2BD5A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and lys-ser at ph 5 and immersed in ph 9 buffer for 30 seconds
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords beta-casomorphin-7
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd5A01
3MH7A 1P9UA 1QBVH 2XRCA 2LPRA 3RMMH 3F1SB 1FN8A 3ZZBA 1AE5A 1THSH 4JZIA 2BLQA 2Y5FA 3T26A 3ZZ4A 3GY8A 4TWWA 3OX7U 2UUKB 1TE0A 1LPGB 1WV7H 1ZYOA 1Z8JB 4A1VA 1GBIA 1SHHB 1RJXB 2HNTE 1BRUP 3RXJA 3I77A 1N8OC 5EQSA 1TIOA 1AHTH 2VWOA 2ZPQA 1O37A 1EUFA 2VGCC 4NSYA 3ZV9A 1S85A 1BTUA 2DUCA 1TOCB 1GI6A 1OS8A 4E7NA 4CRGA 1LO6A 1QBNA 3E0NB 4AG1A 4TPIZ 3SZNA 4NA7A 4OGYA 2CHAC 1TRNA 4FU7A 4ISLA 1EQ9A 1PFXC 3K6ZA 3ZZCA 1AMHA 1O5EH 4DIIH 1C5ZB 2ZO3H 3A7WA 5SGAE 1XVMA 1UVOA 1GWAA 1GBTA 1CA0B 1GCDA 2J95A 3GISB 1FIZA 5EODA 1CA0C 3KNXA 4CBNA 2H1UA 1KXCA 1GGDC 4Y8YA 1DICA 4HI3A 2CXVA 1BBRH 4NG9H 1HJ9A 1AVXA 5JYIA 1C1QA 1EOJA 3AASA 1BRCE 4NFEA 3LPRA 1W0YH 1LPZB 1TPPA 1ABJH 2A4QA 2JH6D 3MH5A 2VGCB 3RXSA 2P3FH 1Z8RA 3HGPA 1GL1A 1O3EA 3M36A 4Y71A 3A7TA 1FONA 1BBRK 2A2QH 1ELEE 1DWEH 4I31A 5E0HA 1QL9A 1GJ4H 2ODYB 1XUJA 2G55A 1NROH 1C2LA 2BOKA 2PLXA 1Z8GA 1NRSH 2QXJA 2FEQH 2J4IA 1HAVB 1K2I1 3LC3A 3RU4T 3SN8A 1BUIA 3ATKA 3SV9A 2GMTB 2XNIA 3E90B 1SLWB 2ZDLA 2GGVB 3QTVH 1J15A 1SB1H 2FYQA 2VVCA 4CBOA 1MAXA 2BZ6H 3BEIB 2D2DA 4D7FA 2NWNA 1QB9A 3SU0A 1C5TA 2BB4A 1P04A 1EOLA 1LCYA 3RU4D 3TGJE 1DFPA 5EPYA 2G5NA 1Q31A 2BDAA 1T4VH 1TMUH 3RXVA 2SGPE 2Q6GA 1Y5AT 2G8TA 3MU1A 1ZMNA 3M5MA 5J4QA 5EW1H 1HLTH 3DFLA 4AB8A 1GHVH 4AX9H 3V12A 2OD3B 4X8VH 3SJIA 1OKXA 2ZWLH 1KXFA 1DITH 4BOHA 1WBGB 2F9PA 1GI9B 1NPMA 1AWFH 4GSOA 1EASA 1HJAB 2OQ5A 4NA9H 4Q2KA 3B8JA 2HRVA 2SGEE 1GGDB 3LGYA 1C4V2 1BT7A 2ZPRA 4Y0ZE 3M35A 2WINI 1AQ7A 2ZFPH 2BD3A 4NIXA 3NWUA 4YLQH 3UREA 3W94A 4F4OC 3QX5H 6LPRA 3ZYEA 2ZP0H 3SJKA 3NZIA 1BZXE 2HNTC 3TJNA 5C1XA 3UIRA 1AFQC 5DP4A 3TGIE 5GDSH 1V2UT 1V2RT 1AKSB 2ZGJA 3SU2A 4JYUH 2BDCA 4J1YA 5JB8S 1ZHMA 2ZZUH 4IS5A 1OWDA 3A89A 4JK5A 3A82A 1FY1A 3ATIA 4LZ1H 1D3TB 1TX6A 1O31A 4MNWA 4O03A 1V2LT 2ODQA 1GVZA 1Y3UA 2FOCA 2BDYA 1J8AA 4Q7XA 2C90B 3T27A 1RTLA 3ZVBA 2ZNKH 3RM2H 1W3CA 4MNVA 4CRBA 2CHAB 2THFB 3AAVA 4ZHMU 3RXMA 1CSOE 1C1TA 3H7OA 1VCPA 1AFEH 1UTOA 1LVYA 1N1LA 3OU0A 1CA8B 1F7ZA 4I8KA 4MQAA 2Z9LA 3A7ZA 3RXRA 2G81E 3KQBA 3ZZDA 4JZDH 4AFUA 3VB7A 3UNRA 1KIGH 2FTMA 2P8OB 1O2MA 1GDUA 2C3SA 1ELAA 1O3GA 1ZHPA 4RKJB 4CHAB 3VXFH 1MZDA 2AMPA 3P8GA 3ITIA 1UTLM 1YCPH 2EEKA 3UR6A 4ZMAH 2ZHEH 2D8WA 1IQIA 1ACBE 4KTSA 4AB9A 1NS3A 2XCNA 2Z9IA 4R0IA 3UOPA 1TRMA 2WYGA 1C5LH 4X8SH 3MWIU 1SGYE 2ANYA 3RC6A 2Q6FA 1IQNA 1U6QA 4E06H 3STIA 5EXLA 1O2TA 3MMGA 1T7CA 3EDXB 4Q7YA 2M5TA 1MQ6A 1IQEA 1XUKA 3JZ1B 1MTUA 4THNH 4INLA 5ABWA 2Z9GA 1GI5A 3FAOA 3UWIA 3BF6H 3LH1A 4IC5A 1TRYA 2GDEH 2Q6DA 3T28A 5DP6A 2ZIQH 3N7OA 3QK1A 1T4UH 1EB2A 1NTPA 2HGTH 3TLOA 2OBQA 3URDA 3SOSA 4FUBA 2TIOA 4DVAU 3QGNB 5C1UA 1ELTA 2BY7X 1DM4B 1Z1JA 3GCHB 3PMBB 4DURA 4B2AA 2V6NA 1QIXB 1YGCH 4MG3A 5F03A 4BAHB 2VINA 4FU8A 3SGQE 4VGCB 3SUFA 1AVWA 1HXEH 2Y5HA 1NN6A 3LGUA 2ZCKP 1KSNA 3BTDE 1B0FA 2LNCA 2FOEA 4OS1A 1G3CA 4FUGA 6GCHG 1HRTH 1AWHB 3MU8A 2BX3A 1A46H 3LJOA 2ZG0H 3O8RA 3OSYA 3FZDA 1GBLA 2FOMB 1ZTLA 4ISIH 1O3FA 2ZTXA 1TABE 1UCYH 2W3KA 1P02A 2H5CA 1O36A 1HGTH 2TGAA 3A80A 4DT7B 1YLDA 3E3TA 4D7GA 3FFGA 1KLTA 5DG6A 3RXLA 8GCHF 3TVJB 3TNSA 1EX3A 2FOAA 5PTPA 1SR5C 1HBTH 5J4SA 1ZPBA 1O2OA 4AOQA 3U1IB 2BY5X 1OP2A 2C8YB 1C2MA 1ZMJA 3ATLA 1NZQH 4I33A 1GI1A 7KMEH 4NZLA 1TGBA 1EZUC 1UK4A 1FV9A 4FUJA 4SGAE 5GCHF 1KYNA 3RDZA 1NFYA 2GD4B 1O2IA 1HXFH 2VIDA 4Y0YE 1F5LA 1HAYB 4HFPB 2ZC9H 4BAKB 1MBMA 2ZDAH 1DDJA 4X8UH 1K1PA 2FIRH 3GYMA 4ESTE 1ZJKA 1OYQA 1KTTB 3E1XB 1C2IA 1XVOA 3NK8A 4FUCA 2WPIS 7GCHF 1O2LA 2PW8H 2TGPZ 1G32B 3QLPH 1VITF 4A7IB 2KAIA 1ZLRA 5H4IB 4ZH8A 1YM0A 1RGQA 1T8LA 1AB9B 1AI8H 4ZHLU 3MH6A 1ZRKA 3HKIB 2PSXA 3RXIA 1KY9A 1AFQB 4WMEA 2QXGA 2J92A 3IITA 4B73A 1LMWB 1JIRA 2BX4A 3EAJA 3T5FH 5JB9S 2JH0D 4Y76A 1O33A 3BTWE 5T6DA 1ESTA 2TBSA 3O8CA 1TGCA 1P2KA 3ZVCA 2Y6TA 3ODDA 1VGCB 4YT7H 2J94A 1JRTA 1PPFE 2UUFB 1MH0A 2SGDE 1QQUA 2YNAA 4K69A 5C5NA 2P95A 1P09A 1F2SE 1QRZA 1C9PA 3KQDA 2V3HH 5T6FA 4MPUA 1BTWA 4IBLH 1N8OB 1OP0A 3DD2H 2G4TA 2VH0A 2RA3A 2VB0A 4LOYH 1ESBA 1Q2WA 2ILNA 3HGNA 3KF2A 1MTSA 1VZQH 1D6WA 2GCTC 4KGAA 1K28D 1O2VA 2FTLE 3U69H 4AFSA 1YPHC 2PUQH 2Z7FE 1V2VT 1BA8B 1YCPM 2O8WA 1ANCA 4SGBE 3SJ9A 2GZ9A 2YNBA 2R0LA 2A7CA 2ZCHP 1S84A 1XUHA 3ZZ3A 1MD8A 2H9EH 5C2ZA 3VEQB 3QDZB 4X2WA 3RXKA 8GCHG 1YPHE 2TPIZ 1GDNA 1V2PT 5GPIB 1IQMA 1CU1A 4ZKSU 3GY3A 5F8XA 1A0JA 1W7GH 3A8DA 1CT4E 3GCTG 3DHKH 5EXMA 3O8DA 4WH6A 3KEEA 1TNLA 3BTTE 2ZHWH 3BEFB 3PO1B 1OWJA 2VJ1A 2FMJA 1GCTB 2B8OH 2R0KA 4JK6A 4CR5A 2GDDA 1TFXA 3MYWA 4QT8C 3W95A 3RLWH 3BV9B 4FVDA 3RUOA 4TYDA 4BTIB 3IWMA 2C4FH 1S6HA 5JBCS 4UDWH 4ABHA 3LIWA 1ZGIA 4NCYA 4TWYA 3MFJA 1GBAA 1O2HA 3V7TA 1TOMH 4RN6A 1RTKA 3M3TA 2WUBA 2XTTB 2OCVB 4CREA 1NY22 2ZQ1A 1MU8B 3F9GA 5EQQA 1BDAA 3FANA 5BPEA 2STAE 4CH2B 4CRAA 2HWLB 7GCHG 2BQWB 1EKBB 1MKXH 3P70B 4XE4A 4LZ4B 1RXPA 1GBJA 3KN2A 1JRSA 1WQSA 4XOJA 1C2HA 4Z0KA 5ETXA 1K22H 2H6MA 2BY9X 3T62A 2ZU3A 1D3QB 1P10A 1C2GA 2BY8X 4O3UA 3SUEA 1O2GH 4OS5A 1OWEA 4IC6A 3CENA 2DE8A 1GBCA 2C8WB 2BLWA 1QA7A 1S5SA 4D8NA 1G2MA 1ID5H 3TH4H 3P8NA 4I8JA 1QJ6B 2QV1A 2PHBA 1SQOA 4NGAH 4VGCC 4A6LA 1SVPA 4LXBH 1GBKA 5CE1A 1N6YA 1TB6H 1XM1A 1NFUA 5EW2H 4KTUA 3L6PA 1UTMA 3SV7A 4A1TA 2A7HA 1AZ8A 1SGEE 2O8TA 3SORA 1VITH 3ZZ6A 3TPIZ 1C1MA 5DK1A 1YPGH 4ABDA 3SNAA 4B76A 4X6PA 1TX8A 3RXQA 1H4WA 1MKWK 1ELCA 2P3TB 3M7TA 2QC2A 1XMNB 2ZU5A 2QN5T 3BG8A 1SMFE 4ABBA 2G51A 2ZFTA 3ZVGA 3EQ0H 1O2RA 4ZXXH 3ATMA 2AEIH 1GJ8B 3MOCA 4K60A 2HOBA 2PKSB 6GCHF 4X6OA 1PQ8A 4TPYA 1GPZA 3TK9A 2ANMH 7ESTE 4E7RG 1EZQA 2QF0A 4XDEA 4BAMB 3LGIA 4KELA 1C5UA 2Q1JA 1OSSA 1TBQH 1E37B 1UJ1A 1J9CH 5EU8A 1NU9A 1LHCH 4B75A 1D3DB 1T8MA 4MDSA 1W2KH 4YZUA 2FM2A 2ZCLP 2BTCE 4RSPA 3A7VA 4GPGA 1OYTH 2BQ6B 1PPCE 1TX7A 3ZV8A 2F9OA 1O5AB 3A8AA 9ESTA 2OQUA 3CP7A 4FUFA 4IMQA 1C1PA 2P16A 1SGNE 5DP8A 3HATH 1TGTA 2W26A 3ODFA 2ZEBA 1L0ZA 3HKJB 5AFYH 5FPYA 3E8LA 3MNCA 1Y3WA 1ZSJA 2ASUB 1V2MT 1GHXH 4AFQA 2OTVA 1HIAB 4H6TA 4U30A 1DUEA 1QCPA 2Z9KA 1D9IA 8ESTE 1A0LA 4ISNA 1FLEE 1TBZH 1L1GA 3QZQA 3E6PH 1HAOH 1QL8A 3QO6A 4NWKA 1AY6H 1P2MA 3RXDA 2J38A 1UTNA 1F5RA 1MTNC 5C5OA 4NIWA 2VIOA 2NU0E 1KDQB 1W10U 3Q00A 1L4DA 5DGJA 1W13U 1H9IE 2BM2A 3M5OA 5BRRE 1E36B 1E0FD 1P12E 1FZZA 1O35A 4DG4A 1J16A 1NRPH 5AFZH 3AW1A 1BTPA 1P06A 2EI8A 3ZZ8A 5F8TA 1V2JT 4WMDA 1O5GH 1H1BA 2BHGA 4UFEH 3GY5A 1A3EH 1SGPE 3S7KB 2DE9A 3LOXA 5HM2A 4NIYA 7LPRA 4IW4E 1GL0E 1ESAA 1CHOG 3A7XA 1F0RA 4B2BA 5F8ZA 1MTVA 2Z94A 1DLKB 1CT0E 1OPHB 1OXGA 2D1JA 4TY7A 1QFKH 3QTOH 3E91A 2BD2A 3SUDA 1ELFA 1P11E 4ABGA 1QB1A 2NU2E 1HYLA 1ELVA 2H9TH 3A8CA 4AYVB 2GV7A 1C1NA 4JZ1A 5HMAA 3SU5A 3FP6E 1O34A 4GCHF 5EXNA 3U8RH 1W12U 1GBHA 1TNKA 2AMQA 1VCWA 2ZPSA 3T2NA 1G2LA 1TA6A 2YOLA 5A0AE 1EPTC 1EPTB 1JXPA 1ELDE 1RRKA 1IAUA 1LHFH 1NESE 2W7UA 3PTBA 4X6MA 4XBCA 2GT8A 3D65E 2VH6A 3ZZ7A 2CF9H 1EJMA 1K1OA 3V3MA 2PSYA 1WQVH 1ETRH 1ZSKA 3EYDA 2XBVA 3A86A 1C1UH 1O3CA 1P03A 3C1KA 1O5CB 1Y5BT 5I25A 4NIVA 3RXOA 3GCHC 3BSQA 2BD8A 1EB1H 3FP7E 1IQGA 3AVZA 1GBBA 1UVSH 2FWWA 4HTCH 2A45B 4JYVH 2A5AA 5DP7A 5DKMA 1C5NH 3K9XB 3RU4E 1HAZB 2PGQB 5DPAA 3BTGE 3C27B 3GDSA 1Y8TA 4AYYB 1DOJA 2A4RA 2EI6A 1QHRB 4GHQA 1YPMH 1YF4A 5ESTE 1FJSA 5EOKA 1W14U 1P2OA 4MVNA 4BXSA 2XBWA 5LPEA 2ZHDA 1O3DA 1BMMH 1BTXA 1DWCH 4H42U 5GCHG 2BDBA 1V2ST 5GJ4B 5IYTA 2H2ZA 1KXAA 1WTHD 1XKBC 4GVUA 3BTKE 1C5QA 3TH2H 3FZZA 5JBTA 2C8XB 3WY8A 4OS6A 5L2YH 1C1SA 2C8ZB 4I32A 3A84A 4K1EA 1IQJA 3CS0A 1QRXA 4FU9A 3I29A 1NRQH 2NU4E 3EA8A 4YESB 1OOKB 6CHAB 2CJIA 6CHAC 4Y7AA 3T29A 2BYAX 1GVKB 1O3JA 3MHWU 5AHGH 4ZHAA 3OTJE 1PJPA 2Z9JA 1DANH 3TH3H 9LPRA 1WYKA 1THPB 3LGTA 1LQDB 4X2YA 5FPSA 1QY6A 1DWDH 1TPAE 4Y8ZA 2HNTF 4K3JA 2AERH 2K1QA 1T32A 1OWHA 1G9IE 1A61H 3SJ8A 2BDGA 1SLVB 2GCHF 3F9EA 3OY5U 5K0HA 1V2WT 3D62A 1FPCH 1KLIH 3M5NA 1IQFA 3RXEA 3RXFA 2EA3A 2SNVA 1C1RA 3BIUH 3DFJA 1LVOA 2ZDKA 5K7RA 2Y7XA 1MKXK 3ZZAA 3MNXA 3PMJA 1DXPA 2ZA5A 1BIOA 5EPNA 3Q77A 2RDLA 2F3CE 2FS8A 2J9NA 2J2UA 1OX1A 2WPMS 1GJ9B 1ZPCA 1ZSLA 2FOHA 3GOVB 5L30H 4BAQB 2A7JA 1Z71A 3BTQE 2FODA 4JZEH 4O97A 1FAXA 5A09A 4ZUHA 1INCA 1MUEB 3BTFE 1QRWA 3TU7H 1HNEE 1Y3VA 3HK6B 2BVRH 4MPVA 2FLRH 1BHXB 1SOTA 1F92A 3VB4A 2BQ7B 3MO6A 3RXTA 2WPLS 2BVXH 3RXAA 5JDUB 3D23A 2BXUH 1MBQA 3KQCA 4B74A 1V3XA 3ELAH 3UY9A 3UTUH 3TK6A 4JZFH 3MU0A 4ABFA 2P3UB 1YBWA 3F9FA 4FUEA 4KTCA 2VWLA 2WYJA 2WV5A 1ELGA 1HPGA 3VGCC 2AFQB 3F9HA 1NRRH 3VB3A 2A4OA 5JPMH 4X1SU 1AD8H 4WWYA 2F91A 1C5XB 4DGJA 5LGOA 1P2NA 3PLPA 3F6UH 5A0CA 4INKA 1FI8A 2AIPA 2ZTZA 5E2PA 2GCTB 5FAHA 2GKVE 2A31A 1ZOMA 3PWCA 4BANB 1ZR0A 2PKAB 1SGFG 1GI8B 8LPRA 4I8GA 3GCTF 3KIDU 3U1JB 4D9RA 1KDQA 3KQEA 4O9VA 1VJAU 3RMOH 1O3BA 1EJAA 1CHGA 3LU9B 5C20A 1SPJA 1O2SA 4YOIA 1F0TA 1ZZZA 1GHWH 1GHZA 1K1NA 1PPZA 3H7TA 4GHTA 5B6OA 1MTWA 1QJ1B 1HIAA 1O3HA 3EGKH 3L3TA 3RXHA 1OWKA 1RFNA 2AGIX 4DCDA 2FO9A 2BXTH 5HM9A 1C2KA 1VCQA 1ELBA 1EZSC 1SC8U 1E34B 2JETC 3U9AH 3UFAA 1FY5A 1P8VC 3S7HB 2AIQA 2GT7A 1AGJA 4XSKU 1AKSA 4PROA 5FCKA 1A5IA 1RS0A 1N6XA 2WUCA 1IHSH 1O3PB 2Z3CA 3VGCB 2BY6X 1MCVA 5A8XA 2OC1A 4A92A 1ABIH 3LJJA 2EI7A 3Q76A 2B7DH 2ZGBH 4FUIA 1AUJA 3RC4A 2QXHA 2A0QB 2PTNA 1TAWA 1TLDA 1C2JA 3R0FA 3SU6A 2HVXA 1HB0B 3PMAB 4U01A 5AVDA 4BNRA 2AH4X 1E38B 1H8DH 1GBDA 2GP9B 3ZVEA 3SNEA 4YM9A 1O3AA 4GCHG 1ZGVA 4H4FA 1PPHE 2O9QA 1EAXA 1YC0A 2W5EA 5LPFA 4OS7A 2W3IA 1EJNA 2F83A 2BD5A 1WOFA 3BN9A 2F9BH 3A87A 3L33A 2OUAA 1C9TA 1DSUA 2AGGX 3PB1E 4Y8XA 1LQEA 3SU3A 2PUXB 4UFDH 5E0GA 1SGQE 3RXGA 5E8EH 3RMNH 1BJVA 2VIWA 1GG6B 1SQAA 5C1YA 2EC9H 1S0QA 5CMXH 1QURH 1UVTH 2JETB 3GCOA 3UQOA 4D76A 1LVBA 4X1PU 3M3SA 2TGTA 5E0JA 3P6ZB 4MNYA 1T8OA 4Q80A 1O39A 2ZU4A 4Y10E 2PV9B 2STBE 2IN2A 2BMGB 3VXEH 2G4UA 1O5DH 2JKHA 3D49H 2Y7ZA 3SNBA 1MQ5A 1T31A 3GY2A 2PR3A 3ENSB 3V13A 2ESTE 1AUTC 4HZHA 1IQKA 1ANBA 1QL7A 4IN2A 3K65B 1DE7H 3TNTA 1S83A 3BIVH 1UCYK 1Z7KA 3KGPA 5TCAA 2GV6A 2PKAA 1EAIA 2FXRA 2ZFFH 4CRFA 3FP8E 4FVBA 3QWCH 4WXVA 1P9SA 4ZAEA 4UE7H 5T6GA 4KP0A 2A1DB 1L1JA 1BOQA 4HGCA 2XWAA 3MU4A 1HAIH 3Q3XA 1MTNB 1H9LB 2OC0A 2W7SA 1QQ4A 1FAKH 3K6YA 5EG4A 3SHAH 5DP5A 2XCFA 3MNBA 5A8YA 1UTKA 2HLCA 2ZGCA 2BDIA 5TCCA 1FXYA 1LPKB 1NT1A 4X2VA 2BOHB 4MPXA 3RXCA 1YPLH 2WPHS 4GAWA 4JCNA 2Z6BD 5LPRA 3B9FH 1OP8A 3MO9A 1XX9A 1FQ3A 1D6RA 1WTGH 4YLUA 5FX5A 1BTHH 4YOJA 3T25A 1LHDH 2SFAA 5GIBA 1PYTD 2ANWA 3LC5A 3ESTA 2ALPA 3EE0B 1P2IA 1M9UA 3GY6A 2OBOA 1LKAA 1D4PB 3SJOA 3QZRA 1BRBE 3SW2B 1YPKH 4K2YA 1O0DH 5E2OA 1C4Y2 5FBIA 5FHTA 4B1TA 2FESH 1UO6A 3AAUA 1NO9H 2CGAA 3DUXH 1TYNA 4A1XA 1TPOA 3KHVA 1LDTT 2FP7B 3GICB 4BAOB 2FYRA 1P0SH 3TIUA 1W7XH 2GCHG 1ETSH 1UHBB 1LHGH 1FUJA 1VITG 3GDVA 4ABJA 4KKDA 2XW9A 1TQ7B 3JZ2B 4IMZA 3UUZA 1BMLA 1UTPA 2KAIB 1BJUA 5JBBS 5L2ZH 1O2ZA 4ZKNU 2FX6A 3SU4A 3QGJA 1UTJA 2FI3E 1CHOF 1LKBA 2SNWA 1WAYB 3IG6B 1BB0B 2P59A 1GJCB 5FXLA 1G3DA 3M5LA 1AIXH 2JH5D 2ZU2A 1FIWA 1GDQA 1QTFA 3RMLH 1DUAA 3BTEE 5JBAS 1GI0A 4X6NA 3U8TH 5CHAB 1BCUH 5HXFA 4B2CA 1NM6A 1HAGE 2QIQA 1JWTA 2D26C 3NCLA 4MPWA 1MAYA 4X8TH 5A0BA 1ZTJA 1BTYA 4CR9A 2B5TB 4JYTA 1VR1H 3MI4A 2AGEX 2C93B 1SHYA 1P3EA 3UQVA 3SGBE 1O5BB 4XFQA 4RKOB 1BBRE 2IOTA 2PGBB 2OC7A 1SGTA 2VIVA 3FVFB 2SGFE 4IGDA 5AF9H 4UD9H 4Y6DA 2R3UA 1C4U2 3SO3A 1DPOA 5L6NH 1QGFA 4WY3A 1NC6A 1JBUH 1SG8B 1UVUH 1W8BH 4NSVA 3VFEA 3A8BA 3SBKA 1A0HB 1HAXB 3VB5A 1BRAA 2ZGXH 1WUNH 1Z1IA 1LVMA 1GBMA 2BD9A 4JMYA 3SI3H 4I7YH 1GI4A 2BD7A 3P8FA 3UPEA 5DP9A 4GUXA 3TJVA 4OS2A 1C5OH 1AO5A 2GMTC 2ZQ2A 1DVAH 2FX4A 2BLOA 3S0NA 1L1NA 3SGAE 3U98H 2ZFRH 1DY9A 1SL3A 1G37A 1HCGA 1UMAH 2CN0H 5DP3A 3UNQA 2WPKS 2B9LA 1GMCG 4Q7ZA 4K8BA 4ISOA 1GHYH 3OY6U 2IPHA 2CMYA 2TRMA 1GCTC 3UWJH 3E16B 4UEHH 1EATA 1FY4A 2ZECA 3ZVAA 4FUHA 4AZ2B 1TGNA 4YT6H 2A4GA 4NZQA 4DIHH 1Z6JH 2FOGA 1FDPA 3RXBA 1DLEA 1ARBA 3ATWA 1IQLA 2XC5A 4K1SA 3S9BA 3SQHE 2RA0A 2F9UA 4OS4A 2ANKH 5A2MH 1EAUA 2V35A 5ESBA 3PV4A 1DY8A 4ZKOU 3G01A 1JIMA 1GMCF 2H9HA 3E0PB 1O2UA 2VVUA 4MTBA 3I78A 3VPKA 1O32A 5HYOA 2Y5GA 1MCTA 3ZVFA 1Y3YA 4X1RU 1C2EA 4AG2A 4NWLA 1TQ0B 1EP6A 1V2QT 4OGXA 1CGHA 4K8YA 3PM3A 1CT2E 3V0XA 2HPQH 1EZXC 3STJA 2GTBA 1BITA 1SBWA 2J34A 3AW0A 4DW2U 1G3BA 3VB6A 1OWIA 4X2XA 1TMTH 2ZKSA 3SQEE 2FZZA 1CO7E 2PTCE 1NFWA 4I8LA 1O2YA 4R8TB 2I6SA 1C1WH 1K1IA 1HAHH 2GZ8A 1FY8E 1PQ7A 1QA0A 5HGGA 4K1TA 8KME2 4FUDA 4CRCA 4CH8B 1HAVA 1NRNH 4Z6AH 1K1LA 4AGJA 1B5GH 1G30B 1P3CA 1C2FA 4ZXYH 1UHBA 2Y80A 3GY4A 1TWXB 2R3YA 4O3TA 1EXFA 1YLCA 1FNIA 3RM0H 4XBDA 3S9AA 1CQQA 2AMDA 3MU5A 4ZKRU 1DX5M 1K21H 3TK5A 1GMDF 3BG4C 3K2UA 1PQAA 1FY3A 1ZRBA 3A7YA 1K9OE 4AN7A 2XBXA 1C5MD 5FCRA 1DS2E 2VVVA 2R2MB 3SUGA 3MH4A 1SGDE 1SLXB 1THRH 3MNSA 1GG6C 4XBBA 5C3NA 1TA2A 4ABIA 3O8BA 1NFXA 2OLGA 1UK3A 2QF3A 1O2XA 4I8HA 2V0BA 3LKWA 3M61U 3Q3YA 2FPZA 1C5VA 1O38A 3M7QA 6ESTA 1C1VH 1GHAF 3PMHB 4AFZA 2XC4A 3NUMA 2B0FA 5C67A 1QB6A 2A32A 2QA9E 2RG3A 4ISHH 4ZROA 1O2JA 1FN6A 1SGRE 4UFGH 1TGSZ 5F6MA 3LT3A 1GI2A 3A88A 3EA7A 1XXFA 3F68H 3SV8A 4BXWA 2G5VA 3PO1C 4ABEA 2OXSA 1GJ6A 1GVLA 2ZFSA 1PPGE 5GXPA 2VIPA 1KXDA 3BG4B 2P93A 4Y11E 2VNTA 1RIWC 1GMHG 1O3IA 1MMJN 3EA9A 2WV4A 1LTOA 2NU1E 1O2PA 3HPTB 5EGMA 2FDAA 5GWZA 4WJG2 2ZDMA 2UWLA 1S81A 3TJUA 2O8LA 3P95A 4INHA 1MU6B 2G00A 4BTTB 3KCGH 4B71A 3HK3B 1W11U 2I6QA 3LGWA 3M7UA 3GY7A 1L4ZA 1O30A 1YYY1 4DY7B 2ZHFH 2R9PA 3RC5A 1EAWA 3A81A 3GYLB 1Y5UT 1CGJE 1ANDA 2OINA 3RXUA 3NPSA 2QAAA 3UOUA 4WH8A 2UUJB 3PROA 1A3BH 1TNIA 1GI3A 1O2QA 1P2JA 2BZAA 3KL6A 3CS7A 1S6FA 1UCYE 1V6DA 1VJ9U 1P2QA 1A4WH 3RXPA 3LONA 1MZAA 1VGCC 1S82A 2RCEA 3A85A 4MLFB 2VWNA 2XXLA 1DXWA 1QNJA 1SOZA 4UFFH 2F9NA 1LHEH 1TONA 1SSXA 2ZU1A 4FXGH 3BTME 1TMBH 3PYHA 2WPJS 1C5YB 1GBFA 5A8ZA 1P01A 1XXDA 3QN7A 2Z3DA 3A83A 3BTHE 1G3EA 5IDKA 2G52A 1T8NA 2QCYA 5LH8A 1C1OA 3TJOA 1V2NT 3ZZ5A 3R3GB 1ORFA 2QYIA 2A5KA 1V2OT 3DA9B 1GHBF 2BLVA 2ZTYA 4X1QU 2HALA 2O8UA 2VWMA 1Q3XA 1O3KA 3S69A 1GHAG 4BTUB 2OC8A 1RIWB 2H5DA 2FOBA 2OP9A 1J17T 1TNHA 4NFFA 1O2NA 5T3HA 5TJXA 1ARCA 1GHBG 4ABAA 1IQHA 2SGQE 1S0RA 2QY0B 4U32A 2VIQA 1WSSH 3TITA 2ZF0H 2XYAA 3MTYA 1C5PA 1HJ8A 1YPJH 1D3PB 1Y59T 3PLBA 4CHAC 1JOUB 4WXIA 3SV6A 1KXEA 1SFIA 1TPSA 1GJ5H 2GVFA 1BTZA 3SNDA 1Y3XA 2ALVA 1IOEA 1WCZA 2XC0A 1O3LA 2BVSH 1A2CH 1AN1E 3LGVA 2CV3A 1HJAC 2ZGHA 1ANEA 1ZPZA 2Y81A 2P8OC 1SGIB 1GMHF 1SLUB 1IHTH 2A2XH 1HFDA 4LK4A 1UTQA 1TNGA 3LH3A 1DSTA 1GJAB 4WF8A 1TBRH 2FOFA 2ZI2H 2Z3EA 3H5CB 2FI5E 4H6SB 2ODPA 1QJ7B 2UUYA 3PWBA 4DJZB 1L2EA 2QGRA 1ZMLA 1KTSB 2ZFQH 3ZVDA 1MKWH 1UK2A 2SGAA 2ZDNA 1PPEE 3RLYH 3P8OA 2P94A 1SGFA 2PFEA 3TGKE 1PYTC 4K5ZA 1C2DA 1PQ5A 4TY6A 1DT2A 1ZTKA 3DT0H 1DWBH 3SNCA 5FX6A 1H8IH 3GCNA 2GZ7A 1A5HA 2TGDA 2NU3E 1SFQB 5CHAC 1KLJH 1CBWB 1CE5A 4WVPE 1GI7B 2VU8E 4X0WU 1YP9A 1O3OA 3Q3KA 4MNXA 1H9HE 2AYWA 3ZZ9A 4NA8A 3BEUA 5DO4H 1F0SA 1C5WB 1P57B 2O8MA 3ZYDA 1C5RA 1TALA 3SV2H 1QBOA 1KXBA 1C5SA 4AORA 1EP5A 2F9VA 1CGIE 4F49A 3NKKA 3P92A 1HDTH 1GMDG 1XUIA 1RTFB 1YCPK 4YTAA 4YOGA 2XWBI 1GJDB 4CRDA 1AB9C 2BD4A 4ASHA 3SU1A 4AGKA 3PLKA 1FPHH 4Y79A 2CF8H 1HV7A 2PWXA 3QUMP 1QR3E 5G4BA 2R2WU 1RD3B 1SGCA 1GJ7B 1F0UA 1BMAA 4E05H 1WU1A 1NU7B 2ZDVH 3GDUA 2ZHQH 1Z6EA 4WMFA 4IN1A 1YPEH 1AZZA 1TNJA 2FS9A 3UNSA 4X1NU 4YO9A 3M37A 2FLBH 1J14A 1O3MA 3B23B 4Y7BA 1CVWH 1O2WA 1AVGH 3U8OH 2XBYA 2UWPA 1HAPH 4D9QA 1BHXF 2Y82A 3SHCH 3LDXH 2IJOB 3PTNA 1GJBB 4A5TS 1EPTA 4J2YB 2UWOA 1K1MA 1JMOH 1BQYA 3SI4H 1YKTA 1B0EA 3OYPA 5DJ7A 3P17H 1XUFA 1AE8H 1O2KA 2ULLA 2PKSC 1UVPA 2AS9A 1O5FH 3NXPA 2QXIA 2HPPH 3URCA 1AU8A 1MD7A 1V2TT 1E35B 1P05A 1ZJDA 1Z8IB 2FI4E 1V2KT 4DOQA 5FPTA 3MO3A 1ETTH 1SI5H 1GBEA 5EQRA 1XKAC 4UONA 1W0ZU 1SQTA 1B7XB 4M7GA 3UR9A 1FMGA 3S9CA 2A5IA 2GX4A 1ZHRA 1G36A 3RP2A 1O3NA 1A1RA 1XUGA 3M3VA 2V3OH 1HUTH 5FBEA 1F5KU 1PPBH 4U2WA 1BMNH 1X7AC 2BDHA 4GLYA 1K1JA 1A7SA 5I46H 1A5GH 1CBWC
chains in the Genus database with same CATH superfamily
3MH7A 1P9UA 1QBVH 2XRCA 2LPRA 3RMMH 3F1SB 1FN8A 3ZZBA 1AE5A 3DCLA 1THSH 4JZIA 3PV5A 2BLQA 2Y5FA 3T26A 3ZZ4A 3GY8A 4TWWA 3OX7U 2UUKB 1TE0A 1LPGB 1WV7H 1ZYOA 1Z8JB 4A1VA 1GBIA 1SHHB 1RJXB 2HNTE 1BRUP 3RXJA 3I77A 1N8OC 5EQSA 1TIOA 5F53A 1AHTH 1E1RD 2VWOA 2ZPQA 1O37A 1EUFA 2VGCC 4NSYA 3ZV9A 1S85A 1BTUA 2DUCA 1TOCB 5DSFA 1GI6A 1OS8A 4E7NA 4CRGA 1LO6A 1QBNA 3E0NB 4AG1A 4TPIZ 3SZNA 4NA7A 4OGYA 2CHAC 1TRNA 4FU7A 4ISLA 1EQ9A 1PFXC 3K6ZA 3ZZCA 1AMHA 1O5EH 4DIIH 1C5ZB 2ZO3H 3A7WA 5SGAE 1XVMA 1UVOA 2LELA 1GWAA 1GBTA 1CA0B 1GCDA 1UW7A 2J95A 3GISB 1FIZA 5EODA 1CA0C 3KNXA 4CBNA 2H1UA 1KXCA 1GGDC 4Y8YA 2EQNA 1DICA 4HI3A 2CXVA 1BBRH 2L6OA 1S6LA 4NG9H 1HJ9A 1AVXA 5JYIA 1C1QA 1EOJA 3AASA 1BRCE 4NFEA 3LPRA 1W0YH 1LPZB 1TPPA 1ABJH 2A4QA 2JH6D 3MH5A 2VGCB 3RXSA 2P3FH 1Z8RA 3HGPA 1GL1A 1O3EA 3M36A 4Y71A 3A7TA 1FONA 1BBRK 1YWUA 2A2QH 1ELEE 1DWEH 4I31A 5E0HA 1QL9A 4YXWD 1GJ4H 2ODYB 1XUJA 2G55A 1NROH 1C2LA 2BOKA 2PLXA 1Z8GA 1NRSH 2QXJA 2FEQH 1KMHB 2J4IA 1HAVB 1K2I1 3LC3A 3SYJA 3RU4T 3SN8A 1BUIA 3ATKA 3SV9A 2GMTB 3F3BA 5C0TA 2XNIA 3E90B 2J98A 3AK5A 1SLWB 2ZDLA 2GGVB 3QTVH 1J15A 1SB1H 2FYQA 2VVCA 4CBOA 1MAXA 2BZ6H 3BEIB 2D2DA 4D7FA 2NWNA 1QB9A 3SU0A 1C5TA 2BB4A 1P04A 1EOLA 1LCYA 3RU4D 3TGJE 1DFPA 5EPYA 2G5NA 1Q31A 2BDAA 1T4VH 1TMUH 3RXVA 2SGPE 2Q6GA 1Y5AT 2G8TA 3MU1A 1ZMNA 3M5MA 5J4QA 1EFRD 5EW1H 1HLTH 3DFLA 4AB8A 1GHVH 4AX9H 3V12A 2OD3B 3F2FA 4X8VH 5B6LA 3SJIA 1OKXA 2ZWLH 3NRLA 1KXFA 1DITH 4BOHA 1WBGB 2F9PA 1GI9B 1NPMA 1AWFH 4GSOA 1EASA 1HJAB 2OQ5A 4NA9H 4Q2KA 3B8JA 2HRVA 2SGEE 1GGDB 3LGYA 1C4V2 3PRDA 1BT7A 2ZPRA 4Y0ZE 3M35A 2WINI 1AQ7A 2ZFPH 2BD3A 4NIXA 3NWUA 4YLQH 3UREA 3W94A 4F4OC 3QX5H 6LPRA 3ZYEA 2ZP0H 3KQ5A 3SJKA 3NZIA 1BZXE 2HNTC 3TJNA 5C1XA 3UIRA 1AFQC 5DP4A 3TGIE 5GDSH 1V2UT 1FX0B 1AKSB 1V2RT 2ZGJA 1VKYA 3SU2A 4JYUH 4AC9A 2BDCA 4J1YA 5JB8S 1ZHMA 1H8HD 2ZZUH 4IS5A 1OWDA 3A89A 4JK5A 3A82A 1FY1A 3ATIA 4LZ1H 1D3TB 1TX6A 1O31A 4MNWA 4O03A 1V2LT 2ODQA 1GVZA 2L74A 1Y3UA 2FOCA 2BDYA 1J8AA 4Q7XA 2C90B 1YY3A 3T27A 1RTLA 3ZVBA 2W6ID 2ZNKH 3RM2H 1W3CA 4MNVA 2KZ4A 4CRBA 2CHAB 2THFB 3AAVA 4Q63A 4ZHMU 3RXMA 1CSOE 1C1TA 3H7OA 1VCPA 1AFEH 1UTOA 1LVYA 1N1LA 3OU0A 1CA8B 1F7ZA 4I8KA 4MQAA 2Z9LA 3A7ZA 3RXRA 2G81E 3KQBA 3ZZDA 4JZDH 4AFUA 3VB7A 3UNRA 1KIGH 2FTMA 2P8OB 1O2MA 1GDUA 2C3SA 1ELAA 1O3GA 1ZHPA 4RKJB 4CHAB 3VXFH 1MZDA 2AMPA 3P8GA 3ITIA 1UTLM 1YCPH 2EEKA 3UR6A 4ZMAH 2ZHEH 2D8WA 1IQIA 1ACBE 4KTSA 4AB9A 1NS3A 2XCNA 2Z9IA 4Q4LA 4R0IA 3UOPA 1TRMA 2WYGA 1C5LH 4X8SH 3MWIU 1SGYE 2ANYA 3RC6A 2Q6FA 1IQNA 1U6QA 4E06H 3STIA 5EXLA 1O2TA 3MMGA 1T7CA 3EDXB 4Q7YA 2M5TA 1MQ6A 1IQEA 1XUKA 3JZ1B 1MTUA 4THNH 4INLA 5ABWA 2Z9GA 1GI5A 3FAOA 3UWIA 3BF6H 3LH1A 4IC5A 1TRYA 2GDEH 2Q6DA 3T28A 5DP6A 2ZIQH 3N7OA 4P00A 3QK1A 1T4UH 1EB2A 1NTPA 2HGTH 2V3MA 3TLOA 2OBQA 3URDA 3SOSA 3OFND 2TIOA 4FUBA 4I86A 4DVAU 3QGNB 5C1UA 1ELTA 2BY7X 1DM4B 1Z1JA 3GCHB 3PMBB 4DURA 4B2AA 2V6NA 1QIXB 1YGCH 4MG3A 5F03A 4BAHB 2VINA 4FU8A 3SGQE 4VGCB 1SQRA 2QE7D 3SUFA 1AVWA 1HXEH 2Y5HA 1NN6A 3LGUA 2YMSC 2ZCKP 1KSNA 2KX4A 3BTDE 1B0FA 2LNCA 2FOEA 4OS1A 1G3CA 4FUGA 6GCHG 1HRTH 1AWHB 3MU8A 2BX3A 1A46H 3LJOA 2ZG0H 3O8RA 3OSYA 3FZDA 3MQKC 2OK5A 3WWBA 1GBLA 2FOMB 1ZTLA 4ISIH 1O3FA 2ZTXA 1TABE 1UCYH 2W3KA 1P02A 2H5CA 1NBME 1O36A 1HGTH 2TGAA 3A80A 4DT7B 1YLDA 3E3TA 4D7GA 3FFGA 1KLTA 5DG6A 3RXLA 8GCHF 3TVJB 3TNSA 1EX3A 2FOAA 5PTPA 1SR5C 1HBTH 5J4SA 1ZPBA 1O2OA 3UB0A 4AOQA 3FOAA 2BY5X 3U1IB 1OP2A 2C8YB 1C2MA 1ZMJA 3ATLA 1NZQH 4I33A 1GI1A 2VBCA 7KMEH 4NZLA 1TGBA 1EZUC 1UK4A 1FV9A 4FUJA 4SGAE 5GCHF 1KYNA 3RDZA 1NFYA 2GD4B 1O2IA 1HXFH 2VIDA 4Y0YE 1F5LA 1HAYB 4HFPB 2ZC9H 4BAKB 1MBMA 2ZDAH 1DDJA 4X8UH 1K1PA 2FIRH 3GYMA 4ESTE 1ZJKA 1OYQA 1KTTB 3E1XB 1C2IA 1XVOA 3NK8A 4FUCA 2WPIS 7GCHF 1O2LA 2PW8H 2TGPZ 1G32B 3QLPH 1VITF 4A7IB 2KAIA 1ZLRA 5H4IB 4ZH8A 1YM0A 1RGQA 1T8LA 1AB9B 1AI8H 4ZHLU 3MH6A 3F2HA 3FN8A 1ZRKA 3HKIB 2PSXA 3RXIA 1KY9A 1AFQB 4WMEA 2QXGA 2J92A 2YMSB 3IITA 4B73A 1LMWB 1JIRA 2WPDD 2BX4A 3EAJA 3T5FH 5JB9S 2JH0D 4Y76A 1O33A 3BTWE 5T6DA 1ESTA 2TBSA 3O8CA 1TGCA 1P2KA 3ZVCA 2Y6TA 3ODDA 3OE7D 1VGCB 4YT7H 2J94A 1JRTA 1PPFE 2UUFB 1MH0A 2SGDE 3OEHD 1QQUA 2YNAA 4K69A 5C5NA 2P95A 1P09A 1F2SE 1QRZA 1C9PA 3KQDA 2V3HH 5T6FA 4MPUA 1BTWA 4IBLH 1N8OB 1OP0A 3DD2H 2G4TA 2VH0A 2RA3A 2VB0A 4LOYH 1ESBA 1Q2WA 2ILNA 3HGNA 3KF2A 1MTSA 1VZQH 1D6WA 2GCTC 4KGAA 1K28D 1O2VA 2FTLE 3U69H 4AFSA 1YPHC 2PUQH 2Z7FE 1V2VT 1BA8B 1YCPM 2O8WA 1ANCA 4SGBE 5FL7D 3SJ9A 2GZ9A 2YNBA 2EY4C 2R0LA 2A7CA 2ZCHP 1S84A 1XUHA 3ZZ3A 1MD8A 2H9EH 5C2ZA 3VEQB 3QDZB 4X2WA 3RXKA 8GCHG 1YPHE 2TPIZ 1GDNA 1V2PT 5GPIB 1IQMA 1CU1A 4ZKSU 3GY3A 5F8XA 1A0JA 1W7GH 3A8DA 1CT4E 3GCTG 3DHKH 5EXMA 3O8DA 4WH6A 3KEEA 1TNLA 3BTTE 2ZHWH 3BEFB 3PO1B 1OWJA 2VJ1A 2FMJA 1GCTB 2B8OH 2R0KA 4JK6A 4CR5A 2GDDA 1TFXA 3MYWA 4QT8C 3W95A 3RLWH 3BV9B 4FVDA 3RUOA 4TYDA 4BTIB 3DSGA 3IWMA 1WXRA 2C4FH 1S6HA 5JBCS 4UDWH 4ABHA 3LIWA 1ZGIA 4NCYA 4TWYA 3MFJA 1GBAA 1O2HA 3V7TA 1TOMH 4RN6A 1RTKA 3M3TA 2WUBA 2XTTB 2OCVB 4CREA 5C94A 1NY22 2ZQ1A 1MU8B 3F9GA 5EQQA 1BDAA 3FANA 5BPEA 2STAE 4CH2B 4CRAA 2HWLB 7GCHG 2BQWB 1EKBB 1MKXH 3P70B 4XE4A 4LZ4B 1RXPA 1GBJA 3KN2A 1JRSA 1WQSA 4XOJA 1C2HA 4Z0KA 5ETXA 1K22H 2H6MA 2BY9X 3T62A 2ZU3A 1D3QB 1P10A 1C2GA 2BY8X 4O3UA 3SUEA 1O2GH 4OS5A 1OWEA 4IC6A 3CENA 2DE8A 1GBCA 2C8WB 2BLWA 1QA7A 1S5SA 1BMFD 4D8NA 1G2MA 1ID5H 3TH4H 1E79D 3P8NA 4I8JA 1QJ6B 2QV1A 2PHBA 1SQOA 4NGAH 4VGCC 4A6LA 1SVPA 4LXBH 1GBKA 5CE1A 1N6YA 1TB6H 1XM1A 1NFUA 5EW2H 4KTUA 3L6PA 1UTMA 3SV7A 4A1TA 2A7HA 1AZ8A 1SGEE 2O8TA 3SORA 1VITH 3ZZ6A 3TPIZ 1C1MA 5DK1A 1YPGH 4ABDA 3SNAA 4B76A 4X6PA 1TX8A 3RXQA 1H4WA 4XD7D 1OHHD 1MKWK 1ELCA 2P3TB 3M7TA 2QC2A 1XMNB 2ZU5A 2QN5T 3BG8A 1SMFE 4ABBA 2G51A 2ZFTA 3ZVGA 3EQ0H 1O2RA 4ZXXH 3ATMA 2AEIH 1GJ8B 3MOCA 4K60A 2HOBA 2PKSB 6GCHF 4X6OA 1PQ8A 4TPYA 1GPZA 3TK9A 2ANMH 7ESTE 4E7RG 5CHBA 1EZQA 2CK3D 2QF0A 4XDEA 4BAMB 3LGIA 4KELA 1C5UA 2Q1JA 1OSSA 1TBQH 1E37B 1MABB 1UJ1A 5HIYA 1J9CH 5EU8A 1NU9A 1LHCH 4B75A 1D3DB 1T8MA 4MDSA 1W2KH 4YZUA 2FM2A 2ZCLP 2BTCE 4RSPA 3A7VA 4GPGA 1OYTH 2BQ6B 1PPCE 1TX7A 3ZV8A 2F9OA 1O5AB 3A8AA 9ESTA 1W0KD 2OQUA 3CP7A 4FUFA 4IMQA 1C1PA 2P16A 1SGNE 5DP8A 3HATH 1TGTA 2W26A 3ODFA 2ZEBA 1L0ZA 2KCAA 3HKJB 1COWD 5AFYH 5FPYA 3E8LA 3MNCA 1Y3WA 1ZSJA 2ASUB 1V2MT 1GHXH 4AFQA 2OTVA 1HIAB 4H6TA 4U30A 1DUEA 1QCPA 2Z9KA 1D9IA 8ESTE 1A0LA 4ISNA 1FLEE 1TBZH 1L1GA 3QZQA 3E6PH 1HAOH 1QL8A 3QO6A 4NWKA 1AY6H 1P2MA 3RXDA 2J38A 1UTNA 1F5RA 1MTNC 5C5OA 4NIWA 2VIOA 2NU0E 1KDQB 1W10U 3Q00A 1L4DA 5DGJA 1W13U 1H9IE 2BM2A 3M5OA 5BRRE 1E36B 1E0FD 1P12E 1FZZA 1O35A 4DG4A 1J16A 1NRPH 5AFZH 3AW1A 1BTPA 1P06A 2EI8A 3ZZ8A 2WHXA 5F8TA 1V2JT 4WMDA 1O5GH 1H1BA 2BHGA 4UFEH 3GY5A 1A3EH 1SGPE 3S7KB 2DE9A 3LOXA 1K0HA 5HM2A 4NIYA 7LPRA 4IW4E 3H09A 1GL0E 1ESAA 1CHOG 3A7XA 1F0RA 4B2BA 5F8ZA 1MTVA 5EJLA 2Z94A 1DLKB 1CT0E 1OPHB 1OXGA 2D1JA 4TY7A 1QFKH 3QTOH 3E91A 2BD2A 3SUDA 1ELFA 1P11E 4ABGA 1QB1A 2NU2E 3W1EA 1HYLA 1ELVA 2H9TH 3A8CA 4AYVB 2GV7A 1C1NA 4JZ1A 5HMAA 3SU5A 3FP6E 4RT1A 1O34A 3OEED 4GCHF 5EXNA 3U8RH 1W12U 1GBHA 1TNKA 2AMQA 1VCWA 2ZPSA 3T2NA 1G2LA 1TA6A 2YOLA 5A0AE 1EPTC 1EPTB 1JXPA 1ELDE 1RRKA 1IAUA 1LHFH 1NESE 5EJZA 2W7UA 3PTBA 2GJGA 4X6MA 4XBCA 2GT8A 3D65E 2VH6A 3ZZ7A 2CF9H 1EJMA 1K1OA 3V3MA 2PSYA 1WQVH 1ETRH 1ZSKA 3EYDA 2XBVA 3A86A 1C1UH 1O3CA 1P03A 3C1KA 2WZQA 1O5CB 1Y5BT 5I25A 4NIVA 3RXOA 3GCHC 3BSQA 2BD8A 1EB1H 3FP7E 2XNDD 1IQGA 3AVZA 1GBBA 1UVSH 2FWWA 4HTCH 2A45B 4JYVH 2A5AA 5DP7A 5DKMA 1C5NH 3K9XB 3RU4E 1HAZB 2PGQB 5DPAA 3BTGE 3C27B 3GDSA 1Y8TA 4HG6A 4AYYB 1DOJA 2A4RA 2EI6A 1QHRB 4GHQA 2JIZD 1YPMH 1YF4A 5ESTE 1FJSA 5EOKA 1W14U 1P2OA 4MVNA 4BXSA 2XBWA 3EE7A 5LPEA 2ZHDA 1O3DA 1BMMH 1BTXA 1DWCH 4H42U 5GCHG 2BDBA 1V2ST 5GJ4B 5IYTA 2H2ZA 1KXAA 1YLNA 1WTHD 1XKBC 4GVUA 3BTKE 1C5QA 3TH2H 3FZZA 5JBTA 5EIYA 2C8XB 3WY8A 2J97A 4OS6A 5L2YH 1C1SA 2C8ZB 4I32A 3A84A 4K1EA 1IQJA 3CS0A 2PP6A 1QRXA 4FU9A 3I29A 1NRQH 2NU4E 3EA8A 4YESB 1OOKB 6CHAB 2CJIA 6CHAC 4Y7AA 3T29A 5C0UA 2BYAX 1GVKB 1O3JA 3MHWU 5AHGH 4ZHAA 3OTJE 1PJPA 2Z9JA 1DANH 3TH3H 9LPRA 1WYKA 1THPB 3LGTA 1LQDB 4X2YA 5FPSA 2LP6A 1QY6A 1DWDH 1TPAE 4Y8ZA 2HNTF 4K3JA 2AERH 2K1QA 1T32A 1OWHA 1G9IE 1A61H 3SJ8A 2BDGA 1SLVB 2GCHF 3F9EA 3OY5U 5K0HA 1V2WT 3D62A 1FPCH 1KLIH 3M5NA 1IQFA 3RXEA 3RXFA 2EA3A 2SNVA 1C1RA 3BIUH 3DFJA 1LVOA 2ZDKA 5K7RA 2Y7XA 1MKXK 3ZZAA 3MNXA 3PMJA 1DXPA 2ZA5A 1BIOA 5EPNA 3Q77A 2RDLA 2F3CE 2FS8A 2J9NA 2J2UA 1OX1A 2WPMS 1GJ9B 4TT3D 3KYFA 1ZPCA 1ZSLA 2FOHA 3GOVB 5EJ1A 5L30H 4BAQB 5IK2D 2A7JA 1Z71A 3N99A 3BTQE 2FODA 4JZEH 4O97A 1FAXA 5A09A 4ZUHA 1INCA 1MUEB 3BTFE 1QRWA 3TU7H 4ACBA 1HNEE 1Y3VA 3HK6B 2BVRH 3DSPA 4MPVA 2FLRH 4B6EA 1BHXB 1SOTA 1F92A 2KCOA 3VB4A 2BQ7B 3MO6A 2K0QA 3RXTA 2WPLS 2BVXH 3RXAA 5JDUB 3D23A 2BXUH 1MBQA 3KQCA 4B74A 1V3XA 3ELAH 3UY9A 3UTUH 3TK6A 4JZFH 3MU0A 4ABFA 2P3UB 1YBWA 3F9FA 4FUEA 4KTCA 2J5UA 2VWLA 2WYJA 2WV5A 1ELGA 1HPGA 3VGCC 2AFQB 3F9HA 1NRRH 3VB3A 2A4OA 5JPMH 4X1SU 1AD8H 2F4LA 4WWYA 2F91A 1C5XB 4DGJA 5LGOA 1P2NA 3PLPA 3F6UH 5A0CA 4INKA 1FI8A 2AIPA 2KM0A 2ZTZA 5E2PA 2GCTB 5FAHA 2GKVE 2A31A 1ZOMA 3PWCA 4BANB 1ZR0A 2PKAB 1SGFG 1GI8B 8LPRA 4I8GA 3GCTF 3KIDU 3U1JB 4D9RA 1KDQA 3KQEA 4O9VA 2IPQX 1VJAU 3RMOH 1O3BA 1EJAA 1CHGA 3LU9B 5C20A 1SPJA 1O2SA 4YOIA 1F0TA 1ZZZA 1GHWH 1GHZA 1K1NA 1PPZA 3H7TA 4GHTA 5B6OA 1MTWA 1QJ1B 1HIAA 1O3HA 3EGKH 3L3TA 3RXHA 1OWKA 1RFNA 2AGIX 4DCDA 2FO9A 2BXTH 5HM9A 1C2KA 1VCQA 1ELBA 1EZSC 1SC8U 1E34B 2F43B 2JETC 3U9AH 3UFAA 1FY5A 1P8VC 3S7HB 2AIQA 2GT7A 1AGJA 4XSKU 1AKSA 4F48B 4PROA 5FCKA 1A5IA 1RS0A 1N6XA 2WUCA 1IHSH 1O3PB 2Z3CA 3VGCB 2BY6X 1MCVA 5A8XA 2OC1A 4A92A 1ABIH 3LJJA 2EI7A 3Q76A 2B7DH 2ZGBH 4FUIA 1AUJA 3RC4A 2QXHA 2A0QB 2PTNA 1TAWA 1TLDA 1C2JA 3R0FA 3SU6A 2HVXA 1HB0B 3PMAB 4U01A 5AVDA 4BNRA 2AH4X 1E38B 1H8DH 1GBDA 2GP9B 3ZVEA 3SNEA 4YM9A 1O3AA 4GCHG 1ZGVA 4H4FA 1PPHE 2O9QA 1EAXA 1YC0A 2W5EA 5LPFA 2JJ1D 4OS7A 2W3IA 1EJNA 2F83A 2BD5A 1WOFA 3BN9A 2F9BH 3A87A 3L33A 2OUAA 1C9TA 1DSUA 2AGGX 3PB1E 4Y8XA 1LQEA 3SU3A 2PUXB 4UFDH 5E0GA 1SGQE 3RXGA 5E8EH 3RMNH 1BJVA 2VIWA 1GG6B 1SQAA 5C1YA 2EC9H 1S0QA 5CMXH 1QURH 1UVTH 2JETB 3GCOA 3UQOA 4D76A 1LVBA 4X1PU 3M3SA 2TGTA 5E0JA 3P6ZB 4MNYA 1T8OA 4Q80A 1O39A 2ZU4A 4Y10E 2PV9B 2STBE 2IN2A 2BMGB 3VXEH 2G4UA 1O5DH 2JKHA 3D49H 2Y7ZA 3SNBA 1MQ5A 1T31A 3GY2A 2PR3A 3ENSB 3V13A 2ESTE 1AUTC 4HZHA 1IQKA 1ANBA 1QL7A 2WSSD 4IN2A 2W6JD 3K65B 1DE7H 3TNTA 1S83A 3BIVH 1UCYK 1Z7KA 3KGPA 5TCAA 2GV6A 2PKAA 1EAIA 2FXRA 2ZFFH 4CRFA 3FP8E 4FVBA 3QWCH 4WXVA 1P9SA 4ZAEA 2QF5A 4UE7H 5T6GA 2RFKC 4KP0A 2A1DB 1L1JA 1BOQA 4HGCA 1QZ8A 2XWAA 3MU4A 1HAIH 3Q3XA 1MTNB 1H9LB 2OC0A 2W7SA 1QQ4A 1FAKH 3K6YA 2KCPA 5EG4A 3SHAH 5DP5A 2XCFA 3MNBA 5A8YA 1UTKA 2HLCA 2ZGCA 2BDIA 5TCCA 1FXYA 1LPKB 1NT1A 2JDID 4X2VA 2BOHB 4MPXA 3RXCA 1YPLH 2WPHS 4GAWA 4JCNA 2Z6BD 5LPRA 3B9FH 1OP8A 3MO9A 1XX9A 1FQ3A 1D6RA 1WTGH 4YLUA 5FX5A 1BTHH 5T1VA 4YOJA 3T25A 1LHDH 2SFAA 5GIBA 1PYTD 2ANWA 3N7EA 3LC5A 3ESTA 3U28C 2ALPA 3EE0B 5KEDA 1P2IA 1M9UA 3GY6A 2OBOA 1LKAA 1D4PB 3SJOA 3CNRA 3QZRA 1BRBE 3SW2B 1YPKH 4K2YA 1O0DH 5E2OA 1C4Y2 2IJD1 5FBIA 5FHTA 4B1TA 2FESH 1UO6A 3AAUA 1NO9H 2CGAA 3DUXH 1TYNA 4A1XA 4P02A 3UAIC 1TPOA 3KHVA 1LDTT 2FP7B 3GICB 4BAOB 2FYRA 1P0SH 3TIUA 3WWFA 1W7XH 2GCHG 1ETSH 3DSOA 1UHBB 1LHGH 1FUJA 1VITG 3GDVA 4ABJA 4KKDA 2XW9A 1TQ7B 3JZ2B 4IMZA 3UUZA 4ZCNA 1BMLA 1UTPA 2KAIB 1BJUA 5JBBS 5L2ZH 3PRBA 1O2ZA 3WW7A 4ZKNU 2FX6A 3SU4A 3QGJA 1UTJA 2FI3E 1CHOF 1LKBA 2SNWA 1WAYB 3IG6B 1BB0B 1W0JD 2P59A 1GJCB 5FXLA 2HLDD 2J98B 1G3DA 3M5LA 1AIXH 2JH5D 2ZU2A 3ZIAD 1FIWA 1GDQA 1QTFA 3RMLH 1DUAA 3BTEE 5JBAS 1GI0A 4X6NA 3U8TH 5CHAB 1BCUH 5HXFA 4B2CA 4XRNA 1NM6A 1HAGE 2QIQA 1JWTA 2D26C 3NCLA 4MPWA 1MAYA 4X8TH 5A0BA 1ZTJA 1BTYA 4CR9A 2B5TB 4JYTA 1VR1H 3MI4A 2AGEX 2C93B 1SHYA 1P3EA 3UQVA 4DT4A 3SGBE 1O5BB 4XFQA 4RKOB 1BBRE 2IOTA 2PGBB 3FKSD 2OC7A 1SGTA 2VIVA 3FVFB 2SGFE 4IGDA 5AF9H 4UD9H 4Y6DA 2R3UA 1C4U2 3SO3A 5KECA 1DPOA 5L6NH 1QGFA 4WY3A 1NC6A 1JBUH 1SG8B 1UVUH 1W8BH 4NSVA 3VFEA 3A8BA 3SBKA 1A0HB 1HAXB 3VB5A 1BRAA 2ZGXH 1WUNH 1Z1IA 1LVMA 1GBMA 2BD9A 4JMYA 3SI3H 4I7YH 1GI4A 2BD7A 2K8IA 3P8FA 3UPEA 5DP9A 4GUXA 3TJVA 4OS2A 1C5OH 3SZEA 1AO5A 2GMTC 3VG8A 2ZQ2A 4M9FA 1DVAH 2FX4A 2BLOA 3S0NA 2RDEA 1L1NA 3SGAE 3U98H 2ZFRH 1DY9A 1SL3A 1G37A 1HCGA 1UMAH 2CN0H 5DP3A 3UNQA 2WPKS 2B9LA 1GMCG 4Q7ZA 4K8BA 4ISOA 1GHYH 3OY6U 4FETA 2IPHA 2CMYA 2TRMA 1GCTC 3UWJH 3E16B 4UEHH 1EATA 1FY4A 2ZECA 3ZVAA 4FUHA 4AZ2B 1TGNA 4YT6H 2KFWA 2A4GA 4NZQA 4DIHH 1Z6JH 2FOGA 5KGOA 1FDPA 3RXBA 1DLEA 1ARBA 3ATWA 1IQLA 2XC5A 4K1SA 3S9BA 3SQHE 2RA0A 2F9UA 4OS4A 2ANKH 5A2MH 1EAUA 2V35A 5ESBA 3PV4A 1DY8A 4ZKOU 3G01A 1JIMA 1GMCF 2H9HA 3E0PB 1O2UA 2VVUA 4MTBA 3I78A 3VPKA 1O32A 5HYOA 2Y5GA 1MCTA 3ZVFA 1Y3YA 4X1RU 1C2EA 4AG2A 4NWLA 2JJ2D 1TQ0B 1EP6A 1V2QT 4OGXA 1CGHA 4K8YA 3PM3A 1CT2E 3V0XA 2HPQH 1EZXC 3STJA 2GTBA 1BITA 1SBWA 2J34A 3AW0A 4DW2U 1G3BA 3VB6A 5CDFE 1OWIA 4X2XA 1TMTH 2ZKSA 3SQEE 2FZZA 1CO7E 2PTCE 1NFWA 4FOUC 4I8LA 1O2YA 4R8TB 2I6SA 1C1WH 1K1IA 1HAHH 2GZ8A 1FY8E 1PQ7A 1QA0A 5HGGA 2QF4A 4K1TA 4FUDA 4CRCA 8KME2 4CH8B 1HAVA 1NRNH 4Z6AH 1K1LA 4AGJA 1B5GH 1G30B 1P3CA 1C2FA 4ZXYH 1UHBA 2Y80A 3GY4A 1TWXB 2R3YA 4O3TA 1EXFA 1YLCA 1FNIA 3RM0H 4XBDA 3S9AA 1CQQA 2AMDA 3MU5A 4ZKRU 1DX5M 1K21H 3FO8D 3TK5A 1GMDF 3BG4C 3K2UA 1E1QD 1PQAA 1WDIA 1FY3A 1ZRBA 3A7YA 1K9OE 4AN7A 2XBXA 1C5MD 5FCRA 1DS2E 2VVVA 2R2MB 3SUGA 3MH4A 1SGDE 3GS9A 1SLXB 1THRH 3MNSA 1GG6C 4XBBA 5C3NA 1TA2A 4ABIA 3O8BA 1NFXA 2OLGA 1UK3A 2QF3A 1O2XA 4I8HA 2V0BA 3LKWA 3M61U 3Q3YA 2FPZA 1C5VA 1O38A 3M7QA 6ESTA 1C1VH 1GHAF 3PMHB 4AFZA 2XC4A 3NUMA 2B0FA 5C67A 1QB6A 2A32A 2QA9E 2RG3A 4ISHH 4ZROA 1O2JA 1FN6A 1SGRE 4UFGH 1TGSZ 5F6MA 3LT3A 1GI2A 3A88A 3EA7A 1XXFA 3F68H 3SV8A 3PV2A 4BXWA 2G5VA 3PO1C 4ABEA 2OXSA 1GJ6A 1GVLA 3OTPA 2ZFSA 1PPGE 5GXPA 2VIPA 1KXDA 3BG4B 2P93A 4Y11E 2VNTA 1RIWC 1GMHG 1O3IA 1MMJN 4ACAA 3EA9A 2WV4A 1LTOA 2NU1E 1O2PA 3HPTB 5EGMA 2FDAA 5GWZA 4WJG2 2ZDMA 2UWLA 1S81A 3TJUA 2O8LA 3P95A 4INHA 1MU6B 2G00A 4BTTB 3F0OA 3KCGH 4B71A 3HK3B 1W11U 2I6QA 3LGWA 3M7UA 3GY7A 1L4ZA 1O30A 1YYY1 4DY7B 2ZHFH 2R9PA 3RC5A 1EAWA 3A81A 3GYLB 1Y5UT 1CGJE 1ANDA 2OINA 3RXUA 3NPSA 2QAAA 3UOUA 3F0PA 4WH8A 2UUJB 3PROA 1A3BH 1TNIA 1GI3A 1O2QA 1P2JA 2BZAA 3KL6A 3CS7A 1S6FA 1UCYE 3F2GA 1V6DA 1VJ9U 1P2QA 1A4WH 3RXPA 3LONA 1MZAA 1VGCC 1S82A 2RCEA 3A85A 4MLFB 5HIZA 2VWNA 2XXLA 1DXWA 1QNJA 5DN6D 1SOZA 4UFFH 2F9NA 1LHEH 1TONA 1SSXA 2ZU1A 4FXGH 3BTME 1TMBH 3PYHA 2WPJS 1C5YB 1GBFA 5A8ZA 1P01A 1XXDA 3QN7A 2Z3DA 3A83A 3BTHE 1G3EA 5IDKA 2G52A 1T8NA 2QCYA 5LH8A 1C1OA 3TJOA 1V2NT 3ZZ5A 3R3GB 1ORFA 2QYIA 2A5KA 1V2OT 3DA9B 1GHBF 2BLVA 2ZTYA 4X1QU 2HALA 2O8UA 2VWMA 1Q3XA 1O3KA 3S69A 1GHAG 4BTUB 2OC8A 1RIWB 2H5DA 2FOBA 2OP9A 1J17T 4RT0A 1TNHA 4NFFA 1O2NA 5T3HA 1NBMD 5TJXA 1ARCA 1GHBG 4ABAA 1IQHA 2SGQE 1S0RA 2QY0B 4U32A 2XOKD 2VIQA 1WSSH 3TITA 2ZF0H 2XYAA 3MTYA 1C5PA 1HJ8A 1YPJH 1D3PB 1Y59T 3PLBA 4CHAC 1JOUB 4WXIA 5HKKD 3SV6A 1KXEA 1SFIA 1TPSA 1GJ5H 2GVFA 4OM9A 1BTZA 3SNDA 1Y3XA 4ASUD 2ALVA 1IOEA 1WCZA 2XC0A 1O3LA 2BVSH 1A2CH 1AN1E 3KYGA 3LGVA 2CV3A 1HJAC 2ZGHA 1H8ED 1ANEA 1ZPZA 2Y81A 2P8OC 1SGIB 1GMHF 2KR7A 1SLUB 1IHTH 2A2XH 1HFDA 4LK4A 1UTQA 1TNGA 3LH3A 1DSTA 1GJAB 4WF8A 1TBRH 2FOFA 2ZI2H 2Z3EA 3H5CB 2FI5E 2V7QD 4H6SB 2ODPA 1QJ7B 4Z1MD 2UUYA 3PWBA 4DJZB 1L2EA 2WV9A 2QGRA 4B6FA 1ZMLA 1KTSB 2ZFQH 2KCYA 3ZVDA 5GNDA 1MKWH 3N7DA 1UK2A 2SGAA 2ZDNA 1PPEE 3RLYH 4RI0A 3P8OA 2P94A 1SGFA 2PFEA 3TGKE 1PYTC 4K5ZA 1C2DA 1PQ5A 4TY6A 1DT2A 1ZTKA 3DT0H 1DWBH 3SNCA 5FX6A 1H8IH 3GCNA 2GZ7A 1A5HA 2TGDA 2NU3E 1SFQB 5CHAC 1KLJH 1CBWB 1CE5A 4WVPE 1GI7B 2VU8E 4X0WU 1YP9A 1O3OA 3Q3KA 4MNXA 1H9HE 2AYWA 3ZZ9A 4NA8A 3BEUA 5DO4H 1F0SA 1C5WB 1P57B 2O8MA 3ZYDA 1C5RA 1TALA 3SV2H 1QBOA 1KXBA 1C5SA 4AORA 1EP5A 1SKYE 2F9VA 1CGIE 4F49A 3NKKA 3P92A 1HDTH 1GMDG 1XUIA 1RTFB 1YCPK 4YTAA 4YOGA 2XWBI 1GJDB 4CRDA 1AB9C 2BD4A 4ASHA 3SU1A 4AGKA 3PLKA 1FPHH 4Y79A 2CF8H 1HV7A 2PWXA 3QUMP 1QR3E 5G4BA 2R2WU 3OAAD 1RD3B 1SGCA 1GJ7B 1F0UA 1BMAA 4E05H 1WU1A 1NU7B 2ZDVH 3GDUA 2ZHQH 1Z6EA 4WMFA 4IN1A 1YPEH 1AZZA 1TNJA 2FS9A 3UNSA 4X1NU 4YO9A 3M37A 2FLBH 1J14A 1O3MA 3B23B 4Y7BA 1CVWH 1O2WA 1AVGH 3U8OH 2XBYA 2UWPA 1HAPH 4D9QA 4F55A 1BHXF 2Y82A 2YMSD 3SHCH 2HVYB 3LDXH 2IJOB 3PTNA 1GJBB 4A5TS 1EPTA 4J2YB 2UWOA 1K1MA 1JMOH 1BQYA 3SI4H 1YKTA 2M2AA 1B0EA 3OYPA 5DJ7A 3P17H 1XUFA 1AE8H 1O2KA 2ULLA 2PKSC 5C17A 1UVPA 2AS9A 1O5FH 3NXPA 2QXIA 2HPPH 3URCA 1AU8A 1MD7A 1V2TT 1E35B 1P05A 1ZJDA 1Z8IB 2FI4E 1V2KT 4DOQA 5FPTA 3MO3A 1ETTH 1SI5H 1GBEA 5EQRA 1XKAC 4UONA 1W0ZU 1SQTA 1B7XB 4M7GA 4TSFD 3UR9A 1FMGA 3S9CA 2A5IA 2AHME 2GX4A 1ZHRA 1G36A 3RP2A 1O3NA 1A1RA 1XUGA 3M3VA 2V3OH 1HUTH 5FBEA 1F5KU 1PPBH 4U2WA 1BMNH 1X7AC 2BDHA 4GLYA 1K1JA 1A7SA 5I46H 1A5GH 1CBWC
chains in the Genus database with same CATH topology
3MH7A 1P9UA 1QBVH 2XRCA 2LPRA 3RMMH 3F1SB 1FN8A 3ZZBA 1AE5A 1THSH 4JZIA 2BLQA 2Y5FA 3T26A 3ZZ4A 3GY8A 4TWWA 3OX7U 2UUKB 1TE0A 1LPGB 1WV7H 1ZYOA 1Z8JB 4A1VA 1GBIA 1SHHB 1RJXB 2HNTE 1BRUP 3RXJA 3I77A 1N8OC 5EQSA 1TIOA 1AHTH 2VWOA 2ZPQA 1O37A 1EUFA 2VGCC 4NSYA 3ZV9A 1S85A 1BTUA 2DUCA 1TOCB 1GI6A 1OS8A 4E7NA 4CRGA 1LO6A 1QBNA 3E0NB 4AG1A 4TPIZ 3SZNA 4NA7A 4OGYA 2CHAC 1TRNA 4FU7A 4ISLA 1EQ9A 1PFXC 3K6ZA 3ZZCA 1AMHA 1O5EH 4DIIH 1C5ZB 2ZO3H 3A7WA 5SGAE 1XVMA 1UVOA 1GWAA 1GBTA 1CA0B 1GCDA 2J95A 3GISB 1FIZA 5EODA 1CA0C 3KNXA 4CBNA 2H1UA 1KXCA 1GGDC 4Y8YA 1DICA 4HI3A 2CXVA 1BBRH 4NG9H 1HJ9A 1AVXA 5JYIA 1C1QA 1EOJA 3AASA 1BRCE 4NFEA 3LPRA 1W0YH 1LPZB 1TPPA 1ABJH 2A4QA 2JH6D 3MH5A 2VGCB 3RXSA 2P3FH 1Z8RA 3HGPA 1GL1A 1O3EA 3M36A 4Y71A 3A7TA 1FONA 1BBRK 2A2QH 1ELEE 1DWEH 4I31A 5E0HA 1QL9A 1GJ4H 2ODYB 1XUJA 2G55A 1NROH 1C2LA 2BOKA 2PLXA 1Z8GA 1NRSH 2QXJA 2FEQH 2J4IA 1HAVB 1K2I1 3LC3A 3RU4T 3SN8A 1BUIA 3ATKA 3SV9A 2GMTB 2XNIA 3E90B 1SLWB 2ZDLA 2GGVB 3QTVH 1J15A 1SB1H 2FYQA 2VVCA 4CBOA 1MAXA 2BZ6H 3BEIB 2D2DA 4D7FA 2NWNA 1QB9A 3SU0A 1C5TA 2BB4A 1P04A 1EOLA 1LCYA 3RU4D 3TGJE 1DFPA 5EPYA 2G5NA 1Q31A 2BDAA 1T4VH 1TMUH 3RXVA 2SGPE 2Q6GA 1Y5AT 2G8TA 3MU1A 1ZMNA 3M5MA 5J4QA 5EW1H 1HLTH 3DFLA 4AB8A 1GHVH 4AX9H 3V12A 2OD3B 4X8VH 3SJIA 1OKXA 2ZWLH 1KXFA 1DITH 4BOHA 1WBGB 2F9PA 1GI9B 1NPMA 1AWFH 4GSOA 1EASA 1HJAB 2OQ5A 4NA9H 4Q2KA 3B8JA 2HRVA 2SGEE 1GGDB 3LGYA 1C4V2 1BT7A 2ZPRA 4Y0ZE 3M35A 2WINI 1AQ7A 2ZFPH 2BD3A 4NIXA 3NWUA 4YLQH 3UREA 3W94A 4F4OC 3QX5H 6LPRA 3ZYEA 2ZP0H 3SJKA 3NZIA 1BZXE 2HNTC 3TJNA 5C1XA 3UIRA 1AFQC 5DP4A 3TGIE 5GDSH 1V2UT 1V2RT 1AKSB 2ZGJA 3SU2A 4JYUH 2BDCA 4J1YA 5JB8S 1ZHMA 2ZZUH 4IS5A 1OWDA 3A89A 4JK5A 3A82A 1FY1A 3ATIA 4LZ1H 1D3TB 1TX6A 1O31A 4MNWA 4O03A 1V2LT 2ODQA 1GVZA 1Y3UA 2FOCA 2BDYA 1J8AA 4Q7XA 2C90B 3T27A 1RTLA 3ZVBA 2ZNKH 3RM2H 1W3CA 4MNVA 4CRBA 2CHAB 2THFB 3AAVA 4ZHMU 3RXMA 1CSOE 1C1TA 3H7OA 1VCPA 1AFEH 1UTOA 1LVYA 1N1LA 3OU0A 1CA8B 1F7ZA 4I8KA 4MQAA 2Z9LA 3A7ZA 3RXRA 2G81E 3KQBA 3ZZDA 4JZDH 4AFUA 3VB7A 3UNRA 1KIGH 2FTMA 2P8OB 1O2MA 1GDUA 2C3SA 1ELAA 1O3GA 1ZHPA 4RKJB 4CHAB 3VXFH 1MZDA 2AMPA 3P8GA 3ITIA 1UTLM 1YCPH 2EEKA 3UR6A 4ZMAH 2ZHEH 2D8WA 1IQIA 1ACBE 4KTSA 4AB9A 1NS3A 2XCNA 2Z9IA 4R0IA 3UOPA 1TRMA 2WYGA 1C5LH 4X8SH 3MWIU 1SGYE 2ANYA 3RC6A 2Q6FA 1IQNA 1U6QA 4E06H 3STIA 5EXLA 1O2TA 3MMGA 1T7CA 3EDXB 4Q7YA 2M5TA 1MQ6A 1IQEA 1XUKA 3JZ1B 1MTUA 4THNH 4INLA 5ABWA 2Z9GA 1GI5A 3FAOA 3UWIA 3BF6H 3LH1A 4IC5A 1TRYA 2GDEH 2Q6DA 3T28A 5DP6A 2ZIQH 3N7OA 3QK1A 1T4UH 1EB2A 1NTPA 2HGTH 3TLOA 2OBQA 3URDA 3SOSA 4FUBA 2TIOA 4DVAU 3QGNB 5C1UA 1ELTA 2BY7X 1DM4B 1Z1JA 3GCHB 3PMBB 4DURA 4B2AA 2V6NA 1QIXB 1YGCH 4MG3A 5F03A 4BAHB 2VINA 4FU8A 3SGQE 4VGCB 3SUFA 1AVWA 1HXEH 2Y5HA 1NN6A 3LGUA 2ZCKP 1KSNA 3BTDE 1B0FA 2LNCA 2FOEA 4OS1A 1G3CA 4FUGA 6GCHG 1HRTH 1AWHB 3MU8A 2BX3A 1A46H 3LJOA 2ZG0H 3O8RA 3OSYA 3FZDA 1GBLA 2FOMB 1ZTLA 4ISIH 1O3FA 2ZTXA 1TABE 1UCYH 2W3KA 1P02A 2H5CA 1O36A 1HGTH 2TGAA 3A80A 4DT7B 1YLDA 3E3TA 4D7GA 3FFGA 1KLTA 5DG6A 3RXLA 8GCHF 3TVJB 3TNSA 1EX3A 2FOAA 5PTPA 1SR5C 1HBTH 5J4SA 1ZPBA 1O2OA 4AOQA 3U1IB 2BY5X 1OP2A 2C8YB 1C2MA 1ZMJA 3ATLA 1NZQH 4I33A 1GI1A 7KMEH 4NZLA 1TGBA 1EZUC 1UK4A 1FV9A 4FUJA 4SGAE 5GCHF 1KYNA 3RDZA 1NFYA 2GD4B 1O2IA 1HXFH 2VIDA 4Y0YE 1F5LA 1HAYB 4HFPB 2ZC9H 4BAKB 1MBMA 2ZDAH 1DDJA 4X8UH 1K1PA 2FIRH 3GYMA 4ESTE 1ZJKA 1OYQA 1KTTB 3E1XB 1C2IA 1XVOA 3NK8A 4FUCA 2WPIS 7GCHF 1O2LA 2PW8H 2TGPZ 1G32B 3QLPH 1VITF 4A7IB 2KAIA 1ZLRA 5H4IB 4ZH8A 1YM0A 1RGQA 1T8LA 1AB9B 1AI8H 4ZHLU 3MH6A 1ZRKA 3HKIB 2PSXA 3RXIA 1KY9A 1AFQB 4WMEA 2QXGA 2J92A 3IITA 4B73A 1LMWB 1JIRA 2BX4A 3EAJA 3T5FH 5JB9S 2JH0D 4Y76A 1O33A 3BTWE 5T6DA 1ESTA 2TBSA 3O8CA 1TGCA 1P2KA 3ZVCA 2Y6TA 3ODDA 1VGCB 4YT7H 2J94A 1JRTA 1PPFE 2UUFB 1MH0A 2SGDE 1QQUA 2YNAA 4K69A 5C5NA 2P95A 1P09A 1F2SE 1QRZA 1C9PA 3KQDA 2V3HH 5T6FA 4MPUA 1BTWA 4IBLH 1N8OB 1OP0A 3DD2H 2G4TA 2VH0A 2RA3A 2VB0A 4LOYH 1ESBA 1Q2WA 2ILNA 3HGNA 3KF2A 1MTSA 1VZQH 1D6WA 2GCTC 4KGAA 1K28D 1O2VA 2FTLE 3U69H 4AFSA 1YPHC 2PUQH 2Z7FE 1V2VT 1BA8B 1YCPM 2O8WA 1ANCA 4SGBE 3SJ9A 2GZ9A 2YNBA 2R0LA 2A7CA 2ZCHP 1S84A 1XUHA 3ZZ3A 1MD8A 2H9EH 5C2ZA 3VEQB 3QDZB 4X2WA 3RXKA 8GCHG 1YPHE 2TPIZ 1GDNA 1V2PT 5GPIB 1IQMA 1CU1A 4ZKSU 3GY3A 5F8XA 1A0JA 1W7GH 3A8DA 1CT4E 3GCTG 3DHKH 5EXMA 3O8DA 4WH6A 3KEEA 1TNLA 3BTTE 2ZHWH 3BEFB 3PO1B 1OWJA 2VJ1A 2FMJA 1GCTB 2B8OH 2R0KA 4JK6A 4CR5A 2GDDA 1TFXA 3MYWA 4QT8C 3W95A 3RLWH 3BV9B 4FVDA 3RUOA 4TYDA 4BTIB 3IWMA 2C4FH 1S6HA 5JBCS 4UDWH 4ABHA 3LIWA 1ZGIA 4NCYA 4TWYA 3MFJA 1GBAA 1O2HA 3V7TA 1TOMH 4RN6A 1RTKA 3M3TA 2WUBA 2XTTB 2OCVB 4CREA 1NY22 2ZQ1A 1MU8B 3F9GA 5EQQA 1BDAA 3FANA 5BPEA 2STAE 4CH2B 4CRAA 2HWLB 7GCHG 2BQWB 1EKBB 1MKXH 3P70B 4XE4A 4LZ4B 1RXPA 1GBJA 3KN2A 1JRSA 1WQSA 4XOJA 1C2HA 4Z0KA 5ETXA 1K22H 2H6MA 2BY9X 3T62A 2ZU3A 1D3QB 1P10A 1C2GA 2BY8X 4O3UA 3SUEA 1O2GH 4OS5A 1OWEA 4IC6A 3CENA 2DE8A 1GBCA 2C8WB 2BLWA 1QA7A 1S5SA 4D8NA 1G2MA 1ID5H 3TH4H 3P8NA 4I8JA 1QJ6B 2QV1A 2PHBA 1SQOA 4NGAH 4VGCC 4A6LA 1SVPA 4LXBH 1GBKA 5CE1A 1N6YA 1TB6H 1XM1A 1NFUA 5EW2H 4KTUA 3L6PA 1UTMA 3SV7A 4A1TA 2A7HA 1AZ8A 1SGEE 2O8TA 3SORA 1VITH 3ZZ6A 3TPIZ 1C1MA 5DK1A 1YPGH 4ABDA 3SNAA 4B76A 4X6PA 1TX8A 3RXQA 1H4WA 1MKWK 1ELCA 2P3TB 3M7TA 2QC2A 1XMNB 2ZU5A 2QN5T 3BG8A 1SMFE 4ABBA 2G51A 2ZFTA 3ZVGA 3EQ0H 1O2RA 4ZXXH 3ATMA 2AEIH 1GJ8B 3MOCA 4K60A 2HOBA 2PKSB 6GCHF 4X6OA 1PQ8A 4TPYA 1GPZA 3TK9A 2ANMH 7ESTE 4E7RG 1EZQA 2QF0A 4XDEA 4BAMB 3LGIA 4KELA 1C5UA 2Q1JA 1OSSA 1TBQH 1E37B 1UJ1A 1J9CH 5EU8A 1NU9A 1LHCH 4B75A 1D3DB 1T8MA 4MDSA 1W2KH 4YZUA 2FM2A 2ZCLP 2BTCE 4RSPA 3A7VA 4GPGA 1OYTH 2BQ6B 1PPCE 1TX7A 3ZV8A 2F9OA 1O5AB 3A8AA 9ESTA 2OQUA 3CP7A 4FUFA 4IMQA 1C1PA 2P16A 1SGNE 5DP8A 3HATH 1TGTA 2W26A 3ODFA 2ZEBA 1L0ZA 3HKJB 5AFYH 5FPYA 3E8LA 3MNCA 1Y3WA 1ZSJA 2ASUB 1V2MT 1GHXH 4AFQA 2OTVA 1HIAB 4H6TA 4U30A 1DUEA 1QCPA 2Z9KA 1D9IA 8ESTE 1A0LA 4ISNA 1FLEE 1TBZH 1L1GA 3QZQA 3E6PH 1HAOH 1QL8A 3QO6A 4NWKA 1AY6H 1P2MA 3RXDA 2J38A 1UTNA 1F5RA 1MTNC 5C5OA 4NIWA 2VIOA 2NU0E 1KDQB 1W10U 3Q00A 1L4DA 5DGJA 1W13U 1H9IE 2BM2A 3M5OA 5BRRE 1E36B 1E0FD 1P12E 1FZZA 1O35A 4DG4A 1J16A 1NRPH 5AFZH 3AW1A 1BTPA 1P06A 2EI8A 3ZZ8A 5F8TA 1V2JT 4WMDA 1O5GH 1H1BA 2BHGA 4UFEH 3GY5A 1A3EH 1SGPE 3S7KB 2DE9A 3LOXA 5HM2A 4NIYA 7LPRA 4IW4E 1GL0E 1ESAA 1CHOG 3A7XA 1F0RA 4B2BA 5F8ZA 1MTVA 2Z94A 1DLKB 1CT0E 1OPHB 1OXGA 2D1JA 4TY7A 1QFKH 3QTOH 3E91A 2BD2A 3SUDA 1ELFA 1P11E 4ABGA 1QB1A 2NU2E 1HYLA 1ELVA 2H9TH 3A8CA 4AYVB 2GV7A 1C1NA 4JZ1A 5HMAA 3SU5A 3FP6E 1O34A 4GCHF 5EXNA 3U8RH 1W12U 1GBHA 1TNKA 2AMQA 1VCWA 2ZPSA 3T2NA 1G2LA 1TA6A 2YOLA 5A0AE 1EPTC 1EPTB 1JXPA 1ELDE 1RRKA 1IAUA 1LHFH 1NESE 2W7UA 3PTBA 4X6MA 4XBCA 2GT8A 3D65E 2VH6A 3ZZ7A 2CF9H 1EJMA 1K1OA 3V3MA 2PSYA 1WQVH 1ETRH 1ZSKA 3EYDA 2XBVA 3A86A 1C1UH 1O3CA 1P03A 3C1KA 1O5CB 1Y5BT 5I25A 4NIVA 3RXOA 3GCHC 3BSQA 2BD8A 1EB1H 3FP7E 1IQGA 3AVZA 1GBBA 1UVSH 2FWWA 4HTCH 2A45B 4JYVH 2A5AA 5DP7A 5DKMA 1C5NH 3K9XB 3RU4E 1HAZB 2PGQB 5DPAA 3BTGE 3C27B 3GDSA 1Y8TA 4AYYB 1DOJA 2A4RA 2EI6A 1QHRB 4GHQA 1YPMH 1YF4A 5ESTE 1FJSA 5EOKA 1W14U 1P2OA 4MVNA 4BXSA 2XBWA 5LPEA 2ZHDA 1O3DA 1BMMH 1BTXA 1DWCH 4H42U 5GCHG 2BDBA 1V2ST 5GJ4B 5IYTA 2H2ZA 1KXAA 1WTHD 1XKBC 4GVUA 3BTKE 1C5QA 3TH2H 3FZZA 5JBTA 2C8XB 3WY8A 4OS6A 5L2YH 1C1SA 2C8ZB 4I32A 3A84A 4K1EA 1IQJA 3CS0A 1QRXA 4FU9A 3I29A 1NRQH 2NU4E 3EA8A 4YESB 1OOKB 6CHAB 2CJIA 6CHAC 4Y7AA 3T29A 2BYAX 1GVKB 1O3JA 3MHWU 5AHGH 4ZHAA 3OTJE 1PJPA 2Z9JA 1DANH 3TH3H 9LPRA 1WYKA 1THPB 3LGTA 1LQDB 4X2YA 5FPSA 1QY6A 1DWDH 1TPAE 4Y8ZA 2HNTF 4K3JA 2AERH 2K1QA 1T32A 1OWHA 1G9IE 1A61H 3SJ8A 2BDGA 1SLVB 2GCHF 3F9EA 3OY5U 5K0HA 1V2WT 3D62A 1FPCH 1KLIH 3M5NA 1IQFA 3RXEA 3RXFA 2EA3A 2SNVA 1C1RA 3BIUH 3DFJA 1LVOA 2ZDKA 5K7RA 2Y7XA 1MKXK 3ZZAA 3MNXA 3PMJA 1DXPA 2ZA5A 1BIOA 5EPNA 3Q77A 2RDLA 2F3CE 2FS8A 2J9NA 2J2UA 1OX1A 2WPMS 1GJ9B 1ZPCA 1ZSLA 2FOHA 3GOVB 5L30H 4BAQB 2A7JA 1Z71A 3BTQE 2FODA 4JZEH 4O97A 1FAXA 5A09A 4ZUHA