4Y0ZE

Trypsin in complex with with bpti mutant aminobutyric acid
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fluorine teams up with water to restore inhibitor activity to mutant BPTI.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor complex
molecule keywords Cationic trypsin
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y0zE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y0zE02
4SGBE 2V6NA 1T32A 1FZZA 1GHXH 1JXPA 1MBMA 1BRCE 2Q1JA 4CBOA 6CHAC 3FVFB 4X1SU 3RXDA 5EQRA 1CE5A 4I7YH 1UCYK 1GI2A 1TRYA 1THSH 8GCHF 1SPJA 3V0XA 2AS9A 3RMMH 1W0YH 3MO3A 2H6MA 2CF8H 3IG6B 1L2EA 4CR5A 1M9UA 1SSXA 3B8JA 2ZZUH 2OQ5A 2XWBI 2BY9X 2FS8A 1MUEB 1S6FA 2FOEA 2OC8A 1EJNA 3QLPH 2JETB 1O2WA 1P12E 2A4GA 1BBRH 3A87A 3GY7A 5PTPA 1TPAE 1EOLA 2XCNA 3RXSA 2O8UA 2SNVA 3F9HA 9ESTA 3W95A 3SNCA 1CA0B 4AFQA 1ZOMA 1OPHB 1DT2A 2VH6A 1PQ5A 1NRRH 4MNVA 5JB9S 3BTQE 1ZPBA 3KQEA 2ZNKH 4XOJA 3U8OH 2QA9E 1K1OA 4OS2A 1QBOA 1EZQA 2JKHA 3F9FA 2FXRA 1SL3A 4AFUA 1O2KA 1N1LA 3BTME 1O5EH 3P17H 1YCPH 1ACBE 3NPSA 1SQOA 1IHTH 3SN8A 3MH7A 1O3JA 2XNIA 1LVOA 2GCTC 1IQFA 2F9NA 1EX3A 1SFQB 3TVJB 1C1NA 4NIWA 2O9QA 3RXGA 1LDTT 2ESTE 3F9EA 1MTNC 1SHYA 1T8OA 3PTNA 5EQQA 2W3KA 4I8KA 4JCNA 5SGAE 3BN9A 4AFZA 4ABFA 1O3DA 2ZTXA 3A82A 1G9IE 4Y0YE 1NRPH 1MD8A 1PPEE 3UOPA 1E34B 1AUJA 1K21H 1C4Y2 3P8OA 1LHEH 3FZDA 2BZAA 1OP0A 4LZ1H 1XM1A 1GBFA 2PR3A 1O2GH 2GP9B 2A31A 4ZH8A 1QIXB 3UQOA 1OKXA 5DK1A 1W10U 4RSPA 2ASUB 1AI8H 2XW9A 1GBDA 1FPCH 2D1JA 3DA9B 3ZVBA 7ESTE 1GI8B 4TPYA 1O2LA 1Z8RA 1AB9B 1QQ4A 5C1YA 2ZFRH 2FI3E 1A0JA 1LPZB 2ZQ1A 4JZFH 4ZXXH 2YNAA 1DUEA 1UTMA 1UHBB 2J9NA 5TJXA 4AYYB 3ESTA 1C2LA 1Y3UA 1FNIA 2R2MB 4AG2A 2HGTH 1BDAA 1C5LH 4GVUA 1P2KA 3E91A 1IQHA 3D23A 1L1NA 3SO3A 1K22H 1VITH 4HI3A 4HFPB 5AFYH 2C3SA 1PQ7A 2XBVA 2XWAA 2P8OB 1TNJA 3AVZA 1O2UA 3GDSA 4INLA 5DP8A 4DT7B 1BBRK 1NRSH 1P10A 3OU0A 2TGDA 4KKDA 3ZZDA 1O3EA 1A61H 1QQUA 4GSOA 4NZQA 1GJ9B 5JBAS 1Y5UT 2J4IA 4LOYH 2VWLA 4BANB 1AQ7A 4DIIH 3VXEH 4K1SA 1GL1A 4LXBH 5C1XA 4TWWA 1GG6B 5L6NH 2FOMB 1OXGA 3ATMA 4ABHA 1HCGA 4OS5A 3M35A 1WSSH 1SGEE 2FOCA 1JBUH 4CRGA 3M7UA 5T6DA 3DT0H 5JPMH 5GCHG 4JZIA 3E1XB 5DPAA 3P70B 4JZEH 2BX3A 4YOIA 1O5AB 3TGIE 1OWIA 3NXPA 3URDA 3M5OA 1HXEH 4KGAA 3SNDA 4ZKSU 4Y8XA 4GCHF 5F03A 4J2YB 2BVRH 1QR3E 1CVWH 1QURH 4YO9A 3ZZ9A 1HAVB 1OYTH 4WH8A 1N6XA 1C5RA 2F3CE 2FI4E 2PUQH 1GDNA 3BEFB 2ZFTA 3K2UA 5JBCS 4XE4A 3UPEA 6CHAB 1UTJA 1O2MA 1YCPM 4B2BA 2R3UA 1W11U 3RXUA 4DOQA 4VGCC 1H9IE 2ZECA 1AWHB 1SOTA 1MTSA 3F9GA 4X8VH 2O8WA 3BF6H 3MYWA 2ZI2H 7KMEH 2Z3CA 1A7SA 5A0AE 7LPRA 1QHRB 3GCOA 1PPGE 4AZ2B 1S85A 2VJ1A 3OX7U 3GICB 1EZUC 1Y3WA 4BTIB 3DHKH 1AUTC 3MU0A 2GTBA 4ABEA 1OX1A 1YF4A 4GAWA 1V2NT 4KP0A 1EOJA 5C1UA 1SLUB 2WPIS 2OQUA 1GJAB 4ISOA 1FIWA 1GMDF 1E38B 1C1QA 1WYKA 4IBLH 4BTTB 4A92A 2ZGXH 3NZIA 1EPTA 1H9LB 3M3TA 3LC5A 2ZA5A 4ZMAH 4X2YA 1P2JA 1CGIE 3KL6A 4Y76A 3T28A 2FIRH 2BYAX 2BOHB 1S83A 4I32A 3SU5A 2Z9KA 2BLVA 2VWMA 1A0LA 4U2WA 2WPHS 3M3VA 3SZNA 4RKJB 2QCYA 1CHOG 3TU7H 1GPZA 4TWYA 2HNTC 4JK6A 4A5TS 4OGYA 5LGOA 4UDWH 1L4ZA 1P0SH 1AB9C 3EYDA 1O5FH 3HGNA 4KTUA 3S9CA 4K69A 4NZLA 2H9EH 2HPPH 1SGYE 2GVFA 2AMDA 1GI5A 1HV7A 1P11E 2WPLS 1C1PA 3FAOA 2G00A 2QY0B 2F9PA 2ZHFH 2XBXA 4ABJA 3RMNH 1DE7H 4K2YA 1V2OT 2NU1E 1DLEA 1H9HE 1ZJDA 2SGQE 3ATKA 1NO9H 2C8YB 1UCYH 3G01A 2NU4E 1UVTH 1P2OA 3R0FA 3RXOA 1O3PB 4GHTA 1GHVH 2LNCA 1B0FA 4A7IB 1MKWH 2J38A 5HM9A 4Y7BA 1KXCA 1ELVA 2OTVA 2OP9A 1RRKA 3URCA 1Z8IB 1XXDA 2H2ZA 4FUDA 2G81E 1YPHE 4BAKB 1T31A 1J17T 1MMJN 2SGAA 5C20A 1SQAA 1CHGA 1SG8B 1BTUA 1UTNA 1AFEH 2P93A 5FBEA 4DJZB 2FO9A 1P01A 2Z9GA 1AGJA 1SGFG 5EW1H 2K1QA 2G5NA 3CENA 2UUJB 2HNTF 1GI3A 2TBSA 1QNJA 2Z7FE 4NFEA 2CF9H 1P2QA 2ODYB 1O32A 3SUEA 2FLRH 3Q3KA 3C27B 1FIZA 1PPHE 4MNXA 2BY6X 4XBBA 4D7GA 1Z6EA 2QYIA 5C3NA 2W3IA 4NGAH 3TH3H 1HAOH 3V12A 1HJ9A 2V35A 1A1RA 3P6ZB 1XKAC 1IQEA 2H1UA 1VITG 3ATIA 5EXNA 4JYVH 2GT7A 3IITA 4A1XA 1C5PA 4K60A 2VGCC 2BTCE 4CR9A 4IC5A 5E2PA 2F9BH 5A8ZA 5JDUB 3RXEA 4XSKU 1YYY1 2ZDMA 3GY2A 3HPTB 1GBEA 2FI5E 2RA3A 3RXTA 1QBNA 2WV4A 2Q6DA 4WMEA 5I46H 1DFPA 1TNHA 2GGVB 3K65B 3RM0H 1DVAH 3RXPA 3RXBA 2Z9JA 3D49H 2B5TB 3VB4A 2UWLA 4UD9H 1O3NA 3A85A 3MWIU 1MKWK 4Y6DA 1P06A 3A7WA 1P09A 1WQVH 2G8TA 1YPGH 2QV1A 4IMQA 5DO4H 2ZTZA 4MNWA 3LH1A 1SGDE 2A1DB 2VU8E 1C5YB 1ID5H 1DDJA 3UQVA 5CHAB 1EAUA 1ELTA 1QA0A 3H7TA 5A8XA 1ZJKA 5FX5A 1MCTA 1PPBH 3T26A 3ITIA 1MTUA 1W0ZU 2XC5A 1DWEH 2ZO3H 1O36A 1KYNA 1TX6A 3RLWH 3BTEE 3AAUA 3MU4A 1KXBA 3LJOA 4JK5A 1AIXH 1AO5A 1BITA 1ZHRA 1UVPA 2H9HA 2ZWLH 1TNKA 4WH6A 3STIA 1FLEE 4R8TB 4GPGA 2GZ7A 4BXWA 5J4QA 3R3GB 2WPKS 1OS8A 3ZVFA 3O8DA 3PLBA 1ARBA 1C1OA 3RXLA 3GDUA 2V0BA 1LHFH 1ETSH 2A4OA 1UVUH 2FM2A 2ZC9H 1W14U 3RXJA 1G3BA 2ULLA 3PMBB 2CGAA 4TYDA 1V2ST 1AFQB 3UFAA 3ZV9A 1C1UH 1LPKB 2IPHA 1GHBF 1TLDA 1CQQA 3NWUA 1T8NA 3STJA 4NWLA 3MOCA 3VXFH 5E8EH 2ANYA 4ISHH 3MNCA 1BA8B 1Y8TA 1ZMNA 5EXLA 2A5AA 1TAWA 1YPEH 1N6YA 1V2JT 3M5NA 2XBYA 3KQDA 5AVDA 5T3HA 2BD5A 1HAVA 5H4IB 3VB5A 4H4FA 3Q3XA 2Q6FA 2W7UA 2JH5D 2G4UA 1BJVA 2PFEA 3A7ZA 3EQ0H 3RMOH 3ZVDA 1Z71A 1YP9A 1IQIA 4HGCA 1DSUA 4ZKOU 2FTMA 1GBCA 3T29A 1DANH 1G36A 2TGPZ 1ZTJA 2GDDA 1KDQB 2EI6A 1L1GA 3QO6A 2XYAA 1WOFA 2PHBA 1TQ0B 1CT4E 1QFKH 5FHTA 3A88A 1EATA 1ZHPA 4O3UA 5DG6A 3A8CA 5G4BA 3A84A 2RDLA 3GCHC 1EAIA 2FESH 4Q2KA 3TH2H 2NU0E 1HUTH 1S84A 5TCCA 1CA0C 4FU7A 3A83A 2QF3A 2R0LA 2AYWA 1N8OB 2PKSC 2PV9B 3MU8A 2BX4A 1BT7A 1TMUH 1QJ6B 1KDQA 3BEIB 1TGCA 1O5BB 1W13U 2BOKA 1RTLA 1SHHB 3SU1A 1C1TA 5JYIA 1MTNB 3LOXA 1BTHH 1KLIH 5JBTA 1MKXK 1YPMH 2JETC 1SGFA 1C2JA 1HGTH 2ALVA 2WUCA 1C5OH 2Y82A 4D8NA 4OS4A 2VIWA 1P2MA 2ANWA 5GXPA 1BMLA 1SI5H 2AIQA 4FUCA 4ISIH 1PJPA 1GJDB 2A5KA 1BOQA 4F4OC 1O35A 3I78A 3RXQA 1O2HA 5IYTA 3BTGE 1X7AC 4ZHAA 1UO6A 3IWMA 4E06H 3A89A 1A0HB 1KTSB 3K6ZA 2BXTH 3CP7A 3RUOA 3M5MA 4Y71A 5EGMA 1BTPA 3ZZAA 1TONA 3FANA 5EODA 1AKSA 5FXLA 1ZHMA 2PKAB 3NK8A 1IQNA 1TGBA 2BB4A 1INCA 5FAHA 1MD7A 1C2KA 4MVNA 2FOBA 1GDUA 3SHCH 1T4VH 2CV3A 3W94A 2D2DA 2OC1A 1Y5BT 1C5XB 4X1NU 8LPRA 1L1JA 2W26A 1Z6JH 4RKOB 2A5IA 2GDEH 4CHAC 3E3TA 2TGAA 5DGJA 3U1JB 1GBKA 3ATLA 4X8UH 1F0SA 3ZVAA 1NC6A 5E0JA 5FPYA 5GWZA 3TH4H 3CS0A 1AFQC 2WINI 4IN1A 3PB1E 2AGIX 1GMCG 4ABBA 1QCPA 3E16B 3GY3A 3BTTE 2RCEA 5GJ4B 2CJIA 3SNEA 4WMDA 3BG8A 5EOKA 1UK3A 1EP6A 1HPGA 1S6HA 9LPRA 3SGQE 1DSTA 1K1JA 1ABIH 1T8MA 1FY8E 2J95A 2SGEE 4SGAE 2PUXB 1GBBA 2B8OH 4NIXA 1O3BA 3PROA 3GOVB 4BOHA 6GCHG 4UFGH 1GJCB 4CRDA 2FOGA 1YPKH 5HMAA 4ESTE 4JYTA 2SGFE 3ATWA 4B76A 4NA9H 4WWYA 1PPFE 4H6TA 4ABAA 3S7HB 1Z1IA 2R9PA 1GMDG 1SMFE 2Q6GA 1GGDB 3AAVA 3SORA 4K1TA 1ZSJA 1BIOA 1NRNH 2IN2A 2V3OH 3KHVA 1GCTB 2ALPA 2BD3A 1L0ZA 2H5DA 1IQLA 1O3HA 4ZUHA 5DKMA 1EASA 1MZDA 1DICA 3MU1A 1V2TT 3A8AA 3TJOA 3AW1A 5DP6A 3ZZ7A 3RXKA 1AZ8A 4I8HA 2PSYA 3P95A 1XUGA 4YT7H 2XRCA 4TY7A 1OOKB 4CRCA 1WCZA 1LVYA 3TITA 2F9VA 1QL7A 2BVSH 1LQEA 2C8WB 4D9RA 1AHTH 1HAHH 3EGKH 2BD9A 1TBRH 3ZVEA 4DG4A 1FXYA 3U1IB 1O2OA 2B7DH 3SU0A 1XVOA 1RJXB 1NTPA 2FX4A 2F9UA 1SGQE 3V7TA 3LU9B 3DFLA 1SGPE 3RXFA 1C5WB 4GCHG 7GCHF 1NU7B 1A2CH 3F1SB 1S81A 1CBWC 3M3SA 2PKAA 4ISNA 1IQGA 1CSOE 1V2UT 2Z9IA 5GDSH 1FY5A 1F5LA 4NSYA 1XX9A 3NKKA 2A4QA 2BHGA 1P02A 2H5CA 2G55A 1XXFA 3F68H 1WTHD 2A7HA 3VGCB 3ZZ8A 3ZZ3A 1O39A 1P05A 3EAJA 4AGJA 5DP5A 5FCKA 4YOGA 2EEKA 1Q2WA 1TNIA 1FN8A 1QTFA 1TMBH 4A1VA 1H8DH 1D4PB 1DXPA 1WV7H 1CT2E 3QZQA 3FZZA 3T5FH 4Y8ZA 2XBWA 3A80A 1D3DB 2ZIQH 4X1QU 1N8OC 2PKSB 1ANCA 1HRTH 3O8CA 5L2ZH 4ZKRU 1UTLM 3K6YA 4JZDH 3HK6B 1F7ZA 1IQMA 1OSSA 1TYNA 1O2ZA 4NA8A 1NFXA 1MCVA 1GMCF 1GWAA 2QIQA 1P2IA 1C5NH 3VFEA 1HAYB 3L33A 1P9SA 1GGDC 1KY9A 5I25A 2PGBB 1FUJA 2A2XH 5TCAA 1QL8A 1GMHG 3FFGA 2ZPSA 1MH0A 1C5ZB 5F8ZA 5ABWA 1GHZA 1IAUA 3PWCA 1AU8A 1W2KH 3BTWE 1ZZZA 2P8OC 1EJMA 1OWEA 2BM2A 3SUGA 2G51A 1P9UA 1A46H 1D3TB 1F2SE 1O2VA 4WJG2 2P95A 2R2WU 1HYLA 3TGKE 4U01A 3VB3A 2ZHDA 1BMNH 4FU9A 1GI6A 2ZDNA 1F5RA 4IS5A 1CA8B 1AN1E 1S82A 1W12U 4WF8A 3A8DA 4D7FA 1TA2A 1F92A 4Q80A 3TLOA 4ZHLU 1HFDA 5ESBA 1OWHA 1CBWB 4ABDA 1KXFA 1YC0A 4YLUA 3E90B 4AORA 1P2NA 4GUXA 1GCTC 4I33A 3SUFA 1EPTB 3ZZ5A 1V2QT 4UEHH 3EA8A 3QTVH 1DWDH 5C5NA 1NU9A 3KF2A 5AF9H 4JYUH 2FYRA 1NESE 3UNQA 4TY6A 3VGCC 1A5IA 1LHCH 4OS6A 1HAPH 4E05H 4ZAEA 2Y7ZA 3PMJA 3RMLH 1DY8A 1UTOA 2VIOA 1O3KA 4KELA 4INKA 8KME2 1HLTH 4HZHA 2BVXH 5E0HA 2GV6A 4AN7A 3M5LA 2Y80A 3EA9A 5BPEA 3MH6A 4A1TA 1U6QA 1GVKB 5GIBA 1VR1H 2GZ8A 1C2FA 2OCVB 4YESB 3D62A 1E0FD 1BJUA 1RD3B 2VIVA 1O3FA 3SU2A 3BIVH 1TBZH 2PGQB 1ARCA 2FP7B 1EZSC 2VVUA 2AMQA 4BNRA 2OLGA 5A09A 7GCHG 1DLKB 5FCRA 2BDYA 2A7JA 1O3MA 1JIRA 5EQSA 3B9FH 1ZGIA 2LPRA 1J8AA 2NWNA 1O34A 3MO9A 5CMXH 3V13A 1NY22 5CHAC 1HDTH 2ZEBA 3RXVA 2B9LA 1ELBA 1UHBA 1MKXH 3RXAA 3GCTF 4RN6A 4B75A 4GLYA 3SI3H 3BTFE 1V2RT 1BHXF 1LHDH 3CS7A 3LC3A 1RTFB 2GCTB 1O2PA 1Y3YA 2CHAC 1ZRKA 2ZPRA 1ELEE 3GYLB 3QUMP 4HTCH 5EW2H 3RXHA 1QRXA 1ABJH 3LGWA 1SGIB 2SGDE 2Y5GA 2WYJA 1OWKA 4E7RG 2QN5T 2VNTA 5A0BA 1IOEA 3PO1C 1TFXA 1GJBB 1ZRBA 1RTKA 4DY7B 4WY3A 3KIDU 1O2NA 1J9CH 2KAIA 1MQ5A 4X2XA 1GI7B 4DCDA 5FBIA 2FDAA 2BD2A 1EXFA 4Q7XA 1NPMA 1XKBC 2VINA 2VVVA 4WMFA 1NS3A 4ABGA 1MBQA 3UUZA 4NWKA 3UR6A 3GCHB 2Y5FA 3TJUA 4ZHMU 3SNBA 2ZCLP 3M36A 2FLBH 1FQ3A 1O30A 1OWJA 4IGDA 4K5ZA 1O3AA 1VGCC 1O2RA 2ZFFH 4DW2U 2BLOA 4OS1A 3P8GA 2ZGCA 2I6QA 4NFFA 3PLKA 1W7GH 2UUKB 1NFYA 2V3HH 2IOTA 4X2WA 1YM0A 1G37A 1SLVB 1ZTKA 2OINA 1C2GA 2ZHEH 4Y79A 3LIWA 1QL9A 1ZTLA 1TNLA 3M61U 4AYVB 1MZAA 1H1BA 2XC0A 3MO6A 3KQCA 3PO1B 3BSQA 1EB1H 1TB6H 3MH5A 3GY5A 2BQ7B 3PYHA 3ZYDA 2EI8A 1ZMJA 1LVBA 3QGJA 5EU8A 3BV9B 1UMAH 3Q77A 1HIAA 1HJAB 1PPCE 5FPSA 3EDXB 2ZQ2A 1UTPA 3HKJB 1QB6A 2AEIH 2FEQH 2J34A 1GI1A 1SR5C 1VJAU 3P8NA 1WTGH 2ZHQH 2ZP0H 1O2TA 2P3FH 2SNWA 3Q76A 3P8FA 1D6RA 2HALA 3GDVA 3MU5A 1QB1A 1QRZA 1SQTA 3HGPA 4YTAA 4K8YA 3NUMA 1AY6H 2QXJA 1BRUP 3SV9A 3RM2H 2HNTE 3S0NA 1BUIA 2DUCA 1K1PA 1GBAA 3SUDA 3UREA 2XXLA 2AGGX 2Z6BD 2KAIB 3SV6A 1ESBA 5L2YH 5EPYA 1D9IA 1J16A 2J94A 4R0IA 3A7YA 1ZGVA 4AFSA 2SGPE 3I29A 4CHAB 2BD4A 2BD8A 1DWBH 2EC9H 4ZROA 4FVDA 1C5QA 4XBCA 1C5UA 1TGTA 3PV4A 1GHAG 4H42U 4I8GA 3SNAA 2AIPA 4IW4E 1C1RA 1C4U2 3RC4A 1GBHA 3ZV8A 1NROH 1C2HA 2HOBA 5A2MH 1UK2A 3DD2H 2P16A 3S9AA 2BLQA 2J92A 2UWPA 4MDSA 1PPZA 1KIGH 1FY1A 1IQJA 4WXVA 2WPJS 2Y7XA 5C67A 1MU8B 3MHWU 1SFIA 2C8XB 2AH4X 1TMTH 2FPZA 1FY4A 3SBKA 4CH8B 5HM2A 3TK6A 1VCQA 2QXGA 2FOHA 3SQEE 3GY8A 1BBRE 1QJ7B 4BAQB 1K28D 1K1IA 1BB0B 4I8JA 1DUAA 1J14A 2P3UB 3OYPA 5L30H 3QGNB 1O2YA 1OP2A 1S0RA 2HPQH 3ODFA 3UR9A 1TALA 1PYTD 1XUJA 1TIOA 2FZZA 1TA6A 1BHXB 1RIWB 3BTDE 4YLQH 3TPIZ 3SV7A 6GCHF 1BTYA 1GI9B 1RS0A 1JRSA 2YOLA 4CREA 3KQBA 1CU1A 1O3CA 2D8WA 1C2DA 1DWCH 1KLTA 4E7NA 2WPMS 3UTUH 1C5TA 1F0UA 3P92A 1WQSA 2BDGA 4FVBA 2F83A 1AD8H 2O8TA 1B7XB 2ZU1A 1GHBG 1GI4A 2CHAB 4UFFH 1ELAA 6ESTA 1LPGB 4X6PA 1ETRH 2QGRA 3KCGH 1EAXA 2IJOB 5T6GA 4VGCB 3SU4A 3SJKA 2NU3E 3M37A 1ELFA 2A45B 3UNSA 1GHWH 1LVMA 1GCDA 3SQHE 4B2AA 3LH3A 1C2EA 4QT8C 4BXSA 2AFQB 2ODPA 5CE1A 4JZ1A 1AVWA 3D65E 1V2LT 1ANDA 1C9TA 1VGCB 1S5SA 1Q3XA 5FX6A 3VPKA 4AOQA 3A81A 1C1SA 1FJSA 1ZPCA 3LDXH 4K8BA 2GKVE 5AHGH 1O5GH 4BAOB 1AZZA 3LGUA 3SJ8A 1A4WH 4FUHA 2ILNA 3SV2H 3PMHB 2GCHG 3H7OA 3ZZ4A 3RXMA 1G3DA 2ZG0H 3OSYA 2BDHA 2TRMA 4MTBA 3MMGA 1YLDA 4Q7YA 4ZXYH 1BRBE 2F9OA 4XFQA 3N7OA 3V3MA 5JB8S 1A3BH 2GX4A 3ZVCA 2GZ9A 4B1TA 5IDKA 1THPB 1XUKA 4YM9A 1C1WH 2W5EA 1B5GH 2Z9LA 2TIOA 2BY8X 1C5VA 4D9QA 2OC7A 2R3YA 3RC5A 3A86A 1F5KU 1RIWC 2ZPQA 1FN6A 3LJJA 5T6FA 4DURA 5DP3A 2ZU3A 1P8VC 4DGJA 1OP8A 4XDEA 2PWXA 2ZGJA 1FMGA 1FY3A 4NIVA 2TPIZ 5F6MA 4CRFA 1SGRE 4MLFB 3KNXA 4MPUA 5DP7A 4NG9H 1RXPA 3PWBA 4X0WU 1ELDE 1BTWA 1NFWA 4WXIA 2SFAA 2FTLE 1HAXB 3U98H 1LCYA 1MU6B 1JOUB 1TOMH 1WUNH 3UNRA 1NFUA 1Y59T 2Y5HA 1C1VH 1G3CA 3HK3B 4X1RU 4FUBA 3E8LA 1DS2E 1DM4B 1QJ1B 3OTJE 4J1YA 1SOZA 1O37A 2BDIA 3E0NB 1HAGE 1WBGB 3DUXH 2FX6A 2VIPA 1TRMA 2G52A 3A7VA 3AW0A 1CGJE 4IC6A 2STAE 2Z94A 4I8LA 3PTBA 4WVPE 1TPPA 3BG4B 1YPLH 3RLYH 1V6DA 1T8LA 1Y3XA 1C2MA 1HXFH 1GJ6A 4YT6H 1GVZA 2ZCHP 3SGAE 1P3EA 3SI4H 3UWIA 1ZPZA 5BRRE 1JMOH 3RXRA 1DPOA 2VWNA 2ZGHA 1VZQH 3RP2A 1G2LA 3H5CB 1THRH 4FUEA 1V2WT 2BDBA 1O38A 1Q31A 1GBTA 1JIMA 1D6WA 4FUFA 1TGSZ 2RA0A 2ZDLA 4MPXA 4Y10E 3TGJE 1QRWA 4CBNA 3RC6A 3Q3YA 2ZDVH 1K2I1 1DXWA 1LKAA 4FUJA 4X6NA 1CO7E 1FONA 1KTTB 1GJ5H 2UUFB 3E6PH 3PM3A 5EXMA 3ZZ6A 4KTSA 1TNGA 4DVAU 1ZSKA 2VWOA 4TPIZ 1KLJH 1BMAA 4K1EA 3U8RH 2Y6TA 5K0HA 1CHOF 1AKSB 3BG4C 3DFJA 1G32B 1O2SA 1SB1H 2VH0A 1W3CA 2YNBA 3MH4A 1H4WA 2ZGBH 1O5CB 1SC8U 5HXFA 3BIUH 3UY9A 1K1NA 1PYTC 1A3EH 3M7QA 4X8SH 5A8YA 3SW2B 4Y8YA 3QTOH 3SV8A 1AWFH 1TGNA 3B23B 3I77A 1TPOA 1G3EA 5E0GA 1QY6A 3ZYEA 3UIRA 1BZXE 2ZTYA 2BQWB 2M5TA 4Q7ZA 1IHSH 1IQKA 1UTQA 4AG1A 1EB2A 3ELAH 1GBLA 5ETXA 2FOAA 1K1MA 1GMHF 5K7RA 1SVPA 1QBVH 3LT3A 3FP6E 3SJOA 1VJ9U 1O2XA 4BAHB 1KXEA 3TNSA 1UK4A 4MPVA 8GCHG 1A5GH 1UTKA 2PW8H 2UWOA 2P3TB 1BTZA 2VIQA 3GCTG 5F8TA 1ORFA 3L6PA 2BY7X 2ANKH 5HYOA 4INHA 1BTXA 2F91A 1SGNE 2ZHWH 3EA7A 1CT0E 4UFDH 4XBDA 1TPSA 4Y0ZE 1HNEE 3GY6A 5C5OA 2ZU4A 5HGGA 1VITF 3QN7A 4NA7A 2QAAA 3M7TA 1GJ4H 2FOFA 3PLPA 1DITH 1W8BH 4CRAA 4DIHH 3LGYA 3U8TH 1MQ6A 2ZFQH 4ABIA 3A7XA 2ODQA 3KGPA 2C4FH 1XUHA 2VIDA 4O3TA 3ZZCA 2OXSA 3S9BA 2Z3DA 3LKWA 1FI8A 1GDQA 2AMPA 3E0PB 1Z7KA 2D26C 3QDZB 2J2UA 3TIUA 4X2VA 2A4RA 1GBJA 4BAMB 1QGFA 1A5HA 1P04A 4B74A 1O2IA 3LGIA 5DP4A 1HJ8A 2VB0A 2ZF0H 5B6OA 1RFNA 4LK4A 3ENSB 4NIYA 3TNTA 1C1MA 2CN0H 2PTCE 3MNSA 1O31A 4GHQA 3BEUA 5JBBS 3GYMA 2O8MA 3TJNA 3SHAH 5GPIB 2GD4B 1ANBA 2EA3A 2ANMH 3HATH 2QXIA 2WUBA 8ESTE 1GJ8B 1PFXC 1YCPK 3UWJH 4I31A 3JZ1B 3K9XB 4B73A 1TX7A 5AFZH 4MG3A 2C90B 1T7CA 1S0QA 2GV7A 1O0DH 3NCLA 4Z0KA 1YLCA 1VCPA 2A32A 3MFJA 3SU6A 1NM6A 1G30B 1GL0E 3SJ9A 3S7KB 4OS7A 1D3PB 3GCNA 5C2ZA 3A8BA 3SGBE 1MAYA 1ELCA 1UVSH 3MNBA 4MQAA 1HAZB 4FU8A 2BXUH 1SBWA 5EPNA 1GBMA 1TQ7B 3ODDA 1UCYE 1OWDA 1DOJA 1O33A 1WAYB 2STBE 4A6LA 3QK1A 4CRBA 1KXDA 1C5SA 2WYGA 1NZQH 3PMAB 4AX9H 2OUAA 2W7SA 1V3XA 1KSNA 1BMMH 2PTNA 1GI0A 2GT8A 1SGCA 1ESTA 1TE0A 4BTUB 3SJIA 1K9OE 4U30A 4FUGA 2C93B 1F0RA 3RXCA 2A0QB 1XUFA 1ZLRA 2JH6D 2ZU5A 3OY5U 2R0KA 2P59A 1KXAA 4X1PU 1E35B 3RU4D 3L3TA 3JZ2B 4ZKNU 1F0TA 3WY8A 1SLXB 1TOCB 1FDPA 2BMGB 1EZXC 5A0CA 2ZDKA 1UVOA 4O9VA 1NN6A 2ZCKP 1SLWB 1H8IH 2JH0D 4MPWA 1V2VT 2HLCA 1XMNB 3VB7A 4U32A 1B0EA 2AERH 1PQ8A 3S69A 1V2KT 4X8TH 1ELGA 2WV5A 3MI4A 3GY4A 3QWCH 4PROA 2VVCA 5LH8A 2BDCA 1ETTH 4Y7AA 2H9TH 1O3GA 2BD7A 1C2IA 2PSXA 2FS9A 1TRNA 2QF0A 4AB9A 1SGTA 2BDAA 1FV9A 2O8LA 1YKTA 1PQAA 1E37B 4YZUA 1GJ7B 1Z8JB 1QB9A 4KTCA 2OBQA 4YOJA 1C4V2 1LHGH 1OYQA 3O8RA 2DE9A 2VGCB 1Y5AT 1EJAA 1GVLA 5DJ7A 3C1KA 1HB0B 4B71A 4K3JA 1ZMLA 4ISLA 2G4TA 1MTVA 3RU4E 3KEEA 1BQYA 2ZU2A 1FAKH 4NSVA 1EKBB 1LMWB 3Q00A 2FWWA 3VB6A 2DE8A 4O97A 5LPFA 2XCFA 3FP7E 1GHAF 1TBQH 3AASA 2XTTB 3TJVA 2AGEX 2C8ZB 5ESTE 2Y81A 3ZZBA 1TWXB 1JRTA 1TABE 1P03A 2G5VA 2XC4A 3MNXA 2I6SA 3GISB 3MTYA 2OC0A 2BY5X 3RXIA 2P94A 1O2QA 1AE8H 2GMTC 3T27A 1WU1A 4Z6AH 2QXHA 1LTOA 1CGHA 4THNH 5LPRA 1LQDB 3BTKE 3T62A 1ESAA 3FP8E 1E36B 1DX5M 1EQ9A 2TGTA 1V2MT 1O5DH 1YGCH 1QA7A 3OY6U 2BLWA 3KN2A 4JMYA 5DP9A 1L4DA 2OBOA 2A2QH 3T25A 4OGXA 2GCHF 2A7CA 1BCUH 5F8XA 1P3CA 5FPTA 4H6SB 4X6OA 1T4UH 4X6MA 2EI7A 3A7TA 4M7GA 3U69H 1AVXA 1P57B 1HIAB 1W7XH 2HVXA 3LGVA 1BRAA 4NCYA 3RU4T 4B2CA 2PLXA 1XUIA 2ZFPH 3U9AH 1AVGH 1ZSLA 6LPRA 2HWLB 1HJAC 2BQ6B 4CH2B 5EG4A 1AMHA 1O2JA 5E2OA 3RDZA 4AB8A 3SU3A 3ZVGA 2RG3A 1YPJH 1Z1JA 1V2PT 4FUIA 1C5MD 3LPRA 1XVMA 1FAXA 1O3OA 4ASHA 1NT1A 2BZ6H 1J15A 1G2MA 5LPEA 4MNYA 4O03A 3UOUA 2Z3EA 3T2NA 1EP5A 1RGQA 3SOSA 1Y3VA 2CXVA 3O8BA 2FMJA 4LZ4B 4IMZA 2FYQA 3VEQB 2OD3B 1ZR0A 1LO6A 1YBWA 1C9PA 1LKBA 1HAIH 1K1LA 1MTWA 3QZRA 4AGKA 2NU2E 1ANEA 1GBIA 1VCWA 2ZKSA 1D3QB 2B0FA 1YPHC 1FPHH 4IN2A 5GCHF 5J4SA 3EE0B 1HBTH 4UE7H 3F6UH 3HKIB 2ZFSA 1O3IA 1MAXA 1JWTA 1GG6C 1UJ1A 2QC2A 1GHYH 1EUFA 4UONA 1Z8GA 2ZDAH 3TK5A 3TK9A 3LONA 4UFEH 1NRQH 1TX8A 2FODA 3LGTA 2THFB 3BTHE 2CMYA 3QX5H 2GMTB 1O3LA 4FXGH 1EAWA 1AE5A 2HRVA 4F49A 1EPTC 1ZYOA 4D76A 4Y11E 1DY9A 2UUYA
chains in the Genus database with same CATH superfamily
4SGBE 2V6NA 1T32A 1FZZA 1GHXH 1JXPA 1MBMA 1BRCE 2Q1JA 4CBOA 6CHAC 3FVFB 4X1SU 3RXDA 5EQRA 1CE5A 4I7YH 1UCYK 1GI2A 1TRYA 1THSH 8GCHF 1SPJA 3V0XA 2AS9A 3RMMH 1W0YH 3MO3A 2H6MA 2CF8H 3IG6B 1L2EA 4CR5A 1M9UA 1SSXA 3B8JA 2ZZUH 2OQ5A 2XWBI 2BY9X 2FS8A 1MUEB 1S6FA 2FOEA 2OC8A 1EJNA 3QLPH 2JETB 1O2WA 1P12E 2A4GA 1BBRH 3A87A 3GY7A 5PTPA 1TPAE 3KQ5A 2IPQX 1EOLA 2XCNA 3RXSA 2M2AA 2O8UA 2SNVA 3F9HA 2KZ4A 4RT0A 2QE7D 9ESTA 3W95A 3SNCA 1CA0B 4AFQA 2XNDD 1ZOMA 1OPHB 2F4LA 1DT2A 2VH6A 1PQ5A 1NRRH 4MNVA 5JB9S 3BTQE 1ZPBA 3KQEA 2ZNKH 4XOJA 3U8OH 2QA9E 1K1OA 4OS2A 1QBOA 1EZQA 2JKHA 3F9FA 2FXRA 1SL3A 4AFUA 5CDFE 1O2KA 1N1LA 3BTME 1O5EH 3P17H 1YCPH 1ACBE 3NPSA 1SQOA 1IHTH 3SN8A 3MH7A 1O3JA 2XNIA 1LVOA 2GCTC 1IQFA 2WZQA 2F9NA 1EX3A 1SFQB 3TVJB 1C1NA 4NIWA 5HKKD 2O9QA 3RXGA 1LDTT 2ESTE 3F9EA 1MTNC 1SHYA 1T8OA 3PTNA 4I86A 5EQQA 2W3KA 4I8KA 4JCNA 5SGAE 3BN9A 4AFZA 4ABFA 1O3DA 2ZTXA 3A82A 4YXWD 1G9IE 4Y0YE 1NRPH 1MD8A 1PPEE 5T1VA 3UOPA 1E34B 1AUJA 1K21H 1C4Y2 3P8OA 1LHEH 3FZDA 2BZAA 1OP0A 4LZ1H 1XM1A 1GBFA 2PR3A 1O2GH 2GP9B 2A31A 4ZH8A 5HIZA 1QIXB 3UQOA 1OKXA 5DK1A 1W10U 4RSPA 2ASUB 1AI8H 2XW9A 1GBDA 1FPCH 2D1JA 3DA9B 3ZVBA 7ESTE 1GI8B 4TPYA 2KCAA 1O2LA 1Z8RA 1AB9B 1QQ4A 5C1YA 2ZFRH 2FI3E 1A0JA 3OEHD 1LPZB 2ZQ1A 4JZFH 4ZXXH 2YNAA 1DUEA 1UTMA 1UHBB 2J9NA 5TJXA 4AYYB 3ESTA 1C2LA 1Y3UA 1FNIA 2R2MB 4AG2A 2HGTH 1BDAA 1C5LH 4GVUA 1P2KA 3E91A 1IQHA 3D23A 1L1NA 3SO3A 1K22H 1VITH 4HI3A 4HFPB 5AFYH 2C3SA 1PQ7A 2XBVA 2XWAA 2P8OB 1TNJA 3AVZA 1O2UA 3GDSA 4INLA 5DP8A 4FOUC 4DT7B 1BBRK 1NRSH 1P10A 3OU0A 2TGDA 4KKDA 3ZZDA 1O3EA 1A61H 1QQUA 4GSOA 4NZQA 1GJ9B 5JBAS 1Y5UT 2J4IA 4LOYH 2VWLA 2KCOA 4BANB 1AQ7A 4DIIH 3VXEH 4K1SA 1GL1A 4LXBH 5C1XA 4TWWA 1GG6B 5L6NH 2FOMB 1OXGA 3ATMA 4ABHA 1HCGA 4OS5A 3M35A 1WSSH 1SGEE 2FOCA 1JBUH 2V3MA 4CRGA 3M7UA 5T6DA 3DT0H 5JPMH 5GCHG 4JZIA 3E1XB 5DPAA 3P70B 4JZEH 2BX3A 4YOIA 1O5AB 3TGIE 1OWIA 3NXPA 3URDA 3M5OA 1HXEH 4KGAA 3SNDA 4ZKSU 4Y8XA 4GCHF 5F03A 4J2YB 2BVRH 1QR3E 1CVWH 1QURH 2JIZD 4YO9A 5FL7D 3ZZ9A 1HAVB 1OYTH 4WH8A 1N6XA 1C5RA 2F3CE 2FI4E 2PUQH 1GDNA 3BEFB 2ZFTA 3K2UA 5JBCS 4XE4A 3UPEA 6CHAB 1UTJA 1O2MA 1YCPM 4B2BA 2R3UA 1W11U 3RXUA 4DOQA 4VGCC 1H9IE 2ZECA 1AWHB 1COWD 1MTSA 1SOTA 3F9GA 4X8VH 2WPDD 2O8WA 3BF6H 3MYWA 2ZI2H 7KMEH 2Z3CA 1A7SA 5A0AE 7LPRA 1QHRB 3GCOA 1PPGE 4AZ2B 1S85A 2VJ1A 3OX7U 3GICB 1EZUC 1Y3WA 4BTIB 3DHKH 1AUTC 4B6EA 3MU0A 2GTBA 4ABEA 1OX1A 1YF4A 4GAWA 1V2NT 3WWFA 4KP0A 1EOJA 5C1UA 1SLUB 2WPIS 2V7QD 2OQUA 1GJAB 3F3BA 1FIWA 4ISOA 1GMDF 1E38B 1C1QA 1WYKA 4IBLH 4BTTB 4A92A 2ZGXH 3NZIA 1EPTA 1H9LB 3M3TA 3LC5A 2ZA5A 4ZMAH 4X2YA 1P2JA 1CGIE 3KL6A 4Y76A 3T28A 2FIRH 2BYAX 2BOHB 1S83A 4I32A 3SU5A 3PRDA 2Z9KA 2BLVA 2VWMA 1A0LA 4U2WA 2WPHS 3M3VA 3SZNA 4RKJB 2QCYA 1CHOG 3TU7H 1GPZA 4TWYA 2HNTC 4JK6A 4A5TS 4OGYA 5LGOA 4UDWH 1L4ZA 1P0SH 1AB9C 3EYDA 1O5FH 3HGNA 4KTUA 3S9CA 4K69A 4NZLA 2H9EH 2HPPH 1SGYE 2GVFA 2AMDA 3OE7D 1GI5A 1HV7A 1P11E 2WPLS 1C1PA 3FAOA 2G00A 2QY0B 2F9PA 2ZHFH 2XBXA 4ABJA 3RMNH 1DE7H 4K2YA 1V2OT 2NU1E 1DLEA 1H9HE 1ZJDA 2SGQE 3ATKA 1NO9H 2C8YB 1UCYH 3G01A 2NU4E 1UVTH 1P2OA 3R0FA 3RXOA 3EE7A 1O3PB 4GHTA 1GHVH 2LNCA 1B0FA 4A7IB 1MKWH 2J38A 5HM9A 4Y7BA 1KXCA 3OAAD 1ELVA 2OTVA 2OP9A 1RRKA 3URCA 1Z8IB 1XXDA 2H2ZA 4FUDA 2G81E 1YPHE 4BAKB 1T31A 2YMSC 1J17T 1MMJN 2SGAA 5C20A 1SQAA 1CHGA 1SG8B 1BTUA 1UTNA 1AFEH 3H09A 2P93A 5FBEA 4DJZB 2FO9A 1P01A 2Z9GA 1AGJA 1SGFG 5EW1H 2K1QA 2G5NA 3CENA 2UUJB 2HNTF 1GI3A 2TBSA 1QNJA 2Z7FE 4NFEA 2CF9H 1P2QA 2ODYB 1O32A 3SUEA 2KX4A 2FLRH 1SKYE 3Q3KA 1VKYA 3C27B 1FIZA 1PPHE 4MNXA 2BY6X 4XBBA 4D7GA 1Z6EA 2QYIA 5C3NA 1FX0B 2W3IA 4NGAH 3TH3H 1HAOH 3V12A 1HJ9A 2V35A 1A1RA 3P6ZB 1XKAC 1IQEA 2H1UA 1VITG 3ATIA 5EXNA 5EJZA 4JYVH 2GT7A 3IITA 4A1XA 1C5PA 4K60A 2VGCC 2BTCE 4CR9A 4IC5A 4F55A 1QZ8A 5E2PA 2F9BH 5A8ZA 5JDUB 3RXEA 4XSKU 1YYY1 2ZDMA 3GY2A 3HPTB 1GBEA 2FI5E 2RA3A 3RXTA 1QBNA 2WV4A 2Q6DA 1MABB 4WMEA 5I46H 1DFPA 1TNHA 2GGVB 3K65B 3RM0H 1DVAH 3RXPA 3RXBA 2Z9JA 3D49H 2B5TB 3VB4A 2K8IA 2UWLA 4UD9H 1O3NA 3A85A 3MWIU 1MKWK 4Y6DA 1P06A 3A7WA 4TSFD 1P09A 1WQVH 4Q63A 2G8TA 5DSFA 1YPGH 2QV1A 4IMQA 5DO4H 2ZTZA 4MNWA 3LH1A 1SGDE 2A1DB 2VU8E 1C5YB 1ID5H 1SQRA 1DDJA 3UQVA 5CHAB 1EAUA 1ELTA 1QA0A 3H7TA 5B6LA 3AK5A 5A8XA 1ZJKA 5FX5A 1MCTA 1PPBH 3T26A 3ITIA 1MTUA 1W0ZU 2XC5A 1DWEH 2ZO3H 1O36A 1KYNA 1TX6A 4TT3D 3RLWH 3BTEE 3AAUA 3MU4A 1KXBA 3LJOA 4JK5A 1AIXH 1AO5A 1BITA 1ZHRA 1UVPA 2H9HA 2ZWLH 1TNKA 4WH6A 3STIA 1FLEE 4R8TB 4GPGA 2GZ7A 4BXWA 5J4QA 3F2FA 3R3GB 2WPKS 1OS8A 3ZVFA 3O8DA 3PLBA 1ARBA 1C1OA 3RXLA 3GDUA 2V0BA 1LHFH 1ETSH 2A4OA 1UVUH 2FM2A 2ZC9H 1W14U 3RXJA 1G3BA 2ULLA 3GS9A 3PMBB 2CGAA 4TYDA 1V2ST 1AFQB 3UFAA 3ZV9A 5EJLA 1C1UH 1LPKB 2IPHA 1GHBF 1TLDA 1CQQA 3NWUA 1T8NA 3STJA 4NWLA 3MOCA 3VXFH 5E8EH 2ANYA 3UAIC 4ISHH 3MNCA 1BA8B 1Y8TA 1ZMNA 5EXLA 2A5AA 1TAWA 1YPEH 1N6YA 1V2JT 3M5NA 4F48B 2XBYA 3KQDA 5AVDA 5T3HA 2BD5A 1HAVA 5H4IB 2EY4C 2YMSB 3VB5A 4H4FA 3Q3XA 2Q6FA 2W7UA 2JH5D 2G4UA 1BJVA 2PFEA 3A7ZA 3EQ0H 3RMOH 3ZVDA 1Z71A 1YP9A 1IQIA 4HGCA 1DSUA 4ZKOU 2FTMA 1GBCA 3T29A 1DANH 1G36A 2TGPZ 1ZTJA 2GDDA 4B6FA 1KDQB 2EI6A 1L1GA 3QO6A 2XYAA 1WOFA 2PHBA 1TQ0B 1CT4E 3N99A 1QFKH 5FHTA 3A88A 1EATA 1ZHPA 4O3UA 2KM0A 5DG6A 3A8CA 5G4BA 3A84A 3N7EA 2RDLA 3GCHC 1EAIA 2FESH 4Q2KA 3TH2H 2NU0E 1HUTH 1S84A 5TCCA 1CA0C 3DSGA 3A83A 4FU7A 5C0UA 2QF3A 2R0LA 2AYWA 1N8OB 2PKSC 2PV9B 3F2HA 3MU8A 2BX4A 3MQKC 1BT7A 1TMUH 1QJ6B 1KDQA 3BEIB 1TGCA 1O5BB 1W13U 2BOKA 1RTLA 1SHHB 3SU1A 1C1TA 5JYIA 1MTNB 2JJ2D 3LOXA 1BTHH 1KLIH 3PRBA 5JBTA 1MKXK 1YPMH 1UW7A 2JETC 1SGFA 1C2JA 1HGTH 2ALVA 2WUCA 1C5OH 2Y82A 4D8NA 4OS4A 2VIWA 1P2MA 2ANWA 5GXPA 1BMLA 1SI5H 2AIQA 4FUCA 4ISIH 1PJPA 1GJDB 2A5KA 1BOQA 4F4OC 1O35A 2YMSD 3I78A 1O2HA 3RXQA 5IYTA 3BTGE 1X7AC 4ZHAA 1UO6A 3IWMA 4E06H 3A89A 1A0HB 1KTSB 3K6ZA 2BXTH 3CP7A 3RUOA 3M5MA 4Y71A 5EGMA 1BTPA 3ZZAA 1TONA 3FANA 5EODA 1AKSA 5FXLA 1ZHMA 2PKAB 3NK8A 5EIYA 1IQNA 1TGBA 2BB4A 1INCA 1OHHD 5FAHA 1MD7A 1C2KA 4MVNA 2FOBA 1GDUA 3SHCH 1T4VH 2CV3A 3W94A 2D2DA 2OC1A 1Y5BT 1C5XB 4X1NU 8LPRA 1L1JA 2W26A 1Z6JH 4RKOB 2A5IA 2GDEH 4CHAC 3E3TA 2TGAA 5DGJA 3U1JB 1GBKA 3ATLA 4X8UH 1F0SA 3ZVAA 1NC6A 5E0JA 5FPYA 5GWZA 3TH4H 3CS0A 1AFQC 2WINI 4IN1A 3PB1E 2AGIX 1GMCG 4ABBA 1QCPA 3E16B 3GY3A 3BTTE 2RCEA 5GJ4B 2CJIA 3SNEA 4WMDA 3BG8A 5EOKA 1UK3A 1EP6A 1HPGA 1S6HA 9LPRA 3SGQE 1DSTA 1K1JA 1ABIH 1T8MA 1FY8E 2J95A 2SGEE 4SGAE 2PUXB 1GBBA 2B8OH 4NIXA 1O3BA 3PROA 3GOVB 4BOHA 6GCHG 4UFGH 1GJCB 4CRDA 2FOGA 1YPKH 5EJ1A 5HMAA 4ESTE 4JYTA 2SGFE 3ATWA 4B76A 4NA9H 4WWYA 1PPFE 4H6TA 4ABAA 3S7HB 1Z1IA 2HVYB 2R9PA 1GMDG 1SMFE 2Q6GA 1GGDB 3AAVA 3SORA 4K1TA 1ZSJA 1BIOA 1NRNH 2IN2A 2V3OH 3KHVA 1GCTB 2ALPA 2BD3A 1L0ZA 2H5DA 1IQLA 1O3HA 4DT4A 4ZUHA 5DKMA 1EASA 1MZDA 1DICA 3MU1A 1V2TT 3A8AA 3TJOA 3AW1A 2KFWA 5DP6A 3ZZ7A 3RXKA 1AZ8A 4I8HA 2PSYA 3P95A 1XUGA 4YT7H 2XRCA 4TY7A 1OOKB 4CRCA 1WCZA 1LVYA 1NBMD 3TITA 2F9VA 1QL7A 2BVSH 1LQEA 2C8WB 4D9RA 1AHTH 1HAHH 3EGKH 2BD9A 1TBRH 3ZVEA 4DG4A 1FXYA 3U1IB 1O2OA 2B7DH 3SU0A 1XVOA 1RJXB 1NTPA 2FX4A 2F9UA 1SGQE 3V7TA 3LU9B 3W1EA 3DFLA 1SGPE 3FN8A 3RXFA 1KMHB 1C5WB 4GCHG 7GCHF 1NU7B 1A2CH 3F1SB 1S81A 1CBWC 3M3SA 2PKAA 4ISNA 1IQGA 1CSOE 1V2UT 2Z9IA 5GDSH 1FY5A 1F5LA 4NSYA 1XX9A 3NKKA 2A4QA 2BHGA 2LELA 1P02A 2H5CA 2G55A 1XXFA 3F68H 1WTHD 2A7HA 3VGCB 3ZZ8A 3ZZ3A 1O39A 1P05A 3EAJA 4AGJA 5DP5A 5FCKA 4YOGA 2EEKA 1Q2WA 1TNIA 1FN8A 1QTFA 1TMBH 4A1VA 1H8DH 1D4PB 4ASUD 1DXPA 1WV7H 4AC9A 1CT2E 3QZQA 3FZZA 3T5FH 4Y8ZA 2XBWA 3A80A 1D3DB 2ZIQH 4X1QU 1N8OC 2PKSB 1ANCA 1HRTH 3O8CA 5L2ZH 4ZKRU 1UTLM 3K6YA 4JZDH 3DSPA 3HK6B 1F7ZA 1IQMA 1OSSA 1TYNA 1O2ZA 4NA8A 1NFXA 1MCVA 2OK5A 1GMCF 1GWAA 2QIQA 1P2IA 1C5NH 3VFEA 1HAYB 3L33A 1P9SA 1GGDC 1KY9A 5I25A 2PGBB 1FUJA 2A2XH 5TCAA 1QL8A 1GMHG 3SZEA 3FFGA 2ZPSA 1MH0A 1C5ZB 5F8ZA 5ABWA 1GHZA 1IAUA 3PWCA 1AU8A 1W2KH 2KCYA 3BTWE 1ZZZA 2P8OC 1EJMA 1OWEA 2BM2A 3SUGA 2G51A 1P9UA 3UB0A 1A46H 1D3TB 1F2SE 1O2VA 4WJG2 2P95A 2R2WU 1HYLA 3TGKE 4U01A 3VB3A 2ZHDA 1BMNH 4FU9A 1GI6A 2ZDNA 1F5RA 4IS5A 1CA8B 1AN1E 1S82A 3OFND 1W12U 2JDID 4WF8A 3A8DA 4D7FA 1TA2A 1F92A 4Q80A 3TLOA 4ZHLU 1HFDA 5ESBA 1OWHA 1CBWB 2J98B 4ABDA 5C94A 1KXFA 1YC0A 4YLUA 3E90B 4AORA 1P2NA 4GUXA 1GCTC 4I33A 3SUFA 1EPTB 3ZZ5A 1V2QT 4UEHH 3EA8A 3QTVH 1DWDH 5C5NA 1NU9A 3KF2A 5AF9H 4JYUH 2FYRA 1NESE 3UNQA 4TY6A 3VGCC 1W0KD 1A5IA 1LHCH 4OS6A 1HAPH 4E05H 4ZAEA 2Y7ZA 3PMJA 3RMLH 1DY8A 1UTOA 2VIOA 1O3KA 4KELA 4INKA 5KECA 2JJ1D 8KME2 1HLTH 4HZHA 2BVXH 5E0HA 2GV6A 4AN7A 3M5LA 1W0JD 2Y80A 3EA9A 5BPEA 3MH6A 4A1TA 1U6QA 1GVKB 5GIBA 5C0TA 1VR1H 2GZ8A 1C2FA 2L74A 2OCVB 3D62A 4YESB 1E0FD 1BJUA 1RD3B 2VIVA 1O3FA 3SU2A 3BIVH 1TBZH 2PGQB 1ARCA 2FP7B 3ZIAD 1EZSC 2VVUA 2AMQA 2IJD1 4BNRA 2OLGA 5A09A 7GCHG 1DLKB 2AHME 5FCRA 2BDYA 2A7JA 1O3MA 1JIRA 1YLNA 5EQSA 3B9FH 1ZGIA 2LPRA 1J8AA 2NWNA 1O34A 3MO9A 5CMXH 3V13A 1NY22 5CHAC 1HDTH 2ZEBA 3RXVA 2B9LA 1ELBA 1UHBA 1MKXH 3RXAA 3GCTF 4RN6A 4B75A 4GLYA 3SI3H 3BTFE 1V2RT 1BHXF 1LHDH 3CS7A 3LC3A 1RTFB 2GCTB 1O2PA 1Y3YA 2CHAC 1ZRKA 2ZPRA 1ELEE 3GYLB 3QUMP 4HTCH 5EW2H 3RXHA 1QRXA 1ABJH 3DSOA 3LGWA 1SGIB 2SGDE 2Y5GA 2WYJA 1OWKA 4E7RG 2QN5T 2VNTA 5A0BA 1IOEA 3PO1C 1TFXA 1GJBB 1ZRBA 1RTKA 4DY7B 4WY3A 3KIDU 1O2NA 1J9CH 2KAIA 1MQ5A 4X2XA 1GI7B 4DCDA 5FBIA 2FDAA 2BD2A 1EXFA 4Q7XA 1NPMA 1XKBC 4ACBA 2VINA 2VVVA 4Q4LA 4WMFA 1NS3A 4ABGA 1MBQA 3UUZA 5HIYA 4NWKA 3UR6A 3GCHB 2Y5FA 3TJUA 5CHBA 4ZHMU 3SNBA 4RI0A 2ZCLP 3M36A 2FLBH 1FQ3A 1O30A 1OWJA 4IGDA 4K5ZA 1O3AA 1VGCC 1O2RA 2ZFFH 4DW2U 1EFRD 2BLOA 4OS1A 3P8GA 3NRLA 2ZGCA 2I6QA 4NFFA 3PLKA 1W7GH 2UUKB 1NFYA 2V3HH 2IOTA 4X2WA 1YM0A 1G37A 1SLVB 1ZTKA 4Z1MD 2OINA 1C2GA 2ZHEH 4Y79A 3LIWA 4RT1A 1QL9A 1ZTLA 1TNLA 3M61U 4AYVB 1MZAA 1H1BA 2XC0A 3MO6A 3KQCA 3PO1B 3BSQA 1EB1H 1TB6H 3MH5A 3GY5A 2BQ7B 3PYHA 3ZYDA 2EI8A 1ZMJA 1LVBA 3QGJA 5EU8A 3BV9B 3OEED 1UMAH 3Q77A 1HIAA 1HJAB 1PPCE 5FPSA 3EDXB 2ZQ2A 1UTPA 3HKJB 1QB6A 2AEIH 2FEQH 2J34A 1GI1A 1SR5C 1VJAU 3P8NA 1WTGH 2ZHQH 2ZP0H 1O2TA 2P3FH 2SNWA 3Q76A 3P8FA 1D6RA 2HALA 3GDVA 3MU5A 1QB1A 1QRZA 1SQTA 3HGPA 4YTAA 4K8YA 3NUMA 1AY6H 2QXJA 1BRUP 3SV9A 3RM2H 2HNTE 3S0NA 1BUIA 2DUCA 1K1PA 1GBAA 3SUDA 1YY3A 3PV5A 2WSSD 3UREA 2XXLA 2AGGX 2Z6BD 2KAIB 3SV6A 1ESBA 5L2YH 5EPYA 1D9IA 1J16A 2J94A 4R0IA 3A7YA 1ZGVA 4AFSA 2SGPE 3I29A 4CHAB 2BD4A 2BD8A 1DWBH 2EC9H 4ZROA 4FVDA 1C5QA 4XBCA 1C5UA 1TGTA 3PV4A 1GHAG 4H42U 4I8GA 3SNAA 2AIPA 4IW4E 1C1RA 1C4U2 3RC4A 1GBHA 3ZV8A 1NROH 1C2HA 2HOBA 5A2MH 1UK2A 3DD2H 2P16A 3S9AA 2BLQA 2J92A 2UWPA 4MDSA 1PPZA 1KIGH 1FY1A 1IQJA 4WXVA 2WPJS 2Y7XA 2VBCA 5C67A 1MU8B 3MHWU 1SFIA 2C8XB 2AH4X 1TMTH 2FPZA 1FY4A 3SBKA 4CH8B 5HM2A 3TK6A 1VCQA 2QXGA 2FOHA 3SQEE 3GY8A 1BBRE 1QJ7B 4BAQB 1K28D 2QF5A 1K1IA 1BB0B 4I8JA 1DUAA 1J14A 2P3UB 3OYPA 5L30H 3QGNB 1O2YA 1OP2A 1S0RA 2HPQH 3ODFA 3UR9A 1TALA 1PYTD 2WHXA 1XUJA 1TIOA 2FZZA 1TA6A 1BHXB 1RIWB 3BTDE 4YLQH 3TPIZ 3SV7A 6GCHF 1BTYA 1GI9B 1RS0A 1JRSA 2YOLA 4CREA 3KQBA 1CU1A 1O3CA 2XOKD 2D8WA 1C2DA 1DWCH 1KLTA 4E7NA 2WPMS 3UTUH 1C5TA 1F0UA 3P92A 1WQSA 2BDGA 4HG6A 4FVBA 2F83A 1AD8H 2O8TA 1B7XB 2ZU1A 1GHBG 1GI4A 2CHAB 4UFFH 1ELAA 6ESTA 1LPGB 4X6PA 1ETRH 2QGRA 3KCGH 1EAXA 2IJOB 5T6GA 4VGCB 3SU4A 3SJKA 2NU3E 3M37A 1ELFA 3SYJA 2A45B 3UNSA 1GHWH 1LVMA 1GCDA 3SQHE 4ACAA 4B2AA 3LH3A 1C2EA 4QT8C 4BXSA 2AFQB 2ODPA 5CE1A 4JZ1A 1AVWA 3D65E 1V2LT 1ANDA 1C9TA 1VGCB 3U28C 1S5SA 2LP6A 1Q3XA 5FX6A 3VPKA 4AOQA 3A81A 1C1SA 1FJSA 1ZPCA 3LDXH 4K8BA 2GKVE 5AHGH 1O5GH 4BAOB 1AZZA 3LGUA 3SJ8A 1A4WH 3F0PA 4FUHA 1S6LA 2ILNA 3SV2H 3PMHB 2GCHG 3H7OA 3ZZ4A 3RXMA 1G3DA 2ZG0H 3OSYA 2BDHA 2TRMA 4MTBA 2CK3D 3MMGA 1YLDA 4Q7YA 1E1QD 4ZXYH 1BRBE 2F9OA 4XFQA 3N7OA 3V3MA 5JB8S 1A3BH 2GX4A 3ZVCA 2GZ9A 4B1TA 5IDKA 1THPB 1XUKA 4YM9A 1C1WH 2W5EA 1B5GH 2Z9LA 4OM9A 2TIOA 2BY8X 1C5VA 4D9QA 2OC7A 2R3YA 3RC5A 3A86A 1F5KU 1RIWC 2ZPQA 1FN6A 3LJJA 5T6FA 5DN6D 4DURA 5DP3A 3FOAA 2ZU3A 1P8VC 4DGJA 1OP8A 4XDEA 5KGOA 2PWXA 2ZGJA 1FMGA 1FY3A 4NIVA 2TPIZ 5F6MA 4CRFA 1SGRE 4MLFB 3KNXA 4MPUA 5DP7A 4NG9H 1RXPA 3PWBA 4X0WU 1ELDE 1BTWA 1NFWA 3DCLA 4WXIA 2SFAA 2FTLE 1HAXB 3U98H 1LCYA 1MU6B 1JOUB 1TOMH 1WUNH 4XD7D 3UNRA 1NFUA 1Y59T 3N7DA 2Y5HA 1C1VH 1G3CA 3HK3B 4X1RU 4FUBA 3E8LA 1DS2E 1DM4B 1QJ1B 3OTJE 4J1YA 1SOZA 1O37A 2BDIA 3E0NB 1HAGE 1WBGB 1WXRA 3KYGA 3DUXH 2FX6A 2VIPA 1TRMA 2G52A 3A7VA 3AW0A 1CGJE 4IC6A 2STAE 2Z94A 4I8LA 3PTBA 4WVPE 1TPPA 3BG4B 1YPLH 3RLYH 1V6DA 1T8LA 1Y3XA 1C2MA 1HXFH 1GJ6A 4YT6H 1GVZA 2ZCHP 3SGAE 1P3EA 2W6JD 3SI4H 3UWIA 1ZPZA 5BRRE 1JMOH 3VG8A 3RXRA 1DPOA 2VWNA 2ZGHA 1VZQH 3RP2A 1G2LA 3H5CB 1THRH 4FUEA 1V2WT 2BDBA 1O38A 1Q31A 1GBTA 1JIMA 1D6WA 4FUFA 1TGSZ 2RA0A 2ZDLA 4MPXA 4Y10E 3TGJE 1QRWA 4CBNA 3RC6A 3Q3YA 2ZDVH 1K2I1 1DXWA 1LKAA 3WW7A 4FUJA 4X6NA 1CO7E 1FONA 1YWUA 1KTTB 1GJ5H 2UUFB 3E6PH 3PM3A 5EXMA 3ZZ6A 4KTSA 1TNGA 4DVAU 1ZSKA 1K0HA 2VWOA 4TPIZ 1KLJH 1BMAA 4K1EA 3U8RH 2Y6TA 3F2GA 5K0HA 1CHOF 1AKSB 3BG4C 3DFJA 1G32B 1O2SA 1SB1H 2J5UA 2VH0A 1W3CA 2YNBA 3MH4A 1H4WA 2ZGBH 1O5CB 2WV9A 1SC8U 5HXFA 3BIUH 3UY9A 1K1NA 1PYTC 1A3EH 3M7QA 4X8SH 5A8YA 3SW2B 4Y8YA 3QTOH 2J98A 5C17A 3SV8A 1AWFH 1TGNA 2L6OA 3B23B 3I77A 1TPOA 1G3EA 5E0GA 1QY6A 3ZYEA 3UIRA 1BZXE 2ZTYA 2BQWB 2M5TA 4Q7ZA 1IHSH 1IQKA 1UTQA 4AG1A 1EB2A 3ELAH 1GBLA 2PP6A 5ETXA 2FOAA 1K1MA 1GMHF 5K7RA 2F43B 2RDEA 1SVPA 1QBVH 3LT3A 3FP6E 3SJOA 1VJ9U 1O2XA 4BAHB 1KXEA 3TNSA 1UK4A 4MPVA 8GCHG 1A5GH 1UTKA 2PW8H 2UWOA 2P3TB 1BTZA 2VIQA 3GCTG 5F8TA 1ORFA 3L6PA 2BY7X 2ANKH 5HYOA 4INHA 1BTXA 2F91A 1SGNE 1BMFD 2ZHWH 3EA7A 1CT0E 4UFDH 4XBDA 1TPSA 4Y0ZE 1HNEE 2W6ID 3GY6A 5C5OA 2ZU4A 5HGGA 1VITF 3QN7A 4NA7A 2QAAA 3M7TA 1GJ4H 5KEDA 2EQNA 2K0QA 2FOFA 3PLPA 1DITH 1W8BH 4CRAA 4DIHH 3LGYA 3U8TH 1MQ6A 2ZFQH 4ABIA 3A7XA 2ODQA 3KGPA 2C4FH 1XUHA 2VIDA 4O3TA 1NBME 3ZZCA 2OXSA 3S9BA 2Z3DA 3LKWA 1FI8A 1GDQA 2AMPA 3E0PB 1Z7KA 2D26C 3QDZB 2HLDD 2J2UA 3TIUA 4X2VA 2A4RA 1GBJA 4BAMB 1QGFA 5F53A 2QF4A 1A5HA 1P04A 4B74A 1O2IA 3LGIA 5DP4A 1HJ8A 2VB0A 2ZF0H 5IK2D 5B6OA 1RFNA 4LK4A 3ENSB 4NIYA 3TNTA 1C1MA 3PV2A 3CNRA 2CN0H 2PTCE 3MNSA 1O31A 4GHQA 3BEUA 5JBBS 3GYMA 2O8MA 3TJNA 3SHAH 5GPIB 1E1RD 2GD4B 1ANBA 2EA3A 2ANMH 3HATH 2QXIA 2WUBA 8ESTE 1GJ8B 1PFXC 1YCPK 2GJGA 3UWJH 4I31A 3JZ1B 3K9XB 1H8ED 4P02A 4B73A 1TX7A 3OTPA 4MG3A 5AFZH 2C90B 1T7CA 1S0QA 2GV7A 1O0DH 3FO8D 3NCLA 4Z0KA 1YLCA 1VCPA 2A32A 3MFJA 3SU6A 1NM6A 1G30B 1GL0E 3SJ9A 3S7KB 4OS7A 1D3PB 3GCNA 5C2ZA 3A8BA 3SGBE 1MAYA 1ELCA 1UVSH 3MNBA 4MQAA 1HAZB 4FU8A 2BXUH 1SBWA 5EPNA 1GBMA 1TQ7B 3ODDA 1UCYE 1OWDA 1DOJA 1O33A 1H8HD 1WAYB 2STBE 4A6LA 3QK1A 4CRBA 1KXDA 1C5SA 2WYGA 1NZQH 3PMAB 4AX9H 2OUAA 2W7SA 1V3XA 1KSNA 1BMMH 2PTNA 1GI0A 2GT8A 1SGCA 1ESTA 1TE0A 4BTUB 3SJIA 1K9OE 4U30A 4FUGA 2C93B 1F0RA 5GNDA 3RXCA 2A0QB 1XUFA 1ZLRA 2JH6D 2ZU5A 3OY5U 2R0KA 2P59A 1KXAA 4X1PU 1E35B 3RU4D 3L3TA 3JZ2B 4ZKNU 1F0TA 3WY8A 1SLXB 1TOCB 1FDPA 2BMGB 1EZXC 5A0CA 2ZDKA 1UVOA 4O9VA 1NN6A 2ZCKP 1SLWB 1H8IH 2JH0D 4MPWA 1V2VT 2HLCA 1XMNB 3VB7A 4U32A 1B0EA 2AERH 1PQ8A 3S69A 1V2KT 4X8TH 1ELGA 2WV5A 3MI4A 3GY4A 4ZCNA 3QWCH 4PROA 2VVCA 5LH8A 2BDCA 1ETTH 2KCPA 4Y7AA 2H9TH 4XRNA 1O3GA 2BD7A 1C2IA 2PSXA 2FS9A 1TRNA 2QF0A 4AB9A 1SGTA 2BDAA 1FV9A 2O8LA 1YKTA 1PQAA 1E37B 4YZUA 1GJ7B 1Z8JB 1QB9A 4KTCA 2OBQA 4YOJA 1C4V2 1LHGH 1OYQA 3O8RA 2DE9A 2VGCB 1Y5AT 1EJAA 1GVLA 5DJ7A 3C1KA 1HB0B 4B71A 4K3JA 1ZMLA 4ISLA 2G4TA 1MTVA 3RU4E 3KEEA 1BQYA 2ZU2A 1FAKH 4NSVA 1EKBB 1LMWB 3Q00A 2FWWA 3VB6A 2DE8A 4O97A 5LPFA 2XCFA 3WWBA 3FP7E 1GHAF 1TBQH 3AASA 2XTTB 3TJVA 2AGEX 2C8ZB 5ESTE 2Y81A 3ZZBA 1TWXB 1JRTA 1TABE 1P03A 2G5VA 2XC4A 3MNXA 2I6SA 3GISB 3MTYA 2OC0A 2BY5X 3RXIA 2P94A 1O2QA 1AE8H 2GMTC 3T27A 1WU1A 4Z6AH 2QXHA 1LTOA 1CGHA 4THNH 5LPRA 1LQDB 3BTKE 3T62A 1ESAA 3FP8E 1E36B 1DX5M 1EQ9A 2TGTA 1V2MT 1O5DH 1YGCH 1QA7A 3OY6U 2BLWA 3KN2A 4JMYA 5DP9A 1L4DA 2OBOA 2A2QH 3T25A 4OGXA 2GCHF 2A7CA 1BCUH 5F8XA 1WDIA 1P3CA 5FPTA 4H6SB 4X6OA 1T4UH 4X6MA 3FKSD 2EI7A 3A7TA 4M7GA 3U69H 1AVXA 1P57B 1HIAB 1W7XH 2HVXA 3LGVA 1BRAA 4NCYA 3RU4T 4B2CA 2PLXA 1XUIA 2ZFPH 3U9AH 1AVGH 1ZSLA 6LPRA 2HWLB 1HJAC 2BQ6B 4CH2B 5EG4A 1AMHA 1O2JA 5E2OA 3RDZA 4AB8A 3SU3A 3ZVGA 2RG3A 1YPJH 2J97A 1Z1JA 2KR7A 1V2PT 4FUIA 1C5MD 3LPRA 1XVMA 1FAXA 1O3OA 4ASHA 1NT1A 2BZ6H 1J15A 1G2MA 5LPEA 4MNYA 4O03A 3UOUA 4P00A 2Z3EA 3T2NA 3F0OA 1EP5A 1RGQA 3SOSA 1Y3VA 2CXVA 3O8BA 2FMJA 4LZ4B 4IMZA 2FYQA 3VEQB 2OD3B 1ZR0A 1LO6A 1YBWA 1C9PA 1LKBA 4FETA 1HAIH 1K1LA 1MTWA 3QZRA 4AGKA 2NU2E 2RFKC 1ANEA 3KYFA 1GBIA 1VCWA 2ZKSA 1D3QB 2B0FA 1YPHC 1FPHH 4IN2A 5GCHF 5J4SA 4M9FA 3EE0B 1HBTH 4UE7H 3F6UH 3HKIB 2ZFSA 1O3IA 1MAXA 1JWTA 1GG6C 1UJ1A 2QC2A 1GHYH 1EUFA 4UONA 1Z8GA 2ZDAH 1E79D 3TK5A 3TK9A 3LONA 4UFEH 1NRQH 1TX8A 2FODA 3LGTA 2THFB 3BTHE 2CMYA 3QX5H 2GMTB 1O3LA 4FXGH 1EAWA 1AE5A 2HRVA 4F49A 1EPTC 1ZYOA 4D76A 4Y11E 1DY9A 2UUYA
chains in the Genus database with same CATH topology
4SGBE 2V6NA 1T32A 1FZZA 1GHXH 1JXPA 1MBMA 1BRCE 2Q1JA 4CBOA 6CHAC 3FVFB 4X1SU 3RXDA 5EQRA 1CE5A 4I7YH 1UCYK 1GI2A 1TRYA 1THSH 8GCHF 1SPJA 3V0XA 2AS9A 3RMMH 1W0YH 3MO3A 2H6MA 2CF8H 3IG6B 1L2EA 4CR5A 1M9UA 1SSXA 3B8JA 2ZZUH 2OQ5A 2XWBI 2BY9X 2FS8A 1MUEB 1S6FA 2FOEA 2OC8A 1EJNA 3QLPH 2JETB 1O2WA 1P12E 2A4GA 1BBRH 3A87A 3GY7A 5PTPA 1TPAE 1EOLA 2XCNA 3RXSA 2O8UA 2SNVA 3F9HA 9ESTA 3W95A 3SNCA 1CA0B 4AFQA 1ZOMA 1OPHB 1DT2A 2VH6A 1PQ5A 1NRRH 4MNVA 5JB9S 3BTQE 1ZPBA 3KQEA 2ZNKH 4XOJA 3U8OH 2QA9E 1K1OA 4OS2A 1QBOA 1EZQA 2JKHA 3F9FA 2FXRA 1SL3A 4AFUA 1O2KA 1N1LA 3BTME 1O5EH 3P17H 1YCPH 1ACBE 3NPSA 1SQOA 1IHTH 3SN8A 3MH7A 1O3JA 2XNIA 1LVOA 2GCTC 1IQFA 2F9NA 1EX3A 1SFQB 3TVJB 1C1NA 4NIWA 2O9QA 3RXGA 1LDTT 2ESTE 3F9EA 1MTNC 1SHYA 1T8OA 3PTNA 5EQQA 2W3KA 4I8KA 4JCNA 5SGAE 3BN9A 4AFZA 4ABFA 1O3DA 2ZTXA 3A82A 1G9IE 4Y0YE 1NRPH 1MD8A 1PPEE 3UOPA 1E34B 1AUJA 1K21H 1C4Y2 3P8OA 1LHEH 3FZDA 2BZAA 1OP0A 4LZ1H 1XM1A 1GBFA 2PR3A 1O2GH 2GP9B 2A31A 4ZH8A 1QIXB 3UQOA 1OKXA 5DK1A 1W10U 4RSPA 2ASUB 1AI8H 2XW9A 1GBDA 1FPCH 2D1JA 3DA9B 3ZVBA 7ESTE 1GI8B 4TPYA 1O2LA 1Z8RA 1AB9B 1QQ4A 5C1YA 2ZFRH 2FI3E 1A0JA 1LPZB 2ZQ1A 4JZFH 4ZXXH 2YNAA 1DUEA 1UTMA 1UHBB 2J9NA 5TJXA 4AYYB 3ESTA 1C2LA 1Y3UA 1FNIA 2R2MB 4AG2A 2HGTH 1BDAA 1C5LH 4GVUA 1P2KA 3E91A 1IQHA 3D23A 1L1NA 3SO3A 1K22H 1VITH 4HI3A 4HFPB 5AFYH 2C3SA 1PQ7A 2XBVA 2XWAA 2P8OB 1TNJA 3AVZA 1O2UA 3GDSA 4INLA 5DP8A 4DT7B 1BBRK 1NRSH 1P10A 3OU0A 2TGDA 4KKDA 3ZZDA 1O3EA 1A61H 1QQUA 4GSOA 4NZQA 1GJ9B 5JBAS 1Y5UT 2J4IA 4LOYH 2VWLA 4BANB 1AQ7A 4DIIH 3VXEH 4K1SA 1GL1A 4LXBH 5C1XA 4TWWA 1GG6B 5L6NH 2FOMB 1OXGA 3ATMA 4ABHA 1HCGA 4OS5A 3M35A 1WSSH 1SGEE 2FOCA 1JBUH 4CRGA 3M7UA 5T6DA 3DT0H 5JPMH 5GCHG 4JZIA 3E1XB 5DPAA 3P70B 4JZEH 2BX3A 4YOIA 1O5AB 3TGIE 1OWIA 3NXPA 3URDA 3M5OA 1HXEH 4KGAA 3SNDA 4ZKSU 4Y8XA 4GCHF 5F03A 4J2YB 2BVRH 1QR3E 1CVWH 1QURH 4YO9A 3ZZ9A 1HAVB 1OYTH 4WH8A 1N6XA 1C5RA 2F3CE 2FI4E 2PUQH 1GDNA 3BEFB 2ZFTA 3K2UA 5JBCS 4XE4A 3UPEA 6CHAB 1UTJA 1O2MA 1YCPM 4B2BA 2R3UA 1W11U 3RXUA 4DOQA 4VGCC 1H9IE 2ZECA 1AWHB 1SOTA 1MTSA 3F9GA 4X8VH 2O8WA 3BF6H 3MYWA 2ZI2H 7KMEH 2Z3CA 1A7SA 5A0AE 7LPRA 1QHRB 3GCOA 1PPGE 4AZ2B 1S85A 2VJ1A 3OX7U 3GICB 1EZUC 1Y3WA 4BTIB 3DHKH 1AUTC 3MU0A 2GTBA 4ABEA 1OX1A 1YF4A 4GAWA 1V2NT 4KP0A 1EOJA 5C1UA 1SLUB 2WPIS 2OQUA 1GJAB 4ISOA 1FIWA 1GMDF 1E38B 1C1QA 1WYKA 4IBLH 4BTTB 4A92A 2ZGXH 3NZIA 1EPTA 1H9LB 3M3TA 3LC5A 2ZA5A 4ZMAH 4X2YA 1P2JA 1CGIE 3KL6A 4Y76A 3T28A 2FIRH 2BYAX 2BOHB 1S83A 4I32A 3SU5A 2Z9KA 2BLVA 2VWMA 1A0LA 4U2WA 2WPHS 3M3VA 3SZNA 4RKJB 2QCYA 1CHOG 3TU7H 1GPZA 4TWYA 2HNTC 4JK6A 4A5TS 4OGYA 5LGOA 4UDWH 1L4ZA 1P0SH 1AB9C 3EYDA 1O5FH 3HGNA 4KTUA 3S9CA 4K69A 4NZLA 2H9EH 2HPPH 1SGYE 2GVFA 2AMDA 1GI5A 1HV7A 1P11E 2WPLS 1C1PA 3FAOA 2G00A 2QY0B 2F9PA 2ZHFH 2XBXA 4ABJA 3RMNH 1DE7H 4K2YA 1V2OT 2NU1E 1DLEA 1H9HE 1ZJDA 2SGQE 3ATKA 1NO9H 2C8YB 1UCYH 3G01A 2NU4E 1UVTH 1P2OA 3R0FA 3RXOA 1O3PB 4GHTA 1GHVH 2LNCA 1B0FA 4A7IB 1MKWH 2J38A 5HM9A 4Y7BA 1KXCA 1ELVA 2OTVA 2OP9A 1RRKA 3URCA 1Z8IB 1XXDA 2H2ZA 4FUDA 2G81E 1YPHE 4BAKB 1T31A 1J17T 1MMJN 2SGAA 5C20A 1SQAA 1CHGA 1SG8B 1BTUA 1UTNA 1AFEH 2P93A 5FBEA 4DJZB 2FO9A 1P01A 2Z9GA 1AGJA 1SGFG 5EW1H 2K1QA 2G5NA 3CENA 2UUJB 2HNTF 1GI3A 2TBSA 1QNJA 2Z7FE 4NFEA 2CF9H 1P2QA 2ODYB 1O32A 3SUEA 2FLRH 3Q3KA 3C27B 1FIZA 1PPHE 4MNXA 2BY6X 4XBBA 4D7GA 1Z6EA 2QYIA 5C3NA 2W3IA 4NGAH 3TH3H 1HAOH 3V12A 1HJ9A 2V35A 1A1RA 3P6ZB 1XKAC 1IQEA 2H1UA 1VITG 3ATIA 5EXNA 4JYVH 2GT7A 3IITA 4A1XA 1C5PA 4K60A 2VGCC 2BTCE 4CR9A 4IC5A 5E2PA 2F9BH 5A8ZA 5JDUB 3RXEA 4XSKU 1YYY1 2ZDMA 3GY2A 3HPTB 1GBEA 2FI5E 2RA3A 3RXTA 1QBNA 2WV4A 2Q6DA 4WMEA 5I46H 1DFPA 1TNHA 2GGVB 3K65B 3RM0H 1DVAH 3RXPA 3RXBA 2Z9JA 3D49H 2B5TB 3VB4A 2UWLA 4UD9H 1O3NA 3A85A 3MWIU 1MKWK 4Y6DA 1P06A 3A7WA 1P09A 1WQVH 2G8TA 1YPGH 2QV1A 4IMQA 5DO4H 2ZTZA 4MNWA 3LH1A 1SGDE 2A1DB 2VU8E 1C5YB 1ID5H 1DDJA 3UQVA 5CHAB 1EAUA 1ELTA 1QA0A 3H7TA 5A8XA 1ZJKA 5FX5A 1MCTA 1PPBH 3T26A 3ITIA 1MTUA 1W0ZU 2XC5A 1DWEH 2ZO3H 1O36A 1KYNA 1TX6A 3RLWH 3BTEE 3AAUA 3MU4A 1KXBA 3LJOA 4JK5A 1AIXH 1AO5A 1BITA 1ZHRA 1UVPA 2H9HA 2ZWLH 1TNKA 4WH6A 3STIA 1FLEE 4R8TB 4GPGA 2GZ7A 4BXWA 5J4QA 3R3GB 2WPKS 1OS8A 3ZVFA 3O8DA 3PLBA 1ARBA 1C1OA 3RXLA 3GDUA 2V0BA 1LHFH 1ETSH 2A4OA 1UVUH 2FM2A 2ZC9H 1W14U 3RXJA 1G3BA 2ULLA 3PMBB 2CGAA 4TYDA 1V2ST 1AFQB 3UFAA 3ZV9A 1C1UH 1LPKB 2IPHA 1GHBF 1TLDA 1CQQA 3NWUA 1T8NA 3STJA 4NWLA 3MOCA 3VXFH 5E8EH 2ANYA 4ISHH 3MNCA 1BA8B 1Y8TA 1ZMNA 5EXLA 2A5AA 1TAWA 1YPEH 1N6YA 1V2JT 3M5NA 2XBYA 3KQDA 5AVDA 5T3HA 2BD5A 1HAVA 5H4IB 3VB5A 4H4FA 3Q3XA 2Q6FA 2W7UA 2JH5D 2G4UA 1BJVA 2PFEA 3A7ZA 3EQ0H 3RMOH 3ZVDA 1Z71A 1YP9A 1IQIA 4HGCA 1DSUA 4ZKOU 2FTMA 1GBCA 3T29A 1DANH 1G36A 2TGPZ 1ZTJA 2GDDA 1KDQB 2EI6A 1L1GA 3QO6A 2XYAA 1WOFA 2PHBA 1TQ0B 1CT4E 1QFKH 5FHTA 3A88A 1EATA 1ZHPA 4O3UA 5DG6A 3A8CA 5G4BA 3A84A 2RDLA 3GCHC 1EAIA 2FESH 4Q2KA 3TH2H 2NU0E 1HUTH 1S84A 5TCCA 1CA0C 4FU7A 3A83A 2QF3A 2R0LA 2AYWA 1N8OB 2PKSC 2PV9B 3MU8A 2BX4A 1BT7A 1TMUH 1QJ6B 1KDQA 3BEIB 1TGCA 1O5BB 1W13U 2BOKA 1RTLA 1SHHB 3SU1A 1C1TA 5JYIA 1MTNB 3LOXA 1BTHH 1KLIH 5JBTA 1MKXK 1YPMH 2JETC 1SGFA 1C2JA 1HGTH 2ALVA 2WUCA 1C5OH 2Y82A 4D8NA 4OS4A 2VIWA 1P2MA 2ANWA 5GXPA 1BMLA 1SI5H 2AIQA 4FUCA 4ISIH 1PJPA 1GJDB 2A5KA 1BOQA 4F4OC 1O35A 3I78A 3RXQA 1O2HA 5IYTA 3BTGE 1X7AC 4ZHAA 1UO6A 3IWMA 4E06H 3A89A 1A0HB 1KTSB 3K6ZA 2BXTH 3CP7A 3RUOA 3M5MA 4Y71A 5EGMA 1BTPA 3ZZAA 1TONA 3FANA 5EODA 1AKSA 5FXLA 1ZHMA 2PKAB 3NK8A 1IQNA 1TGBA 2BB4A 1INCA 5FAHA 1MD7A 1C2KA 4MVNA 2FOBA 1GDUA 3SHCH 1T4VH 2CV3A 3W94A 2D2DA 2OC1A 1Y5BT 1C5XB 4X1NU 8LPRA 1L1JA 2W26A 1Z6JH 4RKOB 2A5IA 2GDEH 4CHAC 3E3TA 2TGAA 5DGJA 3U1JB 1GBKA 3ATLA 4X8UH 1F0SA 3ZVAA 1NC6A 5E0JA 5FPYA 5GWZA 3TH4H 3CS0A 1AFQC 2WINI 4IN1A 3PB1E 2AGIX 1GMCG 4ABBA 1QCPA 3E16B 3GY3A 3BTTE 2RCEA 5GJ4B 2CJIA 3SNEA 4WMDA 3BG8A 5EOKA 1UK3A 1EP6A 1HPGA 1S6HA 9LPRA 3SGQE 1DSTA 1K1JA 1ABIH 1T8MA 1FY8E 2J95A 2SGEE 4SGAE 2PUXB 1GBBA 2B8OH 4NIXA 1O3BA 3PROA 3GOVB 4BOHA 6GCHG 4UFGH 1GJCB 4CRDA 2FOGA 1YPKH 5HMAA 4ESTE 4JYTA 2SGFE 3ATWA 4B76A 4NA9H 4WWYA 1PPFE 4H6TA 4ABAA 3S7HB 1Z1IA 2R9PA 1GMDG 1SMFE 2Q6GA 1GGDB 3AAVA 3SORA 4K1TA 1ZSJA 1BIOA 1NRNH 2IN2A 2V3OH 3KHVA 1GCTB 2ALPA 2BD3A 1L0ZA 2H5DA 1IQLA 1O3HA 4ZUHA 5DKMA 1EASA 1MZDA 1DICA 3MU1A 1V2TT 3A8AA 3TJOA 3AW1A 5DP6A 3ZZ7A 3RXKA 1AZ8A 4I8HA 2PSYA 3P95A 1XUGA 4YT7H 2XRCA 4TY7A 1OOKB 4CRCA 1WCZA 1LVYA 3TITA 2F9VA 1QL7A 2BVSH 1LQEA 2C8WB 4D9RA 1AHTH 1HAHH 3EGKH 2BD9A 1TBRH 3ZVEA 4DG4A 1FXYA 3U1IB 1O2OA 2B7DH 3SU0A 1XVOA 1RJXB 1NTPA 2FX4A 2F9UA 1SGQE 3V7TA 3LU9B 3DFLA 1SGPE 3RXFA 1C5WB 4GCHG 7GCHF 1NU7B 1A2CH 3F1SB 1S81A 1CBWC 3M3SA 2PKAA 4ISNA 1IQGA 1CSOE 1V2UT 2Z9IA 5GDSH 1FY5A 1F5LA 4NSYA 1XX9A 3NKKA 2A4QA 2BHGA 1P02A 2H5CA 2G55A 1XXFA 3F68H 1WTHD 2A7HA 3VGCB 3ZZ8A 3ZZ3A 1O39A 1P05A 3EAJA 4AGJA 5DP5A 5FCKA 4YOGA 2EEKA 1Q2WA 1TNIA 1FN8A 1QTFA 1TMBH 4A1VA 1H8DH 1D4PB 1DXPA 1WV7H 1CT2E 3QZQA 3FZZA 3T5FH 4Y8ZA 2XBWA 3A80A 1D3DB 2ZIQH 4X1QU 1N8OC 2PKSB 1ANCA 1HRTH 3O8CA 5L2ZH 4ZKRU 1UTLM 3K6YA 4JZDH 3HK6B 1F7ZA 1IQMA 1OSSA 1TYNA 1O2ZA 4NA8A 1NFXA 1MCVA 1GMCF 1GWAA 2QIQA 1P2IA 1C5NH 3VFEA 1HAYB 3L33A 1P9SA 1GGDC 1KY9A 5I25A 2PGBB 1FUJA 2A2XH 5TCAA 1QL8A 1GMHG 3FFGA 2ZPSA 1MH0A 1C5ZB 5F8ZA 5ABWA 1GHZA 1IAUA 3PWCA 1AU8A 1W2KH 3BTWE 1ZZZA 2P8OC 1EJMA 1OWEA 2BM2A 3SUGA 2G51A 1P9UA 1A46H 1D3TB 1F2SE 1O2VA 4WJG2 2P95A 2R2WU 1HYLA 3TGKE 4U01A 3VB3A 2ZHDA 1BMNH 4FU9A 1GI6A 2ZDNA 1F5RA 4IS5A 1CA8B 1AN1E 1S82A 1W12U 4WF8A 3A8DA 4D7FA 1TA2A 1F92A 4Q80A 3TLOA 4ZHLU 1HFDA 5ESBA 1OWHA 1CBWB 4ABDA 1KXFA 1YC0A 4YLUA 3E90B 4AORA 1P2NA 4GUXA 1GCTC 4I33A 3SUFA 1EPTB 3ZZ5A 1V2QT 4UEHH 3EA8A 3QTVH 1DWDH 5C5NA 1NU9A 3KF2A 5AF9H 4JYUH 2FYRA 1NESE 3UNQA 4TY6A 3VGCC 1A5IA 1LHCH 4OS6A 1HAPH 4E05H 4ZAEA 2Y7ZA 3PMJA 3RMLH 1DY8A 1UTOA 2VIOA 1O3KA 4KELA 4INKA 8KME2 1HLTH 4HZHA 2BVXH 5E0HA 2GV6A 4AN7A 3M5LA 2Y80A 3EA9A 5BPEA 3MH6A 4A1TA 1U6QA 1GVKB 5GIBA 1VR1H 2GZ8A