4IW4E

Crystal structure of the serine protease domain of masp-3 in complex with ecotin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
274
structure length
244
Chain Sequence
IIGGRNAEPGLFPWQALIVVEKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLGPAPHMLGLVAGWGISNLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Ecotin
publication title The Serine Protease Domain of MASP-3: Enzymatic Properties and Crystal Structure in Complex with Ecotin.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 244
sequence length 274
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4iw4E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4iw4E02
5TCCA 1YC0A 1QRZA 1WTHD 1CU1A 4DIIH 1VCQA 4NSVA 4YTAA 3KQEA 3SU6A 1ZPCA 3BTDE 4MPXA 1KXDA 5AF9H 4JK6A 2AGEX 1K1PA 1TALA 5DP7A 1CE5A 1SQOA 2W26A 4AOQA 2H2ZA 1KXAA 1OP0A 1G37A 1O3KA 1HDTH 1INCA 2FLRH 3UTUH 5J4QA 1L2EA 1SMFE 5L2ZH 3A80A 1O3BA 4X8UH 3QN7A 5EXLA 2ZDKA 3TGIE 1IQJA 2HPQH 4MNXA 3GY4A 1QRWA 1BDAA 4WXIA 5DP4A 2PFEA 2PSXA 4I32A 2J9NA 3FVFB 2H5CA 1FY4A 2BDHA 2PV9B 5EPYA 5FPYA 4I8HA 4X1RU 1B0FA 1OP8A 1UTKA 2F3CE 2SFAA 4FU9A 2O8WA 1GWAA 1GCDA 5DKMA 3RM2H 4LZ1H 4AG1A 1MAXA 5FX6A 1NRPH 1MTNC 1GI0A 5C5NA 1NTPA 2SGEE 1HLTH 1UVPA 4MPWA 2GCHF 3BG8A 2SNVA 3BEFB 1V2QT 3KNXA 1WTGH 3Q3YA 1VZQH 2BDGA 1WUNH 3RC4A 2HVXA 2CN0H 3PTNA 4XBCA 1G3DA 2ZO3H 1C5MD 1TX8A 2AGIX 2BLQA 3IWMA 1O35A 1BT7A 2FI5E 4VGCB 2BQ7B 1P10A 4Y7BA 3RXCA 5F8TA 3SZNA 2ODPA 3GDUA 2ASUB 2Z3DA 3KN2A 2A31A 4K60A 4AFZA 2W3KA 1AB9B 1NY22 2BDIA 4I8LA 1UTMA 2XNIA 4GCHG 4BXWA 4THNH 2OC7A 3T28A 4LOYH 3UFAA 2VIVA 3VGCC 2ZDAH 2TPIZ 1QNJA 1MKWK 4INKA 5LPEA 2ZA5A 5JYIA 5LGOA 1DANH 5B6OA 2ZU2A 1KYNA 3K6ZA 1S81A 1V2UT 4YLUA 4CRAA 4KP0A 3BN9A 1UVOA 4B2BA 3RXTA 2AH4X 3LGTA 3MO6A 3PM3A 1ELVA 4YOGA 3M5NA 1EP6A 1XVMA 5L30H 1ABIH 1QJ1B 1O37A 2P16A 1EUFA 1YYY1 2B0FA 1MQ6A 2BDYA 4UDWH 1CBWC 1F0SA 4I8GA 4A7IB 1O0DH 4YM9A 1WYKA 2EI6A 1GCTB 3GCHB 1W0ZU 1QJ7B 3QK1A 1BJVA 2BHGA 1C1OA 1J17T 2NU4E 2VIPA 3TU7H 2FEQH 1Z7KA 4YT6H 1NPMA 3JZ1B 2ZDNA 1JIMA 1NS3A 2CF9H 1XMNB 5DGJA 1OXGA 4OS1A 5JBCS 2EEKA 2IOTA 4ZHMU 3LGVA 4UE7H 1C5UA 4ISIH 1AGJA 3HATH 1G3BA 4H6TA 1GGDC 4J2YB 4ZKRU 3ZVAA 1QB9A 3A88A 2C3SA 1SGQE 3MOCA 2PLXA 3M5MA 2FS8A 5E0GA 1GBJA 1AVWA 5JDUB 2ESTE 4Q80A 3RXOA 5F03A 4X1PU 3L3TA 2G5NA 4FUFA 3EA9A 2BVXH 4FUJA 1DWCH 4F49A 1OWDA 1DSTA 1O2TA 1GHVH 3GY5A 3O8RA 4A5TS 5DP5A 1DVAH 3T25A 1C5ZB 2HGTH 4K8BA 4X1QU 4X6PA 1O3EA 2G00A 4ABJA 2H9HA 1QCPA 3BG4B 3SGBE 3SORA 3MU0A 1V2WT 1HV7A 4UD9H 1LVMA 4K5ZA 2FODA 4MPUA 2BYAX 3KQCA 4ZHAA 1AHTH 1MU8B 1O5CB 1EPTC 2ZFSA 1P2OA 2VJ1A 3MMGA 3HGNA 3C27B 1SGYE 2FOHA 4X6OA 1Z8RA 1HAXB 1P0SH 3R3GB 4AGJA 3C1KA 2H9EH 3FP8E 1NU7B 2QC2A 1P2NA 3RXMA 3SGAE 1NFYA 1AE5A 1C2FA 3K6YA 5DG6A 5FX5A 2P59A 3OX7U 1BB0B 1CT2E 1BBRH 3A8CA 3M36A 1S6FA 2UUYA 1ZYOA 4J1YA 1XKAC 1MD8A 4NZQA 1QJ6B 1YKTA 4R8TB 4FUGA 1PPZA 2IJOB 1ESAA 2Z6BD 2P3FH 5JB8S 1ETTH 4Y6DA 1ZJKA 3RXDA 6ESTA 5J4SA 2Y82A 1AE8H 2ZCLP 2Q6DA 4FVBA 1FI8A 3SI3H 1EKBB 3P8FA 4GCHF 3FP7E 2A4OA 2VWMA 2W7SA 4CH8B 3SJIA 2GT7A 1RIWC 3ZV9A 1O3NA 1THRH 1NZQH 1CGHA 1O5FH 3GY3A 2BXUH 2CV3A 1C5VA 3B8JA 1Q3XA 1C1NA 1YPEH 1L0ZA 1KTSB 3E6PH 1W11U 2ZDMA 4DW2U 4U01A 1C2LA 4MNVA 4ISNA 3MU5A 3UQOA 1GJ7B 2IN2A 3OY6U 4O97A 2J95A 3KQBA 3RMLH 3W94A 2R9PA 3PMAB 5EQRA 3A7TA 3JZ2B 5C2ZA 1AU8A 1AD8H 1BTHH 4CRFA 1GDQA 1AVGH 2P3UB 5AFYH 2A0QB 2A5IA 1DE7H 4WXVA 2XC4A 2JH6D 1JBUH 3NZIA 4I31A 1O3IA 1QBVH 2ZFQH 2ZHFH 2ANMH 4CBOA 3QGJA 1HXEH 3ODFA 4DOQA 1EB1H 2QXGA 2M5TA 1ID5H 2KAIA 2ZGXH 1FUJA 4MG3A 1VGCC 1UK3A 1LHFH 4HZHA 1NFXA 1C1VH 3EQ0H 3RUOA 1MKXH 2R2WU 1O2UA 1MTNB 1ANCA 1H9LB 2OTVA 2KAIB 3GISB 4KELA 2YOLA 2GKVE 4KTCA 4TPYA 3TGKE 1LKBA 1LPGB 1J9CH 1FONA 1XXFA 1A46H 4O9VA 4HFPB 1SLVB 2BY8X 1CO7E 2J4IA 1GI3A 1PQAA 1EP5A 1E38B 2BX4A 3UNRA 3ATIA 1SLUB 3F68H 1HAIH 1NESE 1K1OA 1BRCE 3RXFA 4CRBA 3P95A 4ZXXH 1W10U 2FTMA 4IN1A 3P6ZB 1FN8A 2Z9KA 2OQUA 3E91A 1QFKH 1TQ7B 2ZCKP 3FFGA 3SNDA 1P3CA 2B7DH 1L1JA 5GWZA 1YGCH 2WPKS 5C1YA 4BANB 2G52A 1BBRE 1SR5C 2AYWA 1TMBH 2FXRA 1TA6A 3LJOA 3VGCB 2H5DA 1D6RA 3MNXA 3STIA 1GMHG 3NK8A 3Q77A 1HJ9A 2Z3CA 3I77A 1AKSA 1SGPE 2XCNA 3ATKA 2BLOA 1ZTJA 1NT1A 1C5LH 4JYTA 3URCA 4O03A 1CA8B 1GVLA 4FUCA 2BMGB 1J14A 1X7AC 2TIOA 1QQUA 2P94A 3H5CB 4INHA 4B2CA 4UONA 2OC1A 1AKSB 1TGNA 3SU0A 1EATA 5EW1H 2ZZUH 1CBWB 1P03A 2HPPH 3ZVBA 2P8OB 1ELEE 3RXAA 5HYOA 1TRYA 1FDPA 5FBEA 1SG8B 1AFQB 4NWLA 3SUDA 1GMCF 2ZFRH 2G8TA 4XSKU 1N8OB 1AZZA 2GD4B 1THPB 1J15A 4B76A 4IMQA 1EQ9A 2BLWA 1VCWA 2WPJS 3NKKA 1L4DA 3QO6A 4NA7A 3LKWA 4X6MA 1NRQH 4K1TA 3F1SB 3E1XB 5EPNA 1GL1A 2FTLE 4NFEA 1O38A 2ZGJA 1Z8JB 2HOBA 3ZVEA 4CRDA 2J38A 1LVYA 4U2WA 1V2LT 4E7NA 1ARBA 1IQNA 1IOEA 6CHAB 3KQDA 1T4UH 7GCHF 1ZSKA 1NN6A 1O2ZA 1TRMA 4QT8C 5LPRA 1QIXB 2PKSC 4ZKSU 2WINI 1FAKH 1AUJA 2GCHG 2ZGBH 3RXQA 3RU4D 2VWNA 4NIXA 1TGSZ 5C20A 1TGBA 2ODYB 1G9IE 1EPTA 3TVJB 2Y5FA 1CHGA 4Q7ZA 1ZHPA 1RJXB 5EG4A 1HAVA 1H4WA 4WH8A 2A32A 1LVBA 3ZV8A 1S0QA 1PPHE 1O5EH 2V35A 5G4BA 4WMEA 1O2SA 1O2HA 2O8UA 2J2UA 4MLFB 4AG2A 3V7TA 4YOIA 1NFWA 2PKAB 4ABFA 5A0BA 2D2DA 2BLVA 1YPHE 1GBBA 4X6NA 5DK1A 1ORFA 1YCPH 1TX6A 3ODDA 1D3TB 3TJNA 3SI4H 1O5DH 2G51A 3RC6A 2Z9IA 3GY7A 3VFEA 2Z7FE 1KLIH 5FCRA 1H8DH 3U9AH 4DGJA 1PFXC 3ZZDA 3SBKA 2ZDLA 2Q6GA 3SU1A 1OOKB 4FU7A 4IC5A 1WQSA 1ZTKA 1UTJA 2QF3A 1YCPM 2XBXA 2R0KA 4X2YA 2C8YB 1GI6A 3ZVDA 3O8CA 1EOLA 1V2NT 2ZU3A 1FN6A 1FY3A 4WMFA 3BEUA 1S82A 3DHKH 5BPEA 1D6WA 2TGPZ 1BMLA 4FU8A 4GVUA 1LHDH 1RIWB 2SGFE 1MKXK 1XUIA 3LDXH 4WH6A 3TH2H 2STBE 3RXHA 5CHAB 6GCHF 1DUAA 1CT0E 1GBMA 1G2LA 2W5EA 2ZHWH 3QX5H 3ZVFA 1HAZB 2FOEA 3T2NA 1ACBE 1QRXA 1C1WH 3TIUA 4MTBA 4ISOA 5IDKA 2SGPE 1TPAE 1HAYB 2ZECA 1HGTH 2A2QH 1P2QA 1HYLA 1YPHC 2VVVA 4IMZA 1YM0A 1LHGH 1GHZA 1FMGA 1A5HA 2ZIQH 4ZAEA 2BY9X 2NU2E 1V2PT 1PQ7A 1LDTT 1IQIA 3TJVA 2G55A 1WV7H 2P95A 2ZGCA 1FY5A 2DE8A 2GTBA 3F9GA 5PTPA 4INLA 1GBLA 2F9VA 3SU3A 1C5TA 1HJ8A 2JETB 3SU4A 4E7RG 1P05A 1VGCB 3A89A 2GCTC 1GI1A 2C8WB 3QZRA 1P02A 1TGTA 1C2GA 1W7XH 4X1SU 1ELBA 2ZU1A 1PYTD 2SGQE 3UOUA 3SW2B 2TBSA 3PMHB 4YOJA 1EJMA 2FI4E 2ZQ2A 1SGNE 1UTOA 3E0PB 2OC0A 5GIBA 4GSOA 4TWYA 4CBNA 3TH4H 4I8JA 5A8XA 1A0LA 3DT0H 5A0CA 3ZZAA 1E36B 3SNCA 2VH6A 1AI8H 3LGIA 3NUMA 4CRCA 3BTTE 4D9RA 2VNTA 4NZLA 3P70B 1SGFA 1TNHA 5GCHG 3UNSA 8KME2 2Z9JA 2QXHA 2Z3EA 1O3JA 4AORA 2A4QA 3MI4A 2BB4A 2F9PA 1GJ5H 3PO1C 3S69A 3U69H 5GJ4B 1CSOE 1HRTH 1Z8IB 3LJJA 1C5XB 3SNEA 1ESTA 3LPRA 3QZQA 2BD7A 5JB9S 1N6YA 1RFNA 2FIRH 1AFEH 3U8RH 1K9OE 3RXBA 2ZG0H 3MYWA 1UK2A 1ELFA 2BDCA 4OGYA 3S0NA 1GJ6A 3M35A 4U30A 5EXNA 1F5KU 1RS0A 5C5OA 1TX7A 2F9BH 1O2RA 3K65B 4RKOB 4X8SH 2FI3E 4XBDA 1SPJA 4BAOB 1C4V2 3BTFE 3MNBA 3P8OA 3RXRA 5HGGA 1HXFH 3S9CA 2F9UA 2BY6X 1TPOA 2RCEA 1DOJA 2FM2A 1KXFA 3RXGA 4GHTA 1CVWH 2A7HA 4NWKA 4K1EA 2ZU5A 2ZWLH 1GBFA 1LHCH 4TYDA 3SO3A 1VITH 2Q1JA 3ZYDA 3ZZ5A 4D76A 5BRRE 1C9TA 1C5SA 3A7ZA 3K2UA 1C1PA 4YESB 1VR1H 1O3PB 2W7UA 5EW2H 2NU0E 5K0HA 1OSSA 3TITA 1SC8U 3RXJA 2Z9LA 1MBQA 5AFZH 1V6DA 1ZMNA 1CA0C 1FQ3A 3RM0H 2FMJA 3VXEH 1TQ0B 2RA3A 9LPRA 2PKSB 2J34A 1O2OA 3UR9A 1P2MA 1HJAB 1C2EA 1QB6A 2CHAB 2FOFA 1UTPA 2TRMA 3UWJH 4D8NA 2ZCHP 1KIGH 3OTJE 3FANA 1ANDA 1PPGE 1F5LA 1LKAA 2PGQB 5E8EH 1UCYH 1DDJA 1SGTA 1O2QA 1E37B 4ABBA 5A0AE 1K2I1 2FOGA 2TGTA 1FNIA 1A0JA 4YLQH 4ABGA 1ANEA 2Y80A 2O8TA 3OSYA 1ZLRA 1QBOA 3RMOH 1ESBA 1FXYA 1HB0B 1BQYA 1W2KH 2OCVB 3BIVH 1TFXA 1W8BH 1UO6A 2B9LA 1YPJH 3RXVA 1A2CH 1XUFA 1GBCA 4Q7XA 1JRTA 1BTUA 1THSH 4NSYA 4GAWA 1P9SA 3T26A 1MD7A 2OUAA 4JZFH 1DUEA 4Y79A 3TNTA 1D3PB 4NFFA 1LTOA 4ABIA 5EU8A 1C4U2 4CR9A 4UFEH 2ZI2H 2WPMS 2THFB 3ATWA 1NO9H 3M61U 1O5AB 2A7CA 4K3JA 3PWCA 3MNSA 1Y3XA 1GI7B 1W13U 1TBQH 2AMPA 5GCHF 1QL9A 3HGPA 2BXTH 1JOUB 2OQ5A 2QY0B 1MZDA 5F8XA 2ZU4A 1FY1A 1UTNA 2FESH 1GMCG 1RTLA 1ZOMA 1KLJH 1BHXB 3VB7A 4RSPA 1K28D 2GZ9A 1GMDG 2GZ8A 1C2DA 1H1BA 1Y5BT 2O8MA 1O2NA 4HI3A 2BZAA 1C2JA 4NCYA 3BTGE 3E16B 2F9NA 1XXDA 3SJ8A 1ZHRA 2RG3A 3A83A 2BQ6B 3U8TH 1V2ST 3MWIU 1QY6A 3MH7A 2H1UA 5F8ZA 5HMAA 2QXIA 3KL6A 1SGIB 4GLYA 2ULLA 2FZZA 2OP9A 4FUDA 4FXGH 3MU4A 1MTVA 2AEIH 2C90B 3AVZA 3OU0A 1QR3E 7GCHG 2EA3A 2FLBH 3B9FH 5JBTA 3ITIA 1S83A 2FYRA 1DY9A 4JK5A 1V2OT 2JH0D 4XOJA 1N6XA 1O3FA 1GVKB 1ELTA 1FAXA 2HNTE 2UUJB 1ELAA 1QA0A 4HTCH 4RN6A 4BTTB 1GI8B 1FIWA 3A87A 3BIUH 2JKHA 4OS5A 1QA7A 5FAHA 1DPOA 1IAUA 4UFGH 4DVAU 2GCTB 2VWOA 4SGBE 4IW4E 1EZSC 1RRKA 1UCYE 2PSYA 4H4FA 1SGFG 5EQQA 3PV4A 2WPIS 3ZZCA 1O2GH 4Y7AA 3F9HA 4DURA 5JBAS 1AWHB 1QL7A 2LPRA 4FUBA 2AGGX 3EGKH 3ZZ8A 4KGAA 1ETSH 3E3TA 4H42U 1ZRKA 2FPZA 1XVOA 1IHTH 2A4GA 3VEQB 1VJAU 4JZDH 5CMXH 1DX5M 3RU4E 2TGDA 2CF8H 5FPSA 1K1NA 3GDSA 1JXPA 1W3CA 2A2XH 2GVFA 1V3XA 3TLOA 2BQWB 4A6LA 1Y3WA 2FS9A 1DWEH 1ZZZA 4Y76A 1GJCB 3CENA 1Y3VA 2HRVA 4ZMAH 1SVPA 1CQQA 1F0UA 1C5PA 2PUXB 3PO1B 3BTQE 1HAOH 3A8DA 1K22H 3A86A 1V2TT 3G01A 3H7OA 3GOVB 3RP2A 3QWCH 3E8LA 1B7XB 1NROH 2IPHA 3ZZ9A 1ZRBA 3VXFH 3LT3A 1SHHB 4IS5A 4NGAH 1DXWA 2Y5HA 1C2MA 2BDBA 1YBWA 3MH5A 1K1LA 2ZPSA 1O33A 1C5QA 2HNTC 2ZKSA 3RXKA 5K7RA 2C8XB 1GI9B 1U6QA 1K1IA 1UMAH 4B2AA 1Y5AT 5EOKA 3QTOH 6GCHG 1GL0E 3Q00A 3A84A 3VPKA 3ZZBA 1D3DB 2J92A 3M5OA 3SV7A 1P01A 4A1TA 1TOCB 2V0BA 2Y81A 3UREA 3FAOA 1PJPA 1BMAA 1O2IA 1SOZA 1UCYK 1EAXA 2ZDVH 2ZTZA 3BTME 3RXSA 3ZVGA 4JCNA 1ANBA 1F5RA 3LGWA 4YO9A 1ZHMA 3MU1A 4Y11E 3A7VA 3MO9A 3GY8A 3AAVA 1FPHH 1TMUH 3R0FA 3ZZ3A 1A61H 1PPFE 2QA9E 2ZF0H 4JMYA 1KLTA 1DFPA 2STAE 2QV1A 1GHAF 1GMDF 2GT8A 3UOPA 3FZDA 4LZ4B 2EC9H 3HK3B 4OS4A 1GBKA 5LH8A 1KTTB 4X2WA 1O5GH 1P9UA 4WY3A 2SNWA 1OKXA 1SL3A 5DP3A 3VB5A 1BMMH 5TCAA 1CA0B 2I6QA 2H6MA 3OY5U 1GGDB 2FO9A 3U98H 5DP9A 4CR5A 1HAPH 1Q31A 3V3MA 2QCYA 1ELGA 4IN2A 4NIYA 1O2MA 1S5SA 4TWWA 2AS9A 1CT4E 1GCTC 3UWIA 1KY9A 3ZYEA 4WJG2 1OX1A 1A5GH 1P04A 3SQHE 3LGYA 1DM4B 3A8BA 1BBRK 2V3HH 1GHBF 3GCTG 3TK5A 1VITF 1Y3UA 1OS8A 1ZTLA 4D7FA 2ZFTA 2BY7X 4BAQB 2PUQH 4IGDA 1E35B 2HLCA 3L33A 3PMJA 7ESTE 2QXJA 1IQLA 4CH2B 1DY8A 1TOMH 1SGCA 3TK6A 1V2VT 3SUGA 4JYUH 5A8YA 4Y71A 1TONA 1GBAA 2Z94A 1Z1IA 2HALA 2VIWA 3MU8A 5E2OA 2ZHEH 2QAAA 1XUHA 1O3OA 1IHSH 2Z9GA 2PWXA 3EE0B 4OGXA 5E0HA 4ABDA 3RXIA 2HNTF 2QGRA 1LPKB 3V0XA 5E2PA 3DFLA 4E05H 1EPTB 1AQ7A 1HUTH 1C9PA 3SUFA 1RTKA 2W3IA 4O3UA 3SU2A 1T7CA 1OYTH 5A09A 1HAVB 1QQ4A 1LCYA 3UQVA 3HPTB 2OBQA 1OPHB 1T4VH 1GPZA 3H7TA 1O3DA 3Q3XA 2GZ7A 3GYMA 1NFUA 1YPMH 2FOAA 1YP9A 1BJUA 2QN5T 3SQEE 2DE9A 2R0LA 4D9QA 1T32A 3M7TA 1UHBA 1UTLM 4D7GA 1MBMA 1YLCA 2ILNA 5I25A 1GHYH 3U1IB 3EYDA 1TIOA 1TBRH 5EODA 5LPFA 2WYGA 1HBTH 4BAHB 1T8LA 1NRSH 1WCZA 1O39A 3A81A 3ZZ7A 1Z71A 1ETRH 1W14U 1SI5H 4Y8ZA 2A45B 2BX3A 1DSUA 4XE4A 2QYIA 2VB0A 4GUXA 3SU5A 1FV9A 3RLYH 1IQHA 3K9XB 1GJ4H 1C5WB 4KTSA 1O2YA 3DD2H 3S9BA 8ESTE 1O34A 2F9OA 1MUEB 2BVRH 4X2XA 1J8AA 1GHWH 2FYQA 1TLDA 1D3QB 3STJA 1HFDA 1YPGH 1PYTC 1DICA 1EX3A 3CS7A 3SV6A 3HKIB 1O3LA 2XWAA 5FXLA 2NU1E 2XYAA 1GG6C 3AAUA 1ZR0A 1A7SA 1AMHA 1S0RA 1P09A 1P2KA 2JH5D 3ATMA 5EGMA 2XWBI 3VB3A 1EZXC 6LPRA 1H9IE 1MCTA 1DXPA 1XM1A 1MAYA 2AIQA 2VGCC 2VVUA 1SGRE 2WUBA 2OXSA 4YZUA 5FBIA 1A0HB 1EAIA 3TH3H 1HAGE 5A2MH 1ZPZA 1NRRH 3SNBA 4OS6A 5JPMH 2OBOA 5CE1A 1IQKA 4M7GA 3P92A 1JWTA 4YT7H 5C1UA 2F91A 3BTWE 2AIPA 2VVCA 3M5LA 5HM2A 3MFJA 1GI5A 4JZEH 1CHOF 3I78A 5T6DA 3M37A 1XUGA 1TAWA 3VB6A 4X0WU 3IITA 2ZGHA 3BEIB 3SV9A 5ETXA 2ANYA 1FY8E 1P11E 3GCTF 1EAUA 1MTSA 4Y0ZE 1P8VC 3NWUA 1C5YB 3P8NA 4A92A 4TY7A 3LIWA 3A7XA 1KDQA 1EJNA 1EJAA 1P2JA 3TJOA 2O8LA 1T31A 2XCFA 2OLGA 2XBYA 1GBIA 1MH0A 2SGAA 3D65E 1BHXF 4Y8YA 4ABHA 2H9TH 4OS7A 3WY8A 1LO6A 3DUXH 3ZZ4A 4AYYB 3O8DA 1CGJE 1W0YH 2G4TA 3ZZ6A 2BD2A 1KDQB 3KEEA 4AX9H 1K21H 3SJOA 2ODQA 3DA9B 3F9FA 1ZSLA 3MHWU 1IQGA 5GXPA 3V13A 1TPSA 1RTFB 3LC5A 3O8BA 4OS2A 2WV4A 1A4WH 1GI2A 2EI7A 3OYPA 1AWFH 2R3UA 4AYVB 2GMTC 4BTIB 3T29A 4CREA 3SN8A 1P06A 4B73A 1WOFA 4ESTE 1Q2WA 1O2WA 2OD3B 2HWLB 1NU9A 4BNRA 1HCGA 2D8WA 4CHAC 4NIWA 1TPPA 4B75A 3RU4T 1O3MA 1V2RT 3NCLA 5FPTA 2ZP0H 1H9HE 1LHEH 3LU9B 1MMJN 1XX9A 3VB4A 2O9QA 2PTCE 3GY6A 1TRNA 1M9UA 3M3SA 3L6PA 2ANWA 1BRAA 3LGUA 4ZUHA 1GBHA 1C2HA 4MVNA 2FP7B 1H8IH 2Y5GA 1MTWA 3FP6E 3QGNB 1YCPK 1XKBC 3PYHA 1TNLA 1DITH 1ZGVA 3A8AA 4Z6AH 4BTUB 1ARCA 1HPGA 2EI8A 8LPRA 2XW9A 5DO4H 3PTBA 1C2IA 1SOTA 2P8OC 3S7HB 1TMTH 1HAHH 4ZH8A 3PLBA 1AO5A 1TB6H 1NRNH 2ZFPH 1AFQC 1EAWA 4KTUA 1T8OA 4AFQA 4SGAE 3RXPA 2Y7ZA 1BZXE 1WBGB 1N8OC 1SQTA 2C8ZB 1V2MT 3A82A 3T62A 1QB1A 1MZAA 3QUMP 2XBVA 4NIVA 1S6HA 2UWOA 1C5RA 3A7WA 1EOJA 3PB1E 1FPCH 1WAYB 3GYLB 1GBEA 1ZMLA 4Q7YA 3UIRA 2A4RA 4Z0KA 5C1XA 3B23B 1O3HA 3RDZA 4X8VH 1PPBH 2FOCA 1QGFA 2FX6A 4NA9H 2CGAA 5T3HA 6CHAC 2WPLS 1KXBA 5GPIB 4DCDA 4WMDA 1G36A 1UJ1A 4FVDA 4E06H 1RXPA 3EDXB 3MH4A 2WYJA 4ZXYH 3V12A 1BRBE 3F6UH 5EQSA 1GJ9B 1MU6B 1SLWB 3GCNA 5H4IB 2UUKB 1BTYA 1F0TA 3W95A 1TNJA 2G81E 4Q2KA 2NWNA 1SLXB 2B8OH 4JYVH 2ZEBA 3S9AA 4UEHH 3SOSA 4LK4A 1LQDB 1E0FD 2GGVB 5DP6A 1GHXH 4X1NU 2A5KA 1S84A 4KKDA 4X2VA 3U8OH 3F9EA 3QTVH 1DS2E 1O3CA 1SSXA 3CP7A 1TA2A 4MDSA 1GI4A 2P93A 4CRGA 1IQFA 1TNKA 3UY9A 3M7UA 1YPLH 3PWBA 2BZ6H 1LPZB 1B0EA 1T8MA 2GV7A 4BOHA 1O2LA 2VINA 3FZZA 1PPCE 4DY7B 1C5OH 3KHVA 3BTEE 4K8YA 1P57B 1C1MA 5IYTA 5I46H 4ZKOU 1TABE 2ZTYA 3A7YA 2C4FH 2G4UA 4ISLA 3SJKA 1GHAG 1SQAA 1ZPBA 4GPGA 4BAMB 1WQVH 2D1JA 1O36A 1TGCA 3MH6A 1GDNA 1SGDE 4RKJB 1TBZH 2Y7XA 3SUEA 1GJAB 1C1RA 2LNCA 5T6GA 1O3AA 1DLKB 4WVPE 4AZ2B 2GDEH 2ZHQH 3SV2H 3M7QA 2WV5A 3BTHE 1OWEA 1ZGIA 1BTPA 1GG6B 1V2JT 1BRUP 1AIXH 1D9IA 1TNIA 2QIQA 1Y3YA 2VIOA 5E0JA 1G30B 1QL8A 1GBDA 1ELDE 1GHBG 2V6NA 3E90B 3KGPA 1VITG 3RLWH 2VGCB 4ZROA 3ELAH 2AMDA 3IG6B 3BSQA 3KIDU 1ZJDA 5CHAC 1LMWB 2ZHDA 2VIQA 7LPRA 2Q6FA 3A85A 3GCOA 1QHRB 3RXLA 1C1SA 3E0NB 4MNWA 3LC3A 1J16A 3AW0A 3HKJB 1IQEA 1FIZA 3TK9A 3EAJA 2BVSH 3MO3A 3CS0A 2YNAA 4K1SA 3NXPA 2BD5A 1FJSA 2PGBB 1G32B 3ESTA 1O5BB 4H6SB 4MPVA 2PTNA 1BTZA 8GCHG 1VJ9U 2Y6TA 4Y0YE 2BDAA 1N1LA 5JBBS 1G3EA 3SV8A 1AVXA 1EZUC 1HIAA 3TGJE 4JZ1A 1NC6A 2BD8A 1AUTC 3PROA 1RD3B 1LQEA 3M3VA 3BTKE 5EXMA 1JIRA 2JETC 1L1NA 2ANKH 1OYQA 3P17H 3GDVA 1XUJA 4XFQA 1GVZA 2A7JA 1B5GH 1HIAB 4TPIZ 2CXVA 2VWLA 3I29A 2GP9B 2XC0A 3Q3KA 2BD4A 4ASHA 2PW8H 1BIOA 1A3BH 4XDEA 4NG9H 5C3NA 1UVTH 1WSSH 4A1XA 4FUHA 1K1JA 4UFDH 5T6FA 2XXLA 1RGQA 1SGEE 2ZQ1A 4AFUA 3QDZB 4NA8A 4ZKNU 3UNQA 1EB2A 1O2VA 1O32A 4DG4A 1VCPA 1ABJH 3BV9B 3ENSB 2F83A 2ZPQA 2XC5A 4HGCA 4AN7A 2GMTB 1W12U 4I7YH 2ZPRA 3HK6B 1JMOH 1BITA 1L4ZA 3RC5A 2R2MB 4VGCC 1D4PB 1P3EA 2ZC9H 1K1MA 1T8NA 1C5NH 4CHAB 1MQ5A 1F7ZA 3Q76A 2BOHB 3UPEA 4UFFH 1OWIA 2FDAA 2BTCE 3TPIZ 1AB9C 1ZMJA 4ABAA 5ABWA 1LVOA 1E34B 2QF0A 3LH1A 3KCGH 1PQ5A 1MTUA 4O3TA 1EZQA 1O2KA 1S85A 2BOKA 3ZVCA 1O2JA 3URDA 1F0RA 1TWXB 3S7KB 2OC8A 1UK4A 1C4Y2 4DIHH 1UTQA 3SHAH 3D49H 5FHTA 1OWJA 1O2XA 2ZNKH 3NPSA 1V2KT 1L1GA 1ELCA 3UUZA 2BM2A 1C1UH 1PQ8A 5ESTE 2AMQA 1A5IA 3AW1A 1XUKA 1CHOG 1GJ8B 1TE0A 1MCVA 2CJIA 4K2YA 5F6MA 5L6NH 3LOXA 1BTWA 1SFIA 2FX4A 3ATLA 1OWKA 3GCHC 5DPAA 4IC6A 2VH0A 2BD3A 1JRSA 1F92A 1F2SE 3GY2A 4R0IA 1O30A 2A5AA 4ABEA 1BCUH 2ALVA 1NM6A 2K1QA 4FUEA 2UWPA 3GICB 4B71A 1AN1E 5HXFA 1DT2A 2UWLA 4AB9A 4BXSA 1AY6H 4WF8A 2I6SA 2BD9A 1FZZA 2XTTB 1HNEE 2XRCA 1P2IA 3EA7A 1KSNA 1MKWH 2NU3E 2G5VA 3TNSA 1BMNH 5AVDA 1HJAC 1WU1A 3T5FH 5L2YH 2CHAC 4DJZB 1FLEE 1SB1H 1Z6EA 2V3OH 5HM9A 3PLPA 2AERH 1QBNA 1ZSJA 3PMBB 2RDLA 5DP8A 2BY5X 4I33A 2PKAA 5GDSH 2YNBA 2UUFB 1UVSH 1SHYA 4U32A 3EA8A 8GCHF 1GJDB 1G3CA 4BAKB 3PLKA 3T27A 2FOMB 1PPEE 1GDUA 1IQMA 3RXUA 1CGIE 4FUIA 1YF4A 3BG4C 2VU8E 4GHQA 4Y10E 7KMEH 1DWBH 1Z8GA 3MTYA 4JZIA 1UVUH 2AFQB 4ISHH 3D62A 3QLPH 2FOBA 2PR3A 5SGAE 1GBTA 3BF6H 4PROA 1DLEA 1UHBB 2GDDA 1KXEA 9ESTA 4AGKA 1Y8TA 1EXFA 1C2KA 1A3EH 5DJ7A 3RXEA 1SFQB 1Z6JH 4I8KA 1O3GA 4Y8XA 1YLDA 4MNYA 3SHCH 3UR6A 3U1JB 2GX4A 2OINA 1O2PA 2J94A 1C1QA 2DUCA 4K69A 4MQAA 2P3TB 2R3YA 2VIDA 3AASA 2WPHS 4IBLH 1BOQA 1A1RA 1BA8B 4B1TA 5AHGH 1G2MA 2FWWA 5ESBA 1TYNA 2C93B 1QTFA 4WWYA 1Y5UT 1GJBB 2SGDE 5A8ZA 4X8TH 2XBWA 3TJUA 1TNGA 4F4OC 2B5TB 3SJ9A 2A1DB 3RMMH 5TJXA 3M3TA 4A1VA 4LXBH 1BUIA 1P12E 3SNAA 2ZFFH 1BTXA 3KF2A 5C67A 3MNCA 1QURH 1KXCA 2WUCA 2ALPA 3P8GA 4AFSA 4ZHLU 1GMHF 2D26C 2RA0A 2PHBA 3RMNH 4AB8A 4DT7B 1AZ8A 3LONA 1OP2A 3DFJA 5FCKA 2TGAA 1DWDH 2ZTXA 3N7OA 4XBBA 4TY6A 1C1TA 3LH3A 2GV6A 4B74A 1Z1JA 1O31A 3D23A 2CMYA 1OWHA 3SGQE 1EASA 1W7GH 1Y59T 1YPKH 1SBWA
chains in the Genus database with same CATH superfamily
5TCCA 1YC0A 1QRZA 1WTHD 1CU1A 3FN8A 1VCQA 4DIIH 4NSVA 4YTAA 3KQEA 3SU6A 1ZPCA 3BTDE 4MPXA 1KXDA 5AF9H 4JK6A 2AGEX 1K1PA 1TALA 5DP7A 1CE5A 1SQOA 2W26A 3UAIC 2KCPA 4AOQA 2H2ZA 1KXAA 4FETA 1OP0A 1G37A 1O3KA 5C17A 1HDTH 1INCA 2FLRH 3UTUH 5J4QA 5C0UA 1L2EA 1SMFE 5L2ZH 3A80A 1O3BA 4X8UH 3QN7A 5EXLA 2ZDKA 3TGIE 1IQJA 2HPQH 4MNXA 3GY4A 3DSGA 1QRWA 1BDAA 4WXIA 5DP4A 2PFEA 2PSXA 4I32A 2J9NA 3FVFB 2H5CA 1FY4A 2BDHA 2PV9B 5EPYA 5FPYA 4I8HA 4X1RU 1B0FA 1OP8A 1UTKA 2F3CE 2SFAA 4FU9A 2O8WA 1GWAA 1GCDA 5DKMA 3RM2H 4LZ1H 4AG1A 1MAXA 5HIYA 5FX6A 1NRPH 1MTNC 1GI0A 5C5NA 1NTPA 2SGEE 1HLTH 1UVPA 4MPWA 2GCHF 3BG8A 2SNVA 3BEFB 1V2QT 3KNXA 1WTGH 3Q3YA 1VZQH 2BDGA 1WUNH 3RC4A 2HVXA 2CN0H 3PTNA 4XBCA 1G3DA 2ZO3H 1C5MD 3PV5A 1TX8A 2AGIX 2BLQA 3IWMA 1O35A 1BT7A 2FI5E 4VGCB 2BQ7B 1P10A 4Y7BA 3RXCA 5F8TA 3SZNA 2ODPA 3GDUA 2ASUB 2Z3DA 3KN2A 2A31A 4K60A 4AFZA 2W3KA 1AB9B 1NY22 2BDIA 4RT0A 4I8LA 1UTMA 2XNIA 4GCHG 4BXWA 4THNH 2OC7A 3T28A 4LOYH 3UFAA 2VIVA 3VGCC 2ZDAH 2TPIZ 1QNJA 1MKWK 4INKA 2XNDD 5LPEA 2ZA5A 5JYIA 5LGOA 1DANH 5B6OA 2ZU2A 1KYNA 3K6ZA 1S81A 1V2UT 4YLUA 4CRAA 4KP0A 3BN9A 2KM0A 1UVOA 4B2BA 3RXTA 2AH4X 3LGTA 3MO6A 3PM3A 1ELVA 4YOGA 3M5NA 1EP6A 1XVMA 4Q4LA 5L30H 1ABIH 1QJ1B 1O37A 2P16A 1EUFA 1YYY1 2B0FA 1MQ6A 2BDYA 4UDWH 1CBWC 1F0SA 4I8GA 4A7IB 1O0DH 4YM9A 1WYKA 2EI6A 1GCTB 3GCHB 1W0ZU 1QJ7B 3QK1A 1BJVA 2BHGA 1C1OA 1J17T 2NU4E 2VIPA 1S6LA 5EJLA 3TU7H 2FEQH 1Z7KA 4YT6H 1NPMA 3JZ1B 2ZDNA 1JIMA 1NS3A 2CF9H 1XMNB 5DGJA 1OXGA 4OS1A 5JBCS 2EEKA 2IOTA 4ZHMU 3LGVA 3WWFA 4UE7H 1C5UA 4ISIH 3F2FA 2KX4A 1AGJA 3HATH 1G3BA 4H6TA 1GGDC 4J2YB 4ZKRU 5IK2D 3ZVAA 1QB9A 2V7QD 3A88A 2C3SA 1SGQE 3MOCA 2PLXA 3M5MA 2FS8A 5E0GA 4ZCNA 1GBJA 1AVWA 5JDUB 2ESTE 4Q80A 3RXOA 5F03A 4X1PU 3L3TA 2G5NA 4FUFA 3EA9A 2BVXH 4FUJA 1DWCH 4F49A 1OWDA 1DSTA 1O2TA 1GHVH 3GY5A 3O8RA 4A5TS 5DP5A 1DVAH 3T25A 1C5ZB 2HGTH 4K8BA 4X1QU 4X6PA 1O3EA 2G00A 4ABJA 2H9HA 1QCPA 2YMSD 3BG4B 3SGBE 3SORA 3MU0A 1V2WT 1HV7A 4UD9H 1LVMA 4K5ZA 2FODA 4MPUA 2BYAX 3KQCA 4ZHAA 1AHTH 1MU8B 1O5CB 1EPTC 2ZFSA 1P2OA 2VJ1A 3MMGA 3HGNA 3C27B 1SGYE 2FOHA 4X6OA 1Z8RA 1HAXB 1P0SH 3R3GB 4AGJA 3U28C 3C1KA 2H9EH 3FP8E 1NU7B 2QC2A 1P2NA 3RXMA 3SGAE 1NFYA 1AE5A 1C2FA 3K6YA 5DG6A 5FX5A 2P59A 5FL7D 3OX7U 1BB0B 1CT2E 1BBRH 3A8CA 3M36A 1S6FA 2UUYA 1ZYOA 4J1YA 1XKAC 1MD8A 1E1RD 4NZQA 1QJ6B 1YKTA 4R8TB 4FUGA 1PPZA 2IJOB 1ESAA 2Z6BD 2P3FH 5JB8S 1ETTH 4Y6DA 1ZJKA 3RXDA 6ESTA 5J4SA 4ACBA 4OM9A 2Y82A 1AE8H 2ZCLP 2Q6DA 1K0HA 4FVBA 1FI8A 3SI3H 1EKBB 3P8FA 4GCHF 3FP7E 2A4OA 2VWMA 2W7SA 4CH8B 3AK5A 3SJIA 2GT7A 1RIWC 3ZV9A 1O3NA 1THRH 1NZQH 1CGHA 1O5FH 3GY3A 3N99A 2BXUH 2CV3A 1C5VA 3B8JA 3OAAD 1Q3XA 1C1NA 1YPEH 1L0ZA 1KTSB 3E6PH 1W11U 2ZDMA 4DW2U 4U01A 1C2LA 4MNVA 4ISNA 3MU5A 3UQOA 4Z1MD 1GJ7B 2IN2A 3OY6U 4O97A 2J95A 3KQBA 3RMLH 3W94A 2R9PA 3PMAB 5EQRA 3A7TA 3JZ2B 2WZQA 5C2ZA 1AU8A 1AD8H 1BTHH 4CRFA 1GDQA 1AVGH 2P3UB 5AFYH 2A0QB 2A5IA 1DE7H 4WXVA 2XC4A 3WWBA 2JH6D 1JBUH 3NZIA 4I31A 1O3IA 1QBVH 2ZFQH 2ZHFH 2ANMH 4CBOA 3QGJA 1HXEH 3ODFA 4DOQA 1EB1H 2QXGA 2M5TA 1ID5H 2KAIA 5KECA 2ZGXH 1FUJA 4MG3A 1VGCC 1UK3A 1LHFH 4HZHA 1NFXA 1C1VH 3EQ0H 3RUOA 1MKXH 2R2WU 1O2UA 1SKYE 1MTNB 1ANCA 1YLNA 1H9LB 2OTVA 4M9FA 2KAIB 3GISB 4KELA 2YOLA 2GKVE 4KTCA 4TPYA 3TGKE 1LKBA 1LPGB 1J9CH 1FONA 1XXFA 1A46H 4O9VA 4HFPB 1SLVB 2BY8X 1CO7E 2J4IA 1GI3A 1PQAA 1EP5A 1E38B 2BX4A 3UNRA 3ATIA 1SLUB 2J97A 3F68H 1HAIH 1NESE 1K1OA 1BRCE 3RXFA 3KQ5A 4CRBA 3P95A 4ZXXH 3F0OA 1W10U 2FTMA 3N7DA 4IN1A 2L74A 1FN8A 2Z9KA 3P6ZB 2OQUA 3E91A 1QFKH 1TQ7B 2ZCKP 3FFGA 3SNDA 1P3CA 2B7DH 1L1JA 5GWZA 1YGCH 2WPKS 5C1YA 4BANB 2G52A 1BBRE 1SR5C 2AYWA 1FX0B 1TMBH 2FXRA 1TA6A 1VKYA 3LJOA 3VGCB 2H5DA 1D6RA 3MNXA 3STIA 1GMHG 3NK8A 3Q77A 1HJ9A 2Z3CA 3I77A 1AKSA 1SGPE 2XCNA 3ATKA 2BLOA 1ZTJA 1NT1A 1C5LH 4JYTA 3URCA 4O03A 1CA8B 1GVLA 3VG8A 4FUCA 2BMGB 1J14A 1X7AC 2TIOA 1QQUA 2P94A 3H5CB 2KCAA 4INHA 4B2CA 4UONA 2OC1A 1AKSB 1TGNA 3SU0A 1EATA 5EW1H 2ZZUH 1CBWB 1P03A 2HPPH 3ZVBA 2P8OB 1ELEE 3RXAA 1H8ED 5HYOA 1TRYA 1FDPA 5FBEA 1SG8B 1AFQB 4NWLA 3SUDA 1GMCF 2ZFRH 2G8TA 4XSKU 1N8OB 1AZZA 2GD4B 1THPB 1J15A 4B76A 4IMQA 1EQ9A 2BLWA 1VCWA 2WPJS 2RFKC 3NKKA 1L4DA 3QO6A 4NA7A 3LKWA 4X6MA 1NRQH 4K1TA 3F1SB 3E1XB 5EPNA 1GL1A 2FTLE 4NFEA 1O38A 2ZGJA 1Z8JB 2HOBA 3ZVEA 4CRDA 5DN6D 2J38A 1LVYA 4U2WA 1V2LT 4E7NA 1ARBA 1IQNA 1IOEA 6CHAB 3KQDA 1T4UH 7GCHF 1ZSKA 1NN6A 1O2ZA 1BMFD 1TRMA 2W6ID 2J98A 4QT8C 5LPRA 1QIXB 2PKSC 4ZKSU 2WINI 1FAKH 1AUJA 2GCHG 2ZGBH 3RXQA 3RU4D 2VWNA 4NIXA 1TGSZ 5C20A 1TGBA 2ODYB 1G9IE 1EPTA 3TVJB 2Y5FA 1CHGA 4Q7ZA 1ZHPA 1RJXB 1SQRA 5EG4A 1HAVA 1H4WA 4WH8A 2A32A 1LVBA 3ZV8A 1S0QA 1PPHE 1O5EH 2V35A 5G4BA 4WMEA 1O2SA 1O2HA 2O8UA 2J2UA 4MLFB 4AG2A 3V7TA 4YOIA 1NFWA 2PKAB 4ABFA 5A0BA 1E79D 2D2DA 2BLVA 1YPHE 1GBBA 4X6NA 5DK1A 1ORFA 1YCPH 1TX6A 3ODDA 1D3TB 3TJNA 3SI4H 1MABB 1O5DH 2G51A 3RC6A 2Z9IA 3GY7A 3VFEA 2Z7FE 1KLIH 5FCRA 3OTPA 1H8DH 3U9AH 4DGJA 1PFXC 3ZZDA 3SBKA 2ZDLA 2Q6GA 3SU1A 1OOKB 4FU7A 4IC5A 1WQSA 1ZTKA 1UTJA 2QF3A 1YCPM 2XBXA 2R0KA 4X2YA 2C8YB 1GI6A 3ZVDA 3O8CA 1EOLA 1V2NT 2ZU3A 1FN6A 1FY3A 4WMFA 1YY3A 3BEUA 1S82A 3DHKH 5BPEA 1D6WA 2TGPZ 1BMLA 4FU8A 4GVUA 1LHDH 1RIWB 2SGFE 1MKXK 1XUIA 3LDXH 4WH6A 3TH2H 2STBE 3RXHA 5CHAB 6GCHF 1DUAA 1CT0E 1GBMA 1G2LA 2W5EA 2ZHWH 3QX5H 3ZVFA 1HAZB 2FOEA 3T2NA 1ACBE 4DT4A 1QRXA 1C1WH 3TIUA 4MTBA 4ISOA 5IDKA 2SGPE 1TPAE 1HAYB 2ZECA 1HGTH 2A2QH 1P2QA 1HYLA 1YPHC 2VVVA 4IMZA 1YM0A 1LHGH 1GHZA 1FMGA 1A5HA 2ZIQH 4ZAEA 2BY9X 2NU2E 1V2PT 1PQ7A 1LDTT 1IQIA 3TJVA 2G55A 1WV7H 2P95A 2ZGCA 1FY5A 2DE8A 2GTBA 3F9GA 5PTPA 4INLA 1GBLA 2F9VA 3SU3A 1C5TA 1HJ8A 2JETB 3SU4A 4E7RG 1P05A 1VGCB 3A89A 2GCTC 1GI1A 2C8WB 2V3MA 3QZRA 1P02A 1TGTA 1C2GA 1W7XH 4X1SU 1ELBA 2ZU1A 1PYTD 2SGQE 3UOUA 3SW2B 2TBSA 3PMHB 4YOJA 1EJMA 2FI4E 2ZQ2A 1SGNE 1UTOA 3E0PB 2OC0A 5GIBA 4GSOA 2WSSD 2XOKD 4TWYA 4CBNA 3TH4H 4I8JA 5A8XA 4B6EA 1A0LA 3DT0H 5A0CA 3ZZAA 1E36B 3SNCA 2VH6A 1AI8H 3LGIA 3NUMA 4CRCA 3BTTE 4D9RA 2VNTA 4NZLA 3P70B 1SGFA 1TNHA 5GCHG 3UNSA 8KME2 2Z9JA 2QXHA 2Z3EA 1O3JA 4AORA 2A4QA 3MI4A 2BB4A 2F9PA 1GJ5H 3PO1C 3S69A 3U69H 5GJ4B 1CSOE 1HRTH 1Z8IB 3LJJA 1C5XB 3SNEA 1ESTA 3LPRA 3QZQA 2BD7A 4F48B 1N6YA 5JB9S 1RFNA 2FIRH 1AFEH 3U8RH 1K9OE 1H8HD 3RXBA 2ZG0H 3MYWA 1UK2A 1ELFA 2BDCA 4OGYA 3S0NA 4XD7D 1GJ6A 3M35A 4U30A 5EXNA 1F5KU 1RS0A 5C5OA 1TX7A 2F9BH 1O2RA 3K65B 1WXRA 4RKOB 4X8SH 2FI3E 4XBDA 1SPJA 4BAOB 1C4V2 3BTFE 3MNBA 1WDIA 3P8OA 3RXRA 5HGGA 1HXFH 3S9CA 2F9UA 2BY6X 5EJZA 1TPOA 2RCEA 1DOJA 2FM2A 1KXFA 3RXGA 4GHTA 1CVWH 2VBCA 2A7HA 4NWKA 4K1EA 2ZU5A 2ZWLH 1GBFA 1LHCH 4TYDA 3SO3A 5HKKD 1VITH 2Q1JA 3ZYDA 3ZZ5A 4D76A 5BRRE 1C9TA 1C5SA 3A7ZA 3K2UA 1C1PA 4YESB 1VR1H 1O3PB 2W7UA 5EW2H 2NU0E 5K0HA 1OSSA 2YMSC 3TITA 1SC8U 2LELA 3RXJA 2Z9LA 1MBQA 5AFZH 1V6DA 1ZMNA 1CA0C 1FQ3A 3RM0H 2FMJA 3VXEH 1TQ0B 2RA3A 9LPRA 2PKSB 2J34A 1O2OA 5DSFA 1P2MA 3UR9A 1HJAB 1C2EA 1QB6A 2CHAB 2FOFA 1UTPA 2TRMA 3UWJH 4D8NA 2ZCHP 1KIGH 3OTJE 3FANA 1ANDA 1PPGE 3SYJA 1F5LA 1LKAA 2PGQB 5E8EH 1UCYH 3UB0A 1DDJA 1SGTA 1O2QA 1E37B 4ABBA 5A0AE 1K2I1 2FOGA 2TGTA 1FNIA 1A0JA 3CNRA 4YLQH 4ABGA 1ANEA 1W0JD 2Y80A 2O8TA 3OSYA 1ZLRA 1QBOA 3RMOH 1ESBA 1FXYA 1HB0B 1BQYA 1W2KH 2OCVB 3BIVH 1TFXA 1W8BH 1UO6A 2B9LA 1YPJH 3RXVA 1A2CH 1XUFA 1GBCA 4Q7XA 1JRTA 1BTUA 1THSH 4NSYA 4GAWA 1P9SA 3T26A 1MD7A 2OUAA 4JZFH 1DUEA 4Y79A 3TNTA 1D3PB 4NFFA 1LTOA 4ABIA 5EU8A 1C4U2 4CR9A 1QZ8A 4UFEH 2ZI2H 2WPMS 2THFB 3ATWA 1NO9H 3M61U 1O5AB 2A7CA 4K3JA 3PWCA 3MNSA 1Y3XA 1GI7B 1W13U 1TBQH 2AMPA 5GCHF 1QL9A 3HGPA 2BXTH 1JOUB 2OQ5A 2QY0B 1MZDA 5F8XA 2ZU4A 1FY1A 1UTNA 2FESH 1GMCG 1RTLA 1ZOMA 1KLJH 1BHXB 3VB7A 4RSPA 1K28D 2GZ9A 1GMDG 2GZ8A 1C2DA 5C94A 1H1BA 1Y5BT 2O8MA 1O2NA 4HI3A 2BZAA 1C2JA 4NCYA 3BTGE 3E16B 2F9NA 1XXDA 3SJ8A 1ZHRA 2RG3A 3A83A 2BQ6B 3U8TH 1V2ST 3MWIU 1QY6A 3MH7A 2H1UA 5F8ZA 5HMAA 2QXIA 3KL6A 1SGIB 4GLYA 2ULLA 2FZZA 2OP9A 4FUDA 4FXGH 3FOAA 3MU4A 1MTVA 2AEIH 2C90B 3AVZA 3OU0A 1QR3E 7GCHG 2EA3A 2FLBH 3B9FH 5JBTA 3ITIA 1S83A 2FYRA 1DY9A 4JK5A 1V2OT 2JH0D 4XOJA 1N6XA 1O3FA 1GVKB 1ELTA 1FAXA 2HNTE 2UUJB 1ELAA 1QA0A 4HTCH 4RN6A 4BTTB 1GI8B 1FIWA 3A87A 3BIUH 2JKHA 2W6JD 4OS5A 1QA7A 4FOUC 5FAHA 1DPOA 1IAUA 4UFGH 4DVAU 2GCTB 2VWOA 4SGBE 4IW4E 1EZSC 1RRKA 1UCYE 2PSYA 4H4FA 1SGFG 2J5UA 5EQQA 4P00A 3PV4A 2WPIS 3ZZCA 4P02A 4F55A 1O2GH 4Y7AA 3F9HA 4DURA 3F0PA 5JBAS 1AWHB 1QL7A 2LPRA 4FUBA 2AGGX 3EGKH 3ZZ8A 5T1VA 4KGAA 4TSFD 1ETSH 3E3TA 4H42U 1ZRKA 2FPZA 1XVOA 1IHTH 2A4GA 3VEQB 1VJAU 4JZDH 5CMXH 1DX5M 3RU4E 2TGDA 2CF8H 5FPSA 2QE7D 1K1NA 3GDSA 1JXPA 1W3CA 2A2XH 2GVFA 1V3XA 3TLOA 2BQWB 4A6LA 1Y3WA 2FS9A 1DWEH 1ZZZA 4Y76A 1GJCB 4ASUD 3CENA 1Y3VA 2HRVA 4ZMAH 1SVPA 1CQQA 1F0UA 1C5PA 2PUXB 3PO1B 3BTQE 1HAOH 3A8DA 1K22H 3A86A 1V2TT 3G01A 3H7OA 3GOVB 3RP2A 3QWCH 3E8LA 1B7XB 1NROH 2IPHA 3ZZ9A 1ZRBA 3VXFH 3LT3A 1SHHB 4IS5A 4NGAH 1DXWA 2Y5HA 1C2MA 2BDBA 1YBWA 3MH5A 1K1LA 2ZPSA 1O33A 1C5QA 2HNTC 3KYFA 2ZKSA 3RXKA 5K7RA 2C8XB 1GI9B 1U6QA 1K1IA 1UMAH 4B2AA 1Y5AT 5EOKA 3QTOH 6GCHG 1GL0E 3Q00A 3A84A 3VPKA 3ZZBA 1D3DB 2J92A 3M5OA 3SV7A 1P01A 2JJ1D 4A1TA 1TOCB 2V0BA 2Y81A 3UREA 3FAOA 1PJPA 1BMAA 1O2IA 1SOZA 1UCYK 1EAXA 2ZDVH 2ZTZA 3BTME 3RXSA 3ZVGA 4JCNA 5GNDA 1ANBA 1F5RA 3LGWA 4YO9A 1ZHMA 3MU1A 4Y11E 3A7VA 3MO9A 4TT3D 3GY8A 3AAVA 1FPHH 1TMUH 2PP6A 3R0FA 3ZZ3A 1A61H 1PPFE 2QA9E 2ZF0H 4JMYA 2F4LA 1KLTA 1DFPA 2STAE 4B6FA 2QV1A 1GHAF 1GMDF 2GT8A 3UOPA 3FZDA 4LZ4B 2EC9H 3HK3B 4OS4A 1GBKA 5LH8A 1KTTB 4X2WA 1O5GH 1P9UA 4WY3A 2SNWA 1OKXA 1SL3A 5DP3A 3VB5A 1BMMH 5TCAA 1CA0B 2I6QA 2H6MA 3OY5U 1GGDB 2FO9A 3U98H 5DP9A 4CR5A 1HAPH 1Q31A 3V3MA 2QCYA 1ELGA 4IN2A 4NIYA 1O2MA 1KMHB 1S5SA 4TWWA 2AS9A 1CT4E 1GCTC 3UWIA 1KY9A 3ZYEA 4WJG2 1OX1A 2KFWA 1A5GH 1W0KD 1P04A 3SQHE 3LGYA 1DM4B 3A8BA 1BBRK 2V3HH 1GHBF 3GCTG 3TK5A 1VITF 1Y3UA 1OS8A 1ZTLA 4D7FA 5KGOA 2ZFTA 2BY7X 5F53A 4BAQB 2PUQH 4IGDA 1E35B 2HLCA 3L33A 3PMJA 7ESTE 2QXJA 1IQLA 2J98B 4CH2B 1DY8A 1TOMH 1SGCA 3TK6A 1V2VT 3SUGA 4JYUH 5A8YA 4Y71A 1TONA 1GBAA 2Z94A 1Z1IA 2HALA 2VIWA 3MU8A 5E2OA 2ZHEH 2QAAA 1XUHA 1O3OA 1IHSH 2Z9GA 2PWXA 3EE0B 4OGXA 5E0HA 4ABDA 3RXIA 2HNTF 2QGRA 1LPKB 3V0XA 5E2PA 3DFLA 4E05H 1EPTB 1AQ7A 1HUTH 1C9PA 3SUFA 1RTKA 2W3IA 4O3UA 3SU2A 1T7CA 1OYTH 5A09A 1HAVB 1QQ4A 1LCYA 3UQVA 3HPTB 2OBQA 1OPHB 1T4VH 1GPZA 3H7TA 1O3DA 3Q3XA 2GZ7A 3GYMA 1NFUA 1YPMH 2FOAA 1YP9A 1BJUA 2QN5T 3SQEE 2DE9A 2R0LA 4D9QA 3N7EA 1T32A 3M7TA 1UHBA 1UTLM 3FO8D 4D7GA 1MBMA 5CDFE 1YLCA 2ILNA 5I25A 1GHYH 3U1IB 2F43B 3EYDA 1TIOA 1TBRH 5EODA 5LPFA 2WYGA 1HBTH 4BAHB 1T8LA 1NRSH 2HLDD 1WCZA 1O39A 3A81A 3ZZ7A 1Z71A 1ETRH 5B6LA 1W14U 4RT1A 1SI5H 4Y8ZA 2A45B 2BX3A 1DSUA 4XE4A 2QYIA 2VB0A 4GUXA 3SU5A 1FV9A 2KR7A 3RLYH 1IQHA 3K9XB 1GJ4H 1C5WB 4KTSA 1O2YA 3DD2H 3S9BA 8ESTE 1O34A 2F9OA 1MUEB 2BVRH 2IJD1 1J8AA 4X2XA 1GHWH 2FYQA 1TLDA 1D3QB 5EIYA 3STJA 1HFDA 1YPGH 1PYTC 1DICA 1EX3A 3CS7A 3OEED 3SV6A 2KZ4A 3HKIB 1O3LA 2XWAA 3DSOA 5FXLA 2NU1E 2XYAA 1GG6C 3AAUA 3EE7A 1ZR0A 1A7SA 1AMHA 1S0RA 1P09A 1P2KA 2JH5D 3ATMA 5EGMA 2XWBI 3VB3A 1EZXC 6LPRA 1H9IE 1MCTA 1DXPA 1XM1A 1MAYA 2AIQA 2VGCC 2EQNA 2VVUA 1SGRE 2WUBA 3F2GA 2OXSA 4YZUA 5FBIA 1A0HB 1EAIA 3TH3H 1NBMD 1HAGE 5A2MH 1ZPZA 1NRRH 3SNBA 4OS6A 5JPMH 2OBOA 5CE1A 1IQKA 4M7GA 3P92A 1JWTA 4YT7H 5C1UA 2F91A 3BTWE 2AIPA 2VVCA 3M5LA 5HM2A 3MFJA 1GI5A 4JZEH 1CHOF 1COWD 3I78A 5T6DA 2EY4C 3M37A 1XUGA 1TAWA 3VB6A 4X0WU 2M2AA 2KCYA 3IITA 2ZGHA 3BEIB 3SV9A 5ETXA 2ANYA 1FY8E 1P11E 2K8IA 3GCTF 1EAUA 1MTSA 4Y0ZE 1P8VC 3NWUA 1C5YB 3P8NA 4A92A 4TY7A 3LIWA 3A7XA 1KDQA 1EJNA 1EJAA 1P2JA 3TJOA 2O8LA 1T31A 2XCFA 2OLGA 2XBYA 1GBIA 1MH0A 2SGAA 3D65E 1BHXF 4Y8YA 4ABHA 2H9TH 4OS7A 3WY8A 1LO6A 3DUXH 3ZZ4A 4AYYB 3O8DA 1CGJE 1W0YH 2G4TA 3ZZ6A 2BD2A 1KDQB 3F2HA 3KEEA 4AX9H 3PRBA 1K21H 3SJOA 2ODQA 3DA9B 3F9FA 1ZSLA 3MHWU 1IQGA 2AHME 3KYGA 5GXPA 3V13A 1TPSA 1RTFB 3LC5A 3O8BA 4OS2A 2WV4A 1A4WH 1GI2A 2EI7A 3OYPA 1AWFH 2R3UA 4AYVB 2GMTC 4BTIB 3T29A 4CREA 3SN8A 1P06A 4B73A 1WOFA 4ESTE 1Q2WA 1O2WA 2HWLB 2OD3B 1NU9A 4BNRA 1HCGA 2D8WA 4CHAC 4NIWA 1TPPA 4B75A 3RU4T 1O3MA 1V2RT 3NCLA 5FPTA 2ZP0H 1H9HE 1LHEH 3LU9B 1MMJN 1XX9A 3VB4A 2O9QA 2PTCE 5CHBA 3GY6A 1TRNA 1M9UA 3M3SA 3L6PA 2ANWA 1BRAA 3LGUA 4ZUHA 1GBHA 1C2HA 4MVNA 2FP7B 1H8IH 2Y5GA 1MTWA 3FP6E 3QGNB 1YCPK 1XKBC 3PYHA 1EFRD 1TNLA 1DITH 1ZGVA 3A8AA 4Z6AH 4BTUB 1ARCA 1HPGA 2EI8A 8LPRA 2XW9A 5DO4H 3PTBA 1C2IA 1SOTA 2P8OC 3S7HB 1TMTH 1HAHH 4ZH8A 3PLBA 1AO5A 1TB6H 1NRNH 2ZFPH 1AFQC 1EAWA 4KTUA 1T8OA 4AFQA 4SGAE 3RXPA 2JJ2D 2Y7ZA 1BZXE 1WBGB 1N8OC 1SQTA 2C8ZB 1V2MT 3A82A 4RI0A 3T62A 1QB1A 1MZAA 3QUMP 2XBVA 4NIVA 1S6HA 2UWOA 1C5RA 3A7WA 1EOJA 3PB1E 1FPCH 1WAYB 3GYLB 1GBEA 1ZMLA 4Q7YA 3UIRA 2A4RA 4Z0KA 5C1XA 3B23B 1O3HA 3RDZA 4X8VH 1PPBH 2FOCA 1QGFA 2FX6A 4NA9H 2CGAA 5T3HA 6CHAC 2WPLS 1KXBA 5GPIB 3SZEA 4DCDA 4WMDA 2OK5A 1G36A 1UJ1A 4FVDA 4E06H 1RXPA 3EDXB 3MH4A 2WYJA 4ZXYH 3V12A 1BRBE 3F6UH 5EQSA 1GJ9B 1MU6B 1SLWB 3GCNA 5H4IB 2UUKB 1BTYA 1F0TA 3W95A 1TNJA 2G81E 2KCOA 4Q2KA 2NWNA 1SLXB 2B8OH 4JYVH 2ZEBA 3S9AA 4UEHH 3SOSA 4LK4A 1LQDB 1E0FD 3ZIAD 2GGVB 1UW7A 4Q63A 5DP6A 1GHXH 4X1NU 2A5KA 1S84A 4KKDA 4X2VA 3U8OH 3F9EA 3QTVH 1DS2E 1O3CA 1SSXA 3CP7A 1TA2A 4MDSA 1GI4A 2P93A 4CRGA 1IQFA 1TNKA 3UY9A 3M7UA 1YPLH 3PWBA 2BZ6H 1LPZB 1B0EA 1T8MA 2GV7A 4BOHA 1O2LA 2VINA 3FZZA 1PPCE 4DY7B 1C5OH 3KHVA 2LP6A 3BTEE 4K8YA 1P57B 1C1MA 5IYTA 5I46H 4ZKOU 1TABE 2ZTYA 3A7YA 2C4FH 2G4UA 4ISLA 3SJKA 1GHAG 1SQAA 1ZPBA 4GPGA 4BAMB 3DSPA 1WQVH 2D1JA 1O36A 1TGCA 3MH6A 1GDNA 1SGDE 4RKJB 1TBZH 2Y7XA 3GS9A 3SUEA 1GJAB 1C1RA 2LNCA 5T6GA 1O3AA 1DLKB 4WVPE 4AZ2B 2GDEH 3FKSD 2ZHQH 3SV2H 3M7QA 2WV5A 3BTHE 1OWEA 1ZGIA 1BTPA 1GG6B 1V2JT 1BRUP 1AIXH 1D9IA 1TNIA 2QIQA 1Y3YA 2VIOA 5E0JA 1G30B 1QL8A 1GBDA 1ELDE 1GHBG 2V6NA 3E90B 3KGPA 1VITG 3RLWH 2VGCB 4ZROA 3ELAH 2AMDA 5C0TA 3IG6B 3BSQA 3KIDU 1ZJDA 1E1QD 5CHAC 1LMWB 2ZHDA 2VIQA 7LPRA 2Q6FA 3A85A 3GCOA 1QHRB 3RXLA 1C1SA 3E0NB 4MNWA 3H09A 2IPQX 3LC3A 1J16A 3AW0A 3F3BA 3HKJB 1IQEA 1FIZA 5KEDA 3TK9A 3EAJA 2BVSH 3MO3A 3CS0A 5EJ1A 2YNAA 4K1SA 3NXPA 2BD5A 1FJSA 2PGBB 1G32B 3ESTA 1O5BB 4H6SB 4MPVA 2PTNA 1BTZA 8GCHG 1VJ9U 2Y6TA 4Y0YE 2BDAA 1N1LA 5JBBS 1G3EA 3SV8A 1AVXA 1EZUC 1HIAA 3TGJE 4JZ1A 1NC6A 2BD8A 1AUTC 3PROA 1RD3B 1LQEA 3M3VA 2RDEA 3BTKE 1JIRA 5EXMA 2JETC 1L1NA 2ANKH 1OYQA 3P17H 3GDVA 1XUJA 4XFQA 1GVZA 2A7JA 1B5GH 1HIAB 4TPIZ 2CXVA 2VWLA 3I29A 2GP9B 2XC0A 3Q3KA 2BD4A 4ASHA 2PW8H 1BIOA 1A3BH 4XDEA 4NG9H 5C3NA 1UVTH 1WSSH 4A1XA 4FUHA 1K1JA 4UFDH 5T6FA 2XXLA 1RGQA 1SGEE 2ZQ1A 3W1EA 4AFUA 3QDZB 4NA8A 4ZKNU 3UNQA 1EB2A 1O2VA 1O32A 4DG4A 1VCPA 1ABJH 3BV9B 3ENSB 2F83A 2ZPQA 2XC5A 4HGCA 4AN7A 2GMTB 1W12U 4I7YH 2WHXA 2ZPRA 3HK6B 3OFND 1JMOH 1BITA 1L4ZA 3RC5A 2R2MB 4VGCC 1D4PB 1P3EA 2ZC9H 1K1MA 1T8NA 1C5NH 4CHAB 1MQ5A 1F7ZA 3Q76A 2BOHB 4I86A 3UPEA 4UFFH 1OWIA 2FDAA 2BTCE 3TPIZ 1AB9C 1ZMJA 4ABAA 4ACAA 5ABWA 1LVOA 1E34B 2QF0A 3PV2A 3LH1A 3KCGH 1PQ5A 1MTUA 4O3TA 1EZQA 1O2KA 1S85A 2BOKA 3ZVCA 2WPDD 1O2JA 3URDA 1F0RA 1TWXB 3S7KB 2OC8A 1UK4A 1C4Y2 4DIHH 1UTQA 2YMSB 3SHAH 3D49H 5FHTA 1OWJA 1O2XA 2ZNKH 3NPSA 1V2KT 1L1GA 1ELCA 3UUZA 2BM2A 1C1UH 1PQ8A 5ESTE 2AMQA 1A5IA 3AW1A 1XUKA 2HVYB 1CHOG 1GJ8B 1TE0A 1MCVA 2CJIA 4K2YA 5F6MA 5L6NH 3LOXA 1BTWA 1SFIA 2FX4A 3ATLA 1OWKA 3NRLA 2QF4A 3GCHC 1YWUA 5DPAA 4IC6A 2VH0A 2BD3A 1JRSA 1F92A 1F2SE 3GY2A 4R0IA 1O30A 2A5AA 4ABEA 1BCUH 2ALVA 1NM6A 2K1QA 4FUEA 2CK3D 2UWPA 1NBME 3GICB 4B71A 4YXWD 1AN1E 5HXFA 1DT2A 2UWLA 4AB9A 4BXSA 1AY6H 4WF8A 2I6SA 2BD9A 1FZZA 2XTTB 3WW7A 1HNEE 2XRCA 1P2IA 3EA7A 1KSNA 2QF5A 1MKWH 2NU3E 2G5VA 3TNSA 1BMNH 5AVDA 1HJAC 1WU1A 3T5FH 5L2YH 2CHAC 4DJZB 1FLEE 1SB1H 1Z6EA 2V3OH 5HM9A 3PLPA 2AERH 1QBNA 4XRNA 1ZSJA 3PMBB 2RDLA 5DP8A 2BY5X 4I33A 2PKAA 5GDSH 2YNBA 3PRDA 2UUFB 1UVSH 1SHYA 4U32A 3EA8A 8GCHF 1GJDB 1G3CA 4BAKB 3PLKA 3T27A 2JDID 2FOMB 1PPEE 1GDUA 1IQMA 3RXUA 1CGIE 4FUIA 1YF4A 3BG4C 2VU8E 2WV9A 4GHQA 4Y10E 7KMEH 1DWBH 1Z8GA 3MTYA 4JZIA 1UVUH 2AFQB 4ISHH 3D62A 3QLPH 2FOBA 2PR3A 2L6OA 5SGAE 1GBTA 3BF6H 3OEHD 5HIZA 4PROA 1DLEA 1UHBB 2GDDA 1KXEA 9ESTA 4AGKA 1Y8TA 1EXFA 3DCLA 1C2KA 1OHHD 4AC9A 1A3EH 5DJ7A 3RXEA 1SFQB 1Z6JH 4I8KA 1O3GA 4Y8XA 1YLDA 4MNYA 3SHCH 2GJGA 3UR6A 3U1JB 2GX4A 2OINA 1O2PA 2J94A 1C1QA 2DUCA 4K69A 4MQAA 2P3TB 2R3YA 2VIDA 3AASA 2WPHS 4IBLH 1BOQA 1A1RA 1BA8B 4B1TA 5AHGH 1G2MA 2FWWA 5ESBA 1TYNA 2C93B 1QTFA 4WWYA 1Y5UT 1GJBB 2SGDE 5A8ZA 4X8TH 2XBWA 3TJUA 1TNGA 4F4OC 2B5TB 3SJ9A 2A1DB 3RMMH 5TJXA 3M3TA 4A1VA 4LXBH 1BUIA 1P12E 3SNAA 2ZFFH 2JIZD 1BTXA 3KF2A 5C67A 4HG6A 2K0QA 3MNCA 1QURH 1KXCA 2WUCA 2ALPA 3P8GA 4AFSA 4ZHLU 1GMHF 2D26C 2RA0A 2PHBA 3RMNH 4AB8A 4DT7B 1AZ8A 3LONA 1OP2A 3DFJA 3MQKC 5FCKA 3OE7D 2TGAA 1DWDH 2ZTXA 3N7OA 4XBBA 4TY6A 1C1TA 3LH3A 2GV6A 4B74A 1Z1JA 1O31A 3D23A 2CMYA 1OWHA 3SGQE 1EASA 1W7GH 1Y59T 1YPKH 1SBWA
chains in the Genus database with same CATH topology
5TCCA 1YC0A 1QRZA 1WTHD 1CU1A 4DIIH 1VCQA 4NSVA 4YTAA 3KQEA 3SU6A 1ZPCA 3BTDE 4MPXA 1KXDA 5AF9H 4JK6A 2AGEX 1K1PA 1TALA 5DP7A 1CE5A 1SQOA 2W26A 4AOQA 2H2ZA 1KXAA 1OP0A 1G37A 1O3KA 1HDTH 1INCA 2FLRH 3UTUH 5J4QA 1L2EA 1SMFE 5L2ZH 3A80A 1O3BA 4X8UH 3QN7A 5EXLA 2ZDKA 3TGIE 1IQJA 2HPQH 4MNXA 3GY4A 1QRWA 1BDAA 4WXIA 5DP4A 2PFEA 2PSXA 4I32A 2J9NA 3FVFB 2H5CA 1FY4A 2BDHA 2PV9B 5EPYA 5FPYA 4I8HA 4X1RU 1B0FA 1OP8A 1UTKA 2F3CE 2SFAA 4FU9A 2O8WA 1GWAA 1GCDA 5DKMA 3RM2H 4LZ1H 4AG1A 1MAXA 5FX6A 1NRPH 1MTNC 1GI0A 5C5NA 1NTPA 2SGEE 1HLTH 1UVPA 4MPWA 2GCHF 3BG8A 2SNVA 3BEFB 1V2QT 3KNXA 1WTGH 3Q3YA 1VZQH 2BDGA 1WUNH 3RC4A 2HVXA 2CN0H 3PTNA 4XBCA 1G3DA 2ZO3H 1C5MD 1TX8A 2AGIX 2BLQA 3IWMA 1O35A 1BT7A 2FI5E 4VGCB 2BQ7B 1P10A 4Y7BA 3RXCA 5F8TA 3SZNA 2ODPA 3GDUA 2ASUB 2Z3DA 3KN2A 2A31A 4K60A 4AFZA 2W3KA 1AB9B 1NY22 2BDIA 4I8LA 1UTMA 2XNIA 4GCHG 4BXWA 4THNH 2OC7A 3T28A 4LOYH 3UFAA 2VIVA 3VGCC 2ZDAH 2TPIZ 1QNJA 1MKWK 4INKA 5LPEA 2ZA5A 5JYIA 5LGOA 1DANH 5B6OA 2ZU2A 1KYNA 3K6ZA 1S81A 1V2UT 4YLUA 4CRAA 4KP0A 3BN9A 1UVOA 4B2BA 3RXTA 2AH4X 3LGTA 3MO6A 3PM3A 1ELVA 4YOGA 3M5NA 1EP6A 1XVMA 5L30H 1ABIH 1QJ1B 1O37A 2P16A 1EUFA 1YYY1 2B0FA 1MQ6A 2BDYA 4UDWH 1CBWC 1F0SA 4I8GA 4A7IB 1O0DH 4YM9A 1WYKA 2EI6A 1GCTB 3GCHB 1W0ZU 1QJ7B 3QK1A 1BJVA 2BHGA 1C1OA 1J17T 2NU4E 2VIPA 3TU7H 2FEQH 1Z7KA 4YT6H 1NPMA 3JZ1B 2ZDNA 1JIMA 1NS3A 2CF9H 1XMNB 5DGJA 1OXGA 4OS1A 5JBCS 2EEKA 2IOTA 4ZHMU 3LGVA 4UE7H 1C5UA 4ISIH 1AGJA 3HATH 1G3BA 4H6TA 1GGDC 4J2YB 4ZKRU 3ZVAA 1QB9A 3A88A 2C3SA 1SGQE 3MOCA 2PLXA 3M5MA 2FS8A 5E0GA 1GBJA 1AVWA 5JDUB 2ESTE 4Q80A 3RXOA 5F03A 4X1PU 3L3TA 2G5NA 4FUFA 3EA9A 2BVXH 4FUJA 1DWCH 4F49A 1OWDA 1DSTA 1O2TA 1GHVH 3GY5A 3O8RA 4A5TS 5DP5A 1DVAH 3T25A 1C5ZB 2HGTH 4K8BA 4X1QU 4X6PA 1O3EA 2G00A 4ABJA 2H9HA 1QCPA 3BG4B 3SGBE 3SORA 3MU0A 1V2WT 1HV7A 4UD9H 1LVMA 4K5ZA 2FODA 4MPUA 2BYAX 3KQCA 4ZHAA 1AHTH 1MU8B 1O5CB 1EPTC 2ZFSA 1P2OA 2VJ1A 3MMGA 3HGNA 3C27B 1SGYE 2FOHA 4X6OA 1Z8RA 1HAXB 1P0SH 3R3GB 4AGJA 3C1KA 2H9EH 3FP8E 1NU7B 2QC2A 1P2NA 3RXMA 3SGAE 1NFYA 1AE5A 1C2FA 3K6YA 5DG6A 5FX5A 2P59A 3OX7U 1BB0B 1CT2E 1BBRH 3A8CA 3M36A 1S6FA 2UUYA 1ZYOA 4J1YA 1XKAC 1MD8A 4NZQA 1QJ6B 1YKTA 4R8TB 4FUGA 1PPZA 2IJOB 1ESAA 2Z6BD 2P3FH 5JB8S 1ETTH 4Y6DA 1ZJKA 3RXDA 6ESTA 5J4SA 2Y82A 1AE8H 2ZCLP 2Q6DA 4FVBA 1FI8A 3SI3H 1EKBB 3P8FA 4GCHF 3FP7E 2A4OA 2VWMA 2W7SA 4CH8B 3SJIA 2GT7A 1RIWC 3ZV9A 1O3NA 1THRH 1NZQH 1CGHA 1O5FH 3GY3A 2BXUH 2CV3A 1C5VA 3B8JA 1Q3XA 1C1NA 1YPEH 1L0ZA 1KTSB 3E6PH 1W11U 2ZDMA 4DW2U 4U01A 1C2LA 4MNVA 4ISNA 3MU5A 3UQOA 1GJ7B 2IN2A 3OY6U 4O97A 2J95A 3KQBA 3RMLH 3W94A 2R9PA 3PMAB 5EQRA 3A7TA 3JZ2B 5C2ZA 1AU8A 1AD8H 1BTHH 4CRFA 1GDQA 1AVGH 2P3UB 5AFYH 2A0QB 2A5IA 1DE7H 4WXVA 2XC4A 2JH6D 1JBUH 3NZIA 4I31A 1O3IA 1QBVH 2ZFQH 2ZHFH 2ANMH 4CBOA 3QGJA 1HXEH 3ODFA 4DOQA 1EB1H 2QXGA 2M5TA 1ID5H 2KAIA 2ZGXH 1FUJA 4MG3A 1VGCC 1UK3A 1LHFH 4HZHA 1NFXA 1C1VH 3EQ0H 3RUOA 1MKXH 2R2WU 1O2UA 1MTNB 1ANCA 1H9LB 2OTVA 2KAIB 3GISB 4KELA 2YOLA 2GKVE 4KTCA 4TPYA 3TGKE 1LKBA 1LPGB 1J9CH 1FONA 1XXFA 1A46H 4O9VA 4HFPB 1SLVB 2BY8X 1CO7E 2J4IA 1GI3A 1PQAA 1EP5A 1E38B 2BX4A 3UNRA 3ATIA 1SLUB 3F68H 1HAIH 1NESE 1K1OA 1BRCE 3RXFA 4CRBA 3P95A 4ZXXH 1W10U 2FTMA 4IN1A 3P6ZB 1FN8A 2Z9KA 2OQUA 3E91A 1QFKH 1TQ7B 2ZCKP 3FFGA 3SNDA 1P3CA 2B7DH 1L1JA 5GWZA 1YGCH 2WPKS 5C1YA 4BANB 2G52A 1BBRE 1SR5C 2AYWA 1TMBH 2FXRA 1TA6A 3LJOA 3VGCB 2H5DA 1D6RA 3MNXA 3STIA 1GMHG 3NK8A 3Q77A 1HJ9A 2Z3CA 3I77A 1AKSA 1SGPE 2XCNA 3ATKA 2BLOA 1ZTJA 1NT1A 1C5LH 4JYTA 3URCA 4O03A 1CA8B 1GVLA 4FUCA 2BMGB 1J14A 1X7AC 2TIOA 1QQUA 2P94A 3H5CB 4INHA 4B2CA 4UONA 2OC1A 1AKSB 1TGNA 3SU0A 1EATA 5EW1H 2ZZUH 1CBWB 1P03A 2HPPH 3ZVBA 2P8OB 1ELEE 3RXAA 5HYOA 1TRYA 1FDPA 5FBEA 1SG8B 1AFQB 4NWLA 3SUDA 1GMCF 2ZFRH 2G8TA 4XSKU 1N8OB 1AZZA 2GD4B 1THPB 1J15A 4B76A 4IMQA 1EQ9A 2BLWA 1VCWA 2WPJS 3NKKA 1L4DA 3QO6A 4NA7A 3LKWA 4X6MA 1NRQH 4K1TA 3F1SB 3E1XB 5EPNA 1GL1A 2FTLE 4NFEA 1O38A 2ZGJA 1Z8JB 2HOBA 3ZVEA 4CRDA 2J38A 1LVYA 4U2WA 1V2LT 4E7NA 1ARBA 1IQNA 1IOEA 6CHAB 3KQDA 1T4UH 7GCHF 1ZSKA 1NN6A 1O2ZA 1TRMA 4QT8C 5LPRA 1QIXB 2PKSC 4ZKSU 2WINI 1FAKH 1AUJA 2GCHG 2ZGBH 3RXQA 3RU4D 2VWNA 4NIXA 1TGSZ 5C20A 1TGBA 2ODYB 1G9IE 1EPTA 3TVJB 2Y5FA 1CHGA 4Q7ZA 1ZHPA 1RJXB 5EG4A 1HAVA 1H4WA 4WH8A 2A32A 1LVBA 3ZV8A 1S0QA 1PPHE 1O5EH 2V35A 5G4BA 4WMEA 1O2SA 1O2HA 2O8UA 2J2UA 4MLFB 4AG2A 3V7TA 4YOIA 1NFWA 2PKAB 4ABFA 5A0BA 2D2DA 2BLVA 1YPHE 1GBBA 4X6NA 5DK1A 1ORFA 1YCPH 1TX6A 3ODDA 1D3TB 3TJNA 3SI4H 1O5DH 2G51A 3RC6A 2Z9IA 3GY7A 3VFEA 2Z7FE 1KLIH 5FCRA 1H8DH 3U9AH 4DGJA 1PFXC 3ZZDA 3SBKA 2ZDLA 2Q6GA 3SU1A 1OOKB 4FU7A 4IC5A 1WQSA 1ZTKA 1UTJA 2QF3A 1YCPM 2XBXA 2R0KA 4X2YA 2C8YB 1GI6A 3ZVDA 3O8CA 1EOLA 1V2NT 2ZU3A 1FN6A 1FY3A 4WMFA 3BEUA 1S82A 3DHKH 5BPEA 1D6WA 2TGPZ 1BMLA 4FU8A 4GVUA 1LHDH 1RIWB 2SGFE 1MKXK 1XUIA 3LDXH 4WH6A 3TH2H 2STBE 3RXHA 5CHAB 6GCHF 1DUAA 1CT0E 1GBMA 1G2LA 2W5EA 2ZHWH 3QX5H 3ZVFA 1HAZB 2FOEA 3T2NA 1ACBE 1QRXA 1C1WH 3TIUA 4MTBA 4ISOA 5IDKA 2SGPE 1TPAE 1HAYB 2ZECA 1HGTH 2A2QH 1P2QA 1HYLA 1YPHC 2VVVA 4IMZA 1YM0A 1LHGH 1GHZA 1FMGA 1A5HA 2ZIQH 4ZAEA 2BY9X 2NU2E 1V2PT 1PQ7A 1LDTT 1IQIA 3TJVA 2G55A 1WV7H 2P95A 2ZGCA 1FY5A 2DE8A 2GTBA 3F9GA 5PTPA 4INLA 1GBLA 2F9VA 3SU3A 1C5TA 1HJ8A 2JETB 3SU4A 4E7RG 1P05A 1VGCB 3A89A 2GCTC 1GI1A 2C8WB 3QZRA 1P02A 1TGTA 1C2GA 1W7XH 4X1SU 1ELBA 2ZU1A 1PYTD 2SGQE 3UOUA 3SW2B 2TBSA 3PMHB 4YOJA 1EJMA 2FI4E 2ZQ2A 1SGNE 1UTOA 3E0PB 2OC0A 5GIBA 4GSOA 4TWYA 4CBNA 3TH4H 4I8JA 5A8XA 1A0LA 3DT0H 5A0CA 3ZZAA 1E36B 3SNCA 2VH6A 1AI8H 3LGIA 3NUMA 4CRCA 3BTTE 4D9RA 2VNTA 4NZLA 3P70B 1SGFA 1TNHA 5GCHG 3UNSA 8KME2 2Z9JA 2QXHA 2Z3EA 1O3JA 4AORA 2A4QA 3MI4A 2BB4A 2F9PA 1GJ5H 3PO1C 3S69A 3U69H 5GJ4B 1CSOE 1HRTH 1Z8IB 3LJJA 1C5XB 3SNEA 1ESTA 3LPRA 3QZQA 2BD7A 5JB9S 1N6YA 1RFNA 2FIRH 1AFEH 3U8RH 1K9OE 3RXBA 2ZG0H 3MYWA 1UK2A 1ELFA 2BDCA 4OGYA 3S0NA 1GJ6A 3M35A 4U30A 5EXNA 1F5KU 1RS0A 5C5OA 1TX7A 2F9BH 1O2RA 3K65B 4RKOB 4X8SH 2FI3E 4XBDA 1SPJA 4BAOB 1C4V2 3BTFE 3MNBA 3P8OA 3RXRA 5HGGA 1HXFH 3S9CA 2F9UA 2BY6X 1TPOA 2RCEA 1DOJA 2FM2A 1KXFA 3RXGA 4GHTA 1CVWH 2A7HA 4NWKA 4K1EA 2ZU5A 2ZWLH 1GBFA 1LHCH 4TYDA 3SO3A 1VITH 2Q1JA 3ZYDA 3ZZ5A 4D76A 5BRRE 1C9TA 1C5SA 3A7ZA 3K2UA 1C1PA 4YESB 1VR1H 1O3PB 2W7UA 5EW2H 2NU0E 5K0HA 1OSSA 3TITA 1SC8U 3RXJA 2Z9LA 1MBQA 5AFZH 1V6DA 1ZMNA 1CA0C 1FQ3A 3RM0H 2FMJA 3VXEH 1TQ0B 2RA3A 9LPRA 2PKSB 2J34A 1O2OA 3UR9A 1P2MA 1HJAB 1C2EA 1QB6A 2CHAB 2FOFA 1UTPA 2TRMA 3UWJH 4D8NA 2ZCHP 1KIGH 3OTJE 3FANA 1ANDA 1PPGE 1F5LA 1LKAA 2PGQB 5E8EH 1UCYH 1DDJA 1SGTA 1O2QA 1E37B 4ABBA 5A0AE 1K2I1 2FOGA 2TGTA 1FNIA 1A0JA 4YLQH 4ABGA 1ANEA 2Y80A 2O8TA 3OSYA 1ZLRA 1QBOA 3RMOH 1ESBA 1FXYA 1HB0B 1BQYA 1W2KH 2OCVB 3BIVH 1TFXA 1W8BH 1UO6A 2B9LA 1YPJH 3RXVA 1A2CH 1XUFA 1GBCA 4Q7XA 1JRTA 1BTUA 1THSH 4NSYA 4GAWA 1P9SA 3T26A 1MD7A 2OUAA 4JZFH 1DUEA 4Y79A 3TNTA 1D3PB 4NFFA 1LTOA 4ABIA 5EU8A 1C4U2 4CR9A 4UFEH 2ZI2H 2WPMS 2THFB 3ATWA 1NO9H 3M61U 1O5AB 2A7CA 4K3JA 3PWCA 3MNSA 1Y3XA 1GI7B 1W13U 1TBQH 2AMPA 5GCHF 1QL9A 3HGPA 2BXTH 1JOUB 2OQ5A 2QY0B 1MZDA 5F8XA 2ZU4A 1FY1A 1UTNA 2FESH 1GMCG 1RTLA 1ZOMA 1KLJH 1BHXB 3VB7A 4RSPA 1K28D 2GZ9A 1GMDG 2GZ8A 1C2DA 1H1BA 1Y5BT 2O8MA 1O2NA 4HI3A 2BZAA 1C2JA 4NCYA 3BTGE 3E16B 2F9NA 1XXDA 3SJ8A 1ZHRA 2RG3A 3A83A 2BQ6B 3U8TH 1V2ST 3MWIU 1QY6A 3MH7A 2H1UA 5F8ZA 5HMAA 2QXIA 3KL6A 1SGIB 4GLYA 2ULLA 2FZZA 2OP9A 4FUDA 4FXGH 3MU4A 1MTVA 2AEIH 2C90B 3AVZA 3OU0A 1QR3E 7GCHG 2EA3A 2FLBH 3B9FH 5JBTA 3ITIA 1S83A 2FYRA 1DY9A 4JK5A 1V2OT 2JH0D 4XOJA 1N6XA 1O3FA 1GVKB 1ELTA 1FAXA 2HNTE 2UUJB 1ELAA 1QA0A 4HTCH 4RN6A 4BTTB 1GI8B 1FIWA 3A87A 3BIUH 2JKHA 4OS5A 1QA7A 5FAHA 1DPOA 1IAUA 4UFGH 4DVAU 2GCTB 2VWOA 4SGBE 4IW4E 1EZSC 1RRKA 1UCYE 2PSYA 4H4FA 1SGFG 5EQQA 3PV4A 2WPIS 3ZZCA 1O2GH 4Y7AA 3F9HA 4DURA 5JBAS 1AWHB 1QL7A 2LPRA 4FUBA 2AGGX 3EGKH 3ZZ8A 4KGAA 1ETSH 3E3TA 4H42U 1ZRKA 2FPZA 1XVOA 1IHTH 2A4GA 3VEQB 1VJAU 4JZDH 5CMXH 1DX5M 3RU4E 2TGDA 2CF8H 5FPSA