4D9QA

Inhibiting alternative pathway complement activation by targeting the exosite on factor d
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
228
structure length
228
Chain Sequence
b'ILGGREAEAHARPYMASVQVNGEHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVEPGTLCDVAGWGIVSHAGRRPDRLQHVLLPVLDRATCNRRTHHDGAITQRMMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor D
publication title Inhibiting alternative pathway complement activation by targeting the factor d exosite.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Hydrolase/immune system
total genus 58
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d9qA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d9qA01
5DK1A 1HYLA 2QCYA 4BNRA 4ESTE 1P2NA 2VIQA 4BXSA 6ESTA 4X2YA 1VJ9U 3RXIA 4MNYA 2O8LA 1SVPA 3MO3A 3U69H 4FUIA 1HJ8A 1LHCH 4K3JA 1TNKA 2QXGA 2ZFRH 1GJ8B 5FCRA 3ZZBA 1IQEA 2GCHF 3A8BA 1MU8B 3RMLH 3CS7A 1T8OA 4WMFA 4AG2A 1RJXB 3PLPA 3TNSA 1Z7KA 5I46H 3AAVA 1GJ4H 1TNIA 2TGPZ 3O8DA 1T8LA 1AVXA 2FYQA 1EKBB 3GICB 1FY4A 1H1BA 1MTWA 5DG6A 3MH4A 4IN2A 3FANA 1BTZA 3PTBA 2F9UA 2XW9A 2Q6GA 2O8MA 1EPTB 1GI4A 1P2IA 2HNTF 1Y3XA 1H4WA 5FXLA 1EOLA 3V3MA 1YC0A 3AW1A 1EASA 1QTFA 2HNTC 3P8GA 3QGJA 5A0CA 1ORFA 2TPIZ 3ELAH 3EGKH 3BTHE 3K6ZA 3UOPA 1FI8A 1UK4A 1SG8B 1L0ZA 4UDWH 1QRZA 2UUYA 1ELVA 2FTMA 1S84A 3RXOA 4XE4A 4Y8YA 1A61H 1GHAG 1HAGE 1EJMA 3ZYDA 3RXPA 3U8OH 3GY8A 2WPMS 2P3FH 3VFEA 2BHGA 4MDSA 1X7AC 1YGCH 3OSYA 1ZHPA 2A31A 3KL6A 1VGCC 1QA0A 1QHRB 1L4DA 1O5FH 3NZIA 2F9OA 4B73A 5DP9A 2WPKS 4B2AA 3ZZAA 1P05A 1AFQC 4ZKSU 3U98H 1HAYB 1PPCE 2AMDA 2G5NA 3SJ8A 3ZVCA 1GBLA 3ODFA 5JBBS 3S7KB 1XMNB 3ITIA 2Y5HA 1CVWH 1TRNA 2HLCA 2C8WB 1QB9A 2GV6A 3M5NA 3TK9A 4ABBA 4AOQA 3TH2H 2TGDA 4AZ2B 1DICA 3A8AA 1MCVA 3RXLA 1C4V2 4JK6A 2FOMB 3K65B 3FP7E 1C9PA 1MH0A 1UTPA 4YT7H 2BY8X 5EODA 3PMJA 4Y7AA 1HV7A 2FWWA 2FEQH 5C2ZA 2GT7A 1C5RA 3OU0A 1GBTA 2ZZUH 1PPEE 4ISIH 2SGPE 1GJ6A 1ESAA 1V2NT 1AIXH 1NO9H 5EQQA 4JZ1A 2BY9X 3BTDE 2UWOA 2IN2A 2XBVA 4DGJA 2GZ7A 2CHAC 2QXJA 1C1UH 1Y5UT 1YP9A 3MU1A 3W94A 1GHAF 3M7UA 5I25A 1CHOG 4Z6AH 1EB2A 1N1LA 3GDUA 2IOTA 1BRCE 2R0LA 1XVMA 4AN7A 2FMJA 5J4QA 4LZ1H 1CA8B 1K1OA 5E2OA 1SGYE 1BTYA 1XKBC 1YF4A 1WQVH 4NWLA 1S85A 1VITG 1VZQH 1GJBB 3RU4T 5DP7A 4DY7B 1PYTD 1K1IA 1P9UA 3SNAA 1ZMJA 3PMBB 3P8FA 3OY5U 3LGTA 5CHAB 1QL7A 1KXBA 2RA3A 4RN6A 1HJAB 1FAKH 2WYJA 1RFNA 3UTUH 4HI3A 4HGCA 3VB3A 3UIRA 4BANB 1AD8H 1KTSB 2ZF0H 4D9QA 3SN8A 1GCDA 2CMYA 1TX6A 1F92A 2FOBA 8KME2 2XCFA 1SLWB 3D23A 3T29A 1W12U 1GBHA 2RA0A 3PO1C 2Z9JA 1K21H 1ANEA 1TX7A 4GCHG 2A45B 2NU4E 1S82A 2BY6X 1NT1A 3S9BA 4NFFA 1E35B 1YPHE 2PGBB 3GY6A 4CRGA 3MH7A 1FY1A 1PJPA 2FDAA 4IMQA 2CXVA 1O2HA 2J95A 3M7TA 3LGWA 3V13A 1SGPE 2ZGXH 2BDIA 1OS8A 1V2MT 1MTVA 2HGTH 3PTNA 1ANBA 3RXFA 1CHOF 2ZHEH 4GAWA 1JRTA 1RTLA 1O2YA 1YYY1 1HB0B 2A2QH 2PKSB 3F6UH 1YLDA 1MKWK 2VGCB 1PQ5A 3LPRA 2DUCA 3TGKE 2XCNA 2ZTYA 2QC2A 2ANKH 1CBWB 1S0QA 1YPEH 1BMNH 1TNJA 1GI2A 1ANCA 1D9IA 1GG6C 3ATLA 1O2TA 1VITF 5EQSA 3RXBA 1QY6A 1Z8IB 1ZMNA 1G9IE 3L3TA 2ZKSA 4FUDA 2FOHA 1AE5A 2O8TA 2ODYB 3A87A 4OGYA 2ZDAH 4WF8A 1W11U 3BTGE 3FZZA 2ZPRA 2P8OC 1ZHRA 5TJXA 2QYIA 2GDEH 1VCQA 7KMEH 5AFZH 1TLDA 1HAZB 1Z1IA 4AYVB 1O2KA 3Q3YA 1TGCA 3Q3KA 4ZKNU 2NU1E 1C2IA 1W3CA 4GCHF 4DW2U 1GBBA 1SB1H 1BBRH 1ZRBA 4E7NA 2ZC9H 1TBZH 2BVXH 3BG8A 2ZECA 3E1XB 2TBSA 1BDAA 3GISB 3QLPH 2G5VA 2BX4A 4X1QU 3SQEE 1D3TB 3N7OA 1O5GH 1TBRH 1G2LA 3JZ1B 5C5OA 1SHYA 1WQSA 1FLEE 1IHTH 4E05H 1EZUC 3E3TA 1SGCA 5EPYA 4ABEA 2M5TA 2P95A 4Y0YE 1GJ9B 4ABHA 2B0FA 4DIHH 1F0UA 1K1JA 1SPJA 1ARCA 1LHDH 3TITA 1W7GH 2FOCA 1EXFA 3PWCA 3SU1A 3M61U 2A2XH 5LH8A 1F2SE 2ANMH 4MVNA 2FI4E 1A0JA 1NU7B 1JXPA 1HCGA 3FZDA 3MWIU 4AGKA 4VGCC 5FX5A 1AUTC 1ZSLA 3JZ2B 4MLFB 4FUJA 1ARBA 3SNBA 1NESE 3E91A 2VINA 8GCHG 2SFAA 3ODDA 1ZRKA 1Z1JA 1J17T 3UR6A 1LQDB 2C93B 2UUFB 2QY0B 3NXPA 1HAHH 2C8YB 1BCUH 1WYKA 2GKVE 2J2UA 5FX6A 2AIPA 3GY5A 1BHXF 1K1PA 2AFQB 1AFQB 2QIQA 2FOEA 1FIZA 1FONA 1O3EA 5BRRE 2WUCA 3MH5A 3M7QA 2A0QB 2B5TB 1JIRA 1O2ZA 1O5EH 2Q6FA 3TPIZ 3ZVDA 3ATWA 2FO9A 5E0JA 3R0FA 3SUGA 1TNLA 4TWYA 5CE1A 1VITH 1P10A 1NS3A 2FOAA 4B71A 2R0KA 1W13U 3QGNB 5GIBA 1THRH 1Z6JH 2WPHS 2Z9GA 1CU1A 2P94A 2AERH 3DT0H 5AF9H 1QNJA 1DXWA 1V2KT 4JZFH 1A5GH 3A7WA 1C1TA 1IQGA 1C1QA 2B9LA 4NGAH 4U01A 5HM2A 2ZHWH 1XVOA 2JETB 1FQ3A 1GBJA 4K1SA 1NY22 1GBKA 1ZSJA 1PQ7A 1XUIA 1YPHC 4B75A 3A80A 5F8TA 2CHAB 2ALVA 3SV8A 3O8RA 2P3TB 3RXTA 3ZZ9A 2ZCLP 3HATH 4D7FA 1AY6H 2GZ8A 3FVFB 1GHVH 5AHGH 1UCYK 1G3CA 3K2UA 1Y3VA 4FUFA 1C2LA 2XTTB 1NROH 2EA3A 8GCHF 4XBBA 4UEHH 3F1SB 3H7TA 3ZYEA 5EXLA 3U8TH 1O2GH 3E0PB 3MU8A 2OINA 1G30B 1TGNA 4K1EA 3STJA 4CREA 4HTCH 3MU0A 3GCNA 3EA7A 2WV5A 1GJ5H 1DWDH 1SMFE 1FPCH 1KYNA 1OP2A 2CJIA 3KF2A 3UOUA 3BN9A 2R2MB 2Z9LA 2PFEA 3KQEA 2Y5GA 3UR9A 2GP9B 2RCEA 3QDZB 1BMAA 5EPNA 1O30A 1AHTH 1QL9A 1S6HA 3RM0H 1TGTA 3PO1B 4NIWA 2H5CA 5A2MH 2I6QA 2BXUH 4Z0KA 3M3TA 1AU8A 4WY3A 4JK5A 1A3BH 1W0ZU 2FTLE 2GCTB 3AAUA 1B7XB 1LPGB 4MPUA 4TYDA 1T4VH 1D6WA 6CHAC 1C2GA 1UMAH 2H9EH 4IGDA 2FPZA 3SO3A 3TJUA 1TYNA 2XBYA 1JIMA 1S0RA 1HAOH 4A1XA 1GCTC 5L30H 1FAXA 1BUIA 1INCA 4AFZA 2VIPA 1W2KH 1YPGH 1OWIA 3HK3B 5A8YA 1FDPA 2PUQH 4Y79A 1SQTA 1BJVA 1OWJA 1V2TT 3O8BA 1WSSH 4Q7YA 1QBNA 1NU9A 2BMGB 3SUEA 1P2KA 1C5LH 4LOYH 1N8OC 1OOKB 3P95A 1BTWA 1GG6B 3L6PA 3ZZ5A 2A4QA 1Y5AT 3RXDA 3UUZA 1W10U 1VCPA 2YNBA 1TRMA 1P8VC 1C2HA 5FPYA 1GMDG 1SGFA 5E0HA 1O2PA 2P8OB 4AX9H 1UJ1A 2F9VA 1EAIA 1HJ9A 2JH0D 1B0EA 4KTSA 1NPMA 1OWEA 2K1QA 1G36A 3E6PH 1HBTH 2FXRA 1LHGH 2A4RA 2PTCE 4I31A 1OX1A 1CSOE 3MU5A 4FU7A 1P11E 1Q3XA 2BLQA 1C2DA 2C8ZB 2VIWA 1DUEA 1SOTA 2HWLB 4D9RA 4NSVA 1J8AA 2HVXA 1BBRE 1HFDA 1V6DA 1MZAA 4ABJA 1L1NA 5DP5A 3ATMA 3VB4A 1QL8A 1EZSC 1ZMLA 3URCA 4DT7B 1DLEA 5F6MA 1UVUH 2FESH 1C2FA 1P04A 1XM1A 1ZPCA 1O3OA 2ZU5A 3A7TA 2G55A 3E8LA 2OC8A 1HAIH 4YT6H 4I8KA 1ABJH 1GHYH 5HM9A 1TOMH 1FNIA 2AH4X 1O3CA 4O3TA 2Z9KA 1EZXC 4B1TA 1D4PB 1TPAE 1BMMH 1W14U 2BDYA 3ATKA 1OYQA 3TVJB 3ZZ4A 4DOQA 4ZHMU 4WMDA 1Z6EA 5JBAS 1MKXH 5C1XA 4VGCB 1MCTA 4X1RU 2ZWLH 4D76A 3RLYH 5ETXA 1GMDF 1ANDA 2UWPA 1OKXA 1RXPA 4DCDA 1P02A 3MU4A 2WPLS 1UVOA 3BTQE 4K60A 6LPRA 3SV7A 1THPB 1TONA 5GPIB 5A0BA 5EGMA 2ODPA 1O31A 4XFQA 1FXYA 1PQ8A 2FOGA 3GYMA 4BOHA 4CR5A 1G32B 4OS2A 1EAUA 1EPTA 2AMPA 1GBCA 2D26C 2ZDVH 1C5NH 3VXFH 1PYTC 1E38B 1BHXB 1RS0A 3FFGA 2F9PA 1EAWA 3BEUA 1ELAA 1BRAA 1J15A 4AFUA 8LPRA 1SGEE 3SZNA 1PPGE 4Y7BA 1TWXB 2P93A 4X2VA 4LXBH 4CHAC 1CA0B 2FM2A 3ZZ7A 2OQUA 1IQKA 3GY3A 2BX3A 2B7DH 3SQHE 2PSXA 4DIIH 2QN5T 1D6RA 2BYAX 1FY3A 1QBOA 2CGAA 1ZPZA 1RIWC 2PSYA 1AZ8A 4Y0ZE 1WTGH 1A4WH 1MTSA 3LGVA 1UVPA 1O3HA 1FUJA 2ZFPH 1C1SA 5F8ZA 1AFEH 1HXFH 1A2CH 2G4TA 2VJ1A 4K69A 3BTKE 4UFFH 1DWBH 5TCCA 3UNSA 1S83A 4ABGA 5E2PA 1GI1A 1MQ5A 5A0AE 1P12E 4CH8B 2GDDA 3GOVB 3ZV8A 5FPTA 2XC5A 4Y8ZA 1SQOA 3TIUA 4THNH 2XBXA 2Z7FE 8ESTE 3PM3A 2AEIH 1Z8RA 5C1UA 1XUHA 2VH0A 2BD2A 1YCPM 2G4UA 1H8DH 3F9GA 1V2LT 4MNXA 1D3QB 1E37B 1RGQA 1G2MA 1SL3A 4Y76A 1K1MA 4YLQH 4WXIA 1AN1E 3U1JB 1O2UA 2FYRA 1KIGH 3FP8E 3DHKH 5JPMH 1TABE 1GPZA 1C1VH 2VVUA 1TMBH 3SI3H 1GBEA 2Q1JA 3SNCA 7ESTE 3A7VA 4BAMB 4MNVA 2AGGX 1MAYA 1FY8E 4XBDA 3ZVEA 3GCHB 5LPFA 4ZKOU 3K6YA 2SGQE 3EQ0H 1BTPA 4ASHA 2GMTC 2V3OH 2ZIQH 1FV9A 1P09A 1GCTB 1OWDA 4I33A 2YNAA 4CRFA 1OWKA 3MO6A 5T6FA 3M5OA 1LKAA 1YPJH 1N6YA 1KTTB 4ZHLU 2CF9H 3GDVA 4ZUHA 4M7GA 1QURH 4ZKRU 3SGAE 2W5EA 3PLKA 3SJ9A 3SU0A 1L1GA 4U2WA 1A1RA 3M37A 1O3GA 2FI3E 1OWHA 1LVBA 1GBMA 2ZP0H 1KXEA 1CGHA 3A86A 3PYHA 1UVSH 3RXGA 3KQCA 4X8VH 3PV4A 1S81A 1V2QT 2OBOA 3ZVFA 1DX5M 2JKHA 3QWCH 4Y8XA 1TMUH 2ZA5A 1A0HB 5ABWA 4D8NA 4NIYA 1S6FA 1ZSKA 1SBWA 1Y3UA 2OLGA 1ABIH 1AWFH 4KP0A 4YLUA 4ZXXH 1XXFA 3HKIB 3NKKA 4JCNA 1AI8H 1IQFA 3NWUA 4JZDH 2XXLA 1MUEB 4NA8A 3UY9A 3B9FH 2G52A 1YPKH 2BOHB 4HZHA 2BZAA 1O3DA 3IWMA 5A8ZA 1AB9C 1T31A 2SGAA 6GCHG 1E36B 3OY6U 2A4OA 1EQ9A 4LK4A 3BEFB 1O2JA 2H2ZA 3RP2A 1SLUB 3ZVGA 4FUGA 3EA8A 2A7HA 2I6SA 1SGNE 1GBFA 4U32A 4GHTA 3ZV9A 5G4BA 1P3CA 1Q2WA 1H9IE 2BY5X 4WJG2 3A81A 3TJVA 5DKMA 5DP3A 3UWIA 1DDJA 2UUKB 4BTUB 4J2YB 2FP7B 4AGJA 5FBEA 3S9CA 3MTYA 2GD4B 1K28D 1MBQA 1JOUB 1O5CB 1GJ7B 3PWBA 3ZZ6A 4YOJA 3UNRA 2J4IA 1C5WB 2D8WA 3DD2H 4INLA 3K9XB 1Y3WA 2VIVA 1Z8GA 1TA6A 4X2XA 2ODQA 1ELCA 1O2NA 4AG1A 3SORA 4CH2B 1XKAC 2ZDMA 4MPWA 4YOGA 2GX4A 1GI3A 4A1TA 4FVBA 5EQRA 1N6XA 2STBE 2Y82A 4A1VA 1YLCA 1SI5H 2AS9A 4YO9A 1O38A 3QZQA 3GY7A 5TCAA 2ILNA 3IG6B 3PMHB 2PWXA 1ZJDA 3SJIA 6GCHF 2BDBA 4XSKU 4XBCA 2F91A 3BTME 4UFEH 1EATA 1GI0A 2Y7XA 2ZDLA 4MPVA 2C3SA 2QGRA 1YCPH 3Q3XA 1L4ZA 5JB9S 1V3XA 1ZGVA 5DPAA 1DOJA 3MOCA 2QXHA 3P6ZB 1C5QA 1HUTH 1S5SA 2ZGJA 2WV4A 3LC5A 2BDHA 1GGDC 2C90B 1E34B 1FJSA 4NA9H 3F68H 1V2JT 1EJNA 5ESTE 1T7CA 2HPPH 5DJ7A 1C1RA 3SHCH 3LT3A 3IITA 1HRTH 2BLOA 2OQ5A 2ZU3A 1PPBH 4X8UH 5C3NA 1ZHMA 1SLVB 1GWAA 1XUJA 1VGCB 1RIWB 2HALA 1QJ7B 1GMHG 1OSSA 1ZTLA 2OCVB 2WPIS 1O2IA 1Z71A 2PHBA 4H4FA 4K1TA 2UUJB 2BQ7B 4YM9A 1ID5H 2XWBI 3C27B 3UWJH 1QJ6B 3RC5A 1HXEH 2Y6TA 2BVSH 1JMOH 3TJOA 4A6LA 5A8XA 1O2WA 1AQ7A 1C5VA 2VNTA 3RMMH 2QXIA 2ZTXA 1TNGA 3LIWA 3DFLA 7GCHG 1Z8JB 7LPRA 3ZZ8A 1O5BB 3RDZA 2ZO3H 4RKOB 3HPTB 1YPMH 1U6QA 4OGXA 4ISOA 4KKDA 4FU9A 3RMOH 1C2EA 4ABFA 1J16A 4OS7A 2OUAA 1BQYA 1ZJKA 1O2RA 1UVTH 4CRDA 1CHGA 1NC6A 3I78A 3CS0A 3SNEA 1A3EH 1DVAH 3A7YA 1YKTA 2Z3DA 1A5HA 1SGDE 4GUXA 1DY8A 1FN8A 4DJZB 1KXAA 1D3PB 1SC8U 5DGJA 5AVDA 1OP0A 2JH6D 3SU5A 2AIQA 2BLVA 3RMNH 5CMXH 1FPHH 3SU2A 3QK1A 1NRQH 5HXFA 4TPIZ 1UTOA 1P3EA 5C5NA 1GHBG 1O0DH 1F5LA 2BD8A 1TE0A 5T6DA 1KLIH 2Z9IA 1GMHF 1NTPA 2CF8H 3SW2B 1BOQA 3AVZA 3KNXA 1OPHB 4I8JA 4NCYA 4E06H 2ASUB 3A8DA 3S9AA 2GZ9A 2SGEE 3FAOA 4H6TA 1MTNC 3D49H 1EAXA 1O37A 3DA9B 1ELFA 2QF3A 3AASA 4JMYA 2O9QA 3KGPA 1ZGIA 5JBCS 1BITA 2SNVA 4MPXA 3GCOA 4X6PA 1F0TA 3SUDA 1WTHD 1DITH 4D7GA 1BRBE 1XXDA 2F83A 2AGIX 3BIVH 3LDXH 4FUEA 4YESB 1EJAA 4NSYA 1TX8A 2ZGHA 3VGCC 7GCHF 4IS5A 1O2LA 1BBRK 1PFXC 1WV7H 1TBQH 2CN0H 4J1YA 2H1UA 1YM0A 3TU7H 3RXAA 3QTOH 2A4GA 3T28A 3EAJA 4WWYA 4BAHB 3RU4D 4X6MA 2PLXA 1K1LA 1K22H 1V2UT 2GV7A 1F0SA 1P57B 1BTUA 1NFXA 2H9HA 5L6NH 5DP6A 2VB0A 2IJOB 1H8IH 2TGAA 1TB6H 1F7ZA 2BQWB 3T27A 3U1IB 3M35A 2DE9A 2Z94A 3QN7A 5ESBA 1WAYB 2OC1A 1PPHE 1DS2E 1MBMA 3I77A 3V7TA 1O3JA 4UE7H 4Q2KA 5HYOA 2JH5D 3A89A 1GI6A 1O3LA 2OD3B 1ZPBA 4JZIA 4JYVH 1GHBF 3SJOA 1O2VA 3SJKA 3I29A 1C5YB 1WUNH 3LOXA 4X1PU 3T26A 1V2ST 5J4SA 3BEIB 2DE8A 3OX7U 5FHTA 1DWCH 1DXPA 2VVCA 3LJOA 1Q31A 1TALA 1T8NA 3SU6A 3U8RH 1SR5C 3P8OA 1MZDA 2GT8A 4GVUA 5PTPA 2NU2E 1UCYE 2OBQA 4UFDH 9ESTA 3E0NB 1NFUA 2GVFA 3S69A 3HKJB 1DSTA 3MMGA 1ETTH 1NRSH 1C5MD 1TIOA 2BM2A 3Q00A 3MO9A 3STIA 5EW2H 4AB9A 4NZLA 1IQMA 3D62A 4XDEA 3M5MA 1OP8A 1KDQB 1GHZA 1EP5A 1OXGA 2ZTZA 1KDQA 2ZFSA 1QRWA 2NU0E 2ZG0H 4K8BA 3LONA 3SBKA 4ABDA 4BTTB 5EW1H 2AMQA 2FI5E 1KXFA 2FODA 1XUGA 1O2XA 3PROA 1KXDA 2D2DA 1DUAA 3BTWE 1C5UA 1WCZA 1V2PT 2XNIA 1JRSA 3CENA 5GWZA 3SUFA 3RXKA 1UO6A 1UTKA 1G3BA 5BPEA 2PR3A 1EB1H 2BDCA 1G3EA 2FLRH 4I8GA 1C2JA 1VCWA 1TGBA 5GCHG 3SU3A 3PB1E 3VXEH 4OS4A 2PUXB 2VGCC 4A92A 3QUMP 4OS5A 4O9VA 4WXVA 1W0YH 1CBWC 1HLTH 1Y3YA 1ZOMA 2NU3E 1G37A 1O3KA 1AMHA 1GDUA 1TA2A 1Y59T 2LNCA 2H5DA 3LU9B 4INHA 4INKA 1C1PA 5F8XA 1DSUA 2PV9B 1O3AA 1GGDB 4R8TB 5GXPA 3QX5H 3SOSA 1P01A 2ZGCA 1PPZA 1HPGA 2Z3EA 1IQLA 2NWNA 1LVYA 4IN1A 3C1KA 4UD9H 3QO6A 1IQHA 1O36A 1A0LA 4ABIA 2P16A 2G51A 1O33A 5F03A 4CRBA 1IQNA 1GJAB 2KAIB 4GPGA 1BB0B 3TH4H 2KAIA 1ZTJA 1V2WT 4B2CA 2A32A 2BDGA 5E8EH 3M3VA 2XWAA 1P0SH 2J34A 1GMCG 4UONA 1A7SA 4Y10E 5T6GA 4JYUH 3ZZCA 2ZEBA 2FOFA 4CBNA 3VB7A 3GY2A 1MD8A 2TIOA 3BV9B 4ZMAH 5K0HA 3PMAB 2BD4A 1SSXA 3T5FH 2ZFFH 1HGTH 3BG4C 2R9PA 1ACBE 1H9HE 1V2RT 2YOLA 4R0IA 4IMZA 5FPSA 3KCGH 3A84A 1K2I1 1YBWA 1IHSH 4NWKA 2V35A 4CR9A 1GHXH 1DE7H 5GCHF 3BTTE 3MHWU 1A5IA 3GY4A 2WINI 3ZZDA 4GSOA 2WPJS 2BD3A 2PKAB 4MQAA 3BTEE 4I7YH 5E0GA 1BTHH 2THFB 1LO6A 4TY7A 4YOIA 1MKWH 2PKAA 1B5GH 1NM6A 3A85A 2FX6A 1ZLRA 2QA9E 4NFEA 1SQAA 3SU4A 1J9CH 4K5ZA 3VB5A 3GDSA 4ABAA 1EOJA 1QB6A 2FLBH 3URDA 2BZ6H 1O3MA 1IAUA 3A7ZA 1AKSB 2TRMA 2OXSA 1AKSA 2SNWA 1SGTA 3BF6H 1AO5A 4MG3A 3P8NA 4O3UA 4KELA 2ZHDA 1WBGB 5HGGA 1TQ7B 2ZQ1A 2P59A 1C1NA 3B8JA 3G01A 2J38A 4BAOB 1UTMA 3NUMA 1DM4B 4AFQA 1MTNB 1LHEH 2A7JA 3SV6A 5GJ4B 3VB6A 2PTNA 1GMCF 1FN6A 1UK3A 1IQJA 2ZNKH 1ESTA 3MNSA 5IDKA 2ZFTA 1F5KU 1C5TA 3DFJA 4Y11E 1THSH 1HIAB 1F0RA 1XX9A 2AGEX 3VGCB 1UTNA 1HIAA 1HAVB 1QBVH 1O5AB 2JETC 4X6OA 3RU4E 1HAVA 4TPYA 3NCLA 3M36A 4DURA 3H7OA 3EE0B 6CHAB 2BB4A 2ZU2A 1C5PA 1LPZB 1FMGA 5JYIA 4LZ4B 3QZRA 5LGOA 4SGBE 3KHVA 2WYGA 5L2YH 4GHQA 1UTJA 1EUFA 1ZR0A 3GYLB 2Q6DA 2ZU4A 3TLOA 1TNHA 1AVGH 2VWMA 3L33A 2UWLA 2OP9A 4NG9H 1TFXA 4CBOA 1BZXE 2R2WU 3R3GB 2A7CA 3S0NA 1GI7B 3SGQE 4RKJB 3LGIA 4B2BA 1ESBA 1LCYA 2EEKA 1QQUA 3UQOA 1GVKB 1C4U2 1GHWH 1HAXB 1N8OB 2Z3CA 1F5RA 1SGFG 1MKXK 2ZCHP 4MNWA 3SHAH 2BD9A 2PW8H 2Y5FA 1C4Y2 4FXGH 1P2MA 2H9TH 2W26A 3S7HB 1O2OA 1BTXA 1GI5A 2WUBA 1ELDE 2QAAA 1KLTA 1DFPA 1LHFH 1MD7A 2O8WA 3VPKA 1GL1A 1NFYA 1DWEH 1WOFA 3GCTG 3QTVH 2FX4A 1T32A 3A82A 3A7XA 3UPEA 4A5TS 2ZQ2A 4ISHH 3EDXB 1AZZA 2ZHQH 1RTKA 2VIDA 1BT7A 1GJCB 3B23B 4NZQA 2GCTC 4FUCA 4ZROA 1A46H 1TRYA 1AWHB 1C1WH 1UHBB 4ZHAA 3TGJE 1ZZZA 1HNEE 4GLYA 2ZU1A 1UHBA 5GDSH 2ZFQH 4DG4A 2SGDE 2ANWA 3LGUA 2A1DB 3TJNA 3FP6E 3RXHA 1O34A 1GDQA 3RLWH 1QJ1B 3A83A 3F9HA 3UNQA 1L1JA 1C5SA 1D3DB 1SFQB 4I32A 1TPSA 3KQDA 4Q7XA 4JZEH 1UCYH 4MTBA 5JB8S 4WVPE 1V2VT 3RUOA 2XBWA 1TMTH 1KXCA 1LVOA 3LC3A 2VU8E 4Q80A 1TPOA 1TAWA 1TGSZ 3OTJE 3W95A 2VH6A 2BLWA 3A8CA 1CT0E 2OTVA 1AE8H 1MAXA 2J94A 3BTFE 1O3BA 2CV3A 3RC4A 5FBIA 1RRKA 2FIRH 2R3YA 3KN2A 1ELTA 3RXUA 2BTCE 1CT4E 3H5CB 1QR3E 1O39A 1DANH 2Y80A 1PPFE 3GCTF 1FIWA 5EXNA 3MYWA 1C2KA 1CE5A 2XYAA 4FUHA 1CT2E 1ETSH 1QIXB 3SGBE 1SOZA 1C5OH 2ZDKA 1MU6B 3HGNA 4IC5A 2XC4A 2W7SA 1DPOA 5B6OA 2W7UA 3UFAA 2ZCKP 1GBDA 1O3FA 3CP7A 2A5AA 1GI9B 1QFKH 1T4UH 1KLJH 3LJJA 1CQQA 1O32A 3RC6A 3RXMA 2F9NA 4B76A 1MTUA 2PGQB 1SGRE 4AB8A 1P9SA 3BG4B 2ZI2H 2GTBA 4WH8A 1SGIB 3LH1A 5A09A 4AORA 4BTIB 1V2OT 4CHAB 1BRUP 1FZZA 4NIXA 2F9BH 2ZGBH 2G8TA 5EOKA 4X1SU 5SGAE 3DUXH 3SI4H 1P2JA 5EG4A 2LPRA 1KSNA 1L2EA 3V12A 1QB1A 4X0WU 1C2MA 5JBTA 4KTUA 3F9FA 5DP8A 4ZH8A 1C9TA 1GVZA 1UTLM 1UTQA 2H6MA 4RSPA 2HRVA 1GL0E 1VJAU 3P17H 2Y7ZA 1ZTKA 2C4FH 4CRAA 1GBAA 1B0FA 2EI6A 3RXEA 4BAQB 3KIDU 1ETRH 2RDLA 1LVMA 3ESTA 1NZQH 2ALPA 1E0FD 3MH6A 3Q76A 1BMLA 1QRXA 4X6NA 2Y81A 4O03A 1EPTC 1P06A 3MNXA 1P2OA 2TGTA 5LPEA 3UREA 1W8BH 1EZQA 1DT2A 4K8YA 4X8TH 1NN6A 4OS1A 2BQ6B 2VWOA 2W3KA 4KTCA 2BVRH 1TOCB 1NRRH 1XUKA 1LTOA 1ELBA 1J14A 3SV2H 1GBIA 2BD5A 2ESTE 1O3PB 4A7IB 1K9OE 5DO4H 4ZAEA 1BA8B 2ZPSA 3SV9A 4ISLA 2VWLA 4O97A 1RD3B 1IQIA 1CA0C 2BOKA 2W3IA 1AUJA 4CRCA 5EXMA 2BDAA 4X2WA 2BY7X 1CGIE 4K2YA 4X8SH 2J92A 3M5LA 1AGJA 2STAE 2HOBA 3LH3A 1PQAA 2O8UA 1H9LB 2GMTB 2OC0A 3RXSA 1ZYOA 3NK8A 4BAKB 9LPRA 4KGAA 1T8MA 3VEQB 1Y8TA 2XC0A 1LPKB 3TNTA 1KY9A 5FCKA 2AYWA 1CGJE 4YZUA 3U9AH 1JBUH 5IYTA 1C1MA 2FZZA 1M9UA 2VWNA 1QQ4A 1O5DH 2A5IA 1C1OA 3RM2H 4IC6A 1AVWA 2BXTH 4H42U 3ZZ3A 2ZHFH 2G00A 1SFIA 2HNTE 2G81E 1P2QA 1C5XB 1GVLA 2A5KA 3ZVAA 1MMJN 5H4IB 2J9NA 2C8XB 3P70B 3UQVA 5FAHA 1HDTH 1BIOA 3SNDA 4BXWA 5JDUB 1EP6A 2EI7A 1RTFB 2EI8A 4U30A 1YPLH 2XRCA 2SGFE 1DY9A 4FVDA 3EYDA 4DVAU 2V6NA 3HGPA 2IPHA 1TQ0B 3HK6B 1GDNA 3E90B 4QT8C 4F4OC 5C1YA 4YTAA 5C67A 1BJUA 1QA7A 1HAPH 4WMEA 3T62A 1QCPA 2ZDNA 1O2QA 2RG3A 1O3NA 3OYPA 5C20A 3O8CA 1IOEA 1AB9B 2V0BA 3A88A 3E16B 3TK5A 1NFWA 3GCHC 2QV1A 1FY5A 2D1JA 4IBLH 5T3HA 2VVVA 1YCPK 2FS8A 1O2SA 2FS9A 1EX3A 3TH3H 4OS6A 1G3DA 3D65E 3NPSA 4H6SB 1TPPA 1O2MA 3ZVBA 3MI4A 4IW4E 4UFGH 1LDTT 4HFPB 2OC7A 4ZXYH 3Q77A 2F3CE 5HMAA 5LPRA 3M3SA 4Y6DA 3TGIE 3P92A 2P3UB 2HPQH 4SGAE 5CHAC 4AYYB 1HJAC 4WH6A 1K1NA 1ELEE 4F49A 5L2ZH 1Y5BT 2V3HH 1SLXB 3RXCA 3BIUH 1W7XH 4PROA 3RXRA 3PLBA 5EU8A 2Z6BD 3MFJA 4JYTA 4XOJA 4TY6A 3LKWA 4AFSA 4B74A 4Q7ZA 3RXVA 3F9EA 2EC9H 1WU1A 4FU8A 2GCHG 1ELGA 1P03A 3ATIA 1VR1H 4X1NU 1O35A 1LQEA 1MQ6A 4NA7A 1UK2A 3MNCA 2B8OH 1C5ZB 2BD7A 1JWTA 3ENSB 1CO7E 4TWWA 3T25A 4Y71A 2GGVB 3KQBA 1LMWB 3RXJA 4ISNA 4NIVA 3RXQA 1XUFA 2ZPQA 5DP4A 4I8LA 3V0XA 4FUBA 5K7RA 1SHHB 1GJDB 3MNBA 4I8HA 1GI8B 1QGFA 1NRNH 1O3IA 1LKBA 1SGQE 2ANYA 3BSQA 2PKSC 3EA9A 3AW0A 3TK6A 3LGYA 4E7RG 2ULLA 3KEEA 1DLKB 2QF0A 2VIOA 1OYTH 2R3UA 3WY8A 3T2NA 1NRPH 5AFYH
chains in the Genus database with same CATH superfamily
1S6LA 5DK1A 5C0TA 1HYLA 2QCYA 4BNRA 4ESTE 1P2NA 2VIQA 4BXSA 6ESTA 3OEHD 1VJ9U 4X2YA 3RXIA 4MNYA 2O8LA 1SVPA 3MO3A 3U69H 4FUIA 1HJ8A 1LHCH 4K3JA 1TNKA 2QXGA 2ZFRH 1GJ8B 5FCRA 3ZZBA 4TT3D 1IQEA 4ASUD 2GCHF 2QF5A 3A8BA 1MU8B 3RMLH 3CS7A 1T8OA 4WMFA 4AG2A 1RJXB 3PLPA 3TNSA 1Z7KA 5I46H 3AAVA 1GJ4H 1TNIA 2TGPZ 3O8DA 1T8LA 1AVXA 1E1QD 2FYQA 2IJD1 1EKBB 3GICB 1FY4A 1H1BA 1MTWA 5DG6A 3MH4A 4IN2A 3FANA 1BTZA 3PTBA 2F9UA 2XW9A 2Q6GA 2O8MA 1EPTB 1GI4A 1P2IA 2HNTF 1Y3XA 1H4WA 5FXLA 1EOLA 3V3MA 1YC0A 3AW1A 1EASA 1QTFA 2HNTC 3P8GA 3QGJA 5A0CA 1ORFA 2TPIZ 3ELAH 3EGKH 3BTHE 3K6ZA 3UOPA 1FI8A 1UK4A 4FOUC 1SG8B 1L0ZA 4UDWH 1QRZA 2UUYA 1ELVA 2FTMA 1S84A 3RXOA 4XE4A 4Y8YA 1A61H 1GHAG 1HAGE 1EJMA 3ZYDA 3RXPA 3U8OH 3GY8A 3F0OA 2WPMS 2P3FH 3VFEA 2BHGA 3N7DA 4MDSA 1X7AC 1YGCH 3OSYA 1ZHPA 2A31A 3KL6A 1VGCC 1QA0A 1QHRB 1L4DA 1O5FH 3NZIA 2F9OA 4B73A 2JJ1D 5DP9A 2WPKS 4B2AA 3ZZAA 1P05A 1AFQC 4ZKSU 3U98H 1HAYB 1PPCE 2AMDA 2G5NA 3SJ8A 3ZVCA 1GBLA 3ODFA 5JBBS 3S7KB 3SZEA 1XMNB 3ITIA 2Y5HA 1CVWH 1TRNA 2HLCA 2C8WB 1QB9A 2GV6A 3M5NA 3TK9A 4ABBA 4AOQA 3TH2H 2TGDA 4AZ2B 1DICA 3A8AA 1MCVA 3RXLA 1C4V2 4JK6A 2FOMB 3K65B 3FP7E 1C9PA 1MH0A 5F53A 1UTPA 4YT7H 2BY8X 5EODA 3PMJA 4Y7AA 1HV7A 2FWWA 2FEQH 5C2ZA 2KM0A 2GT7A 1C5RA 3OU0A 1GBTA 2ZZUH 1PPEE 4ISIH 2SGPE 1GJ6A 1ESAA 1V2NT 1AIXH 1NO9H 5EQQA 4JZ1A 2BY9X 3BTDE 2UWOA 2IN2A 2RDEA 2XBVA 4DGJA 2GZ7A 2CHAC 2QXJA 1C1UH 1Y5UT 1YP9A 3MU1A 3W94A 1GHAF 3M7UA 5I25A 1CHOG 4Z6AH 1EB2A 1N1LA 3GDUA 2IOTA 1BRCE 2R0LA 1XVMA 4AN7A 2FMJA 5J4QA 4LZ1H 1CA8B 1K1OA 5E2OA 1SGYE 1BTYA 1XKBC 1YF4A 1WQVH 4NWLA 1S85A 1VITG 4ACAA 1VZQH 1GJBB 3RU4T 5DP7A 4DY7B 1PYTD 1K1IA 1P9UA 3SNAA 1ZMJA 3PMBB 3P8FA 2J98B 3OY5U 3LGTA 5CHAB 1QL7A 1KXBA 2RA3A 4RN6A 1HJAB 1FAKH 2EY4C 2WYJA 1RFNA 3UTUH 2J98A 4HI3A 4HGCA 3VB3A 3UIRA 4BANB 1AD8H 1KTSB 2ZF0H 4D9QA 3SN8A 1GCDA 2CMYA 1TX6A 1F92A 2FOBA 8KME2 2XCFA 3NRLA 1SLWB 3D23A 3KYFA 3T29A 1W12U 1GBHA 2RA0A 3PO1C 2Z9JA 1K21H 1ANEA 1TX7A 4GCHG 2A45B 2NU4E 1S82A 2BY6X 1NT1A 3S9BA 4NFFA 1E35B 1YPHE 2HVYB 2PGBB 3GY6A 4CRGA 3MH7A 1FY1A 1PJPA 2FDAA 4IMQA 2CXVA 1O2HA 2J95A 3M7TA 3LGWA 3V13A 1SGPE 2ZGXH 3F3BA 2BDIA 1OS8A 1V2MT 1MTVA 2HGTH 3PTNA 3N7EA 1ANBA 3RXFA 1CHOF 3WWFA 2ZHEH 4GAWA 1JRTA 3OEED 1RTLA 1O2YA 1YYY1 1HB0B 2A2QH 2PKSB 3F6UH 1YLDA 1MKWK 2VGCB 1PQ5A 3LPRA 2DUCA 3TGKE 2XCNA 2ZTYA 2QC2A 2ANKH 1CBWB 1S0QA 1YPEH 1BMNH 1TNJA 1GI2A 1ANCA 1D9IA 1GG6C 3ATLA 1O2TA 1VITF 5EQSA 3RXBA 1QY6A 1Z8IB 1ZMNA 1G9IE 3L3TA 2ZKSA 4FUDA 2FOHA 4TSFD 1AE5A 2O8TA 2ODYB 3A87A 4OGYA 2ZDAH 4WF8A 1W11U 3BTGE 3FZZA 2ZPRA 2P8OC 2K8IA 1ZHRA 5TJXA 2QYIA 2GDEH 1VCQA 7KMEH 5AFZH 1TLDA 1HAZB 1Z1IA 4AYVB 4RI0A 2WV9A 4FETA 1O2KA 3Q3YA 1TGCA 3Q3KA 4ZKNU 2NU1E 1C2IA 1W3CA 4GCHF 4DW2U 1GBBA 1SB1H 1BBRH 1ZRBA 4E7NA 2ZC9H 1TBZH 2BVXH 3BG8A 2ZECA 3E1XB 2TBSA 1BDAA 3GISB 3QLPH 2G5VA 2BX4A 4X1QU 3SQEE 1D3TB 3N7OA 1O5GH 1TBRH 1G2LA 3JZ1B 5C5OA 3F2GA 1SHYA 1WQSA 1FLEE 1IHTH 4E05H 1EZUC 3E3TA 1SGCA 5EPYA 4ABEA 2M5TA 2P95A 4Y0YE 1GJ9B 4ABHA 2B0FA 4DIHH 1F0UA 1K1JA 1SPJA 1ARCA 1LHDH 3TITA 1W7GH 2FOCA 1EXFA 3PWCA 3SU1A 3M61U 2A2XH 5LH8A 1F2SE 2ANMH 4MVNA 2FI4E 1A0JA 1NU7B 1JXPA 1HCGA 3FZDA 3MWIU 4AGKA 3OAAD 4VGCC 5FX5A 1AUTC 1ZSLA 3JZ2B 4MLFB 4FUJA 1ARBA 2IPQX 1NESE 3E91A 3SNBA 2VINA 8GCHG 2SFAA 3ODDA 1ZRKA 1Z1JA 1J17T 3UR6A 1LQDB 2C93B 2UUFB 2QY0B 3NXPA 1HAHH 2C8YB 1BCUH 1WYKA 2GKVE 2J2UA 5FX6A 2AIPA 3GY5A 1BHXF 1K1PA 1WDIA 2AFQB 1AFQB 2QIQA 2FOEA 1FIZA 1FONA 1O3EA 5BRRE 2WUCA 3MH5A 3M7QA 2A0QB 2B5TB 1JIRA 1O2ZA 1O5EH 2Q6FA 3TPIZ 3ZVDA 3ATWA 2FO9A 5E0JA 3R0FA 3SUGA 1TNLA 4TWYA 5CE1A 1VITH 1P10A 1NS3A 2FOAA 4B71A 2R0KA 1W13U 3QGNB 5GIBA 1THRH 1Z6JH 1SKYE 2WPHS 2Z9GA 1CU1A 2P94A 2AERH 3DT0H 5AF9H 1QNJA 1DXWA 1V2KT 4JZFH 1A5GH 2RFKC 3A7WA 1C1TA 1IQGA 1C1QA 2B9LA 4NGAH 4U01A 5HM2A 2YMSD 2ZHWH 2JDID 1XVOA 2JETB 1FQ3A 1GBJA 4K1SA 1NY22 1W0JD 1GBKA 3KQ5A 1ZSJA 1PQ7A 5CHBA 1XUIA 1YPHC 4B75A 3A80A 5F8TA 2CHAB 2ALVA 3SV8A 3O8RA 2P3TB 3RXTA 3ZZ9A 2ZCLP 3HATH 4D7FA 1AY6H 2GZ8A 4B6FA 3FVFB 1GHVH 5AHGH 1UCYK 1G3CA 5EJLA 3K2UA 1Y3VA 4FUFA 1C2LA 2XTTB 1NROH 2EA3A 8GCHF 2W6JD 5T1VA 4XBBA 4UEHH 3F1SB 3H7TA 3ZYEA 5EXLA 3U8TH 1O2GH 3E0PB 3MU8A 2OINA 1G30B 1TGNA 4K1EA 1QZ8A 3STJA 4CREA 4HTCH 3MU0A 3GCNA 3EA7A 2WV5A 4ACBA 1GJ5H 1DWDH 1SMFE 1FPCH 1KYNA 1OP2A 2CJIA 3KF2A 3UOUA 3BN9A 2R2MB 3OTPA 2Z9LA 2PFEA 3KQEA 2Y5GA 3UR9A 2GP9B 2RCEA 3QDZB 1BMAA 5EPNA 1O30A 1AHTH 1QL9A 1S6HA 3RM0H 3F0PA 1TGTA 3PO1B 4NIWA 2H5CA 5A2MH 2I6QA 2BXUH 3FOAA 4Z0KA 3M3TA 1AU8A 4WY3A 4JK5A 4HG6A 1A3BH 1W0ZU 2FTLE 2GCTB 3AAUA 1B7XB 1LPGB 4MPUA 4TYDA 1T4VH 1D6WA 6CHAC 1C2GA 1UMAH 2H9EH 2LP6A 2FPZA 4IGDA 3CNRA 3SO3A 3TJUA 1TYNA 2XBYA 1JIMA 1S0RA 1HAOH 4A1XA 1GCTC 5L30H 1FAXA 1BUIA 1INCA 4AFZA 2VIPA 1W2KH 1YPGH 1OWIA 3HK3B 5A8YA 1FDPA 2PUQH 4Y79A 1SQTA 1BJVA 1OWJA 1V2TT 3O8BA 1WSSH 4Q7YA 1QBNA 3VG8A 1NU9A 2BMGB 3SUEA 1P2KA 1C5LH 4LOYH 1N8OC 1OOKB 3P95A 1BTWA 1GG6B 3L6PA 3ZZ5A 2A4QA 3GS9A 1Y5AT 3RXDA 3UUZA 1W10U 1VCPA 2YNBA 1TRMA 2KCAA 1P8VC 1C2HA 5FPYA 1GMDG 1SGFA 5E0HA 1O2PA 2P8OB 2PP6A 4AX9H 1UJ1A 2F43B 2F9VA 1EAIA 1HJ9A 1MABB 2JH0D 1B0EA 4Q4LA 4KTSA 1NPMA 3W1EA 1OWEA 2K1QA 1G36A 3E6PH 1HBTH 2FXRA 1LHGH 2A4RA 2PTCE 4I31A 1OX1A 1CSOE 3MU5A 4FU7A 1P11E 1Q3XA 2BLQA 1C2DA 2C8ZB 2VIWA 1DUEA 1SOTA 2HWLB 4D9RA 4NSVA 1J8AA 2HVXA 1BBRE 1HFDA 1V6DA 1MZAA 4ABJA 1L1NA 5DP5A 3ATMA 3VB4A 1QL8A 1EZSC 1ZMLA 3URCA 4DT7B 1DLEA 5F6MA 1UVUH 2FESH 1C2FA 1P04A 1XM1A 1YLNA 1ZPCA 1O3OA 2ZU5A 3A7TA 2G55A 3E8LA 2OC8A 1HAIH 4YT6H 4I8KA 1ABJH 1GHYH 5HM9A 1TOMH 1FNIA 2AH4X 1O3CA 4O3TA 5EJZA 2Z9KA 1EZXC 4B1TA 1D4PB 1TPAE 5HKKD 3WWBA 1BMMH 1W14U 2BDYA 3ATKA 1OYQA 3TVJB 3ZZ4A 4DOQA 4ZHMU 4WMDA 1Z6EA 5JBAS 1MKXH 5C1XA 4VGCB 1MCTA 4X1RU 2ZWLH 4D76A 3RLYH 5ETXA 1GMDF 1ANDA 2UWPA 4OM9A 1OKXA 1RXPA 4DCDA 1P02A 3MU4A 2WPLS 1UVOA 3BTQE 4K60A 6LPRA 3SV7A 1THPB 1TONA 5GPIB 5A0BA 5EGMA 2ODPA 1O31A 4XFQA 1FXYA 1PQ8A 2FOGA 3GYMA 4BOHA 4CR5A 1G32B 4OS2A 1EAUA 1EPTA 2AMPA 1GBCA 2D26C 2ZDVH 1C5NH 3VXFH 1PYTC 1E38B 1BHXB 1RS0A 3F2FA 3FFGA 2F9PA 1EAWA 3BEUA 1ELAA 2WHXA 1BRAA 1J15A 4AFUA 4M9FA 8LPRA 1SGEE 3SZNA 2KFWA 1PPGE 4Y7BA 1TWXB 2P93A 4X2VA 4LXBH 4AC9A 4CHAC 1CA0B 2FM2A 5DSFA 3ZZ7A 2OQUA 1IQKA 3GY3A 2BX3A 2B7DH 3SQHE 1YY3A 2PSXA 4DIIH 2QN5T 1D6RA 2BYAX 1FY3A 1QBOA 2CGAA 1ZPZA 1RIWC 2PSYA 1AZ8A 4Y0ZE 1WTGH 1A4WH 1MTSA 3LGVA 1UVPA 1O3HA 1FUJA 2ZFPH 1C1SA 2JIZD 5F8ZA 1AFEH 1HXFH 1A2CH 2G4TA 2VJ1A 4K69A 3BTKE 4UFFH 1DWBH 5TCCA 3UNSA 1S83A 4ABGA 1BMFD 5E2PA 1GI1A 1MQ5A 5A0AE 1P12E 3PRDA 4CH8B 2GDDA 3GOVB 3ZV8A 5FPTA 2XC5A 4Y8ZA 1SQOA 3TIUA 4THNH 2XBXA 2Z7FE 8ESTE 3PM3A 2AEIH 1Z8RA 5C1UA 1XUHA 2VH0A 2BD2A 1YCPM 2G4UA 1H8DH 3F9GA 1V2LT 4MNXA 1D3QB 1E37B 1RGQA 1G2MA 1SL3A 4Y76A 1K1MA 4YLQH 4WXIA 1AN1E 3U1JB 1O2UA 2FYRA 1KIGH 3FP8E 3DHKH 5JPMH 1TABE 1GPZA 1C1VH 2VVUA 1TMBH 3SI3H 1GBEA 2Q1JA 4Q63A 3SNCA 2QE7D 3A7VA 4BAMB 4MNVA 7ESTE 2AGGX 4RT0A 1MAYA 1FY8E 4XBDA 3ZVEA 3GCHB 5LPFA 4ZKOU 3K6YA 2SGQE 3EQ0H 1BTPA 4ASHA 2GMTC 2V3OH 2ZIQH 1FV9A 5GNDA 1P09A 1GCTB 1OWDA 4I33A 2YNAA 5EJ1A 4CRFA 1OWKA 3MO6A 5T6FA 3M5OA 1LKAA 1YPJH 1N6YA 1KTTB 4XRNA 4ZHLU 2CF9H 3GDVA 4ZUHA 4M7GA 1QURH 4ZKRU 3SGAE 4RT1A 2W5EA 3PLKA 3SJ9A 3SU0A 1L1GA 4U2WA 1A1RA 3M37A 1O3GA 2FI3E 1OWHA 1LVBA 1GBMA 2ZP0H 1KXEA 1CGHA 3A86A 3PYHA 1UVSH 3RXGA 3KQCA 4X8VH 3PV4A 1S81A 1V2QT 2OBOA 3ZVFA 1DX5M 2JKHA 3QWCH 4Y8XA 1TMUH 2ZA5A 1A0HB 5ABWA 4D8NA 4NIYA 1S6FA 1ZSKA 1SBWA 1Y3UA 2OLGA 1ABIH 1AWFH 4KP0A 4YLUA 4ZXXH 1XXFA 3HKIB 2WSSD 3NKKA 4JCNA 1AI8H 1IQFA 3NWUA 4JZDH 2XXLA 1MUEB 4NA8A 3UY9A 1NBMD 3FKSD 3B9FH 2G52A 2KX4A 1YPKH 2BOHB 4HZHA 2BZAA 1O3DA 3IWMA 5A8ZA 1AB9C 1T31A 2SGAA 6GCHG 5HIYA 1E36B 3OY6U 2A4OA 1EQ9A 4LK4A 3BEFB 2KCPA 1O2JA 2H2ZA 3RP2A 1SLUB 3ZVGA 4FUGA 3EA8A 2A7HA 2I6SA 1SGNE 1GBFA 4U32A 4GHTA 2OK5A 3ZV9A 5G4BA 1P3CA 1Q2WA 1H9IE 2BY5X 4WJG2 3A81A 3TJVA 5DKMA 5DP3A 3UWIA 1DDJA 2UUKB 4BTUB 4J2YB 2FP7B 4AGJA 5FBEA 3S9CA 1YWUA 2GD4B 3MTYA 4B6EA 1K28D 2YMSC 1MBQA 1JOUB 1O5CB 1GJ7B 3PWBA 3ZZ6A 4YOJA 3UNRA 2J4IA 1C5WB 2D8WA 3DD2H 5KECA 4INLA 3K9XB 1Y3WA 2VIVA 1Z8GA 1TA6A 4X2XA 2ODQA 1ELCA 1O2NA 4AG1A 3SORA 4CH2B 1XKAC 2ZDMA 4MPWA 4YOGA 5C0UA 2GX4A 2KZ4A 1GI3A 4A1TA 4FVBA 5EQRA 1N6XA 2STBE 2Y82A 4A1VA 1YLCA 1SI5H 2AS9A 4YO9A 1O38A 3QZQA 3GY7A 5TCAA 2ILNA 3IG6B 3PMHB 2J5UA 2PWXA 1ZJDA 3SJIA 6GCHF 2BDBA 4XSKU 4XBCA 2F91A 3BTME 4UFEH 1EATA 1GI0A 2Y7XA 2ZDLA 4MPVA 2C3SA 2QGRA 1YCPH 3Q3XA 1L4ZA 5JB9S 1V3XA 4YXWD 1ZGVA 5DPAA 1DOJA 3MOCA 2QXHA 3PV2A 4Z1MD 3P6ZB 1C5QA 1HUTH 1S5SA 2ZGJA 2WV4A 3LC5A 2BDHA 1GGDC 2C90B 1E34B 1FJSA 4NA9H 3F68H 1V2JT 1EJNA 5ESTE 1T7CA 2HPPH 5DJ7A 1C1RA 3SHCH 1K0HA 3LT3A 3IITA 1HRTH 2BLOA 1SQRA 2OQ5A 2ZU3A 1PPBH 4X8UH 5C3NA 1ZHMA 1SLVB 1GWAA 1XUJA 1VGCB 1RIWB 2HALA 1QJ7B 1GMHG 1OSSA 1ZTLA 2OCVB 2WPIS 1O2IA 1Z71A 2PHBA 4H4FA 4K1TA 2UUJB 1VKYA 2BQ7B 4YM9A 2KCYA 1ID5H 2XWBI 3C27B 3UWJH 1QJ6B 3RC5A 1HXEH 2Y6TA 2BVSH 1JMOH 3TJOA 4A6LA 5A8XA 1O2WA 1AQ7A 1C5VA 2VNTA 3RMMH 2QXIA 2ZTXA 1TNGA 5C17A 1E1RD 3LIWA 3DFLA 7GCHG 1Z8JB 7LPRA 3ZZ8A 5B6LA 1O5BB 3RDZA 2ZO3H 4RKOB 3HPTB 1YPMH 1U6QA 4OGXA 4ISOA 4KKDA 4FU9A 3RMOH 1C2EA 4ABFA 1J16A 4OS7A 2OUAA 1BQYA 1ZJKA 1O2RA 1UVTH 4CRDA 1CHGA 1NC6A 3I78A 3CS0A 3SNEA 1A3EH 1DVAH 3A7YA 1YKTA 2Z3DA 1A5HA 1COWD 1SGDE 4GUXA 1DY8A 1FN8A 4DJZB 1W0KD 2WPDD 1KXAA 1D3PB 2V7QD 1SC8U 5DGJA 5AVDA 1OP0A 2JH6D 3SU5A 2AIQA 2BLVA 3RMNH 5CMXH 1FPHH 2KCOA 3SU2A 3QK1A 1FX0B 1NRQH 5HXFA 4TPIZ 1UTOA 1P3EA 5C5NA 1GHBG 1O0DH 1F5LA 2BD8A 1TE0A 5T6DA 3KYGA 1KLIH 2Z9IA 1GMHF 1NTPA 2CF8H 5KGOA 3SW2B 1BOQA 3AVZA 3KNXA 1OPHB 3DCLA 4I8JA 4NCYA 4E06H 2ASUB 3A8DA 3S9AA 2GZ9A 2SGEE 3FAOA 4H6TA 1MTNC 3D49H 1EAXA 1O37A 3DA9B 1ELFA 2QF3A 3AASA 4JMYA 2O9QA 3KGPA 1ZGIA 4F48B 5JBCS 1BITA 2SNVA 4MPXA 3GCOA 4X6PA 1F0TA 3SUDA 1WTHD 1DITH 4D7GA 1BRBE 5DN6D 1XXDA 2F83A 2AGIX 3BIVH 3LDXH 4FUEA 4YESB 1EJAA 5KEDA 4NSYA 1TX8A 2ZGHA 3VGCC 7GCHF 4IS5A 1O2LA 1BBRK 1PFXC 1WV7H 1TBQH 2CN0H 4J1YA 2H1UA 1YM0A 3TU7H 3RXAA 3QTOH 2A4GA 4P00A 3T28A 3EAJA 4WWYA 4BAHB 1NBME 3RU4D 4X6MA 2PLXA 1K1LA 1K22H 1V2UT 2GV7A 1F0SA 1P57B 1BTUA 1NFXA 2H9HA 5L6NH 5DP6A 2VB0A 2IJOB 1H8IH 2TGAA 1TB6H 1F7ZA 3PV5A 2BQWB 3T27A 3U1IB 3M35A 2DE9A 2Z94A 3QN7A 5ESBA 1WAYB 2OC1A 1PPHE 1DS2E 1MBMA 3I77A 3V7TA 1O3JA 4UE7H 4Q2KA 4P02A 5HYOA 2JH5D 3A89A 1GI6A 1O3LA 2OD3B 1ZPBA 4JZIA 4JYVH 1GHBF 3SJOA 3U28C 2EQNA 1O2VA 3SJKA 3I29A 1C5YB 1WUNH 3WW7A 3LOXA 5CDFE 4X1PU 3T26A 3FN8A 1V2ST 5J4SA 3BEIB 2DE8A 3OX7U 5FHTA 1DWCH 1DXPA 2VVCA 3LJOA 1Q31A 1TALA 1T8NA 3SU6A 3U8RH 1SR5C 3P8OA 1MZDA 2GT8A 4GVUA 5PTPA 2NU2E 1UCYE 2OBQA 4UFDH 9ESTA 3E0NB 1NFUA 2GVFA 3S69A 3HKJB 1DSTA 3MMGA 1ETTH 5FL7D 1NRSH 1C5MD 4DT4A 1TIOA 2BM2A 3Q00A 3MO9A 3STIA 5EW2H 4AB9A 4NZLA 1IQMA 3D62A 3FO8D 4XDEA 3M5MA 1OP8A 1KDQB 1GHZA 1EP5A 1OXGA 2ZTZA 1KDQA 2ZFSA 1QRWA 2NU0E 2ZG0H 4K8BA 3LONA 4I86A 3SBKA 4ABDA 4BTTB 5EW1H 2AMQA 2FI5E 1KXFA 2FODA 1XUGA 1O2XA 3PROA 1KXDA 2D2DA 1DUAA 3BTWE 1C5UA 1WCZA 1V2PT 2XNIA 1JRSA 3CENA 5GWZA 3SUFA 3RXKA 1UO6A 1UTKA 1G3BA 5BPEA 2PR3A 1EB1H 2BDCA 1UW7A 1G3EA 2FLRH 4I8GA 1C2JA 1VCWA 1TGBA 5GCHG 3SU3A 3PB1E 3VXEH 4OS4A 2PUXB 2VGCC 4A92A 3QUMP 4OS5A 4O9VA 4WXVA 1W0YH 1CBWC 1HLTH 1Y3YA 1ZOMA 2NU3E 1G37A 1O3KA 1AMHA 1GDUA 1TA2A 1Y59T 2LNCA 2H5DA 3LU9B 4INHA 5HIZA 4INKA 1C1PA 5F8XA 1DSUA 2PV9B 1O3AA 1GGDB 4R8TB 5GXPA 3QX5H 3SOSA 1P01A 2ZGCA 1PPZA 1HPGA 2Z3EA 1IQLA 2NWNA 1LVYA 4IN1A 3C1KA 4UD9H 3QO6A 1IQHA 1O36A 1A0LA 4ABIA 2P16A 2G51A 1O33A 5F03A 4CRBA 1IQNA 1GJAB 2KAIB 4GPGA 1BB0B 3TH4H 2KAIA 1ZTJA 1V2WT 4B2CA 1E79D 2A32A 2BDGA 5E8EH 3M3VA 2XWAA 1P0SH 2J34A 3SYJA 1GMCG 4UONA 1A7SA 4Y10E 5T6GA 4JYUH 3ZZCA 2ZEBA 2FOFA 4CBNA 3VB7A 3GY2A 1MD8A 2TIOA 3BV9B 4ZMAH 5K0HA 3PMAB 2BD4A 1SSXA 3T5FH 2ZFFH 1HGTH 3DSOA 3BG4C 2R9PA 1ACBE 1H9HE 1V2RT 2YOLA 4R0IA 4IMZA 5FPSA 3KCGH 3A84A 1K2I1 1YBWA 1IHSH 4NWKA 2V35A 4CR9A 1GHXH 1DE7H 5GCHF 3BTTE 3MHWU 1A5IA 3GY4A 2WINI 3ZZDA 4GSOA 3F2HA 2WPJS 2BD3A 2PKAB 4MQAA 3BTEE 4I7YH 5E0GA 1BTHH 2THFB 1LO6A 4TY7A 4YOIA 1MKWH 2PKAA 1B5GH 1NM6A 3A85A 3H09A 2FX6A 4F55A 2J97A 1ZLRA 2QA9E 4NFEA 1SQAA 3SU4A 1J9CH 4K5ZA 3VB5A 3GDSA 4ABAA 1EOJA 1QB6A 2FLBH 3URDA 2BZ6H 1O3MA 1IAUA 1OHHD 3A7ZA 1AKSB 2TRMA 2OXSA 1KMHB 1AKSA 2SNWA 1SGTA 3BF6H 1AO5A 3AK5A 4MG3A 3P8NA 4O3UA 4KELA 2ZHDA 1WBGB 5HGGA 1TQ7B 2ZQ1A 2P59A 1C1NA 3B8JA 3G01A 2J38A 4BAOB 1UTMA 3NUMA 1DM4B 4AFQA 1MTNB 1LHEH 2A7JA 3SV6A 5GJ4B 3VB6A 2PTNA 1GMCF 1FN6A 1UK3A 1IQJA 2ZNKH 1ESTA 3MNSA 5IDKA 2ZFTA 1F5KU 2L74A 2V3MA 1C5TA 3DFJA 4Y11E 1THSH 1HIAB 1F0RA 1XX9A 2AGEX 3VGCB 1UTNA 1HIAA 1HAVB 1QBVH 1O5AB 2JETC 4X6OA 3RU4E 1HAVA 4TPYA 3NCLA 3M36A 4DURA 3H7OA 3EE0B 6CHAB 2BB4A 2ZU2A 1C5PA 1LPZB 1FMGA 5JYIA 4LZ4B 3QZRA 5LGOA 4SGBE 3KHVA 2WYGA 5L2YH 2KR7A 4GHQA 1UTJA 1EUFA 1ZR0A 3GYLB 2Q6DA 2ZU4A 3TLOA 1TNHA 1AVGH 2VWMA 3L33A 2UWLA 2OP9A 4NG9H 1TFXA 4CBOA 1BZXE 4ZCNA 2R2WU 3R3GB 2A7CA 3S0NA 1GI7B 3SGQE 4RKJB 3LGIA 4B2BA 1ESBA 1LCYA 2EEKA 1QQUA 3UQOA 1GVKB 1C4U2 1GHWH 1HAXB 1N8OB 2Z3CA 1F5RA 1SGFG 1MKXK 2ZCHP 4MNWA 3SHAH 3MQKC 2BD9A 2PW8H 2Y5FA 1C4Y2 4FXGH 1P2MA 2H9TH 2W26A 3S7HB 1O2OA 1BTXA 1GI5A 2WUBA 1ELDE 2JJ2D 2QAAA 1KLTA 1DFPA 1LHFH 1MD7A 2O8WA 3VPKA 1GL1A 1NFYA 1DWEH 1WOFA 3GCTG 3QTVH 2FX4A 1T32A 2VBCA 3A82A 2L6OA 3A7XA 3UPEA 4A5TS 2ZQ2A 4ISHH 2AHME 3EDXB 1AZZA 2ZHQH 1RTKA 2VIDA 3UB0A 1BT7A 1GJCB 3B23B 4NZQA 2GCTC 4FUCA 4ZROA 1A46H 1WXRA 1TRYA 1AWHB 1C1WH 1UHBB 4ZHAA 3TGJE 1ZZZA 1HNEE 4GLYA 2ZU1A 1UHBA 5GDSH 2ZFQH 4DG4A 2SGDE 2ANWA 3LGUA 2A1DB 3TJNA 3FP6E 3RXHA 1O34A 1GDQA 1H8HD 3RLWH 1QJ1B 3A83A 3F9HA 3UNQA 1L1JA 1C5SA 1D3DB 1SFQB 4I32A 1TPSA 3KQDA 4Q7XA 4JZEH 1UCYH 4MTBA 5JB8S 4WVPE 1V2VT 3RUOA 2XBWA 1TMTH 1KXCA 1LVOA 3LC3A 2VU8E 4Q80A 1TPOA 1TAWA 1TGSZ 3OTJE 3W95A 2VH6A 2BLWA 3A8CA 1CT0E 1AE8H 1MAXA 2J94A 2OTVA 3BTFE 1O3BA 2CV3A 3RC4A 5FBIA 1RRKA 2FIRH 2R3YA 3KN2A 1ELTA 3RXUA 2BTCE 1CT4E 3H5CB 1QR3E 1O39A 1DANH 2K0QA 1PPFE 2Y80A 3GCTF 1FIWA 5EXNA 3MYWA 1C2KA 1CE5A 2XYAA 4FUHA 1CT2E 1ETSH 1QIXB 3SGBE 1EFRD 1SOZA 1C5OH 2ZDKA 1MU6B 3HGNA 4IC5A 2XC4A 2W7SA 1DPOA 5B6OA 2W7UA 3UFAA 2ZCKP 1GBDA 1O3FA 3CP7A 2A5AA 1GI9B 1QFKH 1T4UH 1KLJH 3LJJA 1CQQA 1O32A 3RC6A 3RXMA 2F9NA 4B76A 1MTUA 3PRBA 2PGQB 1SGRE 2XOKD 4AB8A 1P9SA 3BG4B 2ZI2H 2GTBA 4WH8A 1SGIB 5C94A 3LH1A 5A09A 4AORA 4BTIB 1V2OT 4CHAB 1BRUP 1FZZA 4NIXA 2F9BH 2ZGBH 2G8TA 5EOKA 4X1SU 5SGAE 3DUXH 3SI4H 2F4LA 3EE7A 1P2JA 5EG4A 2LPRA 1KSNA 1L2EA 3V12A 1QB1A 4X0WU 1C2MA 3ZIAD 4KTUA 5JBTA 3F9FA 5DP8A 4ZH8A 1C9TA 2CK3D 1GVZA 1UTLM 1UTQA 2H6MA 4RSPA 2HRVA 1GL0E 1VJAU 3P17H 2Y7ZA 1ZTKA 2C4FH 4CRAA 1B0FA 1GBAA 2EI6A 3RXEA 4BAQB 3KIDU 1ETRH 2RDLA 1LVMA 3ESTA 1NZQH 2ALPA 1E0FD 3MH6A 3Q76A 1BMLA 1QRXA 4X6NA 2Y81A 2QF4A 4O03A 1EPTC 1P06A 3MNXA 1P2OA 2TGTA 5LPEA 3UREA 1W8BH 1EZQA 1DT2A 4K8YA 4X8TH 1NN6A 4OS1A 2BQ6B 2VWOA 2W3KA 4KTCA 2BVRH 4XD7D 1TOCB 1NRRH 1XUKA 1LTOA 1ELBA 1J14A 3SV2H 1GBIA 2BD5A 2ESTE 1O3PB 4A7IB 1K9OE 5DO4H 4ZAEA 1BA8B 2ZPSA 3SV9A 4ISLA 2VWLA 4O97A 1RD3B 1IQIA 1CA0C 2BOKA 2W3IA 1AUJA 4CRCA 5EXMA 2BDAA 4X2WA 2BY7X 1CGIE 4K2YA 4X8SH 2J92A 3M5LA 1AGJA 2STAE 2GJGA 2HOBA 3LH3A 1PQAA 3N99A 5IK2D 2XNDD 2O8UA 1H9LB 2GMTB 2OC0A 3RXSA 1ZYOA 3DSGA 3NK8A 4BAKB 9LPRA 4KGAA 1T8MA 3VEQB 1Y8TA 2XC0A 1LPKB 3TNTA 1KY9A 5FCKA 2AYWA 1CGJE 4YZUA 3U9AH 1JBUH 5IYTA 1C1MA 2FZZA 1M9UA 2VWNA 1QQ4A 1O5DH 2A5IA 1C1OA 3RM2H 4IC6A 1AVWA 2BXTH 4H42U 3ZZ3A 2ZHFH 2G00A 1SFIA 2HNTE 2G81E 1P2QA 1C5XB 1GVLA 2A5KA 3ZVAA 1MMJN 5H4IB 2J9NA 2C8XB 3P70B 3UQVA 5FAHA 1HDTH 1BIOA 3SNDA 4BXWA 5JDUB 1EP6A 3DSPA 2EI7A 1RTFB 2EI8A 4U30A 1YPLH 2XRCA 2SGFE 1DY9A 2W6ID 4FVDA 3EYDA 4DVAU 2V6NA 3HGPA 2IPHA 1TQ0B 3HK6B 1GDNA 3E90B 4QT8C 4F4OC 2LELA 5EIYA 5C1YA 4YTAA 5C67A 1BJUA 1QA7A 1HAPH 4WMEA 3T62A 1QCPA 2ZDNA 3OFND 1O2QA 2RG3A 1O3NA 3OYPA 5C20A 3O8CA 1IOEA 1AB9B 2V0BA 3A88A 3E16B 3TK5A 1NFWA 3GCHC 2QV1A 1FY5A 2D1JA 4IBLH 5T3HA 2VVVA 1YCPK 2FS8A 1O2SA 2WZQA 2FS9A 1EX3A 3TH3H 4OS6A 1G3DA 3D65E 3NPSA 4H6SB 1TPPA 1O2MA 3ZVBA 3MI4A 4IW4E 4UFGH 1LDTT 4HFPB 2OC7A 4ZXYH 3Q77A 2F3CE 5HMAA 5LPRA 3UAIC 3M3SA 4Y6DA 3TGIE 3P92A 2P3UB 2HPQH 4SGAE 2M2AA 3OE7D 5CHAC 4AYYB 1HJAC 4WH6A 1K1NA 1ELEE 4F49A 5L2ZH 1Y5BT 2HLDD 2V3HH 1SLXB 3RXCA 3BIUH 1W7XH 4PROA 3RXRA 3PLBA 5EU8A 2Z6BD 3MFJA 4JYTA 4XOJA 4TY6A 3LKWA 4AFSA 2YMSB 4B74A 4Q7ZA 3RXVA 3F9EA 2EC9H 1WU1A 4FU8A 2GCHG 1ELGA 1P03A 3ATIA 1VR1H 4X1NU 1O35A 1LQEA 1MQ6A 4NA7A 1UK2A 3MNCA 2B8OH 1C5ZB 2BD7A 1JWTA 3ENSB 1CO7E 4TWWA 3T25A 4Y71A 1H8ED 2GGVB 3KQBA 1LMWB 3RXJA 4ISNA 4NIVA 3RXQA 1XUFA 2ZPQA 5DP4A 4I8LA 3V0XA 4FUBA 5K7RA 1SHHB 1GJDB 3MNBA 4I8HA 1GI8B 1QGFA 1NRNH 1O3IA 1LKBA 1SGQE 2ANYA 3BSQA 2PKSC 3EA9A 3AW0A 3TK6A 3LGYA 4E7RG 2ULLA 3KEEA 1DLKB 2QF0A 2VIOA 1OYTH 2R3UA 3WY8A 3T2NA 1NRPH 5AFYH
chains in the Genus database with same CATH topology
5DK1A 1HYLA 2QCYA 4BNRA 4ESTE 1P2NA 2VIQA 4BXSA 6ESTA 4X2YA 1VJ9U 3RXIA 4MNYA 2O8LA 1SVPA 3MO3A 3U69H 4FUIA 1HJ8A 1LHCH 4K3JA 1TNKA 2QXGA 2ZFRH 1GJ8B 5FCRA 3ZZBA 1IQEA 2GCHF 3A8BA 1MU8B 3RMLH 3CS7A 1T8OA 4WMFA 4AG2A 1RJXB 3PLPA 3TNSA 1Z7KA 5I46H 3AAVA 1GJ4H 1TNIA 2TGPZ 3O8DA 1T8LA 1AVXA 2FYQA 1EKBB 3GICB 1FY4A 1H1BA 1MTWA 5DG6A 3MH4A 4IN2A 3FANA 1BTZA 3PTBA 2F9UA 2XW9A 2Q6GA 2O8MA 1EPTB 1GI4A 1P2IA 2HNTF 1Y3XA 1H4WA 5FXLA 1EOLA 3V3MA 1YC0A 3AW1A 1EASA 1QTFA 2HNTC 3P8GA 3QGJA 5A0CA 1ORFA 2TPIZ 3ELAH 3EGKH 3BTHE 3K6ZA 3UOPA 1FI8A 1UK4A 1SG8B 1L0ZA 4UDWH 1QRZA 2UUYA 1ELVA 2FTMA 1S84A 3RXOA 4XE4A 4Y8YA 1A61H 1GHAG 1HAGE 1EJMA 3ZYDA 3RXPA 3U8OH 3GY8A 2WPMS 2P3FH 3VFEA 2BHGA 4MDSA 1X7AC 1YGCH 3OSYA 1ZHPA 2A31A 3KL6A 1VGCC 1QA0A 1QHRB 1L4DA 1O5FH 3NZIA 2F9OA 4B73A 5DP9A 2WPKS 4B2AA 3ZZAA 1P05A 1AFQC 4ZKSU 3U98H 1HAYB 1PPCE 2AMDA 2G5NA 3SJ8A 3ZVCA 1GBLA 3ODFA 5JBBS 3S7KB 1XMNB 3ITIA 2Y5HA 1CVWH 1TRNA 2HLCA 2C8WB 1QB9A 2GV6A 3M5NA 3TK9A 4ABBA 4AOQA 3TH2H 2TGDA 4AZ2B 1DICA 3A8AA 1MCVA 3RXLA 1C4V2 4JK6A 2FOMB 3K65B 3FP7E 1C9PA 1MH0A 1UTPA 4YT7H 2BY8X 5EODA 3PMJA 4Y7AA 1HV7A 2FWWA 2FEQH 5C2ZA 2GT7A 1C5RA 3OU0A 1GBTA 2ZZUH 1PPEE 4ISIH 2SGPE 1GJ6A 1ESAA 1V2NT 1AIXH 1NO9H 5EQQA 4JZ1A 2BY9X 3BTDE 2UWOA 2IN2A 2XBVA 4DGJA 2GZ7A 2CHAC 2QXJA 1C1UH 1Y5UT 1YP9A 3MU1A 3W94A 1GHAF 3M7UA 5I25A 1CHOG 4Z6AH 1EB2A 1N1LA 3GDUA 2IOTA 1BRCE 2R0LA 1XVMA 4AN7A 2FMJA 5J4QA 4LZ1H 1CA8B 1K1OA 5E2OA 1SGYE 1BTYA 1XKBC 1YF4A 1WQVH 4NWLA 1S85A 1VITG 1VZQH 1GJBB 3RU4T 5DP7A 4DY7B 1PYTD 1K1IA 1P9UA 3SNAA 1ZMJA 3PMBB 3P8FA 3OY5U 3LGTA 5CHAB 1QL7A 1KXBA 2RA3A 4RN6A 1HJAB 1FAKH 2WYJA 1RFNA 3UTUH 4HI3A 4HGCA 3VB3A 3UIRA 4BANB 1AD8H 1KTSB 2ZF0H 4D9QA 3SN8A 1GCDA 2CMYA 1TX6A 1F92A 2FOBA 8KME2 2XCFA 1SLWB 3D23A 3T29A 1W12U 1GBHA 2RA0A 3PO1C 2Z9JA 1K21H 1ANEA 1TX7A 4GCHG 2A45B 2NU4E 1S82A 2BY6X 1NT1A 3S9BA 4NFFA 1E35B 1YPHE 2PGBB 3GY6A 4CRGA 3MH7A 1FY1A 1PJPA 2FDAA 4IMQA 2CXVA 1O2HA 2J95A 3M7TA 3LGWA 3V13A 1SGPE 2ZGXH 2BDIA 1OS8A 1V2MT 1MTVA 2HGTH 3PTNA 1ANBA 3RXFA 1CHOF 2ZHEH 4GAWA 1JRTA 1RTLA 1O2YA 1YYY1 1HB0B 2A2QH 2PKSB 3F6UH 1YLDA 1MKWK 2VGCB 1PQ5A 3LPRA 2DUCA 3TGKE 2XCNA 2ZTYA 2QC2A 2ANKH 1CBWB 1S0QA 1YPEH 1BMNH 1TNJA 1GI2A 1ANCA 1D9IA 1GG6C 3ATLA 1O2TA 1VITF 5EQSA 3RXBA 1QY6A 1Z8IB 1ZMNA 1G9IE 3L3TA 2ZKSA 4FUDA 2FOHA 1AE5A 2O8TA 2ODYB 3A87A 4OGYA 2ZDAH 4WF8A 1W11U 3BTGE 3FZZA 2ZPRA 2P8OC 1ZHRA 5TJXA 2QYIA 2GDEH 1VCQA 7KMEH 5AFZH 1TLDA 1HAZB 1Z1IA 4AYVB 1O2KA 3Q3YA 1TGCA 3Q3KA 4ZKNU 2NU1E 1C2IA 1W3CA 4GCHF 4DW2U 1GBBA 1SB1H 1BBRH 1ZRBA 4E7NA 2ZC9H 1TBZH 2BVXH 3BG8A 2ZECA 3E1XB 2TBSA 1BDAA 3GISB 3QLPH 2G5VA 2BX4A 4X1QU 3SQEE 1D3TB 3N7OA 1O5GH 1TBRH 1G2LA 3JZ1B 5C5OA 1SHYA 1WQSA 1FLEE 1IHTH 4E05H 1EZUC 3E3TA 1SGCA 5EPYA 4ABEA 2M5TA 2P95A 4Y0YE 1GJ9B 4ABHA 2B0FA 4DIHH 1F0UA 1K1JA 1SPJA 1ARCA 1LHDH 3TITA 1W7GH 2FOCA 1EXFA 3PWCA 3SU1A 3M61U 2A2XH 5LH8A 1F2SE 2ANMH 4MVNA 2FI4E 1A0JA 1NU7B 1JXPA 1HCGA 3FZDA 3MWIU 4AGKA 4VGCC 5FX5A 1AUTC 1ZSLA 3JZ2B 4MLFB 4FUJA 1ARBA 3SNBA 1NESE 3E91A 2VINA 8GCHG 2SFAA 3ODDA 1ZRKA 1Z1JA 1J17T 3UR6A 1LQDB 2C93B 2UUFB 2QY0B 3NXPA 1HAHH 2C8YB 1BCUH 1WYKA 2GKVE 2J2UA 5FX6A 2AIPA 3GY5A 1BHXF 1K1PA 2AFQB 1AFQB 2QIQA 2FOEA 1FIZA 1FONA 1O3EA 5BRRE 2WUCA 3MH5A 3M7QA 2A0QB 2B5TB 1JIRA 1O2ZA 1O5EH 2Q6FA 3TPIZ 3ZVDA 3ATWA 2FO9A 5E0JA 3R0FA 3SUGA 1TNLA 4TWYA 5CE1A 1VITH 1P10A 1NS3A 2FOAA 4B71A 2R0KA 1W13U 3QGNB 5GIBA 1THRH 1Z6JH 2WPHS 2Z9GA 1CU1A 2P94A 2AERH 3DT0H 5AF9H 1QNJA 1DXWA 1V2KT 4JZFH 1A5GH 3A7WA 1C1TA 1IQGA 1C1QA 2B9LA 4NGAH 4U01A 5HM2A 2ZHWH 1XVOA 2JETB 1FQ3A 1GBJA 4K1SA 1NY22 1GBKA 1ZSJA 1PQ7A 1XUIA 1YPHC 4B75A 3A80A 5F8TA 2CHAB 2ALVA 3SV8A 3O8RA 2P3TB 3RXTA 3ZZ9A 2ZCLP 3HATH 4D7FA 1AY6H 2GZ8A 3FVFB 1GHVH 5AHGH 1UCYK 1G3CA 3K2UA 1Y3VA 4FUFA 1C2LA 2XTTB 1NROH 2EA3A 8GCHF 4XBBA 4UEHH 3F1SB 3H7TA 3ZYEA 5EXLA 3U8TH 1O2GH 3E0PB 3MU8A 2OINA 1G30B 1TGNA 4K1EA 3STJA 4CREA 4HTCH 3MU0A 3GCNA 3EA7A 2WV5A 1GJ5H 1DWDH 1SMFE 1FPCH 1KYNA 1OP2A 2CJIA 3KF2A 3UOUA 3BN9A 2R2MB 2Z9LA 2PFEA 3KQEA 2Y5GA 3UR9A 2GP9B 2RCEA 3QDZB 1BMAA 5EPNA 1O30A 1AHTH 1QL9A 1S6HA 3RM0H 1TGTA 3PO1B 4NIWA 2H5CA 5A2MH 2I6QA 2BXUH 4Z0KA 3M3TA 1AU8A 4WY3A 4JK5A 1A3BH 1W0ZU 2FTLE 2GCTB 3AAUA 1B7XB 1LPGB 4MPUA 4TYDA 1T4VH 1D6WA 6CHAC 1C2GA 1UMAH 2H9EH 4IGDA 2FPZA 3SO3A 3TJUA 1TYNA 2XBYA 1JIMA 1S0RA 1HAOH 4A1XA 1GCTC 5L30H 1FAXA 1BUIA 1INCA 4AFZA 2VIPA 1W2KH 1YPGH 1OWIA 3HK3B 5A8YA 1FDPA 2PUQH 4Y79A 1SQTA 1BJVA 1OWJA 1V2TT 3O8BA 1WSSH 4Q7YA 1QBNA 1NU9A 2BMGB 3SUEA 1P2KA 1C5LH 4LOYH 1N8OC 1OOKB 3P95A 1BTWA 1GG6B 3L6PA 3ZZ5A 2A4QA 1Y5AT 3RXDA 3UUZA 1W10U 1VCPA 2YNBA 1TRMA 1P8VC 1C2HA 5FPYA 1GMDG 1SGFA 5E0HA 1O2PA 2P8OB 4AX9H 1UJ1A 2F9VA 1EAIA 1HJ9A 2JH0D 1B0EA 4KTSA 1NPMA 1OWEA 2K1QA 1G36A 3E6PH 1HBTH 2FXRA 1LHGH 2A4RA 2PTCE 4I31A 1OX1A 1CSOE 3MU5A 4FU7A 1P11E 1Q3XA 2BLQA 1C2DA 2C8ZB 2VIWA 1DUEA 1SOTA 2HWLB 4D9RA 4NSVA 1J8AA 2HVXA 1BBRE 1HFDA 1V6DA 1MZAA 4ABJA 1L1NA 5DP5A 3ATMA 3VB4A 1QL8A 1EZSC 1ZMLA 3URCA 4DT7B 1DLEA 5F6MA 1UVUH 2FESH 1C2FA 1P04A 1XM1A 1ZPCA 1O3OA 2ZU5A 3A7TA 2G55A 3E8LA 2OC8A 1HAIH 4YT6H 4I8KA 1ABJH 1GHYH 5HM9A 1TOMH 1FNIA 2AH4X 1O3CA 4O3TA 2Z9KA 1EZXC 4B1TA 1D4PB 1TPAE 1BMMH 1W14U 2BDYA 3ATKA 1OYQA 3TVJB 3ZZ4A 4DOQA 4ZHMU 4WMDA 1Z6EA 5JBAS 1MKXH 5C1XA 4VGCB 1MCTA 4X1RU 2ZWLH 4D76A 3RLYH 5ETXA 1GMDF 1ANDA 2UWPA 1OKXA 1RXPA 4DCDA 1P02A 3MU4A 2WPLS 1UVOA 3BTQE 4K60A 6LPRA 3SV7A 1THPB 1TONA 5GPIB 5A0BA 5EGMA 2ODPA 1O31A 4XFQA 1FXYA 1PQ8A 2FOGA 3GYMA 4BOHA 4CR5A 1G32B 4OS2A 1EAUA 1EPTA 2AMPA 1GBCA 2D26C 2ZDVH 1C5NH 3VXFH 1PYTC 1E38B 1BHXB 1RS0A 3FFGA 2F9PA 1EAWA 3BEUA 1ELAA 1BRAA 1J15A 4AFUA 8LPRA 1SGEE 3SZNA 1PPGE 4Y7BA 1TWXB 2P93A 4X2VA 4LXBH 4CHAC 1CA0B 2FM2A 3ZZ7A 2OQUA 1IQKA 3GY3A 2BX3A 2B7DH 3SQHE 2PSXA 4DIIH 2QN5T 1D6RA 2BYAX 1FY3A 1QBOA 2CGAA 1ZPZA 1RIWC 2PSYA 1AZ8A 4Y0ZE 1WTGH 1A4WH 1MTSA 3LGVA 1UVPA 1O3HA 1FUJA 2ZFPH 1C1SA 5F8ZA 1AFEH 1HXFH 1A2CH 2G4TA 2VJ1A 4K69A 3BTKE 4UFFH 1DWBH 5TCCA 3UNSA 1S83A 4ABGA 5E2PA 1GI1A 1MQ5A 5A0AE 1P12E 4CH8B 2GDDA 3GOVB 3ZV8A 5FPTA 2XC5A 4Y8ZA 1SQOA 3TIUA 4THNH 2XBXA 2Z7FE 8ESTE 3PM3A 2AEIH 1Z8RA 5C1UA 1XUHA 2VH0A 2BD2A 1YCPM 2G4UA 1H8DH 3F9GA 1V2LT 4MNXA 1D3QB 1E37B 1RGQA 1G2MA 1SL3A 4Y76A 1K1MA 4YLQH 4WXIA 1AN1E 3U1JB 1O2UA 2FYRA 1KIGH 3FP8E 3DHKH 5JPMH 1TABE 1GPZA 1C1VH 2VVUA 1TMBH 3SI3H 1GBEA 2Q1JA 3SNCA 7ESTE 3A7VA 4BAMB 4MNVA 2AGGX 1MAYA 1FY8E 4XBDA 3ZVEA 3GCHB 5LPFA 4ZKOU 3K6YA 2SGQE 3EQ0H 1BTPA 4ASHA 2GMTC 2V3OH 2ZIQH 1FV9A 1P09A 1GCTB 1OWDA 4I33A 2YNAA 4CRFA 1OWKA 3MO6A 5T6FA 3M5OA 1LKAA 1YPJH 1N6YA 1KTTB 4ZHLU 2CF9H 3GDVA 4ZUHA 4M7GA 1QURH 4ZKRU 3SGAE 2W5EA 3PLKA 3SJ9A 3SU0A 1L1GA 4U2WA 1A1RA 3M37A 1O3GA 2FI3E 1OWHA 1LVBA 1GBMA 2ZP0H 1KXEA 1CGHA 3A86A 3PYHA 1UVSH 3RXGA 3KQCA 4X8VH 3PV4A 1S81A 1V2QT 2OBOA 3ZVFA 1DX5M 2JKHA 3QWCH 4Y8XA 1TMUH 2ZA5A 1A0HB 5ABWA 4D8NA 4NIYA 1S6FA 1ZSKA 1SBWA 1Y3UA 2OLGA 1ABIH 1AWFH 4KP0A 4YLUA 4ZXXH 1XXFA 3HKIB 3NKKA 4JCNA 1AI8H 1IQFA 3NWUA 4JZDH 2XXLA 1MUEB 4NA8A 3UY9A 3B9FH 2G52A 1YPKH 2BOHB 4HZHA 2BZAA 1O3DA 3IWMA 5A8ZA 1AB9C 1T31A 2SGAA 6GCHG 1E36B 3OY6U 2A4OA 1EQ9A 4LK4A 3BEFB 1O2JA 2H2ZA 3RP2A 1SLUB 3ZVGA 4FUGA 3EA8A 2A7HA 2I6SA 1SGNE 1GBFA 4U32A 4GHTA 3ZV9A 5G4BA 1P3CA 1Q2WA 1H9IE 2BY5X 4WJG2 3A81A 3TJVA 5DKMA 5DP3A 3UWIA 1DDJA 2UUKB 4BTUB 4J2YB 2FP7B 4AGJA 5FBEA 3S9CA 3MTYA 2GD4B 1K28D 1MBQA 1JOUB 1O5CB 1GJ7B 3PWBA 3ZZ6A 4YOJA 3UNRA 2J4IA 1C5WB 2D8WA 3DD2H 4INLA 3K9XB 1Y3WA 2VIVA 1Z8GA 1TA6A 4X2XA 2ODQA 1ELCA 1O2NA 4AG1A 3SORA 4CH2B 1XKAC 2ZDMA 4MPWA 4YOGA 2GX4A 1GI3A 4A1TA 4FVBA 5EQRA 1N6XA 2STBE 2Y82A 4A1VA 1YLCA 1SI5H 2AS9A 4YO9A 1O38A 3QZQA 3GY7A 5TCAA 2ILNA 3IG6B 3PMHB 2PWXA 1ZJDA 3SJIA 6GCHF 2BDBA 4XSKU 4XBCA 2F91A 3BTME 4UFEH 1EATA 1GI0A 2Y7XA 2ZDLA 4MPVA 2C3SA 2QGRA 1YCPH 3Q3XA 1L4ZA 5JB9S 1V3XA 1ZGVA 5DPAA 1DOJA 3MOCA 2QXHA 3P6ZB 1C5QA 1HUTH 1S5SA 2ZGJA 2WV4A 3LC5A 2BDHA 1GGDC 2C90B 1E34B 1FJSA