1XUHA

Trypsin-keto-babim-co+2, ph 8.2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuhA02
1KDQA 3TPIZ 3EA9A 3PO1B 1QQUA 3GY7A 3BG8A 3SHCH 3D23A 2F9OA 1EPTA 1XUJA 2WV5A 1VJAU 2AMQA 1SR5C 1LQEA 1YF4A 2BD2A 5AF9H 5AFYH 1O3MA 1SGIB 1BTXA 1YGCH 1TE0A 4R8TB 3SV6A 3URCA 1NESE 9ESTA 2BXTH 2I6SA 3F9HA 3U69H 1HJ8A 1NO9H 3SV7A 1EP5A 3O8DA 1JMOH 3RP2A 3A82A 1UVUH 4IC6A 3HATH 1VITH 2NWNA 1LHDH 2AH4X 1V2ST 3MO9A 1WUNH 5FAHA 2FXRA 3LT3A 4Y10E 3SNCA 2BDBA 1AE5A 4O9VA 3MFJA 2AEIH 2VIVA 5GJ4B 3V13A 4AZ2B 4TPIZ 3I77A 3FVFB 4O97A 1UCYE 3EYDA 1OWDA 1O2HA 1DY9A 5C5OA 2H2ZA 3FFGA 5A0CA 2F3CE 4ZHAA 1ZGVA 1FDPA 1UVTH 2ULLA 1ZZZA 4FXGH 3KQDA 4IMZA 3TVJB 4I32A 2O8UA 1PPEE 3S9CA 3E91A 3GDSA 4HI3A 1CE5A 1LVBA 1GBAA 2TGDA 1JRTA 4ASHA 1TOMH 3CP7A 3SJOA 1SGPE 1K1OA 2PKAA 3E8LA 1TRMA 2CV3A 1T7CA 1XM1A 3UNRA 1TWXB 4BXSA 1QRXA 1S6FA 2P95A 1NN6A 2GDDA 2AGEX 2QYIA 2G4TA 3ESTA 3SGBE 2A4QA 5L2YH 3M5NA 2FI5E 2VWNA 3SUFA 4NWLA 4WMDA 4X1SU 4UFFH 3B9FH 2GX4A 1OX1A 3UWIA 5DP9A 3A85A 6LPRA 5A2MH 2QXJA 5CHAC 1QTFA 3T2NA 4TWYA 1CVWH 3AAUA 1VZQH 5HMAA 2FOFA 3VB7A 2GCHG 2XWAA 2H9EH 1CQQA 2TGPZ 3RXAA 1QCPA 1Y5BT 3R0FA 5ESTE 1SL3A 5DG6A 1LCYA 4BAKB 3P92A 1C5WB 1D3PB 2H9HA 1Z8RA 9LPRA 1D3QB 1MTWA 1MD8A 1IOEA 2C8YB 2R2WU 3PWBA 3PLPA 2EI7A 3ZZ5A 1DLEA 2WINI 5F8XA 2OC1A 1GDNA 1TYNA 2ALVA 1HRTH 4MDSA 4AYYB 2LPRA 2ZU1A 4ZUHA 4GCHG 1KXBA 1GCTC 2BXUH 1C2JA 1A3EH 1ABJH 1P2OA 1EPTB 3E16B 1GHVH 1B0EA 5EQRA 2DUCA 2OINA 2V0BA 1ZPZA 4Y8ZA 2VWLA 2BD3A 3P95A 2J4IA 4AFZA 2ZFQH 5CHAB 1C1QA 4B71A 3RM0H 1RTLA 2ZIQH 3ZZ9A 1Y5AT 4Q7ZA 1BDAA 1DICA 1O2MA 1KY9A 3PM3A 1K1NA 4K60A 1TBRH 1V6DA 1O2YA 1ZHRA 3RU4T 4HGCA 1ELGA 2FMJA 3MMGA 1H4WA 3EAJA 3A87A 2ZC9H 2GCHF 3TJVA 4Q80A 1MCTA 3VB4A 2G5VA 2NU2E 3Q3KA 2G55A 1JIMA 4DOQA 1C2GA 2O8MA 3KF2A 4NGAH 3HKIB 2Q6FA 4BAMB 3TGKE 1JWTA 1RRKA 3HGPA 4GSOA 4KKDA 3GCTG 1TNGA 4ISIH 5DJ7A 2AFQB 1C2FA 2XCFA 3ZZ7A 5TJXA 3UFAA 1AHTH 1ZSJA 4ISHH 2ZDNA 3VXFH 1GI7B 1F7ZA 1SFIA 1XVOA 1HFDA 1K2I1 4WJG2 3SU0A 1OP0A 1P01A 1FY4A 4ZHMU 3A89A 1SLUB 2THFB 4GCHF 2PKAB 1QA7A 2TPIZ 1VITG 5GDSH 1WQVH 1C5QA 3M36A 2W5EA 5JBAS 3T28A 2PKSC 2G00A 3A7WA 3VGCB 2OBQA 3GOVB 3RXHA 4NSVA 1N6YA 3E0NB 1YM0A 1D3TB 2JH0D 3ATWA 1PYTD 1LPKB 1W11U 3K6ZA 2Z94A 3SI3H 1BUIA 4YZUA 3U9AH 1HXEH 1AE8H 4K5ZA 2B8OH 1ESBA 1YKTA 3ZVCA 1QBVH 1V2MT 1EZXC 1OKXA 3P8GA 1P3CA 1F0UA 1PQ7A 3SGAE 1GHXH 2R2MB 1CHOG 1O39A 3Q77A 1DANH 3D65E 3RXSA 2A1DB 2WPIS 2PV9B 1GMHG 3UOUA 1QB1A 2G8TA 3GCTF 1ZR0A 1NU9A 3QTVH 1K1MA 1AWFH 1O5EH 2A45B 3NCLA 4SGBE 3MU8A 2ZU2A 3GISB 1PQAA 3KGPA 1OP8A 4MG3A 4THNH 1Q3XA 1O37A 2ZGBH 5AFZH 2FYQA 1EP6A 4FUDA 1BZXE 4BANB 1VJ9U 1O5FH 3BV9B 3H7OA 1C4Y2 1PQ5A 2PKSB 3BF6H 1CT2E 2ZGXH 2VIDA 1O3BA 5L2ZH 1OSSA 2BQ7B 1VITF 2W7UA 1Y3UA 3RU4D 3S9AA 1MCVA 1Z6EA 1DUAA 1IQEA 3KHVA 2BHGA 5E0JA 1ARCA 1TRYA 1W13U 2WYJA 2BY8X 2CHAB 1GJ5H 4FU9A 1SLVB 1INCA 2WYGA 3A83A 1BIOA 3OU0A 1OP2A 1ZGIA 1V2WT 4INHA 3ODFA 1NC6A 3A80A 2VIOA 2CF9H 1O2KA 1IQMA 3OX7U 2JETC 4X1PU 1O3CA 1CHOF 3SW2B 4Q7YA 1O2VA 3GY6A 5F8TA 3ZZ4A 4NIVA 2VGCC 1GMHF 3LJJA 2A5AA 1KXDA 3UWJH 1ZRBA 3QTOH 5L30H 2VVUA 3FZDA 3M7TA 2AYWA 1AKSA 1S5SA 3A8BA 1C9TA 1DPOA 1MH0A 2QIQA 3KEEA 1J16A 5E2PA 4XBBA 2SGQE 8LPRA 5HM2A 1Y3YA 1U6QA 1GI9B 1QFKH 3E3TA 3ZZCA 1EKBB 3LGIA 1GBKA 5E2OA 1GJ6A 2SGFE 1WQSA 1S84A 1ACBE 5A0AE 1ARBA 2XW9A 2QF3A 1KSNA 1C5MD 5E0HA 3LKWA 1MTVA 1MU8B 2ZNKH 3ZVBA 4D7FA 2K1QA 1UVOA 4K69A 1GDUA 1EJAA 3MU0A 5IYTA 2JETB 4ISOA 1D6RA 5FXLA 3LOXA 1C1NA 2ZCHP 4A92A 1DUEA 3UUZA 3GCHC 1DWCH 4OS4A 4ZHLU 2TIOA 1P3EA 2XWBI 3RXKA 4WWYA 2VGCB 4YESB 1GJBB 1LPGB 2ODYB 5IDKA 1HBTH 1JIRA 4X6MA 4MPVA 3GCOA 1P2QA 4RSPA 3Q3XA 4CRGA 2ANKH 3M3TA 1EB2A 3ZVFA 1S6HA 1WV7H 4LK4A 3E90B 1BRUP 4WY3A 3F9GA 7ESTE 2H5CA 6GCHG 1BJUA 1J8AA 1G37A 2O8WA 1EXFA 1W10U 4BTUB 2AIQA 5DO4H 1GI1A 2VWOA 3VFEA 3OYPA 1HAYB 1LQDB 2BDCA 1GBHA 3RXRA 4JZIA 1EOJA 5EG4A 3TNTA 2AMPA 3NXPA 1FN6A 3GDVA 2FPZA 4KELA 1C2HA 3TK6A 1NS3A 2Y6TA 1O30A 3TNSA 2UUKB 4NFEA 2EC9H 1UK4A 2ZGHA 1RTFB 3IG6B 2WPJS 3K9XB 1DXPA 4I8JA 1ANEA 1GPZA 1O2UA 1MQ6A 1SQOA 2C93B 4B2BA 1O3IA 1K28D 5C67A 3P6ZB 1EAXA 4FUFA 3HGNA 1BMLA 2GTBA 3PB1E 5CMXH 4DURA 4LOYH 2P93A 2FI4E 2W26A 4K8YA 2C90B 2OD3B 3S69A 1ELEE 1MKWH 2HNTF 2A5KA 2WV4A 4K1EA 4AYVB 4ABFA 2XRCA 1BTHH 3RM2H 3Q3YA 1QY6A 4RKJB 4LZ4B 1HAIH 1HIAA 1T8OA 4U2WA 5I46H 3AAVA 3ELAH 4CBOA 1TGNA 2SGAA 2PTCE 3T5FH 2H5DA 2QXIA 1ORFA 5JDUB 6GCHF 5A8XA 4I31A 1YPLH 2OCVB 5JB9S 3LONA 2ZCKP 2XC4A 3DFJA 2J92A 1FQ3A 1GBMA 4TPYA 2ZQ1A 2TRMA 5LPEA 3A8AA 5BPEA 4AFSA 5BRRE 2Q1JA 1K1PA 1BTUA 2CMYA 1BBRK 1QRZA 1MKXH 1BMAA 3A7ZA 1GMCG 3K65B 1HGTH 1DWBH 1C2EA 4BNRA 1GJ4H 2BY7X 1GJ7B 5A0BA 3P8OA 1NRPH 1YCPH 1THPB 5EW2H 1TX8A 1C5XB 4HTCH 4GAWA 4X6OA 3FP8E 4INKA 1F5LA 1J15A 4XE4A 4I8KA 4BXWA 2FODA 2AS9A 1Z1JA 3P8NA 5ESBA 4A6LA 1HAHH 3ZZ3A 3RXFA 3S7HB 4JZEH 4DIHH 5K7RA 4WMEA 3TGJE 4DT7B 2O8TA 1G9IE 2FWWA 3ZZBA 1MTNC 4BAOB 1F0RA 2C4FH 3SU4A 2OTVA 2SGPE 2A4OA 4K3JA 2IPHA 1GVLA 2Z9IA 3K2UA 3UY9A 5FBIA 1ETRH 1IQFA 1C1UH 4AB9A 1YPEH 3UQOA 4AX9H 2NU3E 3GICB 2BZ6H 2FO9A 5EXNA 3SQHE 1GHZA 2YNBA 3QK1A 2R3YA 2YOLA 5PTPA 1NTPA 4BTIB 1FV9A 1C4U2 1OPHB 4J2YB 4CR9A 1SPJA 4MPWA 1Z1IA 2QV1A 2J2UA 3SV8A 2J95A 3M35A 1O35A 2ZO3H 1T8LA 4Y11E 1VCPA 1F92A 2ZFRH 3F9EA 4E7NA 1W8BH 4FUEA 1GHAG 4WMFA 1PJPA 1KTTB 2Z6BD 1AFEH 2AGGX 3RXBA 2QN5T 1YLCA 1GBJA 1DWEH 2WUBA 3AW1A 1XUIA 1C5LH 1GI4A 2VU8E 1AO5A 4ABDA 1QR3E 2OUAA 3TJNA 4OS6A 4X2XA 1TMTH 1G36A 2BDYA 3RXGA 4ABHA 2QGRA 1QA0A 1N6XA 1MTNB 1ELAA 2B5TB 1DXWA 2RA3A 4CRFA 2VJ1A 1AU8A 1CBWC 1FXYA 2Y7ZA 1GI2A 3GY3A 2B7DH 2ANMH 4K8BA 1TLDA 1GMDG 2Q6DA 3A8DA 1UK2A 1MAXA 1HUTH 2H9TH 2P16A 1A3BH 5K0HA 1PPZA 4MTBA 1P9UA 2WPHS 3LH3A 1AZZA 1V2LT 3UOPA 3BEIB 1X7AC 1WBGB 1Y3WA 5B6OA 1XXDA 1H8IH 1MQ5A 1C5OH 1OS8A 3BIVH 5E0GA 1HIAB 1FI8A 4H4FA 4I8LA 2XYAA 2DE8A 3KIDU 1GJAB 1C5YB 4IBLH 1C5VA 2AERH 3ZVDA 4FUBA 1GHAF 1ZHPA 3GYLB 1F2SE 5JYIA 2GD4B 1WOFA 1ZMLA 1MD7A 1ZJDA 1N1LA 1CBWB 2QA9E 3PYHA 6ESTA 1XMNB 3RU4E 2ZFFH 2BY6X 5CE1A 2GVFA 5J4SA 4CRAA 3RXLA 4VGCC 1H8DH 2FZZA 1Z71A 3N7OA 1E37B 3S9BA 1BTWA 4O3UA 4YOJA 1LDTT 2ZTXA 5FCKA 2ODQA 3MH7A 3P17H 1EUFA 2QY0B 2XNIA 3HPTB 1YPKH 3L33A 2M5TA 1G3CA 1KTSB 1CSOE 1SBWA 1NT1A 2BM2A 2SFAA 1SGEE 1UTLM 1KXFA 1A2CH 3I78A 3MO3A 4X6NA 1JRSA 4Y76A 4NCYA 1SVPA 3QO6A 1P06A 1GI5A 3O8BA 3F9FA 2HPPH 3SI4H 1BHXB 1TONA 2ZKSA 1SLWB 3A7TA 4A7IB 1TRNA 1QQ4A 1FZZA 5T3HA 3L3TA 1T31A 1HV7A 6CHAC 5EU8A 5GCHG 2ZWLH 2CGAA 4B76A 5FX5A 4DCDA 3ITIA 1E34B 2GGVB 1FNIA 5EOKA 4VGCB 3FANA 5TCCA 1AUJA 1DS2E 3D49H 3Q00A 1O3LA 5C20A 4Z6AH 3ATKA 1OXGA 1QHRB 3PLKA 3BTWE 4FU7A 4X1NU 1O2XA 1CHGA 5LPRA 3DUXH 1C5TA 1O2OA 5LPFA 3MNXA 3AW0A 5DP4A 4FUIA 1Q2WA 2VIWA 3U8TH 1V2TT 2EI6A 2D26C 1TB6H 2BDIA 1WYKA 3RMNH 3QZQA 2XCNA 3QN7A 3UR9A 4D8NA 2VIQA 1TNLA 2P8OC 1ZMJA 3A8CA 5T6GA 1FUJA 2OBOA 1S83A 1RJXB 1O2RA 4Q2KA 1GBFA 1SI5H 3PMHB 4XBDA 4LXBH 3PLBA 4Y0ZE 1OWHA 2ZECA 4RKOB 2ANWA 4U01A 3UPEA 4OS1A 1P12E 1A5GH 2NU1E 4ESTE 3A81A 2GDEH 4IN1A 3MHWU 1K1IA 1TFXA 2JKHA 5FPYA 2Z3CA 1E35B 4E06H 3BG4C 5GCHF 1SGNE 5LH8A 3LDXH 2WPMS 3OY5U 1YPHE 1LPZB 3SJIA 2GP9B 4B74A 1GI0A 1CGIE 1UHBB 2BY9X 1ANDA 4Y79A 1AVXA 1FY1A 3PTBA 3K6YA 1BTYA 4K1TA 1QJ7B 4WXIA 3SHAH 1GCTB 4A1TA 3I29A 1TGTA 1HAZB 3SOSA 1C1OA 2QXGA 1O2TA 1A4WH 1A0HB 1NFYA 1HAXB 4X8VH 1E36B 2BZAA 1PYTC 5DP3A 3PROA 1YLDA 3CENA 2PW8H 2HVXA 4IN2A 2VH0A 1AB9C 2P8OB 4YTAA 1DVAH 1A5HA 3ZVEA 5JBBS 1LHEH 1CU1A 2Y7XA 2H1UA 1BRAA 1TMBH 5FCRA 2XBYA 1FAXA 1KLIH 2FOCA 1EATA 1UCYH 3ZVAA 1UTNA 1NFUA 1EX3A 1GBCA 4NA7A 1LHFH 1O3HA 1GJCB 4YT7H 1Z7KA 2Y5HA 1KLJH 1W3CA 3SU6A 3F6UH 3BG4B 1ANCA 2Y5GA 2F9UA 1WTHD 3ODDA 1GVKB 3SNAA 4YLUA 8ESTE 3TLOA 1QURH 4MNYA 2VIPA 5DGJA 3TITA 1IQNA 1GBEA 3U8RH 2J9NA 1LO6A 2BLWA 1FMGA 1CO7E 2P3FH 1O5BB 3BTHE 1QRWA 1KIGH 4E05H 3TU7H 1RS0A 1AB9B 3RMMH 1C5NH 2PUXB 3TGIE 2FLRH 2VB0A 1MMJN 2FX6A 1XKAC 1GWAA 4TY7A 1PPHE 1BBRE 1RFNA 4ABEA 1ZPBA 2EEKA 1O33A 3U1IB 1GL0E 3P70B 1C4V2 3EA7A 1ESTA 4ZROA 7LPRA 1PFXC 1CA0C 1XUFA 3GYMA 1BOQA 4NWKA 4K1SA 1HPGA 4DY7B 1GDQA 1V2JT 3MTYA 1TPPA 1S85A 4WH8A 5EQSA 4F4OC 3RXUA 1N8OC 3RC4A 1Y8TA 2PSXA 5FBEA 1GBDA 4ZKOU 1BTZA 4Y7AA 2F83A 4B73A 3KN2A 4R0IA 1O2SA 1CGHA 1JBUH 2VINA 3QLPH 2QF0A 3ATIA 4IW4E 5J4QA 4FVBA 4WVPE 1P04A 1C1SA 1L4DA 1HAGE 5C3NA 1GGDC 3LH1A 4LZ1H 1BTPA 2CF8H 1FJSA 5DP8A 1L0ZA 1UVPA 2BQ6B 3VPKA 2PUQH 4OGYA 1O3DA 3IITA 3VB5A 1IAUA 4CRDA 2BX3A 3MYWA 1ELTA 2XBXA 2J38A 3FP7E 3KQBA 1C2LA 2OC7A 3ZYDA 1CA0B 2C8ZB 1B7XB 1GVZA 1ZRKA 2A5IA 4JYUH 1RXPA 2D8WA 3RUOA 3RMOH 2XTTB 1D6WA 3M61U 4CR5A 2GT8A 2ZU4A 2J94A 3E6PH 2BQWB 5E8EH 3BEUA 1QB6A 2ESTE 2NU4E 4NZLA 3M3VA 2JH5D 3SZNA 1DITH 3BTME 1O3NA 1WAYB 4OGXA 1AWHB 1V2OT 1GBLA 4Y71A 1MTUA 1EJNA 4GHTA 4GLYA 4UDWH 1GJ9B 1C1RA 1P57B 4DG4A 3BTKE 2BMGB 1NZQH 3SUGA 5JB8S 1YPHC 1EQ9A 3UR6A 2J34A 3ZVGA 3L6PA 1GGDB 2FX4A 5GPIB 4ABGA 5C1UA 3GY5A 4X2VA 1TA6A 2HWLB 3EQ0H 4XDEA 2ZHWH 4BAQB 4YOIA 3NWUA 5EPNA 1ZMNA 2CJIA 2ODPA 3EDXB 4CHAC 1ZYOA 2GZ7A 2P94A 1BA8B 1V2UT 1H9LB 1LVMA 3UNQA 2TGTA 1FY5A 3PTNA 1DSUA 2UUJB 3SJ8A 4TYDA 4KTUA 1QL8A 4AGKA 1O36A 1SSXA 4IS5A 2LNCA 3HKJB 1TGCA 2PSYA 3RXCA 1ZTJA 4CRBA 1TQ7B 1GHYH 3VEQB 4IMQA 4H42U 3GCHB 1P2KA 4UFGH 1W2KH 4Y6DA 1MBQA 2OLGA 3U8OH 1PPBH 2PGQB 1BITA 2A4GA 3MU4A 4MPUA 5EODA 3O8RA 3MNSA 4DGJA 2FS9A 2ZG0H 1KXEA 4O3TA 3TJUA 5H4IB 1C1PA 2SGEE 2FOHA 3DFLA 4K2YA 1B5GH 4MNXA 2PWXA 2ZP0H 1YPGH 1TPSA 4NIXA 1KLTA 5C2ZA 1UTJA 3DT0H 5A8ZA 3KCGH 3SU1A 4Y0YE 2O8LA 3LIWA 2FP7B 4U30A 2F9VA 1MAYA 2GV6A 1SHYA 3BEFB 1MKWK 2GCTC 2OC0A 2A2XH 4B1TA 3T26A 4FUJA 1QBOA 1MTSA 4XBCA 2P3TB 3SNBA 5EPYA 1Q31A 3SJ9A 3BN9A 1UTKA 3S7KB 1ZHMA 1FY3A 4Y8YA 1XUKA 2ZZUH 5T6FA 1V2NT 2VH6A 4X0WU 1O3PB 1TAWA 2R3UA 2GKVE 1T8MA 2NU0E 1FLEE 1MKXK 2A7JA 1CA8B 2ZDAH 1DE7H 4OS7A 2IOTA 1G30B 1BT7A 4NZQA 4MVNA 1W12U 1YCPK 3RXEA 3M5MA 1C5PA 1K9OE 1QGFA 2BYAX 1J14A 3ATLA 3MWIU 2ZI2H 2PTNA 2YNAA 1QNJA 1GL1A 1J9CH 1NFXA 2ZDMA 2FOAA 3V3MA 1NY22 3PO1C 1S81A 1LMWB 2G51A 1NROH 2ZGJA 1DOJA 2IJOB 4NIWA 2A32A 2ZDVH 1HLTH 1JXPA 1NM6A 2BDAA 1VGCC 2A2QH 3VXEH 1D9IA 1TOCB 3DHKH 2KAIA 2FLBH 2JH6D 1C2IA 1TGBA 1A46H 1PPFE 1SFQB 1GMCF 1EJMA 3AASA 1K1JA 2RDLA 1NU7B 1P2NA 2F91A 3LPRA 4NA8A 1ELBA 1SC8U 8GCHG 1B0FA 2HOBA 5C1YA 5C5NA 4CH2B 1GBBA 3RXDA 4PROA 4WH6A 3MU5A 2PFEA 3LJOA 2UWLA 4M7GA 3RXIA 1D3DB 8KME2 4X8TH 2HPQH 4NIYA 3MH4A 4GPGA 2OQUA 4ZXYH 1OYTH 1DT2A 1O34A 4D76A 3A7VA 1Y3VA 1DFPA 1UVSH 2ASUB 2ZPSA 2ZHDA 3T29A 4D9QA 3QUMP 1WCZA 4Y7BA 1SGFA 1V2RT 3UTUH 1SGYE 2H6MA 4D9RA 3M37A 1AQ7A 3HK6B 4UEHH 2VVVA 4AG2A 2HNTE 3KNXA 3BTEE 5T6DA 3C1KA 1UO6A 1H9IE 1TNIA 1XUHA 4IC5A 4BAHB 3H5CB 2B0FA 1VGCB 3LC3A 1QL9A 1G2MA 3SNDA 2FOEA 5A8YA 3RXQA 4D7GA 1SGTA 1LVYA 1ELVA 2A0QB 5EXLA 1RTKA 1AVGH 3GY4A 4A5TS 1C2DA 3TK5A 4TWWA 1LVOA 1C5UA 5A09A 1O5CB 3R3GB 3GY2A 1UHBA 2V3HH 3GY8A 3M7QA 4ABBA 3BTQE 1J17T 1XKBC 4KP0A 1EZSC 1CT4E 2ZU3A 3NUMA 3MU1A 1DY8A 1H1BA 3SU2A 3A88A 1HAVA 1G3EA 1OWJA 8GCHF 3MH5A 3TJOA 1TPOA 4X1QU 2BLVA 1TBQH 4SGAE 5JBCS 3OTJE 1AD8H 2ZA5A 3BTTE 1G32B 4H6TA 1O3OA 1GJDB 4KGAA 1O3EA 1SGDE 2FIRH 4JZDH 2ZHQH 5SGAE 1V2QT 1BCUH 1OWEA 2ZFSA 1S82A 1FY8E 2ZPQA 1C2MA 1NRSH 2ZCLP 3TH2H 3QDZB 4YT6H 5DP5A 2FEQH 1IQLA 2BD4A 1GMDF 3RXTA 1OYQA 2FESH 3V12A 1EAUA 1IQHA 5DKMA 2UUFB 2FDAA 2C3SA 1SGCA 5FPSA 1O5GH 1DX5M 4JMYA 3C27B 2Z9KA 3SJKA 4DW2U 4QT8C 4AGJA 1O2JA 2F9BH 4ZXXH 4F49A 1HXFH 2GMTC 4ZKSU 1YPMH 2RA0A 4AG1A 1O2NA 1ZOMA 4NA9H 1QBNA 3TIUA 2F9PA 4A1VA 1SMFE 4NG9H 3VB6A 2ZF0H 2ZEBA 4ZKNU 1P2MA 1W7XH 1O38A 1GI8B 2BOHB 3QX5H 1WU1A 1EPTC 4HZHA 2FOGA 2XXLA 2GZ8A 2D1JA 2QC2A 2EA3A 1DM4B 1V2VT 2KAIB 3B8JA 3TH3H 4KTSA 5L6NH 3ZZ6A 1QL7A 2SGDE 3PMAB 4AB8A 1V2PT 4OS5A 3SN8A 2Y80A 1KYNA 3RXPA 3SGQE 3MNBA 3KL6A 4X6PA 1F0TA 2PHBA 5AHGH 3T62A 3RXMA 3RMLH 1AVWA 3G01A 3M7UA 1T32A 4H6SB 1O5DH 1LHCH 3PWCA 3F68H 2GT7A 1ELDE 1AFQC 1P2JA 3UIRA 1M9UA 2WPLS 5ETXA 2GMTB 1BB0B 1FN8A 2A4RA 1EAWA 3WY8A 1UMAH 1KDQB 1FPCH 4U32A 1O2ZA 2BVSH 3ZZDA 3RXOA 3S0NA 1ID5H 3U1JB 4UE7H 5DPAA 1IQGA 1Z8IB 1ZTKA 1Z6JH 1S0QA 4GHQA 4BOHA 6CHAB 1C1VH 4DVAU 2W3IA 1Y3XA 5I25A 2HRVA 1OWIA 3ZV8A 1THSH 3LGUA 2AGIX 1MZAA 2OP9A 3A7YA 5JBTA 2BDGA 3V7TA 4X1RU 1C5ZB 3W95A 2R9PA 3A84A 4Z0KA 3ZZ8A 2BLQA 4JCNA 3H7TA 4I7YH 1O5AB 5GIBA 3MI4A 1FIWA 1ETTH 4GUXA 5G4BA 3VGCC 1VCWA 4JK5A 3SQEE 1TNHA 1OOKB 2UWOA 1UTMA 3T25A 3EA8A 1BMNH 1UK3A 1AGJA 2A31A 2OC8A 1O2WA 4Q7XA 1HAVB 2ZTYA 1TBZH 1A5IA 3CS0A 3Q76A 2FTMA 1AFQB 1K1LA 2FI3E 1O2IA 3BTFE 3W94A 3MOCA 1LKAA 4A1XA 3FAOA 1E38B 2BTCE 4UFDH 5JPMH 3TK9A 5GXPA 1O2GH 1E0FD 5TCAA 1NRQH 2HNTC 1PPGE 2G52A 3SO3A 3URDA 4B2CA 4ABJA 2WUCA 4YO9A 2G81E 1SG8B 4AFQA 1A0JA 3LGYA 1LKBA 3F1SB 7GCHG 1AZ8A 3E1XB 4DJZB 4ISLA 5ABWA 1AI8H 4UONA 3SV2H 1YP9A 2GV7A 1O3AA 4GVUA 4J1YA 1C2KA 2BD5A 3EE0B 1YCPM 1HCGA 3D62A 2C8WB 3A7XA 2BD8A 4CBNA 1PPCE 3AVZA 1ZTLA 5DK1A 1YPJH 2BVXH 1TALA 3O8CA 3TH4H 1UTQA 4WF8A 2ZFPH 2Z3DA 1IHSH 4X2WA 3PMBB 1UCYK 1RIWC 5EGMA 1F5KU 1TIOA 4ISNA 2P59A 2Z3EA 1EB1H 2ZHEH 4YOGA 1TX7A 1SB1H 1EASA 1NPMA 2CHAC 3LGVA 4JYTA 1OWKA 1TX6A 2VWMA 2HLCA 4UFEH 4X8UH 1O3JA 2Y81A 2W3KA 3OY6U 3SNEA 3LGWA 2PLXA 5FPTA 2G4UA 2I6QA 2ZGCA 3GDUA 3PMJA 1FPHH 5EW1H 4B2AA 5HYOA 2FOBA 3ATMA 2FOMB 1GCDA 2VVCA 1SGFG 1AMHA 1C5RA 3BIUH 2RG3A 1P10A 4AORA 2SNWA 4O03A 4MPXA 1S0RA 3RXJA 2ILNA 3OSYA 4MNVA 4ZAEA 1L4ZA 1LHGH 7GCHF 2Y5FA 3ENSB 1HNEE 1QJ1B 3LU9B 1O31A 3BSQA 4KTCA 1DLKB 1NRNH 2ZPRA 1BHXF 4FUGA 4TY6A 5DP6A 2Q6GA 3M5LA 2FS8A 1O2LA 4XSKU 1JOUB 2BY5X 3SORA 3QZRA 1G3BA 4RN6A 1RIWB 3PV4A 1HJ9A 4AOQA 3FP6E 3UNSA 3M3SA 1MUEB 2CXVA 1TPAE 1EZQA 4FUCA 4ZKRU 3RLYH 4XOJA 2QCYA 3JZ1B 1SLXB 1P03A 1W14U 4INLA 3QWCH 4NSYA 1XVMA 1RD3B 1HYLA 1ABIH 1CGJE 3MNCA 4UD9H 3ZV9A 2OXSA 2BD9A 3FZZA 1O3GA 4XFQA 1TNKA 2BVRH 4MNWA 4Y8XA 1Y59T 2Y82A 1ELFA 2BX4A 4CH8B 1GHWH 3EGKH 1HAPH 1RGQA 1O3KA 1BMMH 1A0LA 1GJ8B 1EAIA 1P11E 3RC5A 5GWZA 4ZH8A 1C9PA 4FVDA 4JZ1A 3U98H 3VB3A 1Z8GA 4CREA 1GI3A 1O3FA 2VNTA 1SGRE 1F0SA 3DA9B 1IQJA 5DP7A 1N8OB 5FX6A 1C1TA 4JZFH 1G3DA 1CT0E 3STIA 1SOZA 2FTLE 1YC0A 3KQEA 1K21H 4FUHA 1H9HE 2XC5A 3A86A 3B23B 2R0LA 1AN1E 2ANYA 1SQAA 1P0SH 1UTPA 2RCEA 1O2QA 3NKKA 1MU6B 1P02A 1GBTA 4ABIA 1DSTA 1KXCA 1LTOA 3BTGE 1O2PA 1TABE 1NRRH 1SOTA 1L2EA 4I8HA 3JZ2B 1O0DH 1C1MA 1HB0B 2DE9A 3NK8A 3GCNA 3RLWH 2C8XB 3KQCA 3IWMA 5HM9A 1VCQA 2CN0H 2Z9JA 1T4VH 1L1JA 3M5OA 4YLQH 4IGDA 1L1GA 3UREA 3DD2H 3ZZAA 2WPKS 1A61H 1NFWA 2UUYA 1XXFA 2ZTZA 1V3XA 1UJ1A 1WTGH 3T27A 1QIXB 1DDJA 1ZJKA 2A7CA 2EI8A 2HALA 1W7GH 2R0KA 1G2LA 3NPSA 1TA2A 2O9QA 4YM9A 2ALPA 1ZSKA 1FAKH 1IQKA 1XX9A 2PGBB 1HDTH 3P8FA 2TGAA 3QGNB 1EOLA 2V6NA 1GHBG 3MO6A 4B75A 3UQVA 1TNJA 4CHAB 1ANBA 4NFFA 1C5SA 1O32A 2F9NA 4MQAA 1V2KT 3RXVA 3QGJA 4X2YA 1BBRH 3LGTA 3SBKA 1ZSLA 1P2IA 1AUTC 1ETSH 4JYVH 4ZMAH 2G5NA 1FONA 1P05A 5C1XA 4E7RG 1UTOA 4CRCA 1MBMA 1AY6H 2QAAA 3E0PB 2ZDKA 2BDHA 1BJVA 2V35A 3STJA 1QJ6B 1A7SA 1HAOH 5LGOA 2FYRA 1THRH 5F8ZA 3LC5A 1F5RA 1TMUH 2AIPA 1P8VC 2XC0A 2Z9GA 1AKSB 3RC6A 3NZIA 5F6MA 2XBVA 4HFPB 4AFUA 1Y5UT 1GG6C 2AMDA 3V0XA 2D2DA 1ZLRA 3BTDE 1HJAC 2TBSA 1BRBE 2ZU5A 1ELCA 1TQ0B 2BB4A 1Z8JB 3HK3B 2STBE 4BTTB 2OQ5A 4FU8A 1VR1H 1SHHB 2A7HA 1GHBF 2GCTB 1IHTH 1DWDH 1W0ZU 1PQ8A 7KMEH 4DIIH 2PR3A 2GZ9A 1P9SA 2QXHA 1SGQE 3MH6A 4MLFB 5AVDA 1MZDA 1P09A 2BOKA 2FM2A 2ZQ2A 5F03A 1QB9A 1BRCE 4X8SH 5HXFA 1EZUC 3RDZA 2W7SA 5EXMA 3SV9A 1AIXH 1BQYA 2XBWA 4WXVA 1GBIA 1GI6A 2STAE 1T8NA 4I33A 2ZFTA 4I8GA 1FIZA 4OS2A 1KXAA 2P3UB 1D4PB 1ESAA 3SU5A 1IQIA 2BD7A 1XUGA 1TGSZ 1K22H 4ABAA 2Z9LA 3SUDA 2IN2A 2UWPA 3SUEA 1WSSH 2V3OH 5EQQA 1L1NA 4AN7A 2ZHFH 1GG6B 2HGTH 1SQTA 3SU3A 1YBWA 1ZPCA 1HJAB 2Z7FE 3CS7A 2B9LA 2BLOA 1YYY1 2ZDLA 1A1RA 5FHTA 1T4UH 1W0YH 1C1WH 4JK6A 3ZYEA 5HGGA 2SNVA
chains in the Genus database with same CATH superfamily
1KDQA 3TPIZ 3EA9A 3PO1B 1QQUA 3GY7A 3DSOA 3BG8A 3SHCH 3D23A 2F9OA 5FL7D 3DCLA 1EPTA 1XUJA 2WV5A 1VJAU 2AMQA 1SR5C 1LQEA 1YF4A 2BD2A 5AF9H 5AFYH 1O3MA 1SGIB 1BTXA 1YGCH 1TE0A 4R8TB 3SV6A 3URCA 1NESE 2PP6A 9ESTA 2BXTH 2I6SA 2WZQA 3F9HA 3U69H 1HJ8A 1NO9H 2L6OA 3SV7A 1EP5A 3O8DA 1JMOH 3RP2A 3A82A 1UVUH 4IC6A 3HATH 1VITH 2NWNA 1LHDH 2AH4X 1V2ST 3MO9A 1WUNH 5FAHA 2FXRA 3LT3A 4Y10E 3SNCA 2BDBA 1AE5A 4O9VA 3MFJA 2AEIH 2JJ1D 2VIVA 5GJ4B 5KGOA 3V13A 4TPIZ 4AZ2B 3I77A 3FVFB 4O97A 1UCYE 3EYDA 2IPQX 1OWDA 1O2HA 1DY9A 5C5OA 2H2ZA 3FFGA 5A0CA 2F3CE 4ZHAA 1ZGVA 1FDPA 1UVTH 2ULLA 1ZZZA 4RI0A 4FXGH 3KQDA 4IMZA 3TVJB 4I32A 2O8UA 1PPEE 3S9CA 3E91A 3GDSA 4HI3A 1CE5A 1LVBA 1GBAA 2TGDA 1JRTA 4ASHA 1TOMH 3CP7A 3SJOA 1SGPE 1K1OA 2PKAA 3E8LA 1TRMA 2CV3A 1T7CA 1XM1A 3UNRA 1TWXB 4BXSA 1QRXA 1S6FA 2P95A 1NN6A 2GDDA 2AGEX 2QYIA 2G4TA 3ESTA 3SGBE 2A4QA 5L2YH 3M5NA 2F4LA 2FI5E 2VWNA 3SUFA 4NWLA 4WMDA 4OM9A 4X1SU 4UFFH 3B9FH 5KECA 2GX4A 1OX1A 3UWIA 5DP9A 3A85A 2HVYB 1YWUA 6LPRA 5A2MH 2QXJA 5CHAC 1QTFA 3T2NA 4TWYA 1CVWH 3AAUA 1VZQH 5HMAA 2FOFA 3VB7A 2GCHG 2XWAA 3CNRA 2H9EH 1CQQA 2TGPZ 2J97A 3RXAA 1QCPA 1Y5BT 3R0FA 5ESTE 1SL3A 5DG6A 1LCYA 4BAKB 3P92A 1C5WB 1D3PB 2QF4A 2H9HA 1Z8RA 9LPRA 1D3QB 1MTWA 1MD8A 4ZCNA 1IOEA 2C8YB 2R2WU 3PWBA 3PLPA 2EI7A 3ZZ5A 1DLEA 2WINI 5F8XA 2OC1A 1GDNA 1TYNA 2ALVA 1HRTH 4MDSA 4AYYB 2LPRA 2ZU1A 4ZUHA 4GCHG 1KXBA 1GCTC 2BXUH 1C2JA 1A3EH 1ABJH 1P2OA 1EPTB 2KX4A 1GHVH 1B0EA 3E16B 5EQRA 1H8HD 2DUCA 2OINA 2V0BA 1ZPZA 4Y8ZA 2VWLA 2BD3A 3P95A 2J4IA 4AFZA 2ZFQH 5CHAB 1C1QA 4B71A 3RM0H 1RTLA 2ZIQH 3ZZ9A 1Y5AT 4Q7ZA 1BDAA 1DICA 1O2MA 1KY9A 3PM3A 1K1NA 4K60A 1TBRH 1V6DA 1O2YA 1ZHRA 3RU4T 4HGCA 1ELGA 2FMJA 3MMGA 1H4WA 3AK5A 3DSGA 3EAJA 3A87A 2ZC9H 2GCHF 3TJVA 4Q80A 1MCTA 3VB4A 2G5VA 2NU2E 3Q3KA 2G55A 1JIMA 4DOQA 1C2GA 1NBMD 2O8MA 3KF2A 4NGAH 3HKIB 2Q6FA 3PV2A 4BAMB 1JWTA 1RRKA 3HGPA 3TGKE 4GSOA 4KKDA 3GCTG 1TNGA 4ISIH 5DJ7A 2AFQB 1C2FA 2XCFA 3ZZ7A 5TJXA 3UFAA 1AHTH 1ZSJA 3VG8A 4ISHH 2ZDNA 3VXFH 1GI7B 1F7ZA 1SFIA 1XVOA 1HFDA 1K2I1 4WJG2 3SU0A 1OP0A 1P01A 1FY4A 4ZHMU 3A89A 1SLUB 2THFB 4GCHF 2PKAB 1QA7A 2TPIZ 1VITG 5GDSH 1WQVH 1C5QA 3M36A 2W5EA 5JBAS 2CK3D 3T28A 2PKSC 2G00A 3A7WA 3VGCB 2OBQA 5IK2D 3GOVB 3RXHA 4NSVA 1N6YA 3E0NB 1YM0A 1D3TB 2JH0D 3ATWA 1PYTD 1LPKB 1W11U 3K6ZA 2Z94A 3SI3H 1BUIA 4YZUA 3U9AH 1HXEH 1AE8H 4K5ZA 2B8OH 1ESBA 1YKTA 3ZVCA 1QBVH 1V2MT 1EZXC 1OKXA 3P8GA 1P3CA 1F0UA 1PQ7A 3SGAE 1GHXH 2R2MB 2J98A 1CHOG 1O39A 3Q77A 1DANH 3D65E 3RXSA 2A1DB 2WPIS 2PV9B 1GMHG 3UOUA 1QB1A 2G8TA 3GCTF 1ZR0A 1NU9A 3QTVH 1K1MA 1AWFH 1O5EH 2A45B 3NCLA 4SGBE 3MU8A 2ZU2A 3GISB 1PQAA 3KGPA 1OP8A 4MG3A 4THNH 2VBCA 1Q3XA 1O37A 2ZGBH 5AFZH 2FYQA 1EP6A 4FUDA 1BZXE 4BANB 1VJ9U 1O5FH 3BV9B 3H7OA 1C4Y2 1OHHD 1PQ5A 2PKSB 3BF6H 1CT2E 2ZGXH 2VIDA 1O3BA 5L2ZH 1OSSA 2BQ7B 1VITF 2W7UA 1Y3UA 3RU4D 3S9AA 1MCVA 1Z6EA 1DUAA 3W1EA 1IQEA 3F2HA 3KHVA 2BHGA 5E0JA 1ARCA 1TRYA 1W13U 2WYJA 2BY8X 2CHAB 1GJ5H 2KFWA 4FU9A 1SLVB 1INCA 2WYGA 3A83A 1BIOA 5C17A 3OU0A 1OP2A 1ZGIA 1V2WT 4INHA 3ODFA 1NC6A 3A80A 4TSFD 2VIOA 1UW7A 2CF9H 1O2KA 1IQMA 3OX7U 2JETC 4X1PU 1O3CA 1CHOF 1COWD 3SW2B 4Q7YA 1O2VA 3GY6A 5F8TA 3ZZ4A 4NIVA 2F43B 2VGCC 1GMHF 3LJJA 2A5AA 1KXDA 3UWJH 1ZRBA 3QTOH 5L30H 2VVUA 3FZDA 3M7TA 2AYWA 1AKSA 1S5SA 3A8BA 1C9TA 1DPOA 1MH0A 2QIQA 3KEEA 1J16A 5E2PA 4XBBA 2SGQE 8LPRA 5HM2A 1Y3YA 1U6QA 1GI9B 1QFKH 3E3TA 3ZZCA 1EKBB 2WPDD 3LGIA 1GBKA 4XD7D 5E2OA 1GJ6A 4RT1A 2SGFE 1WQSA 1S84A 1ACBE 5A0AE 1ARBA 2XW9A 2QF3A 1KSNA 1C5MD 5E0HA 3LKWA 1MTVA 1MU8B 2ZNKH 3ZVBA 4D7FA 2K1QA 1UVOA 4K69A 1GDUA 1EJAA 3MU0A 5IYTA 2JETB 4ISOA 1D6RA 5FXLA 3LOXA 1C1NA 2ZCHP 4A92A 1DUEA 3UUZA 3GCHC 1DWCH 4OS4A 4ZHLU 2TIOA 1P3EA 2XWBI 3RXKA 4WWYA 2VGCB 3KYFA 4YESB 1GJBB 1LPGB 2ODYB 5IDKA 1HBTH 1JIRA 4X6MA 4MPVA 3GCOA 1P2QA 4RSPA 1FX0B 3Q3XA 4CRGA 2ANKH 3M3TA 1EB2A 3ZVFA 1S6HA 1WV7H 4LK4A 3E90B 1BRUP 4WY3A 3F9GA 7ESTE 2H5CA 6GCHG 1BJUA 1J8AA 2J98B 1G37A 2O8WA 1EXFA 1W10U 4BTUB 2AIQA 5DO4H 1GI1A 2VWOA 3VFEA 3OYPA 1HAYB 1LQDB 2BDCA 1GBHA 3RXRA 4JZIA 1EOJA 5EG4A 3TNTA 2AMPA 3NXPA 1FN6A 3GDVA 2FPZA 4KELA 1C2HA 4DT4A 3TK6A 3KYGA 1NS3A 4RT0A 2Y6TA 1O30A 2W6JD 3TNSA 2UUKB 4NFEA 2EC9H 1UK4A 2ZGHA 1RTFB 3IG6B 2WPJS 3K9XB 1DXPA 4I8JA 1ANEA 1GPZA 1O2UA 1MQ6A 1SQOA 2C93B 4B2BA 1O3IA 2WV9A 1K28D 5C67A 4FOUC 1QZ8A 3P6ZB 3FKSD 4AC9A 1EAXA 4FUFA 3HGNA 1BMLA 2GTBA 3PB1E 5CMXH 4DURA 4LOYH 2P93A 2FI4E 2W26A 4K8YA 3WWBA 2C90B 2OD3B 3S69A 1ELEE 1MKWH 4P00A 2HNTF 2A5KA 2WV4A 4K1EA 4AYVB 4ABFA 2XRCA 1BTHH 3RM2H 3Q3YA 1QY6A 4RKJB 4LZ4B 1HAIH 1HIAA 1T8OA 4U2WA 5I46H 3AAVA 3ELAH 4CBOA 1TGNA 2SGAA 2PTCE 3T5FH 2H5DA 2QXIA 1ORFA 5JDUB 6GCHF 5A8XA 4I31A 1YPLH 2OCVB 5B6LA 5JB9S 3LONA 2ZCKP 2XC4A 3DFJA 2J92A 1FQ3A 1GBMA 4TPYA 2ZQ1A 2TRMA 5LPEA 3A8AA 2YMSB 5BPEA 4AFSA 5BRRE 2Q1JA 1K1PA 1BTUA 2CMYA 1BBRK 1QRZA 1MKXH 1BMAA 3A7ZA 1GMCG 3K65B 1HGTH 1DWBH 1C2EA 4BNRA 1GJ4H 3F0OA 2BY7X 1GJ7B 5A0BA 1VKYA 3P8OA 1NRPH 1YCPH 2QF5A 2KCYA 1THPB 5EW2H 1TX8A 2WHXA 1C5XB 1YY3A 4HTCH 4GAWA 4X6OA 3FP8E 4INKA 1F5LA 1J15A 4XE4A 4I8KA 4BXWA 2FODA 2AS9A 1SQRA 1Z1JA 3P8NA 5ESBA 4A6LA 1HAHH 4F55A 3ZZ3A 3RXFA 3S7HB 4JZEH 4DIHH 5K7RA 4WMEA 3TGJE 4DT7B 2O8TA 1G9IE 2FWWA 3ZZBA 1MTNC 4BAOB 1F0RA 2C4FH 3SU4A 5C0UA 2OTVA 2SGPE 2A4OA 4K3JA 2IPHA 2RFKC 1GVLA 2Z9IA 3K2UA 3UY9A 5FBIA 1ETRH 1IQFA 1C1UH 4AB9A 1YPEH 3UQOA 4AX9H 4Q63A 2NU3E 3GICB 2BZ6H 2FO9A 5EXNA 3SQHE 1GHZA 2YNBA 3QK1A 2R3YA 2YOLA 5PTPA 1NTPA 4BTIB 1FV9A 1C4U2 1NBME 1OPHB 4J2YB 2GJGA 4CR9A 1SPJA 4MPWA 1Z1IA 1E1RD 1KMHB 2QV1A 2J2UA 3SV8A 2J95A 3M35A 1O35A 2ZO3H 1T8LA 4Y11E 1VCPA 1F92A 2ZFRH 3F9EA 4E7NA 1W8BH 4FUEA 1GHAG 4WMFA 1PJPA 1KTTB 2Z6BD 4Z1MD 1AFEH 2AGGX 3RXBA 2QN5T 1YLCA 1GBJA 1DWEH 2WUBA 3AW1A 1XUIA 1C5LH 1GI4A 2VU8E 1AO5A 4ABDA 1QR3E 1W0KD 2OUAA 3TJNA 4OS6A 4X2XA 1TMTH 1G36A 2BDYA 3RXGA 4ABHA 2QGRA 1QA0A 1N6XA 1MTNB 1ELAA 2B5TB 1DXWA 2RA3A 4CRFA 2VJ1A 1AU8A 1CBWC 1FXYA 2Y7ZA 1GI2A 3GY3A 2B7DH 2ANMH 4K8BA 1TLDA 1GMDG 2Q6DA 3A8DA 1UK2A 3OE7D 1MAXA 1HUTH 4ASUD 2H9TH 2P16A 1A3BH 5K0HA 1PPZA 4MTBA 1P9UA 2WPHS 3LH3A 1AZZA 1V2LT 3UOPA 3BEIB 1X7AC 1WBGB 1Y3WA 5B6OA 1XXDA 1H8IH 1MQ5A 1C5OH 1OS8A 3BIVH 5E0GA 1HIAB 1FI8A 4H4FA 4I8LA 2XYAA 2DE8A 3KIDU 1GJAB 1C5YB 4IBLH 1C5VA 2AERH 3ZVDA 4FUBA 1GHAF 1ZHPA 1W0JD 3GYLB 3U28C 1F2SE 5CHBA 5JYIA 2GD4B 1WOFA 3DSPA 1H8ED 1ZMLA 1MD7A 1ZJDA 1N1LA 1CBWB 2QA9E 3PYHA 3WWFA 6ESTA 1XMNB 3RU4E 2ZFFH 2BY6X 5CE1A 2GVFA 5J4SA 4CRAA 3RXLA 4VGCC 1H8DH 2FZZA 1Z71A 3N7OA 1E37B 3S9BA 1BTWA 4O3UA 4YOJA 1LDTT 2ZTXA 1S6LA 5FCKA 2ODQA 3MH7A 3P17H 1EUFA 2KCAA 2QY0B 2XNIA 1YPKH 3HPTB 3L33A 2M5TA 1G3CA 1KTSB 1CSOE 1SBWA 1NT1A 2BM2A 2SFAA 1SGEE 1UTLM 1KXFA 1A2CH 3I78A 3MO3A 4X6NA 1JRSA 4Y76A 4NCYA 1SVPA 1E1QD 3QO6A 1P06A 1GI5A 3O8BA 3F9FA 2HPPH 3SI4H 1BHXB 1TONA 2ZKSA 1SLWB 2XOKD 3A7TA 4A7IB 1TRNA 1QQ4A 1FZZA 5T3HA 3L3TA 1T31A 1HV7A 6CHAC 3SYJA 5EU8A 5GCHG 2ZWLH 2CGAA 4B76A 5FX5A 4DCDA 3ITIA 1E34B 2GGVB 1FNIA 5EOKA 4VGCB 3FANA 5TCCA 1AUJA 1DS2E 3D49H 3Q00A 1O3LA 5C20A 4Z6AH 3ATKA 1OXGA 1QHRB 3PLKA 3BTWE 4ACAA 4FU7A 4X1NU 1O2XA 1CHGA 5LPRA 3DUXH 1C5TA 1O2OA 5LPFA 3MNXA 3AW0A 5DP4A 4FUIA 1Q2WA 2VIWA 3U8TH 1V2TT 2EI6A 5T1VA 2D26C 1TB6H 2BDIA 1WYKA 3RMNH 3QZQA 2XCNA 3QN7A 3UR9A 4D8NA 2VIQA 1TNLA 2P8OC 1ZMJA 3A8CA 5T6GA 1FUJA 2OBOA 1S83A 1RJXB 1O2RA 4Q2KA 3N7DA 4YXWD 1GBFA 1SI5H 3PMHB 4Q4LA 4XBDA 4LXBH 3PLBA 4Y0ZE 1OWHA 2ZECA 4RKOB 2ANWA 4U01A 3UPEA 4OS1A 1P12E 1A5GH 2NU1E 4ESTE 3A81A 2GDEH 4IN1A 3MHWU 1K1IA 1TFXA 4F48B 2JKHA 5FPYA 2Z3CA 1E35B 4E06H 3BG4C 5GCHF 1SGNE 5LH8A 3EE7A 3LDXH 2WPMS 3OY5U 1YPHE 1LPZB 3SJIA 2GP9B 4B74A 1GI0A 1CGIE 1UHBB 2BY9X 1ANDA 4Y79A 1AVXA 1FY1A 3PRDA 3K6YA 3PTBA 1BTYA 4K1TA 1QJ7B 4WXIA 3SHAH 1GCTB 4A1TA 3I29A 1TGTA 1HAZB 3SOSA 1C1OA 2QXGA 1O2TA 1A4WH 1A0HB 1NFYA 1HAXB 4X8VH 1E36B 2BZAA 1PYTC 5DP3A 3PROA 1YLDA 3CENA 2PW8H 2HVXA 4IN2A 4TT3D 2VH0A 1AB9C 2P8OB 4YTAA 1DVAH 1A5HA 3ZVEA 5JBBS 1LHEH 1CU1A 2Y7XA 2H1UA 1BRAA 1TMBH 5FCRA 2XBYA 1FAXA 1KLIH 2FOCA 3NRLA 1EATA 1UCYH 3ZVAA 1UTNA 1NFUA 1EX3A 1GBCA 4NA7A 1LHFH 1O3HA 1GJCB 4YT7H 1Z7KA 2Y5HA 1WDIA 1KLJH 1W3CA 3SU6A 3F6UH 3BG4B 1ANCA 2Y5GA 2F9UA 1WTHD 3ODDA 1GVKB 3SNAA 4YLUA 8ESTE 3TLOA 1QURH 4MNYA 2VIPA 5DGJA 3TITA 1IQNA 1GBEA 3U8RH 3OEED 2J9NA 1LO6A 2BLWA 1FMGA 1CO7E 2P3FH 1O5BB 3BTHE 1QRWA 1KIGH 4E05H 3TU7H 1RS0A 1AB9B 3RMMH 1C5NH 2PUXB 3TGIE 1EFRD 2FLRH 2VB0A 1MMJN 3GS9A 2FX6A 1XKAC 1GWAA 4TY7A 1PPHE 1BBRE 1RFNA 4ABEA 1ZPBA 5KEDA 2EEKA 1O33A 3U1IB 1GL0E 3P70B 1C4V2 3EA7A 1ESTA 4ZROA 7LPRA 1PFXC 1CA0C 1XUFA 3GYMA 1BOQA 4NWKA 4K1SA 1HPGA 4DY7B 1BMFD 1GDQA 1V2JT 3MTYA 1TPPA 1S85A 4WH8A 5EQSA 4F4OC 3RXUA 1N8OC 3H09A 3RC4A 1Y8TA 2PSXA 5FBEA 1GBDA 4ZKOU 1BTZA 4Y7AA 2F83A 4B73A 3KN2A 4R0IA 1O2SA 1CGHA 1JBUH 2VINA 3QLPH 2QF0A 2K0QA 3ATIA 4IW4E 5J4QA 4FVBA 4WVPE 1P04A 1C1SA 1L4DA 1HAGE 5C3NA 1GGDC 3LH1A 4LZ1H 1BTPA 2CF8H 1FJSA 5DP8A 1L0ZA 1UVPA 3SZEA 2BQ6B 3VPKA 2PUQH 4OGYA 1O3DA 3IITA 3VB5A 1IAUA 4CRDA 2BX3A 3MYWA 1ELTA 2XBXA 2J38A 3FP7E 3KQBA 2JDID 1C2LA 2OC7A 3ZYDA 3UB0A 1CA0B 2C8ZB 1B7XB 1GVZA 1ZRKA 2A5IA 4JYUH 1RXPA 2D8WA 3RUOA 3RMOH 2XTTB 1D6WA 3M61U 4CR5A 2GT8A 2ZU4A 5HKKD 2J94A 3E6PH 2BQWB 5E8EH 3BEUA 3WW7A 1QB6A 2ESTE 2NU4E 4NZLA 3M3VA 2JH5D 3SZNA 1DITH 3BTME 2AHME 1O3NA 1WAYB 4OGXA 1AWHB 1V2OT 1GBLA 4Y71A 3OTPA 1MTUA 1EJNA 4GHTA 4GLYA 4UDWH 1GJ9B 1C1RA 2EY4C 1P57B 4DG4A 3BTKE 2BMGB 1NZQH 3SUGA 5JB8S 1YPHC 1EQ9A 3UR6A 2J34A 3ZVGA 2LELA 3L6PA 1GGDB 2FX4A 5GPIB 4ABGA 5C1UA 3GY5A 4X2VA 1TA6A 2HWLB 3EQ0H 4XDEA 2ZHWH 4BAQB 4YOIA 3NWUA 5EPNA 2IJD1 1ZMNA 2CJIA 2ODPA 3EDXB 4CHAC 1ZYOA 2GZ7A 2P94A 1BA8B 1V2UT 1H9LB 1LVMA 3UNQA 2TGTA 1FY5A 3PTNA 1DSUA 2UUJB 3SJ8A 4TYDA 4KTUA 1QL8A 4AGKA 1O36A 1SSXA 4IS5A 2LNCA 3HKJB 1TGCA 2PSYA 3RXCA 1ZTJA 4CRBA 1TQ7B 1GHYH 3VEQB 4IMQA 4H42U 3GCHB 1P2KA 4UFGH 1W2KH 4Y6DA 1MBQA 2OLGA 3U8OH 1PPBH 2PGQB 1BITA 2A4GA 3MU4A 4MPUA 5EODA 3O8RA 3MNSA 4DGJA 2FS9A 2ZG0H 3OEHD 1KXEA 4O3TA 4XRNA 3TJUA 5H4IB 1C1PA 2SGEE 2FOHA 3DFLA 4K2YA 1B5GH 4MNXA 2YMSD 2PWXA 2ZP0H 1YPGH 1TPSA 4NIXA 1KLTA 5C2ZA 1UTJA 3DT0H 5A8ZA 3KCGH 3PRBA 3SU1A 4Y0YE 2O8LA 1SKYE 3LIWA 2FP7B 4U30A 2F9VA 1MAYA 2GV6A 1SHYA 3BEFB 1MKWK 2GCTC 2OC0A 2A2XH 4B1TA 3T26A 5CDFE 4FUJA 1QBOA 1MTSA 4XBCA 4B6FA 2P3TB 3SNBA 5EPYA 1Q31A 3SJ9A 3BN9A 1UTKA 1WXRA 3S7KB 1ZHMA 1FY3A 5EJZA 4Y8YA 1XUKA 2ZZUH 5T6FA 5DN6D 1V2NT 2VH6A 4X0WU 1O3PB 1TAWA 2R3UA 2GKVE 1T8MA 2NU0E 1FLEE 1MKXK 2A7JA 1CA8B 2ZDAH 1DE7H 4OS7A 2IOTA 1G30B 1BT7A 4NZQA 2KM0A 4MVNA 1W12U 1YCPK 3RXEA 3M5MA 1C5PA 1K9OE 1QGFA 2BYAX 1J14A 3ATLA 2J5UA 3MWIU 2ZI2H 2PTNA 2YNAA 1QNJA 1GL1A 1J9CH 1E79D 1NFXA 2ZDMA 2FOAA 3V3MA 1NY22 3PO1C 1S81A 1LMWB 2G51A 1NROH 2ZGJA 1DOJA 2IJOB 4NIWA 2A32A 2ZDVH 1HLTH 1JXPA 1NM6A 2BDAA 1VGCC 2A2QH 3VXEH 1D9IA 1TOCB 3DHKH 2KAIA 2FLBH 2JH6D 1C2IA 1TGBA 1A46H 1PPFE 1SFQB 1GMCF 1EJMA 3AASA 1K1JA 2RDLA 1NU7B 1P2NA 2F91A 3LPRA 4NA8A 1ELBA 1SC8U 8GCHG 1B0FA 2HOBA 5C1YA 5C5NA 4CH2B 1GBBA 3RXDA 4PROA 4WH6A 3MU5A 2PFEA 3LJOA 2UWLA 4M7GA 3RXIA 1D3DB 8KME2 4X8TH 2HPQH 4NIYA 3MH4A 4GPGA 2OQUA 4ZXYH 1OYTH 1DT2A 1O34A 4D76A 3A7VA 1Y3VA 1DFPA 1UVSH 2ASUB 2ZPSA 2ZHDA 2K8IA 3OFND 3T29A 4D9QA 3QUMP 1WCZA 4Y7BA 1SGFA 1V2RT 3UTUH 1SGYE 2H6MA 4D9RA 3M37A 1AQ7A 3HK6B 4UEHH 2VVVA 4AG2A 2HNTE 3KNXA 3BTEE 5T6DA 3C1KA 1UO6A 1H9IE 1TNIA 1XUHA 2HLDD 4IC5A 4BAHB 3H5CB 2B0FA 1VGCB 3LC3A 1QL9A 1G2MA 3SNDA 2FOEA 5A8YA 3RXQA 4D7GA 1SGTA 2XNDD 1LVYA 1ELVA 2A0QB 5EXLA 1RTKA 1AVGH 3GY4A 4A5TS 1C2DA 3TK5A 4TWWA 1LVOA 1C5UA 5A09A 1O5CB 3R3GB 3GY2A 1UHBA 2V3HH 3GY8A 3M7QA 4ABBA 3BTQE 1J17T 1XKBC 4KP0A 1EZSC 1MABB 1CT4E 2ZU3A 3NUMA 3MU1A 1DY8A 1H1BA 3SU2A 3A88A 1HAVA 1G3EA 1OWJA 8GCHF 3MH5A 3TJOA 1TPOA 4X1QU 2BLVA 1TBQH 4SGAE 5JBCS 3OTJE 1AD8H 2ZA5A 3BTTE 1G32B 4H6TA 1O3OA 1GJDB 4KGAA 1O3EA 1SGDE 2FIRH 4JZDH 2ZHQH 5SGAE 1V2QT 1BCUH 1OWEA 2ZFSA 1S82A 1FY8E 2ZPQA 1C2MA 1NRSH 2ZCLP 3TH2H 3QDZB 4YT6H 5DP5A 2FEQH 1IQLA 2BD4A 1GMDF 3RXTA 3MQKC 1OYQA 2FESH 3V12A 1EAUA 1IQHA 5DKMA 2EQNA 2UUFB 2FDAA 2C3SA 1SGCA 5FPSA 1O5GH 1DX5M 4JMYA 3C27B 2Z9KA 3SJKA 4DW2U 4QT8C 4AGJA 1O2JA 2F9BH 4ZXXH 4F49A 1HXFH 2GMTC 4ZKSU 1YPMH 2RA0A 4AG1A 1O2NA 1ZOMA 4NA9H 1QBNA 3TIUA 2F9PA 4A1VA 3FOAA 1SMFE 4NG9H 3VB6A 2ZF0H 2ZEBA 4ZKNU 1P2MA 1W7XH 1O38A 1GI8B 2BOHB 2W6ID 3QX5H 1WU1A 1EPTC 4HZHA 2FOGA 2XXLA 3OAAD 2GZ8A 2D1JA 2QC2A 2EA3A 1DM4B 1V2VT 2KAIB 3B8JA 3TH3H 4KTSA 5L6NH 3ZZ6A 1QL7A 2SGDE 3PMAB 4AB8A 5C0TA 1V2PT 4OS5A 3SN8A 2Y80A 1KYNA 3RXPA 3SGQE 3MNBA 3KL6A 4X6PA 1F0TA 2PHBA 5AHGH 3T62A 3RXMA 3RMLH 1AVWA 3G01A 3M7UA 1T32A 4H6SB 1O5DH 1LHCH 3PWCA 3F68H 2GT7A 1ELDE 1AFQC 1P2JA 3UIRA 1M9UA 2WPLS 5ETXA 2RDEA 2GMTB 1BB0B 4P02A 1FN8A 1YLNA 2A4RA 1EAWA 3WY8A 1UMAH 1KDQB 1FPCH 4U32A 1O2ZA 2BVSH 3ZZDA 3RXOA 3S0NA 1ID5H 3U1JB 4UE7H 5DPAA 1IQGA 1Z8IB 1ZTKA 1Z6JH 1S0QA 4GHQA 4BOHA 6CHAB 1C1VH 4DVAU 2W3IA 1Y3XA 5I25A 2HRVA 1OWIA 3ZV8A 1THSH 3LGUA 2AGIX 1MZAA 2OP9A 3A7YA 5JBTA 2BDGA 3V7TA 4X1RU 1C5ZB 3W95A 2R9PA 3A84A 4Z0KA 3ZZ8A 2BLQA 4JCNA 3H7TA 4I7YH 1O5AB 5GIBA 3MI4A 1FIWA 1ETTH 3FO8D 4GUXA 5G4BA 3VGCC 1VCWA 4JK5A 3SQEE 1TNHA 1OOKB 2UWOA 1UTMA 3T25A 3EA8A 1BMNH 2JJ2D 1UK3A 1AGJA 2A31A 2OC8A 1O2WA 4Q7XA 2V3MA 1HAVB 2ZTYA 1TBZH 1A5IA 3CS0A 5DSFA 3Q76A 2FTMA 1AFQB 1K1LA 2FI3E 1O2IA 3BTFE 3W94A 3MOCA 1LKAA 4A1XA 2KCOA 3FAOA 1E38B 2BTCE 4UFDH 5JPMH 3F2GA 3TK9A 2LP6A 5GXPA 1O2GH 1E0FD 5TCAA 1NRQH 2HNTC 1PPGE 2G52A 3SO3A 3URDA 4B2CA 4ABJA 2WUCA 4YO9A 2G81E 1SG8B 4AFQA 1A0JA 3N99A 3LGYA 1LKBA 3F1SB 7GCHG 1AZ8A 3E1XB 4DJZB 4ISLA 5ABWA 1AI8H 4UONA 3SV2H 1YP9A 2GV7A 1O3AA 4M9FA 4GVUA 2M2AA 4J1YA 1C2KA 2BD5A 3EE0B 1YCPM 1HCGA 3F2FA 3D62A 2C8WB 3A7XA 2BD8A 4CBNA 1PPCE 3AVZA 1ZTLA 5DK1A 1YPJH 2BVXH 1TALA 3O8CA 3TH4H 1UTQA 2KZ4A 4WF8A 2ZFPH 2Z3DA 1IHSH 4X2WA 3PMBB 1UCYK 1RIWC 5EGMA 1F5KU 1TIOA 4ISNA 2P59A 2Z3EA 1EB1H 2ZHEH 4YOGA 1TX7A 1SB1H 1EASA 1NPMA 2CHAC 5GNDA 3LGVA 4JYTA 1OWKA 1TX6A 2VWMA 2HLCA 4UFEH 4X8UH 1O3JA 2Y81A 2W3KA 3OY6U 3SNEA 3LGWA 2PLXA 5FPTA 2G4UA 2I6QA 4HG6A 3KQ5A 2ZGCA 3GDUA 3PMJA 1FPHH 5EW1H 4B2AA 5HYOA 2FOBA 3ATMA 2FOMB 1GCDA 2VVCA 1SGFG 1AMHA 1C5RA 3BIUH 2RG3A 1P10A 4AORA 2SNWA 4O03A 4MPXA 3UAIC 1S0RA 3RXJA 2ILNA 5C94A 3OSYA 2KCPA 4MNVA 3PV5A 1L4ZA 1LHGH 4ZAEA 7GCHF 2Y5FA 3ENSB 1HNEE 1QJ1B 3LU9B 1O31A 3BSQA 4KTCA 1DLKB 1NRNH 2ZPRA 1BHXF 4FUGA 4TY6A 5DP6A 2Q6GA 3M5LA 2FS8A 1O2LA 4B6EA 4XSKU 1JOUB 2BY5X 5HIZA 3SORA 3QZRA 1G3BA 4RN6A 1RIWB 3PV4A 1HJ9A 4AOQA 3FP6E 3UNSA 3M3SA 1MUEB 2CXVA 1TPAE 1EZQA 4FUCA 4ZKRU 3RLYH 4XOJA 3ZIAD 2QCYA 3JZ1B 1SLXB 1P03A 1W14U 2QE7D 4INLA 3QWCH 4NSYA 1XVMA 1RD3B 1HYLA 1ABIH 5EJLA 1CGJE 3MNCA 4UD9H 3ZV9A 2OXSA 2BD9A 3FZZA 1O3GA 4XFQA 1K0HA 1TNKA 2BVRH 4MNWA 4Y8XA 1Y59T 2Y82A 1ELFA 2BX4A 4CH8B 5EJ1A 1GHWH 3EGKH 1HAPH 1RGQA 1O3KA 1BMMH 1A0LA 1GJ8B 1EAIA 1P11E 3RC5A 5GWZA 4ZH8A 1C9PA 4FVDA 4JZ1A 3U98H 3VB3A 1Z8GA 4CREA 1GI3A 1O3FA 2VNTA 4I86A 1SGRE 1F0SA 3DA9B 1IQJA 5DP7A 1N8OB 5FX6A 1C1TA 2L74A 4JZFH 2WSSD 1G3DA 1CT0E 3STIA 1SOZA 2FTLE 1YC0A 3KQEA 1K21H 4FUHA 1H9HE 2XC5A 3A86A 3B23B 2R0LA 1AN1E 2ANYA 1SQAA 1P0SH 1UTPA 2RCEA 1O2QA 3NKKA 1MU6B 1P02A 1GBTA 4ABIA 1DSTA 1KXCA 1LTOA 3BTGE 1O2PA 1TABE 1NRRH 1SOTA 2V7QD 1L2EA 4I8HA 3JZ2B 1O0DH 1C1MA 1HB0B 2DE9A 3NK8A 3GCNA 3RLWH 2C8XB 3KQCA 3IWMA 5HM9A 1VCQA 2CN0H 2Z9JA 1T4VH 1L1JA 3M5OA 4YLQH 4IGDA 1L1GA 3UREA 3DD2H 3ZZAA 2WPKS 1A61H 1NFWA 2UUYA 1XXFA 2ZTZA 1V3XA 1UJ1A 1WTGH 2YMSC 3T27A 1QIXB 1DDJA 1ZJKA 2A7CA 2EI8A 2HALA 1W7GH 2R0KA 1G2LA 3NPSA 1TA2A 2O9QA 4YM9A 2ALPA 1ZSKA 1FAKH 1IQKA 1XX9A 2PGBB 1HDTH 3P8FA 2TGAA 3QGNB 1EOLA 2V6NA 1GHBG 2JIZD 3MO6A 4B75A 3UQVA 1TNJA 4CHAB 1ANBA 4NFFA 1C5SA 1O32A 2F9NA 4MQAA 1V2KT 3RXVA 3QGJA 4X2YA 1BBRH 3LGTA 3SBKA 1ZSLA 1P2IA 1AUTC 1ETSH 2OK5A 4JYVH 4ZMAH 2G5NA 1FONA 1P05A 5C1XA 4E7RG 1UTOA 2KR7A 4CRCA 1MBMA 1AY6H 2QAAA 3E0PB 5EIYA 2ZDKA 2BDHA 1BJVA 2V35A 3STJA 1QJ6B 1A7SA 4FETA 1HAOH 5LGOA 2FYRA 1THRH 5F8ZA 3LC5A 1F5RA 1TMUH 3F0PA 2AIPA 1P8VC 2XC0A 2Z9GA 1AKSB 3RC6A 3NZIA 5F6MA 2XBVA 4HFPB 4AFUA 1Y5UT 1GG6C 2AMDA 3V0XA 2D2DA 1ZLRA 3N7EA 3BTDE 1HJAC 2TBSA 1BRBE 2ZU5A 1ELCA 1TQ0B 2BB4A 1Z8JB 3HK3B 2STBE 4BTTB 2OQ5A 4FU8A 1VR1H 3FN8A 1SHHB 2A7HA 1GHBF 2GCTB 1IHTH 1DWDH 1W0ZU 1PQ8A 7KMEH 4DIIH 2PR3A 2GZ9A 1P9SA 2QXHA 1SGQE 3MH6A 4MLFB 5AVDA 1MZDA 1P09A 2BOKA 2FM2A 2ZQ2A 5F03A 1QB9A 4ACBA 1BRCE 4X8SH 5HXFA 1EZUC 3RDZA 2W7SA 5EXMA 3SV9A 1AIXH 1BQYA 2XBWA 4WXVA 1GBIA 1GI6A 2STAE 1T8NA 4I33A 2ZFTA 4I8GA 1FIZA 4OS2A 1KXAA 2P3UB 1D4PB 1ESAA 3SU5A 1IQIA 2BD7A 1XUGA 1TGSZ 1K22H 4ABAA 2Z9LA 5F53A 2IN2A 2UWPA 3SUDA 1WSSH 3SUEA 2V3OH 5EQQA 1L1NA 4AN7A 2ZHFH 1GG6B 2HGTH 1SQTA 3SU3A 1YBWA 1ZPCA 5HIYA 1HJAB 2Z7FE 3CS7A 2B9LA 2BLOA 1YYY1 2ZDLA 1A1RA 5FHTA 3F3BA 1T4UH 1W0YH 1C1WH 4JK6A 3ZYEA 5HGGA 2SNVA
chains in the Genus database with same CATH topology
1KDQA 3TPIZ 3EA9A 3PO1B 1QQUA 3GY7A 3BG8A 3SHCH 3D23A 2F9OA 1EPTA 1XUJA 2WV5A 1VJAU 2AMQA 1SR5C 1LQEA 1YF4A 2BD2A 5AF9H 5AFYH 1O3MA 1SGIB 1BTXA 1YGCH 1TE0A 4R8TB 3SV6A 3URCA 1NESE 9ESTA 2BXTH 2I6SA 3F9HA 3U69H 1HJ8A 1NO9H 3SV7A 1EP5A 3O8DA 1JMOH 3RP2A 3A82A 1UVUH 4IC6A 3HATH 1VITH 2NWNA 1LHDH 2AH4X 1V2ST 3MO9A 1WUNH 5FAHA 2FXRA 3LT3A 4Y10E 3SNCA 2BDBA 1AE5A 4O9VA 3MFJA 2AEIH 2VIVA 5GJ4B 3V13A 4AZ2B 4TPIZ 3I77A 3FVFB 4O97A 1UCYE 3EYDA 1OWDA 1O2HA 1DY9A 5C5OA 2H2ZA 3FFGA 5A0CA 2F3CE 4ZHAA 1ZGVA 1FDPA 1UVTH 2ULLA 1ZZZA 4FXGH 3KQDA 4IMZA 3TVJB 4I32A 2O8UA 1PPEE 3S9CA 3E91A 3GDSA 4HI3A 1CE5A 1LVBA 1GBAA 2TGDA 1JRTA 4ASHA 1TOMH 3CP7A 3SJOA 1SGPE 1K1OA 2PKAA 3E8LA 1TRMA 2CV3A 1T7CA 1XM1A 3UNRA 1TWXB 4BXSA 1QRXA 1S6FA 2P95A 1NN6A 2GDDA 2AGEX 2QYIA 2G4TA 3ESTA 3SGBE 2A4QA 5L2YH 3M5NA 2FI5E 2VWNA 3SUFA 4NWLA 4WMDA 4X1SU 4UFFH 3B9FH 2GX4A 1OX1A 3UWIA 5DP9A 3A85A 6LPRA 5A2MH 2QXJA 5CHAC 1QTFA 3T2NA 4TWYA 1CVWH 3AAUA 1VZQH 5HMAA 2FOFA 3VB7A 2GCHG 2XWAA 2H9EH 1CQQA 2TGPZ 3RXAA 1QCPA 1Y5BT 3R0FA 5ESTE 1SL3A 5DG6A 1LCYA 4BAKB 3P92A 1C5WB 1D3PB 2H9HA 1Z8RA 9LPRA 1D3QB 1MTWA 1MD8A 1IOEA 2C8YB 2R2WU 3PWBA 3PLPA 2EI7A 3ZZ5A 1DLEA 2WINI 5F8XA 2OC1A 1GDNA 1TYNA 2ALVA 1HRTH 4MDSA 4AYYB 2LPRA 2ZU1A 4ZUHA 4GCHG 1KXBA 1GCTC 2BXUH 1C2JA 1A3EH 1ABJH 1P2OA 1EPTB 3E16B 1GHVH 1B0EA 5EQRA 2DUCA 2OINA 2V0BA 1ZPZA 4Y8ZA 2VWLA 2BD3A 3P95A 2J4IA 4AFZA 2ZFQH 5CHAB 1C1QA 4B71A 3RM0H 1RTLA 2ZIQH 3ZZ9A 1Y5AT 4Q7ZA 1BDAA 1DICA 1O2MA 1KY9A 3PM3A 1K1NA 4K60A 1TBRH 1V6DA 1O2YA 1ZHRA 3RU4T 4HGCA 1ELGA 2FMJA 3MMGA 1H4WA 3EAJA 3A87A 2ZC9H 2GCHF 3TJVA 4Q80A 1MCTA 3VB4A 2G5VA 2NU2E 3Q3KA 2G55A 1JIMA 4DOQA 1C2GA 2O8MA 3KF2A 4NGAH 3HKIB 2Q6FA 4BAMB 3TGKE 1JWTA 1RRKA 3HGPA 4GSOA 4KKDA 3GCTG 1TNGA 4ISIH 5DJ7A 2AFQB 1C2FA 2XCFA 3ZZ7A 5TJXA 3UFAA 1AHTH 1ZSJA 4ISHH 2ZDNA 3VXFH 1GI7B 1F7ZA 1SFIA 1XVOA 1HFDA 1K2I1 4WJG2 3SU0A 1OP0A 1P01A 1FY4A 4ZHMU 3A89A 1SLUB 2THFB 4GCHF 2PKAB 1QA7A 2TPIZ 1VITG 5GDSH 1WQVH 1C5QA 3M36A 2W5EA 5JBAS 3T28A 2PKSC 2G00A 3A7WA 3VGCB 2OBQA 3GOVB 3RXHA 4NSVA 1N6YA 3E0NB 1YM0A 1D3TB 2JH0D 3ATWA 1PYTD 1LPKB 1W11U 3K6ZA 2Z94A 3SI3H 1BUIA 4YZUA 3U9AH 1HXEH 1AE8H 4K5ZA 2B8OH 1ESBA 1YKTA 3ZVCA 1QBVH 1V2MT 1EZXC 1OKXA 3P8GA 1P3CA 1F0UA 1PQ7A 3SGAE 1GHXH 2R2MB 1CHOG 1O39A 3Q77A 1DANH 3D65E 3RXSA 2A1DB 2WPIS 2PV9B 1GMHG 3UOUA 1QB1A 2G8TA 3GCTF 1ZR0A 1NU9A 3QTVH 1K1MA 1AWFH 1O5EH 2A45B 3NCLA 4SGBE 3MU8A 2ZU2A 3GISB 1PQAA 3KGPA 1OP8A 4MG3A 4THNH 1Q3XA 1O37A 2ZGBH 5AFZH 2FYQA 1EP6A 4FUDA 1BZXE 4BANB 1VJ9U 1O5FH 3BV9B 3H7OA 1C4Y2 1PQ5A 2PKSB 3BF6H 1CT2E 2ZGXH 2VIDA 1O3BA 5L2ZH 1OSSA 2BQ7B 1VITF 2W7UA 1Y3UA 3RU4D 3S9AA 1MCVA 1Z6EA 1DUAA 1IQEA 3KHVA 2BHGA 5E0JA 1ARCA 1TRYA 1W13U 2WYJA 2BY8X 2CHAB 1GJ5H 4FU9A 1SLVB 1INCA 2WYGA 3A83A 1BIOA 3OU0A 1OP2A 1ZGIA 1V2WT 4INHA 3ODFA 1NC6A 3A80A 2VIOA 2CF9H 1O2KA 1IQMA 3OX7U 2JETC 4X1PU 1O3CA 1CHOF 3SW2B 4Q7YA 1O2VA 3GY6A 5F8TA 3ZZ4A 4NIVA 2VGCC 1GMHF 3LJJA 2A5AA 1KXDA 3UWJH 1ZRBA 3QTOH 5L30H 2VVUA 3FZDA 3M7TA 2AYWA 1AKSA 1S5SA 3A8BA 1C9TA 1DPOA 1MH0A 2QIQA 3KEEA 1J16A 5E2PA 4XBBA 2SGQE 8LPRA 5HM2A 1Y3YA 1U6QA 1GI9B 1QFKH 3E3TA 3ZZCA 1EKBB 3LGIA 1GBKA 5E2OA 1GJ6A 2SGFE 1WQSA 1S84A 1ACBE 5A0AE 1ARBA 2XW9A 2QF3A 1KSNA 1C5MD 5E0HA 3LKWA 1MTVA 1MU8B 2ZNKH 3ZVBA 4D7FA 2K1QA 1UVOA 4K69A 1GDUA 1EJAA 3MU0A 5IYTA 2JETB 4ISOA 1D6RA 5FXLA 3LOXA 1C1NA 2ZCHP 4A92A 1DUEA 3UUZA 3GCHC 1DWCH 4OS4A 4ZHLU 2TIOA 1P3EA 2XWBI 3RXKA 4WWYA 2VGCB 4YESB 1GJBB 1LPGB 2ODYB 5IDKA 1HBTH 1JIRA 4X6MA 4MPVA 3GCOA 1P2QA 4RSPA 3Q3XA 4CRGA 2ANKH 3M3TA 1EB2A 3ZVFA 1S6HA 1WV7H 4LK4A 3E90B 1BRUP 4WY3A 3F9GA 7ESTE 2H5CA 6GCHG 1BJUA 1J8AA 1G37A 2O8WA 1EXFA 1W10U 4BTUB 2AIQA 5DO4H 1GI1A 2VWOA 3VFEA 3OYPA 1HAYB 1LQDB 2BDCA 1GBHA 3RXRA 4JZIA 1EOJA 5EG4A 3TNTA 2AMPA 3NXPA 1FN6A 3GDVA 2FPZA 4KELA 1C2HA 3TK6A 1NS3A 2Y6TA 1O30A 3TNSA 2UUKB 4NFEA 2EC9H 1UK4A 2ZGHA 1RTFB 3IG6B 2WPJS 3K9XB 1DXPA 4I8JA 1ANEA 1GPZA 1O2UA 1MQ6A 1SQOA 2C93B 4B2BA 1O3IA 1K28D 5C67A 3P6ZB 1EAXA 4FUFA 3HGNA 1BMLA 2GTBA 3PB1E 5CMXH 4DURA 4LOYH 2P93A 2FI4E 2W26A 4K8YA 2C90B 2OD3B 3S69A 1ELEE 1MKWH 2HNTF 2A5KA 2WV4A 4K1EA 4AYVB 4ABFA 2XRCA 1BTHH 3RM2H 3Q3YA 1QY6A 4RKJB 4LZ4B 1HAIH 1HIAA 1T8OA 4U2WA 5I46H 3AAVA 3ELAH 4CBOA 1TGNA 2SGAA 2PTCE 3T5FH 2H5DA 2QXIA 1ORFA 5JDUB 6GCHF 5A8XA 4I31A 1YPLH 2OCVB 5JB9S 3LONA 2ZCKP 2XC4A 3DFJA 2J92A 1FQ3A 1GBMA 4TPYA 2ZQ1A 2TRMA 5LPEA 3A8AA 5BPEA 4AFSA 5BRRE 2Q1JA 1K1PA 1BTUA 2CMYA 1BBRK 1QRZA 1MKXH 1BMAA 3A7ZA 1GMCG 3K65B 1HGTH 1DWBH 1C2EA 4BNRA 1GJ4H 2BY7X 1GJ7B 5A0BA 3P8OA 1NRPH 1YCPH 1THPB 5EW2H 1TX8A 1C5XB 4HTCH 4GAWA 4X6OA 3FP8E 4INKA 1F5LA 1J15A 4XE4A 4I8KA 4BXWA 2FODA 2AS9A 1Z1JA 3P8NA 5ESBA 4A6LA 1HAHH 3ZZ3A 3RXFA 3S7HB 4JZEH 4DIHH 5K7RA 4WMEA 3TGJE 4DT7B 2O8TA 1G9IE 2FWWA 3ZZBA 1MTNC 4BAOB 1F0RA 2C4FH 3SU4A 2OTVA 2SGPE 2A4OA 4K3JA 2IPHA 1GVLA 2Z9IA 3K2UA 3UY9A 5FBIA 1ETRH 1IQFA 1C1UH 4AB9A 1YPEH 3UQOA 4AX9H 2NU3E 3GICB 2BZ6H 2FO9A 5EXNA 3SQHE 1GHZA 2YNBA 3QK1A 2R3YA 2YOLA 5PTPA 1NTPA 4BTIB 1FV9A 1C4U2 1OPHB 4J2YB 4CR9A 1SPJA 4MPWA 1Z1IA 2QV1A 2J2UA 3SV8A 2J95A 3M35A 1O35A 2ZO3H 1T8LA 4Y11E 1VCPA 1F92A 2ZFRH 3F9EA 4E7NA 1W8BH 4FUEA 1GHAG 4WMFA 1PJPA 1KTTB 2Z6BD 1AFEH 2AGGX 3RXBA 2QN5T 1YLCA 1GBJA 1DWEH 2WUBA 3AW1A 1XUIA 1C5LH 1GI4A 2VU8E 1AO5A 4ABDA 1QR3E 2OUAA 3TJNA 4OS6A 4X2XA 1TMTH 1G36A 2BDYA 3RXGA 4ABHA 2QGRA 1QA0A 1N6XA 1MTNB 1ELAA 2B5TB 1DXWA 2RA3A 4CRFA 2VJ1A 1AU8A 1CBWC 1FXYA 2Y7ZA 1GI2A 3GY3A 2B7DH 2ANMH 4K8BA 1TLDA 1GMDG 2Q6DA 3A8DA 1UK2A 1MAXA 1HUTH 2H9TH 2P16A 1A3BH 5K0HA 1PPZA 4MTBA 1P9UA 2WPHS 3LH3A 1AZZA 1V2LT 3UOPA 3BEIB 1X7AC 1WBGB 1Y3WA 5B6OA 1XXDA 1H8IH 1MQ5A 1C5OH 1OS8A 3BIVH 5E0GA 1HIAB 1FI8A 4H4FA 4I8LA 2XYAA 2DE8A 3KIDU 1GJAB 1C5YB 4IBLH 1C5VA 2AERH 3ZVDA 4FUBA 1GHAF 1ZHPA 3GYLB 1F2SE 5JYIA 2GD4B 1WOFA 1ZMLA 1MD7A 1ZJDA 1N1LA 1CBWB 2QA9E 3PYHA 6ESTA 1XMNB 3RU4E 2ZFFH 2BY6X 5CE1A 2GVFA 5J4SA 4CRAA 3RXLA 4VGCC 1H8DH 2FZZA 1Z71A 3N7OA 1E37B 3S9BA 1BTWA 4O3UA 4YOJA 1LDTT 2ZTXA 5FCKA 2ODQA 3MH7A 3P17H 1EUFA 2QY0B 2XNIA 3HPTB 1YPKH 3L33A 2M5TA 1G3CA 1KTSB 1CSOE 1SBWA 1NT1A 2BM2A 2SFAA 1SGEE 1UTLM 1KXFA 1A2CH 3I78A 3MO3A 4X6NA 1JRSA 4Y76A 4NCYA 1SVPA 3QO6A 1P06A 1GI5A 3O8BA 3F9FA 2HPPH 3SI4H 1BHXB 1TONA 2ZKSA 1SLWB 3A7TA 4A7IB 1TRNA 1QQ4A 1FZZA 5T3HA 3L3TA 1T31A 1HV7A 6CHAC 5EU8A 5GCHG 2ZWLH 2CGAA 4B76A 5FX5A 4DCDA 3ITIA 1E34B 2GGVB 1FNIA 5EOKA 4VGCB 3FANA 5TCCA 1AUJA 1DS2E 3D49H 3Q00A 1O3LA 5C20A 4Z6AH 3ATKA 1OXGA 1QHRB 3PLKA 3BTWE 4FU7A 4X1NU 1O2XA 1CHGA 5LPRA 3DUXH 1C5TA 1O2OA 5LPFA 3MNXA 3AW0A 5DP4A 4FUIA 1Q2WA 2VIWA 3U8TH 1V2TT 2EI6A 2D26C 1TB6H 2BDIA 1WYKA 3RMNH 3QZQA 2XCNA 3QN7A 3UR9A 4D8NA 2VIQA 1TNLA 2P8OC 1ZMJA 3A8CA 5T6GA 1FUJA 2OBOA 1S83A 1RJXB 1O2RA 4Q2KA 1GBFA 1SI5H 3PMHB 4XBDA 4LXBH 3PLBA 4Y0ZE 1OWHA 2ZECA 4RKOB 2ANWA 4U01A 3UPEA 4OS1A 1P12E 1A5GH 2NU1E 4ESTE 3A81A 2GDEH 4IN1A 3MHWU 1K1IA 1TFXA 2JKHA 5FPYA 2Z3CA 1E35B 4E06H 3BG4C 5GCHF 1SGNE 5LH8A 3LDXH 2WPMS 3OY5U 1YPHE 1LPZB 3SJIA 2GP9B 4B74A 1GI0A 1CGIE 1UHBB 2BY9X 1ANDA 4Y79A 1AVXA 1FY1A 3PTBA 3K6YA 1BTYA 4K1TA 1QJ7B 4WXIA 3SHAH 1GCTB 4A1TA 3I29A 1TGTA 1HAZB 3SOSA 1C1OA 2QXGA 1O2TA 1A4WH 1A0HB 1NFYA 1HAXB 4X8VH 1E36B 2BZAA 1PYTC 5DP3A 3PROA 1YLDA 3CENA 2PW8H 2HVXA 4IN2A 2VH0A 1AB9C 2P8OB 4YTAA 1DVAH 1A5HA 3ZVEA 5JBBS 1LHEH 1CU1A 2Y7XA 2H1UA 1BRAA 1TMBH 5FCRA 2XBYA 1FAXA 1KLIH 2FOCA 1EATA 1UCYH 3ZVAA 1UTNA 1NFUA 1EX3A 1GBCA 4NA7A 1LHFH 1O3HA 1GJCB 4YT7H 1Z7KA 2Y5HA 1KLJH 1W3CA 3SU6A 3F6UH 3BG4B 1ANCA 2Y5GA 2F9UA 1WTHD 3ODDA 1GVKB 3SNAA 4YLUA 8ESTE 3TLOA 1QURH 4MNYA 2VIPA 5DGJA 3TITA 1IQNA 1GBEA 3U8RH 2J9NA 1LO6A 2BLWA 1FMGA 1CO7E 2P3FH 1O5BB 3BTHE 1QRWA 1KIGH 4E05H 3TU7H 1RS0A 1AB9B 3RMMH 1C5NH 2PUXB 3TGIE 2FLRH 2VB0A 1MMJN 2FX6A 1XKAC 1GWAA 4TY7A 1PPHE 1BBRE 1RFNA 4ABEA 1ZPBA 2EEKA 1O33A 3U1IB 1GL0E 3P70B 1C4V2 3EA7A 1ESTA 4ZROA 7LPRA 1PFXC 1CA0C 1XUFA 3GYMA 1BOQA 4NWKA 4K1SA 1HPGA 4DY7B 1GDQA 1V2JT 3MTYA 1TPPA 1S85A 4WH8