1XUHA

Trypsin-keto-babim-co+2, ph 8.2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Serine protease
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuhA02
4BTUB 4XOJA 1P12E 2ODQA 4JZIA 4GLYA 1GI3A 1E37B 1NESE 1BITA 3M5NA 2ZU5A 1DITH 4A1VA 2F9OA 3V13A 4K8YA 1ELCA 3S0NA 1BB0B 2XYAA 3ATMA 1LPGB 2WUBA 1YPHC 2Z3EA 3BIUH 3SBKA 3VGCB 1BTWA 3L3TA 2VINA 4O03A 1LHCH 3Q76A 5GIBA 4DGJA 1NZQH 3LGVA 1MTSA 1MU8B 4Y79A 1ELGA 2Z7FE 1V2UT 2AYWA 2FTMA 1ZRBA 1PPEE 4JZ1A 4DW2U 1FN8A 2H6MA 1UK2A 4VGCC 1KLTA 3RXVA 3UWJH 3RXLA 4WY3A 4ISHH 1Y3XA 4RN6A 2DE8A 1EQ9A 3I29A 1MAYA 1MCTA 2TBSA 4JZDH 4OS4A 1C5ZB 1P09A 4NCYA 1XX9A 4ZAEA 5DP7A 5EW1H 4KGAA 1J15A 1SOZA 5DG6A 1W13U 3U1JB 3TH4H 1EPTC 5IYTA 2GZ9A 1EZUC 1KDQA 1RIWC 1ANBA 2STAE 1O3HA 1OPHB 3C27B 3M5MA 5I46H 2FP7B 2BD5A 4VGCB 3E0NB 4UFGH 3A83A 3RXBA 2ZDMA 1GHYH 2P95A 1VCWA 2ZFFH 2VVUA 3B23B 1EB1H 4X6OA 5T6GA 3D23A 5HXFA 5DP6A 1O2KA 1GJBB 1EPTB 4AORA 3CS0A 1AY6H 1BJVA 1RIWB 4ZHAA 1TABE 2PLXA 3BV9B 4K8BA 1PPGE 2QA9E 5C2ZA 1NRNH 1BUIA 5FXLA 3SUFA 2BLVA 2HVXA 2OC8A 3RU4E 2XWBI 4BAHB 3RXKA 1E38B 5FX5A 4I8HA 5EQRA 4ZH8A 3UIRA 3MO9A 1BHXF 1CGHA 4X1NU 5T6DA 1G32B 3SNBA 4B75A 1WSSH 1V2QT 1YLDA 2FTLE 4U01A 3SV6A 4K1EA 2FODA 3FP6E 3KQCA 4IN2A 4NIYA 2Y6TA 2D2DA 3R0FA 4X8UH 2OC1A 1FJSA 2CN0H 1C1QA 4XSKU 7ESTE 1GBHA 2HLCA 1C2DA 1O38A 2ZU1A 2GD4B 4CRGA 1SR5C 1GMHF 3AVZA 2VH0A 2TGDA 1CA0C 2PUQH 4FUEA 2BY9X 1AE8H 1P0SH 3P95A 3U8RH 1JRSA 1S5SA 5AVDA 1Y8TA 4Z6AH 2FOHA 4AZ2B 4ISLA 2PHBA 2EI7A 2Q6FA 1C1MA 1K9OE 4IS5A 1YGCH 1P06A 1SQTA 2BX4A 5F03A 5T6FA 2A7CA 4D8NA 5A8XA 1RTFB 4AFSA 1GVKB 3UFAA 3GY7A 2H9HA 2OXSA 4NSYA 1CA0B 1LHGH 1WCZA 1EJMA 1DWEH 1YC0A 2BB4A 3BTKE 1FIZA 1T8OA 3EE0B 3LC5A 1EASA 1BDAA 1GI9B 1GBLA 3M7QA 4GHTA 3SU1A 1VCPA 1W2KH 1HAGE 3RXIA 3BIVH 5AFYH 1LKAA 3D65E 3OSYA 3TK9A 1DE7H 2BYAX 1P9SA 1WUNH 3UREA 1GHVH 3GY2A 5JYIA 3MNSA 5A0BA 3KIDU 3CP7A 3NWUA 4BXSA 1YCPM 1QIXB 2P3UB 1WTHD 2FIRH 3MH4A 3BTQE 3HGPA 2PKAB 1WBGB 2ZU2A 1QBOA 3OY5U 4FVDA 5C5OA 3LJOA 1NROH 3BEFB 1HFDA 2PGBB 1Y3UA 2GV6A 2ZO3H 1KDQB 1O2XA 5CE1A 2BZ6H 1RGQA 2BMGB 2FYQA 3RP2A 3ZVBA 2EA3A 2OUAA 2GX4A 1P8VC 3EAJA 2AMPA 1AQ7A 2KAIA 5DJ7A 1O3LA 2HNTF 1SGNE 1WQVH 3BN9A 2BQWB 3I78A 1V2WT 1MBQA 2G52A 2H1UA 4GCHG 1HXEH 2STBE 3H5CB 2DUCA 1TRYA 1Z7KA 3SJKA 1AVGH 1QR3E 1A0HB 3OTJE 2ZTYA 1BRBE 3ATLA 1AI8H 1O34A 2A2QH 3ZZ3A 1QB9A 1XKAC 3SUDA 1OYQA 5FPYA 3RMOH 3SUEA 1QBVH 3IG6B 1EUFA 1LCYA 1KTTB 1MAXA 1BTXA 1UTNA 2BD4A 1BTUA 2QCYA 1BBRK 3GYMA 3M3TA 1DSTA 2BDCA 4ZXXH 1TBQH 3RU4D 1E36B 4QT8C 2XC5A 2ZA5A 5C5NA 4KP0A 3MNBA 2XRCA 2FOFA 2VU8E 1INCA 2ZPRA 1LO6A 1BBRE 1GL1A 1L1GA 2ZHWH 1YPGH 3E3TA 1V2OT 5A8ZA 3UQOA 2B0FA 1T8MA 3IWMA 4WXVA 2PFEA 5EG4A 4YESB 1ZTLA 4U30A 3M5OA 1OWKA 1LVYA 3A7VA 1TMUH 1UVSH 3OU0A 1TGBA 3M7TA 1QJ1B 1HJAC 2ILNA 1ZR0A 5JBBS 2Y5HA 1KXBA 1NM6A 5L2ZH 3ZVGA 2RDLA 2C90B 1SBWA 2BOHB 2LPRA 1DOJA 4BNRA 3ODFA 1SLVB 3SU0A 3AW1A 3RDZA 1TIOA 4NIWA 4ZHLU 1IQIA 4NZQA 5E0HA 4AGKA 1GI4A 3PLPA 4NIXA 1QQUA 3MH5A 1BMLA 1ARBA 3ATKA 4DVAU 1DXWA 4KELA 2R2MB 3M35A 4X6MA 2F3CE 1PPFE 1HJAB 3S9CA 3VEQB 1WTGH 1YPHE 1GBFA 1TYNA 3PB1E 1AUJA 3E0PB 3AAUA 3UNSA 4JK5A 2ZP0H 2VWLA 4ZXYH 4ABGA 8KME2 1TMBH 3MU0A 1CT4E 1S81A 3OY6U 4AYYB 2J95A 3T29A 1P2IA 1GJDB 2F9NA 4AFUA 5EPYA 4X2YA 1A2CH 2HRVA 3MU4A 3RXHA 1IQHA 1MTNC 1TALA 3STIA 5LPEA 2ZU3A 1TB6H 1V2RT 4UFEH 1O2RA 1DT2A 4BAOB 1ACBE 2M5TA 2EEKA 2RCEA 1YKTA 4MPXA 1WV7H 2KAIB 4YM9A 5FX6A 3M5LA 3TJNA 2BQ6B 5HM2A 4JYVH 1C5MD 2IPHA 1AN1E 1C5TA 3V3MA 3KEEA 1O2WA 1GJ9B 1H9IE 1HJ9A 1TMTH 2GT8A 2XWAA 3ZZ6A 3QO6A 3FZDA 3MHWU 3OX7U 4AG2A 2EI8A 3EQ0H 2ZDAH 4HGCA 1GI7B 1MTNB 3LIWA 1ELVA 1OWJA 2GZ8A 2HPPH 1C2IA 1VITG 3BTME 3LGIA 1OWDA 4ZKRU 1O3CA 3UPEA 3GDSA 4U32A 3ZZ8A 4DIIH 1G30B 1TAWA 1P11E 2FOAA 3F9FA 2QIQA 4E06H 2HPQH 1HNEE 4CH2B 1A3BH 2GVFA 3EYDA 2J38A 2OC7A 1MKXH 1F92A 3QTOH 2OD3B 3RM2H 4D7FA 2A5KA 2QF3A 4OS6A 3ZVDA 4Q80A 4B2CA 5TJXA 2CGAA 4XBDA 2QGRA 2FESH 2UUKB 5GXPA 3BTFE 1BTZA 4CHAC 2QYIA 5DP5A 5FPTA 2R9PA 1JOUB 1YPMH 3MMGA 1RTLA 1NTPA 3O8BA 1O5DH 4RKJB 1PPZA 4MG3A 1EX3A 4IN1A 2WPLS 3T25A 2A5AA 1OP8A 2BVSH 1OP0A 5DP9A 3GCOA 3DHKH 1YP9A 3V0XA 1GJ6A 5EOKA 3T5FH 4Y10E 2UUYA 4CRAA 1XM1A 5JB8S 3EA7A 3Q3YA 2A7JA 4CHAB 2GKVE 4CRFA 3SV8A 5H4IB 1ELTA 1O2IA 3A8AA 2V3OH 3QZQA 4GUXA 1XUFA 2DE9A 1T8LA 1EJNA 2OINA 1OWEA 4DURA 3AW0A 4KTCA 4LOYH 1ZPBA 3ZVCA 5F6MA 1TQ7B 4ZROA 1BRCE 1H4WA 3VB7A 2ZCHP 4M7GA 4NFEA 2ZGXH 1KXAA 4H42U 1GL0E 2O9QA 1GBIA 2ZDLA 1TLDA 4H6SB 4X2XA 1SI5H 1S85A 2GGVB 1V2PT 3ZZDA 2OCVB 3SORA 3G01A 4I32A 1DY8A 4ABDA 1Z8RA 3DFLA 5GPIB 1O30A 4X2WA 3BTGE 4FUGA 1P9UA 1EOLA 1GJ8B 2P8OC 1A4WH 1GDNA 5DGJA 1Y5UT 1GMDG 3RXQA 1O37A 1C4V2 1CHGA 3A87A 1GMCG 1K22H 1PYTC 1SGQE 4K3JA 1ZPZA 1FAKH 4OS7A 4X1SU 5DK1A 3DT0H 1O3MA 3T26A 4FU7A 1NFWA 1DFPA 1KXFA 3ZZ4A 4GHQA 4F49A 3AAVA 4NA7A 3VFEA 1BRAA 4Q7YA 5GJ4B 2ZFQH 3MYWA 1NFXA 2P8OB 1K1IA 2C4FH 1C1UH 4O3UA 3RC6A 4KKDA 2ZC9H 1Z8IB 4NFFA 2RG3A 5J4SA 4AGJA 9LPRA 2H9EH 3PMAB 1HAPH 3QUMP 2LNCA 3Q3XA 1FY4A 1TGTA 3P8NA 2AMDA 1QQ4A 1EKBB 2A7HA 1KSNA 1N6XA 1AIXH 1G36A 2IN2A 4ABBA 1ZTJA 3CS7A 4BANB 1HLTH 7LPRA 1KXCA 1JRTA 2H2ZA 2OQUA 3A85A 2GDDA 4A1TA 1QHRB 3U1IB 1J17T 1UVTH 1CGJE 2OP9A 2SGDE 3KHVA 4HTCH 4UE7H 3RXAA 2ZTXA 4CRDA 1FY5A 5E2OA 4O3TA 5DP3A 5HM9A 1O3EA 2A32A 1CHOG 1IHTH 1MQ5A 4RSPA 4MVNA 1F0TA 2D8WA 5A09A 5B6OA 1RFNA 1DWDH 1TA2A 1JIRA 1GI6A 2P16A 4SGBE 4X1PU 3LH3A 3SQHE 1WAYB 2AERH 1EB2A 1EATA 4A1XA 1EXFA 1T8NA 4K1SA 2ZKSA 2ANKH 1ID5H 2FOGA 3RXCA 1CBWC 1P2OA 4NZLA 3RXDA 2GZ7A 5HYOA 3BG8A 3PTBA 2ULLA 3RLWH 1SGYE 1SFIA 2UWPA 1SPJA 3ZZBA 1C1PA 3LU9B 1TQ0B 5DP4A 2BQ7B 3OYPA 2QXIA 4R0IA 1DDJA 2ZZUH 1L1JA 2W3IA 4JYTA 4LXBH 4ESTE 1A5IA 2VIDA 2FDAA 2ZGCA 1HPGA 1BT7A 1P05A 1Y3WA 1VITH 6CHAC 2ZGHA 1CBWB 3F1SB 4X0WU 1Z6EA 2PKAA 2C8WB 5DPAA 1ZLRA 1LMWB 1ESTA 1FNIA 1P2JA 1ZPCA 3ELAH 1K1LA 4WWYA 2G5VA 1FY3A 2GV7A 4YT6H 1ETTH 4CRBA 4FUHA 1L1NA 1TPSA 1IQJA 1CGIE 1EZXC 5TCAA 4U2WA 2ALVA 1O5GH 4MLFB 3SNEA 1EP6A 3A89A 3F68H 3ZZ7A 6CHAB 2Y5FA 2ZDVH 1DANH 2FZZA 1CQQA 1V6DA 1LTOA 2AFQB 3K9XB 1GDUA 2BD3A 1B5GH 1O5EH 3QK1A 1G2LA 1NPMA 1VJAU 1W14U 3RXMA 3GDUA 4FUIA 3S69A 2VIPA 1GCDA 1GJAB 3TH2H 2VIQA 3U69H 1ESAA 4BOHA 1SLXB 3TIUA 5FBEA 3QGJA 3QGNB 2EC9H 1HAYB 2A4OA 3KL6A 1A5GH 3GYLB 2QV1A 3TU7H 5BPEA 2ZTZA 3DFJA 3RXUA 2CV3A 3KQBA 5EODA 2Y81A 1CT2E 1FPHH 3M61U 2CF8H 2P94A 1F0UA 1T31A 2A4QA 2A0QB 2XXLA 3SI4H 4WH8A 2G5NA 1BTYA 1DPOA 1UVOA 5F8TA 1E34B 5DO4H 1J9CH 1K21H 3HK3B 3SOSA 1QNJA 1GVZA 1ZJDA 1JXPA 1E0FD 3TJUA 1EJAA 3FP7E 1P3CA 4X6NA 3ZZ9A 1MKXK 6GCHG 3ATWA 3F9GA 1Y59T 3DA9B 3SU6A 4K5ZA 2BLOA 3PWBA 4B76A 1AB9C 1TOMH 3RMMH 2VJ1A 3SV7A 2BLQA 5IDKA 5C3NA 1V2MT 4MPWA 1IQNA 4SGAE 4BTIB 4X6PA 2FX4A 2BD8A 1MH0A 2D26C 5F8ZA 1SOTA 3TH3H 4JZEH 2YNBA 4I8LA 1G2MA 1GBAA 2PGQB 1HV7A 3ATIA 2GCHG 2GMTC 2G51A 1LKBA 1OS8A 2VWMA 1B7XB 1F5KU 1AB9B 4AG1A 3LONA 4IBLH 1QB1A 2R0LA 4GCHF 1GCTC 1V2KT 2ZQ2A 4BXWA 2VIWA 1XVMA 3LGYA 1ETRH 2Y5GA 1AU8A 1L0ZA 1H1BA 1QB6A 3LKWA 3RXJA 5A2MH 2XC4A 1ELFA 1C5YB 4INHA 3HATH 5C1XA 2BXUH 2Q6DA 4XBBA 1V2VT 2ALPA 4AB9A 3E1XB 3QX5H 1K1OA 2GMTB 1TPPA 3UNRA 3A7ZA 1QL9A 2F9VA 3TGKE 1SGFG 1MZAA 2P59A 2QY0B 1GCTB 4XBCA 1C1WH 1FY1A 3S7KB 1O2GH 4ABAA 1THPB 1EZQA 3RXGA 1TWXB 2FOCA 1C2EA 1SGEE 1AWFH 4ZUHA 1BA8B 1GBDA 1K1MA 3SNCA 1GBBA 2BD2A 3NPSA 1QA0A 1TNLA 1GBTA 3SU5A 1C9PA 5EXNA 3QDZB 5E2PA 4ABEA 1GHAF 3H7TA 1MCVA 1UK4A 3TPIZ 1DSUA 1GMHG 1SMFE 4KTUA 2SGEE 1PQ8A 2BOKA 3RMNH 4AN7A 1SC8U 2HALA 4YZUA 3MH6A 4Y0ZE 2A1DB 3UWIA 4BAQB 4UDWH 2ZCLP 4KTSA 1O5AB 2BY7X 1SGCA 2JKHA 1TGSZ 1M9UA 1RD3B 2ZEBA 3EA9A 1HJ8A 4E7RG 1EZSC 3NK8A 1FONA 4B2AA 1ZMLA 3SJ9A 2SGQE 4MDSA 3RMLH 2F9PA 3RXSA 4FVBA 1S83A 5A0CA 1HGTH 2I6QA 2BLWA 2BY5X 1ZSLA 1A7SA 1GI0A 3LGTA 2WPMS 3UTUH 1A0LA 3V12A 3BSQA 3LJJA 1UTQA 1EOJA 1CA8B 4NGAH 1LHDH 4FXGH 4CR5A 5K0HA 5CHAC 5FCRA 3O8CA 3QLPH 4XFQA 1DX5M 1PQ5A 1LVBA 2B5TB 2XTTB 5JB9S 4Y11E 2BD7A 3VXFH 2ZG0H 1FI8A 1TA6A 1RS0A 4MNXA 1Q31A 4CREA 1Q2WA 2C8ZB 4UFFH 1NU7B 2J94A 2W7SA 2FXRA 1O2QA 5CHAB 4CR9A 1O3IA 2ZHEH 4DY7B 1SGRE 2P3FH 3M37A 1NFYA 3A80A 3M3VA 3U8OH 4FUCA 3SHAH 1W3CA 2ODYB 3O8RA 4A5TS 3GY3A 3I77A 2V3HH 2Z3DA 3LGUA 4RKOB 2F9BH 3TGJE 3RU4T 4WJG2 2PTNA 2CJIA 3K6YA 2FI5E 1TX7A 2SNWA 5ESTE 1GVLA 1SGFA 3SGAE 2WPKS 1AFEH 1YLCA 2WV4A 1VITF 3U98H 4X8TH 1K28D 1TBRH 1HAOH 4IMZA 4JYUH 4AOQA 4FUBA 5GWZA 1DXPA 1N8OC 1OKXA 2PW8H 1UHBA 1UCYE 2Y7ZA 4Y7BA 1GG6C 3F9EA 1FAXA 4X2VA 2VWOA 1XVOA 1YCPH 1C2MA 1C1RA 1O2JA 1ZJKA 3LH1A 5EXMA 2ANWA 2ZF0H 1NRRH 1C2KA 2NU0E 1ELBA 3T27A 3Q00A 1P04A 3UR6A 3PMHB 3UUZA 4E05H 1PPCE 1UVPA 1N8OB 3IITA 5TCCA 1MTUA 4DJZB 1DY9A 2P3TB 1O3AA 4YOJA 1DWCH 1BCUH 3PV4A 3FANA 3E91A 2TGAA 2YNAA 1F5LA 3SZNA 4MPUA 2AMQA 1BJUA 2OQ5A 1C1VH 2VVVA 1FXYA 4WXIA 1D9IA 4JK6A 3A86A 2O8LA 4TWYA 1SQAA 1DLEA 3ZVEA 1BRUP 2H9TH 4NA9H 2Y82A 2WV5A 1VR1H 4MPVA 3F6UH 1RRKA 4ZMAH 1YPLH 1THSH 3P6ZB 1PYTD 3U8TH 1O2SA 1P02A 1O3NA 1D3QB 1O5BB 3FFGA 4AFZA 4GAWA 3D62A 1IHSH 3M3SA 1C5NH 3GISB 3PMBB 2ZIQH 1FZZA 2Q6GA 1CVWH 1O3JA 2Z6BD 3DUXH 3SV9A 1SHHB 1QJ6B 2JH5D 3BG4C 3TNTA 4YO9A 1GBMA 1D4PB 1GJCB 2NU3E 4YLQH 4J1YA 5GCHG 3KCGH 3ZV8A 2BVRH 4WH6A 1ELDE 1XXDA 2UUJB 1XMNB 1BTPA 1O35A 1O36A 2OBOA 5HMAA 1O2ZA 1K1PA 1QJ7B 1GMDF 3S9BA 1THRH 4MNYA 1D3TB 2K1QA 1SSXA 2AH4X 2Y80A 3MTYA 3BG4B 3P70B 1Y5AT 1IQFA 5G4BA 2J9NA 1SGTA 2JH6D 1E35B 2BD9A 1C5SA 1F0SA 2PR3A 3S9AA 1UTMA 1ZHMA 1HAHH 4B74A 3PROA 4CBOA 3A8CA 2VVCA 3ZV9A 3GY5A 3P8OA 3A7YA 1O3BA 1ARCA 5EU8A 7KMEH 3P8GA 1J14A 4ISIH 1HAXB 1RXPA 2QAAA 4BAMB 3P8FA 3GOVB 3UOUA 4DOQA 8GCHG 1C2HA 2NU4E 1UTLM 2VNTA 2AEIH 2W3KA 4A7IB 2THFB 2ZDKA 1SB1H 1C9TA 1BHXB 1GDQA 4INLA 4Y0YE 1ZMJA 3SU3A 1ZSJA 1LDTT 1YYY1 1C4Y2 1W10U 1H8IH 2V0BA 4AB8A 4BAKB 4LK4A 3RC5A 3AASA 1GHXH 3MU5A 2BDAA 2A45B 3JZ1B 1GI1A 1UHBB 4HI3A 2VWNA 2I6SA 4Y76A 3ESTA 3BTDE 5FHTA 1A46H 1L4ZA 1Z6JH 3ZYDA 3RXFA 2ZU4A 1OP2A 3GICB 1FV9A 4K2YA 4J2YB 2Z94A 5EPNA 1O2UA 2A4RA 1DWBH 1TNGA 1ANDA 2QF0A 1CT0E 2O8UA 1AKSA 1NO9H 1VJ9U 1TPOA 1AWHB 1YPJH 1ZOMA 1CSOE 1G3CA 3QWCH 4Q2KA 2PSXA 3E6PH 2G4TA 3PLBA 7GCHG 2BTCE 4UFDH 5C67A 2BDBA 5GDSH 3A7WA 3GCHC 4AYVB 2FOEA 1O3OA 1NS3A 1UVUH 2XCFA 5FBIA 1MD7A 1FUJA 1TGCA 2W26A 4MTBA 4ZKNU 1O2HA 1GGDC 1S82A 4B2BA 5ETXA 1H9LB 1IQGA 1P2NA 4Y8YA 1V2NT 2FOMB 3MFJA 1HAIH 1Y3VA 3GY6A 2ZHDA 2G55A 5E0JA 5CMXH 1ZGIA 1G37A 1EAUA 2ODPA 4MQAA 2BHGA 3UNQA 3RXTA 2PUXB 3ZYEA 3GCHB 1V3XA 3SJIA 4CBNA 2WUCA 3SHCH 1SFQB 1O3KA 3BTHE 3KQDA 2HNTC 3MO3A 2SGPE 1AVWA 1AGJA 3A8DA 3SW2B 1GGDB 1KXEA 1S6HA 1V2ST 2R0KA 4TY6A 4DG4A 3KN2A 1SGDE 1QBNA 1HIAA 4WVPE 1XUIA 4ISOA 4FUFA 2ZFRH 3GCTG 2ZFPH 2ESTE 3BEIB 1GHBG 1C2JA 2OBQA 2Z9GA 1NRSH 4YT7H 4LZ4B 1AD8H 5C1YA 3RUOA 3KF2A 1FDPA 2RA3A 3SI3H 2FYRA 3VB5A 1GHWH 4ABHA 1IQKA 5ABWA 1SGIB 3PWCA 3MNCA 2XCNA 1PQ7A 3QZRA 5T3HA 1OYTH 4D7GA 1UCYH 5DKMA 1NU9A 2VIVA 2B8OH 4UONA 3RXEA 1S0RA 4IGDA 4X8SH 4H4FA 1TNKA 4FUDA 1MU6B 4H6TA 5I25A 1NT1A 1YF4A 3FVFB 4OS5A 1AZ8A 2WINI 1O2MA 1LVOA 4B71A 4I8JA 2SGAA 4WMEA 1YPEH 2SNVA 1GI8B 2YOLA 3TJOA 1C5UA 2BXTH 4TYDA 2WPIS 4B73A 1P01A 1A5HA 3STJA 4Z0KA 1C5VA 1W11U 1V2JT 2ANYA 3URCA 4JZFH 1ANEA 1ZGVA 1K2I1 3SO3A 1Z8JB 1UTJA 5LPRA 2W7UA 1QRWA 1GJ7B 2WYJA 3MU1A 4Y71A 3L6PA 6GCHF 1QL7A 1Q3XA 4O97A 2PWXA 1YCPK 3A7TA 2QXHA 8ESTE 9ESTA 3KGPA 3UOPA 4Y7AA 4TPIZ 3H7OA 4IW4E 5E0GA 2VB0A 1W7GH 1AKSB 2BZAA 1IQMA 1C5PA 1FIWA 4YOIA 1V2LT 3RM0H 2J34A 2ZHQH 1L4DA 2XBXA 1T4UH 2GCHF 1ELEE 1HBTH 4ABFA 3M7UA 3NCLA 2H5DA 4HZHA 4D76A 1X7AC 1O2TA 2XNIA 4ZKOU 3O8DA 3E16B 5LH8A 1OSSA 3SQEE 1GI5A 5AFZH 4NSVA 5LGOA 1QTFA 3E90B 3MO6A 1AHTH 1TGNA 2FMJA 1TE0A 1O2VA 1MZDA 1RTKA 1AMHA 2GT7A 1T4VH 5DP8A 2B7DH 4OS2A 3P92A 4PROA 1D6WA 4DCDA 1C1TA 4F4OC 1KXDA 4X1RU 2W5EA 3NKKA 1FY8E 1C1NA 1HAZB 1DM4B 2J92A 1P3EA 2A31A 2Z3CA 2TRMA 5JBAS 1C5QA 1NFUA 1HIAB 2GDEH 1HYLA 1UK3A 1VZQH 3ZVAA 4FU8A 3A7XA 2XBYA 2ANMH 3SNDA 1QFKH 3W94A 1PQAA 3NUMA 1EAWA 1MKWK 3Q77A 1Y3YA 4ASHA 4I7YH 2A4GA 1UTPA 1EAXA 3BTWE 2FPZA 1B0EA 3MOCA 4OS1A 1TONA 4DIHH 4TPYA 2AGEX 1VCQA 5A0AE 1P2KA 1C5WB 3UR9A 3ZZAA 4GVUA 3HKIB 1L2EA 2HOBA 1ZHRA 1XUGA 3TJVA 1A1RA 1O3GA 1XKBC 4UEHH 1EP5A 1AFQC 3B9FH 1G3DA 3T28A 2TPIZ 1LQDB 1HB0B 1QURH 2A5IA 1CO7E 2ASUB 1YM0A 3FAOA 1P57B 2IOTA 1OWIA 1BTHH 5EW2H 3PMJA 1QGFA 3GCNA 1HRTH 1TNHA 1WQSA 1O5CB 4LZ1H 1MUEB 4NWKA 4FUJA 2R3UA 1DLKB 2JH0D 2ZCKP 2G81E 1QA7A 1TPAE 1O2OA 2BDIA 2Y7XA 1KYNA 3JZ2B 1AFQB 1O3FA 5C1UA 1OXGA 4K69A 1Z71A 2OLGA 4OGYA 3CENA 3LOXA 1ELAA 3SGBE 1H8DH 2H5CA 1BMAA 1GJ4H 1TNIA 4E7NA 3TLOA 3A84A 2BY6X 5A8YA 1V2TT 3E8LA 4XE4A 2JETC 4NIVA 1Z8GA 1C5LH 3SN8A 1WU1A 3MH7A 4HFPB 3ZZ5A 1P10A 3LPRA 3L33A 1N6YA 3SV2H 1LQEA 1O2NA 2Z9LA 1LPZB 2QXGA 1BZXE 1D6RA 1UTKA 4IC6A 4I8GA 3GY8A 4I8KA 3HPTB 4D9RA 2F91A 2Q1JA 1AVXA 2PV9B 5JPMH 3LC3A 1Z1JA 3EGKH 2F83A 2GCTC 1T32A 3T2NA 1GI2A 2CF9H 1J8AA 4I31A 2J2UA 2JETB 1K1JA 1SVPA 2HWLB 3C1KA 3URDA 2QN5T 2O8MA 1LPKB 4Q7ZA 5ESBA 3ENSB 3ODDA 2FLBH 2AIQA 3PM3A 1J16A 2A2XH 3VPKA 1MQ6A 1O3PB 1QY6A 1ZZZA 1A3EH 2ZQ1A 1H9HE 2AIPA 1GBEA 2WPJS 3A88A 1OWHA 4ZKSU 1PPBH 3VB6A 1JIMA 3DD2H 1K1NA 5C20A 2HNTE 2PKSC 3PYHA 2AS9A 2GCTB 4IMQA 2G00A 3FP8E 6LPRA 4ZHMU 3SJ8A 3D49H 3TITA 1G3EA 1XUHA 1BMMH 1CE5A 3MI4A 4O9VA 2ZPSA 4Q7XA 3KQEA 2FM2A 1GHAG 1UMAH 3RC4A 1HAVA 1NC6A 3B8JA 2ZI2H 2O8TA 4BTTB 4ISNA 2C3SA 2PKSB 2ZGBH 2FI3E 3K2UA 4DT7B 4YOGA 1F7ZA 4THNH 4FU9A 5FPSA 1W0YH 2QC2A 1UCYK 3K6ZA 1Y5BT 3GY4A 2BDGA 4TY7A 1JBUH 3NXPA 2FS9A 2J4IA 4JCNA 2EI6A 4XDEA 3GDVA 2BM2A 2ZWLH 2GP9B 2GTBA 3P17H 2ZGJA 4GPGA 2VGCC 2V35A 1TRMA 3SUGA 1AE5A 2XBVA 1U6QA 2BVXH 2FEQH 4JMYA 1O3DA 4Y6DA 1SLUB 1AO5A 5GCHF 3RXRA 1ZHPA 2V6NA 4WMFA 2ZHFH 3A81A 1MMJN 1O0DH 1ZTKA 2F9UA 5L30H 2CMYA 1HDTH 5PTPA 3U9AH 1BMNH 1ABJH 2G8TA 1G9IE 4D9QA 2AGIX 2VIOA 3LGWA 4INKA 1C1OA 1O2YA 2FI4E 1GG6B 2VGCB 3HK6B 1KLJH 3SGQE 3TNSA 1UO6A 1JMOH 1MTWA 1SG8B 2QXJA 4NWLA 1A0JA 5FAHA 1F5RA 5EQQA 1O39A 1P2MA 1GBCA 3KNXA 2XC0A 1TX6A 3BEUA 1KTSB 1O32A 1SLWB 1FLEE 1MD8A 2FO9A 1XUJA 2BX3A 5JBCS 1P03A 3V7TA 2FLRH 4AX9H 1QRXA 1IQLA 2R2WU 8GCHF 1ZRKA 2SFAA 3PLKA 2HGTH 2XBWA 2ZPQA 1RJXB 3Q3KA 1C2LA 1NRQH 1QRZA 1ZMNA 1ETSH 1JWTA 1O33A 2Z9JA 1C2GA 2ZFTA 4AFQA 1KY9A 1TFXA 3UY9A 4NG9H 1W0ZU 3QN7A 4ABIA 2NWNA 3MNXA 5EQSA 1NN6A 2UUFB 4R8TB 1UTOA 4Y8XA 1VGCC 1S6FA 4TWWA 1NRPH 3W95A 1NY22 3EDXB 4CRCA 1IOEA 1P2QA 3ZVFA 5JBTA 1DICA 1GMCF 3S7HB 1MTVA 1SHYA 4YTAA 1C2FA 5L6NH 1GBKA 1MKWH 1YBWA 1D3DB 2ZDNA 2XW9A 4Y8ZA 2ZNKH 2D1JA 5HGGA 4IC5A 1BQYA 1XUKA 3VB4A 2R3YA 1VGCB 1HAVB 2CXVA 5F8XA 4A92A 4WF8A 1TRNA 3N7OA 1WOFA 7GCHF 1C4U2 1OOKB 2WPHS 1FPCH 1CU1A 2FOBA 1HCGA 3SNAA 1ESBA 1D3PB 1N1LA 2C8XB 2ZFSA 1HUTH 1IAUA 1PJPA 1AUTC 1SGPE 1FN6A 3R3GB 1O5FH 1ZYOA 2RA0A 2BDYA 2FWWA 3QTVH 4I33A 5AF9H 5SGAE 1TOCB 2NU1E 3HKJB 3MWIU 2FS8A 3LDXH 1WYKA 3SU2A 3WY8A 2C93B 2G4UA 1QL8A 3BTEE 2ZECA 1LHEH 1YPKH 2FX6A 2PTCE 2TGPZ 2IJOB 3NZIA 1A61H 4K1TA 2BDHA 1EAIA 1ORFA 3PO1C 4ABJA 1GHZA 5LPFA 1TNJA 1O2PA 2AGGX 4YLUA 5FCKA 1BOQA 1SQOA 1CHOF 1UJ1A 4CH8B 3F9HA 3K65B 3TVJB 3TGIE 1DUAA 1LHFH 1Z1IA 3SU4A 1AZZA 2BY8X 5E8EH 1QCPA 1O31A 3T62A 5EXLA 3ZZCA 1SL3A 3A82A 5JDUB 5AHGH 2CHAC 3TK6A 3GCTF 1GHBF 3LT3A 1HXFH 1ZSKA 4K60A 3FZZA 1DS2E 1KLIH 1O2LA 1PPHE 4OGXA 1LVMA 4X1QU 3PO1B 4MNVA 1F0RA 3ITIA 3RLYH 1T7CA 3RXPA 1PFXC 4GSOA 4A6LA 3SJOA 1S0QA 1W7XH 5J4QA 2NU2E 1C1SA 1IQEA 2CHAB 4MNWA 1EPTA 3RXOA 2PSYA 1W12U 1DVAH 1S84A 2Z9IA 3HGNA 1GWAA 3EA8A 3VB3A 2OTVA 5K7RA 1GJ5H 1FQ3A 3TK5A 5BRRE 2UWLA 1BBRH 6ESTA 4UD9H 3UQVA 1ABIH 1GBJA 2B9LA 3MU8A 1W8BH 1XXFA 1MBMA 1C5XB 2SGFE 1OX1A 2TIOA 1ANCA 2C8YB 4B1TA 2P93A 2VH6A 1FMGA 3M36A 2OC0A 1KIGH 4X8VH 2UWOA 3PTNA 5L2YH 1C5RA 1GPZA 1C5OH 5EGMA 3VXEH 3BF6H 8LPRA 2Z9KA 4WMDA 1F2SE 4NA8A 1G3BA 1TBZH 2TGTA 1TX8A 3BTTE 2WYGA 3A8BA 3VGCC 1BIOA 1B0FA 1DUEA 2O8WA
chains in the Genus database with same CATH superfamily
4BTUB 4XOJA 1P12E 2ODQA 4JZIA 3F2GA 4GLYA 1GI3A 1E37B 1NESE 1BITA 3W1EA 3M5NA 2ZU5A 1DITH 4A1VA 2F9OA 3V13A 4K8YA 1ELCA 3S0NA 1BB0B 2XYAA 3ATMA 1LPGB 2WUBA 3VG8A 1YPHC 2Z3EA 3BIUH 4RI0A 3SBKA 3VGCB 1BTWA 3L3TA 2VINA 4O03A 1LHCH 3Q76A 5GIBA 4DGJA 1NZQH 3LGVA 1MTSA 1MU8B 4Y79A 1ELGA 2Z7FE 1V2UT 2AYWA 2FTMA 1ZRBA 1PPEE 4JZ1A 4DW2U 1FN8A 2H6MA 1UK2A 4VGCC 1KLTA 3RXVA 3UWJH 3RXLA 4WY3A 4ISHH 1Y3XA 4RN6A 2DE8A 1EQ9A 3I29A 1MAYA 1MCTA 2TBSA 5EJLA 4JZDH 4OS4A 1C5ZB 1P09A 4NCYA 1XX9A 4ZAEA 5DP7A 5EW1H 4KGAA 1J15A 1SOZA 5DG6A 1W13U 3U1JB 4OM9A 3TH4H 1EPTC 5IYTA 2GZ9A 2YMSD 1EZUC 1KDQA 1RIWC 1ANBA 2STAE 1O3HA 1OPHB 3C27B 3M5MA 5I46H 2FP7B 2BD5A 4VGCB 3E0NB 4UFGH 3A83A 3RXBA 2ZDMA 1GHYH 2P95A 1VCWA 2L6OA 2ZFFH 2VVUA 3B23B 1EB1H 4X6OA 5T6GA 3D23A 5HXFA 5DP6A 1O2KA 1GJBB 1EPTB 4AORA 3CS0A 1AY6H 1BJVA 1RIWB 4ZHAA 3OTPA 1TABE 2PLXA 3BV9B 4K8BA 1PPGE 2QA9E 5C2ZA 1NRNH 1BUIA 5FXLA 3SUFA 2BLVA 2HVXA 2OC8A 3RU4E 2XWBI 4BAHB 3RXKA 1E38B 5FX5A 4I8HA 5EQRA 4ZH8A 3UIRA 3MO9A 1BHXF 1CGHA 4X1NU 5T6DA 1KMHB 1G32B 3SNBA 4B75A 1WSSH 1V2QT 1YLDA 2FTLE 4ACAA 4U01A 3SV6A 4K1EA 2FODA 3FP6E 3KQCA 4IN2A 4NIYA 2Y6TA 2D2DA 3R0FA 4X8UH 2OC1A 1FJSA 2CN0H 1C1QA 4XSKU 7ESTE 1GBHA 2HLCA 1C2DA 1O38A 2ZU1A 2GD4B 4CRGA 1SR5C 2XOKD 1GMHF 3AVZA 2VH0A 2TGDA 1CA0C 2PUQH 4FUEA 4FOUC 2BY9X 1AE8H 1P0SH 2KR7A 3P95A 3U8RH 1JRSA 4I86A 1S5SA 5AVDA 1Y8TA 4Z6AH 2FOHA 4AZ2B 4ISLA 2PHBA 2EI7A 2Q6FA 1C1MA 1K9OE 4IS5A 3OEED 1YGCH 1P06A 1SQTA 2BX4A 5F03A 5T6FA 2A7CA 4D8NA 5A8XA 1RTFB 3F0OA 4AFSA 1GVKB 3UFAA 3GY7A 2H9HA 2OXSA 4NSYA 1CA0B 1LHGH 1WCZA 1EJMA 1DWEH 1YC0A 2BB4A 3BTKE 1FIZA 1T8OA 3EE0B 5C0TA 3LC5A 1EASA 1BDAA 1GI9B 1GBLA 3F0PA 3M7QA 4GHTA 3SU1A 1VCPA 1W2KH 1HAGE 3RXIA 3BIVH 5AFYH 1LKAA 3D65E 3OSYA 3TK9A 1DE7H 2BYAX 1P9SA 1WUNH 3UREA 1GHVH 3GY2A 5JYIA 3MNSA 2JJ1D 5A0BA 4XD7D 3KIDU 3CP7A 3NWUA 4BXSA 1YCPM 1QIXB 2P3UB 1WTHD 2FIRH 4B6FA 3MH4A 3BTQE 3HGPA 2PKAB 1WBGB 2ZU2A 1QBOA 3OY5U 4FVDA 5C5OA 3LJOA 1NROH 3BEFB 1HFDA 2PGBB 3CNRA 1Y3UA 2GV6A 2ZO3H 1KDQB 1O2XA 5CE1A 2BZ6H 1RGQA 2BMGB 2FYQA 3RP2A 3ZVBA 2EA3A 2OUAA 2GX4A 1P8VC 3EAJA 2AMPA 1AQ7A 2KAIA 5DJ7A 1O3LA 4Z1MD 2HNTF 1SGNE 1WQVH 3BN9A 2K8IA 2BQWB 3I78A 1V2WT 1MBQA 2G52A 2H1UA 4GCHG 1HXEH 2STBE 3H5CB 2DUCA 1TRYA 1Z7KA 3SJKA 5KEDA 1AVGH 1QR3E 1A0HB 3OTJE 2ZTYA 1BRBE 3ATLA 1AI8H 1O34A 2A2QH 3ZZ3A 1QB9A 1XKAC 3SUDA 1OYQA 5FPYA 3RMOH 3SUEA 1QBVH 3IG6B 1H8ED 1EUFA 1LCYA 3FO8D 4ASUD 1KTTB 1MAXA 1BTXA 1UTNA 2BD4A 1BTUA 2QCYA 1BBRK 3GYMA 3M3TA 1DSTA 2BDCA 4ZXXH 1TBQH 3RU4D 1E36B 4QT8C 2XC5A 2ZA5A 1E1QD 5C5NA 4KP0A 3MNBA 2XRCA 2FOFA 2VU8E 3OFND 4DT4A 5C17A 1INCA 2ZPRA 1LO6A 1BBRE 1GL1A 1L1GA 2ZHWH 1YPGH 3E3TA 5EIYA 1V2OT 5A8ZA 3UQOA 2B0FA 1T8MA 3IWMA 4WXVA 2PFEA 5EG4A 4RT0A 4YESB 1ZTLA 4U30A 3M5OA 1OWKA 1LVYA 2K0QA 1TMUH 1UVSH 3A7VA 3OU0A 1TGBA 3M7TA 1QJ1B 4F55A 1HJAC 2ILNA 1ZR0A 5JBBS 2Y5HA 1KXBA 1NM6A 5L2ZH 3ZVGA 2RDLA 2C90B 3DCLA 1SBWA 2BOHB 2LPRA 1DOJA 1YLNA 4BNRA 3ODFA 1SLVB 2EQNA 3SU0A 3AW1A 3RDZA 1TIOA 4NIWA 4ZHLU 1IQIA 4NZQA 5E0HA 4AGKA 1GI4A 3PLPA 4NIXA 1QQUA 3MH5A 1BMLA 1ARBA 3ATKA 4DVAU 1DXWA 4KELA 2R2MB 3M35A 4X6MA 2F3CE 1PPFE 1HJAB 3S9CA 3VEQB 1WTGH 1YPHE 1GBFA 1TYNA 3PB1E 1AUJA 3E0PB 3AAUA 3UNSA 4JK5A 2ZP0H 2VWLA 4ZXYH 4ABGA 8KME2 1TMBH 3MU0A 2VBCA 1CT4E 1S81A 3OY6U 4AYYB 2J95A 3T29A 1P2IA 1GJDB 2F9NA 4AFUA 5EPYA 4X2YA 1A2CH 2HRVA 3MU4A 3RXHA 1IQHA 1MTNC 1TALA 3STIA 5LPEA 2ZU3A 1TB6H 1V2RT 4UFEH 1O2RA 1DT2A 4BAOB 1ACBE 2M5TA 2EEKA 2RCEA 1YKTA 4MPXA 1WV7H 2KAIB 4YM9A 5FX6A 3M5LA 3TJNA 2BQ6B 5HM2A 4JYVH 1C5MD 2IPHA 1AN1E 1C5TA 3V3MA 3KEEA 1O2WA 2WHXA 1GJ9B 1H9IE 1HJ9A 1TMTH 2GT8A 2XWAA 3ZZ6A 3QO6A 3FZDA 3MHWU 3OX7U 4AG2A 2EI8A 3EQ0H 2RFKC 2ZDAH 5KGOA 4HGCA 1GI7B 1MTNB 3LIWA 1ELVA 1OWJA 2GZ8A 2HPPH 1C2IA 1VITG 3BTME 3LGIA 2OK5A 1OWDA 4ZKRU 1O3CA 3UPEA 3GDSA 4U32A 3ZZ8A 3MQKC 4DIIH 1G30B 1TAWA 1P11E 2FOAA 3F9FA 2QIQA 4E06H 2HPQH 1HNEE 4CH2B 2W6JD 1A3BH 2GVFA 3EYDA 2J38A 2OC7A 1MKXH 1F92A 3QTOH 2OD3B 3RM2H 4D7FA 2A5KA 2QF3A 4OS6A 3ZVDA 4Q80A 4P00A 4B2CA 5TJXA 2KFWA 2CGAA 4XBDA 2QGRA 2FESH 2UUKB 5GXPA 3BTFE 1BTZA 1K0HA 4CHAC 2QYIA 5DP5A 5FPTA 2JJ2D 2R9PA 1JOUB 1YPMH 3MMGA 1RTLA 1NTPA 3O8BA 1O5DH 4RKJB 1PPZA 4MG3A 1EX3A 3OAAD 4IN1A 2WPLS 3T25A 2A5AA 1OP8A 2BVSH 1OP0A 5DP9A 3GCOA 3DHKH 1YP9A 3V0XA 1GJ6A 5EOKA 3T5FH 4Y10E 2UUYA 4CRAA 1XM1A 4M9FA 5JB8S 3EA7A 3Q3YA 2A7JA 4CHAB 2GKVE 4CRFA 3SV8A 5H4IB 1ELTA 1O2IA 3A8AA 2V3OH 3QZQA 4GUXA 1XUFA 2DE9A 1T8LA 1EJNA 2OINA 1OWEA 4DURA 3AW0A 4KTCA 4LOYH 1ZPBA 3ZVCA 5F6MA 1TQ7B 4ZROA 1BRCE 1H4WA 3VB7A 2ZCHP 4M7GA 4NFEA 2ZGXH 1KXAA 4H42U 1GL0E 2O9QA 1GBIA 2ZDLA 1TLDA 4H6SB 4X2XA 1SI5H 1S85A 2GGVB 1V2PT 3ZZDA 2OCVB 3SORA 3G01A 4I32A 1DY8A 4ABDA 1Z8RA 3DFLA 5GPIB 1O30A 4X2WA 3BTGE 4FUGA 1P9UA 1EOLA 1GJ8B 2P8OC 1A4WH 1GDNA 5DGJA 1Y5UT 1GMDG 3RXQA 1O37A 1C4V2 1CHGA 3A87A 2WZQA 1GMCG 1K22H 1PYTC 1SGQE 4K3JA 1ZPZA 1FAKH 2QF5A 4OS7A 4X1SU 5DK1A 3DT0H 1O3MA 3T26A 4FU7A 1NFWA 1COWD 1DFPA 1KXFA 3ZZ4A 4GHQA 4F49A 3AAVA 4NA7A 3VFEA 1BRAA 4Q7YA 5GJ4B 2ZFQH 3MYWA 1NFXA 2P8OB 1K1IA 2C4FH 1C1UH 4O3UA 3RC6A 4KKDA 2ZC9H 1Z8IB 4NFFA 2RG3A 5J4SA 4AGJA 9LPRA 2H9EH 4F48B 3PMAB 1HAPH 3QUMP 2LNCA 3Q3XA 1FY4A 1TGTA 3P8NA 2AMDA 1QQ4A 1EKBB 2A7HA 1KSNA 1N6XA 1AIXH 1G36A 2IN2A 4ABBA 1ZTJA 3CS7A 4BANB 1HLTH 3N7EA 7LPRA 1KXCA 1JRTA 2H2ZA 2OQUA 3A85A 2GDDA 4A1TA 1QHRB 3U1IB 5CDFE 1J17T 1UVTH 1CGJE 2OP9A 2SGDE 3KHVA 4HTCH 4UE7H 3RXAA 2ZTXA 4CRDA 1FY5A 5E2OA 4O3TA 5DP3A 5HM9A 2CK3D 1O3EA 2A32A 1CHOG 1IHTH 3KYFA 1MQ5A 4RSPA 4MVNA 1F0TA 2D8WA 5A09A 5B6OA 1RFNA 1DWDH 2KCAA 1TA2A 1JIRA 1GI6A 2P16A 4SGBE 4X1PU 3LH3A 3SQHE 1WAYB 2AERH 1EB2A 1EATA 4A1XA 1EXFA 1T8NA 4K1SA 3AK5A 2ZKSA 2ANKH 1ID5H 2FOGA 3NRLA 3RXCA 1CBWC 1P2OA 4NZLA 3DSGA 3RXDA 2GZ7A 5HYOA 3BG8A 3PTBA 2ULLA 3RLWH 1SGYE 1SFIA 2UWPA 1SPJA 3ZZBA 1C1PA 3LU9B 5B6LA 1TQ0B 5DP4A 2BQ7B 2M2AA 3OYPA 2QXIA 4R0IA 1DDJA 2LELA 2ZZUH 1L1JA 2W3IA 4JYTA 4LXBH 4ESTE 1A5IA 2VIDA 2FDAA 2KX4A 2ZGCA 1HPGA 1BT7A 1P05A 1Y3WA 1VITH 6CHAC 2ZGHA 1CBWB 3F1SB 4X0WU 4P02A 1Z6EA 2PKAA 2C8WB 5DPAA 1ZLRA 1LMWB 1ESTA 1FNIA 1P2JA 5C94A 1ZPCA 3ELAH 1K1LA 4WWYA 2G5VA 1FY3A 2GV7A 4YT6H 1ETTH 4CRBA 4FUHA 1L1NA 1TPSA 1IQJA 1CGIE 1EZXC 5TCAA 4U2WA 2ALVA 3UAIC 1O5GH 4MLFB 3SYJA 3SNEA 1EP6A 3KYGA 3A89A 3F68H 5HIZA 3ZZ7A 6CHAB 2Y5FA 2ZDVH 1DANH 1FX0B 2FZZA 1CQQA 1V6DA 1LTOA 2AFQB 2J98B 3K9XB 1GDUA 2BD3A 1B5GH 1O5EH 3QK1A 1G2LA 1NPMA 1VJAU 1W14U 3RXMA 3GDUA 4FUIA 3S69A 2VIPA 1GCDA 1GJAB 3TH2H 2VIQA 3U69H 1ESAA 4BOHA 1SLXB 3TIUA 5FBEA 3QGJA 3QGNB 2EC9H 1HAYB 2A4OA 3KL6A 1A5GH 3GYLB 2QV1A 3TU7H 5BPEA 2ZTZA 3DFJA 3RXUA 2CV3A 3KQBA 5EODA 2Y81A 1CT2E 1FPHH 3M61U 2CF8H 2P94A 1F0UA 1T31A 2A4QA 2A0QB 2XXLA 3SI4H 4WH8A 4AC9A 2G5NA 1BTYA 1DPOA 1UVOA 5F8TA 1E34B 5DO4H 1J9CH 1K21H 2PP6A 3HK3B 2KZ4A 3SOSA 1QNJA 1GVZA 1ZJDA 1JXPA 1E0FD 3TJUA 1EJAA 3FP7E 1P3CA 4X6NA 3ZZ9A 1MKXK 6GCHG 3ATWA 3F9GA 1Y59T 3DA9B 3SU6A 4K5ZA 2BLOA 3PWBA 4B76A 1AB9C 1TOMH 3RMMH 2VJ1A 3SV7A 2BLQA 5IDKA 5C3NA 1V2MT 4MPWA 1IQNA 4SGAE 4BTIB 4X6PA 2FX4A 2BD8A 1MH0A 2D26C 5F8ZA 1SOTA 3TH3H 4JZEH 2YNBA 4I8LA 1G2MA 1GBAA 2PGQB 1HV7A 3ATIA 2GCHG 2GMTC 2G51A 1LKBA 1OS8A 2VWMA 1OHHD 1B7XB 1F5KU 1AB9B 4AG1A 3LONA 5T1VA 4IBLH 1QB1A 2R0LA 4GCHF 1GCTC 1V2KT 2ZQ2A 4BXWA 2VIWA 1XVMA 3LGYA 1ETRH 2Y5GA 1AU8A 1L0ZA 1H1BA 1QB6A 3LKWA 3RXJA 5A2MH 2XC4A 1ELFA 1C5YB 4INHA 3HATH 5C1XA 1EFRD 2BXUH 2Q6DA 4XBBA 1V2VT 2ALPA 4AB9A 3E1XB 3WWBA 3QX5H 1K1OA 2GMTB 1TPPA 3UNRA 3A7ZA 1QL9A 2F9VA 3TGKE 1SGFG 1MZAA 2P59A 2LP6A 2QY0B 1GCTB 4XBCA 1C1WH 1FY1A 3S7KB 1O2GH 4ABAA 1THPB 1EZQA 3RXGA 1TWXB 2FOCA 1C2EA 2KCYA 1AWFH 1SGEE 4ZUHA 1BA8B 1GBDA 1K1MA 4HG6A 3SNCA 1GBBA 2BD2A 3NPSA 1QA0A 1TNLA 1GBTA 3SU5A 1C9PA 5EXNA 3QDZB 5E2PA 4ABEA 1GHAF 3H7TA 1MCVA 1UK4A 3TPIZ 1DSUA 1GMHG 4Q4LA 1SMFE 4KTUA 2SGEE 1PQ8A 2BOKA 3RMNH 5DSFA 4AN7A 1SC8U 2HALA 4YZUA 3MH6A 4Y0ZE 2A1DB 1NBMD 3UWIA 4BAQB 4UDWH 2ZCLP 4KTSA 1O5AB 2BY7X 3H09A 1SGCA 2JKHA 1TGSZ 1M9UA 1QZ8A 1RD3B 2ZEBA 3EA9A 1HJ8A 4E7RG 1EZSC 3NK8A 1FONA 4B2AA 3DSPA 1ZMLA 3SJ9A 2SGQE 4MDSA 3RMLH 2F9PA 3RXSA 4FVBA 1S83A 5A0CA 1HGTH 2I6QA 2BLWA 2BY5X 1ZSLA 1A7SA 1GI0A 3LGTA 2WPMS 3WW7A 3UTUH 1A0LA 3V12A 3BSQA 3LJJA 1UTQA 1EOJA 1CA8B 4NGAH 1LHDH 4FXGH 4CR5A 5K0HA 5CHAC 5FCRA 3O8CA 3QLPH 4XFQA 1DX5M 1PQ5A 1LVBA 2B5TB 2XTTB 3FKSD 5JB9S 4Y11E 2BD7A 3VXFH 2ZG0H 1FI8A 1TA6A 1RS0A 4MNXA 3FN8A 1Q31A 4CREA 1Q2WA 2C8ZB 4UFFH 1NU7B 2J94A 2W7SA 2FXRA 1O2QA 5CHAB 4CR9A 1O3IA 2ZHEH 4TSFD 4DY7B 1SGRE 2P3FH 3M37A 1NFYA 3A80A 3M3VA 3U8OH 4FUCA 5EJ1A 3SHAH 1W3CA 2ODYB 3O8RA 4A5TS 3GY3A 3I77A 2V3HH 2Z3DA 3LGUA 4RKOB 2F9BH 3TGJE 3RU4T 4WJG2 2PTNA 2CJIA 3K6YA 2FI5E 1TX7A 2SNWA 2AHME 5ESTE 1GVLA 1SGFA 3SGAE 2WPKS 3PV5A 1AFEH 1YLCA 2WV4A 1VITF 3U98H 4X8TH 4Q63A 1K28D 1TBRH 1HAOH 4IMZA 4JYUH 4AOQA 4FUBA 5GWZA 1DXPA 1N8OC 1OKXA 2PW8H 1UHBA 1UCYE 2Y7ZA 4Y7BA 1GG6C 3F9EA 1FAXA 4X2VA 2VWOA 1XVOA 1YCPH 1C2MA 1C1RA 1O2JA 1ZJKA 3LH1A 5EXMA 2ANWA 2ZF0H 1NRRH 1C2KA 2NU0E 2QF4A 1ELBA 3T27A 3Q00A 1P04A 3UR6A 3PMHB 3UUZA 4E05H 1PPCE 1UVPA 1N8OB 3IITA 5TCCA 1MTUA 2V3MA 4DJZB 1DY9A 2P3TB 1O3AA 1VKYA 4YOJA 1DWCH 1BCUH 2L74A 3PV4A 3FANA 3E91A 2TGAA 2YNAA 1F5LA 3SZNA 4MPUA 2AMQA 1BJUA 2OQ5A 1C1VH 2VVVA 1FXYA 4WXIA 1D9IA 4JK6A 3A86A 2HLDD 2O8LA 4TWYA 1SQAA 1DLEA 3ZVEA 1BRUP 2H9TH 4NA9H 2JDID 2Y82A 2WV5A 1VR1H 4MPVA 3F6UH 1RRKA 4ZMAH 1YPLH 1THSH 3P6ZB 1PYTD 3U8TH 1O2SA 1P02A 1O3NA 1D3QB 1O5BB 3FFGA 4AFZA 4GAWA 3D62A 1IHSH 3M3SA 1C5NH 2J97A 3GISB 3PMBB 2ZIQH 1FZZA 2Q6GA 1CVWH 1O3JA 2Z6BD 3DUXH 3SV9A 1SHHB 2QE7D 1QJ6B 4RT1A 2JH5D 3BG4C 3TNTA 4YO9A 1GBMA 1D4PB 1GJCB 2NU3E 4YLQH 4J1YA 5GCHG 3KCGH 3ZV8A 2BVRH 4WH6A 1ELDE 1XXDA 2UUJB 1XMNB 1BTPA 1O35A 1O36A 2OBOA 5HMAA 1O2ZA 1K1PA 1QJ7B 1GMDF 3EE7A 3S9BA 1THRH 4MNYA 1D3TB 2K1QA 1SSXA 2AH4X 2Y80A 3MTYA 3BG4B 3P70B 1Y5AT 1IQFA 5G4BA 2J9NA 1SGTA 2JH6D 1E35B 2BD9A 1C5SA 1F0SA 2W6ID 2PR3A 3S9AA 1UTMA 1ZHMA 1HAHH 4B74A 3PROA 4CBOA 3A8CA 2VVCA 3ZV9A 3GY5A 3P8OA 3A7YA 1O3BA 1ARCA 5EU8A 7KMEH 3P8GA 1J14A 4ISIH 2RDEA 1HAXB 1RXPA 2QAAA 4BAMB 3P8FA 3GOVB 3UOUA 4DOQA 8GCHG 1C2HA 2NU4E 1UTLM 2VNTA 2AEIH 2W3KA 4A7IB 2THFB 2ZDKA 1SB1H 1C9TA 1BHXB 1GDQA 4INLA 4Y0YE 1ZMJA 3SU3A 1ZSJA 1LDTT 1YYY1 1C4Y2 1W10U 1H8IH 2V0BA 4AB8A 4BAKB 4LK4A 3RC5A 3AASA 1GHXH 3MU5A 2BDAA 2A45B 3JZ1B 1GI1A 1UHBB 4HI3A 2VWNA 2I6SA 4Y76A 3ESTA 1WXRA 3BTDE 5F53A 5FHTA 1A46H 5DN6D 1L4ZA 1Z6JH 3ZYDA 3RXFA 2JIZD 2ZU4A 1OP2A 3GICB 1MABB 1FV9A 1S6LA 4K2YA 5HKKD 4J2YB 2Z94A 5EPNA 1O2UA 2A4RA 1DWBH 1TNGA 1ANDA 2QF0A 1CT0E 2O8UA 1AKSA 1NO9H 1VJ9U 1TPOA 1AWHB 2J98A 1YPJH 5CHBA 2IPQX 3N7DA 1ZOMA 1CSOE 1G3CA 1SQRA 3WWFA 3QWCH 4Q2KA 2PSXA 3E6PH 2G4TA 3PLBA 7GCHG 2BTCE 4UFDH 5C67A 2BDBA 5GDSH 3A7WA 3GCHC 4AYVB 2FOEA 1O3OA 1NS3A 1UVUH 2XCFA 5FBIA 1MD7A 1FUJA 1TGCA 2W26A 4MTBA 4TT3D 4ZKNU 1O2HA 1GGDC 1S82A 4B2BA 5ETXA 1H9LB 1IQGA 1P2NA 4Y8YA 1V2NT 2FOMB 3MFJA 1HAIH 1Y3VA 3GY6A 2ZHDA 2G55A 5E0JA 5CMXH 1ZGIA 1G37A 1EAUA 2ODPA 4MQAA 2BHGA 3UNQA 3RXTA 2PUXB 3ZYEA 3GCHB 1V3XA 3SJIA 4CBNA 2WUCA 3SHCH 1SFQB 1O3KA 3BTHE 3KQDA 2HNTC 3MO3A 2SGPE 1AVWA 1AGJA 3OE7D 3A8DA 3SW2B 1GGDB 1KXEA 1S6HA 1V2ST 2R0KA 4TY6A 4DG4A 3KN2A 1SGDE 1QBNA 1HIAA 4WVPE 1XUIA 4ISOA 4FUFA 2ZFRH 3GCTG 2ZFPH 2ESTE 3BEIB 1GHBG 1C2JA 2OBQA 2Z9GA 1NRSH 4YT7H 4LZ4B 1AD8H 5C1YA 3RUOA 3KF2A 1FDPA 2RA3A 3SI3H 2FYRA 3VB5A 1GHWH 4ABHA 1IQKA 5ABWA 1SGIB 3PWCA 3MNCA 2XCNA 1PQ7A 3QZRA 5T3HA 1OYTH 4D7GA 1UCYH 5DKMA 1NU9A 2VIVA 2B8OH 4UONA 3RXEA 1S0RA 4IGDA 4X8SH 4H4FA 1TNKA 4FUDA 1MU6B 4H6TA 5I25A 1NT1A 1YF4A 3FVFB 4OS5A 1AZ8A 2WINI 1O2MA 1LVOA 4B71A 4I8JA 2SGAA 4WMEA 1YPEH 2SNVA 1GI8B 2YOLA 3TJOA 1C5UA 2BXTH 4TYDA 3SZEA 2WPIS 4B73A 1P01A 1A5HA 3STJA 4Z0KA 1C5VA 1W11U 1V2JT 2ANYA 3URCA 4JZFH 1ANEA 1ZGVA 1K2I1 3SO3A 1Z8JB 1UTJA 5LPRA 2W7UA 1QRWA 1GJ7B 2WYJA 3MU1A 4Y71A 3L6PA 6GCHF 1QL7A 1NBME 1Q3XA 4O97A 2PWXA 1YCPK 3A7TA 2QXHA 8ESTE 9ESTA 3KGPA 3UOPA 4Y7AA 4TPIZ 3H7OA 4IW4E 5E0GA 2VB0A 1W7GH 1AKSB 2BZAA 1IQMA 1C5PA 1FIWA 4YOIA 1V2LT 2V7QD 3RM0H 2J34A 2ZHQH 1L4DA 2XBXA 1YWUA 1T4UH 2GCHF 1ELEE 1HBTH 4ABFA 3M7UA 3NCLA 2H5DA 4HZHA 4D76A 1X7AC 1O2TA 2XNIA 4ZKOU 3O8DA 3E16B 5LH8A 1OSSA 3SQEE 1GI5A 5AFZH 5HIYA 4NSVA 5LGOA 1QTFA 3E90B 3MO6A 5IK2D 1AHTH 1TGNA 2FMJA 1TE0A 1O2VA 1MZDA 1RTKA 1AMHA 2GT7A 1T4VH 5DP8A 2B7DH 5EJZA 4OS2A 3P92A 4PROA 1D6WA 4DCDA 1C1TA 4F4OC 4ACBA 1KXDA 4X1RU 4ZCNA 2W5EA 3NKKA 1FY8E 1C1NA 1HAZB 1DM4B 2J92A 1P3EA 2A31A 2Z3CA 2TRMA 5JBAS 1C5QA 1NFUA 1HIAB 2GDEH 2WV9A 1HYLA 1UK3A 1VZQH 3ZVAA 4FU8A 3A7XA 2XBYA 2ANMH 3SNDA 1QFKH 3W94A 1PQAA 1YY3A 2F43B 2IJD1 3NUMA 1EAWA 1MKWK 3Q77A 1Y3YA 4ASHA 4I7YH 2A4GA 1UTPA 1EAXA 3BTWE 2FPZA 1B0EA 3MOCA 4OS1A 1TONA 4DIHH 4TPYA 2AGEX 1VCQA 5A0AE 1P2KA 1C5WB 3UR9A 3ZZAA 4GVUA 3HKIB 3PV2A 1L2EA 2HOBA 1ZHRA 1XUGA 3TJVA 5C0UA 1A1RA 1O3GA 1XKBC 4UEHH 1EP5A 1AFQC 3B9FH 1G3DA 3T28A 2TPIZ 1LQDB 1HB0B 2KM0A 1QURH 2A5IA 2YMSC 1CO7E 2ASUB 1YM0A 3FAOA 1P57B 2IOTA 1OWIA 5KECA 1BTHH 5EW2H 3PMJA 1QGFA 3GCNA 1HRTH 1TNHA 1WQSA 1O5CB 4LZ1H 1MUEB 4NWKA 4FUJA 2R3UA 1DLKB 2JH0D 2ZCKP 2G81E 1QA7A 1TPAE 1O2OA 2BDIA 2Y7XA 1KYNA 3JZ2B 1AFQB 1O3FA 5C1UA 1OXGA 4K69A 1Z71A 2OLGA 4OGYA 3CENA 3LOXA 1ELAA 2YMSB 3SGBE 1H8DH 2H5CA 1BMAA 1GJ4H 1TNIA 4E7NA 3TLOA 3A84A 2BY6X 5A8YA 1W0JD 1V2TT 3E8LA 4XE4A 2JETC 3KQ5A 4NIVA 1Z8GA 1C5LH 3SN8A 1WU1A 3MH7A 4HFPB 3ZZ5A 1P10A 3LPRA 3L33A 1N6YA 3SV2H 1SKYE 1LQEA 1O2NA 2Z9LA 1LPZB 2QXGA 1BZXE 1D6RA 1UTKA 4IC6A 4I8GA 3GY8A 4I8KA 3HPTB 4D9RA 2F91A 1BMFD 2Q1JA 1AVXA 2PV9B 5JPMH 3LC3A 1Z1JA 1E79D 3EGKH 2F83A 2GCTC 3OEHD 1T32A 3T2NA 1GI2A 2CF9H 1J8AA 4I31A 2J2UA 2JETB 1K1JA 1SVPA 2HWLB 3C1KA 3URDA 2QN5T 2O8MA 1LPKB 4Q7ZA 5ESBA 3ENSB 3ODDA 2FLBH 2AIQA 5GNDA 3PM3A 1J16A 2A2XH 3VPKA 1MQ6A 1O3PB 1QY6A 1ZZZA 1A3EH 2ZQ1A 1H9HE 2AIPA 1GBEA 2WPJS 3A88A 1OWHA 3PRBA 4ZKSU 1PPBH 3VB6A 1JIMA 3DD2H 1K1NA 5C20A 2HNTE 2PKSC 3PYHA 2AS9A 2GCTB 4IMQA 2G00A 3FP8E 6LPRA 2HVYB 4ZHMU 3SJ8A 3D49H 3TITA 1G3EA 1XUHA 1BMMH 1CE5A 3DSOA 3MI4A 4O9VA 2ZPSA 4Q7XA 3KQEA 2FM2A 1GHAG 2XNDD 1UMAH 2EY4C 3RC4A 1HAVA 1NC6A 3B8JA 2ZI2H 2O8TA 4BTTB 4ISNA 2C3SA 2PKSB 2ZGBH 2FI3E 3K2UA 4DT7B 4YOGA 1F7ZA 4THNH 4FU9A 5FPSA 1W0YH 2QC2A 1UCYK 3K6ZA 1Y5BT 3GY4A 2BDGA 4TY7A 1JBUH 1UW7A 3NXPA 2FS9A 2J4IA 4JCNA 2EI6A 4XDEA 3GDVA 2BM2A 2ZWLH 2GP9B 2GTBA 3P17H 2ZGJA 4GPGA 2VGCC 4XRNA 2V35A 1TRMA 3SUGA 1AE5A 2XBVA 1U6QA 2BVXH 2FEQH 4JMYA 1O3DA 4Y6DA 1SLUB 1AO5A 5GCHF 3RXRA 1ZHPA 2V6NA 4WMFA 2ZHFH 3A81A 1MMJN 1O0DH 1ZTKA 2F9UA 3ZIAD 5L30H 2CMYA 1HDTH 5PTPA 3U9AH 1BMNH 1ABJH 2G8TA 3N99A 1G9IE 4D9QA 2AGIX 2VIOA 3LGWA 4INKA 1C1OA 1O2YA 2FI4E 1GG6B 2VGCB 3HK6B 1KLJH 3SGQE 3TNSA 1UO6A 1JMOH 1MTWA 1SG8B 2QXJA 1E1RD 1A0JA 4NWLA 5FAHA 3GS9A 1F5RA 5EQQA 1O39A 1P2MA 1GBCA 3KNXA 2XC0A 1TX6A 3BEUA 1KTSB 1O32A 1SLWB 1FLEE 1MD8A 2FO9A 3UB0A 1XUJA 2BX3A 5JBCS 1P03A 3V7TA 2FLRH 4AX9H 1QRXA 1IQLA 2J5UA 2R2WU 8GCHF 1ZRKA 3F2FA 2SFAA 3PLKA 2HGTH 2XBWA 2ZPQA 1RJXB 3Q3KA 1C2LA 4FETA 1NRQH 1WDIA 1QRZA 1ZMNA 1ETSH 1JWTA 1O33A 2Z9JA 1C2GA 2ZFTA 4AFQA 1KY9A 1TFXA 3UY9A 4NG9H 1W0ZU 3QN7A 3F3BA 4ABIA 2NWNA 2WPDD 3MNXA 5EQSA 1NN6A 2UUFB 4R8TB 1UTOA 4Y8XA 1VGCC 1S6FA 4TWWA 1NRPH 3W95A 1NY22 3EDXB 4CRCA 4B6EA 1IOEA 1P2QA 3ZVFA 5JBTA 1DICA 1GMCF 3S7HB 1W0KD 1MTVA 1SHYA 4YTAA 1C2FA 5L6NH 1GBKA 1MKWH 1YBWA 1D3DB 2ZDNA 2XW9A 4Y8ZA 2ZNKH 2D1JA 5HGGA 4IC5A 1BQYA 1XUKA 3VB4A 2R3YA 1VGCB 1HAVB 2CXVA 5F8XA 4A92A 4WF8A 1TRNA 3N7OA 1WOFA 7GCHF 1C4U2 1OOKB 2WPHS 1FPCH 1CU1A 2WSSD 2FOBA 1HCGA 3SNAA 1ESBA 1D3PB 1N1LA 3F2HA 2C8XB 2ZFSA 1HUTH 1IAUA 1PJPA 1AUTC 1SGPE 1FN6A 3R3GB 1O5FH 1ZYOA 2RA0A 2BDYA 2FWWA 3QTVH 4I33A 5AF9H 2GJGA 5SGAE 1TOCB 2NU1E 3HKJB 1H8HD 2FS8A 3MWIU 3LDXH 3U28C 1WYKA 3SU2A 3WY8A 2C93B 2G4UA 1QL8A 3BTEE 3FOAA 2ZECA 1LHEH 1YPKH 2FX6A 3PRDA 2PTCE 2TGPZ 2IJOB 3NZIA 1A61H 4K1TA 2BDHA 1EAIA 1ORFA 3PO1C 4ABJA 1GHZA 5LPFA 1TNJA 1O2PA 2AGGX 4YLUA 5FCKA 1BOQA 1SQOA 1CHOF 1UJ1A 2F4LA 4CH8B 3F9HA 3K65B 3TVJB 3TGIE 1DUAA 1LHFH 1Z1IA 3SU4A 1AZZA 2BY8X 5E8EH 1QCPA 1O31A 3T62A 5EXLA 3ZZCA 1SL3A 3A82A 5JDUB 5AHGH 2CHAC 3TK6A 3GCTF 1GHBF 3LT3A 1HXFH 1ZSKA 4K60A 3FZZA 1DS2E 1KLIH 1O2LA 1PPHE 4OGXA 1LVMA 4X1QU 3PO1B 4MNVA 1F0RA 3ITIA 3RLYH 2KCPA 1T7CA 3RXPA 1PFXC 4GSOA 4A6LA 3SJOA 1S0QA 1W7XH 5J4QA 2NU2E 1C1SA 1IQEA 2CHAB 4MNWA 1EPTA 3RXOA 2PSYA 1W12U 1DVAH 1S84A 2Z9IA 3HGNA 1GWAA 3EA8A 3VB3A 2OTVA 5K7RA 1GJ5H 1FQ3A 3TK5A 5BRRE 2UWLA 1BBRH 6ESTA 4UD9H 3UQVA 1ABIH 1GBJA 2B9LA 3MU8A 1W8BH 1XXFA 1MBMA 1C5XB 2SGFE 1OX1A 2TIOA 1ANCA 2C8YB 4B1TA 2P93A 2VH6A 1FMGA 3M36A 2OC0A 1KIGH 4X8VH 2UWOA 5FL7D 3PTNA 5L2YH 1C5RA 1GPZA 2KCOA 1C5OH 5EGMA 3VXEH 3BF6H 8LPRA 2Z9KA 4WMDA 1F2SE 4NA8A 1G3BA 1TBZH 2TGTA 1TX8A 3BTTE 4YXWD 2WYGA 3A8BA 3VGCC 1BIOA 1B0FA 1DUEA 2O8WA
chains in the Genus database with same CATH topology
4BTUB 4XOJA 1P12E 2ODQA 4JZIA 4GLYA 1GI3A 1E37B 1NESE 1BITA 3M5NA 2ZU5A 1DITH 4A1VA 2F9OA 3V13A 4K8YA 1ELCA 3S0NA 1BB0B 2XYAA 3ATMA 1LPGB 2WUBA 1YPHC 2Z3EA 3BIUH 3SBKA 3VGCB 1BTWA 3L3TA 2VINA 4O03A 1LHCH 3Q76A 5GIBA 4DGJA 1NZQH 3LGVA 1MTSA 1MU8B 4Y79A 1ELGA 2Z7FE 1V2UT 2AYWA 2FTMA 1ZRBA 1PPEE 4JZ1A 4DW2U 1FN8A 2H6MA 1UK2A 4VGCC 1KLTA 3RXVA 3UWJH 3RXLA 4WY3A 4ISHH 1Y3XA 4RN6A 2DE8A 1EQ9A 3I29A 1MAYA 1MCTA 2TBSA 4JZDH 4OS4A 1C5ZB 1P09A 4NCYA 1XX9A 4ZAEA 5DP7A 5EW1H 4KGAA 1J15A 1SOZA 5DG6A 1W13U 3U1JB 3TH4H 1EPTC 5IYTA 2GZ9A 1EZUC 1KDQA 1RIWC 1ANBA 2STAE 1O3HA 1OPHB 3C27B 3M5MA 5I46H 2FP7B 2BD5A 4VGCB 3E0NB 4UFGH 3A83A 3RXBA 2ZDMA 1GHYH 2P95A 1VCWA 2ZFFH 2VVUA 3B23B 1EB1H 4X6OA 5T6GA 3D23A 5HXFA 5DP6A 1O2KA 1GJBB 1EPTB 4AORA 3CS0A 1AY6H 1BJVA 1RIWB 4ZHAA 1TABE 2PLXA 3BV9B 4K8BA 1PPGE 2QA9E 5C2ZA 1NRNH 1BUIA 5FXLA 3SUFA 2BLVA 2HVXA 2OC8A 3RU4E 2XWBI 4BAHB 3RXKA 1E38B 5FX5A 4I8HA 5EQRA 4ZH8A 3UIRA 3MO9A 1BHXF 1CGHA 4X1NU 5T6DA 1G32B 3SNBA 4B75A 1WSSH 1V2QT 1YLDA 2FTLE 4U01A 3SV6A 4K1EA 2FODA 3FP6E 3KQCA 4IN2A 4NIYA 2Y6TA 2D2DA 3R0FA 4X8UH 2OC1A 1FJSA 2CN0H 1C1QA 4XSKU 7ESTE 1GBHA 2HLCA 1C2DA 1O38A 2ZU1A 2GD4B 4CRGA 1SR5C 1GMHF 3AVZA 2VH0A 2TGDA 1CA0C 2PUQH 4FUEA 2BY9X 1AE8H 1P0SH 3P95A 3U8RH 1JRSA 1S5SA 5AVDA 1Y8TA 4Z6AH 2FOHA 4AZ2B 4ISLA 2PHBA 2EI7A 2Q6FA 1C1MA 1K9OE 4IS5A 1YGCH 1P06A 1SQTA 2BX4A 5F03A 5T6FA 2A7CA 4D8NA 5A8XA 1RTFB 4AFSA 1GVKB 3UFAA 3GY7A 2H9HA 2OXSA 4NSYA 1CA0B 1LHGH 1WCZA 1EJMA 1DWEH 1YC0A 2BB4A 3BTKE 1FIZA 1T8OA 3EE0B 3LC5A 1EASA 1BDAA 1GI9B 1GBLA 3M7QA 4GHTA 3SU1A 1VCPA 1W2KH 1HAGE 3RXIA 3BIVH 5AFYH 1LKAA 3D65E 3OSYA 3TK9A 1DE7H 2BYAX 1P9SA 1WUNH 3UREA 1GHVH 3GY2A 5JYIA 3MNSA 5A0BA 3KIDU 3CP7A 3NWUA 4BXSA 1YCPM 1QIXB 2P3UB 1WTHD 2FIRH 3MH4A 3BTQE 3HGPA 2PKAB 1WBGB 2ZU2A 1QBOA 3OY5U 4FVDA 5C5OA 3LJOA 1NROH 3BEFB 1HFDA 2PGBB 1Y3UA 2GV6A 2ZO3H 1KDQB 1O2XA 5CE1A 2BZ6H 1RGQA 2BMGB 2FYQA 3RP2A 3ZVBA 2EA3A 2OUAA 2GX4A 1P8VC 3EAJA 2AMPA 1AQ7A 2KAIA 5DJ7A 1O3LA 2HNTF 1SGNE 1WQVH 3BN9A 2BQWB 3I78A 1V2WT 1MBQA 2G52A 2H1UA 4GCHG 1HXEH 2STBE 3H5CB 2DUCA 1TRYA 1Z7KA 3SJKA 1AVGH 1QR3E 1A0HB 3OTJE 2ZTYA 1BRBE 3ATLA 1AI8H 1O34A 2A2QH 3ZZ3A 1QB9A 1XKAC 3SUDA 1OYQA 5FPYA 3RMOH 3SUEA 1QBVH 3IG6B 1EUFA 1LCYA 1KTTB 1MAXA 1BTXA 1UTNA 2BD4A 1BTUA 2QCYA 1BBRK 3GYMA 3M3TA 1DSTA 2BDCA 4ZXXH 1TBQH 3RU4D 1E36B 4QT8C 2XC5A 2ZA5A 5C5NA 4KP0A 3MNBA 2XRCA 2FOFA 2VU8E 1INCA 2ZPRA 1LO6A 1BBRE 1GL1A 1L1GA 2ZHWH 1YPGH 3E3TA 1V2OT 5A8ZA 3UQOA 2B0FA 1T8MA 3IWMA 4WXVA 2PFEA 5EG4A 4YESB 1ZTLA 4U30A 3M5OA 1OWKA 1LVYA 3A7VA 1TMUH 1UVSH 3OU0A 1TGBA 3M7TA 1QJ1B 1HJAC 2ILNA 1ZR0A 5JBBS 2Y5HA 1KXBA 1NM6A 5L2ZH 3ZVGA 2RDLA 2C90B 1SBWA 2BOHB 2LPRA 1DOJA 4BNRA 3ODFA 1SLVB 3SU0A 3AW1A 3RDZA 1TIOA 4NIWA 4ZHLU 1IQIA 4NZQA 5E0HA 4AGKA 1GI4A 3PLPA 4NIXA 1QQUA 3MH5A 1BMLA 1ARBA 3ATKA 4DVAU 1DXWA 4KELA 2R2MB 3M35A 4X6MA 2F3CE 1PPFE 1HJAB 3S9CA 3VEQB 1WTGH 1YPHE 1GBFA 1TYNA 3PB1E 1AUJA 3E0PB 3AAUA 3UNSA 4JK5A 2ZP0H 2VWLA 4ZXYH 4ABGA 8KME2 1TMBH 3MU0A 1CT4E 1S81A 3OY6U 4AYYB 2J95A 3T29A 1P2IA 1GJDB 2F9NA 4AFUA 5EPYA 4X2YA 1A2CH 2HRVA 3MU4A 3RXHA 1IQHA 1MTNC 1TALA 3STIA 5LPEA 2ZU3A 1TB6H 1V2RT 4UFEH 1O2RA 1DT2A 4BAOB 1ACBE 2M5TA 2EEKA 2RCEA 1YKTA 4MPXA 1WV7H 2KAIB 4YM9A 5FX6A 3M5LA 3TJNA 2BQ6B 5HM2A 4JYVH 1C5MD 2IPHA 1AN1E 1C5TA 3V3MA 3KEEA 1O2WA 1GJ9B 1H9IE 1HJ9A 1TMTH 2GT8A 2XWAA 3ZZ6A 3QO6A 3FZDA 3MHWU 3OX7U 4AG2A 2EI8A 3EQ0H 2ZDAH 4HGCA 1GI7B 1MTNB 3LIWA 1ELVA 1OWJA 2GZ8A 2HPPH 1C2IA 1VITG 3BTME 3LGIA 1OWDA 4ZKRU 1O3CA 3UPEA 3GDSA 4U32A 3ZZ8A 4DIIH 1G30B 1TAWA 1P11E 2FOAA 3F9FA 2QIQA 4E06H 2HPQH 1HNEE 4CH2B 1A3BH 2GVFA 3EYDA 2J38A 2OC7A 1MKXH 1F92A 3QTOH 2OD3B 3RM2H 4D7FA 2A5KA 2QF3A 4OS6A 3ZVDA 4Q80A 4B2CA 5TJXA 2CGAA 4XBDA 2QGRA 2FESH 2UUKB 5GXPA 3BTFE 1BTZA 4CHAC 2QYIA 5DP5A 5FPTA 2R9PA 1JOUB 1YPMH 3MMGA 1RTLA 1NTPA 3O8BA 1O5DH 4RKJB 1PPZA 4MG3A 1EX3A 4IN1A 2WPLS 3T25A 2A5AA 1OP8A 2BVSH 1OP0A 5DP9A 3GCOA 3DHKH 1YP9A 3V0XA 1GJ6A 5EOKA 3T5FH 4Y10E 2UUYA 4CRAA 1XM1A 5JB8S 3EA7A 3Q3YA 2A7JA 4CHAB 2GKVE 4CRFA 3SV8A 5H4IB 1ELTA 1O2IA 3A8AA 2V3OH 3QZQA 4GUXA 1XUFA 2DE9A 1T8LA 1EJNA 2OINA 1OWEA 4DURA 3AW0A 4KTCA 4LOYH 1ZPBA 3ZVCA 5F6MA 1TQ7B 4ZROA 1BRCE 1H4WA 3VB7A 2ZCHP 4M7GA 4NFEA 2ZGXH 1KXAA 4H42U 1GL0E 2O9QA 1GBIA 2ZDLA 1TLDA 4H6SB 4X2XA 1SI5H 1S85A 2GGVB 1V2PT 3ZZDA 2OCVB 3SORA 3G01A 4I32A 1DY8A 4ABDA 1Z8RA 3DFLA 5GPIB 1O30A 4X2WA 3BTGE 4FUGA 1P9UA 1EOLA 1GJ8B 2P8OC 1A4WH 1GDNA 5DGJA 1Y5UT 1GMDG 3RXQA 1O37A 1C4V2 1CHGA 3A87A 1GMCG 1K22H 1PYTC 1SGQE 4K3JA 1ZPZA 1FAKH 4OS7A 4X1SU 5DK1A 3DT0H 1O3MA 3T26A 4FU7A 1NFWA 1DFPA 1KXFA 3ZZ4A 4GHQA 4F49A 3AAVA 4NA7A 3VFEA 1BRAA 4Q7YA 5GJ4B 2ZFQH 3MYWA 1NFXA 2P8OB 1K1IA 2C4FH 1C1UH 4O3UA 3RC6A 4KKDA 2ZC9H 1Z8IB 4NFFA 2RG3A 5J4SA 4AGJA 9LPRA 2H9EH 3PMAB 1HAPH 3QUMP 2LNCA 3Q3XA 1FY4A 1TGTA 3P8NA 2AMDA 1QQ4A 1EKBB 2A7HA 1KSNA 1N6XA 1AIXH 1G36A 2IN2A 4ABBA 1ZTJA 3CS7A 4BANB 1HLTH 7LPRA 1KXCA 1JRTA 2H2ZA 2OQUA 3A85A 2GDDA 4A1TA 1QHRB 3U1IB 1J17T 1UVTH 1CGJE 2OP9A 2SGDE 3KHVA 4HTCH 4UE7H 3RXAA 2ZTXA 4CRDA 1FY5A 5E2OA 4O3TA 5DP3A 5HM9A 1O3EA 2A32A 1CHOG 1IHTH 1MQ5A 4RSPA 4MVNA 1F0TA 2D8WA 5A09A 5B6OA 1RFNA 1DWDH 1TA2A 1JIRA 1GI6A 2P16A 4SGBE 4X1PU 3LH3A 3SQHE 1WAYB 2AERH 1EB2A 1EATA 4A1XA 1EXFA 1T8NA 4K1SA 2ZKSA 2ANKH 1ID5H 2FOGA 3RXCA 1CBWC 1P2OA 4NZLA 3RXDA 2GZ7A 5HYOA 3BG8A 3PTBA 2ULLA 3RLWH 1SGYE 1SFIA 2UWPA 1SPJA 3ZZBA 1C1PA 3LU9B 1TQ0B 5DP4A 2BQ7B 3OYPA 2QXIA 4R0IA 1DDJA 2ZZUH 1L1JA 2W3IA 4JYTA 4LXBH 4ESTE 1A5IA 2VIDA 2FDAA 2ZGCA 1HPGA 1BT7A 1P05A 1Y3WA 1VITH 6CHAC 2ZGHA 1CBWB 3F1SB 4X0WU 1Z6EA 2PKAA 2C8WB 5DPAA 1ZLRA 1LMWB 1ESTA 1FNIA 1P2JA 1ZPCA 3ELAH 1K1LA 4WWYA 2G5VA 1FY3A 2GV7A 4YT6H 1ETTH 4CRBA 4FUHA 1L1NA 1TPSA 1IQJA 1CGIE 1EZXC 5TCAA 4U2WA 2ALVA 1O5GH 4MLFB 3SNEA 1EP6A 3A89A 3F68H 3ZZ7A 6CHAB 2Y5FA 2ZDVH 1DANH 2FZZA 1CQQA 1V6DA 1LTOA 2AFQB 3K9XB 1GDUA 2BD3A 1B5GH 1O5EH 3QK1A 1G2LA 1NPMA 1VJAU 1W14U 3RXMA 3GDUA 4FUIA 3S69A 2VIPA 1GCDA 1GJAB 3TH2H 2VIQA 3U69H 1ESAA 4BOHA 1SLXB 3TIUA 5FBEA 3QGJA 3QGNB 2EC9H 1HAYB 2A4OA 3KL6A 1A5GH 3GYLB 2QV1A 3TU7H 5BPEA 2ZTZA 3DFJA 3RXUA 2CV3A 3KQBA 5EODA 2Y81A 1CT2E 1FPHH 3M61U 2CF8H 2P94A 1F0UA 1T31A 2A4QA 2A0QB 2XXLA 3SI4H 4WH8A 2G5NA 1BTYA 1DPOA 1UVOA 5F8TA 1E34B 5DO4H 1J9CH 1K21H 3HK3B 3SOSA 1QNJA 1GVZA 1ZJDA 1JXPA 1E0FD 3TJUA 1EJAA 3FP7E 1P3CA 4X6NA 3ZZ9A 1MKXK 6GCHG 3ATWA 3F9GA 1Y59T 3DA9B 3SU6A 4K5ZA 2BLOA 3PWBA 4B76A 1AB9C 1TOMH 3RMMH 2VJ1A 3SV7A 2BLQA 5IDKA 5C3NA 1V2MT 4MPWA 1IQNA 4SGAE 4BTIB 4X6PA 2FX4A 2BD8A 1MH0A 2D26C 5F8ZA 1SOTA 3TH3H 4JZEH 2YNBA 4I8LA 1G2MA 1GBAA 2PGQB 1HV7A 3ATIA 2GCHG 2GMTC 2G51A 1LKBA 1OS8A 2VWMA 1B7XB 1F5KU 1AB9B 4AG1A 3LONA 4IBLH 1QB1A 2R0LA 4GCHF 1GCTC 1V2KT 2ZQ2A 4BXWA 2VIWA 1XVMA 3LGYA 1ETRH 2Y5GA 1AU8A 1L0ZA 1H1BA 1QB6A 3LKWA 3RXJA 5A2MH 2XC4A 1ELFA 1C5YB 4INHA 3HATH 5C1XA 2BXUH 2Q6DA 4XBBA 1V2VT 2ALPA 4AB9A 3E1XB 3QX5H 1K1OA 2GMTB 1TPPA 3UNRA 3A7ZA 1QL9A 2F9VA 3TGKE 1SGFG 1MZAA 2P59A 2QY0B 1GCTB 4XBCA 1C1WH 1FY1A 3S7KB 1O2GH 4ABAA 1THPB 1EZQA 3RXGA 1TWXB 2FOCA 1C2EA 1SGEE 1AWFH 4ZUHA 1BA8B 1GBDA 1K1MA 3SNCA 1GBBA 2BD2A 3NPSA 1QA0A 1TNLA 1GBTA 3SU5A 1C9PA 5EXNA 3QDZB 5E2PA 4ABEA 1GHAF 3H7TA 1MCVA 1UK4A 3TPIZ 1DSUA 1GMHG 1SMFE 4KTUA 2SGEE 1PQ8A 2BOKA 3RMNH 4AN7A 1SC8U 2HALA 4YZUA 3MH6A 4Y0ZE 2A1DB 3UWIA 4BAQB 4UDWH 2ZCLP 4KTSA 1O5AB 2BY7X 1SGCA 2JKHA 1TGSZ 1M9UA 1RD3B 2ZEBA 3EA9A 1HJ8A 4E7RG 1EZSC 3NK8A 1FONA 4B2AA 1ZMLA 3SJ9A 2SGQE 4MDSA 3RMLH 2F9PA 3RXSA 4FVBA 1S83A 5A0CA 1HGTH 2I6QA 2BLWA 2BY5X 1ZSLA 1A7SA 1GI0A 3LGTA 2WPMS 3UTUH 1A0LA 3V12A 3BSQA 3LJJA 1UTQA 1EOJA 1CA8B 4NGAH 1LHDH 4FXGH 4CR5A 5K0HA 5CHAC 5FCRA 3O8CA 3QLPH 4XFQA 1DX5M 1PQ5A 1LVBA 2B5TB 2XTTB 5JB9S 4Y11E 2BD7A 3VXFH 2ZG0H 1FI8A 1TA6A 1RS0A 4MNXA 1Q31A 4CREA 1Q2WA 2C8ZB 4UFFH 1NU7B 2J94A 2W7SA 2FXRA 1O2QA 5CHAB 4CR9A 1O3IA 2ZHEH 4DY7B 1SGRE 2P3FH 3M37A 1NFYA 3A80A 3M3VA 3U8OH 4FUCA 3SHAH 1W3CA 2ODYB 3O8RA 4A5TS 3GY3A 3I77A