2BD5A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and lys-ser at ph 5 and immersed in ph 9 buffer for 30 seconds
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-casomorphin-7
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd5A01
1WAYB 1A3BH 3BEUA 3ZVAA 1V2TT 1GDUA 2A4QA 1AVWA 3QDZB 1BHXF 1VITG 3MU1A 3TU7H 4F4OC 1O2NA 2PGQB 4DT7B 3SBKA 4X6PA 5F03A 3ZYDA 2BOKA 2ZG0H 2P3FH 3M3VA 2XNIA 4AFUA 1C1MA 1SGTA 2ZFTA 4H42U 4INLA 4A92A 4OGXA 1YPJH 1MQ5A 2BY7X 4B2AA 2ZWLH 3ITIA 4ZXYH 3A88A 3UQVA 4ABFA 6GCHG 1LQEA 2AMPA 2RCEA 1BTWA 1E0FD 3VGCC 4UFEH 1FJSA 3FP8E 4FUBA 4IGDA 2FOMB 2PV9B 3STJA 1O3PB 1TGBA 1XUFA 2BDGA 2FESH 1MTVA 3QZQA 3AVZA 4A6LA 4AZ2B 1YLDA 5LH8A 1DSTA 3GY8A 1GVZA 1TGNA 1ARBA 1OWDA 4MNXA 3KCGH 4KTCA 3Q77A 1OP8A 2FOGA 1K1LA 3MNCA 1O3NA 2BQWB 4FUFA 4UFDH 1QL8A 3SGQE 1ORFA 2A4GA 4Y6DA 3TJNA 4GUXA 1HAVB 3MWIU 1MUEB 4D7GA 1VCPA 3KQDA 2VWOA 1DLKB 1T8OA 4HI3A 1AWHB 3VB3A 3BTWE 1D6WA 1HJAB 3URDA 4X8SH 2TIOA 2WINI 2BM2A 4ISIH 4GVUA 5ETXA 1C2IA 1DWCH 5HXFA 3EGKH 4JZDH 1C2MA 3H7OA 1QFKH 1F5KU 5FPSA 1ELBA 1LPZB 4WH8A 6ESTA 1O2OA 7GCHF 1ELDE 1DITH 4YOJA 3KN2A 3RXKA 3M61U 1XUJA 1DANH 4CRBA 6LPRA 3PWBA 2JH5D 1C2HA 4FU9A 2H6MA 2KAIA 3PLPA 1LDTT 4FXGH 1QCPA 1ZMLA 1A0HB 4U32A 4NIXA 1O2YA 5DP9A 4IMQA 3M36A 4B73A 1ZRBA 4KELA 4NSVA 1FIWA 5DKMA 1BT7A 1V2NT 4NCYA 1ZTJA 4AFZA 4GHQA 2ZCLP 5A8YA 2R2WU 1C5PA 3A82A 4U01A 3ZYEA 2O8UA 4NG9H 3SZNA 2B0FA 4MNYA 3GY3A 1QA7A 1EATA 1QNJA 2VIOA 3U98H 4AGJA 1VGCC 5EXLA 3OX7U 4QT8C 3SHAH 3SJ8A 2R0LA 3SU3A 1FPHH 5EU8A 1W3CA 1NM6A 4CR5A 1DOJA 1V2ST 1O5DH 3MU5A 1OYTH 1ZLRA 1O5CB 4AN7A 1J15A 3E8LA 1OYQA 3HATH 3RMNH 2ZHDA 1O3MA 2XBYA 3M3TA 5GWZA 2ZGHA 1B0FA 1BTXA 2TGDA 1UTPA 4MLFB 2BLOA 2P3UB 1O2TA 1MTUA 2XRCA 3SJOA 1AKSA 2WPLS 3RXIA 2D26C 1HLTH 4Y11E 1V6DA 1PPGE 1C2LA 3D65E 1SC8U 5DG6A 1MZAA 1WCZA 3K6ZA 5A09A 5L30H 2P93A 1AZ8A 2O8MA 5H4IB 4KTUA 2FODA 1GCTB 1IQMA 3LGYA 3QN7A 4UEHH 5FBEA 1RIWB 1YGCH 1UHBB 1NRQH 2HNTC 4X8UH 3SU2A 1GMDF 3IITA 1JXPA 1FY5A 1O2MA 3A89A 4YM9A 1T8MA 3EDXB 2FYQA 3FZZA 2VIDA 4AB8A 1HBTH 4A1VA 1S6FA 3SU1A 2C3SA 3RDZA 1DPOA 1GI8B 1SGYE 1Z8JB 3SU4A 4A5TS 3DD2H 5EPYA 1ETSH 2BLVA 4B2CA 1EOLA 2ZP0H 1ELGA 3SGAE 2ZKSA 2Y82A 4MG3A 1A3EH 2PLXA 1O3CA 1OWKA 2PUXB 2J95A 3TH3H 3HKIB 2ILNA 4UFFH 3TVJB 1O31A 4AOQA 1KXAA 1C1QA 1O3LA 3SJKA 2GV6A 2J92A 2C8WB 1EXFA 1BIOA 1HDTH 2ZTXA 1AFQC 3RXJA 1S85A 1SB1H 1NRPH 2BX3A 5A0BA 1BMMH 4Y8YA 3LGTA 1CGIE 1GBKA 1SOZA 2XWBI 1T4VH 4D8NA 5GXPA 1NU9A 1SG8B 1F5LA 1UTJA 1O32A 1QB1A 1RJXB 2FOCA 1TRNA 3A80A 2QAAA 1IQLA 1CHGA 2QIQA 2ZQ1A 5TCAA 2ALPA 1BHXB 2FLBH 1SI5H 2ALVA 2PSXA 3GY5A 3IWMA 1S82A 1TNHA 1J9CH 1TOCB 2A5KA 3TGKE 4HGCA 2O8WA 3HGPA 8ESTE 1O38A 4X2XA 1HAOH 4K3JA 1C2EA 1RGQA 1Z1IA 1HIAA 1P01A 1BRBE 1P2MA 4YT6H 3UFAA 1CQQA 5JB9S 1FAXA 1GBFA 1B0EA 1BUIA 5GPIB 2BD5A 1W8BH 3KQEA 1AHTH 5E2PA 8KME2 5ESBA 1GJBB 1HAGE 4JYTA 5F8TA 2NU0E 3R3GB 4I8GA 4TY7A 1XUHA 2CJIA 4NZLA 1CA0C 2VH6A 4IC6A 4Y8ZA 2P59A 2ZDLA 4OGYA 3T26A 1D6RA 1YYY1 2FZZA 1DWBH 1K1JA 1FAKH 4WMFA 3T28A 2XCFA 1GHAF 2GCTB 4IW4E 2VIQA 2WPJS 3SORA 1ZHRA 1C2FA 3RMLH 1CA8B 1GBJA 2ZC9H 3LDXH 1HXFH 1A0JA 2PW8H 3SGBE 1S6HA 3PROA 3P92A 2V35A 3ZVEA 3M7QA 2FX6A 2QXJA 3QWCH 5EQSA 3SV9A 3GY6A 1GHWH 1FY4A 3S9CA 1ZZZA 2PKAA 2VNTA 3ZV9A 4XFQA 2AGIX 2PWXA 5F6MA 1TBRH 1PPBH 2CXVA 1EQ9A 3LC5A 2VVCA 3MHWU 1SFQB 4ZROA 1FY8E 1AZZA 4MTBA 1F92A 1C2JA 1F2SE 3OTJE 2WPHS 3PLKA 2GP9B 3C27B 1LHDH 2VGCB 4NZQA 1PPEE 3NUMA 5CHAC 1AU8A 2EI7A 3SQEE 1HRTH 2I6SA 3P8OA 1NFUA 4AG1A 1O5BB 4U30A 1JIRA 1PPHE 1BJUA 1O2RA 1AE5A 1GI4A 1P03A 1YCPK 3SJIA 2FTMA 2PKSB 3PMAB 3T5FH 3ATKA 2KAIB 1GPZA 4FUDA 4I8LA 3RLYH 2Y6TA 1HV7A 1GBEA 2H5CA 4MPXA 4YLQH 1IOEA 4ZUHA 3EA7A 2A2QH 3UTUH 2BOHB 5C2ZA 2Z9GA 1MTSA 1C4U2 3CS0A 3LT3A 2BDAA 3Q3XA 5AHGH 1V2MT 2AIQA 3ATLA 2SNVA 1O2HA 1O2JA 2GT7A 1MKXK 1F7ZA 1HAYB 1P11E 1MU6B 4AB9A 3ZZ4A 3ATWA 2ANYA 2FX4A 1SLXB 2QC2A 4O3UA 1A5IA 5GCHG 3F9GA 1AY6H 1ID5H 2Y5GA 1KXCA 4WY3A 2PTNA 4OS2A 2HRVA 2BY8X 1EAWA 1MU8B 1AN1E 2Z7FE 4E05H 2BTCE 4JMYA 4CRFA 4WXVA 1AGJA 1YLCA 3LKWA 1ANEA 1FPCH 3MO9A 4YTAA 1W0ZU 3KEEA 2ZCHP 1GMHG 2ZTZA 1EZXC 1A1RA 4Y7BA 3VXFH 1BTHH 1J17T 1GHAG 2A0QB 1DUEA 3M7TA 3MNXA 1KDQB 1NRRH 2NU4E 2WPIS 1ELCA 1TRMA 1DLEA 1IQHA 2W7UA 3MMGA 4SGAE 2WPKS 2Z9KA 3SUEA 1QY6A 1TWXB 4TY6A 1THRH 3RXAA 5HM9A 2A2XH 2YNAA 4IBLH 5L2ZH 4O9VA 1S0RA 4X8VH 1BB0B 3AAVA 1THSH 1C5OH 2AYWA 4CRCA 2XBWA 2UWPA 1TQ7B 1L2EA 1Z8RA 1QL7A 2A5IA 1QBNA 4XE4A 2NWNA 1S0QA 1TNJA 1V3XA 1ZR0A 2D1JA 4ABAA 2QYIA 1P8VC 4WF8A 1O2GH 2HOBA 2ZFPH 3A7YA 1OWJA 1P0SH 1W7GH 4JZIA 3ENSB 3KF2A 1KXFA 3ZVCA 1XVOA 2XCNA 2HNTF 3NCLA 4A7IB 3ZZDA 1C5YB 2CGAA 5DP3A 1C2KA 2AH4X 1F0UA 2XBXA 3OY5U 1J14A 2DE9A 1TABE 1ACBE 1AB9B 1GGDB 2WYGA 1NN6A 3MNBA 2ZO3H 4MPVA 4AGKA 1TX6A 2Z3EA 1O3DA 3A81A 3TGJE 1YBWA 7KMEH 1GJDB 5EW1H 2HVXA 3ATMA 1XUGA 3MTYA 1QR3E 4B71A 2J9NA 5E0JA 2PUQH 5JB8S 3BN9A 3BF6H 3IG6B 5EQQA 1O2SA 1XKBC 3A87A 3S7HB 4H6TA 1GI1A 1YC0A 2FOEA 2BQ7B 3ODFA 2YOLA 1Y5BT 5JBBS 2O8TA 3RXPA 4KTSA 1VITH 2UUKB 2P8OC 2OBQA 3RXFA 3RXOA 3GDUA 1UCYH 5T6FA 1VCQA 2FEQH 3U8OH 2F3CE 4YLUA 3RXQA 3S9BA 1C4Y2 1WSSH 3BG4C 1LQDB 2SGDE 3RLWH 1TMUH 3ZZBA 3STIA 1O2KA 1KLJH 2H9HA 2A5AA 1JRSA 4NSYA 3A7WA 3I77A 3T2NA 1VJAU 4JZEH 4BTIB 1Y5AT 2J2UA 2D2DA 1O5FH 3OSYA 4IN1A 1TOMH 4AYYB 4A1XA 4RN6A 3CS7A 1EJMA 1E37B 1M9UA 2P3TB 4ZHMU 2Y5FA 1PQ7A 1UTMA 1PPFE 3GCNA 1IQNA 4DG4A 2Z9LA 1TRYA 1XKAC 3ELAH 3K65B 2RA3A 1O3AA 3MOCA 5EXNA 1O33A 1ESTA 1FZZA 3CENA 1P57B 2ZU3A 3QTVH 5DJ7A 3OU0A 1AUTC 1BA8B 2OC7A 4NA9H 2QN5T 1ZYOA 1C9PA 3RMMH 1GVLA 5FCRA 2B7DH 1P3EA 4MPUA 5EODA 3T27A 1ZHMA 2BY5X 6CHAB 1O3GA 4DY7B 1A2CH 2TGTA 3O8CA 1BITA 2BB4A 1OKXA 5HMAA 3QGNB 3GDSA 2ZNKH 1ELVA 3PB1E 5DP4A 1EPTB 5AFZH 2GV7A 4K69A 4HZHA 2AFQB 2Y7ZA 1TALA 1ZHPA 2M5TA 4IN2A 5FXLA 1C1PA 2ZZUH 3PLBA 3QTOH 2ZDKA 1PJPA 1G2MA 1LHGH 1GHBF 1O5AB 3KHVA 4X6OA 4ABGA 3D49H 4BTUB 1RFNA 4GSOA 3ZVFA 1KXEA 2O9QA 4Q2KA 1N6XA 3TK5A 4O03A 2GD4B 3KQBA 3LGIA 4PROA 4Y79A 2ZFSA 1NS3A 1DXWA 1SGDE 3NPSA 3LU9B 4Q7XA 3LGUA 2SGAA 3SU0A 1JWTA 1YPKH 8GCHF 2OQUA 3MYWA 5ABWA 1ANCA 5A8XA 1DX5M 3VB5A 5C20A 4D9RA 4MNWA 3SNDA 1G32B 1O5EH 1O2PA 2H1UA 1ANBA 3SV7A 1O39A 1QB6A 1XX9A 1TAWA 1TB6H 1GI6A 2VIVA 1C5LH 1MKWK 1NT1A 4SGBE 1EJNA 1INCA 2P95A 1PFXC 1EZUC 1TFXA 2QXIA 4FUEA 1O36A 1NFWA 1C9TA 5EG4A 1SGRE 2XYAA 4I32A 1Y3XA 1DY9A 3LOXA 5F8XA 2W5EA 5HYOA 3B8JA 2ZIQH 1GVKB 1VGCB 1YCPM 2Z6BD 2GMTC 2I6QA 5JBAS 2UWOA 1TBZH 2FYRA 3I78A 5JDUB 1G2LA 3EAJA 4GPGA 1AWFH 1Y3YA 2F9VA 1DT2A 3PTBA 1BBRE 3K9XB 3TJVA 1AIXH 1NROH 1TGSZ 2HPPH 2SGFE 3BTEE 1BMLA 2OC1A 4IMZA 4BXWA 3T62A 1F5RA 2ZDAH 1SL3A 2J4IA 1HJAC 1T32A 4B75A 1Y3UA 1ZJDA 4UDWH 5JPMH 3RXLA 1W7XH 1DY8A 4Q7YA 2W7SA 1TYNA 4FU7A 4DURA 2BHGA 2Z3CA 2DUCA 3GCHB 3VB6A 1PYTC 3MH7A 3HGNA 3GCOA 2XTTB 1MTNC 3RXCA 2WV5A 3PO1C 1L4DA 2QY0B 2ZFRH 1TX8A 1CHOF 3I29A 2ZDVH 3QO6A 3GCTF 3PMHB 1DSUA 1MMJN 1ELAA 1QL9A 4Z0KA 2XC0A 5FAHA 2VU8E 1SLVB 1UK2A 2R0KA 2ZCKP 3ZVGA 1Q31A 5A2MH 4K1TA 1TX7A 1WBGB 1Q2WA 4RKOB 2FM2A 3QGJA 1V2LT 1WUNH 5GDSH 1V2WT 1V2RT 1KTSB 1ZGVA 4ISNA 2F91A 3RXEA 4VGCB 1C4V2 2ZI2H 3UREA 1AE8H 3Q3YA 1LPKB 1Z71A 8GCHG 2A7CA 1D9IA 1IAUA 1V2PT 2ZECA 4LOYH 1GBMA 3ZZ8A 2BD3A 4O97A 1O2IA 1IQEA 1YPGH 1V2UT 1G3CA 2JETC 3HPTB 1ARCA 3VXEH 2G4UA 5J4QA 4BTTB 5FX5A 1ELEE 1Z8IB 1O5GH 1EB2A 2FLRH 1GI7B 2P16A 4NWKA 4X2WA 1TNKA 1OSSA 2FPZA 3SW2B 2QXHA 3P8GA 2QF0A 1HAZB 2C8ZB 3PM3A 4FUIA 7GCHG 3KIDU 4ZXXH 2Z9JA 3UOUA 3EQ0H 1O2WA 2ZGXH 4Y0YE 3M5LA 2BVXH 1QJ7B 2OTVA 1CBWB 3QX5H 5ESTE 1G9IE 3SNEA 2D8WA 4JZFH 3NKKA 3TH2H 5E2OA 1FY3A 1P2KA 2OC8A 2BXUH 1GCTC 1PPCE 1TGTA 1B5GH 1EX3A 1RIWC 2FTLE 4Z6AH 2OD3B 3H7TA 3TLOA 4K60A 2A7JA 4E7RG 1BTUA 2GX4A 1HJ8A 1OP0A 1RTFB 4X1QU 2F9NA 5E8EH 3UR9A 1EP6A 3C1KA 3F9EA 1SGNE 1ZTLA 2G8TA 5K7RA 1O2ZA 5C5OA 1GI9B 1T7CA 2VWNA 4RKJB 4INKA 2XC5A 3GCTG 4NFFA 4B76A 3VB7A 2BDBA 1O3FA 2ZGJA 2R3YA 2TPIZ 1CA0B 2A45B 1BJVA 1AMHA 2F9OA 4BAHB 2TBSA 3K2UA 3M5OA 3UPEA 1HAHH 1O34A 4Q80A 5EW2H 1LHEH 4X6NA 4GCHF 1MAXA 1RD3B 3RXDA 3L3TA 4K1EA 1PQ8A 1QTFA 2Q6FA 2K1QA 2NU1E 3UR6A 3F9FA 1BMAA 4GLYA 3M35A 1AI8H 1WYKA 1H9LB 2G5VA 3PYHA 4NWLA 2QV1A 2XXLA 5T3HA 2G5NA 1YPMH 1UK4A 3M37A 1K21H 2BD4A 3V0XA 1K22H 3HKJB 3RXUA 1TMTH 2SGPE 1E36B 1EAUA 1GMDG 1LHCH 4I31A 1A46H 3UNSA 2NU3E 1BDAA 2HGTH 1CGHA 1GBBA 2ZU2A 1UCYE 4UONA 1NFYA 5E0HA 3HK6B 4X6MA 2WYJA 2FS8A 4K8BA 5LPEA 1F0SA 2AMQA 5BPEA 5CE1A 1AQ7A 3SQHE 1OP2A 2EC9H 1C1OA 1EASA 1CU1A 3F9HA 3D23A 4JYVH 1HYLA 3SUGA 4ASHA 4ABIA 5LPFA 3NWUA 1GG6C 4ABHA 2F9UA 3A7XA 5CHAB 3VPKA 2GTBA 1P9UA 3VEQB 1N1LA 5C1XA 5GJ4B 1FIZA 1BBRH 1EZSC 1A5GH 1S5SA 4ABJA 1C1UH 1LVOA 1SVPA 5JYIA 2ZPRA 1D3QB 1W2KH 2Y7XA 4ABDA 1EP5A 1MZDA 3PWCA 2FO9A 2QCYA 3BTKE 3RXSA 4AORA 1RRKA 1IQIA 3LJOA 3DFLA 1QURH 5SGAE 1KY9A 3BSQA 1K1NA 4XBCA 3FP6E 4TPIZ 3U1IB 2BVSH 1C5RA 3E90B 1F0TA 2UUJB 1TNIA 3BTME 1T4UH 2GCTC 4CR9A 1BOQA 1ZSKA 7LPRA 1KLTA 1CT4E 1YP9A 4DIIH 4X1PU 3DA9B 1SMFE 3ATIA 2CN0H 1OS8A 4ZKRU 1HJ9A 4M7GA 1IQJA 3V13A 2CF9H 4Y10E 1V2QT 3SHCH 1MAYA 1K1PA 3FVFB 1QHRB 1LKAA 4Y76A 3BIVH 5FX6A 1TLDA 4FUJA 2ZU5A 1PYTD 4DVAU 2SGQE 1JMOH 2PTCE 1MD7A 1YCPH 1FN8A 5DP5A 3B23B 1LKBA 2BLWA 2ZPSA 4GCHG 1H1BA 1ABIH 2C4FH 1ELTA 5FPYA 2CHAB 4I8KA 3E0NB 1T8LA 1O2XA 1P3CA 1L4ZA 2BZ6H 2VGCC 1SQAA 3SJ9A 4ISHH 1P06A 1WQSA 4U2WA 3MO6A 3A7ZA 1J16A 1ZSLA 2QF3A 1O30A 2Y5HA 4DJZB 1C2GA 3U9AH 1FN6A 3RMOH 3KNXA 5AFYH 1O3OA 2BLQA 3LIWA 4NFEA 9ESTA 2PKSC 2ODYB 1VR1H 1MCVA 3R0FA 1CVWH 1UJ1A 4LZ4B 4NA7A 2GCHF 1E35B 1K1MA 1AKSB 2H9EH 2BD2A 1GMCF 4CRAA 2A7HA 1TA2A 1C5QA 2ULLA 4JZ1A 3O8DA 4KKDA 5F8ZA 1V2KT 3F1SB 3NXPA 4JK6A 4MPWA 1KXBA 1K1IA 1YKTA 1GBCA 5IDKA 3FANA 3MU4A 1TE0A 1GI3A 2ZHWH 3GISB 1DM4B 1OXGA 2OLGA 4ZKOU 1QB9A 3F68H 1GJ6A 1QJ6B 3BV9B 3QLPH 2XC4A 5AF9H 3SN8A 1C1NA 3SV8A 1LTOA 1NPMA 1SQOA 4FU8A 2BDCA 3M7UA 3GICB 1HAIH 4MQAA 5AVDA 4WMDA 2A4RA 1SFIA 5CMXH 5JBCS 4CHAB 4XBDA 2BXTH 1KIGH 1IQFA 4NA8A 3Q3KA 1Q3XA 2RDLA 4XDEA 2A1DB 3A7VA 2P94A 5K0HA 4CREA 4DIHH 4UD9H 3L6PA 5A0AE 1VITF 5HM2A 1Y3VA 4I33A 5DP7A 1AUJA 4XBBA 1GCDA 3BTFE 3E3TA 1D3DB 1GJCB 2TGPZ 1NC6A 1ZPCA 4MDSA 1YPEH 3URCA 3FAOA 1ELFA 2Z9IA 1GJ4H 3Q76A 5EXMA 4XOJA 2BDIA 1XVMA 4BANB 1C5WB 4TYDA 3E91A 3PV4A 1KLIH 3NZIA 5FPTA 1TONA 1OWHA 2PSYA 3P95A 1UHBA 1IQGA 3MH5A 3TJUA 1XUIA 3BEIB 1GJ8B 3M5NA 2STBE 1GL0E 3E0PB 1EB1H 1SBWA 1GI0A 1BTYA 1PQAA 1YM0A 1HIAB 1AB9C 3UY9A 3B9FH 3A83A 3DFJA 1BRCE 2HWLB 2HLCA 2C90B 1TA6A 1A4WH 1C5XB 1YPHE 2UWLA 1U6QA 4TPYA 1WTGH 1W14U 5TCCA 3K6YA 3ZV8A 3P17H 1O2QA 3RXBA 2ANMH 4AFSA 4OS5A 1GBAA 1MCTA 1W12U 4K5ZA 1LVBA 1V2OT 1EKBB 1OOKB 2CMYA 1G3DA 1HGTH 2FOAA 4LZ1H 5J4SA 1UO6A 3FFGA 2GZ8A 1P09A 1ZPZA 2A32A 3MNSA 1UTOA 3RC6A 1LVYA 2F83A 4I8HA 3VGCB 1BRAA 3UWJH 1NRSH 4DW2U 2BQ6B 5DP6A 2F9BH 2H5DA 1N8OC 2F9PA 2GDDA 1XUKA 1GWAA 1Z6EA 2PKAB 3UNQA 1EOJA 2ANWA 1N6YA 1J8AA 4JCNA 2OQ5A 3JZ1B 2B9LA 3RXRA 2PR3A 3RC4A 3N7OA 4B2BA 4DCDA 1ETTH 1P2JA 3EYDA 1FXYA 2ESTE 4ABBA 3RU4E 2H9TH 3SV2H 3LH3A 1GJ9B 1HUTH 2ZDMA 5JBTA 5C5NA 1P2IA 3RXVA 2R9PA 4ZHLU 1G3BA 3NK8A 4OS4A 2TGAA 2CF8H 3LPRA 1FLEE 1UMAH 2IJOB 3BTTE 1RXPA 1C5NH 2G4TA 2EI6A 5FBIA 3ZZAA 3ZZ6A 3A8BA 1T31A 1QBVH 5PTPA 2VWLA 1GDQA 3WY8A 3A86A 1OPHB 3T25A 1C5VA 2IN2A 1GJAB 4J2YB 1FV9A 4FUCA 1MBMA 3RXGA 1FMGA 1HNEE 1XXFA 4ZKNU 1PQ5A 1DUAA 1DVAH 2J34A 3LGVA 1H9IE 2HALA 1NTPA 1UVUH 1A7SA 3ZZ9A 1HB0B 3RXMA 2PFEA 4JK5A 1ZGIA 1UVOA 4BAOB 6CHAC 1TPSA 2QGRA 4WWYA 3ZZCA 4E7NA 2Q1JA 1GBIA 4IC5A 2Y81A 2GMTB 3U8TH 4J1YA 4ZKSU 1GHXH 4ISOA 3P6ZB 9LPRA 4ZH8A 4BNRA 1EPTC 1S81A 3W94A 1GBLA 1KXDA 2WUCA 1DS2E 2G52A 5T6GA 2BY9X 2A31A 4CH2B 5EGMA 3ZZ3A 4BOHA 3MU8A 4MVNA 1EAIA 2ZDNA 5EQRA 3OYPA 1VZQH 1UVPA 1SGIB 1BQYA 1SQTA 2Q6GA 2UUYA 2ODPA 3QZRA 4D9QA 1G3EA 1W10U 2ZU1A 1NU7B 1MKWH 3VB4A 1SPJA 1QQUA 1MQ6A 4BAMB 1Y8TA 3M5MA 1MTNB 1GBDA 2V6NA 1QQ4A 2C8XB 2Z3DA 3PO1B 1C5ZB 2G55A 4FUHA 4RSPA 1THPB 1QJ1B 4ZMAH 1C5TA 3EA9A 2ZGCA 2EA3A 4AYVB 1SR5C 2QA9E 1JRTA 4NIWA 3M3SA 2JH6D 4K1SA 2OC0A 1FNIA 1SGFA 2H2ZA 1C1RA 2VJ1A 1ANDA 4I7YH 4O3TA 2STAE 3PTNA 1TPPA 5DP8A 3S9AA 1W0YH 2BMGB 2GZ9A 3TIUA 1C1TA 1O35A 3FZDA 1O2LA 3E1XB 4NIYA 1SHHB 2LNCA 1NRNH 1P12E 3CP7A 2GZ7A 2VH0A 1GHBG 3RU4D 3TJOA 2JETB 2ZGBH 3A8AA 2C8YB 2GT8A 4WVPE 4XSKU 5A8ZA 1BMNH 2WV4A 1DICA 5DGJA 1AD8H 2ZEBA 1AFEH 3DT0H 2SFAA 3RM2H 1NO9H 2FOFA 1GHZA 4YO9A 1O2UA 1KDQA 4HFPB 1UTQA 5EOKA 1RS0A 1AO5A 2ZF0H 3GCHC 3VFEA 2EI8A 2BZAA 1YPLH 2VVVA 1FI8A 4X1RU 3SI3H 4F49A 3PMJA 4I8JA 4KGAA 1QIXB 1P02A 4MNVA 5C3NA 4CBOA 1AFQB 1O3IA 4WJG2 1WQVH 5I25A 4NGAH 1KSNA 3UOPA 1FQ3A 5T6DA 1S83A 4BAQB 4D76A 2OCVB 3QUMP 3DUXH 3F6UH 4FUGA 4CRDA 2VIWA 3ESTA 1Z7KA 2AGEX 3MO3A 2ANKH 3ZZ7A 5LGOA 2BD7A 1X7AC 1WU1A 2OUAA 1CGJE 3GYMA 3A8DA 5EPNA 1ETRH 1OWIA 3HK3B 4VGCC 1DXPA 5C1UA 4INHA 2FOHA 3AW1A 1P9SA 5C67A 2PHBA 2AIPA 2EEKA 1SGPE 2JKHA 2ZHQH 1XM1A 2J38A 4YOIA 5GIBA 1WTHD 1C2DA 1E38B 4JYUH 3TNTA 3SO3A 1LPGB 1QBOA 2AGGX 2BD9A 1SGFG 3GY2A 3LC3A 4TWYA 1H4WA 5LPRA 4AG2A 2Q6DA 2THFB 1QRZA 1E34B 1VJ9U 5FHTA 1MTWA 3TH4H 1WV7H 3MFJA 3RUOA 2AS9A 1CHOG 1C5SA 1CT2E 5L2YH 2ZHEH 4R0IA 2ZA5A 3EA8A 2G51A 3FP7E 4K8YA 1CBWC 5G4BA 1B7XB 1GL1A 4THNH 3LGWA 2Y80A 1UTLM 2JH0D 3ZZ5A 3MH4A 1L1JA 1D3TB 2O8LA 3W95A 1MBQA 4HTCH 3S7KB 4WH6A 3U8RH 3SUDA 3ZVBA 2ZPQA 1NESE 1AVXA 1C5UA 1BZXE 2BDHA 1AVGH 2BY6X 3BEFB 3T29A 2FIRH 1V2VT 1GI2A 3D62A 4TWWA 1GG6B 3TK6A 3LONA 3ODDA 3SU5A 3MU0A 1TIOA 1DWDH 3SOSA 1CO7E 1ZMJA 4Y0ZE 1HPGA 1S84A 3ZVDA 1O3KA 1O3BA 2WPMS 4X1SU 1IHTH 2FP7B 5GCHF 1K28D 3RU4T 2HNTE 4CRGA 2BYAX 3RP2A 3V3MA 3A8CA 3SUFA 2NU2E 2GDEH 1SGEE 1UTKA 1LVMA 3OY6U 1GHVH 1YF4A 4LXBH 1LCYA 1SGQE 1GMHF 2V0BA 1HAPH 3KQCA 2GKVE 1TNLA 1BCUH 1QRWA 2ZFQH 1P10A 2CV3A 1G36A 1G37A 5A0CA 4X1NU 1MD8A 5IYTA 1ESAA 1BBRK 2FOBA 4DGJA 2VB0A 3BG8A 1LMWB 3S69A 1ESBA 4GHTA 3GDVA 1JOUB 4UFGH 1DDJA 3TITA 1RTKA 4ZHAA 3DHKH 1C1SA 3GYLB 1SLWB 4ISLA 2W3KA 1NZQH 1L1GA 1WOFA 2PGBB 1Y59T 3E16B 1VCWA 3L33A 2RG3A 2V3HH 4BXSA 2RA0A 2BVRH 1H8DH 2AERH 2IPHA 1UVTH 2B8OH 1P2QA 1GBHA 2OXSA 5BRRE 1HAXB 1JBUH 4YESB 1IHSH 2TRMA 2B5TB 4B74A 2XW9A 2UUFB 3V7TA 4UE7H 1QA0A 1ZSJA 2GVFA 1EPTA 1CSOE 1BRUP 3O8BA 4WXIA 5TJXA 3TK9A 1C5MD 3RXTA 1NFXA 4X8TH 1HXEH 1TGCA 2OBOA 4DOQA 1NY22 2HPQH 1HCGA 2VIPA 3RXHA 3MI4A 4NIVA 1BTZA 1ZOMA 3BTGE 4K2YA 3LH1A 1Z6JH 1H9HE 1Y5UT 3Q00A 2FI3E 1SLUB 1XXDA 1ZMNA 1HAVA 1GJ7B 3SU6A 2FDAA 1SGCA 1XMNB 2BDYA 3P8FA 5I46H 2G81E 4ESTE 3U69H 3SI4H 3RM0H 1P05A 2DE8A 3SV6A 4KP0A 2QXGA 2VINA 2R2MB 1TPAE 1MKXH 5C1YA 1JIMA 2W26A 4YT7H 1FY1A 3O8RA 1D4PB 3A7TA 1BTPA 1TBQH 3AASA 1Z8GA 5DK1A 3A85A 2G00A 2BD8A 2OINA 2FI5E 5DPAA 3RC5A 4B1TA 4BAKB 3UUZA 1DE7H 1H8IH 1EAXA 1ZJKA 3P70B 1GJ5H 1EZQA 2XWAA 2AEIH 1YPHC 2CHAC 2WUBA 3TGIE 1QRXA 1IQKA 4CBNA 1CT0E 3BTDE 1C1VH 1FUJA 2ZFFH 1Z1JA 1KTTB 1A0LA 1QGFA 2BX4A 1P2NA 3SNCA 8LPRA 3QK1A 3TNSA 3UNRA 3KGPA 4OS7A 1P04A 1W11U 3BTHE 2VVUA 4H4FA 1LO6A 3JZ2B 1FONA 1K2I1 2FWWA 3AW0A 3MH6A 4X2YA 2ODQA 1SOTA 2ASUB 3EE0B 1FDPA 1ABJH 1O3HA 2R3UA 2YNBA 3SNBA 4GAWA 1TPOA 2J94A 2XBVA 3UWIA 3U1JB 3P8NA 1GHYH 1OWEA 2P8OB 1DWEH 2V3OH 4OS6A 3A84A 3PMBB 2Z94A 2ZU4A 1O0DH 4E06H 1A61H 1K9OE 3BG4B 4WMEA 4IS5A 1A5HA 3GOVB 1ZPBA 4ZAEA 6GCHF 3SNAA 1ZTKA 1O3EA 2FMJA 1G30B 3V12A 1L0ZA 2C93B 4H6SB 1T8NA 2SNWA 1SSXA 4CHAC 1GBTA 2ZHFH 1GI5A 4FVDA 1UCYK 3KL6A 4A1TA 2VWMA 1TNGA 1W13U 5HGGA 2ZQ2A 4Y8XA 4X0WU 1GDNA 1O3JA 3E6PH 1KYNA 1TQ0B 1O2VA 1SHYA 1EJAA 1OX1A 4Y7AA 2FS9A 1GGDC 1O37A 2GCHG 1K1OA 7ESTE 1GMCG 1CE5A 1TMBH 4AX9H 3S0NA 1EUFA 4YOGA 3TPIZ 1LHFH 3UQOA 1F0RA 1MH0A 3GY7A 1L1NA 3GY4A 1ZRKA 4AFQA 2LPRA 2SGEE 1UTNA 3LJJA 1UVSH 3G01A 4FVBA 1N8OB 1HFDA 4X2VA 5E0GA 4LK4A 1UK3A 5DO4H 1C1WH 3H5CB 4Y71A 3BIUH 2IOTA 3AAUA 2FXRA 1D3PB 5FCKA 5B6OA 1DFPA 2GGVB 2OP9A 4Q7ZA 1P2OA 1Y3WA 2A4OA 4R8TB 1V2JT 4D7FA 2AMDA 4OS1A 5L6NH 1PPZA 2W3IA 3BTQE 3UIRA 4CH8B 1RTLA 4YZUA 2FI4E 2ZTYA 4ABEA
chains in the Genus database with same CATH superfamily
1WAYB 1A3BH 3BEUA 3ZVAA 1V2TT 3N99A 1GDUA 2A4QA 1AVWA 3QDZB 1BHXF 1VITG 3MU1A 3TU7H 4F4OC 1O2NA 2PGQB 5KEDA 4DT7B 3SBKA 4X6PA 5F03A 3ZYDA 2BOKA 2ZG0H 2P3FH 3M3VA 2GJGA 2XNIA 4AFUA 1C1MA 1SGTA 2ZFTA 4H42U 4INLA 4TT3D 4A92A 4OGXA 1YPJH 1MQ5A 2BY7X 4B2AA 2ZWLH 3ITIA 4ZXYH 3A88A 3UQVA 4ABFA 6GCHG 1LQEA 2AMPA 2RCEA 1BTWA 1E0FD 3VGCC 4UFEH 1FJSA 3FP8E 4FUBA 4IGDA 2FOMB 2PV9B 3STJA 1O3PB 1TGBA 1XUFA 2BDGA 2FESH 1MTVA 3QZQA 3AVZA 4A6LA 4AZ2B 1YLDA 5LH8A 1DSTA 3GY8A 1GVZA 1TGNA 1ARBA 1OWDA 4MNXA 3KCGH 4KTCA 1KMHB 1OP8A 2FOGA 3Q77A 1K1LA 3MNCA 1O3NA 2BQWB 4FUFA 4UFDH 2F4LA 1QL8A 3SGQE 1ORFA 2A4GA 3F2GA 4Y6DA 3TJNA 4GUXA 1HAVB 3MWIU 1MUEB 4D7GA 1VCPA 3KQDA 2VWOA 1DLKB 1T8OA 4HI3A 2RDEA 1AWHB 3VB3A 3BTWE 1YWUA 1D6WA 4F48B 1HJAB 3URDA 4X8SH 2TIOA 2WINI 5B6LA 2BM2A 4ISIH 4GVUA 5ETXA 1C2IA 1DWCH 5HXFA 3EGKH 4JZDH 1C2MA 3H7OA 4ACBA 1QFKH 1F5KU 5FPSA 1ELBA 1LPZB 4WH8A 6ESTA 1O2OA 7GCHF 1ELDE 1DITH 4YOJA 3KN2A 3RXKA 3M61U 4I86A 1XUJA 1DANH 4CRBA 6LPRA 3PWBA 4XRNA 2JH5D 1C2HA 4FU9A 2H6MA 2KAIA 3PLPA 1LDTT 4FXGH 1QCPA 1ZMLA 1A0HB 4U32A 4NIXA 1O2YA 5DP9A 4IMQA 3M36A 4B73A 1ZRBA 4KELA 4NSVA 1FIWA 5DKMA 1BT7A 1V2NT 4NCYA 1ZTJA 4AFZA 4GHQA 2ZCLP 5A8YA 2R2WU 1C5PA 3A82A 4U01A 3ZYEA 2O8UA 4NG9H 3SZNA 2B0FA 4MNYA 2JJ1D 3GY3A 1QA7A 1EATA 1QNJA 2VIOA 3U98H 4AGJA 1VGCC 5EXLA 1YY3A 3OX7U 4QT8C 3SHAH 3SJ8A 2R0LA 3SU3A 1FPHH 5EU8A 1W3CA 1NM6A 4CR5A 1DOJA 1V2ST 1O5DH 3DSOA 1OYTH 1ZLRA 3MU5A 1O5CB 4AN7A 5EIYA 1J15A 3E8LA 1OYQA 3HATH 3RMNH 2ZHDA 1O3MA 2XBYA 3M3TA 5GWZA 2ZGHA 1B0FA 1BTXA 2TGDA 1UTPA 4MLFB 2BLOA 2P3UB 1O2TA 1MTUA 2XRCA 3SJOA 1AKSA 2WPLS 3RXIA 2D26C 1HLTH 4Y11E 1V6DA 1PPGE 1C2LA 3D65E 1SC8U 5DG6A 1MZAA 1WCZA 3K6ZA 5A09A 5L30H 2P93A 1AZ8A 2O8MA 5H4IB 4KTUA 2FODA 1GCTB 1IQMA 3LGYA 3QN7A 4UEHH 5FBEA 1NBME 1RIWB 1YGCH 1UHBB 1NRQH 2HNTC 4X8UH 3SU2A 1GMDF 3IITA 1JXPA 1FY5A 1O2MA 3A89A 4YM9A 1T8MA 3EDXB 2FYQA 3FZZA 2VIDA 4AB8A 1HBTH 4A1VA 1S6FA 3SU1A 2C3SA 3RDZA 1DPOA 1GI8B 1SGYE 1Z8JB 3SU4A 4A5TS 3DD2H 3U28C 5EPYA 1ETSH 2BLVA 4B2CA 1EOLA 2ZP0H 1ELGA 5GNDA 2ZKSA 3SGAE 2Y82A 4MG3A 1A3EH 2PLXA 1O3CA 1OWKA 2PUXB 2J95A 3TH3H 3HKIB 2ILNA 4UFFH 3TVJB 1O31A 4AOQA 1KXAA 1C1QA 1O3LA 3SJKA 2GV6A 2J92A 2C8WB 1EXFA 1BIOA 1HDTH 2ZTXA 1AFQC 3RXJA 1S85A 1SB1H 1NRPH 2BX3A 5A0BA 1BMMH 2AHME 4Y8YA 1E79D 3LGTA 1CGIE 1GBKA 1SOZA 1UW7A 2XWBI 1T4VH 4M9FA 4D8NA 1W0JD 5GXPA 1NU9A 1SG8B 1F5LA 1UTJA 1O32A 1QB1A 1RJXB 2FOCA 1S6LA 1TRNA 3A80A 2QAAA 1IQLA 1CHGA 2QIQA 2ZQ1A 5TCAA 2ALPA 1BHXB 2FLBH 1SI5H 2ALVA 2PSXA 3GY5A 3IWMA 1S82A 1TNHA 1J9CH 1TOCB 2A5KA 3TGKE 4HGCA 2O8WA 3HGPA 8ESTE 1O38A 4X2XA 1HAOH 4K3JA 1C2EA 3WWFA 1RGQA 1Z1IA 1HIAA 1P01A 2W6JD 1BRBE 1P2MA 4YT6H 3UFAA 1CQQA 5JB9S 1FAXA 1GBFA 1B0EA 1BUIA 5GPIB 2BD5A 1W8BH 3KQEA 1AHTH 5E2PA 8KME2 5ESBA 1GJBB 1HAGE 4JYTA 5F8TA 2NU0E 1QZ8A 3R3GB 4I8GA 4TY7A 1XUHA 2CJIA 4NZLA 1CA0C 2VH6A 4IC6A 4Y8ZA 2P59A 2ZDLA 4OGYA 3T26A 1D6RA 1YYY1 2FZZA 1DWBH 1K1JA 1FAKH 4WMFA 3T28A 2XCFA 1GHAF 2GCTB 5C0TA 4IW4E 2VIQA 2WPJS 3DSGA 3SORA 2YMSB 1ZHRA 1C2FA 3RMLH 1CA8B 1GBJA 2ZC9H 3LDXH 1HXFH 1A0JA 2PW8H 3SGBE 1S6HA 3PROA 3P92A 2V35A 3ZVEA 3M7QA 2FX6A 2QXJA 2LP6A 3QWCH 5EQSA 3GY6A 1GHWH 3SV9A 5F53A 1FY4A 3S9CA 1ZZZA 2PKAA 2VNTA 3ZV9A 4XFQA 2AGIX 2PWXA 5F6MA 1TBRH 3EE7A 3F2HA 1PPBH 2CXVA 1EQ9A 3LC5A 2VVCA 3MHWU 1SFQB 4ZROA 1FY8E 1AZZA 4MTBA 1F92A 1C2JA 1F2SE 3OTJE 2WPHS 3F0PA 3PLKA 2GP9B 3C27B 1LHDH 2VGCB 4NZQA 1PPEE 3NUMA 5CHAC 3DCLA 1AU8A 2EI7A 3SQEE 1HRTH 2I6SA 3P8OA 1NFUA 4AG1A 1O5BB 4U30A 1JIRA 1PPHE 1BJUA 1O2RA 1AE5A 1GI4A 1P03A 1YCPK 3SJIA 2FTMA 2PKSB 3PMAB 3T5FH 3ATKA 2KAIB 1GPZA 4FUDA 4I8LA 4ZCNA 3RLYH 4Z1MD 2Y6TA 1HV7A 1GBEA 2H5CA 4MPXA 4YLQH 1IOEA 4ZUHA 3EA7A 2A2QH 3UTUH 2BOHB 5C2ZA 2Z9GA 1H8HD 1MTSA 1C4U2 3CS0A 3LT3A 2BDAA 3Q3XA 5AHGH 1V2MT 2AIQA 3ATLA 2SNVA 1O2HA 1O2JA 2GT7A 1MKXK 1F7ZA 1HAYB 1P11E 1MU6B 4AB9A 3ZZ4A 3ATWA 2ANYA 2FX4A 1SLXB 2QC2A 4O3UA 1A5IA 5GCHG 3F9GA 1AY6H 1ID5H 2Y5GA 1KXCA 4WY3A 2PTNA 4OS2A 2HRVA 2BY8X 1EAWA 1MU8B 1AN1E 2Z7FE 4E05H 2BTCE 4JMYA 3SZEA 4CRFA 4WXVA 1AGJA 1YLCA 3LKWA 1ANEA 1FPCH 3MO9A 4YTAA 1W0ZU 3KEEA 2ZCHP 1GMHG 2ZTZA 1EZXC 1A1RA 4Y7BA 3VXFH 1BTHH 2OK5A 1J17T 1GHAG 2A0QB 1DUEA 1EFRD 3M7TA 3MNXA 1KDQB 1NRRH 2NU4E 2WPIS 1ELCA 1TRMA 1DLEA 2J5UA 1IQHA 4Q63A 2W7UA 3MMGA 4SGAE 2WPKS 2Z9KA 4RT0A 3SUEA 1QY6A 1TWXB 4TY6A 1THRH 3RXAA 5HM9A 2K8IA 2A2XH 2YNAA 4IBLH 5L2ZH 4O9VA 1S0RA 4X8VH 1BB0B 1SKYE 3AAVA 1THSH 2JDID 1C5OH 2AYWA 4CRCA 2XBWA 2UWPA 1TQ7B 1L2EA 1YLNA 1Z8RA 1QL7A 2A5IA 1QBNA 4XE4A 2NWNA 1S0QA 1TNJA 1V3XA 1ZR0A 2D1JA 4ABAA 3FO8D 4TSFD 2QYIA 1P8VC 2KR7A 4WF8A 1O2GH 2HOBA 2ZFPH 3A7YA 1OWJA 1P0SH 1W7GH 4JZIA 3ENSB 3KF2A 1KXFA 3ZVCA 1XVOA 2XCNA 2HNTF 3NCLA 4A7IB 3ZZDA 1C5YB 2CGAA 5DP3A 1C2KA 2AH4X 1F0UA 2XBXA 3OY5U 1J14A 2DE9A 2QF4A 1TABE 1ACBE 1AB9B 1GGDB 2WYGA 1NN6A 3MNBA 2ZO3H 4MPVA 4AGKA 1TX6A 2Z3EA 1O3DA 3A81A 3TGJE 1YBWA 7KMEH 1GJDB 5EW1H 2HVXA 3ATMA 1XUGA 3MTYA 1QR3E 4B71A 2J9NA 5E0JA 2PUQH 5JB8S 3BN9A 3BF6H 3IG6B 5EQQA 1O2SA 1XKBC 3A87A 3S7HB 4H6TA 1GI1A 1YC0A 2FOEA 2BQ7B 3ODFA 2YOLA 1Y5BT 5JBBS 2O8TA 3RXPA 4KTSA 5EJLA 4F55A 1VITH 2UUKB 2P8OC 2OBQA 3RXFA 3RXOA 3GDUA 1UCYH 5T6FA 1VCQA 3UB0A 2FEQH 3U8OH 2F3CE 4YLUA 3RXQA 3S9BA 1C4Y2 1WSSH 3BG4C 1LQDB 2SGDE 3RLWH 1TMUH 3ZZBA 3STIA 1O2KA 1KLJH 2H9HA 2A5AA 1JRSA 4NSYA 3A7WA 3I77A 3T2NA 1VJAU 4JZEH 4BTIB 5C17A 2WSSD 1Y5AT 2J2UA 2D2DA 1O5FH 3OSYA 4IN1A 1TOMH 4AYYB 4A1XA 4RN6A 3CS7A 5HIZA 1EJMA 1E37B 1M9UA 1WXRA 2P3TB 4ZHMU 2Y5FA 1PQ7A 1UTMA 1PPFE 3GCNA 1IQNA 4DG4A 2Z9LA 1TRYA 1XKAC 2L74A 3ELAH 3K65B 4Q4LA 2RA3A 1O3AA 5CHBA 3MOCA 5EXNA 1O33A 1ESTA 1FZZA 3CENA 1P57B 2ZU3A 3QTVH 2RFKC 5DJ7A 1E1RD 3OU0A 4OM9A 1AUTC 1BA8B 2OC7A 4NA9H 2QN5T 1ZYOA 1C9PA 3RMMH 1GVLA 5FCRA 2B7DH 1P3EA 4MPUA 5EODA 3T27A 1ZHMA 2BY5X 6CHAB 1O3GA 4DY7B 1A2CH 2TGTA 3O8CA 1BITA 2BB4A 1OKXA 5HMAA 3QGNB 3GDSA 2ZNKH 1ELVA 3PB1E 5DP4A 1EPTB 5AFZH 2GV7A 4K69A 4HZHA 2AFQB 2Y7ZA 1TALA 1ZHPA 2M5TA 4IN2A 5FXLA 1C1PA 2ZZUH 3PLBA 3QTOH 2ZDKA 1PJPA 1G2MA 1LHGH 2HVYB 1GHBF 1O5AB 3KHVA 4X6OA 4ABGA 3D49H 4BTUB 1RFNA 4GSOA 3ZVFA 1KXEA 4XD7D 2IJD1 2O9QA 4Q2KA 1N6XA 3TK5A 4O03A 2GD4B 3KQBA 3LGIA 4PROA 4Y79A 2ZFSA 1NS3A 1DXWA 1SGDE 3NPSA 3LU9B 4Q7XA 3LGUA 2SGAA 3SU0A 1JWTA 2J98B 1YPKH 8GCHF 2OQUA 3MYWA 5ABWA 1ANCA 5A8XA 1DX5M 3VB5A 5C20A 3ZIAD 4D9RA 4MNWA 3SNDA 1G32B 1O5EH 3FOAA 1O2PA 2H1UA 1ANBA 3SV7A 1O39A 1QB6A 1XX9A 1TAWA 1TB6H 1GI6A 2JIZD 2VIVA 1C5LH 1MKWK 1NT1A 4SGBE 1EJNA 1INCA 2P95A 1PFXC 1EZUC 1TFXA 3F0OA 5C0UA 2QXIA 4FUEA 1O36A 1NFWA 1C9TA 5EG4A 1SGRE 2XYAA 4I32A 3WW7A 2XNDD 1Y3XA 1DY9A 3LOXA 5F8XA 2W5EA 5HYOA 3B8JA 2ZIQH 1GVKB 1VGCB 1YCPM 2Z6BD 5EJ1A 2GMTC 2I6QA 5JBAS 2UWOA 1TBZH 2FYRA 3I78A 5JDUB 1G2LA 3EAJA 4GPGA 1AWFH 1Y3YA 2F9VA 1DT2A 3PTBA 1BBRE 3K9XB 3TJVA 1AIXH 1NROH 1TGSZ 2HPPH 2SGFE 3BTEE 1BMLA 2OC1A 4IMZA 4BXWA 3T62A 1F5RA 2ZDAH 1SL3A 2J4IA 1FX0B 1HJAC 1T32A 4B75A 1Y3UA 1ZJDA 4ASUD 4UDWH 5JPMH 3RXLA 1W7XH 1DY8A 4Q7YA 2W7SA 1TYNA 4FU7A 4DURA 2BHGA 2Z3CA 2DUCA 3GCHB 3VB6A 1PYTC 3MH7A 3HGNA 3GCOA 2XTTB 1MTNC 3RXCA 2WV5A 3PO1C 1L4DA 2QY0B 2ZFRH 1TX8A 1CHOF 3I29A 2ZDVH 3QO6A 3GCTF 3PMHB 1DSUA 1MMJN 1ELAA 1QL9A 4Z0KA 2XC0A 5FAHA 4ACAA 2VU8E 1SLVB 1UK2A 2R0KA 2ZCKP 3ZVGA 1Q31A 5A2MH 4K1TA 1TX7A 1WBGB 1Q2WA 4RKOB 2J97A 2QE7D 2FM2A 3QGJA 1V2LT 1WUNH 5GDSH 1V2WT 1V2RT 1KTSB 1ZGVA 4ISNA 2F91A 3RXEA 4VGCB 1C4V2 2ZI2H 3UREA 1AE8H 3Q3YA 1LPKB 1Z71A 8GCHG 2A7CA 2CK3D 1D9IA 1IAUA 1V2PT 2ZECA 4LOYH 1GBMA 3ZZ8A 2BD3A 4O97A 1O2IA 1IQEA 1W0KD 1YPGH 1V2UT 1G3CA 2JETC 3HPTB 1ARCA 3VXEH 2G4UA 5J4QA 4BTTB 5FX5A 1ELEE 1Z8IB 1O5GH 1EB2A 2FLRH 1GI7B 2P16A 4NWKA 4X2WA 1TNKA 1OSSA 3SYJA 2FPZA 3SW2B 2QXHA 2KCPA 3P8GA 2QF0A 1HAZB 2C8ZB 3PM3A 4FUIA 7GCHG 3KIDU 4ZXXH 2Z9JA 3UOUA 3CNRA 3EQ0H 1O2WA 2HLDD 2ZGXH 4Y0YE 3M5LA 2BVXH 1QJ7B 2OTVA 1CBWB 2WZQA 3QX5H 5ESTE 5C94A 1G9IE 3SNEA 2D8WA 4JZFH 3NKKA 3TH2H 5E2OA 2V7QD 1FY3A 1P2KA 2OC8A 2BXUH 1GCTC 1PPCE 1TGTA 1B5GH 1EX3A 1RIWC 2FTLE 4Z6AH 2OD3B 3H7TA 5T1VA 3TLOA 4K60A 2A7JA 1COWD 4E7RG 1BTUA 2GX4A 1HJ8A 1OP0A 1RTFB 4X1QU 2F9NA 5E8EH 3UR9A 1EP6A 3C1KA 3F9EA 1SGNE 1ZTLA 2G8TA 5K7RA 1O2ZA 5C5OA 1GI9B 1T7CA 3UAIC 2VWNA 4RKJB 4INKA 2XC5A 3GCTG 4NFFA 4B76A 3VB7A 2BDBA 1O3FA 2ZGJA 2R3YA 2TPIZ 1CA0B 2A45B 1BJVA 1AMHA 4RI0A 2F9OA 4BAHB 2TBSA 3K2UA 3M5OA 3UPEA 1HAHH 1O34A 4Q80A 5EW2H 1LHEH 4X6NA 4GCHF 1MAXA 1RD3B 3RXDA 3L3TA 4K1EA 1PQ8A 1QTFA 2Q6FA 2K1QA 2NU1E 3UR6A 3F9FA 1BMAA 1E1QD 4GLYA 3M35A 3OTPA 1AI8H 1WYKA 1H9LB 2G5VA 3PYHA 4NWLA 2QV1A 2XXLA 5T3HA 2G5NA 1YPMH 1UK4A 3M37A 1K21H 2BD4A 3V0XA 1K22H 3HKJB 3RXUA 1TMTH 2SGPE 1E36B 1EAUA 1GMDG 1LHCH 4I31A 1A46H 3UNSA 2NU3E 1BDAA 2HGTH 1CGHA 1GBBA 2ZU2A 1UCYE 4UONA 1NFYA 5E0HA 2EY4C 3HK6B 4X6MA 2WYJA 2FS8A 4K8BA 2QF5A 5LPEA 1F0SA 2AMQA 5BPEA 5CE1A 1AQ7A 3SQHE 1OP2A 3F3BA 2EC9H 1C1OA 1EASA 1CU1A 3F9HA 1NBMD 3D23A 4JYVH 1HYLA 3WWBA 3SUGA 4ASHA 4ABIA 5LPFA 3NWUA 1GG6C 4ABHA 2F9UA 3A7XA 5CHAB 3VPKA 2GTBA 1P9UA 3VEQB 1N1LA 2KM0A 5C1XA 1K0HA 5GJ4B 1FIZA 1BBRH 1EZSC 1A5GH 1S5SA 4ABJA 1C1UH 1LVOA 1SVPA 5JYIA 2ZPRA 1D3QB 1W2KH 2Y7XA 4ABDA 1EP5A 1MZDA 3PWCA 2FO9A 2QCYA 3BTKE 3RXSA 4AORA 1RRKA 1IQIA 3LJOA 3DFLA 1QURH 5SGAE 1KY9A 3BSQA 1K1NA 4XBCA 3FP6E 4TPIZ 3U1IB 2BVSH 1C5RA 3E90B 1F0TA 2UUJB 1TNIA 3BTME 1T4UH 2GCTC 4CR9A 1BOQA 1ZSKA 7LPRA 1KLTA 1CT4E 1YP9A 4DIIH 4X1PU 3DA9B 1SMFE 2YMSC 3ATIA 2CN0H 1OS8A 4ZKRU 1HJ9A 4M7GA 5HKKD 1IQJA 3V13A 2CF9H 4Y10E 4AC9A 1V2QT 3SHCH 1MAYA 1K1PA 3FVFB 1QHRB 1LKAA 4Y76A 3BIVH 5FX6A 1TLDA 4FUJA 2ZU5A 1PYTD 2KCYA 4DVAU 2SGQE 1JMOH 2PTCE 1MD7A 1YCPH 1FN8A 5DP5A 3B23B 1LKBA 2BLWA 2ZPSA 4GCHG 3MQKC 1H1BA 1ABIH 2C4FH 1ELTA 1MABB 5FPYA 2CHAB 4I8KA 3E0NB 1T8LA 1O2XA 1P3CA 1L4ZA 2BZ6H 4HG6A 2VGCC 1SQAA 3SJ9A 4ISHH 1P06A 1WQSA 4U2WA 3MO6A 3A7ZA 1J16A 1ZSLA 2QF3A 1O30A 2Y5HA 4DJZB 1C2GA 3U9AH 1FN6A 3RMOH 3KNXA 5AFYH 1O3OA 2BLQA 3LIWA 4NFEA 9ESTA 2PKSC 2ODYB 1VR1H 1MCVA 3R0FA 5EJZA 1CVWH 1UJ1A 4LZ4B 5DN6D 4NA7A 2GCHF 3KQ5A 1E35B 1K1MA 1AKSB 2H9EH 2BD2A 1GMCF 4CRAA 2A7HA 1TA2A 1C5QA 2ULLA 4JZ1A 3O8DA 4KKDA 5F8ZA 1V2KT 3F1SB 3NXPA 4JK6A 4MPWA 1KXBA 1K1IA 1YKTA 1GBCA 5IDKA 3FANA 3MU4A 1TE0A 1GI3A 2ZHWH 3GISB 1DM4B 1OXGA 2OLGA 4ZKOU 1QB9A 3F68H 1GJ6A 1QJ6B 3BV9B 3QLPH 2XC4A 5AF9H 3SN8A 1C1NA 3SV8A 1LTOA 1NPMA 1SQOA 4FU8A 2BDCA 3M7UA 4FOUC 3GICB 1HAIH 4MQAA 5AVDA 4WMDA 2A4RA 1SFIA 5CMXH 5JBCS 4CHAB 4XBDA 2BXTH 1KIGH 1IQFA 4NA8A 3Q3KA 1Q3XA 2RDLA 4XDEA 2A1DB 3A7VA 5KGOA 2P94A 5K0HA 4CREA 4DIHH 4UD9H 3L6PA 5A0AE 1VITF 5HM2A 1Y3VA 4I33A 5DP7A 1AUJA 4XBBA 1GCDA 3BTFE 3E3TA 5DSFA 1D3DB 1GJCB 2TGPZ 1NC6A 1ZPCA 5HIYA 4MDSA 1YPEH 3URCA 3FAOA 1ELFA 2Z9IA 1GJ4H 3Q76A 5EXMA 4XOJA 2BDIA 1XVMA 4BANB 1C5WB 4TYDA 3E91A 3PV4A 1KLIH 3NZIA 5FPTA 1TONA 1VKYA 1OWHA 2PSYA 3P95A 1UHBA 1IQGA 3MH5A 3TJUA 1XUIA 3BEIB 1GJ8B 3M5NA 3FN8A 2STBE 1GL0E 3E0PB 1EB1H 1SBWA 1GI0A 2KZ4A 1BTYA 1PQAA 1YM0A 1HIAB 1AB9C 3UY9A 3B9FH 3A83A 3DFJA 1BRCE 2LELA 2HWLB 2HLCA 2C90B 1TA6A 4P00A 1A4WH 1C5XB 1YPHE 2UWLA 1U6QA 4TPYA 5KECA 1WTGH 1W14U 5TCCA 3K6YA 3ZV8A 5IK2D 3P17H 1O2QA 3RXBA 2ANMH 4AFSA 4OS5A 1GBAA 1MCTA 1W12U 4K5ZA 3OFND 1LVBA 1V2OT 1EKBB 1OOKB 2CMYA 1G3DA 1HGTH 2FOAA 4LZ1H 5J4SA 1UO6A 3FFGA 2GZ8A 1P09A 1ZPZA 1WDIA 2A32A 3MNSA 1UTOA 3RC6A 1LVYA 2F83A 4I8HA 3VGCB 1BRAA 3UWJH 1NRSH 4DW2U 2BQ6B 5DP6A 2F9BH 2H5DA 1N8OC 2F9PA 2GDDA 1XUKA 1GWAA 1Z6EA 2PKAB 2V3MA 3UNQA 1EOJA 2ANWA 1N6YA 1J8AA 4JCNA 2OQ5A 3JZ1B 2B9LA 3RXRA 2PR3A 3RC4A 3N7OA 4B2BA 4DCDA 1ETTH 1P2JA 3EYDA 1FXYA 2ESTE 4ABBA 3RU4E 2H9TH 2YMSD 3SV2H 3LH3A 1GJ9B 1HUTH 2ZDMA 5JBTA 5C5NA 1P2IA 3RXVA 2R9PA 2KX4A 4ZHLU 1G3BA 3NK8A 4OS4A 2TGAA 2CF8H 3LPRA 1FLEE 1UMAH 2IJOB 3BTTE 1RXPA 1C5NH 2G4TA 2EI6A 5FBIA 1SQRA 3ZZAA 3ZZ6A 3A8BA 1T31A 1QBVH 5PTPA 2VWLA 1GDQA 2WV9A 3WY8A 3A86A 1OPHB 3T25A 1C5VA 2IN2A 1GJAB 4J2YB 1FV9A 4FUCA 1MBMA 3RXGA 1FMGA 1HNEE 1XXFA 4ZKNU 1PQ5A 1DUAA 1DVAH 2J34A 3LGVA 1H9IE 2HALA 1NTPA 1UVUH 1A7SA 3ZZ9A 1HB0B 3RXMA 2PFEA 4JK5A 1ZGIA 1UVOA 4BAOB 6CHAC 1TPSA 2QGRA 4WWYA 3ZZCA 4E7NA 2Q1JA 1GBIA 4IC5A 2Y81A 2GMTB 3U8TH 4J1YA 4ZKSU 1GHXH 3OEHD 4ISOA 3P6ZB 9LPRA 4ZH8A 4BNRA 1EPTC 1S81A 3W94A 1GBLA 1KXDA 3OAAD 2WUCA 1DS2E 2G52A 5T6GA 2WHXA 2BY9X 2A31A 4CH2B 5EGMA 3ZZ3A 4BOHA 3MU8A 4MVNA 1EAIA 2ZDNA 5EQRA 3OYPA 1VZQH 1UVPA 1SGIB 1BQYA 1SQTA 2Q6GA 2UUYA 2ODPA 3QZRA 2KCAA 4D9QA 1G3EA 1W10U 2ZU1A 1NU7B 1MKWH 3VB4A 1SPJA 1QQUA 1MQ6A 2EQNA 4BAMB 1Y8TA 3M5MA 1MTNB 3PRDA 1GBDA 2V6NA 1QQ4A 1BMFD 2C8XB 2Z3DA 3PO1B 3PV2A 1C5ZB 2G55A 4FUHA 4RSPA 1THPB 1QJ1B 4ZMAH 1C5TA 3EA9A 2ZGCA 2EA3A 4AYVB 1SR5C 2QA9E 3PV5A 1JRTA 4NIWA 3M3SA 2JH6D 4K1SA 2OC0A 1FNIA 1SGFA 2H2ZA 1C1RA 2VJ1A 1ANDA 4I7YH 4O3TA 2STAE 3PTNA 1TPPA 5DP8A 3S9AA 1W0YH 2BMGB 2GZ9A 3TIUA 1C1TA 1O35A 3FZDA 1O2LA 3E1XB 4NIYA 1SHHB 2LNCA 1NRNH 1P12E 3CP7A 2GZ7A 2VH0A 1GHBG 3RU4D 3TJOA 2JETB 2ZGBH 3A8AA 2C8YB 2GT8A 4WVPE 4XSKU 5A8ZA 1BMNH 2WV4A 1DICA 5DGJA 1AD8H 2ZEBA 1AFEH 3DT0H 2IPQX 2SFAA 3RM2H 1NO9H 2FOFA 1GHZA 4YO9A 1O2UA 1KDQA 4HFPB 1UTQA 5EOKA 1RS0A 1AO5A 2ZF0H 3GCHC 3VFEA 2EI8A 2BZAA 1YPLH 2VVVA 1FI8A 4X1RU 3SI3H 4F49A 3PMJA 4I8JA 4KGAA 1QIXB 1P02A 4MNVA 5C3NA 4CBOA 1AFQB 1O3IA 4WJG2 1WQVH 5I25A 4NGAH 1KSNA 3UOPA 1FQ3A 5T6DA 1S83A 4BAQB 4D76A 2OCVB 3QUMP 3DUXH 3F6UH 4FUGA 4CRDA 2VIWA 3ESTA 1Z7KA 2AGEX 3MO3A 2ANKH 3ZZ7A 5LGOA 2BD7A 1X7AC 1WU1A 2OUAA 1CGJE 1OHHD 3GYMA 3A8DA 5EPNA 1ETRH 3DSPA 1OWIA 3HK3B 4VGCC 1DXPA 5C1UA 4INHA 2FOHA 3AW1A 1P9SA 5C67A 2PHBA 2AIPA 2EEKA 1SGPE 2JKHA 2ZHQH 1XM1A 2J38A 4YOIA 5GIBA 1WTHD 1C2DA 1E38B 4JYUH 3TNTA 3SO3A 1LPGB 1QBOA 2AGGX 2BD9A 1SGFG 3GY2A 3LC3A 4TWYA 1H4WA 5LPRA 4AG2A 2Q6DA 2THFB 1QRZA 1E34B 1VJ9U 5FHTA 1MTWA 3TH4H 1WV7H 3MFJA 3RUOA 2AS9A 1CHOG 1C5SA 2XOKD 1CT2E 5L2YH 2ZHEH 4R0IA 2ZA5A 3EA8A 2G51A 3KYFA 3FP7E 4K8YA 1CBWC 5G4BA 1B7XB 1GL1A 3OEED 3LGWA 2Y80A 1UTLM 4THNH 2JH0D 3ZZ5A 3MH4A 1L1JA 1D3TB 2O8LA 3W95A 2M2AA 1MBQA 4HTCH 3S7KB 4WH6A 1H8ED 3U8RH 3N7DA 3SUDA 3ZVBA 2ZPQA 1NESE 1AVXA 3F2FA 1C5UA 1BZXE 2BDHA 1AVGH 2BY6X 3BEFB 3T29A 2FIRH 1V2VT 1GI2A 3D62A 4TWWA 1GG6B 3TK6A 3LONA 3ODDA 3SU5A 3MU0A 1TIOA 1DWDH 3SOSA 1CO7E 1ZMJA 4Y0ZE 1HPGA 1S84A 3GS9A 3ZVDA 1O3KA 1O3BA 2WPMS 4X1SU 1IHTH 2FP7B 5GCHF 1K28D 3RU4T 2HNTE 4CRGA 2BYAX 3RP2A 3V3MA 3A8CA 3SUFA 2NU2E 2GDEH 1SGEE 1UTKA 1LVMA 3OY6U 1GHVH 1YF4A 4LXBH 1LCYA 1SGQE 1GMHF 2V0BA 1HAPH 3KQCA 2KCOA 2GKVE 1TNLA 1BCUH 1QRWA 2ZFQH 1P10A 2CV3A 1G36A 1G37A 5A0CA 4X1NU 1MD8A 5IYTA 1ESAA 1BBRK 2FOBA 4DGJA 2VB0A 3BG8A 1LMWB 3S69A 1ESBA 4GHTA 3GDVA 1JOUB 4UFGH 1DDJA 3TITA 1RTKA 4ZHAA 5CDFE 3DHKH 1C1SA 3GYLB 1SLWB 4RT1A 4ISLA 2W3KA 1NZQH 1L1GA 1WOFA 2PGBB 1Y59T 3E16B 1VCWA 3L33A 2RG3A 2V3HH 3H09A 4BXSA 2RA0A 2BVRH 1H8DH 2AERH 2IPHA 1UVTH 4YXWD 4FETA 2B8OH 1P2QA 1GBHA 2OXSA 5BRRE 1HAXB 1JBUH 3W1EA 4YESB 1IHSH 2TRMA 2B5TB 4B74A 2XW9A 2UUFB 3V7TA 4UE7H 1QA0A 1ZSJA 2GVFA 1EPTA 1CSOE 1BRUP 3O8BA 4WXIA 5TJXA 3TK9A 1C5MD 3RXTA 1NFXA 4B6FA 4X8TH 1HXEH 1TGCA 2OBOA 4DOQA 1NY22 2HPQH 1HCGA 2VIPA 3RXHA 3MI4A 4NIVA 1BTZA 1ZOMA 3BTGE 4K2YA 3LH1A 1Z6JH 1H9HE 1Y5UT 3Q00A 2FI3E 1SLUB 1XXDA 1ZMNA 1HAVA 1GJ7B 3FKSD 2FDAA 1SGCA 3SU6A 1XMNB 2BDYA 3P8FA 5I46H 2G81E 2J98A 4ESTE 3U69H 3SI4H 3RM0H 1P05A 2DE8A 3SV6A 4KP0A 2QXGA 2VINA 2R2MB 1TPAE 1MKXH 5C1YA 1JIMA 2W26A 4YT7H 1FY1A 2K0QA 3O8RA 1D4PB 3A7TA 1BTPA 3OE7D 1TBQH 3AASA 1Z8GA 5DK1A 3A85A 2G00A 2BD8A 2OINA 2FI5E 5DPAA 3RC5A 4B1TA 4BAKB 3UUZA 2KFWA 1DE7H 1H8IH 1EAXA 1ZJKA 3P70B 1GJ5H 1EZQA 2XWAA 2AEIH 1YPHC 4DT4A 2CHAC 2WUBA 3TGIE 1QRXA 1IQKA 4CBNA 1CT0E 3BTDE 3N7EA 1C1VH 1FUJA 2ZFFH 1Z1JA 1KTTB 1A0LA 1QGFA 2BX4A 1P2NA 3SNCA 8LPRA 2JJ2D 3QK1A 3TNSA 3UNRA 3KGPA 4OS7A 1P04A 1W11U 3BTHE 2VVUA 4H4FA 1LO6A 2PP6A 3JZ2B 1FONA 1K2I1 2FWWA 3AW0A 3MH6A 4X2YA 2ODQA 1SOTA 2ASUB 3EE0B 1FDPA 1ABJH 1O3HA 2R3UA 2YNBA 3SNBA 4GAWA 1TPOA 2J94A 2XBVA 5FL7D 3UWIA 3PRBA 3U1JB 3P8NA 1GHYH 1OWEA 2P8OB 1DWEH 2V3OH 4OS6A 3A84A 3PMBB 2Z94A 2ZU4A 1O0DH 4E06H 1A61H 1K9OE 3BG4B 4WMEA 4IS5A 1A5HA 3GOVB 1ZPBA 4ZAEA 6GCHF 3SNAA 1ZTKA 1O3EA 2FMJA 4B6EA 1G30B 3V12A 1L0ZA 2C93B 4H6SB 1T8NA 2SNWA 1SSXA 4CHAC 1GBTA 2W6ID 2ZHFH 1GI5A 3NRLA 4FVDA 1UCYK 3KL6A 4A1TA 2VWMA 1TNGA 1W13U 5HGGA 2ZQ2A 3VG8A 4Y8XA 4X0WU 1GDNA 1O3JA 3E6PH 1KYNA 1TQ0B 1O2VA 1SHYA 1EJAA 1OX1A 4Y7AA 2FS9A 1GGDC 1O37A 2GCHG 1K1OA 2VBCA 7ESTE 1GMCG 1CE5A 1TMBH 4AX9H 3S0NA 1EUFA 4YOGA 3TPIZ 1LHFH 3UQOA 1F0RA 1MH0A 2L6OA 3GY7A 2F43B 1L1NA 3GY4A 1ZRKA 4AFQA 2LPRA 2SGEE 1UTNA 3LJJA 1UVSH 3G01A 4FVBA 1N8OB 1HFDA 4X2VA 5E0GA 4LK4A 1UK3A 5DO4H 1C1WH 3H5CB 4Y71A 2WPDD 3BIUH 2IOTA 3AAUA 2FXRA 1D3PB 5FCKA 3AK5A 5B6OA 1DFPA 4P02A 2GGVB 2OP9A 4Q7ZA 1P2OA 3KYGA 1Y3WA 2A4OA 4R8TB 1V2JT 4D7FA 2AMDA 4OS1A 5L6NH 1PPZA 2W3IA 3BTQE 3UIRA 4CH8B 1RTLA 4YZUA 2FI4E 2ZTYA 4ABEA
chains in the Genus database with same CATH topology
1WAYB 1A3BH 3BEUA 3ZVAA 1V2TT 1GDUA 2A4QA 1AVWA 3QDZB 1BHXF 1VITG 3MU1A 3TU7H 4F4OC 1O2NA 2PGQB 4DT7B 3SBKA 4X6PA 5F03A 3ZYDA 2BOKA 2ZG0H 2P3FH 3M3VA 2XNIA 4AFUA 1C1MA 1SGTA 2ZFTA 4H42U 4INLA 4A92A 4OGXA 1YPJH 1MQ5A 2BY7X 4B2AA 2ZWLH 3ITIA 4ZXYH 3A88A 3UQVA 4ABFA 6GCHG 1LQEA 2AMPA 2RCEA 1BTWA 1E0FD 3VGCC 4UFEH 1FJSA 3FP8E 4FUBA 4IGDA 2FOMB 2PV9B 3STJA 1O3PB 1TGBA 1XUFA 2BDGA 2FESH 1MTVA 3QZQA 3AVZA 4A6LA 4AZ2B 1YLDA 5LH8A 1DSTA 3GY8A 1GVZA 1TGNA 1ARBA 1OWDA 4MNXA 3KCGH 4KTCA 3Q77A 1OP8A 2FOGA 1K1LA 3MNCA 1O3NA 2BQWB 4FUFA 4UFDH 1QL8A 3SGQE 1ORFA 2A4GA 4Y6DA 3TJNA 4GUXA 1HAVB 3MWIU 1MUEB 4D7GA 1VCPA 3KQDA 2VWOA 1DLKB 1T8OA 4HI3A 1AWHB 3VB3A 3BTWE 1D6WA 1HJAB 3URDA 4X8SH 2TIOA 2WINI 2BM2A 4ISIH 4GVUA 5ETXA 1C2IA 1DWCH 5HXFA 3EGKH 4JZDH 1C2MA 3H7OA 1QFKH 1F5KU 5FPSA 1ELBA 1LPZB 4WH8A 6ESTA 1O2OA 7GCHF 1ELDE 1DITH 4YOJA 3KN2A 3RXKA 3M61U 1XUJA 1DANH 4CRBA 6LPRA 3PWBA 2JH5D 1C2HA 4FU9A 2H6MA 2KAIA 3PLPA 1LDTT 4FXGH 1QCPA 1ZMLA 1A0HB 4U32A 4NIXA 1O2YA 5DP9A 4IMQA 3M36A 4B73A 1ZRBA 4KELA 4NSVA 1FIWA 5DKMA 1BT7A 1V2NT 4NCYA 1ZTJA 4AFZA 4GHQA 2ZCLP 5A8YA 2R2WU 1C5PA 3A82A 4U01A 3ZYEA 2O8UA 4NG9H 3SZNA 2B0FA 4MNYA 3GY3A 1QA7A 1EATA 1QNJA 2VIOA 3U98H 4AGJA 1VGCC 5EXLA 3OX7U 4QT8C 3SHAH 3SJ8A 2R0LA 3SU3A 1FPHH 5EU8A 1W3CA 1NM6A 4CR5A 1DOJA 1V2ST 1O5DH 3MU5A 1OYTH 1ZLRA 1O5CB 4AN7A 1J15A 3E8LA 1OYQA 3HATH 3RMNH 2ZHDA 1O3MA 2XBYA 3M3TA 5GWZA 2ZGHA 1B0FA 1BTXA 2TGDA 1UTPA 4MLFB 2BLOA 2P3UB 1O2TA 1MTUA 2XRCA 3SJOA 1AKSA 2WPLS 3RXIA 2D26C 1HLTH 4Y11E 1V6DA 1PPGE 1C2LA 3D65E 1SC8U 5DG6A 1MZAA 1WCZA 3K6ZA 5A09A 5L30H 2P93A 1AZ8A 2O8MA 5H4IB 4KTUA 2FODA 1GCTB 1IQMA 3LGYA 3QN7A 4UEHH 5FBEA 1RIWB 1YGCH 1UHBB 1NRQH 2HNTC 4X8UH 3SU2A 1GMDF 3IITA 1JXPA 1FY5A 1O2MA 3A89A 4YM9A 1T8MA 3EDXB 2FYQA 3FZZA 2VIDA 4AB8A 1HBTH 4A1VA 1S6FA 3SU1A 2C3SA 3RDZA 1DPOA 1GI8B 1SGYE 1Z8JB 3SU4A 4A5TS 3DD2H 5EPYA 1ETSH 2BLVA 4B2CA 1EOLA 2ZP0H 1ELGA 3SGAE 2ZKSA 2Y82A 4MG3A 1A3EH 2PLXA 1O3CA 1OWKA 2PUXB 2J95A 3TH3H 3HKIB 2ILNA 4UFFH 3TVJB 1O31A 4AOQA 1KXAA 1C1QA 1O3LA 3SJKA 2GV6A 2J92A 2C8WB 1EXFA 1BIOA 1HDTH 2ZTXA 1AFQC 3RXJA 1S85A 1SB1H 1NRPH 2BX3A 5A0BA 1BMMH 4Y8YA 3LGTA 1CGIE 1GBKA 1SOZA 2XWBI 1T4VH 4D8NA 5GXPA 1NU9A 1SG8B 1F5LA 1UTJA 1O32A 1QB1A 1RJXB 2FOCA 1TRNA 3A80A 2QAAA 1IQLA 1CHGA 2QIQA 2ZQ1A 5TCAA 2ALPA 1BHXB 2FLBH 1SI5H 2ALVA 2PSXA 3GY5A 3IWMA 1S82A 1TNHA 1J9CH 1TOCB 2A5KA 3TGKE 4HGCA 2O8WA 3HGPA 8ESTE 1O38A 4X2XA 1HAOH 4K3JA 1C2EA 1RGQA 1Z1IA 1HIAA 1P01A 1BRBE 1P2MA 4YT6H 3UFAA 1CQQA 5JB9S 1FAXA 1GBFA 1B0EA 1BUIA 5GPIB 2BD5A 1W8BH 3KQEA 1AHTH 5E2PA 8KME2 5ESBA 1GJBB 1HAGE 4JYTA 5F8TA 2NU0E 3R3GB 4I8GA 4TY7A 1XUHA 2CJIA 4NZLA 1CA0C 2VH6A 4IC6A 4Y8ZA 2P59A 2ZDLA 4OGYA 3T26A 1D6RA 1YYY1 2FZZA 1DWBH 1K1JA 1FAKH 4WMFA 3T28A 2XCFA 1GHAF 2GCTB 4IW4E 2VIQA 2WPJS 3SORA 1ZHRA 1C2FA 3RMLH 1CA8B 1GBJA 2ZC9H 3LDXH 1HXFH 1A0JA 2PW8H 3SGBE 1S6HA 3PROA 3P92A 2V35A 3ZVEA 3M7QA 2FX6A 2QXJA 3QWCH 5EQSA 3SV9A 3GY6A 1GHWH 1FY4A 3S9CA 1ZZZA 2PKAA 2VNTA 3ZV9A 4XFQA 2AGIX 2PWXA 5F6MA 1TBRH 1PPBH 2CXVA 1EQ9A 3LC5A 2VVCA 3MHWU 1SFQB 4ZROA 1FY8E 1AZZA 4MTBA 1F92A 1C2JA 1F2SE 3OTJE 2WPHS 3PLKA 2GP9B 3C27B 1LHDH 2VGCB 4NZQA 1PPEE 3NUMA 5CHAC 1AU8A 2EI7A 3SQEE 1HRTH 2I6SA 3P8OA 1NFUA 4AG1A 1O5BB 4U30A 1JIRA 1PPHE 1BJUA 1O2RA 1AE5A 1GI4A 1P03A 1YCPK 3SJIA 2FTMA 2PKSB 3PMAB 3T5FH 3ATKA 2KAIB 1GPZA 4FUDA 4I8LA 3RLYH 2Y6TA 1HV7A 1GBEA 2H5CA 4MPXA 4YLQH 1IOEA 4ZUHA 3EA7A 2A2QH 3UTUH 2BOHB 5C2ZA 2Z9GA 1MTSA 1C4U2 3CS0A 3LT3A 2BDAA 3Q3XA 5AHGH 1V2MT 2AIQA 3ATLA 2SNVA 1O2HA 1O2JA 2GT7A 1MKXK 1F7ZA 1HAYB 1P11E 1MU6B 4AB9A 3ZZ4A 3ATWA 2ANYA 2FX4A 1SLXB 2QC2A 4O3UA 1A5IA 5GCHG 3F9GA 1AY6H 1ID5H 2Y5GA 1KXCA 4WY3A 2PTNA 4OS2A 2HRVA 2BY8X 1EAWA 1MU8B 1AN1E 2Z7FE 4E05H 2BTCE 4JMYA 4CRFA 4WXVA 1AGJA 1YLCA 3LKWA 1ANEA 1FPCH 3MO9A 4YTAA 1W0ZU 3KEEA 2ZCHP 1GMHG 2ZTZA 1EZXC 1A1RA 4Y7BA 3VXFH 1BTHH 1J17T 1GHAG 2A0QB 1DUEA 3M7TA 3MNXA 1KDQB 1NRRH 2NU4E 2WPIS 1ELCA 1TRMA 1DLEA 1IQHA 2W7UA 3MMGA 4SGAE 2WPKS 2Z9KA 3SUEA 1QY6A 1TWXB 4TY6A 1THRH 3RXAA 5HM9A 2A2XH 2YNAA 4IBLH 5L2ZH 4O9VA 1S0RA 4X8VH 1BB0B 3AAVA 1THSH 1C5OH 2AYWA 4CRCA 2XBWA 2UWPA 1TQ7B 1L2EA 1Z8RA 1QL7A 2A5IA 1QBNA 4XE4A 2NWNA 1S0QA 1TNJA 1V3XA 1ZR0A 2D1JA 4ABAA 2QYIA 1P8VC 4WF8A 1O2GH 2HOBA 2ZFPH 3A7YA 1OWJA 1P0SH 1W7GH 4JZIA 3ENSB 3KF2A 1KXFA 3ZVCA 1XVOA 2XCNA 2HNTF 3NCLA 4A7IB 3ZZDA 1C5YB 2CGAA 5DP3A 1C2KA 2AH4X 1F0UA 2XBXA 3OY5U 1J14A 2DE9A 1TABE 1ACBE 1AB9B 1GGDB 2WYGA 1NN6A 3MNBA 2ZO3H 4MPVA 4AGKA 1TX6A 2Z3EA 1O3DA 3A81A 3TGJE 1YBWA 7KMEH 1GJDB 5EW1H 2HVXA 3ATMA 1XUGA 3MTYA 1QR3E 4B71A 2J9NA 5E0JA 2PUQH 5JB8S 3BN9A 3BF6H 3IG6B 5EQQA 1O2SA 1XKBC 3A87A 3S7HB 4H6TA 1GI1A 1YC0A 2FOEA 2BQ7B 3ODFA 2YOLA 1Y5BT 5JBBS 2O8TA 3RXPA 4KTSA 1VITH 2UUKB 2P8OC 2OBQA 3RXFA 3RXOA 3GDUA 1UCYH 5T6FA 1VCQA 2FEQH 3U8OH 2F3CE 4YLUA 3RXQA 3S9BA 1C4Y2 1WSSH 3BG4C 1LQDB 2SGDE 3RLWH 1TMUH 3ZZBA 3STIA 1O2KA 1KLJH 2H9HA 2A5AA 1JRSA 4NSYA 3A7WA 3I77A 3T2NA 1VJAU 4JZEH 4BTIB 1Y5AT 2J2UA 2D2DA 1O5FH 3OSYA 4IN1A 1TOMH 4AYYB 4A1XA 4RN6A 3CS7A 1EJMA 1E37B 1M9UA 2P3TB 4ZHMU 2Y5FA 1PQ7A 1UTMA 1PPFE 3GCNA 1IQNA 4DG4A 2Z9LA 1TRYA 1XKAC 3ELAH 3K65B 2RA3A 1O3AA 3MOCA 5EXNA 1O33A 1ESTA 1FZZA 3CENA 1P57B 2ZU3A 3QTVH 5DJ7A 3OU0A 1AUTC 1BA8B 2OC7A 4NA9H 2QN5T 1ZYOA 1C9PA 3RMMH 1GVLA 5FCRA 2B7DH 1P3EA 4MPUA 5EODA 3T27A 1ZHMA 2BY5X 6CHAB 1O3GA 4DY7B 1A2CH 2TGTA 3O8CA 1BITA 2BB4A 1OKXA 5HMAA 3QGNB 3GDSA 2ZNKH 1ELVA 3PB1E 5DP4A 1EPTB 5AFZH 2GV7A 4K69A 4HZHA 2AFQB 2Y7ZA 1TALA 1ZHPA 2M5TA 4IN2A 5FXLA 1C1PA 2ZZUH 3PLBA 3QTOH 2ZDKA 1PJPA 1G2MA 1LHGH 1GHBF 1O5AB 3KHVA 4X6OA 4ABGA 3D49H 4BTUB 1RFNA 4GSOA 3ZVFA 1KXEA 2O9QA 4Q2KA 1N6XA 3TK5A 4O03A 2GD4B 3KQBA 3LGIA 4PROA 4Y79A 2ZFSA 1NS3A 1DXWA 1SGDE 3NPSA 3LU9B 4Q7XA 3LGUA 2SGAA 3SU0A 1JWTA 1YPKH 8GCHF 2OQUA 3MYWA 5ABWA 1ANCA 5A8XA 1DX5M 3VB5A 5C20A 4D9RA 4MNWA 3SNDA 1G32B 1O5EH 1O2PA 2H1UA 1ANBA 3SV7A 1O39A 1QB6A 1XX9A 1TAWA 1TB6H 1GI6A 2VIVA 1C5LH 1MKWK 1NT1A 4SGBE 1EJNA 1INCA 2P95A 1PFXC 1EZUC 1TFXA 2QXIA 4FUEA 1O36A 1NFWA 1C9TA 5EG4A 1SGRE 2XYAA 4I32A 1Y3XA 1DY9A 3LOXA 5F8XA 2W5EA 5HYOA 3B8JA 2ZIQH 1GVKB 1VGCB 1YCPM 2Z6BD 2GMTC 2I6QA 5JBAS 2UWOA 1TBZH 2FYRA 3I78A 5JDUB 1G2LA 3EAJA 4GPGA 1AWFH 1Y3YA 2F9VA 1DT2A 3PTBA 1BBRE 3K9XB 3TJVA 1AIXH 1NROH 1TGSZ 2HPPH 2SGFE 3BTEE 1BMLA 2OC1A 4IMZA 4BXWA 3T62A 1F5RA 2ZDAH 1SL3A 2J4IA 1HJAC 1T32A 4B75A 1Y3UA 1ZJDA 4UDWH 5JPMH 3RXLA 1W7XH 1DY8A 4Q7YA 2W7SA 1TYNA 4FU7A 4DURA 2BHGA 2Z3CA 2DUCA 3GCHB 3VB6A 1PYTC 3MH7A 3HGNA 3GCOA 2XTTB 1MTNC 3RXCA 2WV5A 3PO1C 1L4DA 2QY0B 2ZFRH 1TX8A 1CHOF 3I29A 2ZDVH 3QO6A 3GCTF 3PMHB 1DSUA 1MMJN 1ELAA 1QL9A 4Z0KA 2XC0A 5FAHA 2VU8E 1SLVB 1UK2A 2R0KA 2ZCKP 3ZVGA 1Q31A 5A2MH 4K1TA 1TX7A 1WBGB 1Q2WA 4RKOB 2FM2A 3QGJA 1V2LT 1WUNH 5GDSH 1V2WT 1V2RT 1KTSB 1ZGVA 4ISNA 2F91A 3RXEA 4VGCB 1C4V2 2ZI2H 3UREA 1AE8H 3Q3YA 1LPKB 1Z71A 8GCHG 2A7CA 1D9IA 1IAUA 1V2PT 2ZECA 4LOYH 1GBMA 3ZZ8A 2BD3A 4O97A 1O2IA 1IQEA 1YPGH 1V2UT 1G3CA 2JETC 3HPTB 1ARCA 3VXEH 2G4UA 5J4QA 4BTTB 5FX5A 1ELEE 1Z8IB 1O5GH 1EB2A 2FLRH 1GI7B 2P16A 4NWKA 4X2WA 1TNKA 1OSSA 2FPZA 3SW2B 2QXHA 3P8GA 2QF0A 1HAZB 2C8ZB 3PM3A 4FUIA 7GCHG 3KIDU 4ZXXH 2Z9JA 3UOUA 3EQ0H 1O2WA 2ZGXH 4Y0YE 3M5LA 2BVXH 1QJ7B 2OTVA 1CBWB 3QX5H 5ESTE 1G9IE 3SNEA 2D8WA 4JZFH 3NKKA 3TH2H 5E2OA 1FY3A 1P2KA 2OC8A 2BXUH 1GCTC 1PPCE 1TGTA 1B5GH 1EX3A 1RIWC 2FTLE 4Z6AH 2OD3B 3H7TA 3TLOA 4K60A 2A7JA 4E7RG 1BTUA 2GX4A 1HJ8A 1OP0A 1RTFB 4X1QU 2F9NA 5E8EH 3UR9A 1EP6A 3C1KA 3F9EA 1SGNE 1ZTLA 2G8TA 5K7RA 1O2ZA 5C5OA 1GI9B 1T7CA 2VWNA 4RKJB 4INKA 2XC5A 3GCTG 4NFFA 4B76A 3VB7A 2BDBA 1O3FA 2ZGJA 2R3YA 2TPIZ 1CA0B 2A45B 1BJVA 1AMHA 2F9OA 4BAHB 2TBSA 3K2UA 3M5OA 3UPEA 1HAHH 1O34A 4Q80A 5EW2H 1LHEH 4X6NA 4GCHF 1MAXA 1RD3B 3RXDA 3L3TA 4K1EA 1PQ8A 1QTFA 2Q6FA 2K1QA 2NU1E 3UR6A 3F9FA 1BMAA 4GLYA 3M35A 1AI8H 1WYKA 1H9LB 2G5VA 3PYHA 4NWLA 2QV1A 2XXLA 5T3HA 2G5NA 1YPMH 1UK4A 3M37A 1K21H 2BD4A 3V0XA 1K22H 3HKJB 3RXUA