4Y0ZE

Trypsin in complex with with bpti mutant aminobutyric acid
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor complex
molecule keywords Cationic trypsin
publication title Fluorine teams up with water to restore inhibitor activity to mutant BPTI.
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y0zE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4y0zE02
1Z8IB 2F3CE 2GZ7A 5FPYA 2OCVB 3W95A 4OS7A 2ZHDA 3G01A 1OWDA 2ZKSA 1A0LA 1J16A 1ZGIA 4XFQA 4MTBA 1K1MA 3ODFA 4Q7YA 1VZQH 1EB2A 4JZEH 1O3FA 3MO6A 2JH6D 1P2KA 3RXSA 1C2GA 2B9LA 5HMAA 3UWJH 1G2LA 1GL0E 2PUQH 4D7FA 3UIRA 1GMDF 1SR5C 1ZHMA 2FDAA 1XKBC 2OUAA 5EXMA 2GP9B 1VITF 5C3NA 5IYTA 5DP9A 1O33A 1TQ7B 7KMEH 5L30H 1J8AA 1YGCH 9LPRA 5T6FA 1EP6A 1Y5AT 2Y5GA 3BG4C 1BT7A 3MH5A 1BB0B 2A4GA 3TJVA 3CS0A 2C8WB 1OSSA 2Y5FA 1A1RA 1YCPH 1EZQA 4NZLA 3S0NA 1E0FD 1GCTB 2HVXA 3EA8A 5T3HA 3PMBB 1F7ZA 1PPCE 1E35B 2V3HH 3M5OA 1P09A 1Y5UT 2HOBA 1Q31A 3SHCH 1GI5A 2B7DH 3BTEE 3KQCA 1LHEH 4GPGA 1A3EH 1ELAA 4NIVA 2CF9H 3DFLA 4AZ2B 4ASHA 2A45B 3RMOH 2IPHA 2O8TA 1JBUH 4AB8A 4X1PU 4KP0A 2SGAA 3P92A 4CH2B 1CSOE 1Y3WA 1YPGH 2FI5E 2G51A 1IQEA 1ZPCA 1HAOH 1BMMH 1C1PA 1RTKA 1IQGA 2Z3DA 2H5DA 2Q6FA 1RTLA 3O8CA 4DGJA 3LU9B 1LPGB 5DP7A 1L4DA 1CHOG 2XC5A 1HLTH 1GGDB 1FAXA 1ABIH 4I32A 3DD2H 1FAKH 1W11U 4XBCA 1GBMA 3VB6A 2UUKB 2ZDKA 1TA2A 2A31A 4BANB 1O2PA 4THNH 3IITA 1SGTA 4NA7A 4Y79A 2VIQA 1INCA 3SV2H 4GUXA 4BTTB 4MNXA 4ZKRU 1BDAA 2PKSB 3FAOA 3MI4A 3P6ZB 4CRFA 1W13U 2Z9LA 1P02A 1S84A 1V2JT 2XC4A 1GJ6A 5LH8A 8GCHG 5DP8A 4TPIZ 4YESB 3BTGE 4I7YH 2A2XH 2CHAB 1T4VH 2TGDA 4CRCA 1O3AA 4WMFA 1Y3XA 1GJAB 1UJ1A 4YZUA 5C5OA 2GDEH 1DSUA 4B2BA 1O2TA 4I33A 4GAWA 1YCPM 4FUDA 1RIWB 2Y81A 5DP5A 1F92A 3GICB 1IQFA 5IDKA 3UQVA 1RXPA 1D9IA 4FVBA 1UTKA 1YF4A 3BTKE 3TNTA 1G30B 2W7SA 1M9UA 2QV1A 1TFXA 1Y59T 4D9RA 5G4BA 2OLGA 4GHTA 4X1SU 4IBLH 4JK6A 5GPIB 1LHDH 4AFQA 1A5GH 4DOQA 1ESAA 1B5GH 1GPZA 1V2TT 4NSYA 1ZJDA 4YT7H 1O35A 2Z9KA 3MU5A 1QIXB 1H9IE 1ZHRA 1FY3A 2NWNA 2UWOA 4IMQA 2SGFE 3SU2A 1K2I1 1UTOA 1FN6A 2CV3A 4Y8XA 4JZ1A 3Q00A 4IC6A 2WV4A 3QZRA 4B76A 5T6DA 1JOUB 2AIPA 1CT2E 4X8UH 3PTNA 5E8EH 1V2OT 3VB7A 1EATA 4ZAEA 3RXLA 1TMBH 1D3TB 1QL8A 1UMAH 1SGIB 4CBNA 1GHYH 3HKJB 2A5AA 1LPZB 3RXOA 1SQTA 2ODYB 4ABDA 1BCUH 3GY7A 4ZROA 2JETB 5K0HA 2WV5A 3GCOA 1EJAA 3ZYEA 1A0HB 4Z6AH 5E2OA 3U1IB 2BLWA 2EA3A 4AORA 3H7OA 1N1LA 4B2CA 2ZGJA 1WAYB 1YC0A 1ELEE 2OBOA 2Q1JA 4FU8A 3AAUA 3RXEA 3NCLA 1GJ9B 1HAZB 1MTSA 1KXFA 2BQ6B 1AZ8A 3ODDA 1QL7A 1SQAA 1E37B 2OXSA 2Z9IA 1RS0A 4BXWA 1MKWH 1O3OA 1RFNA 1NFWA 1TA6A 3A8BA 1IQHA 1O36A 1O3GA 2SGEE 2AS9A 1AQ7A 3GCTF 4SGAE 4WWYA 1Z8GA 3P8OA 1GBLA 2QXJA 1K28D 1MKXH 1W0ZU 4U30A 4ZKSU 1WYKA 2VWOA 1MCVA 5HXFA 1C5YB 4Z0KA 2BYAX 1O3CA 2FLRH 5EGMA 1ELDE 4LOYH 2WPJS 1PPBH 1J9CH 4ISLA 3SI4H 3ZVEA 3A81A 1IQMA 1Z6JH 1UCYH 3UPEA 4U01A 1A46H 2PTNA 1TGCA 1THPB 5GCHF 1Y3VA 5LPEA 3RXPA 4FUFA 4I8HA 1P3EA 3ZV8A 1ZRBA 3M7QA 5A09A 7GCHF 1GMCF 3PROA 1IQJA 1SGCA 3NWUA 1K1OA 1HAHH 1T8NA 5FBEA 2A5IA 7ESTE 3S7HB 1LHFH 4ABEA 1SSXA 1J17T 2ZP0H 3E6PH 2VWLA 5DP6A 3F9HA 4HI3A 2DE8A 1EPTA 2G52A 1SGNE 1LKBA 1C5RA 1O2KA 4NFFA 3NK8A 1QR3E 2PKAA 2ZFRH 2OC1A 4NGAH 3L3TA 1A2CH 5C1XA 1G36A 3E3TA 4AN7A 4OGXA 2QXIA 1O2HA 2Y6TA 4J2YB 5I46H 2A4RA 1NO9H 1GHWH 4CBOA 1P9SA 4FVDA 2BLOA 1KLJH 1GMHG 2ILNA 2P3TB 1SLWB 1C5QA 2J92A 1C1RA 3LGTA 2FM2A 2A4QA 1AVGH 2Y7XA 3LGWA 3TNSA 3SBKA 3P8GA 1HJAB 3OX7U 2HNTC 2ZO3H 1PPGE 2A7CA 2Z94A 1XX9A 2C8YB 5F8TA 1AD8H 2OINA 4DG4A 4HZHA 6CHAC 4BAQB 4UONA 3T26A 1AN1E 2P8OC 4MNVA 1ETRH 1KTSB 3LPRA 3QK1A 1T31A 1CA0B 1D4PB 3KQDA 4LK4A 4XSKU 2QXHA 1FLEE 3BG8A 1LVOA 1SGPE 2RCEA 1O3BA 4FUEA 3T62A 2CJIA 5EXLA 1UTLM 1AVWA 2GZ9A 3WY8A 2PWXA 5DPAA 1DY9A 1TGSZ 1OWHA 2XWAA 3K6YA 5JDUB 1V6DA 2H6MA 4ZH8A 1QJ7B 2ANMH 4NCYA 3LOXA 5GIBA 4YOGA 2ZQ2A 2W5EA 2GCHG 3LIWA 4I31A 5A0BA 4KELA 4E05H 5CE1A 2J34A 2G81E 1F0UA 2QC2A 3ELAH 3ESTA 1V2UT 4TYDA 4AYVB 1F5RA 1KIGH 2EI6A 1C1VH 3D62A 3KF2A 5EPNA 3VXEH 3KL6A 5DP4A 3KIDU 4AX9H 5EW1H 1VCQA 2OP9A 1OPHB 1CO7E 4XE4A 4CHAC 1OWJA 3BV9B 1AE5A 2VIWA 1Z1JA 1O2ZA 4IW4E 1BMAA 2P95A 1BIOA 2XXLA 1TE0A 1NROH 5EODA 2GMTC 4K69A 3T29A 1TNGA 1KLTA 2FYRA 1YLDA 1GHAF 1DUAA 8LPRA 1C1TA 3M37A 3P17H 1GBKA 1A61H 1DFPA 2D2DA 2ZU3A 4JZDH 4X6OA 2F9BH 2FTLE 1AMHA 2BVSH 2FS8A 1NY22 2ZFTA 3SJ8A 1V2ST 3GDVA 1EQ9A 1EOLA 5L2ZH 1TX6A 1XXDA 2EI8A 2B5TB 1LQDB 3TJOA 3ZZ9A 1C5PA 3TGKE 3SUEA 1MTNC 1HV7A 1V2RT 1YPHC 2Z3EA 4WH8A 2VIOA 2EC9H 2BX3A 4NWLA 1P3CA 2F91A 2ZTZA 2I6SA 4CRAA 1QJ1B 3KNXA 1FY8E 2XTTB 4MPVA 2BD9A 4AYYB 1OX1A 1O3KA 2QY0B 3A7XA 4IMZA 4DIHH 2BY6X 3A8CA 4INKA 1P2IA 3BSQA 1C4U2 1OKXA 1ZPBA 4OS1A 2R0LA 1EXFA 4AGJA 3A7ZA 3ZZCA 1QA7A 1AZZA 2WPHS 4A7IB 4QT8C 2DE9A 4R0IA 1BHXB 1TBQH 2D26C 4K8YA 2QIQA 3SNBA 4A1TA 2G4UA 3RU4T 4F4OC 1W12U 4MPUA 1FV9A 2AERH 4YOJA 3LGUA 2ZDNA 3M5NA 3TLOA 3B8JA 1GDUA 1SG8B 2BZ6H 1SOTA 1C2JA 3OY6U 1BTXA 2ZU5A 3LJOA 3DT0H 3Q77A 4ZHLU 5K7RA 1HCGA 1KXAA 1K22H 1P04A 1O38A 3LGYA 1EAUA 4WJG2 1GBIA 1VITH 4D76A 5J4QA 1BUIA 2W3IA 1SLVB 2A0QB 2GD4B 1GDNA 3HPTB 1MMJN 1EB1H 1FPHH 3MOCA 1ABJH 1OP2A 3SGBE 2TGPZ 3M3SA 1JIMA 3UFAA 2ZZUH 3ITIA 3GCNA 1W14U 2BX4A 2A1DB 3ZZBA 1HXFH 2RA3A 2A32A 3E0PB 1HXEH 1CGJE 4YLQH 4LXBH 5EQQA 3T25A 1SGDE 3S9BA 4JZIA 4X0WU 1WTGH 1HPGA 3EAJA 2Y80A 2C93B 3LGIA 1TMUH 4INLA 2BOKA 1DLEA 4UFDH 1C2LA 3EA9A 1TNLA 1L1JA 1Z6EA 4RSPA 1NU9A 1MTUA 1QBVH 1MH0A 1HNEE 1KYNA 4H6SB 3PV4A 1GJCB 2V0BA 3BEIB 3E16B 1F5KU 3SHAH 1SGQE 5FPTA 1RTFB 2FYQA 3VB3A 1AUTC 2SGPE 3UNQA 2ZU1A 2C8ZB 5LPFA 1BA8B 1LKAA 1DWBH 3MMGA 2HALA 3A7YA 1GBTA 1UTQA 4DCDA 2VU8E 2BD7A 3ZZ8A 1PPZA 2FOAA 1D6WA 1C5VA 3SOSA 3V7TA 2UUJB 3ZVGA 2I6QA 5GXPA 3ZVCA 1DXPA 1QRXA 1O31A 1PQ5A 5SGAE 1QURH 1MTVA 1TABE 1KY9A 1NESE 3W94A 3O8RA 3BIUH 3URDA 2VIDA 1Y8TA 1GCDA 1JRTA 4ZHMU 4A1VA 1V2MT 2LPRA 3TJNA 2IN2A 2C4FH 3LH1A 3ZZ6A 1GBAA 1GDQA 4I8GA 1A0JA 4FU7A 1W0YH 2ZPSA 1IHSH 3B23B 3SV7A 3ZZDA 1W10U 3MNCA 1XUIA 3RMNH 3SNCA 2QN5T 3GYLB 5DK1A 1C1OA 1HAYB 3TU7H 3KCGH 6CHAB 3Q3XA 1IHTH 2VH6A 2P8OB 1TPPA 1T8MA 1O5AB 1SGRE 1DY8A 1EPTB 5CMXH 4Q2KA 2ZFPH 4GCHF 1J14A 3LJJA 1LHCH 5FAHA 3UNRA 5TJXA 3RP2A 4XDEA 4I8KA 4O3TA 5F6MA 1AI8H 3SU3A 2PKAB 1ZSLA 3EGKH 4CR9A 3D49H 1C9TA 2BM2A 1ZYOA 4LZ4B 2CGAA 5GJ4B 2STAE 2A5KA 4HTCH 2PGBB 3RXQA 1OXGA 5EPYA 1GJ4H 1O37A 5JBAS 5L2YH 4DURA 1WQSA 1SOZA 3RMMH 4CR5A 1MQ5A 3RXHA 2ZNKH 3SZNA 3T27A 2TIOA 1Y3UA 3A89A 4D9QA 4ABBA 4UFEH 1DITH 1MZDA 3OSYA 4CHAB 1GHZA 3MH4A 1TONA 3MU8A 5F8ZA 3V12A 1C5NH 3E90B 2GMTB 3UTUH 4HGCA 5E0JA 2AYWA 3GISB 1P12E 1S82A 2VWMA 4Y7AA 1XUGA 1XVMA 1O2SA 1O3HA 1H9HE 2BDHA 5C67A 5A0AE 4NA8A 2FZZA 4A6LA 1MAXA 1P03A 1B7XB 1N8OC 3MH6A 3TK6A 1FPCH 4JK5A 1ZGVA 1FY5A 1LVMA 2FMJA 1CHGA 3GDSA 1MU8B 1ESTA 1ANCA 1GI0A 3UOUA 1KSNA 2ZU2A 2VJ1A 2W3KA 4FU9A 3SU0A 2G00A 1THSH 3A7VA 3BTWE 3C1KA 2NU0E 1LO6A 2ANKH 1RRKA 4Y11E 4LZ1H 3TGIE 4I8JA 2BY8X 3EA7A 1DWCH 1QQUA 4AFUA 2R2WU 2VINA 1T4UH 2GVFA 1X7AC 4Y0YE 2G55A 3UR9A 2HRVA 2UWLA 3BTDE 1GVKB 5GCHG 1C5ZB 7LPRA 3UOPA 3BTTE 1LPKB 1UVPA 2VVVA 1V2KT 3C27B 3MO3A 1KXCA 3P8NA 2ULLA 1O3NA 3PMJA 2BXTH 3OU0A 4K2YA 3STIA 3E0NB 1CT4E 3PO1C 4AFZA 4BAKB 1HFDA 1ELCA 2OQ5A 3MTYA 5JB9S 2QF0A 4NWKA 1ZSJA 4IC5A 1DWDH 2D1JA 1AGJA 2Z6BD 4NSVA 2TRMA 3VGCC 5LGOA 2ANYA 4B2AA 2Q6GA 4DY7B 2P16A 2FLBH 4PROA 2QGRA 4UE7H 1IQNA 2GV7A 1O2MA 3M61U 1GG6C 1EJNA 1TGTA 2KAIA 3IWMA 5C20A 1Z7KA 4K5ZA 4UFFH 1NRRH 1TX8A 3HK3B 3F1SB 6ESTA 5A0CA 3PWBA 6LPRA 1VGCC 4MVNA 5EW2H 5BRRE 1P06A 3V13A 1ANEA 1AFQC 1SI5H 5FHTA 4JYVH 4JZFH 4AG1A 1QFKH 2GDDA 5ESTE 3K65B 1S6HA 1C5XB 1ANDA 3VFEA 4K1TA 1CT0E 2G8TA 3RXDA 4D7GA 1BBRK 3LKWA 1DSTA 1F0SA 2ESTE 1TBRH 4JYTA 2ASUB 2QCYA 4H6TA 4OS6A 4Q7ZA 6GCHG 3A85A 3TH2H 1JXPA 2BD5A 1C2FA 1P57B 1Z1IA 2AMQA 1DS2E 2B8OH 1BRUP 4BNRA 3VEQB 3U98H 4YM9A 1O3LA 1C2MA 1C5OH 2FOCA 4H4FA 1Q2WA 3AASA 2PLXA 1QQ4A 3GY6A 1DX5M 2QXGA 2ZQ1A 2ODQA 2XNIA 1A7SA 5DGJA 1CHOF 1FQ3A 1O39A 3M5MA 2BY5X 3GOVB 1ETSH 4AFSA 1O3EA 3MFJA 5EU8A 3KHVA 2AGGX 3EQ0H 2ZHFH 1TNIA 2HNTE 1ZRKA 2BVXH 1C2HA 2Y5HA 3F9FA 3U8RH 1O2QA 1GI4A 2FO9A 2VB0A 1O2JA 3RU4E 1EUFA 4K60A 1YBWA 3SQEE 3DHKH 1MUEB 1F0TA 4DT7B 2A7HA 2PTCE 2FX4A 2OBQA 3GY5A 8GCHF 1UVSH 1IQLA 4X2VA 3BG4B 4Y10E 1P2OA 5JYIA 4KTSA 2FODA 1O3DA 1S5SA 1GBBA 3GY3A 3ENSB 3SV9A 2FTMA 3SU6A 3CENA 1MCTA 4WXVA 1EZSC 3FVFB 1YCPK 1TPSA 1BBRE 2A2QH 1A5HA 5AF9H 5E0HA 2BXUH 1Q3XA 1BRCE 3LGVA 1SHHB 1MD8A 3M35A 2HGTH 2TPIZ 2SGQE 2FOFA 1NFYA 2HWLB 4UD9H 3A86A 4XBBA 2YNAA 3JZ2B 4Y71A 2Y82A 3RXCA 4UDWH 3SQHE 3JZ1B 2ZECA 3ZVAA 1LTOA 3RM0H 2BD2A 2AGIX 1P05A 5FPSA 1TX7A 1TBZH 2ZC9H 1T8OA 1QNJA 2ZGBH 1F0RA 1H4WA 3GCHC 3MNSA 5FX5A 1SLUB 1L1NA 1UVOA 1V2VT 2ZEBA 5FXLA 1GVLA 1HBTH 2K1QA 2PW8H 3B9FH 1ELBA 3S9AA 3LDXH 3BTME 3RXBA 2WUCA 2GCTC 1O2NA 4U2WA 2SNVA 5EQSA 1GI9B 3VPKA 2XBYA 2BDYA 1ZJKA 1G3DA 5FX6A 1V2LT 1G3BA 3SORA 2OC7A 3QGNB 1NFXA 3O8BA 2CXVA 3V0XA 1C1QA 2F9NA 1D3QB 1YPHE 1TGBA 1OYTH 3MWIU 3SGQE 1O32A 3RC4A 3D65E 4X2YA 4WMEA 1UTNA 1PPHE 3KEEA 3OYPA 5JBCS 1AE8H 2BD4A 2VIPA 2NU4E 1ACBE 2O8WA 2V6NA 2IOTA 1ZHPA 2Y7ZA 3LH3A 3A8DA 1O2RA 3S7KB 4IS5A 1LHGH 1TWXB 2R3UA 3U1JB 3RC6A 4HFPB 1AIXH 1TGNA 1GBEA 4MG3A 3UR6A 1O0DH 2XBVA 1XKAC 5HYOA 3QLPH 1KDQA 1O3JA 1V2WT 2PSYA 4FUIA 2BMGB 2J94A 4Y8ZA 3ZZ4A 1TQ0B 3RXJA 3LC3A 1PFXC 1YKTA 3PMAB 4KKDA 3K2UA 3TITA 1W8BH 3GYMA 1WSSH 1V3XA 1XMNB 2GT8A 3DFJA 1BQYA 1FIWA 1UK2A 3HKIB 2SNWA 4K1SA 3P8FA 1QB9A 5LPRA 1S83A 4DVAU 1ZOMA 1U6QA 3S9CA 5E0GA 2YOLA 3VB4A 4CRBA 4B1TA 2BQWB 2ZFQH 1ZPZA 2JKHA 1P11E 4XOJA 4DJZB 3U69H 2XRCA 1CU1A 2VH0A 3RC5A 1QB1A 1VCPA 1XXFA 4INHA 1KXEA 1YPJH 2XYAA 2H9HA 3I78A 4IN2A 2RG3A 2ZCLP 3F68H 2PKSC 1BTPA 1GMDG 4O9VA 2PV9B 1HIAA 2WPIS 1VITG 1Z71A 2J95A 1BTHH 1N6XA 1RGQA 3SJKA 1EZUC 2TGAA 3RXIA 4R8TB 2CHAC 1BTWA 3KN2A 1F2SE 4MNWA 1UHBA 3MHWU 1BHXF 4A1XA 3QUMP 3A83A 8ESTE 4XBDA 1VGCB 2QF3A 4DW2U 3ATMA 1SGFG 2A4OA 1ZTJA 1SGEE 5HGGA 1T8LA 1RIWC 5EG4A 3T2NA 2J38A 1GBCA 3SUGA 3FANA 5ESBA 4VGCC 5ETXA 1GMHF 2FOGA 1PYTD 4X8SH 1NPMA 1YPLH 1OWKA 3A87A 5GWZA 1DT2A 4RKOB 2BD3A 1O2GH 2R3YA 3SU5A 2ZTXA 4ZXXH 2J2UA 4IN1A 1DUEA 3RLYH 1MZAA 3OY5U 4TY7A 1GHVH 2F9UA 1ETTH 2BLVA 3UUZA 1OP0A 3MYWA 3UY9A 2KAIB 3PLPA 2BD8A 3M7TA 1TMTH 5L6NH 1MKXK 5JPMH 4M7GA 4Y7BA 2TBSA 3SNEA 1FY1A 2XW9A 4H42U 2FOBA 2WPKS 3U8OH 3MH7A 1AUJA 4IGDA 1MBMA 1D3PB 2PR3A 3ZVDA 4TWWA 1WV7H 1PQ7A 4K1EA 2GCHF 1MAYA 3ZVBA 1UCYK 1LQEA 1PYTC 4FUBA 2XWBI 4ISOA 1C5SA 3DA9B 3ATIA 3QTOH 3NKKA 1S0QA 2F9OA 4B74A 2PFEA 4UFGH 5DG6A 1ESBA 2NU2E 5HM2A 3MU0A 1BZXE 4RN6A 1GI2A 5F8XA 4AOQA 3MU4A 3GY8A 4ESTE 3T5FH 1TALA 1SGYE 4ZUHA 1UK4A 2XBWA 2H1UA 1DXWA 1SLXB 1Z8JB 1P2MA 3NZIA 4NIWA 5PTPA 3UNSA 4KTUA 2QYIA 1TOCB 1JMOH 1P2JA 3CP7A 4O97A 1O2XA 2ZWLH 3BEUA 2V35A 1GHBF 4MPXA 4FUJA 5A8XA 1P01A 2AEIH 1N6YA 1TNKA 3LONA 2HNTF 2THFB 2VNTA 3GCHB 3MNBA 1AB9C 3PB1E 1EKBB 3RXAA 1L2EA 1XUJA 1O5CB 1GJDB 2QAAA 1DVAH 2RDLA 2XC0A 1SHYA 3SV8A 2AIQA 3M7UA 4MQAA 2H2ZA 1IQIA 2GCTB 1C5TA 1S81A 2GT7A 1GHXH 1NRPH 1PQAA 2WYGA 1BITA 1EAXA 2ZGCA 4NZQA 1GI7B 1CBWC 1OS8A 5DP3A 1CGHA 3U9AH 1UCYE 1W7XH 2VVUA 4E06H 3H7TA 1ARBA 2BVRH 2O8MA 1G3CA 5C2ZA 2FI4E 1K9OE 3CS7A 1NT1A 3P70B 1UVUH 1XVOA 2FS9A 2ZHQH 1B0FA 2ZTYA 1TRMA 4CREA 3QO6A 1ANBA 1GI6A 3BIVH 2G4TA 5DJ7A 1WCZA 4GLYA 2DUCA 2ZG0H 1RD3B 4WVPE 2R0KA 3MO9A 2ZHEH 1LDTT 2BY7X 2D8WA 1S0RA 1AO5A 1NRQH 2XCNA 3OTJE 4KGAA 3UWIA 1NZQH 1MU6B 3PTBA 1JRSA 3KQBA 4X1QU 3T28A 3ZZAA 1KTTB 3HATH 1DPOA 1QTFA 3MNXA 2M5TA 3IG6B 4X2XA 1HJAC 3L33A 3UQOA 1EAWA 2GV6A 1DDJA 1WU1A 1SBWA 2BZAA 4TY6A 1WTHD 4D8NA 2C90B 1VJ9U 4E7NA 2EEKA 5HM9A 2H9EH 3NPSA 4B73A 5FBIA 2AH4X 3S69A 5AHGH 4MNYA 2CF8H 1TB6H 3ZZ3A 1YM0A 3ATKA 4WH6A 3TH3H 2F83A 3PYHA 1GJ5H 1CA0C 1HDTH 3GCTG 3PMHB 1EP5A 4AB9A 3R3GB 3QX5H 3PLKA 1HAGE 1A4WH 1AKSB 5GDSH 4RKJB 4ABIA 3VB5A 2O8LA 4X2WA 3RUOA 1D6RA 3AVZA 1O2WA 4Y0ZE 1W3CA 1K1NA 1SMFE 1NM6A 2FP7B 4X8TH 1TPOA 2G5NA 2WPLS 2AMDA 3SUDA 1SL3A 5F03A 2UUFB 3SJOA 8KME2 1MTNB 2OC0A 1BMLA 1KDQB 2STBE 4JYUH 2BOHB 1AWHB 2O8UA 1CE5A 1DLKB 3NXPA 5DKMA 5FCRA 1QRWA 4WF8A 3O8DA 1E38B 3E91A 1GL1A 1H8IH 1L1GA 1K1PA 1PQ8A 1HAPH 1IAUA 2C8XB 7GCHG 1GMCG 5T6GA 5AVDA 2Z3CA 2PUXB 3QGJA 3GY2A 4O3UA 3SU4A 1DWEH 2AMPA 4ZMAH 1PPEE 3V3MA 2R2MB 2P59A 1HAXB 2VIVA 1O2LA 4B75A 4ABGA 3TIUA 2W26A 1NC6A 1ID5H 1SQOA 2Q6DA 2H5CA 4VGCB 1O2VA 3A84A 4Y76A 3RDZA 1UTMA 1C2DA 3L6PA 1TRNA 1TNHA 4WMDA 3SN8A 2ZCKP 3EE0B 1BMNH 5EXNA 1GJBB 9ESTA 1KXBA 3SNDA 3R0FA 3Q3YA 4KTCA 1MBQA 3SNAA 4E7RG 3F6UH 2ZGXH 4GVUA 2ZPQA 3UREA 3A7WA 2FOMB 2B0FA 3PM3A 1W2KH 2Z9JA 4AGKA 3GY4A 3AW0A 1HIAB 2SGDE 2ZIQH 4FUHA 2VGCC 1C4Y2 4MDSA 3HGNA 1LMWB 1O34A 1LVYA 2ZF0H 1UHBB 4NIYA 3BN9A 4ISNA 1GJ8B 2YNBA 2ZU4A 3ZVFA 4BTUB 2AFQB 1DM4B 2BHGA 4FXGH 1P8VC 2ZDVH 3PLBA 3RXTA 1E34B 1CQQA 1LCYA 3FZZA 1QCPA 2AGEX 3RXKA 1ZMNA 1LVBA 1QJ6B 3QDZB 1NS3A 2ZFSA 5A8ZA 3M3VA 1O5DH 1C2EA 5C5NA 1FUJA 1RJXB 3DUXH 1FN8A 4YT6H 3F9GA 1OOKB 4X6MA 4OS2A 2OD3B 4BAHB 5H4IB 3RM2H 1HUTH 1K21H 2ZFFH 1UTJA 3TJUA 4AG2A 1P9UA 3P95A 1Z8RA 4ABAA 1BRBE 2IJOB 1C1NA 1WOFA 4F49A 3FP6E 5A8YA 1V2QT 1ELVA 3SGAE 4ZKOU 1H1BA 5AFYH 1P0SH 1HAVA 1V2PT 2BB4A 1OWEA 3RXGA 1QHRB 2LNCA 3BTHE 1BOQA 3MU1A 2OC8A 4ZKNU 3ZV9A 4CRGA 3FFGA 4A5TS 4Q7XA 5A2MH 5I25A 4YTAA 2ZDAH 1GVZA 1CVWH 1HRTH 1BTYA 3KGPA 1SC8U 2NU1E 1TPAE 1AWFH 2FESH 4UEHH 2BLQA 1EZXC 2TGTA 4CH8B 2XBXA 1K1JA 1XUKA 2QA9E 3M3TA 4O03A 2BDIA 2F9PA 1QA0A 3EDXB 1H8DH 3QN7A 1C5MD 1YPKH 1L0ZA 4YLUA 1EX3A 4J1YA 1O2IA 4WXIA 3QZQA 1C1WH 5CHAC 1C2IA 1AB9B 3STJA 1GHAG 1TYNA 4OS5A 1QY6A 1O2UA 2PSXA 4NG9H 2FOEA 2BDBA 1S6FA 3D23A 1SFQB 1C5WB 2GX4A 1CGIE 3TVJB 2ANWA 1QBOA 1Y5BT 3Q76A 1XM1A 1JIRA 4ABFA 1HJ8A 3RU4D 1CBWB 5DO4H 4BAOB 2FI3E 1BJVA 1A5IA 1SFIA 1TOMH 1FJSA 1SGFA 1C5UA 1BTUA 2WUBA 1QB6A 2XCFA 1T7CA 4CRDA 2Z9GA 5B6OA 1C5LH 3TH4H 2NU3E 1ZLRA 1ZMLA 2OTVA 1L4ZA 1G32B 1C1MA 4BOHA 1MTWA 3KQEA 1P10A 2HLCA 1O30A 4JMYA 5ABWA 2BDGA 3ZZ7A 3RXMA 2BDCA 1O5FH 1GJ7B 2FXRA 1EASA 1UVTH 1YPEH 1ORFA 2ALPA 1G3EA 2JH5D 4ISHH 2WINI 3RXVA 1TRYA 3LT3A 3TK9A 3K9XB 1AU8A 1QGFA 1SVPA 3LC5A 1FDPA 3SJ9A 4X8VH 2GGVB 1SPJA 2BDAA 4BXSA 2VVCA 5JBBS 1C4V2 5E2PA 1NRNH 2P3FH 4A92A 2C3SA 3ZYDA 4I8LA 2JH0D 3FP7E 1TLDA 3TK5A 1D3DB 1GBFA 1UTPA 5TCCA 4FUGA 2VWNA 3I77A 4ABHA 1MD7A 1GCTC 2FOHA 3H5CB 4TPYA 1GBHA 3A8AA 1VR1H 5FCKA 3E8LA 2ODPA 1AVXA 2HPQH 1AKSA 6GCHF 1FXYA 1A3BH 2ZI2H 1ZSKA 4MLFB 1EPTC 2FPZA 2ZA5A 3E1XB 4K3JA 1XUFA 1N8OB 3HGPA 1C2KA 1GI1A 3BTQE 1HYLA 1C9PA 4YOIA 4K8BA 1KXDA 3M5LA 3RXRA 1IQKA 1BRAA 2CMYA 4GHQA 4YO9A 3GDUA 1MQ6A 1PJPA 1ELTA 1J15A 3A80A 3U8TH 1AFEH 4TWYA 3ZZ5A 3FZDA 2ZPRA 2J4IA 3A82A 3HK6B 4B71A 4NIXA 3QTVH 1EJMA 5J4SA 1FNIA 1Y3YA 3K6ZA 2FX6A 1S85A 1TNJA 2ZGHA 3SUFA 2P94A 1NRSH 5JB8S 2FIRH 1GWAA 3RXFA 4Y8YA 1YLCA 1ZMJA 1H9LB 1KLIH 1K1IA 3M36A 1GGDC 2G5VA 1F5LA 3RMLH 1W7GH 3PO1B 1FIZA 2P3UB 1QRZA 3SV6A 2SFAA 2O9QA 1VJAU 1HGTH 2HPPH 2OQUA 3RXUA 1OP8A 1AHTH 1JWTA 3AAVA 4ABJA 2WYJA 4NFEA 1NN6A 1QBNA 4ZXYH 3QWCH 3VGCB 1NFUA 1DOJA 2UWPA 4SGBE 2A7JA 3NUMA 2BTCE 1ZTLA 1GHBG 1VCWA 2J9NA 2V3OH 1GG6B 4FUCA 4OGYA 1HAIH 1HJ9A 1CA8B 1TIOA 1WQVH 1THRH 3TGJE 2VGCB 3Q3KA 1UK3A 3BF6H 1K1LA 1FY4A 1AFQB 2GZ8A 2FWWA 1UO6A 2ZHWH 4NA9H 1O2YA 4JCNA 2W7UA 5BPEA 1P2QA 5C1UA 1O5GH 1BJUA 1ELFA 4ZHAA 1DANH 1V2NT 1EAIA 4X1RU 1G9IE 1NTPA 3ATWA 3SJIA 2ZCHP 3FP8E 4X6NA 1WUNH 1O5BB 2GTBA 1ELGA 4OS4A 1O3MA 3I29A 4GCHG 3BTFE 4MPWA 3ATLA 1T32A 2H9TH 1GBJA 2ZDMA 1AY6H 1YPMH 4BAMB 1ARCA 1FZZA 3SI3H 2F9VA 1IOEA 1MKWK 1O5EH 1QL9A 5C1YA 1ZZZA 1PPFE 1SB1H 1WBGB 2CN0H 4DIIH 1O3IA 5EQRA 4GSOA 3EYDA 1EOJA 2UUYA 3A88A 1FONA 1DE7H 2ALVA 1O3PB 4X1NU 5JBTA 1OYQA 3SO3A 1GI3A 2FEQH 1GI8B 3RLWH 1TAWA 2PHBA 3VXFH 1G37A 2JETC 4X6PA 4BTIB 1YYY1 3SW2B 4WY3A 1OWIA 1FI8A 3N7OA 4Y6DA 2GKVE 1BTZA 1BBRH 1E36B 1YP9A 5EOKA 5TCAA 2PGQB 5CHAB 3SU1A 3TPIZ 1P2NA 2RA0A 1C1UH 2EI7A 2WPMS 4U32A 1G2MA 1GBDA 1FMGA 2P93A 2BY9X 5AFZH 2Z7FE 3BEFB 1XUHA 4Q80A 1O2OA 3A7TA 4ISIH 1B0EA 2R9PA 1C1SA 3AW1A 1ZTKA 1DICA 3F9EA 2ZDLA 1HAVB 3PWCA 1NU7B 3URCA 1HB0B 2BQ7B 1ZR0A
chains in the Genus database with same CATH superfamily
1Z8IB 2F3CE 2GZ7A 5FPYA 2OCVB 3W95A 4OS7A 2ZHDA 3G01A 1OWDA 2ZKSA 1A0LA 1J16A 1ZGIA 2KR7A 4XFQA 4MTBA 1K1MA 3GS9A 3ODFA 4Q7YA 1VZQH 1EB2A 2KCOA 1O3FA 4JZEH 3MO6A 2JH6D 1P2KA 3RXSA 1C2GA 2B9LA 5HMAA 3UWJH 1G2LA 1GL0E 2PUQH 4D7FA 3UIRA 1GMDF 1SR5C 1ZHMA 2FDAA 1XKBC 2OUAA 5EXMA 2GP9B 1VITF 5C3NA 5IYTA 5DP9A 1O33A 1TQ7B 7KMEH 5L30H 1J8AA 4ACAA 1YGCH 1YWUA 9LPRA 2V7QD 5T6FA 1EP6A 1Y5AT 2Y5GA 3BG4C 1BT7A 3MH5A 1BB0B 2A4GA 3TJVA 3CS0A 2C8WB 1OSSA 2Y5FA 1A1RA 1YCPH 1EZQA 4NZLA 3S0NA 1E0FD 2W6JD 1GCTB 2HVXA 3EA8A 5T3HA 3PMBB 1F7ZA 1PPCE 1E35B 2V3HH 3M5OA 1P09A 1Y5UT 2HOBA 1Q31A 3SHCH 5HKKD 1GI5A 2B7DH 3BTEE 1YY3A 3KQCA 1LHEH 4GPGA 1A3EH 1ELAA 4NIVA 2CF9H 3DFLA 4AZ2B 4ASHA 2A45B 3RMOH 2IPHA 2O8TA 1JBUH 4AB8A 4X1PU 4KP0A 2SGAA 3P92A 4CH2B 1CSOE 1Y3WA 1YPGH 2FI5E 2G51A 1IQEA 1ZPCA 1HAOH 1BMMH 1C1PA 1RTKA 1IQGA 2Z3DA 2H5DA 2Q6FA 1RTLA 3O8CA 4DGJA 3LU9B 1LPGB 3F2FA 5DP7A 1L4DA 1CHOG 2XC5A 1HLTH 1GGDB 1FAXA 1ABIH 4I32A 3DD2H 1FAKH 1W11U 4XBCA 1GBMA 3VB6A 2UUKB 2ZDKA 1TA2A 2K0QA 2A31A 4BANB 1O2PA 4THNH 3IITA 1SGTA 4NA7A 4Y79A 2VIQA 1INCA 3N99A 4GUXA 3SV2H 4BTTB 4MNXA 4ZKRU 1BDAA 2PKSB 3FAOA 3MI4A 3P6ZB 4CRFA 1W13U 2Z9LA 1P02A 1S84A 1V2JT 2XC4A 1GJ6A 5LH8A 8GCHG 5DP8A 4TPIZ 4YESB 3BTGE 4I7YH 2A2XH 2CHAB 1T4VH 2TGDA 4CRCA 1O3AA 4WMFA 1Y3XA 1GJAB 1UJ1A 4YZUA 5C5OA 2GDEH 1DSUA 4B2BA 1O2TA 4I33A 4GAWA 1YCPM 4FUDA 1RIWB 2Y81A 5DP5A 1F92A 3GICB 1IQFA 5IDKA 3UQVA 1EFRD 1RXPA 1D9IA 4FVBA 1UTKA 1YF4A 3BTKE 3TNTA 1G30B 2W7SA 1M9UA 2QV1A 1TFXA 1Y59T 4D9RA 5G4BA 2XNDD 2OLGA 4GHTA 4X1SU 4IBLH 4JK6A 5GPIB 1LHDH 4AFQA 1A5GH 4DOQA 1ESAA 1B5GH 1GPZA 1V2TT 4NSYA 1ZJDA 4YT7H 1O35A 2Z9KA 3MU5A 1QIXB 1H9IE 1ZHRA 1FY3A 1K0HA 2NWNA 1H8HD 2UWOA 4IMQA 2KCAA 2SGFE 3SU2A 1K2I1 1UTOA 3PV2A 1FN6A 2CV3A 4Y8XA 4JZ1A 3Q00A 4IC6A 2EQNA 2WV4A 3QZRA 5T6DA 4B76A 2L74A 1JOUB 2AIPA 1CT2E 3OEED 4X8UH 3PTNA 5E8EH 1V2OT 3VB7A 1EATA 4ZAEA 3RXLA 1TMBH 1D3TB 1QL8A 1UMAH 1SGIB 4CBNA 1GHYH 3HKJB 2A5AA 1LPZB 3RXOA 1SQTA 2ODYB 4ABDA 1BCUH 3GY7A 4ZROA 2JETB 5K0HA 2WV5A 2KX4A 3GCOA 1EJAA 3ZYEA 1A0HB 1E1RD 1FX0B 4Z6AH 5E2OA 3U1IB 2BLWA 2EA3A 4AORA 3H7OA 5EJ1A 1N1LA 4B2CA 2ZGJA 1WAYB 1YC0A 1ELEE 2OBOA 2J98A 2Q1JA 4FU8A 3AAUA 3U28C 3RXEA 3NCLA 1GJ9B 1HAZB 1MTSA 1KXFA 2BQ6B 1AZ8A 3ODDA 1QL7A 1SQAA 1E37B 2OXSA 2Z9IA 1RS0A 4BXWA 1MKWH 1O3OA 1RFNA 1NFWA 1TA6A 3A8BA 1IQHA 1O36A 1O3GA 2SGEE 2AS9A 1AQ7A 3GCTF 4SGAE 4WWYA 1Z8GA 3P8OA 1GBLA 5F53A 2QXJA 1K28D 1MKXH 1W0ZU 4U30A 4ZKSU 1WYKA 2VWOA 1MCVA 5HXFA 1C5YB 4Z0KA 2BYAX 1O3CA 2FLRH 5EGMA 1ELDE 4LOYH 2WPJS 1PPBH 1J9CH 4ISLA 3SI4H 3ZVEA 3A81A 1IQMA 1Z6JH 1UCYH 2PP6A 3UPEA 4U01A 1A46H 2PTNA 1TGCA 1THPB 5GCHF 1Y3VA 3WWFA 5LPEA 3RXPA 4FUFA 4I8HA 1P3EA 3ZV8A 1ZRBA 3M7QA 5A09A 7GCHF 1GMCF 3PROA 1IQJA 1SGCA 3NWUA 1K1OA 1HAHH 4ZCNA 1T8NA 5FBEA 2A5IA 7ESTE 3S7HB 1LHFH 4ABEA 1SSXA 1J17T 2ZP0H 3E6PH 2VWLA 5DP6A 1H8ED 3F9HA 4HI3A 2DE8A 1EPTA 2G52A 3PRBA 1SGNE 1LKBA 4RT0A 1C5RA 1O2KA 4NFFA 3NK8A 1QR3E 2PKAA 2ZFRH 2OC1A 4NGAH 3L3TA 1A2CH 5C1XA 1G36A 3E3TA 4AN7A 4OGXA 2QXIA 1O2HA 2Y6TA 4J2YB 5I46H 2A4RA 1NO9H 1GHWH 4CBOA 1P9SA 4FVDA 2BLOA 1KLJH 1GMHG 2ILNA 2P3TB 1SLWB 1C5QA 2J92A 2JJ2D 1C1RA 3LGTA 2FM2A 2A4QA 1AVGH 2Y7XA 3LGWA 3TNSA 3SBKA 3P8GA 1HJAB 3OX7U 2HNTC 2ZO3H 1PPGE 2A7CA 2F43B 2KZ4A 2Z94A 1XX9A 2C8YB 5F8TA 1AD8H 2OINA 4DG4A 4HZHA 6CHAC 4BAQB 4UONA 3T26A 1AN1E 2P8OC 4MNVA 1ETRH 1KTSB 3LPRA 3QK1A 1T31A 1CA0B 1D4PB 3KQDA 4LK4A 4XSKU 2QXHA 1FLEE 3BG8A 1LVOA 1SGPE 2RCEA 1O3BA 4FUEA 3T62A 2CJIA 5EXLA 1UTLM 1AVWA 2GZ9A 3WY8A 2PWXA 5DPAA 1DY9A 1TGSZ 1OWHA 2XWAA 3K6YA 5JDUB 1V6DA 2H6MA 4ZH8A 3UAIC 1QJ7B 2ANMH 4NCYA 3LOXA 5GIBA 4YOGA 2ZQ2A 2W5EA 2GCHG 3LIWA 4I31A 5A0BA 4KELA 2KFWA 4E05H 5CE1A 2J34A 2G81E 3NRLA 1F0UA 2QC2A 3ELAH 3ESTA 1V2UT 4TYDA 4AYVB 4ACBA 1F5RA 1KIGH 2EI6A 1C1VH 3D62A 3KF2A 2YMSC 5EPNA 3VXEH 3KL6A 5DP4A 3KIDU 4AX9H 5EW1H 1VCQA 2OP9A 4Q63A 1OPHB 1CO7E 4XE4A 5EJZA 4CHAC 1OWJA 1NBMD 3BV9B 1AE5A 2VIWA 1Z1JA 1O2ZA 4IW4E 1BMAA 2P95A 1BIOA 2XXLA 1TE0A 1NROH 5EODA 2GMTC 4K69A 3T29A 1TNGA 1KLTA 2FYRA 1YLDA 1GHAF 1DUAA 1W0JD 8LPRA 1C1TA 3M37A 3P17H 1GBKA 1A61H 1DFPA 2D2DA 2ZU3A 4JZDH 4X6OA 2F9BH 2FTLE 1AMHA 2BVSH 2FS8A 1NY22 2ZFTA 3SJ8A 1V2ST 3GDVA 1EQ9A 1EOLA 5L2ZH 1TX6A 1XXDA 2EI8A 2B5TB 1LQDB 3TJOA 3ZZ9A 1C5PA 3TGKE 3SUEA 1MTNC 1HV7A 1V2RT 1YPHC 1YLNA 2Z3EA 4WH8A 2VIOA 2EC9H 2BX3A 2IPQX 1P3CA 2F91A 4NWLA 2ZTZA 2I6SA 4CRAA 1QJ1B 3KNXA 1FY8E 2XTTB 4MPVA 1MABB 2BD9A 4AYYB 1OX1A 1O3KA 2QY0B 3A7XA 4IMZA 4DIHH 2BY6X 2L6OA 3A8CA 4INKA 1P2IA 3BSQA 1C4U2 1OKXA 5HIYA 1ZPBA 4OS1A 2R0LA 1EXFA 4AGJA 3A7ZA 3ZZCA 3W1EA 1QA7A 1AZZA 2KM0A 2WPHS 4A7IB 4QT8C 2DE9A 4R0IA 1BHXB 1TBQH 2D26C 4K8YA 2QIQA 3SNBA 4A1TA 2G4UA 3FO8D 3RU4T 4F4OC 1W12U 4MPUA 1FV9A 2AERH 4YOJA 3LGUA 2ZDNA 3M5NA 3TLOA 3B8JA 1GDUA 1SG8B 2BZ6H 1SOTA 1C2JA 3OY6U 1BTXA 2ZU5A 3LJOA 3DT0H 3Q77A 4ZHLU 5K7RA 1HCGA 1KXAA 1K22H 1P04A 1O38A 3LGYA 1EAUA 4WJG2 1GBIA 1VITH 4D76A 2WSSD 5J4QA 1BUIA 2W3IA 1SLVB 2A0QB 2GD4B 1GDNA 3HPTB 1MMJN 1EB1H 1FPHH 3MOCA 1ABJH 3FN8A 1OP2A 3SGBE 2TGPZ 1S6LA 3M3SA 1JIMA 3UFAA 2ZZUH 3ITIA 3GCNA 1W14U 2BX4A 2A1DB 3OE7D 3ZZBA 1HXFH 2RA3A 2A32A 3E0PB 1HXEH 1CGJE 4YLQH 4LXBH 5EQQA 3T25A 1SGDE 3S9BA 4JZIA 4X0WU 1WTGH 1HPGA 3EAJA 2Y80A 2C93B 3LGIA 3N7EA 1TMUH 1WDIA 4INLA 2BOKA 2J98B 1DLEA 4UFDH 1C2LA 3EA9A 1TNLA 1L1JA 1Z6EA 4RSPA 1NU9A 1MTUA 1QBVH 1MH0A 1HNEE 1KYNA 4TSFD 4H6SB 3PV4A 1GJCB 2V0BA 3BEIB 3E16B 1F5KU 3SHAH 1SGQE 5FPTA 1RTFB 2FYQA 3VB3A 1AUTC 2SGPE 3UNQA 2ZU1A 2C8ZB 5LPFA 1BA8B 1LKAA 1DWBH 3MMGA 2HALA 3A7YA 1GBTA 1UTQA 4DCDA 2VU8E 2BD7A 3ZZ8A 3CNRA 1PPZA 2FOAA 1D6WA 1C5VA 3SOSA 3V7TA 2UUJB 3ZVGA 2I6QA 5GXPA 3ZVCA 1DXPA 1QRXA 1O31A 1PQ5A 5SGAE 2J5UA 1QURH 1MTVA 1TABE 4P02A 2OK5A 1KY9A 1NESE 3W94A 3O8RA 3BIUH 3URDA 2VIDA 1Y8TA 1GCDA 1JRTA 4ZHMU 4A1VA 1V2MT 2LPRA 3TJNA 2IN2A 2C4FH 3LH1A 3ZZ6A 1GBAA 1GDQA 4I8GA 1A0JA 4FU7A 1W0YH 2ZPSA 1IHSH 3B23B 3SV7A 3SZEA 3ZZDA 1W10U 3MNCA 1XUIA 3RMNH 3SNCA 2QN5T 3GYLB 5DK1A 1C1OA 1HAYB 3TU7H 3KCGH 2EY4C 6CHAB 3Q3XA 1IHTH 2VH6A 2P8OB 1TPPA 1T8MA 1O5AB 1SGRE 1DY8A 1EPTB 5CMXH 4Q2KA 2ZFPH 4GCHF 1J14A 3LJJA 1LHCH 5FAHA 3UNRA 5TJXA 3RP2A 4XDEA 4I8KA 4O3TA 5F6MA 1AI8H 3SU3A 2PKAB 1ZSLA 3EGKH 4CR9A 3D49H 1C9TA 2BM2A 1ZYOA 1WXRA 4LZ4B 2CGAA 3KYFA 5GJ4B 2STAE 2A5KA 4HTCH 2PGBB 3RXQA 1OXGA 5EPYA 1GJ4H 1QZ8A 1O37A 5JBAS 5L2YH 4XD7D 3F0OA 4DURA 1WQSA 1SOZA 3RMMH 4CR5A 1MQ5A 3RXHA 2ZNKH 3SZNA 3T27A 2TIOA 2YMSB 1Y3UA 3A89A 4D9QA 4ABBA 4UFEH 3DSOA 4F55A 1DITH 1MZDA 3OSYA 4CHAB 1GHZA 3MH4A 1TONA 3MU8A 5F8ZA 3V12A 1C5NH 3E90B 2GMTB 5T1VA 4HGCA 3UTUH 5E0JA 2AYWA 3GISB 5CDFE 1P12E 1S82A 2VWMA 4Y7AA 1XUGA 4FETA 1XVMA 1O2SA 1O3HA 1H9HE 2BDHA 5C67A 5A0AE 4NA8A 2FZZA 4A6LA 1MAXA 1P03A 1B7XB 1N8OC 3MH6A 3TK6A 1FPCH 4JK5A 1ZGVA 1FY5A 1LVMA 2FMJA 1CHGA 3GDSA 1MU8B 1ESTA 1ANCA 1GI0A 3UOUA 1KSNA 2ZU2A 2VJ1A 2W3KA 4FU9A 3SU0A 2G00A 1THSH 3A7VA 3BTWE 3C1KA 2QE7D 2NU0E 1LO6A 2ANKH 1RRKA 3H09A 4Y11E 4LZ1H 2JJ1D 3TGIE 4I8JA 2BY8X 3EA7A 1DWCH 1QQUA 4AFUA 2R2WU 2VINA 1T4UH 2GVFA 5KECA 1X7AC 4Y0YE 2G55A 3UR9A 2HRVA 3MQKC 2UWLA 3BTDE 1GVKB 5GCHG 1C5ZB 7LPRA 3UOPA 4B6FA 3BTTE 1LPKB 1UVPA 2VVVA 2JIZD 1V2KT 3C27B 3MO3A 1KXCA 3P8NA 2ULLA 1O3NA 3PMJA 5C0UA 2BXTH 3OU0A 4K2YA 3STIA 3E0NB 1CT4E 3PO1C 4AFZA 4BAKB 1HFDA 1ELCA 2OQ5A 3MTYA 5JB9S 2QF0A 4NWKA 1ZSJA 4IC5A 1DWDH 2D1JA 1AGJA 2Z6BD 4NSVA 2TRMA 3VGCC 5LGOA 2ANYA 4B2AA 2Q6GA 4DY7B 2P16A 2FLBH 4PROA 2QGRA 4UE7H 1IQNA 2GV7A 1O2MA 3M61U 2WZQA 1GG6C 1EJNA 1TGTA 2KAIA 3IWMA 5C20A 5KEDA 1Z7KA 4K5ZA 4UFFH 1NRRH 1TX8A 3HK3B 3F1SB 5C17A 6ESTA 5A0CA 3PWBA 6LPRA 1VGCC 4MVNA 5EW2H 5BRRE 1P06A 3V13A 1ANEA 1AFQC 1SI5H 5FHTA 4JYVH 4JZFH 4AG1A 1QFKH 2GDDA 5ESTE 3K65B 1S6HA 1C5XB 1ANDA 3VFEA 4K1TA 1CT0E 2G8TA 3RXDA 4D7GA 1BBRK 3LKWA 1DSTA 1F0SA 2ESTE 1TBRH 4JYTA 2ASUB 2QCYA 4H6TA 4OS6A 4Q7ZA 6GCHG 3A85A 3TH2H 1JXPA 2BD5A 1C2FA 1P57B 2K8IA 1Z1IA 2V3MA 2AMQA 1DS2E 2B8OH 1BRUP 4BNRA 1OHHD 3VEQB 3U98H 4YM9A 1O3LA 1C2MA 1C5OH 2FOCA 4H4FA 1Q2WA 3AASA 4ASUD 2PLXA 1QQ4A 3GY6A 1DX5M 2QXGA 2ZQ1A 2ODQA 2XNIA 1A7SA 5DGJA 4AC9A 1CHOF 3ZIAD 1FQ3A 1O39A 3M5MA 2BY5X 3GOVB 1ETSH 4AFSA 1O3EA 3MFJA 5EU8A 2WHXA 3KHVA 2AGGX 3EQ0H 2ZHFH 1TNIA 2HNTE 1ZRKA 2BVXH 1C2HA 2Y5HA 3F9FA 3U8RH 1O2QA 1GI4A 2FO9A 2VB0A 1O2JA 3RU4E 1EUFA 4K60A 1YBWA 4XRNA 3SQEE 3DHKH 1MUEB 1F0TA 4DT7B 2A7HA 2PTCE 2FX4A 2OBQA 3GY5A 8GCHF 1UVSH 1IQLA 4X2VA 2XOKD 3BG4B 4Y10E 1P2OA 5JYIA 4KTSA 2FODA 1O3DA 1S5SA 1GBBA 3GY3A 3ENSB 3SV9A 5CHBA 2FTMA 3SU6A 3CENA 1MCTA 4WXVA 1EZSC 3FVFB 1YCPK 1TPSA 1BBRE 2A2QH 1A5HA 5AF9H 5E0HA 2BXUH 1Q3XA 1BRCE 3LGVA 1SHHB 1MD8A 3M35A 2HGTH 2TPIZ 2SGQE 2FOFA 1NFYA 2HWLB 4UD9H 3A86A 4XBBA 2YNAA 3JZ2B 4Y71A 2Y82A 3F3BA 3RXCA 4UDWH 3SQHE 3JZ1B 3WW7A 2ZECA 3ZVAA 1LTOA 3RM0H 2BD2A 2AGIX 1P05A 5FPSA 1TX7A 1TBZH 2ZC9H 4HG6A 1T8OA 1QNJA 2ZGBH 1F0RA 1H4WA 3GCHC 3MNSA 5FX5A 1SLUB 1L1NA 1UVOA 1V2VT 2ZEBA 5FXLA 1GVLA 1HBTH 2K1QA 2PW8H 3B9FH 1ELBA 3S9AA 3LDXH 3BTME 3RXBA 2WUCA 2GCTC 1O2NA 5EIYA 4U2WA 2SNVA 4P00A 5EQSA 1GI9B 3SYJA 3VPKA 2XBYA 2BDYA 1ZJKA 3OFND 1G3DA 5FX6A 1V2LT 1G3BA 3SORA 2OC7A 3QGNB 1NFXA 3O8BA 2CXVA 3V0XA 1C1QA 2F9NA 1D3QB 1YPHE 1TGBA 1OYTH 3MWIU 3SGQE 1O32A 3RC4A 3D65E 4X2YA 4WMEA 1UTNA 1PPHE 3KEEA 3OYPA 5JBCS 1AE8H 2BD4A 2VIPA 3FOAA 2NU4E 1ACBE 2KCPA 2O8WA 2V6NA 2IOTA 1ZHPA 2Y7ZA 3LH3A 3A8DA 1O2RA 3S7KB 4IS5A 1LHGH 1TWXB 1NBME 2R3UA 3U1JB 5HIZA 3RC6A 4HFPB 1AIXH 1TGNA 1GBEA 4MG3A 3UR6A 5C94A 1O0DH 2XBVA 1XKAC 5HYOA 3QLPH 1KDQA 1O3JA 1V2WT 2PSYA 4FUIA 2BMGB 2J94A 4Y8ZA 3ZZ4A 1TQ0B 3RXJA 3LC3A 1PFXC 3F0PA 1YKTA 3PMAB 4KKDA 3K2UA 3TITA 1W8BH 3GYMA 1WSSH 1V3XA 4RT1A 1XMNB 2GT8A 3DFJA 1BQYA 1FIWA 1UK2A 3HKIB 2SNWA 4K1SA 3P8FA 1QB9A 5LPRA 1S83A 4DVAU 1ZOMA 1U6QA 3S9CA 5E0GA 2YOLA 3VB4A 4CRBA 4B1TA 2BQWB 2ZFQH 3N7DA 1ZPZA 2JKHA 1P11E 4XOJA 4DJZB 3U69H 2XRCA 1CU1A 2VH0A 3RC5A 1QB1A 1VCPA 1XXFA 4INHA 1KXEA 1YPJH 2XYAA 2GJGA 2H9HA 3I78A 4IN2A 2RG3A 2ZCLP 2LP6A 2PKSC 1BTPA 3F68H 4Q4LA 1GMDG 4O9VA 2PV9B 1HIAA 2WPIS 1VITG 1Z71A 2J95A 1UW7A 1BTHH 1N6XA 1RGQA 3SJKA 1EZUC 2TGAA 3RXIA 4R8TB 2CHAC 1BTWA 3KN2A 1F2SE 4MNWA 1UHBA 3MHWU 1BHXF 4A1XA 3QUMP 3A83A 8ESTE 4XBDA 1VGCB 2QF3A 4DW2U 3ATMA 1SGFG 2A4OA 1ZTJA 1SGEE 5HGGA 1T8LA 1RIWC 5EG4A 3T2NA 2J38A 1GBCA 3SUGA 3FANA 5ESBA 4VGCC 5ETXA 1GMHF 2FOGA 5FL7D 1PYTD 3FKSD 4X8SH 1NPMA 1YPLH 1OWKA 3A87A 5GWZA 1DT2A 4RKOB 2BD3A 1O2GH 2R3YA 3SU5A 2ZTXA 4ZXXH 2J2UA 4IN1A 1DUEA 3RLYH 1MZAA 3OY5U 4TY7A 1GHVH 2F9UA 1ETTH 2BLVA 2WPDD 3UUZA 1OP0A 3MYWA 3UY9A 2KAIB 3PLPA 2BD8A 3M7TA 1TMTH 3F2HA 5L6NH 1MKXK 5JPMH 2JDID 4M7GA 4Y7BA 2TBSA 3SNEA 1FY1A 2XW9A 4H42U 2FOBA 2WPKS 3U8OH 3MH7A 1AUJA 4IGDA 1MBMA 1D3PB 2PR3A 3ZVDA 4TWWA 1WV7H 1PQ7A 4K1EA 2GCHF 1MAYA 3ZVBA 1UCYK 1LQEA 1PYTC 4FUBA 2XWBI 4ISOA 1C5SA 3DA9B 3ATIA 3QTOH 3NKKA 1S0QA 2F9OA 4B74A 2PFEA 4UFGH 5DG6A 1ESBA 2NU2E 5HM2A 1SKYE 3MU0A 1BZXE 4RN6A 1GI2A 5F8XA 4AOQA 2AHME 3MU4A 3GY8A 4ESTE 3T5FH 1TALA 1SGYE 4ZUHA 1UK4A 2XBWA 2H1UA 1DXWA 1SLXB 1Z8JB 1P2MA 3NZIA 4NIWA 5PTPA 3UNSA 4KTUA 2QYIA 1TOCB 1JMOH 1P2JA 3CP7A 4O97A 1O2XA 2ZWLH 3BEUA 2V35A 1GHBF 4MPXA 4FUJA 5A8XA 1P01A 2AEIH 1N6YA 1TNKA 3LONA 2HNTF 2THFB 2VNTA 3GCHB 3MNBA 1AB9C 3PB1E 1EKBB 3RXAA 1L2EA 1XUJA 1O5CB 1GJDB 2QAAA 3KQ5A 1DVAH 2RDLA 2XC0A 1SHYA 2HLDD 2J97A 2AIQA 3SV8A 3M7UA 4MQAA 2H2ZA 1IQIA 2GCTB 1C5TA 1S81A 2GT7A 1GHXH 1NRPH 1PQAA 2WYGA 1BITA 1EAXA 2ZGCA 4NZQA 1GI7B 1CBWC 1OS8A 5DP3A 1CGHA 3U9AH 1UCYE 1W7XH 2VVUA 4E06H 3H7TA 1ARBA 2BVRH 2O8MA 1G3CA 5C2ZA 3AK5A 2FI4E 1K9OE 3CS7A 1NT1A 3P70B 1UVUH 1XVOA 2FS9A 2ZHQH 1B0FA 2ZTYA 1TRMA 4CREA 3QO6A 1ANBA 1GI6A 3BIVH 2G4TA 5DJ7A 1WCZA 4GLYA 2DUCA 2ZG0H 1RD3B 1W0KD 4WVPE 2R0KA 3MO9A 2ZHEH 1LDTT 1KMHB 2BY7X 2D8WA 1S0RA 1AO5A 1NRQH 2XCNA 3OTJE 4KGAA 3UWIA 1NZQH 1MU6B 3PTBA 1JRSA 3KQBA 4X1QU 3T28A 3ZZAA 1KTTB 3HATH 1DPOA 1QTFA 3MNXA 2M5TA 3IG6B 4X2XA 1HJAC 3L33A 3UQOA 1EAWA 2GV6A 2VBCA 1DDJA 1WU1A 1SBWA 2BZAA 4TY6A 1WTHD 4D8NA 2C90B 1VJ9U 4E7NA 2EEKA 5HM9A 2H9EH 2LELA 3NPSA 4B73A 1E79D 5FBIA 2AH4X 3S69A 5AHGH 4MNYA 2CF8H 1TB6H 3ZZ3A 1YM0A 3ATKA 4WH6A 3TH3H 2F83A 3KYGA 3PYHA 1GJ5H 1CA0C 1HDTH 3GCTG 3PMHB 1EP5A 4AB9A 3R3GB 3QX5H 3PLKA 1HAGE 1A4WH 1AKSB 5GDSH 4RKJB 4ABIA 3VB5A 2O8LA 4X2WA 3RUOA 1D6RA 3AVZA 1O2WA 3DSPA 4Y0ZE 1W3CA 1K1NA 1SMFE 1NM6A 2FP7B 4X8TH 1TPOA 2G5NA 2WPLS 2AMDA 3SUDA 1SL3A 5F03A 2UUFB 2M2AA 3SJOA 8KME2 1MTNB 2OC0A 1BMLA 1KDQB 2STBE 4JYUH 2BOHB 1AWHB 2O8UA 1CE5A 2RDEA 1DLKB 3NXPA 5DKMA 5FCRA 1QRWA 4WF8A 3O8DA 1E38B 3E91A 1GL1A 1H8IH 1L1GA 1K1PA 1PQ8A 1HAPH 1IAUA 2C8XB 7GCHG 4DT4A 1GMCG 5T6GA 5AVDA 2Z3CA 2PUXB 3QGJA 3GY2A 4O3UA 3SU4A 1DWEH 2AMPA 4ZMAH 1PPEE 3V3MA 2R2MB 2RFKC 2W6ID 2P59A 1HAXB 4M9FA 4TT3D 2VIVA 1O2LA 4B75A 4ABGA 3TIUA 2W26A 1NC6A 1ID5H 1SQOA 2Q6DA 2H5CA 4VGCB 1O2VA 3A84A 4Y76A 3RDZA 1UTMA 1C2DA 3L6PA 1TRNA 1TNHA 4WMDA 3SN8A 2ZCKP 3EE0B 1BMNH 5EXNA 1GJBB 9ESTA 1KXBA 3SNDA 3R0FA 3Q3YA 4KTCA 1MBQA 3SNAA 2IJD1 4E7RG 3F6UH 2ZGXH 4GVUA 1E1QD 2ZPQA 3A7WA 2FOMB 2B0FA 3PM3A 3UREA 1W2KH 2Z9JA 4AGKA 3GY4A 3AW0A 1HIAB 2SGDE 2ZIQH 4FUHA 2VGCC 3OTPA 1C4Y2 4MDSA 3HGNA 1LMWB 1O34A 1LVYA 2ZF0H 1UHBB 4NIYA 3BN9A 4ISNA 1GJ8B 2YNBA 2ZU4A 3ZVFA 4BTUB 2AFQB 1DM4B 2BHGA 4FXGH 1P8VC 2ZDVH 3PLBA 3RXTA 1E34B 1CQQA 1LCYA 3FZZA 1QCPA 2AGEX 3RXKA 1ZMNA 1LVBA 1QJ6B 3QDZB 4F48B 1NS3A 2ZFSA 5A8ZA 3M3VA 1O5DH 1C2EA 5C5NA 1FUJA 1RJXB 3DUXH 1FN8A 4YT6H 3F9GA 1OOKB 4X6MA 5DSFA 4OS2A 2OD3B 4BAHB 5H4IB 3RM2H 1HUTH 1K21H 2ZFFH 1UTJA 3TJUA 4AG2A 1P9UA 3P95A 1Z8RA 4ABAA 1BRBE 2IJOB 1C1NA 1WOFA 4F49A 3FP6E 5A8YA 1V2QT 1ELVA 3SGAE 4ZKOU 1H1BA 5AFYH 1P0SH 2F4LA 1HAVA 1V2PT 2BB4A 1OWEA 3RXGA 1QHRB 2LNCA 3BTHE 1BOQA 1BMFD 3MU1A 2OC8A 4ZKNU 3ZV9A 4CRGA 5DN6D 3FFGA 4A5TS 4Q7XA 5A2MH 5I25A 4YTAA 2ZDAH 1GVZA 1CVWH 1HRTH 1BTYA 3KGPA 1SC8U 2NU1E 1TPAE 1AWFH 2FESH 4UEHH 2BLQA 1EZXC 2TGTA 4CH8B 2XBXA 1K1JA 1XUKA 2QA9E 3M3TA 4O03A 2BDIA 2F9PA 1QA0A 3EDXB 1H8DH 3QN7A 1C5MD 1YPKH 1L0ZA 4YLUA 1EX3A 4J1YA 1O2IA 4WXIA 3QZQA 1C1WH 5CHAC 1C2IA 1AB9B 3STJA 1GHAG 1TYNA 4OS5A 1QY6A 4B6EA 1O2UA 5EJLA 2PSXA 4NG9H 2FOEA 2BDBA 1S6FA 3D23A 1SFQB 1C5WB 2GX4A 1CGIE 3TVJB 2ANWA 3DCLA 1QBOA 1Y5BT 3Q76A 1XM1A 2CK3D 1JIRA 4ABFA 1HJ8A 3RU4D 1CBWB 5C0TA 5DO4H 4BAOB 2FI3E 1BJVA 1A5IA 1SFIA 1SQRA 1TOMH 1FJSA 1SGFA 1C5UA 1BTUA 2WUBA 1QB6A 2XCFA 3UB0A 1T7CA 4CRDA 2Z9GA 5B6OA 1C5LH 3TH4H 2NU3E 1ZLRA 1ZMLA 2OTVA 1L4ZA 1G32B 1C1MA 4BOHA 1MTWA 3KQEA 3EE7A 1P10A 2HLCA 1O30A 4JMYA 5ABWA 2BDGA 3ZZ7A 3RXMA 2BDCA 1O5FH 1GJ7B 2FXRA 1EASA 1UVTH 1YPEH 3PV5A 1ORFA 2ALPA 1G3EA 2JH5D 4ISHH 2WINI 3RXVA 4RI0A 1TRYA 3LT3A 3TK9A 3K9XB 1AU8A 1QGFA 1SVPA 3LC5A 1FDPA 3SJ9A 4X8VH 2GGVB 1SPJA 2BDAA 4BXSA 2VVCA 5JBBS 1C4V2 5E2PA 1NRNH 2P3FH 4A92A 2C3SA 3ZYDA 4I8LA 2JH0D 3FP7E 1TLDA 2YMSD 2KCYA 4Z1MD 3TK5A 1D3DB 1GBFA 1UTPA 4FOUC 5TCCA 4FUGA 2VWNA 3I77A 4ABHA 1MD7A 1GCTC 2FOHA 3H5CB 4TPYA 1GBHA 3A8AA 1VR1H 5FCKA 3E8LA 2ODPA 1AVXA 2HPQH 1AKSA 3OAAD 6GCHF 1FXYA 1A3BH 2ZI2H 1ZSKA 4MLFB 2HVYB 1EPTC 2FPZA 2ZA5A 3E1XB 4K3JA 1XUFA 1N8OB 3HGPA 1C2KA 3WWBA 1GI1A 3BTQE 1HYLA 1C9PA 4YOIA 4K8BA 1KXDA 3M5LA 3RXRA 1IQKA 1BRAA 2CMYA 4GHQA 1VKYA 4YO9A 3GDUA 1MQ6A 1PJPA 1ELTA 1J15A 3A80A 3U8TH 1AFEH 4TWYA 3ZZ5A 3FZDA 2ZPRA 2J4IA 3A82A 3HK6B 4B71A 4NIXA 3QTVH 1EJMA 5J4SA 1FNIA 1Y3YA 3K6ZA 2FX6A 1S85A 1TNJA 2ZGHA 3SUFA 2P94A 1NRSH 5JB8S 2FIRH 1GWAA 2QF4A 3RXFA 4Y8YA 1YLCA 1ZMJA 1H9LB 1KLIH 1K1IA 3F2GA 3M36A 1GGDC 2G5VA 1F5LA 3RMLH 1W7GH 3PO1B 1FIZA 2P3UB 1QRZA 3SV6A 2SFAA 2O9QA 1VJAU 1HGTH 2HPPH 2OQUA 3RXUA 1OP8A 1AHTH 1JWTA 3AAVA 4ABJA 2WYJA 4NFEA 1NN6A 1QBNA 4ZXYH 5IK2D 3QWCH 3VGCB 1NFUA 1DOJA 2UWPA 4SGBE 2A7JA 3NUMA 2BTCE 1ZTLA 1GHBG 1VCWA 2J9NA 2V3OH 1GG6B 4FUCA 4OGYA 1HAIH 1HJ9A 4I86A 1CA8B 1TIOA 1WQVH 3PRDA 1THRH 3TGJE 2VGCB 3Q3KA 5KGOA 1UK3A 3BF6H 1K1LA 1FY4A 1AFQB 2GZ8A 2FWWA 1UO6A 2ZHWH 4NA9H 1O2YA 4JCNA 2W7UA 5BPEA 1P2QA 5C1UA 1O5GH 1BJUA 1ELFA 4ZHAA 1DANH 1V2NT 1EAIA 4X1RU 1G9IE 2WV9A 1NTPA 3ATWA 5B6LA 3SJIA 2ZCHP 3FP8E 4X6NA 1WUNH 1O5BB 2GTBA 1ELGA 4OS4A 1O3MA 3I29A 5GNDA 4GCHG 3BTFE 4MPWA 3ATLA 1T32A 2H9TH 1GBJA 2ZDMA 1AY6H 1YPMH 4BAMB 1ARCA 1FZZA 3SI3H 2F9VA 1IOEA 1MKWK 1O5EH 1QL9A 5C1YA 1COWD 1ZZZA 1PPFE 1SB1H 1WBGB 2CN0H 4DIIH 3DSGA 1O3IA 5EQRA 4GSOA 3EYDA 1EOJA 2UUYA 3A88A 1FONA 1DE7H 2ALVA 1O3PB 4X1NU 3OEHD 5JBTA 1OYQA 3SO3A 1GI3A 2FEQH 1GI8B 3RLWH 1TAWA 2PHBA 3VXFH 1G37A 2JETC 4X6PA 4BTIB 1YYY1 3SW2B 4WY3A 1OWIA 1FI8A 3N7OA 4Y6DA 2GKVE 1BTZA 1BBRH 1E36B 1YP9A 5EOKA 5TCAA 2PGQB 5CHAB 4OM9A 3SU1A 3TPIZ 1P2NA 3VG8A 2RA0A 1C1UH 2EI7A 2WPMS 4U32A 1G2MA 1GBDA 1FMGA 2P93A 2BY9X 5AFZH 2QF5A 2Z7FE 3BEFB 1XUHA 4Q80A 1O2OA 3A7TA 4ISIH 1B0EA 2R9PA 1C1SA 3AW1A 1ZTKA 1DICA 3F9EA 2ZDLA 4YXWD 1HAVB 3PWCA 1NU7B 3URCA 1HB0B 2BQ7B 1ZR0A
chains in the Genus database with same CATH topology
1Z8IB 2F3CE 2GZ7A 5FPYA 2OCVB 3W95A 4OS7A 2ZHDA 3G01A 1OWDA 2ZKSA 1A0LA 1J16A 1ZGIA 4XFQA 4MTBA 1K1MA 3ODFA 4Q7YA 1VZQH 1EB2A 4JZEH 1O3FA 3MO6A 2JH6D 1P2KA 3RXSA 1C2GA 2B9LA 5HMAA 3UWJH 1G2LA 1GL0E 2PUQH 4D7FA 3UIRA 1GMDF 1SR5C 1ZHMA 2FDAA 1XKBC 2OUAA 5EXMA 2GP9B 1VITF 5C3NA 5IYTA 5DP9A 1O33A 1TQ7B 7KMEH 5L30H 1J8AA 1YGCH 9LPRA 5T6FA 1EP6A 1Y5AT 2Y5GA 3BG4C 1BT7A 3MH5A 1BB0B 2A4GA 3TJVA 3CS0A 2C8WB 1OSSA 2Y5FA 1A1RA 1YCPH 1EZQA 4NZLA 3S0NA 1E0FD 1GCTB 2HVXA 3EA8A 5T3HA 3PMBB 1F7ZA 1PPCE 1E35B 2V3HH 3M5OA 1P09A 1Y5UT 2HOBA 1Q31A 3SHCH 1GI5A 2B7DH 3BTEE 3KQCA 1LHEH 4GPGA 1A3EH 1ELAA 4NIVA 2CF9H 3DFLA 4AZ2B 4ASHA 2A45B 3RMOH 2IPHA 2O8TA 1JBUH 4AB8A 4X1PU 4KP0A 2SGAA 3P92A 4CH2B 1CSOE 1Y3WA 1YPGH 2FI5E 2G51A 1IQEA 1ZPCA 1HAOH 1BMMH 1C1PA 1RTKA 1IQGA 2Z3DA 2H5DA 2Q6FA 1RTLA 3O8CA 4DGJA 3LU9B 1LPGB 5DP7A 1L4DA 1CHOG 2XC5A 1HLTH 1GGDB 1FAXA 1ABIH 4I32A 3DD2H 1FAKH 1W11U 4XBCA 1GBMA 3VB6A 2UUKB 2ZDKA 1TA2A 2A31A 4BANB 1O2PA 4THNH 3IITA 1SGTA 4NA7A 4Y79A 2VIQA 1INCA 3SV2H 4GUXA 4BTTB 4MNXA 4ZKRU 1BDAA 2PKSB 3FAOA 3MI4A 3P6ZB 4CRFA 1W13U 2Z9LA 1P02A 1S84A 1V2JT 2XC4A 1GJ6A 5LH8A 8GCHG 5DP8A 4TPIZ 4YESB 3BTGE 4I7YH 2A2XH 2CHAB 1T4VH 2TGDA 4CRCA 1O3AA 4WMFA 1Y3XA 1GJAB 1UJ1A 4YZUA 5C5OA 2GDEH 1DSUA 4B2BA 1O2TA 4I33A 4GAWA 1YCPM 4FUDA 1RIWB 2Y81A 5DP5A 1F92A 3GICB 1IQFA 5IDKA 3UQVA 1RXPA 1D9IA 4FVBA 1UTKA 1YF4A 3BTKE 3TNTA 1G30B 2W7SA 1M9UA 2QV1A 1TFXA 1Y59T 4D9RA 5G4BA 2OLGA 4GHTA 4X1SU 4IBLH 4JK6A 5GPIB 1LHDH 4AFQA 1A5GH 4DOQA 1ESAA 1B5GH 1GPZA 1V2TT 4NSYA 1ZJDA 4YT7H 1O35A 2Z9KA 3MU5A 1QIXB 1H9IE 1ZHRA 1FY3A 2NWNA 2UWOA 4IMQA 2SGFE 3SU2A 1K2I1 1UTOA 1FN6A 2CV3A 4Y8XA 4JZ1A 3Q00A 4IC6A 2WV4A 3QZRA 4B76A 5T6DA 1JOUB 2AIPA 1CT2E 4X8UH 3PTNA 5E8EH 1V2OT 3VB7A 1EATA 4ZAEA 3RXLA 1TMBH 1D3TB 1QL8A 1UMAH 1SGIB 4CBNA 1GHYH 3HKJB 2A5AA 1LPZB 3RXOA 1SQTA 2ODYB 4ABDA 1BCUH 3GY7A 4ZROA 2JETB 5K0HA 2WV5A 3GCOA 1EJAA 3ZYEA 1A0HB 4Z6AH 5E2OA 3U1IB 2BLWA 2EA3A 4AORA 3H7OA 1N1LA 4B2CA 2ZGJA 1WAYB 1YC0A 1ELEE 2OBOA 2Q1JA 4FU8A 3AAUA 3RXEA 3NCLA 1GJ9B 1HAZB 1MTSA 1KXFA 2BQ6B 1AZ8A 3ODDA 1QL7A 1SQAA 1E37B 2OXSA 2Z9IA 1RS0A 4BXWA 1MKWH 1O3OA 1RFNA 1NFWA 1TA6A 3A8BA 1IQHA 1O36A 1O3GA 2SGEE 2AS9A 1AQ7A 3GCTF 4SGAE 4WWYA 1Z8GA 3P8OA 1GBLA 2QXJA 1K28D 1MKXH 1W0ZU 4U30A 4ZKSU 1WYKA 2VWOA 1MCVA 5HXFA 1C5YB 4Z0KA 2BYAX 1O3CA 2FLRH 5EGMA 1ELDE 4LOYH 2WPJS 1PPBH 1J9CH 4ISLA 3SI4H 3ZVEA 3A81A 1IQMA 1Z6JH 1UCYH 3UPEA 4U01A 1A46H 2PTNA 1TGCA 1THPB 5GCHF 1Y3VA 5LPEA 3RXPA 4FUFA 4I8HA 1P3EA 3ZV8A 1ZRBA 3M7QA 5A09A 7GCHF 1GMCF 3PROA 1IQJA 1SGCA 3NWUA 1K1OA 1HAHH 1T8NA 5FBEA 2A5IA 7ESTE 3S7HB 1LHFH 4ABEA 1SSXA 1J17T 2ZP0H 3E6PH 2VWLA 5DP6A 3F9HA 4HI3A 2DE8A 1EPTA 2G52A 1SGNE 1LKBA 1C5RA 1O2KA 4NFFA 3NK8A 1QR3E 2PKAA 2ZFRH 2OC1A 4NGAH 3L3TA 1A2CH 5C1XA 1G36A 3E3TA 4AN7A 4OGXA 2QXIA 1O2HA 2Y6TA 4J2YB 5I46H 2A4RA 1NO9H 1GHWH 4CBOA 1P9SA 4FVDA 2BLOA 1KLJH 1GMHG 2ILNA 2P3TB 1SLWB 1C5QA 2J92A 1C1RA 3LGTA 2FM2A 2A4QA 1AVGH 2Y7XA 3LGWA 3TNSA 3SBKA 3P8GA 1HJAB 3OX7U 2HNTC 2ZO3H 1PPGE 2A7CA 2Z94A 1XX9A 2C8YB 5F8TA 1AD8H 2OINA 4DG4A 4HZHA 6CHAC 4BAQB 4UONA 3T26A 1AN1E 2P8OC 4MNVA 1ETRH 1KTSB 3LPRA 3QK1A 1T31A 1CA0B 1D4PB 3KQDA 4LK4A 4XSKU 2QXHA 1FLEE 3BG8A 1LVOA 1SGPE 2RCEA 1O3BA 4FUEA 3T62A 2CJIA 5EXLA 1UTLM 1AVWA 2GZ9A 3WY8A 2PWXA 5DPAA 1DY9A 1TGSZ 1OWHA 2XWAA 3K6YA 5JDUB 1V6DA 2H6MA 4ZH8A 1QJ7B 2ANMH 4NCYA 3LOXA 5GIBA 4YOGA 2ZQ2A 2W5EA 2GCHG 3LIWA 4I31A 5A0BA 4KELA 4E05H 5CE1A 2J34A 2G81E 1F0UA 2QC2A 3ELAH 3ESTA 1V2UT 4TYDA 4AYVB 1F5RA 1KIGH 2EI6A 1C1VH 3D62A 3KF2A 5EPNA 3VXEH 3KL6A 5DP4A 3KIDU 4AX9H 5EW1H 1VCQA 2OP9A 1OPHB 1CO7E 4XE4A 4CHAC 1OWJA 3BV9B 1AE5A 2VIWA 1Z1JA 1O2ZA 4IW4E 1BMAA 2P95A 1BIOA 2XXLA 1TE0A 1NROH 5EODA 2GMTC 4K69A 3T29A 1TNGA 1KLTA 2FYRA 1YLDA 1GHAF 1DUAA 8LPRA 1C1TA 3M37A 3P17H 1GBKA 1A61H 1DFPA 2D2DA 2ZU3A 4JZDH 4X6OA 2F9BH 2FTLE 1AMHA 2BVSH 2FS8A 1NY22 2ZFTA 3SJ8A 1V2ST 3GDVA 1EQ9A 1EOLA 5L2ZH 1TX6A 1XXDA 2EI8A 2B5TB 1LQDB 3TJOA 3ZZ9A 1C5PA 3TGKE 3SUEA 1MTNC 1HV7A 1V2RT 1YPHC 2Z3EA 4WH8A 2VIOA 2EC9H 2BX3A 4NWLA 1P3CA 2F91A 2ZTZA 2I6SA 4CRAA 1QJ1B 3KNXA 1FY8E 2XTTB 4MPVA 2BD9A 4AYYB 1OX1A 1O3KA 2QY0B 3A7XA 4IMZA 4DIHH 2BY6X 3A8CA 4INKA 1P2IA 3BSQA 1C4U2 1OKXA 1ZPBA 4OS1A 2R0LA 1EXFA 4AGJA 3A7ZA 3ZZCA 1QA7A 1AZZA 2WPHS 4A7IB 4QT8C 2DE9A 4R0IA 1BHXB 1TBQH 2D26C 4K8YA 2QIQA 3SNBA 4A1TA 2G4UA 3RU4T 4F4OC 1W12U 4MPUA 1FV9A 2AERH 4YOJA 3LGUA 2ZDNA 3M5NA 3TLOA 3B8JA 1GDUA 1SG8B 2BZ6H 1SOTA 1C2JA 3OY6U 1BTXA 2ZU5A 3LJOA 3DT0H 3Q77A 4ZHLU 5K7RA 1HCGA 1KXAA 1K22H 1P04A 1O38A 3LGYA 1EAUA 4WJG2 1GBIA 1VITH 4D76A 5J4QA 1BUIA 2W3IA 1SLVB 2A0QB 2GD4B 1GDNA 3HPTB 1MMJN 1EB1H 1FPHH 3MOCA 1ABJH 1OP2A 3SGBE 2TGPZ 3M3SA 1JIMA 3UFAA 2ZZUH 3ITIA 3GCNA 1W14U 2BX4A 2A1DB 3ZZBA 1HXFH 2RA3A 2A32A 3E0PB 1HXEH 1CGJE 4YLQH 4LXBH 5EQQA 3T25A 1SGDE 3S9BA 4JZIA 4X0WU 1WTGH 1HPGA 3EAJA 2Y80A 2C93B 3LGIA 1TMUH 4INLA 2BOKA 1DLEA 4UFDH 1C2LA 3EA9A 1TNLA 1L1JA 1Z6EA 4RSPA 1NU9A 1MTUA 1QBVH 1MH0A 1HNEE 1KYNA 4H6SB 3PV4A 1GJCB 2V0BA 3BEIB 3E16B 1F5KU 3SHAH 1SGQE 5FPTA 1RTFB 2FYQA 3VB3A 1AUTC 2SGPE 3UNQA 2ZU1A 2C8ZB 5LPFA 1BA8B 1LKAA 1DWBH 3MMGA 2HALA 3A7YA 1GBTA 1UTQA 4DCDA 2VU8E 2BD7A 3ZZ8A 1PPZA 2FOAA 1D6WA 1C5VA 3SOSA 3V7TA 2UUJB 3ZVGA 2I6QA 5GXPA 3ZVCA 1DXPA 1QRXA 1O31A 1PQ5A 5SGAE 1QURH 1MTVA 1TABE 1KY9A 1NESE 3W94A 3O8RA 3BIUH 3URDA 2VIDA 1Y8TA 1GCDA 1JRTA 4ZHMU 4A1VA 1V2MT 2LPRA 3TJNA 2IN2A 2C4FH 3LH1A 3ZZ6A 1GBAA 1GDQA 4I8GA 1A0JA 4FU7A 1W0YH 2ZPSA 1IHSH 3B23B 3SV7A 3ZZDA 1W10U 3MNCA 1XUIA 3RMNH 3SNCA 2QN5T 3GYLB 5DK1A 1C1OA 1HAYB 3TU7H 3KCGH 6CHAB 3Q3XA 1IHTH 2VH6A 2P8OB 1TPPA 1T8MA 1O5AB 1SGRE 1DY8A 1EPTB 5CMXH 4Q2KA 2ZFPH 4GCHF 1J14A 3LJJA 1LHCH 5FAHA 3UNRA 5TJXA 3RP2A 4XDEA 4I8KA 4O3TA 5F6MA 1AI8H 3SU3A 2PKAB 1ZSLA 3EGKH 4CR9A 3D49H 1C9TA 2BM2A 1ZYOA 4LZ4B 2CGAA 5GJ4B 2STAE 2A5KA 4HTCH 2PGBB 3RXQA 1OXGA 5EPYA 1GJ4H 1O37A 5JBAS 5L2YH 4DURA 1WQSA 1SOZA 3RMMH 4CR5A 1MQ5A 3RXHA 2ZNKH 3SZNA 3T27A 2TIOA 1Y3UA 3A89A 4D9QA 4ABBA 4UFEH 1DITH 1MZDA 3OSYA 4CHAB 1GHZA 3MH4A 1TONA 3MU8A 5F8ZA 3V12A 1C5NH 3E90B 2GMTB 3UTUH 4HGCA 5E0JA 2AYWA 3GISB 1P12E 1S82A 2VWMA 4Y7AA 1XUGA 1XVMA 1O2SA 1O3HA 1H9HE 2BDHA 5C67A 5A0AE 4NA8A 2FZZA 4A6LA 1MAXA 1P03A 1B7XB 1N8OC 3MH6A 3TK6A 1FPCH 4JK5A 1ZGVA 1FY5A 1LVMA 2FMJA 1CHGA 3GDSA 1MU8B 1ESTA 1ANCA 1GI0A 3UOUA 1KSNA 2ZU2A 2VJ1A 2W3KA 4FU9A 3SU0A 2G00A 1THSH 3A7VA 3BTWE 3C1KA 2NU0E 1LO6A 2ANKH 1RRKA 4Y11E 4LZ1H 3TGIE 4I8JA 2BY8X 3EA7A 1DWCH 1QQUA 4AFUA 2R2WU 2VINA 1T4UH 2GVFA 1X7AC 4Y0YE 2G55A 3UR9A 2HRVA 2UWLA 3BTDE 1GVKB 5GCHG 1C5ZB 7LPRA 3UOPA 3BTTE 1LPKB 1UVPA 2VVVA 1V2KT 3C27B 3MO3A 1KXCA 3P8NA 2ULLA 1O3NA 3PMJA 2BXTH 3OU0A 4K2YA 3STIA 3E0NB 1CT4E 3PO1C 4AFZA 4BAKB 1HFDA 1ELCA 2OQ5A 3MTYA 5JB9S 2QF0A 4NWKA 1ZSJA 4IC5A 1DWDH 2D1JA 1AGJA 2Z6BD 4NSVA 2TRMA 3VGCC 5LGOA 2ANYA 4B2AA 2Q6GA 4DY7B 2P16A 2FLBH 4PROA 2QGRA 4UE7H 1IQNA 2GV7A 1O2MA 3M61U 1GG6C 1EJNA 1TGTA 2KAIA 3IWMA 5C20A 1Z7KA 4K5ZA 4UFFH 1NRRH 1TX8A 3HK3B 3F1SB 6ESTA 5A0CA 3PWBA 6LPRA 1VGCC 4MVNA 5EW2H 5BRRE 1P06A 3V13A 1ANEA 1AFQC 1SI5H 5FHTA 4JYVH 4JZFH 4AG1A 1QFKH 2GDDA 5ESTE 3K65B 1S6HA 1C5XB 1ANDA 3VFEA 4K1TA 1CT0E 2G8TA 3RXDA 4D7GA 1BBRK 3LKWA 1DSTA 1F0SA 2ESTE 1TBRH 4JYTA 2ASUB 2QCYA 4H6TA 4OS6A 4Q7ZA 6GCHG 3A85A 3TH2H 1JXPA 2BD5A 1C2FA 1P57B 1Z1IA 2AMQA 1DS2E 2B8OH 1BRUP 4BNRA 3VEQB 3U98H 4YM9A 1O3LA 1C2MA 1C5OH 2FOCA 4H4FA 1Q2WA 3AASA 2PLXA 1QQ4A 3GY6A 1DX5M 2QXGA 2ZQ1A 2ODQA 2XNIA 1A7SA 5DGJA 1CHOF 1FQ3A 1O39A 3M5MA 2BY5X 3GOVB 1ETSH 4AFSA 1O3EA 3MFJA 5EU8A 3KHVA 2AGGX 3EQ0H 2ZHFH 1TNIA 2HNTE 1ZRKA 2BVXH 1C2HA 2Y5HA 3F9FA 3U8RH 1O2QA 1GI4A 2FO9A 2VB0A 1O2JA 3RU4E 1EUFA 4K60A 1YBWA 3SQEE 3DHKH 1MUEB 1F0TA 4DT7B 2A7HA 2PTCE 2FX4A 2OBQA 3GY5A 8GCHF 1UVSH 1IQLA 4X2VA 3BG4B 4Y10E 1P2OA 5JYIA 4KTSA 2FODA 1O3DA 1S5SA 1GBBA 3GY3A 3ENSB 3SV9A 2FTMA 3SU6A 3CENA 1MCTA 4WXVA 1EZSC 3FVFB 1YCPK 1TPSA 1BBRE 2A2QH 1A5HA 5AF9H 5E0HA 2BXUH 1Q3XA