH 1AVWA 3M5NA 5JYIA 1P02A 2K8IA 1B5GH 4DT7B 1NPMA 1MBQA 3O8BA 2ZDLA 4MDSA 3MH5A 5EGMA 3P6ZB 3N7EA 4B2AA 2XC0A 2WUBA 1ESTA 1MTUA 3P95A 1P04A 1YM0A 3OEED 3EDXB 5K7RA 2OBQA 3MU8A 1TRMA 2B9LA 2OINA 7KMEH 4GVUA 1YLNA 3S7KB 4JZ1A 1S0RA 1WTHD 2Y7ZA 3BF6H 4ZKRU 5HGGA 1C2FA 5C5OA 2BDHA 1CHGA 2JETB 1ESBA 2BDBA 4MTBA 3ZV8A 1GHAG 1O5GH 3B8JA 1TYNA 1GHBF 1NFYA 1GI1A 3KEEA 3S69A 1HIAA 4FUFA 1AMHA 2A7CA 2BY7X 2XBVA 1ZOMA 3LPRA 4WWYA 1DWDH 1K0HA 1O33A 4ABIA 1G2MA 1ARBA 1UVOA 2ZHDA 8ESTE 1DXPA 1XKAC 1EZXC 3EYDA 5L2YH 4R8TB 1AWFH 2GDEH 1F92A 3GCOA 3VGCC 1G37A 2O8MA 4O3UA 1XVMA 4BXWA 1QB1A 1TPAE 1O2MA 3NRLA 1Y59T 3M5LA 1F0TA 3GY8A 1EFRD 2GP9B 1MUEB 1TPSA 1EXFA 2AHME 1A5HA 4M9FA 2BD7A 4TWYA 1KLTA 4RT0A 4RKJB 5T3HA 3A7TA 2H2ZA 3MU0A 1PFXC 1TMBH 3DFJA 1KDQA 3UWIA 3AASA 4K1EA 3A7ZA 4WF8A 5HM2A 4I8HA 4B6EA 1C1TA 1SQTA 1GJ9B 2Y82A 1W8BH 1E35B 5EPNA 3UTUH 2BDAA 1Q3XA 2ZIQH 1AUJA 1KXBA 3DCLA 3W1EA 3FANA 1QA7A 1QL9A 3ZZBA 4O9VA 2ZGHA 2WPJS 1FPHH 3BG4C 3PV2A 1BJVA 1BRUP 2BY9X 2ZHQH 1O3PB 1BHXB 4I31A 2I6QA 2P95A 1DANH 3SW2B 2K0QA 1KTTB 2ZDAH 1OWJA 4GUXA 3RXMA 4A6LA 1IQJA 1YPJH 1QL8A 5F8XA 1Y8TA 1UW7A 1UCYK 1SHHB 1ELGA 3PLPA 1TA2A 1F0SA 1S83A 2BXUH 1Y3XA 2WV4A 3PLKA 3K65B 2NU3E 3LGYA 4ISIH 4E06H 1TRNA 3DA9B 3KIDU 3TPIZ 4P02A 1RTFB 1EP5A 1C1QA 5DGJA 4YOJA 3VB7A 3SGAE 2UWLA 4XFQA 2FOHA 2RA3A 3PWBA 1P2MA 2PW8H 5JB8S 2QE7D 1LCYA 3U8RH 2J5UA 1FPCH 1AVXA 1QRWA 1A5IA 1SSXA 2GKVE 2XXLA 4IN2A 1MD7A 2AS9A 1AFEH 4X0WU 5GIBA 1F5KU 2GX4A 4BOHA 4DW2U 1SR5C 3F1SB 4K2YA 3O8CA 4B2BA 2F9PA 1ZRBA 2ASUB 1W7XH 1TGBA 1MCVA 3F9GA 1Z8JB 4OS6A 5EJ1A 4H42U 2ANWA 2XCNA 3SORA 1HCGA 2H5CA 3RMOH 2VU8E 1TBRH 2JJ1D 1LQEA 3BTKE 1V2JT 4GHTA 1LHGH 1L0ZA 4K1TA 3F9HA 1QB9A 3LGTA 3TITA 3RUOA 1Y3UA 2Y7XA 1SC8U 1G3CA 1E38B 2JH6D 1IOEA 1SKYE 1LVYA 1ZHMA 2TBSA 2G55A 1QR3E 2PUXB 6CHAC 4WJG2 1L4DA 1GCTC 1FI8A 1GMHG 3A7VA 3PMHB 1YF4A 1T8MA 4ZAEA 2W6JD 5GCHG 5ESBA 4DCDA 1O2KA 1O3HA 1DDJA 3VB3A 1A7SA 2FESH 1CA0B 3A8BA 3OFND 4FOUC 2BLOA 1O5DH 1Y5UT 1FAXA 1TNKA 4XOJA 1OWKA 5EOKA 2JIZD 2KFWA 3NPSA 1ESAA 1L1GA 2A2QH 1KXFA 4FUIA 4ZHLU 3TU7H 1EX3A 3LT3A 2FDAA 5C0UA 4ZROA 5HYOA 2BD4A 1ZGVA 2IJOB 3M3SA 1ANEA 1ELTA 1DPOA 3BTDE 2R2MB 2CF9H 2BXTH 2BD5A 2Z9LA 1ZHRA 1YLDA 2A4QA 3BTME 3T29A 3A7YA 4K1SA 1D3PB 2J97A 2BVRH 3PB1E 1A5GH 8GCHG 2DE9A 4B71A 1HPGA 4FUEA 1IQEA 7GCHF 1HAPH 2FYRA 2G5NA 1C2DA 5ABWA 1UMAH 1NM6A 2PSYA 3RXEA 5C20A 2C90B 4JZDH 1EAUA 1O2RA 1WV7H 2AGIX 3DFLA 1YC0A 5A8YA 5JBAS 3A85A 1P12E 4FU8A 3GS9A 1O3CA 2PP6A 2WPDD 3K9XB 4WH6A 2XNDD 2VH0A 2CF8H 1QTFA 3M5MA 3QO6A 1A4WH 2OLGA 3QZQA 1GWAA 3F2HA 4K60A 2BVSH 4NFEA 2Z9JA 1GCDA 2WINI 1ELEE 2FI5E 4Y6DA 1MQ5A 2BZAA 2AIPA 2JKHA 1H8DH 2O9QA 2GV7A 4FETA 1TPPA 2AIQA 2A32A 2YMSC 5PTPA 2I6SA 2FM2A 1GHXH 2GZ9A 5DJ7A 1PYTC 5I46H 4ZMAH 3A83A 1GI0A 3M3VA 2ZI2H 1V2PT 1VCPA 1A3EH 2UWPA 1SGFG 2UWOA 3A8CA 3SJKA 2Y6TA 2FOBA 3SBKA 2ZPSA 1AKSB 1QB6A 3ELAH 4NSYA 1GI2A 1TLDA 3Q76A 3V12A 4E7NA 3S9AA 1G9IE 1UVSH 4DT4A 1K28D 4Q63A 4K8YA 3SUFA 5DO4H 4LZ4B 2KZ4A 2QXJA 1N8OB 5JBCS 1FAKH 5EG4A 3KQEA 3ATIA 1SGCA 3MO6A 4TY7A 3ESTA 4XRNA 3M61U 1J16A 4MPVA 1EUFA 3GYLB 3KYFA 3L3TA 1NY22 3D23A 3QUMP 5FX5A 1LTOA 1AGJA 2AEIH 2ZFSA 3BG4B 4E7RG 1W3CA 3B23B 4UDWH 1GDNA 3RDZA 1P2NA 1SG8B 5T6FA 1GVZA 2VVUA 5CHAC 2FS9A 3ZZCA 4X8VH 3F68H 4DIHH 4HTCH 3OTJE 5DPAA 4BTUB 4F4OC 1F5RA 2WSSD 1GBFA 1JIMA 1NRSH 1C5VA 2OD3B 1UJ1A 2H9EH 1CBWB 1O3LA 1SI5H 1Z8GA 3QX5H 3RXUA 1O2GH 3OE7D 2NU4E 3PMAB 3K2UA 2GCHG 5FL7D 1EB2A 1RGQA 1O3NA 1W0JD 4FUGA 1BJUA 3MFJA 4ZCNA 1CA8B 1ELFA 1VCWA 2ZCLP 3HKIB 2WPLS 4RI0A 2ZFQH 5ETXA 4WXIA 1RJXB 1OWHA 2AMDA 2GMTC 8LPRA 4OS1A 1TX8A 1TA6A 5HIYA 2IPHA 1QFKH 2BQWB 3ODFA 1L4ZA 1H9HE 1OWEA 1O2YA 1ZTLA 2BX4A 4YT6H 5DKMA 1TOCB 5LPFA 1C2IA 1VGCC 3AW1A 5LPRA 2NU0E 3I78A 4B73A 3RP2A 1ZSKA 3KQCA 2BVXH 2THFB 4TPIZ 3RXTA 4YOIA 1ZMLA 3T2NA 4I33A 1DLEA 1ETTH 4FUDA 1EOLA 1YPGH 4AFSA 4A1XA 4CR5A 2RDEA 2QIQA 1O2OA 3BG8A 2ULLA 3A84A 4Y76A 1C1MA 2W26A 1OP8A 1VITF 2FS8A 4KTUA 1ZR0A 1O3JA 5DK1A 3SV7A 2A45B 1PQ7A 4ABBA 1FZZA 1U6QA 4RN6A 1BIOA 5F53A 1FX0B 1OHHD 1T4UH 2HNTE 3LONA 2SGEE 1S82A 3MMGA 2DE8A 1G2LA 3C1KA 3SZEA 5TCAA 1ZYOA 1P3EA 1CBWC 1O3OA 1QA0A 2L74A 1HAIH 3QN7A 1LVOA 1D3DB 5C2ZA 1W12U 1YP9A 1BTPA 3LOXA 4GHQA 3RMLH 1CA0C 1SGFA 2G81E 4JZFH 1K1IA 4JYTA 1S81A 2FOMB 5EQRA 3KCGH 3MU4A 2QXIA 3MWIU 3OAAD 3W95A 4NZLA 5IYTA 1CO7E 5C0TA 1J9CH 1ELBA 2Q6GA 2VGCC 1P2KA 1TIOA 4J2YB 1XKBC 2ZU2A 2QF4A 2TRMA 1RIWB 1P2JA 2LNCA 4MPXA 3U69H 3VGCB 1ZGIA 2BB4A 4D76A 1WTGH 1J14A 2B8OH 1ZHPA 1O30A 1IQIA 4VGCC 5HMAA 2LP6A 4X1RU 3TJUA 3DSGA 3ZIAD 2M5TA 2V35A 3TGIE 1HAGE 3KQDA 2CXVA 4U32A 2CHAC 2J98B 2VINA 3AW0A 2AGGX 3M7UA 3F0PA 3OY6U 4Y7AA 3SO3A 3UNQA 1TABE 1C5RA 2J2UA 3ZZ5A 1Y3VA 1TAWA 5C17A 3PRBA 5EW2H 4INHA 4KELA 3KYGA 4M7GA 2B7DH 3T5FH 1UVUH 3SJ9A 4I7YH 3HGNA 3ZVCA 4DURA 2NWNA 3ZVAA 1O5FH 2F91A 1P10A 2L6OA 5FCRA 1IHTH 4XE4A 4UFDH 2TGPZ 1V2ST 4OS7A 1C9TA 8GCHF 5JDUB 2IN2A 1WQSA 3ZVFA 4K3JA 2H1UA 5CDFE 3SU4A 1QURH 3GY7A 2BLQA 4X2VA 3QGNB 5KGOA 1P3CA 4AB8A 4AB9A 2C4FH 1QY6A 1Q2WA 1YWUA 3LDXH 1ACBE 4TSFD 2SNWA 1G3BA 1C5WB 3CENA 3STJA 2ODPA 1UO6A 1HLTH 1SQRA 2CMYA 1BBRK 1Z6JH 3U1JB 2UUFB 4XBCA 4DG4A 4NIWA 1LPKB 1PPHE 2Z9IA 2WPKS 2QAAA 2SGFE 1W0ZU 5DP5A 1TX6A 1O3GA 1C1WH 4XD7D 2QGRA 3LKWA 2VWOA 1BMNH 2SNVA 2BHGA 3MH7A 1TNIA 2BLVA 2VGCB 4YOGA 1DFPA 3TK9A 4AGJA 1SFQB 3E6PH 3URCA 4WY3A 5FPYA 3ITIA 3ZZ9A 3BEIB 3WWBA 1S6LA 2ZPRA 2V3HH 2EC9H 1DXWA 1YGCH 1BT7A 3ZZ8A 1B7XB 2OC0A 3T27A 5JBBS 3F0OA 1HJ9A 4A7IB 2P94A 2ZGBH 5C94A 3E8LA 4NA8A 1OS8A 4AG1A 5A0BA 5BPEA 2FOFA 2BZ6H 2F3CE 3T28A 2VNTA 4I86A 2A0QB 2W7SA 3UQOA 5AVDA 1TRYA 4ABDA 1TGCA 4AX9H 5EIYA 1ARCA 5DP9A 3DD2H 1MKXK 2D8WA 4TT3D 1EAWA 1K2I1 6LPRA 4Z1MD 1OWDA 5ESTE 5DP6A 5EW1H 1C9PA 4WMEA 1AZZA 2BY5X 5DN6D 5DP8A 1Z8IB 1H9IE 2ODYB 2CK3D 1GJBB 2XTTB 1AB9B 1C5QA 3TVJB 4FU7A 1MU8B 1FY4A 3SNAA 5K0HA 3RXBA 1IQMA 1ELAA 3ZZ3A 3OU0A 1NBMD 1FLEE 1WU1A 1KIGH 3WWFA 5JPMH 2A5AA 2R3UA 3LC5A 1CVWH 1LKAA 3OTPA 2ALVA 2ZDNA 1NFWA 1O34A 2Y5HA 3ZVEA 1FY8E 2GD4B 5C1XA 3R3GB 3A87A 2OC7A 1MABB 3RC5A 2EI8A 3ZZ7A 4AFUA 4Y10E 1DOJA 1SLUB 5B6OA 3GDSA 3F2FA 4RT1A 1GMCF 3H7TA 5A2MH 2FX6A 3F6UH 2A4GA 2F9UA 3SQHE 1F0UA 1V2KT 1P09A 3KQ5A 1YBWA 4XBBA 3UOUA 1A0HB 3EA9A 3OEHD 7LPRA 1UCYH 3ZYDA 1Y5AT 2KAIA 1KLJH 1VJAU 2HOBA 1V2WT 5F03A 2FYQA 3CP7A 2AYWA 3SU0A 2XC4A 1ELCA 1N1LA 1O2NA 1KXAA 3A86A 1SGQE 2Q6DA 1CT2E 1AFQC 3MTYA 3E91A 4Y7BA 1DVAH 2JJ2D 3H5CB 3LU9B 3RXCA 2J9NA 1EP6A 2KM0A 1ZPZA 1HAVA 2XC5A 1GMDF 4CRBA 4Y8YA 1SQOA 1AB9C 1NN6A 1UTNA 3ZV9A 4A5TS 1KSNA 2NU1E 3P8NA 3QTOH 4NIVA 4IGDA 3ZZAA 2R0KA 4AN7A 3LJOA 3ZVGA 1LMWB 1QJ1B 1UK2A 4X8SH 5EXMA 3SI4H 5C67A 1MTVA 1T8LA 2VH6A 3SNDA 4BAQB 1G3DA 3RXVA 4YM9A 2GCTB 3QZRA 1HAXB 4ZKSU 3BTWE 1COWD 3FN8A 2ZHEH 1ZSJA 4FVBA 1CGIE 2FOCA 2BLWA 3Q3KA 3E1XB 4HI3A 1F2SE 1OP0A 4CHAC 2A4RA 1C5XB 1MCTA 1SOZA 3ZZ4A 1XUIA 2PHBA 4IC6A 1IAUA 3SU5A 1NU9A 2RG3A 1DWEH 1EJNA 1CHOF 2P93A 1V2OT 4D9RA 2HWLB 1SVPA 2GDDA 1BMAA 1EAIA 2VJ1A 4DGJA 5AF9H 1O31A 2KCPA 3MHWU 1NFUA 4CRFA 1OYQA 2J98A 3RMNH 3VB5A 3SV9A 2VIDA 3NXPA 1HJ8A 2VBCA 4HZHA 1C1SA 1T8NA 4JMYA 3ATKA 1X7AC 3PRDA 5I25A 1KY9A 2AFQB 3V3MA 1SMFE 1TX7A 1YCPM 3F3BA 1SLVB 2Y5GA 3BTHE 2F9OA 3NWUA 1NRNH 1O32A 1QJ7B 1MBMA 2BDGA 1GBLA 1RTLA 1O0DH 1ZRKA 1O3KA 1O2ZA 2FMJA 1AFQB 1XXDA 1GHYH 2SFAA 1DUEA 3U8OH 1QHRB 1O2VA 1B0FA 2FEQH 1AU8A 1SGPE 1GPZA 2EEKA 1V2LT 1YPMH 3H7OA 4TYDA 1LHDH 3RXOA 2PTNA 3A82A 1PPZA 4AFQA 1SOTA 1JXPA 2J38A 2JETC 1GHZA 4AYVB 1ZPCA 3FOAA 1NU7B 3AVZA 1V6DA 3L33A 3S0NA 4Q4LA 2V7QD 3D49H 1HAHH 1UHBB 3BEUA 2BMGB 3U98H 2EQNA 2G00A 1NBME 3SUGA 4OGXA 1GHAF 1T7CA 1MTNC 3I29A 1GHBG 2Q6FA 1KTSB 1TNLA 1QQ4A 1N6XA 1EJAA 3UWJH 3UFAA 1P8VC 1C5LH 1SGNE 2W6ID 5EQSA 5A8ZA 4FUBA 2W3IA 4JZIA 2R9PA 2BD2A 2VIOA 1ORFA 1GVKB 1VCQA 2Z94A 2O8UA 4OS5A 4X8UH 3P70B 1O38A 1LDTT 3Q77A 5A0CA 3LH3A 2BTCE 3N7OA 3W94A 2A5KA 1HGTH 1UTMA 1NS3A 2QYIA 3BTTE 1XX9A 3G01A 1O3EA 2PSXA 1TOMH 1DLKB 1OX1A 1ZTJA 3F2GA 4ABAA 3RXSA 5E0HA 3EE7A 1HUTH 3BTGE 1EPTC 1MKWH 4YZUA 4UEHH 3ATMA 2BY6X 3GDUA 1VGCB 3SNEA 1K21H 4B6FA 4NA7A 4HGCA 1YPEH 5C1UA 4CBNA 1OXGA 4TY6A 5EQQA 4DOQA 4X2YA 1BTUA 1YPHC 1P01A 1Z71A 1UCYE 2D2DA 2R0LA 1FY5A 1HBTH 1GGDB 1RD3B 3VPKA 2BYAX 1MTWA 1W0YH 2YMSD 3ATLA 4FUJA 3PYHA 1DSUA 1Z1IA 3TH4H 4ZHAA 1EATA 4D9QA 4NWKA 3SU3A 3TLOA 1MKWK 2TIOA 3O8DA 3OY5U 1E36B 2PTCE 3CS0A 5JB9S 1A0JA 3DSPA 1BTHH 1XM1A 2PWXA 2BOHB 4A1VA 3MQKC 1OOKB 4CRCA 1BRCE 1CE5A 1CSOE 1DS2E 1XUJA 2JH5D 2F9BH 4KTSA 2ZU1A 3STIA 2PKAA 1C5ZB 3LGWA 1TBQH 4UFGH 1W11U 2ZO3H 4CRGA 4BAMB 1AQ7A 1ID5H 4AGKA 1THPB 2H6MA 3UB0A 1GBBA 5DG6A 3IG6B 3NUMA 4SGAE 2G51A 4K69A 4H6TA 1GJ4H 1J15A 3UUZA 1EZUC 4MG3A 1W0KD 5TJXA 5EODA 3SV2H 3BEFB 3TJNA 2ZG0H 3GCHB 3SUEA 1VKYA 2ODQA 4AFZA 2KAIB 4XDEA 5F8ZA 3TIUA 4H6SB 4B76A 1PJPA 1RXPA 1GMCG 4I8GA 4OM9A 4Y8ZA 2PKSB 4B75A 1PYTD 2OQ5A 4KTCA 3RM0H 2ZC9H 1P2IA 1HFDA 2F9NA 2QV1A 5TCCA 3L6PA 2J92A 1SPJA 2WZQA 2BM2A 1TFXA 1O3IA 2UUJB 2GVFA 3KGPA 2Y5FA 4QT8C 3B9FH 5LPEA 1HAVB 3AAUA 1P06A 1DE7H 2P16A 4X2XA 4IN1A 2G4UA 1C5UA 3BTQE 1XUKA 2HPQH 1JBUH 2D26C 2EI6A 2WPMS 2VB0A 1O39A 1HAZB 2R3YA 4PROA 1TB6H 1ZLRA 4ISHH 4AOQA 3D65E 8KME2 1C5OH 2FODA 1O36A 3T62A 1F0RA 4WXVA 1GMDG 4RSPA 1PQ5A 1GI3A 3EQ0H 1SGTA 2SGPE 1JOUB 1QQUA 5C1YA 1AE5A 1GHWH 4MVNA 1UK4A 5GJ4B 1KXEA 2EI7A 5IDKA 1AO5A 3PLBA 1JWTA 2GTBA 5A09A 1BMLA 2G8TA 1BBRE 4IW4E 3M7QA 3ODDA 4ISLA 4DIIH 1P9SA 2OP9A 2ZQ1A 3M37A 1E37B 3HPTB 1WAYB 1C2MA 1L2EA 2TPIZ 3R0FA 5L30H 4HG6A 1YCPK 1HXEH 5T6DA 1O3MA 3URDA 1AUTC 3P17H 2P8OB 1GBEA 2GCHF 4X1SU 5HKKD 3JZ1B 1K1PA 2B0FA 3K6ZA 1VITH 2V3OH 2GZ7A 2H5DA 4Y0ZE 1K1JA 3VEQB 3CNRA 2PLXA 4ZKOU 1FQ3A 5A0AE 4BAHB 2Y80A 3S9CA 2BOKA 2VIVA 2NU2E 3WW7A 2W3KA 1D9IA 2BD9A 1D6WA 2K1QA 2XBYA 4F55A 1P03A 3H09A 4ABEA 5FXLA 2A7HA 1BTWA 3E0PB 1ABJH 4X8TH 1EPTB 1W10U 1FNIA 3BN9A 5GDSH 4IMZA 1DY9A 1UTQA 2WPIS 1EZSC 2Z6BD 5SGAE 1ZZZA 3SJOA 3SI3H 2PGQB 1K1LA 3SYJA 3VFEA 4NFFA 2ZGCA 2BQ6B 1QRXA 1C2HA 3A80A 1CGJE 4BAOB 5GNDA 3KN2A 4Q7ZA 1ANCA
chains in the Genus database with same CATH topology
4ABGA 3RXHA 1CT0E 1C1OA 1O5CB 4I8LA 3GCTF 4RKOB 1LKBA 1VR1H 1QBNA 3RU4E 3BTFE 1H8IH 3RC6A 2H9TH 4CREA 4CBOA 3K6YA 4B74A 1NRPH 4Q7XA 2FPZA 5L6NH 3TNSA 2FI3E 1BA8B 1FN8A 4FU9A 2VIWA 3C27B 4BANB 2ZFFH 3UOPA 2GGVB 1RFNA 1BQYA 1TWXB 3M3TA 4UFEH 1FN6A 3PV4A 1O2IA 3AAVA 2DUCA 2FOGA 3SUDA 1BRBE 2HNTF 1YCPH 2ZHWH 3RC4A 3OYPA 1SLXB 3EGKH 2Z3DA 4H4FA 3V0XA 3LJJA 5H4IB 2PGBB 3T26A 1DX5M 3Q3XA 1GJAB 1TALA 1IQHA 3HATH 3PMBB 4UE7H 4IMQA 1Z1JA 2RDLA 3E3TA 1XVOA 4U01A 5EXNA 2A7JA 1C5YB 1H1BA 1O35A 4ABHA 1OPHB 2ZP0H 1E0FD 1ZMJA 4MNWA 1EPTA 4CH8B 1C5SA 1YPKH 3EE0B 4CRDA 2G5VA 1FY1A 2AH4X 3P92A 3ZVDA 1ZJDA 5CHAB 2A4OA 3RXRA 3RLWH 1ZTKA 2BQ7B 1GBTA 1GI7B 1AZ8A 1V2QT 2FTMA 3UREA 4ISOA 3LH1A 1FJSA 3FFGA 4O03A 1V2UT 1W14U 3GDVA 4X6PA 1KLIH 1KXCA 6ESTA 4LK4A 1C1UH 1UTOA 5FBIA 1C1VH 2QN5T 2ANYA 1HB0B 1PQ8A 4K8BA 5AFZH 1M9UA 4A1TA 3UQVA 1S0QA 3SU2A 9ESTA 2GT8A 3WY8A 1GDQA 1SHYA 2HGTH 2XWAA 2ZQ2A 4Y11E 3GY3A 3RXLA 1ETRH 1GI4A 5E0JA 1HJAC 2FX4A 2O8LA 5FPSA 3I77A 1EAXA 1LHCH 2A2XH 2RCEA 1ZMNA 4FUHA 4JYVH 1LVBA 4D7FA 1S85A 1BOQA 1Z8RA 1QL7A 1G36A 1Y5BT 5A8XA 4THNH 5DP7A 1GBKA 4MQAA 1TGTA 1TQ0B 4CH2B 5FPTA 4VGCB 1PPFE 4I32A 1PQAA 3V13A 3MH6A 2VIQA 2Z7FE 3GCTG 5AHGH 1BITA 1C5PA 3DUXH 2G4TA 2ILNA 1VITG 3MU1A 1NRRH 1Z7KA 4MNYA 1FXYA 2XRCA 2XBXA 3S7HB 3TK5A 1S6HA 1MH0A 2XBWA 3FAOA 4WMFA 2ZPQA 4DVAU 1TGSZ 4NG9H 1BDAA 3PMJA 2OC8A 1O5EH 1LPGB 3FVFB 1SGIB 3PROA 1TPOA 3SGBE 1GDUA 1B0EA 1P57B 3LGUA 1K1MA 1EOJA 5E2PA 1HIAB 1TNHA 1F7ZA 1XXFA 2ZEBA 1HDTH 1C4V2 1A3BH 2XYAA 2WUCA 2HLCA 2W5EA 2WYGA 2BDCA 1C2KA 3P8GA 1THSH 4GLYA 1IQFA 1GBIA 2ZTXA 2ZFRH 5GCHF 3O8RA 1C2GA 4KP0A 4B2CA 1GBCA 2Z9KA 3FZDA 1P05A 1MU6B 1F5LA 1A0LA 1JMOH 1E34B 1MAYA 1GG6C 4K5ZA 1SGYE 2ZDVH 3RXJA 1AN1E 1TQ7B 1T32A 2BDIA 3OX7U 2ZFPH 5HXFA 2C8ZB 1LHEH 3HK3B 3IITA 4ZXYH 1O3DA 5GXPA 2QF0A 4X6MA 1WSSH 4CR9A 4D7GA 4U30A 4HFPB 3F9FA 2P3UB 3GYMA 1GJ7B 1O2QA 1SBWA 1ANBA 4ZHMU 1GBDA 2F9VA 1GJ6A 1WBGB 1FY3A 1GGDC 1QBOA 1TONA 1YYY1 2FTLE 5F8TA 4ZXXH 2QCYA 4MLFB 1Q31A 1RS0A 5G4BA 4WH8A 3HGPA 4GPGA 1GI6A 3GICB 1J17T 1FV9A 2HRVA 3ZZDA 1WYKA 3E0NB 2XNIA 2QA9E 2XCFA 1QNJA 1DITH 2CGAA 5E2OA 3UNSA 4IC5A 4Z0KA 3MNBA 5GPIB 1JIRA 4ESTE 1C4Y2 2Y81A 2STAE 1K1NA 1WCZA 1ZPBA 1HRTH 2Z3CA 2ZTZA 5FHTA 2OTVA 3PO1B 3MNCA 2ZTYA 3EA7A 4GCHF 2BY8X 1DWCH 1O2UA 4NSVA 1QRZA 5DP4A 5F6MA 3VXFH 1OKXA 4XBDA 1GVLA 1PPEE 4E05H 4JK5A 1RIWC 2BDYA 3RU4T 3FZZA 3SHCH 4YLQH 1THRH 1QJ6B 4SGBE 3ZYEA 3BTEE 1LVMA 3F9EA 4OS4A 4NA9H 1TGNA 5FBEA 2WV5A 1EB1H 2ZNKH 2BX3A 1C5NH 2YNBA 1FMGA 1NROH 1DM4B 1CHOG 4IBLH 5DP3A 1O2PA 3FP6E 4INKA 1SGDE 3QK1A 3QWCH 3RXPA 3SV8A 1N8OC 4A92A 3FP8E 2FZZA 3NKKA 1GJCB 2OCVB 1VZQH 1EQ9A 1EKBB 1YPLH 2TGDA 2EA3A 3RXIA 1GI8B 4ZUHA 1CT4E 1IQNA 1BB0B 1SGEE 2J94A 3A88A 3NCLA 3MNXA 1G30B 2FWWA 4FUCA 2XWBI 1LO6A 1NT1A 2FXRA 3EAJA 3D62A 3KNXA 4LXBH 1QIXB 1AVGH 3SJIA 1BHXF 3KQBA 3KL6A 3KHVA 3SOSA 1O3AA 1UTKA 4INLA 1CU1A 1MMJN 2ZZUH 3UR6A 2ZF0H 3RXGA 3QLPH 2FLRH 1BCUH 2VWNA 1W13U 1O5AB 5L2ZH 1DT2A 5LH8A 4YT7H 2J4IA 1ANDA 1H9LB 1A46H 1MKXH 4MNVA 1QGFA 1V2TT 1GI9B 1TBZH 2OXSA 2C8XB 1TMUH 4OGYA 1GJDB 3RXDA 2AERH 3UR9A 1GBAA 1NRQH 2OC1A 2PKAB 2ZGXH 1Y3WA 1H4WA 2C3SA 3GOVB 3M5OA 4MPUA 1UVPA 1C2LA 2ZDMA 1C1PA 3MYWA 2UUKB 1GI5A 1MQ6A 2FOAA 3MO3A 3ZZ6A 4AG2A 4X2WA 5E0GA 1IQKA 3TJOA 1SQAA 4O3TA 3LGIA 3MNSA 1C1NA 1ELDE 1GG6B 1SB1H 2ZU5A 1FUJA 4ZKNU 2QC2A 1BTZA 1AWHB 2JH0D 2TGAA 5LGOA 3RXAA 2C93B 2QY0B 1WOFA 2ZHFH 3A7XA 3SU6A 1AHTH 1LQDB 2AMPA 3VB4A 3IWMA 3UY9A 3PWCA 5FAHA 3U9AH 2ZCKP 1HYLA 1P11E 6CHAB 1L1NA 1P2OA 2UUYA 4MNXA 2B5TB 1DUAA 3MI4A 3GY6A 1S6FA 1NC6A 2SGAA 2QF3A 1GHVH 4KGAA 2GMTB 1XUGA 4FVDA 1XUFA 1MTSA 3A89A 1S5SA 2FP7B 2GV6A 4Y0YE 3M35A 2P3FH 1EASA 4R0IA 2O8TA 1T4VH 1GJ5H 5HM9A 3M36A 1L1JA 1WQVH 1BTXA 2PUQH 1OSSA 1AKSA 2ALPA 2OQUA 1V2NT 2FO9A 3GY4A 5J4QA 4YLUA 1P9UA 3DT0H 3TGKE 6GCHF 4IS5A 3GY5A 3TNTA 1A2CH 2ZCHP 3UNRA 1RRKA 4NZQA 1SGRE 2YOLA 3GY2A 4Y71A 3RMMH 3PO1C 3GCHC 1C2EA 3MOCA 4X6OA 1YKTA 3HKJB 2PKSC 1Y3YA 1RTKA 2WYJA 1PPBH 3RXQA 4NGAH 2A1DB 1P0SH 1MAXA 2PFEA 2P8OC 1A61H 4YESB 3LC3A 1UK3A 3CS7A 2QXHA 2BD8A 1TNJA 2CJIA 2C8YB 2VIPA 1V3XA 1SFIA 4Y79A 1ZSLA 5EXLA 5FX6A 1D4PB 4UONA 2CHAB 1DSTA 4BAKB 3ATWA 3S9BA 4NIYA 1HXFH 5BRRE 2OBOA 4AYYB 1MZDA 1FONA 2A5IA 2STBE 3Q3YA 4Q2KA 1EJMA 3MO9A 3SU1A 1N6YA 1D3QB 3GISB 2ZFTA 2VVVA 1O3FA 1IQGA 2AGEX 3RXFA 3A8DA 5CE1A 2SGDE 1BRAA 2ZDKA 5C5NA 3RU4D 4TWWA 2V6NA 3V7TA 1WUNH 1GBMA 1MZAA 1D3TB 1OP2A 1C1RA 3KF2A 3PM3A 3LIWA 1GCTB 1NFXA 2FIRH 1O2HA 3TK6A 4OS2A 1DICA 3E90B 3JZ2B 2IOTA 1HNEE 1O2TA 2ANKH 4U2WA 1T31A 4AORA 1HAYB 3P8OA 3TH3H 1VJ9U 2VWMA 3QDZB 1A1RA 3SGQE 1ELVA 3A8AA 1XUHA 1ETSH 2PR3A 4GCHG 1NO9H 4NCYA 1FIZA 1BZXE 2P59A 2WPHS 2ZA5A 1P2QA 1JRSA 3UIRA 4JK6A 3HK6B 1OWIA 4AZ2B 1GBHA 2Z3EA 2BD3A 4UD9H 2GT7A 5E8EH 1EZQA 1JRTA 4NWLA 5FCKA 1O37A 2A31A 3Q00A 2TGTA 1KDQB 1O2JA 3OSYA 2PV9B 4JCNA 4MPWA 4XSKU 2ESTE 5AFYH 2R2WU 1T8OA 3SJ8A 3U8TH 2ZKSA 3NK8A 1O3BA 4I8JA 2HVXA 2ZWLH 2CN0H 4DJZB 2G52A 5T6GA 1MD8A 1V2MT 1TE0A 2P3TB 6GCHG 2GCTC 3ENSB 2ZECA 4Z6AH 3SV6A 1ABIH 4GSOA 3A7WA 3SZNA 1O2LA 5EU8A 1ZJKA 3EA8A 3A81A 4BXSA 1YPHE 1O2SA 1UTJA 1C2JA 1GL1A 1INCA 1AI8H 3M7TA 2FOEA 4X1QU 1V2RT 3GCNA 4CRAA 2LPRA 1W7GH 2ANMH 4X1NU 1BMMH 4JYUH 3TGJE 1FIWA 1BTYA 1K1OA 2H9HA 2HPPH 4X6NA 2V0BA 4ZH8A 4WMDA 1HV7A 3DHKH 3ZVBA 1AD8H 4WVPE 1UTLM 2AMQA 1UTPA 3SNBA 1NTPA 3FP7E 2W7UA 3MH4A 4Y8XA 3PTNA 2YNAA 1S84A 3SNCA 1YLCA 9LPRA 1C4U2 4KKDA 4ASHA 2ZU4A 2O8WA 3PTBA 2D1JA 3NZIA 3VB6A 3U1IB 3BIVH 3VXEH 4BTIB 1IHSH 1AY6H 2RA0A 4ISNA 1J8AA 4TPYA 1C5MD 1TMTH 2J34A 4UFFH 3BSQA 2ZU3A 4ABFA 4GAWA 3TH2H 1UVTH 1DWBH 3E16B 1BUIA 4JZEH 2CV3A 1V2VT 4FXGH 3BIUH 3TJVA 1TNGA 1G3EA 1GMHF 1O5BB 1O2WA 2GZ8A 1NZQH 2J95A 5J4SA 2ZGJA 1MTNB 1HAOH 2VWLA 1UHBA 1SLWB 2FLBH 3RLYH 3QGJA 4J1YA 1NESE 1AE8H 2FI4E 4DY7B 2F83A 2Z9GA 4F49A 1AIXH 4BNRA 2VVCA 3RM2H 1OYTH 1Z6EA 4X1PU 3QTVH 4B1TA 1D6RA 1FDPA 1HJAB 1CQQA 4D8NA 3P8FA 1BBRH 1GL0E 4NIXA 3SHAH 1PPGE 1KYNA 4LOYH 1GJ8B 4CHAB 2HALA 1LHFH 2XW9A 3BV9B 5C3NA 2Q1JA 2C8WB 3SQEE 1K9OE 4BTTB 5JBTA 5EPYA 1IQLA 1O2XA 2OUAA 1QCPA 2SGQE 4ABJA 1GBJA 4LZ1H 4Q7YA 1C5TA 1KXDA 4I8KA 5CMXH 2QXGA 1CGHA 3LGVA 4YO9A 3SN8A 7GCHG 7ESTE 1LPZB 1XMNB 1SL3A 4O97A 2HNTC 1QBVH 3MU5A 4Q80A 4YTAA 3UPEA 5GWZA 1K22H 3T25A 1DY8A 3RXKA 1G32B 1PPCE 1W2KH 1AVWA 3M5NA 5JYIA 1P02A 4DT7B 1B5GH 1NPMA 1MBQA 3O8BA 2ZDLA 4MDSA 3MH5A 5EGMA 3P6ZB 4B2AA 2XC0A 2WUBA 1ESTA 1MTUA 3P95A 1P04A 1YM0A 3EDXB 5K7RA 2OBQA 3MU8A 1TRMA 2B9LA 2OINA 7KMEH 4GVUA 3S7KB 4JZ1A 1S0RA 1WTHD 2Y7ZA 3BF6H 4ZKRU 5HGGA 1C2FA 5C5OA 2BDHA 1CHGA 2JETB 1ESBA 2BDBA 4MTBA 3ZV8A 1GHAG 1O5GH 3B8JA 1TYNA 1GHBF 1NFYA 1GI1A 3KEEA 3S69A 1HIAA 4FUFA 1AMHA 2A7CA 2BY7X 2XBVA 1ZOMA 3LPRA 4WWYA 1DWDH 1O33A 4ABIA 1G2MA 1ARBA 1UVOA 2ZHDA 8ESTE 1DXPA 1XKAC 1EZXC 3EYDA 5L2YH 4R8TB 1AWFH 2GDEH 1F92A 3GCOA 3VGCC 1G37A 2O8MA 4O3UA 1XVMA 4BXWA 1QB1A 1TPAE 1O2MA 1Y59T 3M5LA 1F0TA 3GY8A 2GP9B 1MUEB 1TPSA 1EXFA 1A5HA 2BD7A 4TWYA 1KLTA 5T3HA 4RKJB 3A7TA 2H2ZA 3MU0A 1PFXC 1TMBH 3DFJA 1KDQA 3UWIA 3AASA 4K1EA 3A7ZA 4WF8A 5HM2A 4I8HA 1C1TA 1SQTA 1GJ9B 2Y82A 1W8BH 1E35B 5EPNA 3UTUH 2BDAA 1Q3XA 2ZIQH 1AUJA 1KXBA 3FANA 1QA7A 1QL9A 3ZZBA 4O9VA 2ZGHA 2WPJS 1FPHH 3BG4C 1BJVA 1BRUP 2BY9X 2ZHQH 1O3PB 1BHXB 4I31A 2I6QA 2P95A 1DANH 3SW2B 1KTTB 2ZDAH 1OWJA 4GUXA 3RXMA 4A6LA 1IQJA 1YPJH 1QL8A 5F8XA 1Y8TA 1UCYK 1SHHB 1ELGA 3PLPA 1TA2A 1F0SA 1S83A 2BXUH 1Y3XA 2WV4A 3PLKA 3K65B 2NU3E 3LGYA 4ISIH 4E06H 1TRNA 3DA9B 3KIDU 3TPIZ 1RTFB 1EP5A 1C1QA 5DGJA 4YOJA 3VB7A 3SGAE 2UWLA 4XFQA 2FOHA 2RA3A 3PWBA 1P2MA 2PW8H 5JB8S 1LCYA 3U8RH 1FPCH 1AVXA 1QRWA 1A5IA 1SSXA 2GKVE 2XXLA 4IN2A 1MD7A 2AS9A 1AFEH 4X0WU 5GIBA 1F5KU 2GX4A 4BOHA 4DW2U 1SR5C 3F1SB 4K2YA 3O8CA 4B2BA 2F9PA 1ZRBA 2ASUB 1W7XH 1TGBA 1MCVA 3F9GA 1Z8JB 4OS6A 4H42U 2ANWA 2XCNA 3SORA 1HCGA 2H5CA 3RMOH 2VU8E 1TBRH 1LQEA 3BTKE 1V2JT 4GHTA 1LHGH 1L0ZA 4K1TA 3F9HA 1QB9A 3LGTA 3TITA