2OC1A

Structure of the hcv ns3/4a protease inhibitor cvs4819
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Hepatitis C virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 46
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oc1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oc1A01
1Z1IA 3GCTF 1PJPA 4TPYA 2ESTE 4AGJA 1GHAF 3T25A 1O2QA 1K28D 3M7QA 1Z8GA 1A5IA 1P57B 3LGYA 1S85A 5CHAC 1C5VA 2ZGBH 1FPHH 2BMGB 1RXPA 3E16B 3ODDA 3FAOA 2CV3A 1A4WH 1GJ5H 3KQCA 1MTWA 3K9XB 1GI6A 3PB1E 5GCHG 4ZMAH 7KMEH 3MOCA 1FY5A 1AE5A 1TBZH 1ZSKA 2H2ZA 2FTLE 3ATIA 3PYHA 2UWLA 4A6LA 3P8OA 4WWYA 4U2WA 4CRAA 2SGDE 3C1KA 8ESTE 1GMDG 2AH4X 1Z71A 1NM6A 3U8RH 5AF9H 4IS5A 4ISNA 2ZPQA 1JXPA 1DWDH 1SOZA 1SGYE 1XM1A 2BB4A 4KELA 1C2DA 2GZ7A 4WXVA 5EXLA 2PHBA 1ZPZA 4D9QA 1MH0A 2P16A 2H1UA 2GT7A 2A0QB 3KQDA 5F6MA 5F8ZA 1UJ1A 3U1IB 2J95A 3ATMA 1C4V2 1DSUA 2C4FH 2J38A 3MNCA 3ZVFA 1Y3VA 1EZXC 3BG4C 3O8BA 2BY5X 1C2MA 2ZECA 3M37A 1PPGE 1T8MA 2WUBA 1SLWB 1LPZB 1XKAC 4BXWA 2WINI 3SNBA 1ETRH 2PSXA 4MPVA 5EG4A 2XBWA 1O37A 3ZVBA 3QGJA 1ABJH 2EA3A 4Q7ZA 2PGQB 2FEQH 2XC5A 4K1SA 4Y79A 3LPRA 3MTYA 1IQEA 1G2LA 1IQGA 1EPTB 4O03A 6CHAC 1ELCA 1T8LA 4D9RA 1UTOA 1SSXA 3EGKH 3LKWA 1EX3A 1WV7H 3LOXA 2F9PA 4Z0KA 3A86A 1K21H 1Z6EA 1BCUH 1TMTH 4X6NA 2PKSC 3Q3YA 1OX1A 1FY8E 1UTQA 1AMHA 1O3FA 2CN0H 3HATH 3QLPH 2FOAA 3BTKE 1P3EA 1Y3XA 3TJNA 1DT2A 3VGCB 4BOHA 4X1QU 1L2EA 2QF3A 2BQ6B 3FFGA 1PYTD 2C8XB 1TMBH 1AUJA 1TPSA 4UFDH 3MH5A 3UNRA 1JMOH 4LZ4B 4K3JA 3QWCH 1EQ9A 3GY8A 1SG8B 2R9PA 3UREA 5E0JA 3VFEA 2P59A 1ETSH 3A7TA 4CR5A 1BITA 2BD3A 1G2MA 3BEIB 1WU1A 2FPZA 1TBQH 1TE0A 5C3NA 1GBJA 1O3EA 2BOHB 2ZHWH 1TNGA 3BEUA 4O3TA 3TK9A 5HMAA 5K0HA 3TK5A 2ODPA 1ZSLA 5B6OA 1O2IA 1C5MD 1P01A 2ZNKH 1PPCE 2EC9H 4ESTE 4FUDA 1VCWA 2HVXA 3HGPA 3DD2H 1C1PA 1CHOF 2KAIA 1UCYH 1ZTKA 1S0RA 1T32A 1GHXH 4MPWA 2F4LA 1EASA 1GMDF 2ZFPH 4INKA 3GY3A 4F49A 1MQ5A 1ELVA 3U8OH 1GI8B 1HPGA 4YOJA 1NFXA 2OC8A 5G4BA 4OS4A 1LHDH 1HYLA 2GCTB 1B7XB 2C90B 1YLDA 1BBRH 1UK3A 2BDYA 3UNQA 3ZZ6A 1FXYA 2A4OA 1N1LA 1CT0E 4QT8C 4X1SU 4AORA 2A5IA 1ZTJA 3U69H 1SI5H 1H9HE 4MNYA 4UFGH 2Q1JA 1PQ8A 1PPFE 3FP7E 2VWNA 4BAQB 3L3TA 4GCHF 1AUTC 2M5TA 4DURA 5EODA 3SGAE 1AO5A 1JRSA 5AHGH 1DITH 2NU2E 4K60A 1EJMA 3SHCH 1UTPA 1DE7H 1GBBA 5DP5A 1P10A 1DICA 3U8TH 1SFQB 3M61U 3OSYA 5JBAS 2G5NA 2H9EH 4DY7B 2ZGJA 1MCVA 1CGJE 1S6HA 3ODFA 4A1XA 2ZZUH 3PM3A 3MU0A 3ELAH 1DSTA 3PO1B 2VWMA 3CS7A 4Y8YA 5T6DA 3VB7A 1ZJKA 2BDHA 2VINA 2PR3A 5LPRA 3C27B 4K8BA 4AG1A 4FUHA 2XW9A 1ELDE 3RLYH 1X7AC 1THPB 4CH8B 1S0QA 2O8TA 2WPKS 1ELTA 1K2I1 3DA9B 2FDAA 2VBCA 4FVDA 4E7NA 2WPLS 2ZCLP 4ZHAA 1QRXA 1RRKA 1SLVB 2SNVA 2QXHA 1JRTA 1KLTA 1RTFB 4B2CA 1PQ5A 3E3TA 2WYGA 1AGJA 1ARCA 1T4UH 1UO6A 3Q3KA 1FQ3A 3GDUA 2TGPZ 3F9GA 5J4SA 1F2SE 4MG3A 1SLUB 1W0YH 2XWBI 3GY4A 3SQEE 1V2ST 5HM2A 1B0EA 1P02A 1PYTC 1ABIH 3RXEA 3N7OA 1MD8A 1VCPA 1BT7A 1RJXB 5CHAB 1C5QA 4FUJA 3S69A 3SZNA 1DLEA 3ATLA 1UTJA 1YCPM 1QY6A 1A3EH 2ZA5A 5F03A 5BRRE 1Q2WA 5GPIB 1HAOH 2UUKB 1O2JA 4UE7H 1SOTA 4SGAE 5EGMA 1BTUA 1GBEA 5TJXA 8LPRA 1OWJA 1TGSZ 3MNSA 1NFYA 1KDQA 2BDGA 2FOBA 1BRBE 4NA7A 3TJOA 1ORFA 4ABGA 3ZZBA 1ESAA 3SV8A 2TGDA 3IITA 1XUGA 1EXFA 2ZDKA 1AFQB 2FI3E 3F9HA 3E0PB 4LXBH 1GL0E 3AW0A 2Y5FA 3RXJA 1HAVA 1YM0A 3HGNA 4X2XA 1O3BA 1XXFA 3NZIA 1BDAA 1GBTA 4HTCH 1BJVA 1DOJA 2Y80A 3URDA 3RMLH 2BX4A 4Y10E 1AVGH 1UTLM 3IG6B 4GPGA 3EAJA 1AIXH 1LVYA 3SN8A 1C1MA 2C93B 3SI3H 1GI7B 3ZZ4A 1YKTA 3A7VA 2HPQH 4KGAA 1S81A 3BG4B 4ABJA 4PROA 1ELEE 4M7GA 4XBCA 5E2OA 5C20A 7ESTE 1TFXA 1MZDA 4Y7BA 2ULLA 4ZHLU 1Q3XA 2PUQH 4Y8ZA 5JYIA 2GTBA 3SV7A 2KAIB 5E0GA 1GI1A 1QA7A 2B9LA 2G4TA 3F6UH 3RXAA 2W7SA 2OTVA 3P8FA 4UEHH 1TOMH 3ZVCA 2QC2A 1NU9A 2PLXA 1GG6B 5JDUB 1SGFA 1IQMA 1C5PA 1CVWH 1D4PB 2FYRA 2AIPA 2V0BA 2BDIA 3T62A 1A5GH 2C8WB 6CHAB 4H6SB 1C5NH 2FOHA 3OU0A 4MTBA 1O3PB 2BD4A 2OD3B 9LPRA 1SPJA 2IN2A 1GI2A 2W3KA 1FAKH 2PTNA 1C1TA 2P93A 2O8LA 2J34A 3SBKA 3GCNA 3LJJA 3RDZA 1FIWA 2RDLA 3M5LA 3RXBA 1V2UT 4UDWH 4X2YA 1AB9B 1MKXK 1BMNH 2R0LA 1LKAA 3SNDA 1SQOA 4NSVA 3ZZ8A 2ZPSA 1SVPA 2CF9H 3BTME 1WTHD 4GLYA 5FPTA 5FBEA 2VIWA 1CBWC 5ABWA 2XCFA 5DJ7A 5T6FA 4AFUA 1LDTT 4D8NA 1C2IA 1BTHH 2AERH 4AX9H 1WQVH 3ATKA 1BTXA 1GBMA 1GBCA 1MU8B 1SBWA 2OBOA 4MQAA 2ZQ2A 2A31A 3BTDE 1OWHA 1RS0A 1O3KA 1GHWH 1CA8B 1GHYH 1TGBA 3O8RA 1XMNB 1P9SA 1TPPA 2ASUB 2Z9IA 2XTTB 3M3TA 4K1EA 4JMYA 3RMOH 1BHXB 2B7DH 2VIOA 4YT6H 2D26C 1RFNA 1GJAB 3KL6A 2JH5D 1MTUA 2HOBA 2NU0E 1OP8A 1TNKA 2NWNA 1ESTA 2VGCC 4A7IB 2EI8A 1KXAA 2ANMH 4HGCA 1W8BH 4OGXA 4YZUA 3ZVAA 4FU9A 3BTTE 5ETXA 2ALPA 1C2FA 1EZSC 4AFZA 5H4IB 1HIAA 5GDSH 1Z1JA 1O2PA 1ZPBA 3A89A 2CHAC 1QR3E 1ZRBA 2OC7A 5LPFA 1NPMA 1LHGH 1DVAH 4YLQH 2ZFRH 1HAZB 2ZFSA 2BLWA 3MH7A 1YYY1 2GP9B 2BM2A 1GPZA 3ZV9A 1P04A 1N8OB 1S5SA 1H9LB 4B1TA 1H8DH 5C5NA 1W7XH 1EAXA 2V3HH 1P05A 1V2PT 1BTZA 1ZMNA 1W10U 1FUJA 1NFUA 5F8TA 4RSPA 1C4U2 1DDJA 2ZIQH 3AK5A 3GOVB 1MBMA 3RXFA 3NKKA 3SU6A 3RM0H 2QN5T 4YOGA 1EP6A 2STAE 1C2HA 2BYAX 2A2QH 1JBUH 3T29A 4J1YA 2XC0A 2G52A 5A8YA 2BD9A 3A7ZA 2ZTZA 2ILNA 1O3GA 4NZLA 3W94A 1AHTH 3SJ8A 3UFAA 2AEIH 4ISLA 1P9UA 2QXGA 3ZZCA 1C5WB 2EI7A 2Z3CA 3GY2A 1MTNC 4FUBA 4ASHA 2OP9A 4IW4E 3B9FH 1QIXB 5FHTA 3PTNA 5DP8A 1VR1H 1K1PA 2G81E 4CRFA 1P2QA 4RKJB 4A1TA 4IN2A 3L6PA 1O3HA 1GWAA 1SB1H 5CE1A 1ZZZA 3V12A 3UQVA 3QN7A 1VITH 1ETTH 2ZDVH 4BAKB 2JH6D 1MTSA 2FODA 3PMAB 3V3MA 4DW2U 1W7GH 1PPHE 4B71A 3RXCA 1QTFA 1VGCB 2A7HA 1P3CA 2BXTH 1QRWA 3P8NA 2BX3A 3OY6U 3NWUA 2GX4A 3GCHC 1C5ZB 1HAYB 2W5EA 3KNXA 1GHVH 3GCOA 1TQ0B 1FN6A 1WOFA 1VITF 2HALA 1F92A 4YLUA 1MZAA 2I6QA 4I8KA 2VIDA 2HLCA 2C3SA 3A8AA 1FNIA 1F7ZA 1SL3A 1Y3YA 4DCDA 1LQDB 4WJG2 1QNJA 1PPEE 1ACBE 4WMDA 3TJVA 3SJIA 1XKBC 3MWIU 3VB5A 2FOEA 1ZHRA 1H1BA 1Y5BT 3NXPA 4DT7B 1G36A 1C1QA 3UY9A 1K1MA 4NWKA 1KXBA 3UWIA 4DVAU 1YLCA 2Y81A 4U30A 1IHSH 3UQOA 1AQ7A 1F0UA 2GCHG 1KYNA 4DOQA 1E35B 2AMPA 1SHHB 4OS1A 1PQ7A 5T6GA 1KSNA 1KXEA 4TPIZ 4AZ2B 1S84A 1CT2E 1LVOA 4OM9A 3U98H 4DGJA 3GY6A 1C9TA 2BD5A 1HDTH 2A7CA 5ESBA 1YPKH 1AD8H 1GVLA 3KQEA 2IPHA 1TNIA 1GI9B 3F68H 3EA9A 2WUCA 3SU5A 1XUFA 1F5RA 3W95A 3LGWA 1HRTH 3H09A 3P70B 4CRDA 2QA9E 1EAWA 4CREA 4CHAB 3KEEA 1LHEH 3PMBB 1EB1H 1MAXA 1V3XA 5FX6A 4D76A 2BY8X 2AGIX 2FWWA 1GMCF 2BLVA 1J8AA 3SORA 2ZG0H 3RXDA 3SGBE 2P8OB 2UUJB 5DP7A 1P8VC 3ZZDA 1GCDA 3Q3XA 1HB0B 1ZHMA 4I8JA 1MKWK 3Q76A 1LPGB 5EW1H 2B0FA 4RKOB 1WCZA 2BXUH 5HGGA 1RTLA 3HKIB 2V3OH 4NA9H 2ZHEH 1FDPA 1O2MA 1PPZA 1IQIA 1TMUH 3JZ2B 1O3DA 3BSQA 4ZAEA 4NIXA 4X2WA 4E06H 1V2TT 1VJ9U 3LC3A 4Y11E 4JCNA 4NG9H 1GGDC 4MNXA 1UCYE 2FLRH 3VB6A 1GDQA 1CT4E 1CA0C 1OPHB 3M5NA 1ZSJA 2FOMB 1HIAB 4XE4A 1GJ7B 1QJ6B 1FY3A 1GCTC 1QBVH 2DUCA 2BD7A 4KTUA 3T2NA 4YO9A 4X8VH 5C2ZA 1SGRE 2A4QA 3DHKH 3SGQE 1EOLA 2F9NA 1QURH 2ZDNA 1MBQA 1UHBA 1FZZA 1BBRE 2EI6A 3SU0A 5GXPA 2P94A 1ZRKA 4NFEA 3GY5A 1K22H 1Y3UA 1MD7A 2JKHA 2GDDA 3ZVEA 1ANDA 2FX6A 1C5YB 3ZZ5A 2D1JA 5GCHF 3RUOA 3EQ0H 4ZROA 1DUEA 3M7TA 2DE8A 1O2RA 2Z3DA 1BZXE 1OWIA 2OK5A 1CBWB 1NT1A 1DANH 5C1UA 2PKAA 1RIWB 1TNHA 1C2EA 1P12E 4BANB 1HJAC 1OXGA 1INCA 5L2YH 5ESTE 2VVUA 3EDXB 1AWHB 3BIVH 5DGJA 3P8GA 3SUDA 2P3TB 1NZQH 3O8DA 3TJUA 5DP6A 4ABAA 3TU7H 4X8TH 2ANKH 4NFFA 1TOCB 5JPMH 2BD2A 2RA3A 1A7SA 1O0DH 3RMMH 4DJZB 1O2XA 5A8XA 2W7UA 2VGCB 2PW8H 2BVSH 3A8CA 4UFFH 1W2KH 4ISOA 4ZKRU 4KKDA 1CU1A 1IQFA 4WF8A 1DUAA 1FI8A 3UIRA 3FZDA 3P92A 1TX7A 3URCA 1AKSA 4BAMB 1SGQE 2CHAB 1O3JA 4MDSA 1XVMA 1HBTH 1C5UA 5JBBS 1C1OA 1OOKB 3TK6A 1BJUA 1ANCA 3A8DA 1ZPCA 3SV9A 2CJIA 2IJD1 1ZR0A 1YBWA 2AGEX 1LMWB 8GCHG 4FU8A 5IYTA 1TA6A 4B75A 1GJDB 1O36A 1ZOMA 3PWCA 2PV9B 8KME2 3MHWU 4OS7A 5J4QA 1UTNA 1TNLA 2Z9GA 2JETC 4FU7A 2ZCKP 1GHZA 2BLQA 1G9IE 1HJ9A 1O30A 1KY9A 2A45B 3K6YA 4Y0YE 1DWBH 1LQEA 1QL9A 1DS2E 1GBKA 1GI5A 2F9VA 1SQTA 1KTSB 4HI3A 1AVXA 4ZXXH 3KIDU 1PQAA 1O3NA 4B6EA 3SJ9A 3SUGA 1C5XB 2GT8A 1BQYA 3A85A 3BTGE 1HAIH 1FIZA 1O5DH 1W3CA 1P09A 4CR9A 3EA8A 3SHAH 3SJOA 1G32B 3ATWA 2BHGA 4IMQA 1GL1A 7LPRA 3KQBA 1ELAA 3VB4A 1V2JT 4A5TS 4DIIH 5C5OA 4INLA 4MVNA 2ZHDA 3OYPA 5A0BA 4ABHA 4X0WU 5AFYH 1W14U 5EW2H 3SO3A 1HFDA 3UOPA 5JBCS 4RI0A 1AI8H 3T27A 4ZXYH 3KCGH 2AYWA 1C5RA 1PFXC 2HGTH 4X8UH 2H9TH 1TQ7B 2H9HA 2TGAA 3S7KB 1MKXH 1YCPK 3A7XA 3PTBA 4TWYA 3MU5A 1L4DA 3P17H 3H7TA 3AASA 3MNXA 1FV9A 5A0AE 2AS9A 3BTEE 3T26A 3M3VA 1D3DB 2ZEBA 2C8YB 1QJ7B 3V7TA 1DM4B 1K1LA 3L33A 2OINA 2I6SA 2FI5E 2ZCHP 3EA7A 1O3LA 2FIRH 3ZZ9A 2XBVA 4B2BA 2DE9A 4WH8A 1V2NT 1ZYOA 4NZQA 3P6ZB 2THFB 2VIQA 2YOLA 3STIA 1K1OA 1NROH 1RD3B 3AAUA 3K6ZA 1XUJA 1F0TA 2OQ5A 1T7CA 2P3FH 1O2WA 4NCYA 2FO9A 2VWLA 5DKMA 3MU8A 1HXEH 1A5HA 1WYKA 3MNBA 1EKBB 1S6FA 2F9BH 3TNSA 1T4VH 3ENSB 4Y0ZE 3D65E 1D3TB 3V13A 4JZEH 2ZWLH 1TGTA 2TGTA 2SGQE 3MO9A 1NO9H 3UR9A 1O2HA 1QHRB 5I46H 4X6OA 1KXDA 1G3EA 2ZGCA 2H5DA 5HM9A 1AN1E 1SGIB 4MNVA 5EQQA 2Q6FA 1DLKB 4YM9A 3RC6A 2OC1A 1TB6H 3S9BA 3DFJA 4OGYA 1V2VT 1XVOA 3F1SB 1OWEA 9ESTA 2ZTYA 3PV4A 4NWLA 2YNBA 3SNCA 2GZ9A 2ZTXA 3A83A 4WH6A 1S83A 4GAWA 1MUEB 1IQJA 4XFQA 5CMXH 4D7FA 3A81A 2UUFB 2PKAB 1ZHPA 2STBE 4I8LA 1Y8TA 8GCHF 1LVBA 1EPTC 4GHQA 4ZHMU 3OTPA 2QIQA 3U1JB 4Y6DA 4B73A 1GBAA 2UWPA 2WPMS 1FAXA 1A0LA 1TPOA 3EE0B 3KHVA 4LOYH 1IAUA 2QGRA 3SNEA 3ZVDA 1CGHA 1QBNA 2Q6DA 3PWBA 1O3AA 3RM2H 1CE5A 4ABIA 1UVOA 2ZU4A 5A8ZA 1YPJH 3ZV8A 3VGCC 1O33A 3IWMA 2PKSB 3GDSA 3SZEA 4A1VA 1U6QA 2F3CE 5PTPA 1P0SH 4BXSA 2AMDA 1O34A 2SGAA 2GV6A 2GDEH 2Y5HA 3U9AH 4TYDA 1ANBA 2P95A 3QK1A 3VXFH 1HAHH 1P11E 4H6TA 4K8YA 3GISB 4ZH8A 1Z8JB 1ZJDA 1O2TA 1SGFG 2BQWB 1BHXF 3E0NB 5E0HA 1V2KT 3NCLA 1GVZA 2QXIA 1BMMH 4XSKU 4ABEA 1GCTB 2PUXB 1YF4A 1C2LA 3LGUA 4AOQA 4I31A 3MO6A 1MTVA 4K5ZA 3R0FA 3AVZA 1QB6A 2O8WA 1HCGA 3LGVA 1K9OE 1KTTB 2QAAA 2ZU2A 3TH4H 3RXGA 4ABFA 1C1WH 2FXRA 2TPIZ 3TPIZ 1DFPA 3G01A 3E91A 2XNIA 1PPBH 1L1NA 2BY7X 4LZ1H 1C5LH 4GHTA 6GCHG 1DY8A 3GY7A 2WV5A 2FS8A 3HPTB 2W26A 1H8IH 1CGIE 1JIMA 2VB0A 1EAUA 1WBGB 4GSOA 2GVFA 4Z6AH 4AN7A 1O2SA 1HJAB 3LT3A 1EPTA 2OCVB 1GJCB 3PV2A 4CRCA 1QL7A 1V2WT 1NRNH 1TYNA 4YOIA 4WVPE 1BB0B 1IHTH 5GNDA 2GCTC 2VVCA 4MPXA 2GMTC 3TGKE 1W12U 1OYQA 2ZDLA 4NIYA 3RC4A 2F9OA 3QZQA 1EJAA 3HK6B 3A7YA 5DG6A 5DK1A 1T8OA 3FP6E 1D3QB 1VJAU 4BTUB 3A7WA 1ID5H 4ISIH 1HXFH 3I29A 1O2UA 5FX5A 4AGKA 1AZ8A 2QXJA 3PMJA 1TNJA 1GJ8B 5LPEA 2Z6BD 3BG8A 3LGTA 4KTSA 3JZ1B 4HFPB 1C1NA 2ALVA 1J16A 4CBNA 3K2UA 1AFEH 2FMJA 1TABE 1V6DA 1SMFE 3RXLA 1FJSA 2LPRA 3GICB 1DXWA 4X1PU 3I77A 1XUIA 2HRVA 3BTHE 4DG4A 1LCYA 1C5OH 2AMQA 5A2MH 1KXFA 1EZUC 1NTPA 1YP9A 4O9VA 3RP2A 3A8BA 3O8CA 2FZZA 1UVTH 2VNTA 3BN9A 2OUAA 1A46H 2ZFFH 2BOKA 4I32A 1XXDA 2HPPH 1AU8A 1KDQB 2ZP0H 1SGEE 3RMNH 1JIRA 1TIOA 3GYLB 4O97A 1HAXB 1QRZA 2BTCE 3SU2A 3ZYEA 3RLWH 2JH0D 1P2JA 1NC6A 3EYDA 2PTCE 1JOUB 3DUXH 4FVBA 4X8SH 1P2KA 3E6PH 3LDXH 1J9CH 4A92A 1NY22 4U01A 2JETB 1BRAA 2PGBB 3RXSA 1A3BH 2HNTF 1HAVB 3Q77A 1BRUP 4ABDA 2BDCA 3LGIA 1D6WA 1O3IA 1GBHA 1SQAA 1O5GH 4FUEA 3E1XB 3UUZA 2R2MB 4XDEA 5A09A 1C2JA 3BTFE 1MKWH 5EQRA 1GBDA 2O9QA 3ITIA 1WTGH 3SV2H 1AVWA 1GBFA 1O2KA 3BTWE 3SOSA 1Z6JH 5DPAA 3T5FH 1HV7A 3RXPA 1N6YA 2QF0A 3S9AA 1HUTH 4M9FA 4O3UA 4JYVH 1D3PB 1BIOA 1O2VA 1YPHC 2BDBA 1A1RA 1DY9A 4B74A 5LGOA 5EXMA 4WY3A 5GJ4B 1ARBA 4Y76A 1QA0A 3LJOA 2GD4B 3F9EA 1FY1A 4K2YA 1LPKB 2F91A 3H5CB 2FX4A 1EJNA 3UNSA 1ZTLA 1EB2A 1G3DA 2GZ8A 2FESH 2FYQA 4Q2KA 1OWKA 7GCHG 6GCHF 2QY0B 1BTWA 1BOQA 2FTMA 1L0ZA 1P2OA 1B0FA 4IN1A 4OS2A 2ZU1A 1K1IA 1OWDA 1CHOG 1NESE 3RXVA 5T1VA 1E36B 3S7HB 5A0CA 1AFQC 2WV4A 3MO3A 2A4GA 3RU4D 1HJ8A 1QGFA 4I33A 1AY6H 3LONA 1WUNH 2ZDAH 1YPEH 3VEQB 1O5AB 1Y3WA 3H7OA 1DPOA 4JYUH 1GJ9B 2BLOA 1SR5C 1OSSA 3PLKA 4X6PA 1ZLRA 3QTVH 2K1QA 1GHBG 5EPNA 5IDKA 2WHXA 3NUMA 3M3SA 4Q7XA 2A1DB 4Y8XA 3SNAA 1S82A 2CXVA 1DWCH 3QO6A 3ZVGA 1TWXB 1O31A 3VB3A 4JZ1A 3FVFB 1OYTH 4OS6A 4CRBA 1A61H 1ANEA 1UK4A 4GCHG 3M36A 4Q80A 4IC5A 3F9FA 4E7RG 1FONA 1THRH 1BRCE 1ZMLA 3SUFA 1GBLA 4AYYB 1FN8A 1EATA 3QDZB 1O5BB 1UTKA 1O2GH 1GG6C 1J15A 2RG3A 4BNRA 1YPGH 3SU4A 1O2ZA 2A4RA 1TRYA 2VH6A 2ZU5A 3TH3H 1Y5AT 3PV5A 2ODYB 4X1NU 1Z8RA 5L30H 1EZQA 2CGAA 4X6MA 3ZZAA 1Y5UT 2J2UA 3TVJB 3P95A 2ZF0H 2BY6X 2TRMA 3QGNB 4SGBE 3RXTA 3SUEA 2G51A 1V2RT 1D6RA 1UVSH 4IMZA 4ABBA 1VZQH 1GVKB 3QUMP 2PFEA 1L1JA 1O3MA 1Q31A 3RC5A 1AB9C 3B23B 4YESB 3SU3A 4RN6A 2BQ7B 3UTUH 1AE8H 2A32A 1Z8IB 1O2YA 2P3UB 1LKBA 1QL8A 5EU8A 3MMGA 1Y59T 3AAVA 2FLBH 2SGFE 6ESTA 5EPYA 1F5KU 1E38B 2ZI2H 2J92A 2Q6GA 4INHA 1EOJA 1T8NA 4NIWA 1NFWA 2NU1E 3ZZ3A 1HGTH 4IGDA 2AGGX 1IOEA 4HZHA 1DXPA 1H9IE 1IQLA 2Z94A 1V2OT 1TGCA 1UK2A 1TX8A 1ZGVA 2RA0A 6LPRA 5FXLA 5I25A 1LHCH 1EAIA 4X1RU 3M7UA 3OY5U 3LIWA 1NU7B 1NRSH 4Y7AA 1MU6B 3BV9B 7GCHF 4I7YH 2F83A 4IC6A 1P2IA 4THNH 1TRNA 4MPUA 4U32A 2WPJS 5LH8A 1QBOA 3NK8A 4MNWA 3CP7A 3R3GB 1OS8A 5E8EH 2OQUA 3ESTA 3QTOH 3FANA 2EEKA 2GCHF 4B76A 3HK3B 2F9UA 1V2QT 2ANYA 2O8UA 1OP2A 5TCCA 1WAYB 1YPHE 3RU4T 1UVUH 4TWWA 5FAHA 4WMFA 1YCPH 4JZFH 5FPSA 5SGAE 3SYJA 1AZZA 5FBIA 1J17T 2XCNA 1V2LT 1C1VH 1TAWA 1WSSH 3D23A 2GMTB 3KGPA 4NA8A 1UTMA 5C1YA 1GHBF 3MH4A 2ZFTA 3LC5A 3MU4A 5EOKA 1C4Y2 3MYWA 1EUFA 5AFZH 1N8OC 2QYIA 1O3OA 4JZIA 1L1GA 3GYMA 5EXNA 5DP9A 4H42U 4ZKSU 1GJ4H 3BF6H 1JWTA 3RXUA 2RCEA 4ZUHA 4BAHB 1BUIA 1YGCH 1H4WA 2VIPA 3A84A 2ZKSA 3RXRA 3BIUH 1A0JA 1L4ZA 1RGQA 1KLJH 2Z9KA 3PMHB 4FXGH 1KLIH 3D62A 5B6LA 5C67A 3S9CA 1P2MA 3KN2A 2BZAA 1F0RA 1IQNA 4B6FA 2ZDMA 3UWJH 2OXSA 2XBYA 1FY4A 4VGCC 5FPYA 1F5LA 2Y7ZA 3E90B 2BZ6H 2Y7XA 1CQQA 4WMEA 4JYTA 2J4IA 4ISHH 4J2YB 2ODQA 1THSH 2ZO3H 2A5KA 2V6NA 1MTNB 2ZPRA 1UVPA 2D2DA 1O35A 3TH2H 2H5CA 3ZZ7A 4AFSA 1NRPH 3SJKA 2GKVE 4H4FA 1NS3A 2J9NA 1K1NA 1O5CB 4ZKNU 1VGCC 2FOGA 2WYJA 2VJ1A 4R8TB 1BTYA 1UCYK 3B8JA 4NIVA 1AWFH 1J14A 1GDNA 1E34B 1A0HB 1DX5M 1SGCA 3GCHB 3TLOA 1ZGIA 1ELGA 2HNTC 5JB8S 1SGTA 4E05H 4GVUA 4CBOA 1FMGA 1TALA 2QCYA 3CENA 1C2GA 3MFJA 1XUKA 1Z7KA 1QJ1B 3PROA 5BPEA 3TNTA 3RXKA 4K69A 1NRQH 2UWOA 1ZMJA 2FS9A 5E2PA 1BBRK 2BDAA 4DIHH 1BMLA 4D7GA 1F0SA 1G3BA 1KXCA 1GMHG 5DP4A 5GWZA 3E8LA 2Z9JA 3UR6A 1V2MT 2V35A 1O2NA 1SLXB 5L2ZH 1EP5A 4WXIA 5DO4H 4JK6A 2G55A 2NU3E 2G4UA 1GI3A 2J94A 4JZDH 3V0XA 1TBRH 4KTCA 4Y71A 4JK5A 4NSYA 4TY6A 4CH2B 1TX6A 2AIQA 3RXOA 2XXLA 3VXEH 1BMAA 1T31A 3UOUA 2VH0A 2G00A 4YT7H 3VPKA 2SGEE 1O2LA 4IBLH 1UHBB 1BTPA 2LNCA 1GBIA 2G8TA 2XBXA 1DWEH 3ZYDA 2A2XH 3M5OA 1E37B 3SW2B 1SHYA 1TONA 1HAPH 1QB1A 1YPLH 1W0ZU 2ZC9H 1G37A 4CHAC 2OBQA 1OP0A 3LH3A 1XX9A 4R0IA 5FCRA 5C1XA 1O38A 4FUGA 4X2VA 2G5VA 3DFLA 3M35A 4Q7YA 2P8OC 2ZFQH 2FM2A 1BA8B 1O3CA 3RXQA 1CSOE 3MU1A 3D49H 2XYAA 1TRMA 2SNWA 1QQUA 1MMJN 2SFAA 2ANWA 3Q00A 1O5FH 4CRGA 3TITA 1G3CA 1GJBB 1C5SA 3M5MA 1TGNA 2TIOA 2ZQ1A 4LK4A 3RU4E 5DP3A 1GJ6A 1MQ6A 5JB9S 1FPCH 4KP0A 3SI4H 1SGNE 2OC0A 1P03A 3I78A 3GDVA 1GGDB 3SQHE 4B2AA 4ZKOU 2Z7FE 1OKXA 4UFEH 2AFQB 4BTTB 1M9UA 1FLEE 1CA0B 2ZHFH 1C2KA 2QV1A 1A2CH 2NU4E 1WQSA 1LTOA 2IJOB 1AKSB 3STJA 4FUCA 2FI4E 4TY7A 4XBBA 3T28A 3GCTG 1SC8U 2CF8H 3S0NA 5HYOA 2FOCA 1MCTA 1LHFH 1GHAG 3A80A 3A82A 3FZZA 3A88A 1P2NA 3PLBA 2A7JA 5F8XA 2A5AA 4GUXA 1O5EH 2WV9A 4UD9H 1O2OA 4YTAA 4MLFB 1QCPA 1W11U 1RIWC 4OS5A 5TCAA 1VITG 2FP7B 3TGIE 2Y5GA 2XC4A 3KF2A 2ZU3A 4K1TA 4AB8A 2VWOA 1XUHA 2SGPE 4AG2A 2WZQA 1K1JA 2GV7A 1GMHF 2BVXH 2Y82A 2ZHQH 2ZGXH 1WXRA 2R3YA 2TBSA 2D8WA 3PLPA 1ELFA 2OLGA 3LH1A 2B5TB 2O8MA 2ZGHA 3MI4A 4UONA 2VIVA 2HNTE 1C1UH 5EQSA 4FUIA 1LO6A 5L6NH 1TPAE 1YC0A 2PSYA 1C1SA 1UMAH 3WY8A 1GI0A 1QB9A 2YNAA 3BEFB 1GI4A 2H6MA 3QX5H 2B8OH 2WPHS 3CS0A 1CHGA 5JBTA 3K65B 3OTJE 4I8HA 1YPMH 4I8GA 2IOTA 3RXMA 1SGDE 4XBDA 1HLTH 5AVDA 5HXFA 1TA2A 5FCKA 4FUFA 5T3HA 3A87A 4BTIB 2Y6TA 3DT0H 2Z9LA 3UPEA 1IQKA 4AB9A 2XRCA 1W13U 3LU9B 3SV6A 1ELBA 2BY9X 1C5TA 1LVMA 1KIGH 3RXHA 2VVVA 1B5GH 3TIUA 3FP8E 1HNEE 2C8ZB 1GMCG 2R0KA 3OX7U 3PO1C 3BTQE 2WPIS 1TLDA 3HKJB 2BVRH 3MH6A 4AYVB 4NGAH 3RXIA 1C9PA 2CMYA 1E0FD 1D9IA 1ESBA 4F4OC 1HAGE 1SGPE 3AW1A 1RTKA 1IQHA 1N6XA 1SFIA 2BD8A 2R3UA 1GDUA 1P06A 3SU1A 3NPSA 1QQ4A 1O39A 3QZRA 1QFKH 1C1RA 1VCQA 4AFQA 1CO7E 1NRRH 2VU8E 2XWAA 4VGCB 5K7RA 1G30B 2HWLB 5GIBA 2UUYA 3TGJE 1NN6A 4XOJA 4BAOB 2PWXA 2GGVB 2Z3EA 1MAYA 2W3IA 2FOFA 1O32A 2R2WU
chains in the Genus database with same CATH superfamily
1Z1IA 3GCTF 1PJPA 4TPYA 2ESTE 4AGJA 1GHAF 3T25A 1O2QA 1K28D 3M7QA 1Z8GA 1A5IA 1P57B 3LGYA 1S85A 5CHAC 1C5VA 2ZGBH 1FPHH 2BMGB 1RXPA 3E16B 3ODDA 3FAOA 2CV3A 1A4WH 1GJ5H 3KQCA 1MTWA 3K9XB 1GI6A 3PB1E 5GCHG 4ZMAH 7KMEH 3MOCA 1FY5A 1AE5A 1TBZH 1ZSKA 2H2ZA 2FTLE 3ATIA 3PYHA 2UWLA 4A6LA 3P8OA 5KECA 4WWYA 4U2WA 4CRAA 2SGDE 3C1KA 4YXWD 8ESTE 1GMDG 2AH4X 1Z71A 1NM6A 3U8RH 5AF9H 4IS5A 4ISNA 2ZPQA 1JXPA 1DWDH 1SOZA 1SGYE 1XM1A 2BB4A 4KELA 1C2DA 2GZ7A 4WXVA 5EXLA 2PHBA 1ZPZA 4D9QA 1MH0A 2P16A 2H1UA 2GT7A 2A0QB 3KQDA 5EJZA 5F6MA 5F8ZA 1UJ1A 3U1IB 2J95A 3ATMA 1C4V2 1DSUA 2C4FH 2J38A 3MNCA 3ZVFA 1Y3VA 1EZXC 3BG4C 3O8BA 2BY5X 1C2MA 2ZECA 3M37A 2IPQX 1PPGE 1T8MA 2WUBA 1SLWB 1LPZB 1XKAC 4BXWA 2WINI 3SNBA 1ETRH 2PSXA 4MPVA 5EG4A 5HIYA 2XBWA 1O37A 3ZVBA 3QGJA 1ABJH 2EA3A 4Q7ZA 2PGQB 2FEQH 2XC5A 5HIZA 4K1SA 4Y79A 3LPRA 3MTYA 1IQEA 1G2LA 1IQGA 1EPTB 4O03A 6CHAC 1ELCA 1T8LA 4D9RA 1UTOA 1SSXA 3EGKH 3LKWA 1EX3A 1WV7H 4RT0A 3LOXA 5EJLA 2F9PA 4Z0KA 3A86A 1K21H 1Z6EA 1BCUH 1TMTH 4X6NA 2PKSC 3Q3YA 1OX1A 1FY8E 1UTQA 1AMHA 1O3FA 2CN0H 3HATH 3QLPH 2FOAA 3BTKE 1P3EA 1Y3XA 3DSPA 3TJNA 1DT2A 3VGCB 4BOHA 4X1QU 1L2EA 2QF3A 2BQ6B 3FFGA 1PYTD 2C8XB 2RFKC 1YLNA 1TMBH 1AUJA 1TPSA 4UFDH 3MH5A 3UNRA 1JMOH 4TSFD 4LZ4B 4K3JA 3QWCH 1EQ9A 3GY8A 1SG8B 2R9PA 3UREA 5E0JA 3VFEA 2P59A 1ETSH 3A7TA 4CR5A 1BITA 2BD3A 1G2MA 3BEIB 1WU1A 2FPZA 1TBQH 1TE0A 5C3NA 1GBJA 1O3EA 2BOHB 2ZHWH 1TNGA 3BEUA 4O3TA 3TK9A 5HMAA 5K0HA 3TK5A 2ODPA 1ZSLA 5B6OA 1O2IA 1C5MD 1P01A 2ZNKH 1PPCE 2EC9H 4ESTE 4FUDA 2KCOA 1VCWA 2HVXA 3HGPA 3DD2H 1C1PA 1CHOF 2KAIA 1UCYH 1ZTKA 1S0RA 1T32A 1GHXH 4MPWA 2F4LA 1EASA 1GMDF 2ZFPH 4INKA 3GY3A 4F49A 1MQ5A 1ELVA 3U8OH 1GI8B 1HPGA 3EE7A 1NFXA 4YOJA 2OC8A 5G4BA 4OS4A 1LHDH 1HYLA 2GCTB 1B7XB 2C90B 1YLDA 1BBRH 1UK3A 2BDYA 3UNQA 3UB0A 3ZZ6A 1FXYA 2A4OA 1N1LA 1CT0E 4QT8C 4X1SU 4AORA 2A5IA 1ZTJA 2V3MA 3U69H 1SI5H 1H9HE 4MNYA 3GS9A 4UFGH 2Q1JA 5CDFE 4Z1MD 1PQ8A 1PPFE 3FP7E 2VWNA 4BAQB 3L3TA 4GCHF 1AUTC 2M5TA 4DURA 5EODA 3SGAE 3U28C 1AO5A 1JRSA 4FOUC 5AHGH 1DITH 2NU2E 4K60A 1EJMA 3SHCH 1UTPA 1DE7H 1GBBA 5DP5A 1P10A 1DICA 3U8TH 1SFQB 3M61U 3OSYA 5JBAS 2G5NA 2H9EH 2KM0A 4DY7B 2ZGJA 1MCVA 1CGJE 1S6HA 2RDEA 3ODFA 4A1XA 2ZZUH 3PM3A 3MU0A 3ELAH 1DSTA 3PO1B 2VWMA 3CS7A 4Y8YA 5T6DA 3VB7A 1ZJKA 2BDHA 2VINA 2PR3A 5LPRA 3C27B 4K8BA 4AG1A 4FUHA 2XW9A 1ELDE 3RLYH 1X7AC 1THPB 4CH8B 2HLDD 1S0QA 2O8TA 2WPKS 1ELTA 1K2I1 3DA9B 2FDAA 2VBCA 4FVDA 4E7NA 2WPLS 2ZCLP 4ZHAA 1QRXA 1RRKA 1SLVB 2SNVA 2QXHA 1JRTA 1KLTA 1RTFB 4B2CA 1PQ5A 3E3TA 2WYGA 1AGJA 1ARCA 1T4UH 1UO6A 3Q3KA 1FQ3A 3GDUA 2TGPZ 3F9GA 5J4SA 1F2SE 4MG3A 1SLUB 1W0YH 2XWBI 3GY4A 3SQEE 1V2ST 5HM2A 1B0EA 1P02A 1PYTC 1ABIH 3RXEA 3N7OA 1MD8A 1VCPA 2W6ID 1BT7A 1RJXB 5CHAB 1C5QA 4FUJA 3S69A 3SZNA 1DLEA 3ATLA 1UTJA 1YCPM 2AHME 1QY6A 1A3EH 2ZA5A 5F03A 5BRRE 1Q2WA 5GPIB 1HAOH 2UUKB 1O2JA 2QE7D 4UE7H 1SOTA 4SGAE 5EGMA 1BTUA 1GBEA 5TJXA 8LPRA 1OWJA 1TGSZ 3MNSA 1NFYA 1KDQA 2BDGA 2FOBA 1BRBE 4NA7A 3F2GA 3TJOA 1ORFA 4ABGA 3ZZBA 1ESAA 1SQRA 3SV8A 2TGDA 3IITA 1XUGA 1EXFA 2ZDKA 1AFQB 2FI3E 3F9HA 3E0PB 4LXBH 1GL0E 3OEHD 3AW0A 2Y5FA 3RXJA 1HAVA 1YM0A 3HGNA 4X2XA 1O3BA 1XXFA 3NZIA 1BDAA 1GBTA 4HTCH 1BJVA 1DOJA 2Y80A 3URDA 3RMLH 2BX4A 4Y10E 1AVGH 1UTLM 3IG6B 3ZIAD 4GPGA 3EAJA 1AIXH 1LVYA 3SN8A 1C1MA 2C93B 3SI3H 1GI7B 2K8IA 3ZZ4A 1YKTA 3A7VA 2HPQH 4KGAA 3WWBA 1S81A 3BG4B 5FL7D 4ABJA 4PROA 1ELEE 4M7GA 4XBCA 5E2OA 5C20A 7ESTE 1TFXA 1MZDA 4Y7BA 2ULLA 1BMFD 4ZHLU 1Q3XA 1SKYE 2PUQH 4Y8ZA 5JYIA 2GTBA 3SV7A 2KAIB 5E0GA 1GI1A 1QA7A 2B9LA 2G4TA 3F6UH 3RXAA 2W7SA 2OTVA 3P8FA 4UEHH 1TOMH 3ZVCA 2QC2A 1NU9A 2PLXA 1GG6B 5JDUB 1SGFA 1IQMA 1C5PA 1CVWH 1D4PB 2FYRA 2AIPA 2V0BA 2BDIA 3T62A 1A5GH 2C8WB 6CHAB 4H6SB 1C5NH 2FOHA 3OU0A 4MTBA 1O3PB 2BD4A 2OD3B 9LPRA 1SPJA 1UW7A 1GI2A 2IN2A 1FAKH 2W3KA 2PTNA 1C1TA 2P93A 2O8LA 2J34A 3SBKA 3GCNA 3LJJA 3RDZA 1FIWA 2RDLA 3M5LA 3RXBA 1V2UT 4UDWH 4X2YA 1AB9B 1MKXK 1BMNH 2R0LA 1LKAA 3SNDA 2K0QA 1SQOA 4NSVA 3ZZ8A 2ZPSA 1SVPA 2CF9H 3BTME 1WTHD 4GLYA 5FPTA 5FBEA 2VIWA 1CBWC 5ABWA 3KYFA 2XCFA 5DJ7A 5T6FA 4AFUA 1LDTT 4D8NA 1C2IA 1BTHH 2AERH 4AX9H 1WQVH 3ATKA 1BTXA 1GBMA 1GBCA 1MU8B 1SBWA 2OBOA 4MQAA 2ZQ2A 2A31A 3BTDE 1OWHA 1RS0A 1O3KA 1GHWH 1CA8B 1GHYH 1TGBA 3O8RA 1XMNB 1P9SA 1TPPA 2ASUB 2Z9IA 2LP6A 2XTTB 3M3TA 4K1EA 4JMYA 3RMOH 1BHXB 2B7DH 2VIOA 4YT6H 2D26C 1RFNA 1GJAB 3KL6A 2JH5D 1MTUA 2HOBA 2NU0E 1OP8A 1TNKA 2NWNA 1ESTA 2VGCC 4A7IB 2EI8A 1KXAA 2ANMH 4HGCA 1W8BH 4OGXA 4YZUA 3ZVAA 4FU9A 3BTTE 5ETXA 2ALPA 1C2FA 1EZSC 4AFZA 5H4IB 1HIAA 2KR7A 5GDSH 1Z1JA 2KCYA 1O2PA 1ZPBA 3A89A 2CHAC 1QR3E 1ZRBA 2OC7A 5LPFA 1NPMA 1LHGH 1DVAH 4YLQH 2ZFRH 1HAZB 2ZFSA 2BLWA 2J98B 3MH7A 1YYY1 2GP9B 2BM2A 1GPZA 3ZV9A 1P04A 1N8OB 1S5SA 1H9LB 1YWUA 1H8DH 4B1TA 5C5NA 1W7XH 3F2HA 1EAXA 2V3HH 1P05A 1V2PT 1BTZA 1ZMNA 1W10U 1FUJA 1NFUA 5F8TA 4RSPA 1C4U2 1DDJA 2ZIQH 3AK5A 3GOVB 1MBMA 3RXFA 3NKKA 3SU6A 3RM0H 2QN5T 4YOGA 1EP6A 2STAE 1C2HA 2BYAX 2A2QH 1JBUH 3T29A 4J1YA 2XC0A 2G52A 5A8YA 2BD9A 3A7ZA 4F48B 5KGOA 2ZTZA 2ILNA 1O3GA 4NZLA 3W94A 1AHTH 3SJ8A 3UFAA 2AEIH 4ISLA 1P9UA 2QXGA 3ZZCA 1C5WB 2EI7A 2Z3CA 3GY2A 1MTNC 4FUBA 4ASHA 2OP9A 4IW4E 3B9FH 1QIXB 5FHTA 3PTNA 3DCLA 5DP8A 2LELA 1VR1H 1K1PA 2G81E 4CRFA 1P2QA 4RKJB 4A1TA 4IN2A 3L6PA 1O3HA 1GWAA 1SB1H 5CE1A 1ZZZA 3V12A 3UQVA 3QN7A 1VITH 1ETTH 2ZDVH 4BAKB 2JH6D 1MTSA 2FODA 3PMAB 3V3MA 4DW2U 1W7GH 4TT3D 3F0OA 1PPHE 4B71A 3RXCA 3MQKC 1QTFA 1VGCB 2A7HA 1P3CA 2BXTH 1QRWA 3P8NA 2BX3A 3OY6U 3NWUA 2GX4A 3GCHC 1C5ZB 1HAYB 2W5EA 3KNXA 1GHVH 3GCOA 1TQ0B 1FN6A 1WOFA 1VITF 2HALA 1F92A 4YLUA 1MZAA 2I6QA 4I8KA 2VIDA 2HLCA 2C3SA 3A8AA 1FNIA 1F7ZA 1SL3A 1Y3YA 4DCDA 1LQDB 4WJG2 1QNJA 1PPEE 1ACBE 4WMDA 3TJVA 3SJIA 1XKBC 3MWIU 3VB5A 2FOEA 5C17A 1ZHRA 1H1BA 1Y5BT 3NXPA 4DT7B 1G36A 1C1QA 3UY9A 1VKYA 1K1MA 4NWKA 1KXBA 3UWIA 4DVAU 1YLCA 2Y81A 4U30A 1IHSH 3UQOA 1AQ7A 1F0UA 2GCHG 1KYNA 4DOQA 1E35B 2AMPA 1SHHB 4OS1A 1PQ7A 5T6GA 1KSNA 1KXEA 4TPIZ 4AZ2B 1E1QD 1S84A 2XOKD 1CT2E 1LVOA 4OM9A 2J5UA 3U98H 4DGJA 3GY6A 1C9TA 2BD5A 1HDTH 2A7CA 5ESBA 1YPKH 1AD8H 1GVLA 3KQEA 2IPHA 1TNIA 1GI9B 3F68H 3EA9A 2WUCA 3SU5A 1XUFA 1F5RA 3W95A 3LGWA 1HRTH 3H09A 3P70B 4CRDA 2QA9E 1K0HA 1EAWA 4CREA 3NRLA 4CHAB 3KEEA 1LHEH 3PMBB 1EB1H 1MAXA 1V3XA 4Q63A 5FX6A 4D76A 2BY8X 2AGIX 2FWWA 1GMCF 2BLVA 1J8AA 3SORA 2ZG0H 5CHBA 3RXDA 3SGBE 2P8OB 2UUJB 2M2AA 5DP7A 1P8VC 3ZZDA 1GCDA 3Q3XA 1HB0B 2L6OA 1ZHMA 4I8JA 1MKWK 3Q76A 1LPGB 5EW1H 2B0FA 4FETA 4RKOB 1WCZA 2BXUH 5HGGA 1RTLA 3HKIB 2V3OH 4NA9H 2ZHEH 1FDPA 1O2MA 1PPZA 1IQIA 1TMUH 3JZ2B 1O3DA 3BSQA 4ZAEA 4NIXA 4X2WA 4E06H 1V2TT 1VJ9U 3LC3A 4Y11E 4JCNA 4NG9H 1GGDC 4MNXA 1UCYE 2FLRH 3VB6A 1GDQA 1CT4E 1CA0C 1OPHB 3FKSD 3M5NA 1ZSJA 2FOMB 1HIAB 4XE4A 1GJ7B 3WWFA 1QJ6B 1FY3A 1GCTC 1QBVH 2DUCA 2BD7A 5EIYA 4KTUA 3T2NA 4YO9A 4X8VH 5C2ZA 1SGRE 2A4QA 3DHKH 3SGQE 1EOLA 2F9NA 1QURH 2YMSB 2ZDNA 1MBQA 1UHBA 1FZZA 1BBRE 2EI6A 3SU0A 5GXPA 2P94A 1ZRKA 4NFEA 3GY5A 1K22H 1Y3UA 1MD7A 2JKHA 2GDDA 3ZVEA 1ANDA 2FX6A 1C5YB 3ZZ5A 2D1JA 5GCHF 3RUOA 3EQ0H 4ZROA 1DUEA 3M7TA 2DE8A 1O2RA 2Z3DA 1BZXE 1OWIA 2OK5A 1CBWB 1NT1A 1DANH 5C1UA 2PKAA 1RIWB 1TNHA 1C2EA 1P12E 4BANB 1HJAC 1OXGA 1INCA 5L2YH 1E79D 5ESTE 2VVUA 3EDXB 1AWHB 3BIVH 5DGJA 3P8GA 4Q4LA 3SUDA 2P3TB 1NZQH 2QF4A 3O8DA 3TJUA 5DP6A 4ABAA 3TU7H 4X8TH 2ANKH 4NFFA 1TOCB 5JPMH 2BD2A 2RA3A 1A7SA 1O0DH 3RMMH 4DJZB 1O2XA 5A8XA 2W7UA 2VGCB 2PW8H 2BVSH 3A8CA 3F0PA 4UFFH 1W2KH 4ISOA 4ZKRU 4KKDA 1CU1A 1IQFA 4WF8A 1DUAA 1FI8A 3DSOA 3UIRA 3FZDA 3P92A 1TX7A 3URCA 1AKSA 1NBMD 4BAMB 1SGQE 2CHAB 1O3JA 4MDSA 1XVMA 1HBTH 1C5UA 5JBBS 1C1OA 2PP6A 1OOKB 3TK6A 1BJUA 1ANCA 3A8DA 3CNRA 1ZPCA 3SV9A 2CJIA 2IJD1 1ZR0A 1YBWA 2AGEX 1LMWB 8GCHG 4FU8A 5IYTA 1TA6A 5C0UA 4B75A 1GJDB 1O36A 1ZOMA 3PWCA 2PV9B 8KME2 3MHWU 4OS7A 5J4QA 1UTNA 1TNLA 2Z9GA 2JETC 4FU7A 2ZCKP 1GHZA 2BLQA 1G9IE 1HJ9A 1O30A 1KY9A 2A45B 3K6YA 4Y0YE 1DWBH 1LQEA 1QL9A 1DS2E 1GBKA 1GI5A 2F9VA 1SQTA 1KTSB 4HI3A 1AVXA 4ZXXH 3KIDU 1PQAA 1O3NA 4B6EA 3SJ9A 3SUGA 1C5XB 2GT8A 1BQYA 3A85A 3BTGE 1HAIH 1FIZA 1O5DH 1W3CA 1P09A 4CR9A 3EA8A 3SHAH 3SJOA 1G32B 3ATWA 2BHGA 4IMQA 1GL1A 7LPRA 3KQBA 1ELAA 3VB4A 1V2JT 4A5TS 4DIIH 5C5OA 4INLA 4MVNA 2ZHDA 3OYPA 5A0BA 4ABHA 4X0WU 5AFYH 1W14U 5EW2H 3SO3A 1HFDA 3UOPA 5JBCS 4RI0A 1AI8H 3T27A 4AC9A 1E1RD 4ZXYH 3KCGH 2AYWA 1C5RA 1PFXC 2HGTH 4X8UH 2H9TH 1TQ7B 2H9HA 2TGAA 3S7KB 1MKXH 1YCPK 3A7XA 3PTBA 4TWYA 3MU5A 1L4DA 3P17H 3H7TA 3OEED 3AASA 3MNXA 1FV9A 5A0AE 2AS9A 3BTEE 3T26A 3M3VA 1D3DB 2ZEBA 2C8YB 1QJ7B 3V7TA 1DM4B 1K1LA 3L33A 2OINA 2I6SA 2FI5E 2ZCHP 3EA7A 1O3LA 2FIRH 3ZZ9A 2XBVA 4B2BA 2DE9A 4WH8A 1V2NT 1ZYOA 4NZQA 3P6ZB 2THFB 2VIQA 2YOLA 3STIA 1K1OA 1NROH 1RD3B 3AAUA 3K6ZA 1XUJA 1F0TA 2OQ5A 1T7CA 2P3FH 1O2WA 4NCYA 2FO9A 2VWLA 2JIZD 5DKMA 3MU8A 1HXEH 1A5HA 1WYKA 3MNBA 1EKBB 1S6FA 2F9BH 3TNSA 1T4VH 3ENSB 4Y0ZE 3D65E 1D3TB 3V13A 4JZEH 2ZWLH 1TGTA 2TGTA 2SGQE 3MO9A 1NO9H 3UR9A 1O2HA 1QHRB 5I46H 4X6OA 1KXDA 3UAIC 1G3EA 2ZGCA 2H5DA 5HM9A 1AN1E 2JDID 1SGIB 4MNVA 5EQQA 2Q6FA 1DLKB 4P00A 4YM9A 3RC6A 2OC1A 1TB6H 3S9BA 3DFJA 4OGYA 1V2VT 1XVOA 3F1SB 1OWEA 9ESTA 2ZTYA 3PV4A 3KQ5A 2YNBA 4NWLA 3SNCA 2GZ9A 2ZTXA 3A83A 4HG6A 4WH6A 1S83A 4GAWA 1MUEB 1IQJA 4XFQA 5CMXH 4D7FA 3A81A 2UUFB 2F43B 2PKAB 1ZHPA 2STBE 4I8LA 1Y8TA 8GCHF 1LVBA 1EPTC 3OTPA 4GHQA 2XNDD 4ZHMU 2QIQA 3U1JB 4Y6DA 4B73A 1GBAA 2UWPA 2WPMS 1FAXA 1A0LA 1TPOA 3PRBA 3EE0B 3KHVA 4LOYH 1IAUA 2QGRA 3SNEA 3ZVDA 1CGHA 1QBNA 2Q6DA 3PWBA 1O3AA 3RM2H 1CE5A 4ABIA 1UVOA 4XD7D 2ZU4A 5A8ZA 1YPJH 3ZV8A 3VGCC 1O33A 3IWMA 2PKSB 3GDSA 3SZEA 4A1VA 1U6QA 2F3CE 5PTPA 1P0SH 4BXSA 2AMDA 1QZ8A 1O34A 2SGAA 2GV6A 2GDEH 2Y5HA 3U9AH 4TYDA 1ANBA 3N99A 2P95A 3QK1A 3VXFH 1HAHH 1P11E 4H6TA 4K8YA 2JJ2D 3GISB 2L74A 4ZH8A 1Z8JB 3OE7D 1ZJDA 1O2TA 1SGFG 2BQWB 1BHXF 3E0NB 5E0HA 1V2KT 3NCLA 1GVZA 2QXIA 5F53A 1BMMH 4XSKU 4ABEA 1GCTB 2PUXB 1YF4A 1C2LA 3LGUA 4AOQA 4I31A 3MO6A 1MTVA 3OAAD 4K5ZA 3R0FA 3AVZA 1QB6A 2O8WA 1HCGA 3LGVA 1K9OE 1KTTB 2QAAA 2ZU2A 3TH4H 3RXGA 4ABFA 1C1WH 2FXRA 2TPIZ 3TPIZ 1DFPA 3G01A 3E91A 2XNIA 1PPBH 1L1NA 2BY7X 4LZ1H 1C5LH 2WPDD 4GHTA 6GCHG 1DY8A 3FO8D 3GY7A 2WV5A 2FS8A 3HPTB 2W26A 1H8IH 1CGIE 1JIMA 2VB0A 1EAUA 1WBGB 4GSOA 2GVFA 4Z6AH 4AN7A 1O2SA 1HJAB 3LT3A 1EPTA 2OCVB 1GJCB 3PV2A 4CRCA 1QL7A 1V2WT 1NRNH 1TYNA 4YOIA 4I86A 4WVPE 1BB0B 1IHTH 5GNDA 2GCTC 2VVCA 4MPXA 2GMTC 5IK2D 3TGKE 1W12U 1OYQA 2ZDLA 4NIYA 3RC4A 2F9OA 3QZQA 1EJAA 3HK6B 3A7YA 5DG6A 5DK1A 1T8OA 3FP6E 1D3QB 1VJAU 4BTUB 2KCPA 3A7WA 1ID5H 4ISIH 1HXFH 3I29A 1O2UA 5FX5A 4AGKA 1AZ8A 2QXJA 3PMJA 1TNJA 1GJ8B 5LPEA 2Z6BD 3BG8A 3LGTA 4KTSA 3JZ1B 4HFPB 1C1NA 2ALVA 1J16A 1FX0B 4CBNA 3K2UA 1AFEH 2FMJA 1KMHB 1TABE 1V6DA 1SMFE 3RXLA 1FJSA 2LPRA 3GICB 1DXWA 4X1PU 3I77A 1XUIA 2HRVA 3BTHE 4DG4A 1LCYA 1C5OH 2AMQA 5A2MH 1KXFA 1EZUC 1NTPA 1YP9A 4O9VA 3RP2A 3A8BA 3O8CA 2FZZA 1UVTH 2VNTA 3BN9A 2OUAA 1A46H 2ZFFH 2BOKA 4I32A 1XXDA 2HPPH 1AU8A 1KDQB 2ZP0H 1SGEE 3RMNH 1JIRA 1TIOA 3GYLB 4O97A 1HAXB 1QRZA 2BTCE 3SU2A 3ZYEA 3RLWH 2JH0D 1P2JA 1NC6A 3EYDA 2PTCE 1JOUB 3DUXH 4FVBA 4X8SH 1P2KA 3E6PH 3LDXH 1J9CH 4A92A 1NY22 4U01A 2JETB 1BRAA 2PGBB 3RXSA 1A3BH 2HNTF 1HAVB 3Q77A 1BRUP 4ABDA 2BDCA 3LGIA 1D6WA 1O3IA 1GBHA 1SQAA 1O5GH 4FUEA 3E1XB 3UUZA 2R2MB 4XDEA 5A09A 1EFRD 1C2JA 3BTFE 1MKWH 5EQRA 1GBDA 2O9QA 3ITIA 1WTGH 3SV2H 1AVWA 1GBFA 1O2KA 3BTWE 3SOSA 1Z6JH 5DPAA 3T5FH 1HV7A 3RXPA 1N6YA 2QF0A 3S9AA 1HUTH 4M9FA 4O3UA 4JYVH 1NBME 1D3PB 2WSSD 1BIOA 1O2VA 1YPHC 2BDBA 1A1RA 1DY9A 3KYGA 4B74A 5LGOA 5EXMA 4WY3A 5GJ4B 1ARBA 4Y76A 1QA0A 3LJOA 2GD4B 3F9EA 1FY1A 4K2YA 1LPKB 2F91A 4DT4A 3H5CB 2FX4A 1EJNA 3UNSA 1ZTLA 1EB2A 1G3DA 2GZ8A 2FESH 2FYQA 4Q2KA 1OWKA 7GCHG 6GCHF 2QY0B 1BTWA 4ACAA 2J97A 1BOQA 2FTMA 1L0ZA 1P2OA 1B0FA 4IN1A 4OS2A 2ZU1A 1K1IA 1OWDA 1CHOG 1NESE 3RXVA 3OFND 5T1VA 1E36B 3S7HB 5A0CA 1AFQC 2WV4A 3MO3A 2A4GA 3RU4D 1HJ8A 1QGFA 4I33A 1AY6H 3LONA 1WUNH 2ZDAH 1YPEH 3VEQB 1O5AB 1Y3WA 3H7OA 1DPOA 4JYUH 4ZCNA 1GJ9B 2BLOA 1SR5C 1OSSA 3PLKA 4X6PA 1ZLRA 3QTVH 2K1QA 1GHBG 5EPNA 5IDKA 2WHXA 3NUMA 3M3SA 4Q7XA 2A1DB 4Y8XA 3SNAA 1S82A 2CXVA 1DWCH 3QO6A 3ZVGA 1TWXB 1O31A 3VB3A 4F55A 4JZ1A 3FVFB 1OYTH 4OS6A 4CRBA 1A61H 1ANEA 1UK4A 4GCHG 3M36A 4Q80A 4IC5A 3F9FA 4E7RG 1FONA 1THRH 1BRCE 2KFWA 1ZMLA 3SUFA 1GBLA 4AYYB 1FN8A 1EATA 1YY3A 3QDZB 2V7QD 1O5BB 1UTKA 2GJGA 1O2GH 1GG6C 1J15A 2RG3A 4BNRA 1YPGH 3SU4A 1O2ZA 2A4RA 3WW7A 1TRYA 2VH6A 2ZU5A 3TH3H 1Y5AT 3PV5A 2ODYB 4X1NU 1Z8RA 5L30H 1EZQA 2CGAA 4X6MA 3ZZAA 1Y5UT 2J2UA 3TVJB 3P95A 2ZF0H 2BY6X 2TRMA 3QGNB 2W6JD 4SGBE 3RXTA 3SUEA 2G51A 1V2RT 1D6RA 1UVSH 4IMZA 4ABBA 1VZQH 1GVKB 3QUMP 2PFEA 1L1JA 1O3MA 1Q31A 3RC5A 1AB9C 3B23B 4YESB 1MABB 3SU3A 4RN6A 2BQ7B 3UTUH 1AE8H 2A32A 4ASUD 1Z8IB 2HVYB 1O2YA 2P3UB 1LKBA 1QL8A 5EU8A 3MMGA 1Y59T 3AAVA 2FLBH 2SGFE 6ESTA 5EPYA 1F5KU 1E38B 2ZI2H 2J92A 2Q6GA 4INHA 1EOJA 1T8NA 4NIWA 1NFWA 2NU1E 3ZZ3A 1HGTH 4IGDA 2AGGX 1IOEA 4HZHA 1DXPA 1H9IE 1IQLA 2Z94A 3W1EA 1V2OT 1TGCA 1UK2A 1TX8A 1ZGVA 2RA0A 6LPRA 5FXLA 5I25A 1LHCH 1EAIA 4X1RU 3M7UA 3OY5U 3LIWA 1NU7B 1NRSH 4Y7AA 1MU6B 3BV9B 7GCHF 4I7YH 2F83A 4IC6A 1P2IA 4THNH 1TRNA 4MPUA 4U32A 2WPJS 5LH8A 1QBOA 3NK8A 4MNWA 3CP7A 2KCAA 3R3GB 1OS8A 5E8EH 2OQUA 3ESTA 3QTOH 3FANA 2EEKA 2GCHF 4B76A 1S6LA 3HK3B 2F9UA 1V2QT 2ANYA 2O8UA 1OP2A 5TCCA 1WAYB 1YPHE 3RU4T 1UVUH 4TWWA 5FAHA 4WMFA 1YCPH 4JZFH 5FPSA 3SYJA 5SGAE 1AZZA 5FBIA 1J17T 2XCNA 1V2LT 3FN8A 1C1VH 1TAWA 1WSSH 3D23A 2GMTB 3KGPA 4NA8A 1UTMA 5C1YA 1GHBF 3MH4A 2ZFTA 3LC5A 3MU4A 5EOKA 5HKKD 1C4Y2 3MYWA 1EUFA 1WDIA 5AFZH 1N8OC 2QYIA 3FOAA 1O3OA 4JZIA 1L1GA 3GYMA 5EXNA 5DP9A 4H42U 4ZKSU 1GJ4H 3BF6H 1JWTA 3RXUA 2RCEA 4ZUHA 4BAHB 1BUIA 1YGCH 1H4WA 2VIPA 3A84A 1H8HD 2ZKSA 3RXRA 3BIUH 1A0JA 1L4ZA 1RGQA 1KLJH 2Z9KA 3PMHB 4FXGH 1KLIH 3D62A 5B6LA 5C67A 3S9CA 1P2MA 3KN2A 2BZAA 1F0RA 1IQNA 4B6FA 2ZDMA 3UWJH 2OXSA 2XBYA 1FY4A 1W0KD 2YMSD 4VGCC 5FPYA 1F5LA 2Y7ZA 3E90B 2BZ6H 2Y7XA 1CQQA 4WMEA 4JYTA 2J4IA 4ISHH 4J2YB 2EQNA 2ODQA 1THSH 2ZO3H 2A5KA 2V6NA 1MTNB 2ZPRA 1UVPA 2D2DA 1O35A 3TH2H 2H5CA 3ZZ7A 4AFSA 1NRPH 3SJKA 2GKVE 4H4FA 1NS3A 2J9NA 1K1NA 1O5CB 4ZKNU 3PRDA 1VGCC 2FOGA 2WYJA 2VJ1A 4R8TB 1BTYA 1UCYK 3B8JA 4NIVA 1AWFH 1J14A 1GDNA 1E34B 1A0HB 1DX5M 1SGCA 3GCHB 3TLOA 1ZGIA 1ELGA 2HNTC 5JB8S 1SGTA 2J98A 4E05H 4GVUA 4CBOA 1FMGA 1TALA 2QCYA 3CENA 1C2GA 3MFJA 1XUKA 1Z7KA 1QJ1B 3PROA 5BPEA 3TNTA 3RXKA 4K69A 1NRQH 2UWOA 1ZMJA 2FS9A 5E2PA 1BBRK 2BDAA 4DIHH 4ACBA 1BMLA 4D7GA 1F0SA 1G3BA 1KXCA 1GMHG 5DP4A 5GWZA 3E8LA 2Z9JA 3UR6A 5C94A 1V2MT 2V35A 1O2NA 1SLXB 5L2ZH 1EP5A 4WXIA 5DO4H 4JK6A 2G55A 2NU3E 2G4UA 1GI3A 2J94A 4JZDH 3V0XA 1TBRH 4KTCA 4Y71A 4JK5A 4NSYA 4TY6A 4CH2B 1TX6A 2AIQA 3RXOA 2XXLA 3VXEH 3DSGA 1BMAA 1T31A 3UOUA 2VH0A 2G00A 4YT7H 3VPKA 2SGEE 1O2LA 4IBLH 1UHBB 1BTPA 2LNCA 1GBIA 2G8TA 1H8ED 1DWEH 2XBXA 3ZYDA 2A2XH 1W0JD 3M5OA 1E37B 3SW2B 1SHYA 1TONA 1HAPH 1QB1A 1YPLH 1W0ZU 2ZC9H 1G37A 2QF5A 4CHAC 2OBQA 1OP0A 3LH3A 1XX9A 4R0IA 5FCRA 4P02A 5C1XA 1O38A 4FUGA 4X2VA 2G5VA 3DFLA 3M35A 4Q7YA 2P8OC 2ZFQH 2FM2A 1BA8B 1O3CA 3RXQA 1CSOE 3MU1A 2JJ1D 3D49H 2KX4A 2XYAA 1TRMA 2SNWA 1QQUA 1MMJN 2SFAA 2ANWA 3Q00A 1O5FH 4CRGA 5KEDA 3TITA 1G3CA 1GJBB 1C5SA 3M5MA 1TGNA 2TIOA 2ZQ1A 4LK4A 3RU4E 5DP3A 1GJ6A 1MQ6A 5JB9S 1FPCH 4KP0A 3SI4H 1SGNE 2OC0A 3VG8A 1P03A 3I78A 3GDVA 1GGDB 3SQHE 4B2AA 4ZKOU 2Z7FE 1OKXA 2EY4C 4UFEH 2KZ4A 2AFQB 4BTTB 1M9UA 1FLEE 1CA0B 2ZHFH 1C2KA 2QV1A 1A2CH 2NU4E 1WQSA 1LTOA 2IJOB 1AKSB 3STJA 4FUCA 2FI4E 2YMSC 4TY7A 4XBBA 3T28A 3GCTG 1SC8U 2CF8H 3S0NA 5HYOA 2FOCA 1MCTA 1LHFH 1GHAG 2CK3D 3A82A 3A80A 3FZZA 3A88A 1P2NA 3PLBA 2A7JA 5F8XA 2A5AA 4GUXA 1O5EH 2WV9A 4UD9H 1O2OA 4YTAA 1COWD 4MLFB 1QCPA 1W11U 1RIWC 4OS5A 5TCAA 1VITG 2FP7B 3TGIE 2Y5GA 3F3BA 2XC4A 3KF2A 2ZU3A 4K1TA 4AB8A 2VWOA 1XUHA 2SGPE 4AG2A 2WZQA 1K1JA 2GV7A 1GMHF 2BVXH 2Y82A 2ZHQH 2ZGXH 1WXRA 2R3YA 2TBSA 2D8WA 3PLPA 1ELFA 2OLGA 3LH1A 2B5TB 2O8MA 2ZGHA 3MI4A 3N7EA 4UONA 3F2FA 2VIVA 2HNTE 1C1UH 5EQSA 4FUIA 1LO6A 5L6NH 1TPAE 1YC0A 2PSYA 1C1SA 1UMAH 3WY8A 1GI0A 1QB9A 2YNAA 3BEFB 1GI4A 2H6MA 3QX5H 2B8OH 2WPHS 3CS0A 1CHGA 5DSFA 5JBTA 3K65B 3OTJE 4I8HA 1YPMH 4I8GA 2IOTA 4RT1A 3RXMA 5DN6D 1SGDE 4XBDA 1HLTH 5AVDA 5HXFA 1TA2A 5FCKA 4FUFA 5T3HA 3A87A 4BTIB 2Y6TA 3DT0H 2Z9LA 3UPEA 1IQKA 4AB9A 2XRCA 1W13U 3LU9B 3SV6A 1ELBA 2BY9X 1C5TA 1LVMA 1KIGH 3RXHA 2VVVA 1B5GH 3TIUA 3FP8E 1HNEE 2C8ZB 1GMCG 2R0KA 3OX7U 3PO1C 3BTQE 2WPIS 1TLDA 3HKJB 2BVRH 3MH6A 4AYVB 4NGAH 3RXIA 1C9PA 2CMYA 1E0FD 1D9IA 1ESBA 4F4OC 5C0TA 1HAGE 1SGPE 3AW1A 1RTKA 1IQHA 1N6XA 1SFIA 2BD8A 2R3UA 1GDUA 1P06A 3SU1A 3NPSA 1QQ4A 1O39A 3QZRA 1QFKH 1C1RA 1VCQA 1OHHD 4AFQA 1CO7E 1NRRH 2VU8E 2XWAA 4VGCB 5K7RA 1G30B 2HWLB 5GIBA 2UUYA 3TGJE 5EJ1A 1NN6A 4XOJA 4BAOB 2PWXA 2GGVB 2Z3EA 1MAYA 2W3IA 4XRNA 2FOFA 3N7DA 1O32A 2R2WU
chains in the Genus database with same CATH topology
1Z1IA 3GCTF 1PJPA 4TPYA 2ESTE 4AGJA 1GHAF 3T25A 1O2QA 1K28D 3M7QA 1Z8GA 1A5IA 1P57B 3LGYA 1S85A 5CHAC 1C5VA 2ZGBH 1FPHH 2BMGB 1RXPA 3E16B 3ODDA 3FAOA 2CV3A 1A4WH 1GJ5H 3KQCA 1MTWA 3K9XB 1GI6A 3PB1E 5GCHG 4ZMAH 7KMEH 3MOCA 1FY5A 1AE5A 1TBZH 1ZSKA 2H2ZA 2FTLE 3ATIA 3PYHA 2UWLA 4A6LA 3P8OA 4WWYA 4U2WA 4CRAA 2SGDE 3C1KA 4YXWD 8ESTE 1GMDG 2AH4X 1Z71A 1NM6A 3U8RH 5AF9H 4IS5A 4ISNA 2ZPQA 1JXPA 1DWDH 1SOZA 1SGYE 1XM1A 2BB4A 4KELA 1C2DA 2GZ7A 4WXVA 5EXLA 2PHBA 1ZPZA 4D9QA 1MH0A 2P16A 2H1UA 2GT7A 2A0QB 3KQDA 5F6MA 5F8ZA 1UJ1A 3U1IB 2J95A 3ATMA 1C4V2 1DSUA 2C4FH 2J38A 3MNCA 3ZVFA 1Y3VA 1EZXC 3BG4C 3O8BA 2BY5X 1C2MA 2ZECA 3M37A 1PPGE 1T8MA 2WUBA 1SLWB 1LPZB 1XKAC 4BXWA 2WINI 3SNBA 1ETRH 2PSXA 4MPVA 5EG4A 2XBWA 1O37A 3ZVBA 3QGJA 1ABJH 2EA3A 4Q7ZA 2PGQB 2FEQH 2XC5A 4K1SA 4Y79A 3LPRA 3MTYA 1IQEA 1G2LA 1IQGA 1EPTB 4O03A 6CHAC 1ELCA 1T8LA 4D9RA 1UTOA 1SSXA 3EGKH 3LKWA 1EX3A 1WV7H 3LOXA 2F9PA 4Z0KA 3A86A 1K21H 1Z6EA 1BCUH 1TMTH 4X6NA 2PKSC 3Q3YA 1OX1A 1FY8E 1UTQA 1AMHA 1O3FA 2CN0H 3HATH 3QLPH 2FOAA 3BTKE 1P3EA 1Y3XA 3DSPA 3TJNA 1DT2A 3VGCB 4BOHA 4X1QU 1L2EA 2QF3A 2BQ6B 3FFGA 1PYTD 2C8XB 1TMBH 1AUJA 1TPSA 4UFDH 3MH5A 3UNRA 1JMOH 4TSFD 4LZ4B 4K3JA 3QWCH 1EQ9A 3GY8A 1SG8B 2R9PA 3UREA 5E0JA 3VFEA 2P59A 1ETSH 3A7TA 4CR5A 1BITA 2BD3A 1G2MA 3BEIB 1WU1A 2FPZA 1TBQH 1TE0A 5C3NA 1GBJA 1O3EA 2BOHB 2ZHWH 1TNGA 3BEUA 4O3TA 3TK9A 5HMAA 5K0HA 3TK5A 2ODPA 1ZSLA 5B6OA 1O2IA 1C5MD 1P01A 2ZNKH 1PPCE 2EC9H 4ESTE 4FUDA 2KCOA 1VCWA 2HVXA 3HGPA 3DD2H 1C1PA 1CHOF 2KAIA 1UCYH 1ZTKA 1S0RA 1T32A 1GHXH 4MPWA 2F4LA 1EASA 1GMDF 2ZFPH 4INKA 3GY3A 4F49A 1MQ5A 1ELVA 3U8OH 1GI8B 1HPGA 4YOJA 1NFXA 2OC8A 5G4BA 4OS4A 1LHDH 1HYLA 2GCTB 1B7XB 2C90B 1YLDA 1BBRH 1UK3A 2BDYA 3UNQA 3ZZ6A 3UB0A 1FXYA 2A4OA 1N1LA 1CT0E 4QT8C 4X1SU 4AORA 2A5IA 1ZTJA 3U69H 1SI5H 1H9HE 4MNYA 3GS9A 4UFGH 2Q1JA 5CDFE 4Z1MD 1PQ8A 1PPFE 3FP7E 2VWNA 4BAQB 3L3TA 4GCHF 1AUTC 2M5TA 4DURA 5EODA 3SGAE 1AO5A 1JRSA 5AHGH 1DITH 2NU2E 4K60A 1EJMA 3SHCH 1UTPA 1DE7H 1GBBA 5DP5A 1P10A 1DICA 3U8TH 1SFQB 3M61U 3OSYA 5JBAS 2G5NA 2H9EH 4DY7B 2KM0A 2ZGJA 1MCVA 1CGJE 1S6HA 3ODFA 4A1XA 2ZZUH 3PM3A 3MU0A 3ELAH 1DSTA 3PO1B 2VWMA 3CS7A 4Y8YA 5T6DA 3VB7A 1ZJKA 2BDHA 2VINA 2PR3A 5LPRA 3C27B 4K8BA 4AG1A 4FUHA 2XW9A 1ELDE 3RLYH 1X7AC 1THPB 4CH8B 2HLDD 1S0QA 2O8TA 2WPKS 1ELTA 1K2I1 3DA9B 2FDAA 2VBCA 4FVDA 4E7NA 2WPLS 2ZCLP 4ZHAA 1QRXA 1RRKA 1SLVB 2SNVA 2QXHA 1JRTA 1KLTA 1RTFB 4B2CA 1PQ5A 3E3TA 2WYGA 1AGJA 1ARCA 1T4UH 1UO6A 3Q3KA 1FQ3A 3GDUA 2TGPZ 3F9GA 5J4SA 1F2SE 4MG3A 1SLUB 1W0YH 2XWBI 3GY4A 3SQEE 1V2ST 5HM2A 1B0EA 1P02A 1PYTC 1ABIH 3RXEA 3N7OA 1MD8A 1VCPA 2W6ID 1BT7A 1RJXB 5CHAB 1C5QA 4FUJA 3S69A 3SZNA 1DLEA 3ATLA 1UTJA 1YCPM 2AHME 1QY6A 1A3EH 2ZA5A 5F03A 5BRRE 1Q2WA 5GPIB 1HAOH 2UUKB 1O2JA 2QE7D 4UE7H 1SOTA 4SGAE 5EGMA 1BTUA 1GBEA 5TJXA 8LPRA 1OWJA 1TGSZ 3MNSA 1NFYA 1KDQA 2BDGA 2FOBA 1BRBE 4NA7A 3TJOA 3F2GA 1ORFA 4ABGA 3ZZBA 1ESAA 3SV8A 2TGDA 3IITA 1XUGA 1EXFA 2ZDKA 1AFQB 2FI3E 3F9HA 3E0PB 4LXBH 1GL0E 3OEHD 3AW0A 2Y5FA 3RXJA 1HAVA 1YM0A 3HGNA 4X2XA 1O3BA 1XXFA 3NZIA 1BDAA 1GBTA 4HTCH 1BJVA 1DOJA 2Y80A 3URDA 3RMLH 2BX4A 4Y10E 1AVGH 1UTLM 3IG6B 3ZIAD 4GPGA 3EAJA 1AIXH 1LVYA 3SN8A 1C1MA 2C93B 3SI3H 1GI7B 3ZZ4A 2K8IA 1YKTA 3A7VA 2HPQH 4KGAA 3WWBA 1S81A 3BG4B 4ABJA 5FL7D 4PROA 1ELEE 4M7GA 4XBCA 5E2OA 5C20A 7ESTE 1TFXA 1MZDA 4Y7BA 2ULLA 1BMFD 4ZHLU 1Q3XA 2PUQH 4Y8ZA 5JYIA 1SKYE 2GTBA 3SV7A 2KAIB 5E0GA 1GI1A 1QA7A 2B9LA 2G4TA 3F6UH 3RXAA 2W7SA 2OTVA 3P8FA 4UEHH 1TOMH 3ZVCA 2QC2A 1NU9A 2PLXA 1GG6B 5JDUB 1SGFA 1IQMA 1C5PA 1CVWH 1D4PB 2FYRA 2AIPA 2V0BA 2BDIA 3T62A 1A5GH 2C8WB 6CHAB 4H6SB 1C5NH 2FOHA 3OU0A 4MTBA 1O3PB 2BD4A 2OD3B 9LPRA 1SPJA 2IN2A 1GI2A 2W3KA 1FAKH 2PTNA 1C1TA 2P93A 2O8LA 2J34A 3SBKA 3GCNA 3LJJA 3RDZA 1FIWA 2RDLA 3M5LA 3RXBA 1V2UT 4UDWH 4X2YA 1AB9B 1MKXK 1BMNH 2R0LA 1LKAA 3SNDA 2K0QA 1SQOA 4NSVA 3ZZ8A 2ZPSA 1SVPA 2CF9H 3BTME 1WTHD 4GLYA 5FPTA 5FBEA 2VIWA 1CBWC 5ABWA 2XCFA 5DJ7A 5T6FA 4AFUA 1LDTT 4D8NA 1C2IA 1BTHH 2AERH 4AX9H 1WQVH 3ATKA 1BTXA 1GBMA 1GBCA 1MU8B 1SBWA 2OBOA 4MQAA 2ZQ2A 2A31A 3BTDE 1OWHA 1RS0A 1O3KA 1GHWH 1CA8B 1GHYH 1TGBA 3O8RA 1XMNB 1P9SA 1TPPA 2ASUB 2Z9IA 2XTTB 3M3TA 4K1EA 4JMYA 3RMOH 1BHXB 2B7DH 2VIOA 4YT6H 2D26C 1RFNA 1GJAB 3KL6A 2JH5D 1MTUA 2HOBA 2NU0E 1OP8A 1TNKA 2NWNA 1ESTA 2VGCC 4A7IB 2EI8A 1KXAA 2ANMH 4HGCA 1W8BH 4OGXA 4YZUA 3ZVAA 4FU9A 3BTTE 5ETXA 2ALPA 1C2FA 1EZSC 4AFZA 5H4IB 1HIAA 2KR7A 5GDSH 1Z1JA 2KCYA 1O2PA 1ZPBA 3A89A 2CHAC 1QR3E 1ZRBA 2OC7A 5LPFA 1NPMA 1LHGH 1DVAH 4YLQH 2ZFRH 1HAZB 2ZFSA 2BLWA 3MH7A 1YYY1 2GP9B 2BM2A 1GPZA 3ZV9A 1P04A 1N8OB 1S5SA 1H9LB 4B1TA 1H8DH 5C5NA 1W7XH 3F2HA 1EAXA 2V3HH 1P05A 1V2PT 1BTZA 1ZMNA 1W10U 1FUJA 1NFUA 5F8TA 4RSPA 1C4U2 1DDJA 2ZIQH 3AK5A 3GOVB 1MBMA 3RXFA 3NKKA 3SU6A 3RM0H 2QN5T 4YOGA 1EP6A 2STAE 1C2HA 2BYAX 2A2QH 1JBUH 3T29A 4J1YA 2XC0A 2G52A 5A8YA 2BD9A 3A7ZA 2ZTZA 2ILNA 1O3GA 4NZLA 3W94A 1AHTH 3SJ8A 3UFAA 2AEIH 4ISLA 1P9UA 2QXGA 3ZZCA 1C5WB 2EI7A 2Z3CA 3GY2A 1MTNC 4FUBA 4ASHA 2OP9A 4IW4E 3B9FH 1QIXB 5FHTA 3PTNA 3DCLA 5DP8A 2LELA 1VR1H 1K1PA 2G81E 4CRFA 1P2QA 4RKJB 4A1TA 4IN2A 3L6PA 1O3HA 1GWAA 1SB1H 5CE1A 1ZZZA 3V12A 3UQVA 3QN7A 1VITH 1ETTH 2ZDVH 4BAKB 2JH6D 1MTSA 2FODA 3PMAB 3V3MA 4DW2U 1W7GH 4TT3D 3F0OA 1PPHE 4B71A 3RXCA 1QTFA 1VGCB 2A7HA 1P3CA 2BXTH 1QRWA 3P8NA 2BX3A 3OY6U 3NWUA 2GX4A 3GCHC 1C5ZB 1HAYB 2W5EA 3KNXA 1GHVH 3GCOA 1TQ0B 1FN6A 1WOFA 1VITF 2HALA 1F92A 4YLUA 1MZAA 2I6QA 4I8KA 2VIDA 2HLCA 2C3SA 3A8AA 1FNIA 1F7ZA 1SL3A 1Y3YA 4DCDA 1LQDB 4WJG2 1QNJA 1PPEE 1ACBE 4WMDA 3TJVA 3SJIA 1XKBC 3MWIU 3VB5A 2FOEA 5C17A 1ZHRA 1H1BA 1Y5BT 3NXPA 4DT7B 1G36A 1C1QA 3UY9A 1K1MA 4NWKA 1KXBA 3UWIA 4DVAU 1YLCA 2Y81A 4U30A 1IHSH 3UQOA 1AQ7A 1F0UA 2GCHG 1KYNA 4DOQA 1E35B 2AMPA 1SHHB 4OS1A 1PQ7A 5T6GA 1KSNA 1KXEA 4TPIZ 4AZ2B 1S84A 1E1QD 2XOKD 1CT2E 1LVOA 4OM9A 2J5UA 3U98H 4DGJA 3GY6A 1C9TA 2BD5A 1HDTH 2A7CA 5ESBA 1YPKH 1AD8H 1GVLA 3KQEA 2IPHA 1TNIA 1GI9B 3F68H 3EA9A 2WUCA 3SU5A 1XUFA 1F5RA 3W95A 3LGWA 1HRTH 3H09A 3P70B 4CRDA 2QA9E 1EAWA 4CREA 3NRLA 4CHAB 3KEEA 1LHEH 3PMBB 1EB1H 1MAXA 1V3XA 5FX6A 4D76A 4Q63A 2BY8X 2AGIX 2FWWA 1GMCF 2BLVA 1J8AA 3SORA 2ZG0H 5CHBA 3RXDA 3SGBE 2P8OB 2UUJB 5DP7A 2M2AA 1P8VC 3ZZDA 1GCDA 3Q3XA 1HB0B 2L6OA 1ZHMA 4I8JA 1MKWK 3Q76A 1LPGB 5EW1H 2B0FA 4FETA 4RKOB 1WCZA 2BXUH 5HGGA 1RTLA 3HKIB 2V3OH 4NA9H 2ZHEH 1FDPA 1O2MA 1PPZA 1IQIA 1TMUH 3JZ2B 1O3DA 3BSQA 4ZAEA 4NIXA 4X2WA 4E06H 1V2TT 1VJ9U 3LC3A 4Y11E 4JCNA 4NG9H 1GGDC 4MNXA 1UCYE 2FLRH 3VB6A 1GDQA 1CT4E 1CA0C 1OPHB 3M5NA 3FKSD 1ZSJA 2FOMB 1HIAB 4XE4A 1GJ7B 3WWFA 1QJ6B 1FY3A 1GCTC 1QBVH 2DUCA 2BD7A 4KTUA 3T2NA 4YO9A 4X8VH 5C2ZA 1SGRE 2A4QA 3DHKH 3SGQE 1EOLA 2F9NA 1QURH 2YMSB 2ZDNA 1MBQA 1UHBA 1FZZA 1BBRE 2EI6A 3SU0A 5GXPA 2P94A 1ZRKA 4NFEA 3GY5A 1K22H 1Y3UA 1MD7A 2JKHA 2GDDA 3ZVEA 1ANDA 2FX6A 1C5YB 3ZZ5A 2D1JA 5GCHF 3RUOA 3EQ0H 4ZROA 1DUEA 3M7TA 2DE8A 1O2RA 2Z3DA 1BZXE 1OWIA 2OK5A 1CBWB 1NT1A 1DANH 5C1UA 2PKAA 1RIWB 1TNHA 1C2EA 1P12E 4BANB 1HJAC 1OXGA 1INCA 5L2YH 1E79D 5ESTE 2VVUA 3EDXB 1AWHB 3BIVH 5DGJA 3P8GA 4Q4LA 3SUDA 2P3TB 1NZQH 2QF4A 3O8DA 3TJUA 5DP6A 4ABAA 3TU7H 4X8TH 2ANKH 4NFFA 1TOCB 5JPMH 2BD2A 2RA3A 1A7SA 1O0DH 3RMMH 4DJZB 1O2XA 5A8XA 2W7UA 2VGCB 2PW8H 2BVSH 3A8CA 4UFFH 3F0PA 1W2KH 4ISOA 4ZKRU 4KKDA 1CU1A 1IQFA 4WF8A 1DUAA 1FI8A 3UIRA 3DSOA 3FZDA 3P92A 1TX7A 3URCA 1AKSA 1NBMD 4BAMB 1SGQE 2CHAB 1O3JA 4MDSA 1XVMA 1HBTH 1C5UA 5JBBS 1C1OA 1OOKB 3TK6A 1BJUA 1ANCA 3A8DA 1ZPCA 3SV9A 2CJIA 2IJD1 1ZR0A 1YBWA 2AGEX 1LMWB 8GCHG 4FU8A 5IYTA 1TA6A 5C0UA 4B75A 1GJDB 1O36A 1ZOMA 3PWCA 2PV9B 8KME2 3MHWU 4OS7A 5J4QA 1UTNA 1TNLA 2Z9GA 2JETC 4FU7A 2ZCKP 1GHZA 2BLQA 1G9IE 1HJ9A 1O30A 1KY9A 2A45B 3K6YA 4Y0YE 1DWBH 1LQEA 1QL9A 1DS2E 1GBKA 1GI5A 2F9VA 1SQTA 1KTSB 4HI3A 1AVXA