2OC1A

Structure of the hcv ns3/4a protease inhibitor cvs4819
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
molecule keywords Hepatitis C virus
total genus 46
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oc1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oc1A01
2QXHA 5DP9A 4YTAA 1KDQA 3QGNB 4MNXA 5FCKA 4OS6A 3AAUA 3VFEA 3GCOA 2FP7B 3OTPA 3UREA 1NM6A 2ZNKH 3UQVA 5A0AE 1C5PA 3VEQB 2FOGA 4XE4A 2QXJA 3BTQE 1CHOG 4AG2A 3B23B 3EDXB 1O37A 4X0WU 2WPKS 1AE5A 2XYAA 2PTCE 1C2MA 1XKBC 1BZXE 4AN7A 2ZDNA 4X6MA 7GCHG 1NRPH 1ABJH 1TQ7B 1MKWK 5AHGH 3ZV9A 1HUTH 2AIPA 4NZQA 1ANCA 1ELBA 2FOAA 4XFQA 1GJ6A 1THRH 3RXGA 1GI9B 4TPYA 1G3DA 5DP8A 4ZHMU 3ZVCA 1DFPA 1TE0A 1WV7H 3QTOH 1EZQA 1CT2E 2Y82A 4YT7H 5FBEA 2XW9A 4D9RA 1O2TA 1GHBF 1YPHE 2OD3B 3RMOH 1YF4A 1JOUB 3TK5A 1ZJDA 3DHKH 4GLYA 3RXUA 3WY8A 1EP6A 3ZZ5A 4F4OC 4KTCA 3A8CA 5IDKA 1UK3A 1AN1E 1QB9A 3T2NA 1D3PB 1Z6JH 1O2ZA 1O32A 1YBWA 3A8AA 2BMGB 1O5EH 3UR9A 3SW2B 2FO9A 1GBKA 5FXLA 1ZRKA 1G36A 4VGCC 3RXPA 3STIA 1NPMA 2V6NA 3P8OA 2FDAA 2XC5A 4H6TA 1O38A 2Q6FA 3S69A 2SGFE 5GWZA 5EPYA 1GVZA 1MBQA 1BMMH 4CH2B 1DPOA 1JIMA 3U8RH 4ISHH 1V2WT 1GBTA 1MTNB 1H9HE 2RA3A 1ZSLA 2A2QH 3LDXH 1BRAA 2G5VA 1FNIA 1GBDA 2ZEBA 3LT3A 1YPHC 1AFQC 1QCPA 2WV5A 3BTTE 2FYRA 1GBMA 4FUIA 1SGFA 3GOVB 7GCHF 1J16A 3BTWE 1WQSA 3RMMH 4O97A 1DXWA 4ABBA 1XVMA 1C2HA 3MI4A 3GCNA 1HNEE 1MTUA 3OU0A 4ASHA 1G37A 1UTQA 1LPZB 3A8DA 1H1BA 1SGQE 3RXHA 4NIWA 4AGJA 2PKAB 5A8YA 2FOMB 4E06H 1O3NA 1PFXC 2Z3EA 1VR1H 2HPQH 2ZFQH 3RC4A 1CA0C 3ZVGA 2B9LA 4A6LA 1FAKH 1DANH 3M7TA 1LTOA 4U30A 1TAWA 3PWBA 2UUKB 3PWCA 2DUCA 3RXAA 4JYVH 1HJ9A 2PKAA 1Z8RA 1KTSB 2BY5X 3RU4T 3A7VA 1BTWA 1GI1A 1TBZH 1UCYE 3EA8A 1SFIA 1P05A 2XC0A 3LOXA 2QXGA 2OXSA 2OTVA 1KXCA 1BJUA 1HV7A 5EW2H 3KQBA 4HZHA 1GBHA 1BTPA 1O3LA 1TPOA 3TJUA 1JRTA 1O2RA 4TWYA 3P8GA 1Y3WA 5GCHG 1XXFA 3BTFE 5EG4A 1AI8H 1TPAE 1W11U 2STAE 3ODDA 5F8XA 4WMDA 3QLPH 3CENA 3EYDA 2HLCA 3SNEA 1SLUB 3PV2A 1A46H 2Z9GA 1UVSH 3C27B 1P9UA 1T31A 1T8NA 4H4FA 3AASA 4Q7YA 1ELTA 5EW1H 2A7JA 5TCCA 1O39A 2OLGA 4AG1A 1C1MA 1FY4A 4R8TB 3LGUA 1P03A 4AB9A 1B5GH 1DE7H 2P59A 2ZGJA 3KCGH 1DXPA 2JKHA 1C2GA 2BVSH 1QTFA 2GDEH 4MTBA 2VBCA 3IG6B 3A8BA 1V3XA 2ODYB 1UO6A 1G32B 1MQ5A 4I7YH 5DKMA 4TYDA 1AVWA 4WWYA 4AX9H 3A7ZA 4ZXYH 1F0UA 1TX8A 1SR5C 4B2AA 1LVYA 1EJNA 1SI5H 1VCWA 3A83A 3VPKA 2G52A 2GV7A 1C5QA 2ZU5A 1CBWB 2AH4X 1LMWB 4AORA 3K9XB 1MKXK 1RFNA 5I46H 2Y5HA 4NSYA 2HNTE 5GXPA 3IITA 1TRMA 2PFEA 2ZF0H 1AKSA 1D3TB 2R0LA 1FMGA 4ZMAH 4I31A 1A0LA 3D62A 2GP9B 3AAVA 2PSXA 3LIWA 5TCAA 5JB8S 1TMBH 1LVMA 3I77A 3KQDA 1A61H 1NU7B 5EQQA 4AB8A 3T27A 5I25A 4CREA 5AFZH 4ABJA 2PKSB 9LPRA 2HOBA 3P17H 3EA9A 2VWNA 2OC7A 5C1XA 3S7HB 2BQ7B 2BTCE 3QTVH 2B0FA 3B9FH 1O2YA 7KMEH 2G4TA 4AZ2B 3SHCH 4ZKSU 1IQMA 1GMDF 3SGAE 4HGCA 1QRWA 1O3JA 1AY6H 1UTKA 2BD7A 1P2NA 2VWOA 2J94A 3HPTB 1BA8B 1A5GH 1GVLA 1AD8H 2A7HA 3GISB 4SGAE 4CBNA 2AMDA 3KN2A 2J2UA 1RS0A 1U6QA 1HAVA 4IS5A 1JWTA 3NWUA 1EP5A 3LONA 1T8OA 3NK8A 3ENSB 1DUEA 1NESE 4K1SA 4NIYA 2FOBA 4U32A 3S9AA 3ZV8A 1DLKB 3RXCA 1PPCE 1CA8B 2JH6D 2ZDVH 4WVPE 1MD8A 1TMUH 1ELVA 1Z8IB 4X2XA 4GPGA 1E0FD 1FDPA 1ZTLA 4DVAU 1CSOE 2PLXA 2Z6BD 2OINA 2VGCB 1YLCA 4IMZA 1C5RA 3CS0A 3RMLH 5FPYA 4K60A 4RKOB 2BDAA 3KHVA 2P16A 1GGDC 2TPIZ 5T3HA 1HFDA 1TBRH 1CHOF 3SO3A 2J34A 4CHAB 4YOJA 4X1SU 2Q6GA 5A2MH 1HAVB 2EA3A 2BD3A 2XCNA 3A80A 3U8OH 3A84A 3SUDA 2PWXA 1QHRB 2PSYA 1ARBA 1BQYA 3UTUH 6GCHF 2QN5T 2AFQB 3KIDU 2P8OC 4IBLH 4CRDA 3M37A 3RXTA 1T8LA 2FI5E 5EGMA 1P2OA 5EQRA 4M7GA 1ESTA 5E0HA 1Z1IA 2HPPH 4GUXA 1CE5A 2XC4A 1O2WA 1JIRA 1F5RA 1E35B 1YPKH 5C1UA 2HNTF 1LHDH 1L1NA 1GGDB 2GT8A 3KL6A 1J8AA 2VIOA 2FM2A 3PLKA 3QWCH 3U8TH 4X1NU 2QY0B 4JK6A 1S85A 1SLXB 2GCHG 1S6FA 2K1QA 1W7XH 1OWHA 4Y6DA 4AFSA 2VWLA 2VGCC 3RP2A 2Z9IA 4ISLA 2O8MA 3STJA 4IMQA 1O2KA 3FANA 1VCPA 2VIPA 5DO4H 1BB0B 3TK6A 3K65B 6CHAB 1EOLA 2R3YA 4DGJA 1D3QB 1FV9A 4ABEA 4GVUA 3PROA 1DT2A 2TIOA 2Z7FE 4B6EA 4UEHH 1TWXB 5F03A 2Z9LA 3H7TA 2BX3A 4ZHAA 1BTXA 2A4QA 2VJ1A 4X8VH 3O8RA 1AE8H 1EPTA 3A82A 5ETXA 1JMOH 3TU7H 2PGQB 2VU8E 2ZHEH 3ATWA 4OM9A 2KAIA 1NFXA 1L0ZA 1C1RA 4WH6A 1IQHA 2STBE 1OWEA 4UONA 1G3CA 1P0SH 1Y3YA 2HVXA 4ABGA 1GJ7B 1PYTC 2W3IA 4KELA 5F8TA 1TMTH 3GYMA 4AYYB 1UVPA 1MCTA 4BAMB 2BLVA 1LHEH 1SSXA 4JYTA 1O3AA 1ZTJA 3Q3YA 2VIVA 3RUOA 1HB0B 3RXQA 4Y8YA 2A4OA 4OS1A 1C2LA 3OTJE 1E37B 1D6RA 4XDEA 2XBYA 3ATLA 3QGJA 3LGTA 1VZQH 4MVNA 3BN9A 3SU3A 1HAGE 2NWNA 1GBJA 1F0RA 1WBGB 1YYY1 4J2YB 3MH5A 2ALPA 2A31A 2QF0A 1DDJA 1DSUA 5DPAA 2ZA5A 1DSTA 3RXBA 4WF8A 1EKBB 2ZCLP 2OQ5A 3TGJE 1L1GA 1C1PA 6ESTA 1KLTA 3DD2H 3PLBA 4DY7B 1GHBG 3UOUA 2BXTH 1PQ7A 3D49H 4Z6AH 3TITA 3VB5A 2ZECA 3GICB 5CHAC 4XSKU 1RTFB 2WPMS 2G00A 3NZIA 1ID5H 1TGSZ 4AOQA 1LKBA 1UVOA 3A7YA 4BNRA 4WJG2 5EPNA 4YM9A 3PYHA 4K1EA 2O8LA 4DIIH 1C2EA 1D9IA 1EZSC 5DP4A 5FHTA 1V6DA 1HJAB 2F3CE 1K1MA 3FP6E 3L33A 5T1VA 3RMNH 1TOMH 5C5OA 1ELGA 1D3DB 1MZDA 1GJ5H 4MNWA 1BTYA 4I32A 2HWLB 2VIDA 1C4V2 4MQAA 1SC8U 2FI4E 1C1VH 3E91A 2B8OH 2A1DB 1YPGH 1FJSA 3U69H 5GPIB 1E34B 1LDTT 2GTBA 1B7XB 2NU0E 4TY7A 2ZWLH 1GHAF 2WPJS 1EAUA 1FUJA 4OS4A 5JPMH 1NN6A 1H8IH 2GZ8A 2DE8A 1GHXH 1Y8TA 1L4DA 1CO7E 2H5CA 2ZQ1A 1IQKA 3F6UH 4FVDA 2ZGCA 1N8OC 4XBBA 3TGIE 2IOTA 2WZQA 3NKKA 4NA9H 1KXDA 2WUBA 1NZQH 3P95A 5HYOA 1C5TA 2P93A 1FN8A 4F49A 1O5GH 2VWMA 2GV6A 5IYTA 2QF3A 1VGCB 2FS9A 1AUJA 1HIAA 2PUQH 4NWLA 4OS7A 3RXIA 1W13U 5A0BA 4KTSA 2VINA 1QJ7B 2M5TA 1BHXF 4GAWA 1GI8B 2EEKA 3UUZA 1BJVA 2ZI2H 2P94A 1ZPCA 2C3SA 3UR6A 3ZZ6A 3A7WA 4BANB 5F6MA 2C8ZB 2VIQA 1O2HA 5EODA 1NRQH 1TNJA 1GI4A 2SGQE 2FX6A 4INKA 2ANKH 2VVUA 4ABIA 1TNGA 1CT4E 3PMBB 1QIXB 3ZVBA 1EAWA 1HAHH 1PQAA 4X6OA 2ZIQH 1RTKA 5DP5A 1VGCC 4CH8B 3RXRA 1AO5A 2FOFA 5T6DA 3U98H 1SLVB 2A0QB 2V35A 1C5NH 4J1YA 1DUAA 4ZHLU 2ZTXA 1YC0A 1C5LH 1TRYA 3ATKA 1HIAB 1AUTC 1BRBE 2ZPQA 3MNSA 4H6SB 5GJ4B 1UTJA 1DWBH 1SFQB 1LHGH 2H5DA 3MHWU 2JETC 2WPHS 1BCUH 1NU9A 2A7CA 3RDZA 1ETRH 1LPGB 2FPZA 3K2UA 4D76A 1ACBE 1SGRE 3SHAH 1O31A 1P2KA 1C1UH 2ZP0H 2Q6DA 2ESTE 2F9VA 2WV4A 1N6XA 5JBAS 1Y3XA 3DFLA 1GI6A 2W26A 2Z3DA 7ESTE 1P11E 3SUFA 4DG4A 1BT7A 3BEFB 1TIOA 4D7FA 6LPRA 3RXMA 1W2KH 1FN6A 1NROH 1IQEA 5L2YH 1VITF 2OBOA 3OX7U 1GG6B 3M5OA 1EZXC 4Y71A 3UFAA 4RKJB 3TK9A 1C2DA 3HGNA 4NCYA 5J4QA 4DIHH 1SGYE 2KAIB 1V2MT 1RIWB 1G3EA 1N1LA 1SGFG 1BTUA 1UTNA 1INCA 2A4RA 1UK4A 3ODFA 3RXOA 1KXBA 1SGTA 1Z7KA 4FUEA 2F9BH 1HAIH 4YZUA 1TNHA 4X6NA 1EJAA 3V3MA 2BY6X 5EQSA 1CHGA 6GCHG 1WU1A 1W7GH 1ORFA 4NFEA 1GMCG 3SV2H 5FX5A 1EXFA 4IN2A 5LPEA 3NUMA 1EAIA 3M61U 4JCNA 2IPHA 3M3VA 4U01A 1P3EA 2QIQA 3SJIA 1NY22 1AB9C 1BMLA 2FODA 1UMAH 4JZDH 4Q80A 4X8SH 4ZKNU 2FIRH 1FZZA 4MG3A 1OWDA 4O3TA 1S0RA 3MOCA 2TGAA 3TNTA 2J4IA 1O3MA 1GMHG 3PO1B 3GCHB 1FIZA 1O5DH 4ISIH 3M5MA 4BTIB 1SG8B 4BTTB 2P8OB 1BRUP 1CBWC 3B8JA 1J15A 2AMQA 3LH1A 3ZZ9A 1NT1A 2C8YB 1WAYB 4BTUB 3Q00A 2FYQA 4D8NA 2J9NA 3PMAB 3QK1A 1T4UH 4AFQA 1Y5BT 2FESH 1WCZA 1JXPA 2Z9JA 3UIRA 3ZZCA 3MU1A 2FMJA 2PTNA 5JBTA 5GNDA 3T28A 3E16B 3KQCA 4YO9A 3ATMA 1SHHB 1GI5A 1RXPA 4UFGH 2A5AA 1ELDE 1O2PA 4WMEA 1C5SA 4YLQH 1GBEA 2BLOA 1TONA 1F0SA 4B71A 2Q1JA 1CQQA 1LQDB 1QBNA 2YNBA 1SGPE 1YCPK 4RSPA 3HK3B 2OUAA 1A7SA 1F0TA 4O3UA 1TALA 3UNRA 2CN0H 2OC0A 4INLA 1NRRH 1ZRBA 3FP7E 4NFFA 4NIXA 3QZRA 4GSOA 3JZ1B 3M5LA 3ATIA 4QT8C 3F9HA 5HXFA 4YOIA 1Y59T 1AVGH 3LU9B 1IQNA 1K1PA 2GGVB 3BIUH 1H4WA 4TWWA 3SNAA 1GJDB 2AMPA 1P02A 1GDNA 1KSNA 5JB9S 3MO3A 4ZXXH 3MNBA 3SGQE 1VJ9U 3M3SA 1BMAA 1N8OB 1O2SA 1V2TT 2ZGBH 1SQOA 4K1TA 1ABIH 3MH7A 2WYJA 1RTLA 1NS3A 3RXVA 2BX4A 5A09A 4JZFH 4R0IA 1QGFA 3F9EA 2H9TH 1HPGA 1V2VT 2ULLA 5J4SA 1KLJH 4LZ1H 2BDGA 1FAXA 3SJKA 3GY7A 2EI6A 4NA7A 1WXRA 2J92A 2C93B 2OC1A 1Z6EA 2RCEA 3O8DA 4I33A 1C4U2 3ZZAA 2GT7A 2AGEX 1UHBA 1HAZB 3MYWA 1DS2E 3QUMP 1OKXA 4DJZB 1O2VA 2ANYA 1KXEA 3K6ZA 1QL9A 4K5ZA 3GDSA 2Y81A 2CGAA 3TVJB 1K28D 3A86A 1EPTB 1VJAU 2H1UA 3T5FH 4GCHG 1XVOA 3MFJA 3SU4A 4CRGA 3ZYDA 7LPRA 5GDSH 3SORA 3TGKE 3MU8A 1ZSJA 3TJVA 2ZTZA 3ZVDA 1JRSA 1K1IA 1ETSH 5DP6A 2F9UA 1SGDE 1QA7A 2BLWA 5BRRE 3RU4E 5A0CA 2PW8H 1A5HA 4B6FA 1GI7B 2YNAA 2QCYA 2WHXA 1C1NA 1QQ4A 3H5CB 1F7ZA 2F9PA 3S7KB 1OWKA 2FOEA 3QZQA 4ZKRU 5CMXH 2QXIA 3A87A 3ZZ3A 4KP0A 4BAHB 3F9GA 4JZEH 3V7TA 1GHAG 1ZMJA 1AIXH 4PROA 1A4WH 1W14U 3AVZA 3PLPA 1O2MA 4ABAA 5PTPA 1C5MD 1XUFA 2A32A 4MNVA 1Z1JA 2OCVB 3TLOA 1MH0A 1EX3A 1K21H 3SV6A 2VIWA 2ZCHP 3D65E 3NCLA 4FVBA 1SL3A 5C1YA 2OP9A 2ZU4A 2R3UA 1SHYA 1Q31A 1KIGH 2BVRH 4AGKA 1NFWA 4DCDA 1TABE 1MTVA 3F1SB 1FPCH 3M36A 1A3EH 3A89A 4X1RU 3LGIA 4AFUA 3SJ8A 4B73A 3QDZB 2FWWA 1O3EA 1UK2A 5E2PA 5E0JA 1ELEE 1ZHPA 3O8CA 1ZZZA 1QRXA 3MU5A 2FXRA 4TY6A 1AVXA 3EQ0H 3RLWH 3MMGA 1O3BA 4E05H 3GYLB 9ESTA 2O8TA 3GY2A 8ESTE 1GI0A 1C2JA 4Y7AA 2SGDE 3TIUA 1ZMLA 4ABFA 1L4ZA 4ISOA 1YPEH 1B0FA 1C1WH 4H42U 1GBFA 1ZJKA 2PKSC 1HAPH 5FAHA 2UWOA 5F8ZA 1O2JA 2P3TB 4B2CA 3D23A 1AKSB 3SJ9A 3GY6A 4U2WA 3QX5H 1FONA 4O9VA 1EATA 4NZLA 4LZ4B 4JYUH 1WOFA 2I6SA 3UQOA 5HM2A 5ABWA 2GMTB 3SQHE 1K22H 1BTZA 3PTNA 3IWMA 3V12A 1QA0A 1F5KU 5EOKA 2BD8A 1TPPA 2PV9B 3W95A 3ZZ4A 2QGRA 1QNJA 2HALA 1S6HA 3UNSA 1SMFE 1ANDA 1SLWB 4JK5A 1LVBA 1O36A 5A8XA 2TRMA 1MU6B 3ZZ7A 5JBBS 3KQEA 3OYPA 2F83A 2XCFA 1DVAH 1HBTH 1O3KA 1ETTH 2RDLA 1O3CA 1KTTB 3TPIZ 4GHQA 2BLQA 3E1XB 2H2ZA 2UWLA 1DM4B 4HI3A 1TQ0B 1LVOA 2G4UA 1D4PB 1THSH 3UWIA 1E36B 3CP7A 1AZ8A 1TB6H 1GCTC 3K6YA 2WYGA 1UTLM 3LGYA 2RG3A 3UNQA 5C5NA 2BZAA 4ESTE 3FAOA 2OBQA 1O3PB 1O34A 1K2I1 5FCRA 2ZU2A 3SZNA 2ILNA 5ESTE 3RXLA 4BOHA 1A0HB 1TGBA 1A5IA 4I8LA 4K8YA 5JDUB 1ZYOA 4CR5A 1GPZA 3A7TA 3C1KA 1C2IA 1IQGA 1DITH 1H9LB 1TX7A 2CMYA 2BYAX 2D8WA 2NU4E 5G4BA 1C4Y2 3AW0A 5E8EH 5FBIA 3SZEA 1GI2A 2PUXB 1MKWH 2ZCKP 5B6OA 1NFUA 2ZDKA 2JH5D 1DWCH 5C67A 3SV7A 1UHBB 1WTHD 3E6PH 1Z8JB 1PPHE 3AK5A 4X8TH 1X7AC 3O8BA 4FUBA 2BM2A 1GHZA 1HXFH 1LO6A 1OX1A 5JYIA 3BIVH 2ZFSA 3TJOA 1P06A 3L3TA 4CHAC 3VB7A 3TH2H 4AYVB 1TX6A 1TNLA 1FI8A 1XX9A 3F68H 3MNCA 1HXEH 2CHAB 1V2RT 1K1LA 3SQEE 4UE7H 4JMYA 5AFYH 1HJAC 1IQJA 3E90B 4THNH 2ZKSA 1PQ8A 4B1TA 5BPEA 1EASA 2V0BA 1S82A 2G55A 5L30H 4YOGA 1CGIE 5L6NH 4A1VA 1G2MA 1PQ5A 3BTGE 2P3UB 1C5WB 3ITIA 1EB2A 3BF6H 1NRNH 4MNYA 1GCDA 4K8BA 5JBCS 3GCTG 1YKTA 1HDTH 1KDQB 2Z94A 5DK1A 3SBKA 3ZZ8A 1NFYA 3F9FA 2LNCA 1DLEA 4I8KA 1N6YA 4CRBA 1YCPH 4JZ1A 3EA7A 3RXDA 1MAXA 2FS8A 2ZZUH 1ZR0A 3UPEA 5EXLA 2QA9E 3BSQA 1MBMA 1ZMNA 4DT7B 3LJJA 4ZAEA 6CHAC 1FXYA 4A7IB 2C8XB 3LKWA 1AU8A 1EB1H 1XMNB 3A85A 1BDAA 2G51A 4BXSA 2C4FH 1AWHB 4ABHA 3SU5A 5DGJA 1O33A 3LGVA 2PGBB 2R2MB 4Y76A 1SQAA 1KYNA 3E0PB 1GMHF 1BIOA 2HRVA 1WTGH 4IN1A 4LOYH 1QRZA 1EAXA 2C8WB 4MPWA 1GJAB 2A45B 2LPRA 4Q2KA 4WMFA 3SUEA 3MWIU 1QURH 3MTYA 3SYJA 2QV1A 3A88A 3BTHE 1T4VH 3RXJA 1GBLA 3SJOA 4D9QA 2BY7X 1P57B 2XRCA 1S83A 1ZHMA 1BHXB 1BUIA 1XUKA 1UTOA 2QYIA 1DWEH 2V3OH 1F5LA 1GDQA 2RA0A 2SGAA 3W94A 1O5BB 1BRCE 4FUDA 2BDHA 1TA6A 1T32A 4LK4A 1RJXB 2GCTC 3M3TA 1BMNH 1WSSH 2A4GA 3Q3XA 3SU0A 1BBRH 1IHSH 2ODPA 3DFJA 3MU0A 1GBBA 2NU3E 4HFPB 2GKVE 5K7RA 5A8ZA 4NGAH 1BBRE 1EOJA 2P3FH 1P10A 1VITH 1KXAA 1TGNA 4RN6A 3OY5U 3JZ2B 4Y8XA 3SN8A 2O8WA 2ZPRA 2AEIH 3S9CA 3DUXH 1SVPA 4FU7A 1BTHH 1YGCH 3MH4A 1ANBA 3RXEA 2GZ7A 1ARCA 4O03A 1QY6A 5AVDA 1HAXB 2D1JA 4WH8A 4WY3A 2ZFRH 4ABDA 1J14A 1IHTH 4KKDA 2W7UA 1G2LA 1GHYH 1GJCB 1LHFH 2WV9A 3MO9A 2D26C 3HGPA 3ZZBA 1M9UA 2GCTB 1EUFA 1VCQA 2PHBA 2ZFFH 4M9FA 1DY9A 1DX5M 1C5VA 2GVFA 2SGEE 1MKXH 4NIVA 2UWPA 1QFKH 2I6QA 1W3CA 1AMHA 3KEEA 5EXNA 1FY3A 1ZPZA 4NA8A 1V2NT 3P92A 2CF9H 1K1JA 4UDWH 5FPTA 3M35A 1W10U 1ZGVA 2ZGXH 2ZPSA 2H9EH 2ALVA 5TJXA 1EQ9A 2BOHB 3HATH 1P9SA 4XBDA 1C5ZB 1V2LT 3PTBA 2BVXH 1J17T 2VVCA 2BD9A 3BG4B 2GMTC 5EXMA 2ZGHA 1WQVH 2Z3CA 1Y5UT 2Y5FA 1A2CH 1V2KT 4INHA 4X6PA 3LH3A 4Y0YE 1Y5AT 2Y5GA 5E0GA 3LC3A 3H09A 4X1QU 1TLDA 1Q2WA 3PB1E 3RC6A 3G01A 4BAKB 2G81E 1MU8B 1YLDA 3A81A 2XWAA 2FZZA 2XWBI 4B75A 4BAQB 1NC6A 2NU2E 1TFXA 1MAYA 4DOQA 2QAAA 1GCTB 4MLFB 3FZZA 2ZHFH 5T6FA 1RIWC 3BEUA 3KGPA 2G5NA 4FUJA 5H4IB 3BEIB 1GL0E 1HYLA 1QB1A 1YM0A 2IJOB 3RC5A 3I78A 1TGCA 3KF2A 5FX6A 1CGJE 2XNIA 1VITG 5C2ZA 2A5KA 1P04A 1FY1A 4E7RG 2WINI 1V2OT 3S9BA 4A1XA 1HGTH 1OYQA 5B6LA 2UUYA 1OP2A 1BBRK 1SGCA 2BDCA 2BDYA 4I8HA 4WXIA 2THFB 2TGTA 4ISNA 2ZU3A 1LPKB 1MUEB 3H7OA 4YT6H 3T25A 2O9QA 3EAJA 1XXDA 3SI4H 1SB1H 1GI3A 4Y7BA 3ESTA 4OGYA 3MH6A 4FU9A 3SUGA 2OQUA 1JBUH 3FVFB 1SOZA 1MTNC 2XBWA 2AS9A 4IC6A 1W0ZU 1GMCF 3URDA 2BDIA 2BD5A 4DURA 2ZG0H 2SNVA 2Y6TA 1QJ1B 1YPMH 3P70B 5E2OA 5HMAA 8KME2 5HGGA 1MMJN 1UCYK 1THPB 3RM2H 1PPFE 3LPRA 2BY9X 1ZTKA 1K1NA 4A5TS 1AWFH 1V2UT 2VB0A 4ZROA 4FXGH 1XUJA 1GJBB 3Q3KA 1L2EA 1P01A 2ZC9H 1FY5A 3T26A 1FLEE 1F92A 1O3FA 2W3KA 4NWKA 3BTDE 1ANEA 4UFFH 3PMHB 1EZUC 1AGJA 1MCVA 3NXPA 1GJ8B 1V2PT 1AFQB 1MZAA 4SGBE 1RGQA 4IW4E 2BD2A 1FQ3A 4I8JA 3N7OA 1O2IA 4OS2A 2CHAC 2ZTYA 3E8LA 1O30A 1PPEE 1O35A 2GX4A 2BD4A 4B74A 1FY8E 1P2IA 1EJMA 1A3BH 1ZHRA 3FZDA 2JH0D 1C9PA 4B2BA 1SBWA 3E3TA 4Y11E 1OOKB 3RXFA 1QJ6B 1CA0B 2FI3E 2R9PA 3U1IB 1DY8A 3I29A 3QN7A 5LPRA 2BOKA 1GBCA 1OWJA 3GY4A 2BY8X 4UFEH 1C5XB 2V3HH 2B7DH 1BITA 1XUIA 3SU2A 4Y8ZA 2CXVA 1GBIA 2C90B 3AW1A 3VXEH 4LXBH 4Q7XA 1PYTD 1IOEA 4FUFA 1D6WA 3V0XA 8LPRA 4FUGA 3U1JB 2ODQA 1SGEE 3Q76A 5K0HA 3FP8E 4E7NA 2ZHWH 3ZVFA 2FTLE 1GHWH 1OWIA 1SPJA 1CVWH 1LKAA 2ZQ2A 5DG6A 1Z8GA 5LH8A 1F2SE 3VGCB 3PV5A 2VH0A 1WYKA 2J95A 3T29A 1AHTH 2SGPE 3R3GB 5HM9A 3CS7A 4X8UH 1UCYH 3RM0H 4K3JA 2XTTB 3ZYEA 2DE9A 2EI7A 1W8BH 2GDDA 4XOJA 1QB6A 3TH4H 2P95A 4RI0A 3URCA 2A5IA 1C5OH 4UFDH 1P2MA 1TNKA 4X2WA 2FEQH 1UVUH 2ASUB 1SGNE 3BTEE 1K1OA 5GIBA 1P2JA 5ESBA 2Y7ZA 3SI3H 2ANWA 4CR9A 3SV9A 3VGCC 4DW2U 1NO9H 1O2XA 1HRTH 1EPTC 3LC5A 3LJOA 2SNWA 2BZ6H 4ZH8A 1WUNH 3GDVA 2BDBA 2CJIA 5CE1A 4Y10E 5C3NA 2BQWB 1GG6C 5AF9H 1HCGA 1O2NA 3A7XA 1OP0A 1DICA 3SNDA 3SNBA 1DOJA 1AQ7A 3ELAH 1XUGA 2CF8H 4AFZA 1PPBH 2SFAA 4CBOA 1KXFA 1CT0E 2ZFTA 4ZKOU 1RRKA 1P3CA 1OP8A 2F91A 1UVTH 2FLBH 2J38A 2BB4A 3ZVAA 1Y3VA 1ESAA 1V2JT 4OS5A 2UUJB 3OSYA 3HKIB 2WPIS 5LPFA 2XBVA 1K9OE 1P8VC 1UTMA 5GCHF 5SGAE 1FIWA 1IQIA 5LGOA 3T62A 3BTME 3GCTF 2ZO3H 3TNSA 2WUCA 1O5FH 3UWJH 4GCHF 4K69A 3MO6A 1GBAA 1B0EA 4NSVA 4VGCB 3P8NA 3FFGA 2XXLA 4UD9H 3M7UA 1XM1A 2TGPZ 1C1SA 1ESBA 1P2QA 1C1QA 3GY5A 2A2XH 1O5CB 1G9IE 3R0FA 1ELFA 3E0NB 1PPGE 1QBOA 1KY9A 4BXWA 2EI8A 1O0DH 3S0NA 4MPVA 1QBVH 5C20A 1GHVH 3M5NA 1H8DH 1SQTA 1UJ1A 2Y7XA 1QL7A 2UUFB 2TGDA 4HTCH 3HKJB 1IAUA 1T7CA 3TJNA 3NPSA 3P6ZB 4TPIZ 8GCHF 1S81A 2Z9KA 2GCHF 1P12E 1GJ4H 3RXKA 2TBSA 2ANMH 1T8MA 4IC5A 1NRSH 3QO6A 4BAOB 1W0YH 2YOLA 1O2UA 2H9HA 1ZPBA 1AZZA 4A92A 4KTUA 3UOPA 2IN2A 4FUCA 3GY8A 3VB3A 1BOQA 1TGTA 2GD4B 1W12U 2F9OA 1TYNA 2FLRH 2VVVA 3DA9B 3SNCA 1TBQH 1O3OA 4OGXA 3PM3A 2W7SA 2ZDAH 3Q77A 1A0JA 1MQ6A 2G8TA 1C9TA 2ZU1A 2W5EA 1S5SA 4MDSA 1G30B 5DP3A 1LHCH 3EE0B 1CU1A 4YLUA 1KLIH 1UTPA 2ZFPH 1GL1A 4CRCA 1Z71A 1MD7A 1GWAA 2OK5A 1GMDG 1YP9A 1RD3B 1OYTH 3TH3H 1XKAC 3MNXA 1HLTH 4X2VA 2FOCA 2IJD1 4K2YA 1ZGIA 3KNXA 2QC2A 5CHAB 2ZDMA 2D2DA 2AERH 1Q3XA 3SOSA 1GJ9B 1CGHA 1DWDH 1J9CH 1O5AB 1O2QA 4IGDA 1OXGA 2HGTH 4X2YA 3SGBE 2R0KA 3U9AH 1TRNA 4A1TA 1SGIB 3RU4D 8GCHG 1HAOH 2XBXA 4JZIA 1O2LA 3SU1A 3DT0H 1Y3UA 3RXSA 1O3HA 2AYWA 3BV9B 2HNTC 1LQEA 1TNIA 1C5UA 2GZ9A 2JETB 3PO1C 4CRAA 2B5TB 2AGIX 3PMJA 1OSSA 2EC9H 1L1JA 3P8FA 1ELAA 1SOTA 2F4LA 2VNTA 5EU8A 1PPZA 3GDUA 1TA2A 1TOCB 1FPHH 4FUHA 4ZUHA 2BHGA 1GVKB 1QQUA 2WPLS 2FX4A 1O3GA 1YCPM 4I8GA 1O2OA 1OPHB 5DP7A 1C2FA 4NG9H 3V13A 3SV8A 1PJPA 2FOHA 1O3DA 3EGKH 1O2GH 1IQFA 5DJ7A 4CRFA 3VXFH 1LCYA 3ZZDA 1TPSA 2FTMA 4Z0KA 1HJ8A 4Y79A 2ZHQH 1OS8A 1HAYB 4MPXA 1V2ST 1YPLH 3OY6U 2OC8A 3VB6A 3VB4A 2F9NA 2VH6A 2CV3A 1S0QA 1YPJH 2O8UA 2AIQA 3BG8A 3SU6A 4X1PU 4WXVA 1C2KA 1ELCA 1O3IA 2BXUH 1NTPA 2R2WU 4Q7ZA 4KGAA 1G3BA 1MTSA 3L6PA 3M7QA 3HK6B 4MPUA 3ZVEA 1C1OA 1XUHA 2Y80A 4GHTA 4Y0ZE 4D7GA 1V2QT 1GDUA 2PR3A 2ZDLA 3BTKE 1MTWA 1S84A 4XBCA 1A1RA 1AB9B 2NU1E 1C1TA 1ZLRA 4YESB 3UY9A 3MU4A 3PV4A 1E38B 2H6MA 5L2ZH 3LGWA 1QL8A 1ZSKA 3RLYH 2ZHDA 1P09A 5FPSA 1H9IE 1QR3E 2AGGX 3GY3A 4B76A 1ZOMA 1IQLA 2BQ6B 5T6GA 1AFEH 4FU8A 3GCHC 1C5YB 3BG4C
chains in the Genus database with same CATH superfamily
2QXHA 5DP9A 4YTAA 1KDQA 1FX0B 3QGNB 4MNXA 5FCKA 4OS6A 3AAUA 3VFEA 3GCOA 4YXWD 2FP7B 3OTPA 3UREA 1NM6A 4FOUC 2ZNKH 3UQVA 5A0AE 1C5PA 3VEQB 2FOGA 4XE4A 2QXJA 3BTQE 1CHOG 4AG2A 3B23B 3EDXB 1O37A 4X0WU 2WPKS 1AE5A 2XYAA 2PTCE 3WWBA 1C2MA 1XKBC 1BZXE 4AN7A 2ZDNA 4X6MA 7GCHG 1NRPH 1ABJH 1TQ7B 1MKWK 5AHGH 3ZV9A 1HUTH 1S6LA 2AIPA 4NZQA 1ANCA 1ELBA 2FOAA 4XFQA 1GJ6A 1THRH 3RXGA 1GI9B 4TPYA 1G3DA 5DP8A 4ZHMU 3ZVCA 1DFPA 1TE0A 1WV7H 3QTOH 1EZQA 1CT2E 2Y82A 4YT7H 3KQ5A 5FBEA 2XW9A 4D9RA 1O2TA 1GHBF 1YPHE 2OD3B 3RMOH 1YF4A 1JOUB 4F48B 3TK5A 1ZJDA 3DHKH 4GLYA 3RXUA 3WY8A 1EP6A 3ZZ5A 4F4OC 4KTCA 3A8CA 5IDKA 1UK3A 1AN1E 1QB9A 3T2NA 5EJ1A 1D3PB 1Z6JH 1O2ZA 1O32A 1YBWA 3A8AA 2BMGB 2QE7D 1O5EH 3UR9A 3SW2B 2FO9A 1GBKA 5FXLA 1ZRKA 1G36A 4VGCC 3RXPA 3STIA 1NPMA 2V6NA 3P8OA 2FDAA 2XC5A 4H6TA 1O38A 2Q6FA 3S69A 2SGFE 5GWZA 5EPYA 1GVZA 1MBQA 1BMMH 4CH2B 1DPOA 1JIMA 3U8RH 4ISHH 1V2WT 1GBTA 1MTNB 1H9HE 2RA3A 1ZSLA 2A2QH 3LDXH 1BRAA 2G5VA 1FNIA 1GBDA 2ZEBA 3LT3A 1YPHC 1AFQC 1QCPA 2WV5A 3BTTE 2FYRA 1GBMA 4FUIA 1SGFA 3GOVB 7GCHF 1J16A 3BTWE 1WQSA 3RMMH 1MABB 4O97A 1DXWA 4ABBA 1XVMA 1C2HA 3MI4A 3GCNA 1HNEE 1MTUA 3OU0A 4ASHA 1G37A 1UTQA 1LPZB 3A8DA 1H1BA 1SGQE 2XOKD 3RXHA 4NIWA 4AGJA 2PKAB 5A8YA 2FOMB 4E06H 1O3NA 3KYGA 1PFXC 2RFKC 4ACAA 2Z3EA 1VR1H 2HPQH 2ZFQH 3RC4A 1CA0C 3ZVGA 2B9LA 4A6LA 1FAKH 1DANH 3M7TA 1LTOA 4U30A 1TAWA 3PWBA 2UUKB 3PWCA 2DUCA 3RXAA 4JYVH 1HJ9A 2PKAA 1Z8RA 1KTSB 2BY5X 3RU4T 3A7VA 1BTWA 1GI1A 1TBZH 1UCYE 3EA8A 1SFIA 5CDFE 1P05A 2XC0A 3LOXA 2QXGA 2OXSA 2OTVA 1KXCA 1BJUA 1HV7A 5EW2H 3KQBA 4HZHA 1GBHA 1BTPA 1O3LA 1TPOA 3TJUA 1JRTA 1O2RA 4TWYA 3P8GA 1Y3WA 5GCHG 1XXFA 3BTFE 5EG4A 1AI8H 1TPAE 1W11U 2STAE 3ODDA 5F8XA 4WMDA 3QLPH 3CENA 3EYDA 2HLCA 3SNEA 1SLUB 3OE7D 3PV2A 1A46H 2Z9GA 1UVSH 3C27B 1P9UA 5DSFA 1T31A 1T8NA 4H4FA 3AASA 4Q7YA 1ELTA 5EW1H 2A7JA 5TCCA 1O39A 2OLGA 4AG1A 1H8HD 1C1MA 1FY4A 4R8TB 3LGUA 1P03A 4AB9A 1B5GH 1DE7H 2P59A 2ZGJA 3KCGH 1DXPA 2JKHA 1C2GA 2BVSH 1QTFA 2GDEH 2VBCA 4MTBA 3IG6B 3A8BA 1V3XA 2ODYB 1UO6A 1G32B 1MQ5A 3F0OA 4I7YH 5DKMA 4TYDA 1AVWA 4WWYA 4AX9H 3A7ZA 1W0KD 4ZXYH 1F0UA 1NBME 1TX8A 1SR5C 4B2AA 1LVYA 1EJNA 1SI5H 1VCWA 3A83A 3VPKA 2G52A 2GV7A 1C5QA 2ZU5A 1CBWB 2AH4X 1LMWB 4AORA 3K9XB 1MKXK 1RFNA 5I46H 2Y5HA 4NSYA 2HNTE 5GXPA 3IITA 1TRMA 4AC9A 2PFEA 2ZF0H 1AKSA 1D3TB 2R0LA 1FMGA 4ZMAH 4I31A 2F43B 1A0LA 3D62A 2GP9B 3AAVA 2PSXA 3LIWA 5TCAA 5JB8S 1TMBH 1LVMA 3I77A 3KQDA 1A61H 1NU7B 5EQQA 4AB8A 3T27A 5I25A 4CREA 5AFZH 4ABJA 2PKSB 9LPRA 2HOBA 3P17H 3EA9A 2VWNA 2OC7A 5C1XA 3S7HB 2BQ7B 2BTCE 3QTVH 2B0FA 3B9FH 3PRDA 1O2YA 7KMEH 2G4TA 4AZ2B 3SHCH 4ZKSU 1IQMA 1GMDF 3MQKC 3SGAE 4HGCA 2LELA 1QRWA 1O3JA 1AY6H 1UTKA 2BD7A 1P2NA 2VWOA 2J94A 3HPTB 1BA8B 2QF4A 1A5GH 3DSPA 1GVLA 1AD8H 2A7HA 3GISB 4SGAE 4CBNA 2AMDA 3KN2A 2J2UA 1RS0A 1U6QA 1HAVA 4IS5A 1JWTA 3NWUA 1EP5A 3LONA 1T8OA 3NK8A 3ENSB 5F53A 1DUEA 1NESE 2JIZD 4K1SA 4NIYA 2FOBA 4U32A 3S9AA 3ZV8A 1DLKB 3RXCA 1PPCE 1CA8B 2JH6D 2ZDVH 4WVPE 1MD8A 1TMUH 1ELVA 1Z8IB 4X2XA 4GPGA 1E0FD 1FDPA 1ZTLA 4DVAU 1CSOE 2PLXA 2Z6BD 2OINA 2VGCB 1YLCA 4IMZA 2JJ2D 1C5RA 3CS0A 3RMLH 5FPYA 4K60A 4RKOB 2BDAA 3KHVA 2P16A 1GGDC 2TPIZ 5T3HA 1HFDA 1TBRH 1CHOF 3SO3A 2J34A 4CHAB 4YOJA 4X1SU 2Q6GA 5A2MH 1HAVB 2EA3A 2BD3A 1WDIA 2XCNA 3A80A 3U8OH 3A84A 3SUDA 2PWXA 1QHRB 2PSYA 1ARBA 1BQYA 3UTUH 6GCHF 2QN5T 2AFQB 3KIDU 2P8OC 4IBLH 4CRDA 3M37A 3RXTA 1T8LA 2FI5E 5EGMA 1NBMD 1P2OA 5EQRA 4M7GA 1ESTA 5E0HA 1Z1IA 2HPPH 4GUXA 1CE5A 2XC4A 1O2WA 1JIRA 1F5RA 1E35B 1YPKH 5C1UA 2HNTF 1LHDH 1L1NA 4P00A 1GGDB 2GT8A 3F2FA 3KL6A 1J8AA 2VIOA 2FM2A 3PLKA 3QWCH 3U8TH 4X1NU 2QY0B 4JK6A 1S85A 1SLXB 2GCHG 1S6FA 2K1QA 1W7XH 1OWHA 4Y6DA 4AFSA 2VWLA 2VGCC 3RP2A 2Z9IA 4ISLA 2O8MA 3STJA 4IMQA 1O2KA 3FANA 2WSSD 1VCPA 2VIPA 5DO4H 1BB0B 3TK6A 3K65B 6CHAB 3F3BA 1EOLA 2R3YA 4DGJA 1D3QB 1FV9A 4ABEA 4GVUA 3PROA 1DT2A 2TIOA 2Z7FE 4B6EA 4UEHH 1TWXB 5F03A 2Z9LA 3H7TA 2BX3A 4ZHAA 1BTXA 2A4QA 2VJ1A 4X8VH 3O8RA 1AE8H 2V3MA 1YLNA 1EPTA 3A82A 5ETXA 1JMOH 3TU7H 2PGQB 2VU8E 2ZHEH 3ATWA 2J5UA 4OM9A 2KAIA 1NFXA 1L0ZA 1C1RA 4WH6A 1IQHA 2STBE 1OWEA 4UONA 1G3CA 1P0SH 1Y3YA 2HVXA 4ABGA 1GJ7B 1PYTC 2W3IA 4KELA 5F8TA 1TMTH 3GYMA 4AYYB 1UVPA 1MCTA 4BAMB 2BLVA 1LHEH 1SSXA 4JYTA 1O3AA 1ZTJA 3Q3YA 2VIVA 3RUOA 1HB0B 3RXQA 4Y8YA 2A4OA 4OS1A 1C2LA 3OTJE 1E37B 1D6RA 4XDEA 2V7QD 2XBYA 3ATLA 3LGTA 1VZQH 3QGJA 4MVNA 3BN9A 2GJGA 3SU3A 1HAGE 2NWNA 1GBJA 1F0RA 1WBGB 1YYY1 4J2YB 3MH5A 2ALPA 2A31A 2QF0A 1DDJA 1DSUA 5DPAA 2ZA5A 1DSTA 3RXBA 4WF8A 1EKBB 2ZCLP 2OQ5A 3TGJE 1L1GA 1C1PA 6ESTA 1KLTA 3DD2H 3PLBA 4DY7B 1GHBG 3UOUA 2BXTH 1PQ7A 3D49H 4Z6AH 3TITA 3VB5A 2ZECA 3GICB 5CHAC 4XSKU 1RTFB 2WPMS 2G00A 3NZIA 1ID5H 1TGSZ 4AOQA 1LKBA 1UVOA 3A7YA 4BNRA 4WJG2 5EPNA 4YM9A 3PYHA 4K1EA 2O8LA 4DIIH 1C2EA 1D9IA 1EZSC 5DP4A 5FHTA 1V6DA 1HJAB 2JDID 2F3CE 1K1MA 3FP6E 3L33A 5T1VA 3RMNH 1TOMH 5C5OA 1ELGA 1D3DB 1MZDA 1GJ5H 4MNWA 1BTYA 4I32A 2HWLB 2KFWA 2VIDA 1C4V2 4MQAA 1SC8U 2FI4E 1C1VH 3E91A 2B8OH 2A1DB 1YPGH 1FJSA 3U69H 5GPIB 1E34B 1LDTT 2GTBA 1B7XB 2NU0E 5CHBA 4TY7A 2ZWLH 1GHAF 2WPJS 1EAUA 1FUJA 4OS4A 2WPDD 5JPMH 1NN6A 1H8IH 2GZ8A 2DE8A 1GHXH 1Y8TA 1L4DA 1CO7E 2H5CA 2ZQ1A 1IQKA 3F6UH 4FVDA 2ZGCA 1N8OC 4XBBA 3TGIE 2IOTA 2WZQA 3NKKA 4NA9H 5EJZA 1KXDA 2WUBA 1NZQH 3P95A 5HYOA 2KX4A 1C5TA 2P93A 1FN8A 4F49A 1O5GH 2VWMA 2GV6A 5IYTA 2QF3A 1VGCB 2FS9A 1AUJA 1HIAA 2PUQH 4NWLA 4OS7A 3RXIA 1W13U 5A0BA 3N7DA 4KTSA 2VINA 1QJ7B 2M5TA 1BHXF 4GAWA 1GI8B 2EEKA 3UUZA 1BJVA 2ZI2H 2P94A 1ZPCA 2C3SA 3UR6A 3ZZ6A 3A7WA 4BANB 5F6MA 2C8ZB 2VIQA 1O2HA 5EODA 1NRQH 1TNJA 1GI4A 2SGQE 2FX6A 2HLDD 4INKA 2ANKH 2W6JD 2VVUA 4ABIA 1TNGA 1CT4E 3PMBB 1QIXB 3ZVBA 1EAWA 1HAHH 1PQAA 4X6OA 2ZIQH 1RTKA 2EY4C 5DP5A 1VGCC 4CH8B 3UB0A 3RXRA 1AO5A 2FOFA 5T6DA 3U98H 1SLVB 2A0QB 2V35A 1C5NH 4J1YA 1DUAA 4ZHLU 2ZTXA 1YC0A 1C5LH 1TRYA 3ATKA 1HIAB 2K8IA 1AUTC 1BRBE 2ZPQA 3MNSA 4H6SB 5GJ4B 1UTJA 1DWBH 1SFQB 1LHGH 2H5DA 3MHWU 2JETC 2WPHS 1BCUH 1NU9A 2A7CA 3RDZA 1ETRH 1LPGB 2FPZA 3K2UA 4D76A 1ACBE 1SGRE 3SHAH 1O31A 1P2KA 1C1UH 2ZP0H 2Q6DA 2ESTE 2F9VA 1UW7A 2WV4A 1N6XA 5JBAS 2J98B 1Y3XA 3DFLA 1GI6A 2W26A 2Z3DA 7ESTE 1P11E 3SUFA 4DG4A 1BT7A 3BEFB 1TIOA 4D7FA 6LPRA 3RXMA 1W2KH 1FN6A 1NROH 1IQEA 5L2YH 1VITF 2OBOA 3OX7U 1GG6B 3M5OA 1EZXC 4Y71A 3UFAA 4RKJB 3TK9A 1C2DA 3HGNA 4NCYA 5J4QA 4DIHH 1SGYE 2KAIB 1V2MT 1RIWB 1G3EA 1N1LA 1SGFG 1BTUA 5IK2D 1UTNA 1INCA 3GS9A 2A4RA 1UK4A 3ODFA 3RXOA 1KXBA 1SGTA 1Z7KA 4FUEA 2F9BH 1HAIH 4YZUA 1TNHA 4X6NA 1EJAA 3V3MA 1YY3A 2BY6X 5EQSA 1CHGA 6GCHG 1WU1A 1W7GH 1ORFA 4HG6A 4NFEA 1GMCG 3SV2H 5FX5A 1EXFA 2L6OA 4IN2A 5LPEA 3NUMA 1EAIA 3M61U 4JCNA 2IPHA 3M3VA 3WW7A 4U01A 1P3EA 2QIQA 2XNDD 1NY22 3SJIA 1AB9C 1BMLA 2FODA 1UMAH 4JZDH 2K0QA 4Q80A 4X8SH 4ZKNU 2FIRH 1FZZA 4MG3A 1OWDA 4O3TA 1EFRD 1S0RA 3MOCA 2TGAA 3TNTA 2J4IA 1O3MA 1GMHG 3PO1B 3GCHB 1FIZA 1O5DH 4ISIH 3M5MA 4BTIB 1SG8B 4BTTB 2P8OB 1BRUP 1CBWC 3B8JA 1J15A 2AMQA 3LH1A 3ZZ9A 1NT1A 2C8YB 1WAYB 4BTUB 3Q00A 4Z1MD 2FYQA 4D8NA 2J9NA 3PMAB 3QK1A 1T4UH 4AFQA 1Y5BT 2FESH 1WCZA 1JXPA 2Z9JA 3UIRA 3ZZCA 3MU1A 2FMJA 2PTNA 5JBTA 5GNDA 3T28A 3E16B 3KQCA 4YO9A 3ATMA 1SHHB 1GI5A 1RXPA 4UFGH 2A5AA 1ELDE 1O2PA 4WMEA 1C5SA 4YLQH 1GBEA 2BLOA 1TONA 1F0SA 4B71A 2Q1JA 1CQQA 1LQDB 1QBNA 2YNBA 1SGPE 1YCPK 1BMFD 4RSPA 1SQRA 3HK3B 2OUAA 1A7SA 1F0TA 4O3UA 1TALA 3UNRA 2CN0H 2OC0A 4INLA 1NRRH 1ZRBA 3FP7E 4NFFA 4NIXA 3QZRA 4GSOA 3JZ1B 3M5LA 3ATIA 4QT8C 2RDEA 2KCPA 3F9HA 5HXFA 4YOIA 1Y59T 1AVGH 3LU9B 1IQNA 1K1PA 2GGVB 3BIUH 1H4WA 4TWWA 3SNAA 1GJDB 2AMPA 1P02A 1GDNA 1KSNA 5JB9S 3MO3A 4ZXXH 3MNBA 3SGQE 1VJ9U 2HVYB 3M3SA 1BMAA 1N8OB 1O2SA 1V2TT 2ZGBH 1SQOA 4K1TA 1ABIH 3MH7A 2WYJA 1RTLA 1NS3A 3RXVA 2BX4A 5A09A 4JZFH 4R0IA 1QGFA 3F9EA 2H9TH 1HPGA 1V2VT 2ULLA 4DT4A 5J4SA 1KLJH 4LZ1H 2BDGA 1FAXA 3SJKA 2QF5A 3GY7A 2EI6A 4NA7A 1WXRA 2J92A 2C93B 2OC1A 1Z6EA 2RCEA 3O8DA 4I33A 1C4U2 3ZZAA 2GT7A 2AGEX 1UHBA 1HAZB 3MYWA 1DS2E 3QUMP 1OKXA 4DJZB 1O2VA 2ANYA 1KXEA 3K6ZA 1QL9A 4K5ZA 3GDSA 2Y81A 2CGAA 3TVJB 1K28D 3A86A 1EPTB 1VJAU 2H1UA 3T5FH 4GCHG 1XVOA 3MFJA 3SU4A 4CRGA 3ZYDA 7LPRA 3OEHD 5GDSH 3SORA 5KEDA 3TGKE 3MU8A 1ZSJA 3TJVA 2ZTZA 3ZVDA 1JRSA 1K1IA 2LP6A 1ETSH 5DP6A 2F9UA 1SGDE 1QA7A 2BLWA 5BRRE 3RU4E 5A0CA 2PW8H 1A5HA 4B6FA 2JJ1D 1GI7B 2YNAA 2QCYA 2WHXA 1C1NA 1QQ4A 3H5CB 1F7ZA 2F9PA 3S7KB 1OWKA 2FOEA 3QZQA 4ZKRU 5CMXH 2QXIA 3A87A 3ZZ3A 4KP0A 4BAHB 3F9GA 4JZEH 3V7TA 1GHAG 1ZMJA 1AIXH 4PROA 1A4WH 1W14U 3AVZA 3PLPA 1O2MA 4ABAA 5PTPA 1C5MD 1XUFA 2A32A 4MNVA 1Z1JA 2OCVB 3TLOA 1MH0A 1EX3A 1K21H 3SV6A 2VIWA 2ZCHP 3D65E 3NCLA 4FVBA 1SL3A 5C1YA 2OP9A 2ZU4A 2R3UA 2KCOA 1SHYA 1Q31A 1KIGH 2BVRH 4AGKA 1NFWA 4DCDA 1TABE 1MTVA 3F1SB 1FPCH 3M36A 1A3EH 3A89A 2W6ID 4X1RU 3LGIA 4AFUA 3SJ8A 4B73A 3QDZB 2FWWA 1O3EA 1UK2A 5E2PA 5E0JA 1ELEE 3F2HA 1ZHPA 3O8CA 1VKYA 1ZZZA 1QRXA 4XD7D 3MU5A 4ACBA 2FXRA 4TY6A 1AVXA 3FN8A 3EQ0H 3RLWH 3MMGA 1O3BA 4E05H 3GYLB 9ESTA 2O8TA 3GY2A 3NRLA 8ESTE 1GI0A 1C2JA 4Y7AA 2SGDE 3TIUA 1ZMLA 4ABFA 1L4ZA 4ISOA 1YPEH 1B0FA 1C1WH 4H42U 1GBFA 1ZJKA 2PKSC 1HAPH 5FAHA 2UWOA 5F8ZA 2PP6A 1O2JA 2P3TB 4B2CA 3D23A 1AKSB 3SJ9A 3GY6A 4U2WA 3QX5H 1FONA 4O9VA 1EATA 4NZLA 4LZ4B 4JYUH 1WOFA 2I6SA 3UQOA 5HM2A 5ABWA 2GMTB 3SQHE 1K22H 1BTZA 3PTNA 3IWMA 3V12A 1QA0A 1F5KU 5EOKA 2KM0A 2BD8A 1TPPA 2PV9B 3W95A 3ZZ4A 2QGRA 1QNJA 2HALA 1S6HA 3UNSA 1SMFE 1ANDA 1SLWB 4JK5A 1LVBA 1O36A 5A8XA 2TRMA 1MU6B 3W1EA 5JBBS 3ZZ7A 3KQEA 3OYPA 2F83A 2XCFA 1DVAH 1HBTH 1O3KA 3ZIAD 1ETTH 2RDLA 1O3CA 1KTTB 3TPIZ 4GHQA 2BLQA 3E1XB 2H2ZA 2UWLA 1DM4B 4HI3A 1TQ0B 1LVOA 2G4UA 1D4PB 1THSH 3UWIA 1E36B 3CP7A 1AZ8A 1TB6H 2EQNA 1GCTC 3K6YA 2WYGA 1UTLM 3LGYA 2RG3A 3UNQA 5C5NA 2BZAA 4ESTE 3FAOA 2OBQA 1O3PB 1O34A 1K2I1 5FCRA 2ZU2A 3SZNA 2ILNA 5ESTE 3RXLA 4BOHA 1A0HB 1TGBA 3F0PA 1A5IA 2CK3D 4I8LA 4K8YA 1ZYOA 5JDUB 4CR5A 1GPZA 3A7TA 3C1KA 1C2IA 1IQGA 1DITH 1H9LB 1TX7A 2CMYA 2BYAX 2D8WA 2NU4E 5G4BA 1C4Y2 3AW0A 5E8EH 5FBIA 3SZEA 1GI2A 2PUXB 1MKWH 2ZCKP 5B6OA 1NFUA 2ZDKA 2JH5D 1DWCH 5C67A 3SV7A 1UHBB 1WTHD 3E6PH 1Z8JB 1PPHE 3AK5A 4X8TH 1X7AC 3O8BA 4FUBA 2BM2A 5KGOA 1GHZA 1HXFH 1LO6A 1OX1A 5JYIA 3BIVH 2ZFSA 3TJOA 1P06A 3L3TA 4CHAC 3VB7A 3TH2H 4AYVB 1TX6A 1TNLA 1FI8A 1XX9A 3F68H 3MNCA 1HXEH 2CHAB 1V2RT 1K1LA 3SQEE 4UE7H 4JMYA 5AFYH 3OEED 1HJAC 1IQJA 3E90B 4THNH 2ZKSA 1PQ8A 4B1TA 5BPEA 1EASA 2V0BA 1S82A 2G55A 5HKKD 5L30H 4YOGA 1CGIE 5L6NH 4A1VA 1G2MA 1PQ5A 3BTGE 2P3UB 1C5WB 3ITIA 1EB2A 3BF6H 1NRNH 4MNYA 1GCDA 4K8BA 5JBCS 3GCTG 1YKTA 1HDTH 1KDQB 2Z94A 5DK1A 3SBKA 3ZZ8A 1NFYA 3F9FA 2LNCA 1DLEA 4I8KA 1N6YA 4CRBA 1YCPH 4JZ1A 3EA7A 3RXDA 1MAXA 2FS8A 2ZZUH 1ZR0A 3UPEA 5EXLA 2QA9E 3BSQA 1MBMA 1ZMNA 4DT7B 3LJJA 1COWD 4ZAEA 6CHAC 1FXYA 4A7IB 2C8XB 3LKWA 1AU8A 1EB1H 3VG8A 1XMNB 3A85A 1BDAA 2G51A 4BXSA 2C4FH 1AWHB 4ABHA 3SU5A 3PRBA 5DGJA 1O33A 3LGVA 2PGBB 2R2MB 4Y76A 1SQAA 1KYNA 3E0PB 1GMHF 1BIOA 2HRVA 1WTGH 4IN1A 4LOYH 1QRZA 1EAXA 2C8WB 4MPWA 1GJAB 2A45B 2LPRA 4Q2KA 4WMFA 3SUEA 3MWIU 1QURH 3MTYA 3SYJA 2QV1A 3A88A 3BTHE 1T4VH 3RXJA 5HIZA 1GBLA 3SJOA 4D9QA 2BY7X 1P57B 2XRCA 1S83A 1ZHMA 1BHXB 1BUIA 1XUKA 4XRNA 1UTOA 2QYIA 1DWEH 1F5LA 2RA0A 1GDQA 2SGAA 2V3OH 3W94A 1O5BB 1BRCE 4FUDA 2BDHA 1TA6A 1T32A 4LK4A 1RJXB 2GCTC 3M3TA 1BMNH 1WSSH 2A4GA 3Q3XA 3SU0A 1BBRH 1IHSH 2ODPA 3DFJA 3MU0A 1GBBA 2NU3E 4HFPB 2GKVE 5K7RA 5A8ZA 4NGAH 1BBRE 1EOJA 2P3FH 1P10A 1VITH 1KXAA 1TGNA 4RN6A 3OY5U 3JZ2B 4Y8XA 3SN8A 2O8WA 3FKSD 2ZPRA 2AEIH 3S9CA 3DUXH 1SVPA 4FU7A 1BTHH 1YGCH 3MH4A 1ANBA 3RXEA 2GZ7A 1ARCA 4O03A 1QY6A 5AVDA 1HAXB 2D1JA 4WH8A 4WY3A 2ZFRH 4ABDA 1J14A 1IHTH 4KKDA 2W7UA 5KECA 1G2LA 1GHYH 1GJCB 1LHFH 1SKYE 2WV9A 3MO9A 2D26C 3HGPA 3ZZBA 1M9UA 2GCTB 1EUFA 1VCQA 2PHBA 2ZFFH 4M9FA 1DY9A 1DX5M 1C5VA 2GVFA 2SGEE 1MKXH 4NIVA 2UWPA 4TT3D 1QFKH 2I6QA 1W3CA 1AMHA 3KEEA 5EXNA 1FY3A 1ZPZA 4NA8A 1QZ8A 1V2NT 3P92A 2CF9H 1K1JA 4ASUD 4UDWH 2YMSB 5FPTA 3M35A 1W10U 1ZGVA 2ZGXH 2ZPSA 2H9EH 2ALVA 5TJXA 1EQ9A 2BOHB 3HATH 2KCYA 1P9SA 4XBDA 4FETA 1C5ZB 1V2LT 1YWUA 3PTBA 2BVXH 1J17T 2VVCA 2BD9A 3BG4B 2GMTC 5EXMA 2ZGHA 1WQVH 2Z3CA 1Y5UT 2Y5FA 1A2CH 1V2KT 4INHA 4X6PA 3LH3A 4Y0YE 1Y5AT 2Y5GA 5E0GA 3LC3A 3H09A 4X1QU 1TLDA 1KMHB 1Q2WA 3PB1E 3RC6A 3G01A 3OAAD 4BAKB 2G81E 1MU8B 1YLDA 2J97A 3A81A 3UAIC 2XWAA 2FZZA 2XWBI 4B75A 4BAQB 1NC6A 2NU2E 1TFXA 1MAYA 4DOQA 2QAAA 1GCTB 4MLFB 3FZZA 2ZHFH 5T6FA 1RIWC 3BEUA 3KGPA 2G5NA 4FUJA 5H4IB 3BEIB 1GL0E 1HYLA 1QB1A 1YM0A 2IJOB 4Q63A 3RC5A 3I78A 1TGCA 3KF2A 5FX6A 1CGJE 1VITG 2XNIA 5C2ZA 2A5KA 1P04A 1FY1A 4E7RG 2WINI 1V2OT 3S9BA 4A1XA 1HGTH 1OYQA 5B6LA 2UUYA 1OP2A 1BBRK 1SGCA 2BDCA 2BDYA 4I8HA 4WXIA 2THFB 2TGTA 5C17A 4ISNA 2ZU3A 1LPKB 1MUEB 3H7OA 4YT6H 3T25A 2O9QA 3EAJA 1XXDA 3SI4H 1SB1H 1GI3A 4Y7BA 3ESTA 4OGYA 3MH6A 4FU9A 3SUGA 2OQUA 5C0UA 1JBUH 3FVFB 1SOZA 1MTNC 2XBWA 2AS9A 4IC6A 1W0ZU 1GMCF 3URDA 2BDIA 2BD5A 4DURA 2ZG0H 2SNVA 2Y6TA 1QJ1B 1YPMH 3P70B 5E2OA 5HMAA 8KME2 5HGGA 1MMJN 1UCYK 1THPB 3RM2H 1PPFE 3LPRA 2BY9X 1OHHD 1ZTKA 1K1NA 4A5TS 1AWFH 1V2UT 2VB0A 4ZROA 4FXGH 1XUJA 1GJBB 2J98A 3Q3KA 1L2EA 1P01A 2ZC9H 1FY5A 3T26A 1FLEE 1F92A 1O3FA 2W3KA 4NWKA 3BTDE 1ANEA 4UFFH 3PMHB 1EZUC 1AGJA 1MCVA 3NXPA 1GJ8B 1V2PT 1AFQB 1MZAA 4SGBE 1RGQA 4IW4E 2BD2A 3WWFA 1FQ3A 5C94A 4I8JA 1W0JD 3N7OA 1O2IA 4OS2A 2CHAC 2ZTYA 2M2AA 3E8LA 1O30A 1PPEE 4RT0A 1O35A 2GX4A 2BD4A 4B74A 1FY8E 1P2IA 1EJMA 1A3BH 1ZHRA 3FZDA 2JH0D 1C9PA 4B2BA 1SBWA 3E3TA 4Y11E 1OOKB 4RT1A 3RXFA 1QJ6B 1CA0B 2FI3E 2R9PA 3U1IB 1DY8A 3I29A 3QN7A 5LPRA 2BOKA 1GBCA 1OWJA 3GY4A 2BY8X 4UFEH 1C5XB 2V3HH 2B7DH 1BITA 3F2GA 1XUIA 4P02A 4Y8ZA 3SU2A 2CXVA 1GBIA 2C90B 3AW1A 3VXEH 4LXBH 4Q7XA 1PYTD 1IOEA 4FUFA 1D6WA 3V0XA 8LPRA 4FUGA 1E1QD 3U1JB 2ODQA 2YMSC 1SGEE 3Q76A 5K0HA 3FP8E 4E7NA 2ZHWH 3ZVFA 2FTLE 1GHWH 1OWIA 2AHME 1SPJA 1CVWH 1LKAA 2ZQ2A 5DG6A 1Z8GA 5LH8A 1F2SE 3VGCB 3PV5A 2VH0A 1WYKA 2J95A 3T29A 1AHTH 3EE7A 2SGPE 3R3GB 5HM9A 3CS7A 4X8UH 1UCYH 3RM0H 4K3JA 2XTTB 3ZYEA 2DE9A 2EI7A 1W8BH 2GDDA 4XOJA 1QB6A 3TH4H 3DCLA 2P95A 4RI0A 3URCA 2A5IA 1C5OH 4UFDH 1P2MA 1TNKA 4X2WA 2FEQH 1UVUH 2ASUB 1SGNE 3BTEE 1K1OA 5GIBA 1P2JA 5ESBA 2Y7ZA 3SI3H 2YMSD 2ANWA 4CR9A 3SV9A 3VGCC 4DW2U 1NO9H 1O2XA 2KR7A 1HRTH 1EPTC 3LC5A 3LJOA 2SNWA 2BZ6H 1H8ED 4ZH8A 1WUNH 3GDVA 2BDBA 2CJIA 3DSOA 4Y10E 5CE1A 5C3NA 2BQWB 1GG6C 5AF9H 1HCGA 1O2NA 3A7XA 1OP0A 1DICA 3SNDA 3SNBA 1DOJA 1AQ7A 3ELAH 1XUGA 2CF8H 4AFZA 1PPBH 2SFAA 4CBOA 1KXFA 1CT0E 2ZFTA 4ZKOU 1RRKA 1P3CA 1OP8A 2F91A 1UVTH 2FLBH 2J38A 2BB4A 3ZVAA 1Y3VA 1ESAA 1V2JT 4OS5A 2UUJB 3OSYA 3HKIB 2WPIS 5LPFA 2XBVA 1K9OE 1P8VC 1UTMA 5GCHF 5SGAE 1FIWA 1IQIA 2KZ4A 5LGOA 3T62A 3BTME 3GCTF 2ZO3H 3TNSA 2WUCA 1O5FH 3UWJH 4GCHF 4K69A 3MO6A 1GBAA 1B0EA 4NSVA 4VGCB 3P8NA 3FFGA 2XXLA 4UD9H 3M7UA 1XM1A 2TGPZ 1C1SA 1ESBA 1P2QA 1C1QA 3GY5A 2A2XH 1O5CB 1G9IE 3R0FA 1ELFA 3E0NB 1PPGE 2IPQX 1QBOA 1KY9A 4BXWA 2EI8A 1E1RD 1O0DH 3S0NA 4MPVA 1QBVH 5C20A 1GHVH 3M5NA 1H8DH 1SQTA 1UJ1A 2Y7XA 1QL7A 2UUFB 2TGDA 4HTCH 3HKJB 1IAUA 1T7CA 3TJNA 3NPSA 3P6ZB 4TPIZ 8GCHF 1S81A 2Z9KA 3FOAA 1E79D 1K0HA 2GCHF 1P12E 1GJ4H 3RXKA 2TBSA 2ANMH 1T8MA 4IC5A 1NRSH 3QO6A 4BAOB 1W0YH 2YOLA 1O2UA 2H9HA 1ZPBA 1AZZA 4A92A 4KTUA 3UOPA 2L74A 2IN2A 4FUCA 3GY8A 3VB3A 1BOQA 1TGTA 2GD4B 1W12U 2F9OA 1TYNA 2FLRH 2VVVA 3DA9B 3SNCA 1TBQH 1O3OA 4OGXA 3PM3A 2W7SA 2ZDAH 3Q77A 3OFND 1A0JA 1MQ6A 2G8TA 1C9TA 2ZU1A 2W5EA 1S5SA 4MDSA 1G30B 5DP3A 1LHCH 3EE0B 1CU1A 4YLUA 1KLIH 5C0TA 1UTPA 2ZFPH 5EJLA 1GL1A 4CRCA 1Z71A 1MD7A 1GWAA 2OK5A 1GMDG 1YP9A 1RD3B 1OYTH 3TH3H 1XKAC 3MNXA 1HLTH 4X2VA 2FOCA 2IJD1 4K2YA 1ZGIA 3KNXA 3CNRA 2QC2A 5CHAB 2ZDMA 2D2DA 2AERH 1Q3XA 3SOSA 1GJ9B 1CGHA 1DWDH 5HIYA 1J9CH 3KYFA 1O5AB 1O2QA 4IGDA 1OXGA 2HGTH 2KCAA 4X2YA 3SGBE 2R0KA 3U9AH 1TRNA 4A1TA 1SGIB 3RU4D 8GCHG 1HAOH 2XBXA 4JZIA 1O2LA 3SU1A 3DT0H 1Y3UA 3RXSA 4TSFD 1O3HA 2AYWA 3BV9B 2HNTC 1LQEA 1TNIA 1C5UA 5FL7D 2GZ9A 2JETB 3PO1C 4CRAA 2B5TB 3N99A 2AGIX 3PMJA 1OSSA 2EC9H 1L1JA 4I86A 3P8FA 1ELAA 3FO8D 4F55A 1SOTA 2F4LA 2VNTA 5EU8A 1PPZA 3GDUA 1TA2A 1TOCB 1FPHH 4FUHA 4ZUHA 2BHGA 1GVKB 1QQUA 2WPLS 2FX4A 1O3GA 1YCPM 4I8GA 1O2OA 1OPHB 5DP7A 1C2FA 4NG9H 3V13A 3SV8A 1PJPA 2FOHA 1O3DA 3EGKH 1O2GH 1IQFA 5DJ7A 4CRFA 3VXFH 1LCYA 4ZCNA 3ZZDA 1TPSA 2FTMA 4Z0KA 1HJ8A 4Y79A 2ZHQH 1OS8A 1HAYB 4MPXA 1V2ST 1YPLH 3OY6U 2OC8A 3VB6A 3VB4A 2F9NA 2VH6A 3U28C 2CV3A 1S0QA 1YPJH 2O8UA 2AIQA 3BG8A 3SU6A 5EIYA 4X1PU 4WXVA 1C2KA 1ELCA 1O3IA 2BXUH 4Q4LA 1NTPA 2R2WU 4Q7ZA 4KGAA 1G3BA 1MTSA 3L6PA 3M7QA 3HK6B 4MPUA 3ZVEA 1C1OA 3DSGA 1XUHA 2Y80A 4GHTA 4Y0ZE 4D7GA 1V2QT 1GDUA 2PR3A 2ZDLA 3BTKE 1MTWA 1S84A 3N7EA 4XBCA 1A1RA 1AB9B 2NU1E 1C1TA 1ZLRA 4YESB 3UY9A 3MU4A 3PV4A 1E38B 2H6MA 5L2ZH 3LGWA 1QL8A 1ZSKA 5DN6D 3RLYH 2ZHDA 1P09A 5FPSA 1H9IE 1QR3E 2AGGX 3GY3A 4B76A 1ZOMA 1IQLA 2BQ6B 5T6GA 1AFEH 4FU8A 3GCHC 1C5YB 3BG4C
chains in the Genus database with same CATH topology
2QXHA 5DP9A 4YTAA 1KDQA 1FX0B 3QGNB 4MNXA 5FCKA 4OS6A 3AAUA 3VFEA 3GCOA 4YXWD 2FP7B 3OTPA 3UREA 1NM6A 2ZNKH 3UQVA 5A0AE 1C5PA 3VEQB 2FOGA 4XE4A 2QXJA 3BTQE 1CHOG 4AG2A 3B23B 3EDXB 1O37A 4X0WU 2WPKS 1AE5A 2XYAA 2PTCE 3WWBA 1C2MA 1XKBC 1BZXE 4AN7A 2ZDNA 4X6MA 7GCHG 1NRPH 1ABJH 1TQ7B 1MKWK 5AHGH 3ZV9A 1HUTH 1S6LA 2AIPA 4NZQA 1ANCA 1ELBA 2FOAA 4XFQA 1GJ6A 1THRH 3RXGA 1GI9B 4TPYA 1G3DA 5DP8A 4ZHMU 3ZVCA 1DFPA 1TE0A 1WV7H 3QTOH 1EZQA 1CT2E 2Y82A 4YT7H 5FBEA 2XW9A 4D9RA 1O2TA 1GHBF 1YPHE 2OD3B 3RMOH 1YF4A 1JOUB 3TK5A 1ZJDA 3DHKH 4GLYA 3RXUA 3WY8A 1EP6A 3ZZ5A 4F4OC 4KTCA 3A8CA 5IDKA 1UK3A 1AN1E 1QB9A 3T2NA 1D3PB 1Z6JH 1O2ZA 1O32A 1YBWA 3A8AA 2BMGB 2QE7D 1O5EH 3UR9A 3SW2B 2FO9A 1GBKA 5FXLA 1ZRKA 1G36A 4VGCC 3RXPA 3STIA 1NPMA 2V6NA 3P8OA 2FDAA 2XC5A 4H6TA 1O38A 2Q6FA 3S69A 2SGFE 5GWZA 5EPYA 1GVZA 1MBQA 1BMMH 4CH2B 1DPOA 1JIMA 3U8RH 4ISHH 1V2WT 1GBTA 1MTNB 1H9HE 2RA3A 1ZSLA 2A2QH 3LDXH 1BRAA 2G5VA 1FNIA 1GBDA 2ZEBA 3LT3A 1YPHC 1AFQC 1QCPA 2WV5A 3BTTE 2FYRA 1GBMA 4FUIA 1SGFA 3GOVB 7GCHF 1J16A 3BTWE 1WQSA 3RMMH 1MABB 4O97A 1DXWA 4ABBA 1XVMA 1C2HA 3MI4A 3GCNA 1HNEE 1MTUA 3OU0A 4ASHA 1G37A 1UTQA 1LPZB 3A8DA 1H1BA 1SGQE 3RXHA 2XOKD 4NIWA 4AGJA 2PKAB 5A8YA 2FOMB 4E06H 1O3NA 1PFXC 2Z3EA 1VR1H 2HPQH 2ZFQH 3RC4A 1CA0C 3ZVGA 2B9LA 4A6LA 1FAKH 1DANH 3M7TA 1LTOA 4U30A 1TAWA 3PWBA 2UUKB 3PWCA 2DUCA 3RXAA 4JYVH 1HJ9A 2PKAA 1Z8RA 1KTSB 2BY5X 3RU4T 3A7VA 1BTWA 1GI1A 1TBZH 1UCYE 3EA8A 1SFIA 5CDFE 1P05A 2XC0A 3LOXA 2QXGA 2OXSA 2OTVA 1KXCA 1BJUA 1HV7A 5EW2H 3KQBA 4HZHA 1GBHA 1BTPA 1O3LA 1TPOA 3TJUA 1JRTA 1O2RA 4TWYA 3P8GA 1Y3WA 5GCHG 1XXFA 3BTFE 5EG4A 1AI8H 1TPAE 1W11U 2STAE 3ODDA 5F8XA 4WMDA 3QLPH 3CENA 3EYDA 2HLCA 3SNEA 1SLUB 3OE7D 3PV2A 1A46H 2Z9GA 1UVSH 3C27B 1P9UA 5DSFA 1T31A 1T8NA 4H4FA 3AASA 4Q7YA 1ELTA 5EW1H 2A7JA 5TCCA 1O39A 2OLGA 4AG1A 1H8HD 1C1MA 1FY4A 4R8TB 3LGUA 1P03A 4AB9A 1B5GH 1DE7H 2P59A 2ZGJA 3KCGH 1DXPA 2JKHA 1C2GA 2BVSH 1QTFA 2GDEH 4MTBA 2VBCA 3IG6B 3A8BA 1V3XA 2ODYB 1UO6A 1G32B 1MQ5A 3F0OA 4I7YH 5DKMA 4TYDA 1AVWA 4WWYA 4AX9H 3A7ZA 1W0KD 4ZXYH 1F0UA 1NBME 1TX8A 1SR5C 4B2AA 1LVYA 1EJNA 1SI5H 1VCWA 3A83A 3VPKA 2G52A 2GV7A 1C5QA 2ZU5A 1CBWB 2AH4X 1LMWB 4AORA 3K9XB 1MKXK 1RFNA 5I46H 2Y5HA 4NSYA 2HNTE 5GXPA 3IITA 1TRMA 2PFEA 2ZF0H 1AKSA 1D3TB 2R0LA 1FMGA 4ZMAH 4I31A 2F43B 1A0LA 3D62A 2GP9B 3AAVA 2PSXA 3LIWA 5TCAA 5JB8S 1TMBH 1LVMA 3I77A 3KQDA 1A61H 1NU7B 5EQQA 4AB8A 3T27A 5I25A 4CREA 5AFZH 4ABJA 2PKSB 9LPRA 2HOBA 3P17H 3EA9A 2VWNA 2OC7A 5C1XA 3S7HB 2BQ7B 2BTCE 3QTVH 2B0FA 3B9FH 3PRDA 1O2YA 7KMEH 2G4TA 4AZ2B 3SHCH 4ZKSU 1IQMA 1GMDF 3SGAE 4HGCA 2LELA 1QRWA 1O3JA 1AY6H 1UTKA 2BD7A 1P2NA 2VWOA 2J94A 3HPTB 1BA8B 2QF4A 1A5GH 3DSPA 1GVLA 1AD8H 2A7HA 3GISB 4SGAE 4CBNA 2AMDA 3KN2A 2J2UA 1RS0A 1U6QA 1HAVA 4IS5A 1JWTA 3NWUA 1EP5A 3LONA 1T8OA 3NK8A 3ENSB 5F53A 1DUEA 1NESE 4K1SA 2JIZD 4NIYA 2FOBA 4U32A 3S9AA 3ZV8A 1DLKB 3RXCA 1PPCE 1CA8B 2JH6D 2ZDVH 4WVPE 1MD8A 1TMUH 1ELVA 1Z8IB 4X2XA 4GPGA 1E0FD 1FDPA 1ZTLA 4DVAU 1CSOE 2PLXA 2Z6BD 2OINA 2VGCB 1YLCA 4IMZA 2JJ2D 1C5RA 3CS0A 3RMLH 5FPYA 4K60A 4RKOB 2BDAA 3KHVA 2P16A 1GGDC 2TPIZ 5T3HA 1HFDA 1TBRH 1CHOF 3SO3A 2J34A 4CHAB 4YOJA 4X1SU 2Q6GA 5A2MH 1HAVB 2EA3A 2BD3A 2XCNA 3A80A 3U8OH 3A84A 3SUDA 2PWXA 1QHRB 2PSYA 1ARBA 1BQYA 3UTUH 6GCHF 2QN5T 2AFQB 3KIDU 2P8OC 4IBLH 4CRDA 3M37A 3RXTA 1T8LA 2FI5E 5EGMA 1NBMD 1P2OA 5EQRA 4M7GA 1ESTA 5E0HA 1Z1IA 2HPPH 4GUXA 1CE5A 2XC4A 1O2WA 1JIRA 1F5RA 1E35B 1YPKH 5C1UA 2HNTF 1LHDH 1L1NA 1GGDB 2GT8A 3KL6A 3F2FA 1J8AA 2VIOA 2FM2A 3PLKA 3QWCH 3U8TH 4X1NU 2QY0B 4JK6A 1S85A 1SLXB 2GCHG 1S6FA 2K1QA 1W7XH 1OWHA 4Y6DA 4AFSA 2VWLA 2VGCC 3RP2A 2Z9IA 4ISLA 2O8MA 3STJA 4IMQA 1O2KA 3FANA 2WSSD 1VCPA 2VIPA 5DO4H 1BB0B 3TK6A 3K65B 6CHAB 3F3BA 1EOLA 2R3YA 4DGJA 1D3QB 1FV9A 4ABEA 4GVUA 3PROA 1DT2A 2TIOA 2Z7FE 4B6EA 4UEHH 1TWXB 5F03A 2Z9LA 3H7TA 2BX3A 4ZHAA 1BTXA 2A4QA 2VJ1A 4X8VH 3O8RA 1AE8H 1EPTA 3A82A 5ETXA 1JMOH 3TU7H 2PGQB 2VU8E 2ZHEH 3ATWA 2J5UA 4OM9A 2KAIA 1NFXA 1L0ZA 1C1RA 4WH6A 1IQHA 2STBE 1OWEA 4UONA 1G3CA 1P0SH 1Y3YA 2HVXA 4ABGA 1GJ7B 1PYTC 2W3IA 4KELA 5F8TA 1TMTH 3GYMA 4AYYB 1UVPA 1MCTA 4BAMB 2BLVA 1LHEH 1SSXA 4JYTA 1O3AA 1ZTJA 3Q3YA 2VIVA 3RUOA 1HB0B 3RXQA 4Y8YA 2A4OA 4OS1A 1C2LA 3OTJE 1E37B 1D6RA 4XDEA 2XBYA 3ATLA 3QGJA 3LGTA 1VZQH 2V7QD 4MVNA 3BN9A 3SU3A 1HAGE 2NWNA 1GBJA 1F0RA 1WBGB 1YYY1 4J2YB 3MH5A 2ALPA 2A31A 2QF0A 1DDJA 1DSUA 5DPAA 2ZA5A 1DSTA 3RXBA 4WF8A 1EKBB 2ZCLP 2OQ5A 3TGJE 1L1GA 1C1PA 6ESTA 1KLTA 3DD2H 3PLBA 4DY7B 1GHBG 3UOUA 2BXTH 1PQ7A 3D49H 4Z6AH 3TITA 3VB5A 2ZECA 3GICB 5CHAC 4XSKU 1RTFB 2WPMS 2G00A 3NZIA 1ID5H 1TGSZ 4AOQA 1LKBA 1UVOA 3A7YA 4BNRA 4WJG2 5EPNA 4YM9A 3PYHA 4K1EA 2O8LA 4DIIH 1C2EA 1D9IA 1EZSC 5DP4A 5FHTA 1V6DA 1HJAB 2F3CE 2JDID 1K1MA 3FP6E 3L33A 5T1VA 3RMNH 1TOMH 5C5OA 1ELGA 1D3DB 1MZDA 1GJ5H 4MNWA 1BTYA 4I32A 2HWLB 2KFWA 2VIDA 1C4V2 4MQAA 1SC8U 2FI4E 1C1VH 3E91A 2B8OH 2A1DB 1YPGH 1FJSA 3U69H 5GPIB 1E34B 1LDTT 2GTBA 1B7XB 2NU0E 5CHBA 4TY7A 2ZWLH 1GHAF 2WPJS 1EAUA 1FUJA 4OS4A 2WPDD 5JPMH 1NN6A 1H8IH 2GZ8A 2DE8A 1GHXH 1Y8TA 1L4DA 1CO7E 2H5CA 2ZQ1A 1IQKA 3F6UH 4FVDA 2ZGCA 1N8OC 4XBBA 3TGIE 2IOTA 2WZQA 3NKKA 4NA9H 1KXDA 2WUBA 1NZQH 3P95A 5HYOA 1C5TA 2P93A 1FN8A 4F49A 1O5GH 2VWMA 2GV6A 5IYTA 2QF3A 1VGCB 2FS9A 1AUJA 1HIAA 2PUQH 4NWLA 4OS7A 3RXIA 1W13U 5A0BA 3N7DA 4KTSA 2VINA 1QJ7B 2M5TA 1BHXF 4GAWA 1GI8B 2EEKA 3UUZA 1BJVA 2ZI2H 2P94A 1ZPCA 2C3SA 3UR6A 3ZZ6A 3A7WA 4BANB 5F6MA 2C8ZB 2VIQA 1O2HA 5EODA 1NRQH 1TNJA 1GI4A 2SGQE 2FX6A 2HLDD 4INKA 2ANKH 2W6JD 2VVUA 4ABIA 1TNGA 1CT4E 3PMBB 1QIXB 3ZVBA 1EAWA 1HAHH 1PQAA 4X6OA 2ZIQH 1RTKA 5DP5A 1VGCC 4CH8B 3UB0A 3RXRA 1AO5A 2FOFA 5T6DA 3U98H 1SLVB 2A0QB 2V35A 1C5NH 4J1YA 1DUAA 4ZHLU 2ZTXA 1YC0A 1C5LH 1TRYA 3ATKA 1HIAB 2K8IA 1AUTC 1BRBE 2ZPQA 3MNSA 4H6SB 5GJ4B 1UTJA 1DWBH 1SFQB 1LHGH 2H5DA 3MHWU 2JETC 2WPHS 1BCUH 1NU9A 2A7CA 3RDZA 1ETRH 1LPGB 2FPZA 3K2UA 4D76A 1ACBE 1SGRE 3SHAH 1O31A 1P2KA 1C1UH 2ZP0H 2Q6DA 2ESTE 2F9VA 2WV4A 1N6XA 5JBAS 1Y3XA 3DFLA 1GI6A 2W26A 2Z3DA 7ESTE 1P11E 3SUFA 4DG4A 1BT7A 3BEFB 1TIOA 4D7FA 6LPRA 3RXMA 1W2KH 1FN6A 1NROH 1IQEA 5L2YH 1VITF 2OBOA 3OX7U 1GG6B 3M5OA 1EZXC 4Y71A 3UFAA 4RKJB 3TK9A 1C2DA 3HGNA 4NCYA 5J4QA 4DIHH 1SGYE 2KAIB 1V2MT 1RIWB 1G3EA 1N1LA 1SGFG 1BTUA 5IK2D 1UTNA 1INCA 3GS9A 2A4RA 1UK4A 3ODFA 3RXOA 1KXBA 1SGTA 1Z7KA 4FUEA 2F9BH 1HAIH 4YZUA 1TNHA 4X6NA 1EJAA 3V3MA 2BY6X 5EQSA 1CHGA 6GCHG 1WU1A 1W7GH 1ORFA 4NFEA 1GMCG 3SV2H 5FX5A 1EXFA 2L6OA 4IN2A 5LPEA 3NUMA 1EAIA 3M61U 4JCNA 2IPHA 3M3VA 3WW7A 4U01A 1P3EA 2QIQA 3SJIA 1NY22 2XNDD 1AB9C 1BMLA 2FODA 1UMAH 4JZDH 2K0QA 4Q80A 4X8SH 4ZKNU 2FIRH 1FZZA 4MG3A 1OWDA 4O3TA 1EFRD 1S0RA 3MOCA 2TGAA 3TNTA 2J4IA 1O3MA 1GMHG 3PO1B 3GCHB 1FIZA 1O5DH 4ISIH 3M5MA 4BTIB 1SG8B 4BTTB 2P8OB 1BRUP 1CBWC 3B8JA 1J15A 2AMQA 3LH1A 3ZZ9A 1NT1A 2C8YB 1WAYB 4BTUB 3Q00A 4Z1MD 2FYQA 4D8NA 2J9NA 3PMAB 3QK1A 1T4UH 4AFQA 1Y5BT 2FESH 1WCZA 1JXPA 2Z9JA 3UIRA 3ZZCA 3MU1A 2FMJA 2PTNA 5JBTA 5GNDA 3T28A 3E16B 3KQCA 4YO9A 3ATMA 1SHHB 1GI5A 1RXPA 4UFGH 2A5AA 1ELDE 1O2PA 4WMEA 1C5SA 4YLQH 1GBEA 2BLOA 1TONA 1F0SA 4B71A 2Q1JA 1CQQA 1LQDB 1QBNA 2YNBA 1SGPE 1YCPK 4RSPA 1BMFD 3HK3B 2OUAA 1A7SA 1F0TA 4O3UA 1TALA 3UNRA 2CN0H 2OC0A 4INLA 1NRRH 1ZRBA 3FP7E 4NFFA 4NIXA 3QZRA 4GSOA 3JZ1B 3M5LA 3ATIA 4QT8C 2KCPA 3F9HA 5HXFA 4YOIA 1Y59T 1AVGH 3LU9B 1IQNA 1K1PA 2GGVB 3BIUH 1H4WA 4TWWA 3SNAA 1GJDB 2AMPA 1P02A 1GDNA 1KSNA 5JB9S 3MO3A 4ZXXH 3MNBA 3SGQE 1VJ9U 3M3SA 1BMAA 1N8OB 1O2SA 1V2TT 2ZGBH 1SQOA 4K1TA 1ABIH 3MH7A 2WYJA 1RTLA 1NS3A 3RXVA 2BX4A 5A09A 4JZFH 4R0IA 1QGFA 3F9EA 2H9TH 1HPGA 1V2VT 2ULLA 4DT4A 5J4SA 1KLJH 4LZ1H 2BDGA 1FAXA 3SJKA 2QF5A 3GY7A 2EI6A 4NA7A 1WXRA 2J92A 2C93B 2OC1A 1Z6EA 2RCEA 3O8DA 4I33A 1C4U2 3ZZAA 2GT7A 2AGEX 1UHBA 1HAZB 3MYWA 1DS2E 3QUMP