4D9QA

Inhibiting alternative pathway complement activation by targeting the exosite on factor d
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
228
structure length
228
Chain Sequence
ILGGREAEAHARPYMASVQVNGEHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVEPGTLCDVAGWGIVSHAGRRPDRLQHVLLPVLDRATCNRRTHHDGAITQRMMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Factor D
publication title Inhibiting alternative pathway complement activation by targeting the factor d exosite.
pubmed doi rcsb
source organism Macaca mulatta
total genus 58
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d9qA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d9qA01
1FIWA 1WTHD 1DUAA 1DXWA 3FAOA 1GJ7B 1SPJA 3KF2A 1BRCE 4I8GA 1MAXA 2GX4A 1ZTLA 1G2MA 1QY6A 1VCWA 4PROA 2H9TH 2XYAA 5E2OA 5F03A 1FY5A 1GVKB 1LKAA 3F68H 2C8XB 5LPEA 1AKSB 1AWHB 4U30A 2PTNA 4FU8A 1ELVA 3FP7E 3SOSA 2FI5E 1GBFA 3SNBA 4KGAA 1DWCH 1O5EH 1ZPZA 2Y5FA 2ZGXH 3NWUA 1WTGH 1A5HA 3RXFA 1XVOA 1B5GH 2WUBA 1KXBA 3RXDA 1O31A 3VFEA 1LVMA 4JYVH 3LGUA 1O3MA 3PWCA 1W0YH 4DVAU 2P16A 1TMBH 2RDLA 2F9BH 2P3TB 1P2JA 2D8WA 2STBE 1UMAH 3RLWH 1C2HA 1BRUP 4J1YA 1RS0A 4MG3A 2UUKB 1C1OA 1LHCH 1UHBA 2FYRA 3PMJA 1BRAA 2SNWA 1O0DH 3T27A 1Z1JA 2ZFFH 2A4RA 1CSOE 2OLGA 3RLYH 2NU1E 2CXVA 1QNJA 3U8TH 2BDIA 2P8OB 1A0JA 2BD9A 5TCAA 4IC5A 5DP9A 5LGOA 1EUFA 1Y5UT 4WWYA 3O8RA 2BOKA 1MTNC 3AW0A 3Q77A 1LHFH 3PLBA 4JZEH 4XSKU 1HIAB 2VVCA 2ZPQA 4THNH 3E0PB 1JOUB 1EOJA 2AH4X 1OWEA 3S9BA 4ABDA 2BZ6H 1GMHG 1GJ4H 1HIAA 2G00A 4CH8B 1IOEA 1V2VT 4YZUA 2P8OC 1C1WH 1HBTH 1IQMA 1C1PA 4WMDA 1C1UH 3O8DA 1SL3A 1BRBE 1K9OE 1QA0A 5EPYA 1GVLA 1RIWB 1UJ1A 3BEUA 2BZAA 5EQRA 3KN2A 2Y5GA 3M61U 4WH6A 3A86A 1E38B 4I33A 1EZSC 5C20A 1V2MT 1KYNA 3A7YA 1XMNB 3SUGA 1EOLA 2CMYA 9ESTA 2NU2E 1O3EA 4AG2A 2EI6A 1PPFE 3MU0A 1V6DA 3NCLA 1GMHF 2FPZA 2ZDAH 1W13U 1O2UA 4WVPE 3CENA 1GI0A 2QN5T 5LH8A 4U01A 1AY6H 3RU4D 4X6PA 1Z8RA 1HAVB 1V2NT 5GXPA 3KQCA 1C2EA 2ILNA 4Q80A 5F6MA 1GBMA 2DE8A 1GBBA 3SN8A 3E3TA 3ESTA 2ZDKA 2JH6D 3U8OH 4Y8YA 3I29A 2XWAA 1GI6A 3ODFA 4BNRA 3F9EA 1YKTA 1NU7B 1FY8E 4YLUA 4I8KA 1WBGB 3U1JB 5T6GA 3B23B 3ZYDA 1GBTA 2TGPZ 3NK8A 1KTSB 1J17T 5EU8A 3TH2H 4XBDA 5FPSA 4BXWA 1HV7A 3M3VA 4Y0YE 1GHWH 2G81E 2J9NA 1HGTH 1TX8A 3UQOA 1BBRH 1DDJA 6ESTA 2QXJA 1AUTC 1NFWA 2Y5HA 1H9LB 1O2XA 1Z1IA 1XX9A 3UIRA 2BLQA 4YOJA 3V12A 1MCTA 4X1NU 3MH7A 4K69A 2ZDMA 4FXGH 2VIWA 4ZKSU 4Y0ZE 1DWEH 2FOBA 5FCKA 2IN2A 2O8UA 3HK3B 1AWFH 1GJ5H 4E7NA 4TY7A 5C1YA 3KIDU 2GT7A 4MPXA 4OS4A 1AVGH 5IYTA 4AOQA 3A85A 1C1RA 1IQHA 1OOKB 3T2NA 4ABGA 3F9HA 2ZCHP 3ATKA 4Y10E 1LPZB 2BQ6B 4R0IA 3FVFB 2VWLA 3HKJB 2H5CA 5AFZH 1O33A 3SU4A 2VH6A 3K6YA 2Z7FE 3DT0H 2G52A 1W8BH 2G4TA 2GD4B 2ZCKP 1SHYA 3BTME 1C1MA 1CT2E 5FXLA 1P2IA 1OKXA 3QO6A 1DITH 1O2LA 1TPPA 3UTUH 2CN0H 1NRPH 1ZHPA 1BJVA 3M7TA 2OTVA 3PMBB 4ZXXH 3P8OA 1QQ4A 4NIYA 1GJ8B 1GDQA 2FS8A 1DSTA 4INLA 2FOEA 1TNJA 2AS9A 5EGMA 1O2GH 2VIOA 1O2PA 2A45B 3KQBA 2R0KA 4ZKOU 5SGAE 3RXBA 1FV9A 2BD3A 3ZZCA 4JZDH 1O5CB 5DPAA 3NZIA 3MNCA 2ZHFH 3HATH 1PQ5A 1GI1A 2J94A 1AD8H 5A8ZA 1MCVA 1ANCA 1AGJA 4AG1A 2ZPSA 3RM0H 3TU7H 1JIRA 2AERH 1QBNA 4BANB 5BRRE 2G51A 1DY8A 2SFAA 1SQOA 2FMJA 2M5TA 1MTWA 2V0BA 2PWXA 3RXQA 1ETRH 1SGDE 1GBKA 4Z6AH 4ABEA 1H8DH 5C1UA 4HZHA 1YPGH 9LPRA 4X1SU 2FXRA 4FUBA 1S0QA 2A5KA 3RM2H 3RXJA 2UWOA 1AUJA 1LO6A 5HYOA 2ZFPH 1SFQB 2FOCA 1V2TT 1FUJA 1QRZA 1D3TB 2QYIA 2ZDVH 4NWLA 2O8WA 1QJ6B 5K7RA 1GI5A 1Z8IB 1C5MD 3Q3KA 3SNDA 3MO9A 1AE8H 3MYWA 3VXEH 1BHXB 1B7XB 3T29A 5FAHA 1YF4A 2VNTA 1F5LA 2BD8A 3A89A 3MO3A 4B75A 5JYIA 1UTJA 2C8ZB 1G36A 1GJAB 3QGNB 1IQFA 4X8VH 5E2PA 1SLXB 4O9VA 3OYPA 1C4U2 3EQ0H 4R8TB 3CS7A 2A0QB 1RD3B 1PQAA 3SW2B 1O38A 1Y3UA 2FLRH 3Q00A 2C3SA 5EW2H 2H1UA 1B0EA 4FUCA 1FAXA 1L0ZA 1FI8A 1YLDA 2SGPE 1ZMLA 1J15A 4D7FA 3RC4A 1C5YB 1LPKB 2FZZA 3AVZA 1QB1A 1TNGA 2P94A 4MPVA 3RXCA 2PW8H 3PO1B 1EAXA 1FONA 3SNAA 3QN7A 5DK1A 1QA7A 2QXHA 3BTWE 4JYTA 2ZI2H 2QA9E 1TE0A 1J9CH 5BPEA 1YPMH 1MKWH 3ELAH 3SV7A 1HAPH 1FXYA 5TJXA 2EI7A 1G3BA 3A7VA 2BXUH 4FUGA 3MU4A 4KTSA 1C1NA 1ZSJA 1ZYOA 3E1XB 4B2CA 3GISB 1S6HA 3SI4H 3FP8E 3BSQA 4HI3A 2GZ7A 5EQSA 3MNXA 1TFXA 2WV4A 6GCHG 2ANMH 3UOPA 1ZJKA 3SGBE 1D4PB 2D2DA 4NA7A 1C1TA 5CE1A 5EXLA 1CVWH 2K1QA 4B2BA 1DFPA 2OCVB 4XDEA 3B8JA 1Y3XA 3RXSA 1PQ7A 2CV3A 4NGAH 4GAWA 4AGKA 3I78A 2XBYA 2FESH 2ZHQH 3EA8A 2RA0A 1SGIB 1LHEH 3A80A 4XFQA 4J2YB 1O3DA 2HNTC 3E91A 3BG8A 1TONA 2ANKH 1SOTA 2ZU3A 4K5ZA 4GPGA 3SGAE 1XXDA 2EI8A 2F9UA 2VIVA 2FEQH 5ABWA 5ESBA 2BXTH 1YCPM 1G3CA 2AYWA 2C4FH 2PKAB 4CR9A 1EXFA 2G8TA 5A2MH 4OGYA 4ABFA 4AZ2B 2UWLA 2PKAA 2HALA 2ZA5A 1AVXA 1HUTH 1FQ3A 2ZGBH 3LGTA 3T62A 1GDUA 2QCYA 3ZZ5A 1UVSH 2ZQ1A 1O2NA 2BD2A 3ZZ4A 1HJAB 4DIIH 2C8WB 3QZRA 1SBWA 4ISOA 2XCNA 3A8AA 3PM3A 1GMCG 1GBEA 4X8SH 6CHAB 3ZZ7A 2Z9JA 1YC0A 1HAXB 1EJNA 1UTKA 3UPEA 4TY6A 1PYTD 1LQDB 1DLEA 1QB6A 1NTPA 1BTZA 1MKWK 1ESAA 1SR5C 1HXFH 2GV6A 1MAYA 1CE5A 1QRWA 4KELA 1QBVH 3UWIA 1MBQA 1HJAC 3GY2A 2P93A 2C90B 2W5EA 1GHVH 1K1PA 2ODPA 4X2XA 2Z9GA 1GJBB 5I46H 4X6OA 1C2IA 1GBJA 3GY7A 1A5GH 1J16A 6CHAC 2ZDLA 1E34B 4BAMB 2R0LA 1S81A 3ZZDA 1O2JA 4Y76A 1GMCF 1A5IA 2Y80A 4MDSA 2BY5X 5B6OA 1ELCA 4CRDA 1HJ8A 2ZFSA 1YGCH 4OS7A 1S83A 4YTAA 1TX7A 1O2VA 4O97A 1P11E 3UFAA 2Z3CA 5FX6A 1BB0B 2EEKA 5DP5A 4CREA 2BOHB 3S9AA 1C1QA 3LOXA 1C5RA 3JZ2B 5IDKA 1GCTB 2HOBA 2W3IA 1W3CA 1HNEE 1GPZA 1TBQH 3EYDA 1Q31A 2RG3A 3BEIB 1O30A 1UTPA 2PSXA 1GG6B 1ZLRA 1RTKA 3T25A 1S82A 2BDHA 2VWMA 1FY3A 4X2YA 3TJNA 7KMEH 3RDZA 2VWOA 1A4WH 1CBWB 2BD7A 2BQ7B 2PLXA 3MH5A 5FBIA 1O5DH 3SUDA 1K22H 1ARBA 4A1XA 5L2YH 3RXIA 1CHOG 3AAVA 1YPHC 1T31A 2XW9A 2ULLA 1EP6A 1GCTC 5T6DA 1WV7H 2DUCA 3RXMA 1DUEA 2J34A 4LZ1H 5C1XA 4JMYA 3SI3H 1BA8B 3NXPA 1PPZA 2FDAA 1C2FA 1E36B 1BTPA 1NN6A 1GG6C 1O2SA 5GJ4B 3UWJH 3KGPA 4A92A 3ATLA 1Y8TA 1TGBA 3H5CB 4BOHA 2ZU5A 1JRSA 3F9FA 4LOYH 4K2YA 2PHBA 2ZU4A 1TB6H 4NCYA 1QCPA 1PPEE 3B9FH 2A4OA 4WH8A 1AU8A 1N1LA 3TNTA 1FIZA 1ABIH 4B2AA 2A2XH 5FPYA 2Z6BD 4NZLA 4BAKB 1H9HE 1O3NA 1WU1A 4TPYA 3IITA 1P9UA 1CHOF 5LPFA 2Y6TA 3OTJE 2F3CE 2G5NA 4YT7H 3S69A 1C9TA 1QL7A 1TRNA 2GP9B 1TGNA 3W95A 3R3GB 1THRH 2Q6FA 3BTQE 4OS2A 1RFNA 2PGBB 1GBCA 1ARCA 1DWBH 4FUHA 2FIRH 4WMEA 1XKAC 4NA9H 5K0HA 3AASA 3RP2A 2BDCA 2V35A 4NFFA 3MU1A 4YM9A 2B0FA 1O35A 3VB3A 3K65B 8ESTE 1UCYK 3HKIB 3U8RH 1MTSA 2ZHEH 2ZEBA 3EA9A 1FPHH 3EGKH 1EZQA 2W26A 3F9GA 4NIVA 1UTNA 2B9LA 1K1NA 1O3AA 1L4DA 1ANBA 1N6XA 1FNIA 2F83A 4MPUA 2R2MB 2VIPA 4SGBE 1EB2A 4DOQA 4HFPB 1ESBA 1FPCH 2C8YB 1T32A 1OYTH 1KLIH 3HGPA 2OQ5A 4WY3A 2JETB 1ZPBA 3A8BA 1UHBB 1MTNB 1AI8H 3A7ZA 3PLPA 4CH2B 4E06H 1S0RA 1F0SA 1L1JA 2TPIZ 1NRSH 2O9QA 3A82A 1O3BA 2F9OA 4NSYA 5JB8S 4A1TA 1GJ9B 3V3MA 1K1IA 3GY6A 1ELAA 1QGFA 4ISHH 3U1IB 1TPSA 4Y79A 5T3HA 1H1BA 2C93B 1F0UA 4OS5A 2XCFA 2JETC 1T8NA 3LU9B 2HWLB 3STJA 1YLCA 1RJXB 1SGEE 4FUIA 3SV2H 1BMAA 2WINI 1P03A 3M35A 2A5AA 4ISNA 2UWPA 1HAZB 1W14U 1NRQH 2ZPRA 1OP2A 1JWTA 4RKJB 3KEEA 1NRRH 3A88A 4GUXA 3P17H 2Z9KA 1TLDA 1LVOA 1O2YA 3QUMP 4Y7BA 5E8EH 1AFQB 2ZF0H 2ZO3H 3U98H 1TNKA 1CO7E 2NU3E 2VWNA 3A87A 2DE9A 3LH3A 4U2WA 3JZ1B 1LPGB 5ESTE 2R3YA 4K3JA 1SLVB 1G30B 1A61H 2H6MA 1HXEH 4AB8A 1MBMA 2WYGA 1GBLA 3TGIE 3GCOA 3RXTA 3E16B 2Z94A 5DJ7A 3URCA 1AFQC 1IQIA 1HRTH 3TH3H 1Y59T 1XM1A 5JB9S 2SNVA 1GHZA 4FUJA 1QFKH 5DP4A 3SU5A 1Y5AT 4NWKA 5EXNA 1DT2A 2BHGA 4KKDA 1GI8B 1LKBA 1BUIA 1GBHA 2ZFRH 1ZRBA 2AGEX 1VZQH 1F2SE 4TWWA 2ZGHA 2VB0A 3L6PA 3LDXH 1PPHE 3UREA 3GDVA 1P06A 2A4QA 1KLTA 4Y8ZA 2AFQB 1ZGIA 3R0FA 2F91A 2WPKS 1TBRH 1L4ZA 1SGFA 2AGGX 3V13A 5GPIB 1C4Y2 4AFSA 3BTHE 2Q6DA 1THPB 1H4WA 1LVYA 1QL8A 1UCYE 1ID5H 3TVJB 4D7GA 1O2TA 1Q3XA 1Y3WA 1QBOA 1CA0C 1T7CA 2OUAA 5A0CA 1RXPA 1W2KH 1K1JA 3WY8A 3D65E 1CGIE 4X6NA 4INKA 3A8DA 3CS0A 1O3GA 3SJIA 1SGFG 1A2CH 1SGRE 1XUHA 5DGJA 3KCGH 2V3OH 1O2MA 2J4IA 2OXSA 1UK2A 2BY8X 5A8XA 1HAGE 3F1SB 2O8LA 3LONA 2QGRA 2OC7A 3SU0A 3DFLA 3MH4A 1AB9B 2THFB 1D9IA 1GHYH 5L6NH 1C2MA 1V3XA 1OWIA 1SC8U 1TA6A 1TQ0B 3LGWA 4JK6A 4CRFA 1NS3A 3SV9A 1LMWB 1DSUA 3QGJA 5JBCS 1Z8GA 1E0FD 4DW2U 3C27B 1A0LA 1F5KU 3SJOA 4AYVB 8LPRA 3QLPH 1FAKH 4UDWH 3OU0A 1AB9C 1M9UA 2GDEH 4Y8XA 4CRGA 1C5XB 3SQEE 3L3TA 2HVXA 2G55A 2CJIA 4D76A 2J38A 4NA8A 1GI9B 1WAYB 2ODQA 3DA9B 3VXFH 1O3CA 1SI5H 1EKBB 1TNIA 3RXVA 5DO4H 1DVAH 5AVDA 2ZP0H 3TIUA 1C1VH 1LQEA 4UFFH 4YESB 2PKSC 1HJ9A 4DT7B 1VITG 4WF8A 2QAAA 1DANH 1SB1H 3PTNA 1RTFB 1ACBE 1K1LA 4JZIA 1SGCA 1SVPA 3P92A 4E7RG 2WV5A 3FZZA 1C5PA 1N8OB 1GBIA 3MO6A 5JDUB 3ITIA 4CBNA 3G01A 1DE7H 1C1SA 2PFEA 4O3TA 4X0WU 4ZMAH 1ANEA 1HDTH 1UTOA 2OC0A 3OX7U 5G4BA 3SV8A 1F5RA 2XBWA 5GIBA 1AN1E 3M5MA 3M3TA 3SU1A 1NM6A 2BMGB 1GI2A 1SQTA 1P0SH 1L1GA 3ZVGA 5JBBS 1O2WA 1VITF 1TGSZ 2IOTA 3D49H 1TX6A 1JMOH 1MTVA 4GSOA 4IW4E 4A5TS 1YBWA 3D62A 1N8OC 3LH1A 3TJUA 1FY4A 1EZXC 4F49A 2PV9B 3PB1E 5FCRA 4RKOB 2ZTZA 3RXPA 5GDSH 5CMXH 4ABHA 5F8XA 4B1TA 2HLCA 1ZSLA 1EATA 3M5NA 3LGYA 1LVBA 2ZCLP 4Q7ZA 1EAWA 3BEFB 3MTYA 4DGJA 3ZYEA 3SNEA 4ZKRU 3AW1A 2A7JA 1KIGH 1S84A 2Y7ZA 3QTVH 4OGXA 2J92A 2H9EH 4ESTE 4MPWA 3E8LA 1C5LH 5EW1H 4IGDA 2BLVA 4KTUA 1P04A 1BT7A 1VITH 2BX3A 4D9QA 5I25A 1UK3A 4YO9A 3TNSA 2FM2A 2QXGA 1G32B 3UY9A 1C2LA 1K28D 2BTCE 3FP6E 1PYTC 3A81A 2FWWA 3NKKA 1ESTA 1QTFA 4M7GA 4Y6DA 3S7KB 5FBEA 1MKXK 4LXBH 3A84A 2TGTA 3RUOA 4K60A 3BTEE 2P3FH 1P3CA 1ZGVA 1TMTH 3BIUH 3HGNA 4B73A 1XUJA 1AIXH 2EC9H 1V2QT 3PROA 4NFEA 1HYLA 3ZV8A 1TA2A 2QY0B 3KHVA 2FOFA 1A1RA 1V2ST 5LPRA 7ESTE 1SLWB 1HAYB 1YCPK 3KNXA 3OY6U 2YNAA 3M3SA 4I8LA 1O36A 4XOJA 1TALA 1TGCA 3SUEA 1O3PB 1F7ZA 1O34A 1ZR0A 1TABE 1P3EA 2BQWB 1K1MA 2ZHDA 4WXVA 1NU9A 1AZ8A 3KQDA 3KQEA 3QX5H 2CF8H 4BTUB 1RGQA 2OBOA 4X1RU 4Q7YA 2TGDA 3NPSA 4U32A 1O2IA 5EOKA 4I8JA 4H6SB 3Q3XA 2BLOA 1W11U 2Z3DA 1SOZA 1DM4B 3GDUA 1TWXB 4MNWA 2WPMS 3GDSA 2FOAA 5EQQA 4CBOA 1GHXH 2Z9IA 2G5VA 4ZROA 4A7IB 1GVZA 1BBRE 4WMFA 2R3UA 4FUFA 3P8NA 1LHGH 1O2HA 5J4QA 1V2WT 3LJOA 3GCHB 3VB5A 1V2PT 1ZMJA 4IMZA 5FPTA 4AFZA 1NO9H 1NZQH 1MZDA 1VCQA 1C2DA 2FTMA 3TGJE 3ZZBA 1KTTB 1GHAG 3GYLB 3BG4B 1OWHA 1QURH 2GKVE 1C2KA 4DURA 4BAOB 3BF6H 3T28A 4AFUA 2BM2A 1XUFA 1W12U 2BY6X 1GDNA 5GWZA 1WUNH 3GCHC 1LHDH 1C5TA 1DLKB 1C9PA 1RTLA 3SHCH 1OXGA 2A5IA 4Q2KA 4ABJA 3ATMA 1UCYH 1KSNA 2FYQA 3A83A 2WYJA 3BG4C 2FX4A 2ZU1A 1T8MA 1MU6B 1QB9A 1TGTA 2FOHA 2WPJS 1DX5M 1ELDE 4IMQA 1EPTB 4CRCA 2ZTXA 2H9HA 1PJPA 1GHAF 3PV4A 1LDTT 2OC1A 1EPTA 4IS5A 1EB1H 1BQYA 1C5SA 2GZ8A 4Y7AA 3LT3A 4B74A 4A6LA 1EZUC 3MFJA 3A7XA 3I77A 1KXDA 3SNCA 3OY5U 3PYHA 1OWDA 4D9RA 4MNVA 3RC5A 3RXEA 1YPEH 1K2I1 2ZNKH 2O8MA 2BDGA 1D3DB 4CRAA 2ZFTA 4K1EA 3DUXH 3SJKA 1EPTC 1A3BH 4OS6A 2ZC9H 1CGJE 3UR9A 3RMLH 1MH0A 3MOCA 1E35B 3P8FA 1DS2E 3O8BA 3T26A 2BDYA 1VCPA 1O3FA 4XBBA 1EJMA 2AMPA 1F92A 1CQQA 3QWCH 2GVFA 8GCHG 3A8CA 2OP9A 1C2GA 1O39A 3W94A 4KP0A 3BIVH 1SQAA 1ZHMA 1HFDA 1C5NH 1BCUH 3SBKA 4ZKNU 2J2UA 3RXLA 2H5DA 1CT0E 4UE7H 3RXHA 4AYYB 1MD7A 4UEHH 4KTCA 2XBVA 4Q7XA 1C5UA 3P70B 3P6ZB 1GI3A 2F9PA 5HM9A 2OD3B 1KDQA 1BZXE 1MD8A 4UD9H 2FO9A 3ZZAA 5DP8A 1T8LA 4FU7A 3UQVA 1IHTH 2XXLA 1IAUA 3RXOA 2VGCB 3E0NB 2LPRA 4UFDH 8GCHF 1P2NA 3HK6B 2GCHF 2W7UA 1ZRKA 1TNLA 4K8YA 1C2JA 5JPMH 4MNXA 2GT8A 1P12E 2D1JA 2BDAA 3H7TA 3IWMA 1P57B 1P2OA 2QV1A 3BTDE 1ZMNA 4D8NA 2VH0A 1V2UT 2ZKSA 2FTLE 1S5SA 1ANDA 2QF0A 3LJJA 3MNSA 3SU6A 1Y3YA 1D6RA 2FOMB 1YPLH 1O2RA 2CHAB 4BXSA 4QT8C 2VGCC 2R2WU 1ZPCA 4X1QU 4O3UA 4ABIA 3SUFA 1AKSA 1IQNA 2BVXH 1SGNE 1YYY1 2VIQA 3LC3A 5HGGA 3TGKE 1S6FA 4X8UH 3UNRA 3ZZ6A 3ATWA 4JYUH 2GTBA 1BITA 1V2JT 4X8TH 3GY5A 1ZOMA 1XVMA 1XXFA 1C5ZB 2CHAC 1INCA 2V6NA 2VIDA 1QQUA 3GICB 4FVBA 3FZDA 2A2QH 2FI3E 4ZH8A 1O37A 3O8CA 2IJOB 4IBLH 2FLBH 1MTUA 1NFXA 2HPQH 3TH4H 3GY8A 1V2RT 2Y82A 1GBAA 3NUMA 2Q1JA 1NC6A 2ZFQH 1OP0A 4K1SA 1FZZA 5DP6A 1Z8JB 3TPIZ 3VEQB 2Y81A 1L2EA 3SORA 1P10A 3SU3A 1ELGA 3MU5A 4XBCA 2ANWA 2AEIH 4ISIH 2XC0A 1TRYA 2A7CA 4YLQH 2RCEA 2OC8A 1N6YA 2ZHWH 1SGTA 1CT4E 2V3HH 1FLEE 5T6FA 2PUQH 4CRBA 4NIXA 4Y71A 2VVUA 1DOJA 3K6ZA 4GVUA 1P2QA 4RN6A 2P59A 4NG9H 2W7SA 1C5QA 1J8AA 3PTBA 1O5AB 4O03A 3F6UH 2Z9LA 3RXUA 1SGYE 1ETTH 1VJ9U 1UO6A 1QJ1B 5AHGH 2FOGA 3RMMH 5L2ZH 3SV6A 3RXAA 4K8BA 3C1KA 1O3LA 3UNQA 6LPRA 4FUDA 5C5OA 1IQJA 1Q2WA 5DP3A 2A7HA 5PTPA 1K1OA 4DCDA 1ZHRA 1ZJDA 1NT1A 2BB4A 4ZXYH 4AFQA 1P02A 5C3NA 2A1DB 2WPIS 3LGVA 1BTHH 5HXFA 2W3KA 3QTOH 2XC5A 5A8YA 2PTCE 1OS8A 1NRNH 2F9VA 4X6MA 4BTTB 1DWDH 1CA0B 1QIXB 4JCNA 1PQ8A 1RIWC 1GJ6A 3MHWU 4ZHMU 3DD2H 2ZQ2A 3RC6A 3VB7A 1BTUA 2UUJB 1BJUA 1UVPA 2UUFB 1BMMH 4YOIA 5A0AE 4E05H 3ZZ3A 1UTQA 5AFYH 1E37B 3PLKA 3TJVA 4LK4A 1TBZH 1YPKH 1HAVA 5HM2A 1LCYA 1DPOA 1NFYA 3E90B 2FX6A 4UFEH 2QXIA 1V2OT 2BY7X 2RA3A 2XTTB 4BAHB 1NFUA 1O32A 1Z6JH 2LNCA 3ODDA 2BD4A 2GDDA 1MQ6A 1Z71A 2A32A 3VB6A 1H9IE 1TIOA 2HNTE 1UVUH 4DY7B 1CGHA 2AMQA 1G3EA 5E0GA 2ANYA 1RRKA 3OSYA 2OINA 2Z3EA 1MZAA 2QC2A 1C4V2 1T4VH 2NU0E 5E0HA 4DIHH 1O3IA 3S0NA 2WPHS 1A3EH 3ZVDA 2B5TB 4A1VA 1ETSH 5EXMA 1AMHA 1G3DA 1BIOA 1XKBC 2ESTE 3SQHE 3TLOA 5DG6A 1P09A 3M7QA 1IHSH 2B7DH 1THSH 1SG8B 4I32A 2FODA 3IG6B 4GLYA 5EPNA 3ATIA 1W0ZU 5JBTA 1SFIA 3M5OA 1SGPE 1ELBA 3ENSB 2YOLA 2VU8E 2BDBA 2R9PA 4IC6A 5A0BA 1PFXC 3ZZ9A 2YNBA 4NZQA 1MQ5A 4B76A 2PKSB 1NY22 2TIOA 1AZZA 3A7WA 1ZZZA 3A7TA 3Q76A 1GCDA 1TPOA 3BN9A 3ZVAA 2G4UA 4ZHAA 1J14A 3ZZ8A 1XUGA 4X2VA 1FMGA 3M36A 1D3QB 2JH0D 2XBXA 1BTWA 3UUZA 4YOGA 1EJAA 4JZ1A 2JH5D 4DJZB 1W10U 1TQ7B 1VGCB 3TITA 1MKXH 4FU9A 1P8VC 3L33A 4Y11E 4AX9H 2GCTB 3SJ9A 1C5WB 3TK6A 1QHRB 2ASUB 1BMLA 1D3PB 1GJCB 4JZFH 1TYNA 2FP7B 1PPCE 2PGQB 1O5BB 2BX4A 3GY3A 1MU8B 1UTMA 2FI4E 1IQKA 1VGCC 3U9AH 1LTOA 1O5FH 1KXCA 4MQAA 1YCPH 1BBRK 3QDZB 2GCTC 3GCNA 4LZ4B 3DFJA 1SGQE 1ABJH 3ZVEA 4OS1A 2HGTH 4YT6H 1PPGE 2ZG0H 1G37A 1B0FA 1BTYA 5A09A 3UOUA 1WSSH 3EAJA 1YM0A 4IN1A 1GHBG 1JIMA 4ABBA 1IQEA 1C5VA 4H6TA 1TAWA 3SO3A 3KL6A 2ZIQH 7GCHG 4I31A 1GWAA 3H7OA 5C2ZA 1YPHE 2AMDA 4XE4A 2B8OH 1WOFA 3PWBA 3V7TA 1Y3VA 1FDPA 2AIPA 3ZVFA 3LPRA 2SGFE 3MMGA 1HAOH 1ORFA 2SGEE 1HAIH 1XUIA 1KXAA 3EA7A 3URDA 1Z6EA 3M37A 1G9IE 7LPRA 1QR3E 1WQSA 2TRMA 1ZTJA 3MI4A 2A4GA 3QK1A 2QF3A 2VVVA 1GI7B 3ZV9A 3K9XB 3RXKA 1W7XH 3V0XA 3PMAB 4X1PU 1O3HA 5EODA 4GCHG 1SMFE 4AN7A 3FFGA 4NSVA 1GHBF 1A46H 1BTXA 2ZWLH 3E6PH 2PR3A 3VB4A 2Q6GA 3CP7A 1ELEE 1P01A 2TBSA 7GCHF 1QJ7B 5F8ZA 5HMAA 4ASHA 1SSXA 2SGQE 1F0TA 2NU4E 2UUYA 1AE5A 4I7YH 1HPGA 1WYKA 4B71A 1P05A 2XC4A 1O2QA 3Q3YA 1O3OA 3MU8A 4WJG2 1OSSA 1UVTH 4JK5A 4MVNA 2KAIB 4UFGH 5L30H 1WCZA 4MTBA 5FHTA 2F9NA 2Y7XA 1TMUH 3BTTE 5CHAB 2KAIA 3RMNH 4GCHF 8KME2 1O2OA 5DKMA 1JXPA 4TPIZ 3PO1C 4Z0KA 1BHXF 3S9CA 1ELFA 3ZVCA 3MH6A 4CR5A 2BYAX 4DG4A 5F8TA 2XRCA 2ZECA 1S85A 3MWIU 3TJOA 2AGIX 3SHAH 1F0RA 5E0JA 1MMJN 1CU1A 3N7OA 3SZNA 5EG4A 1DY9A 4AORA 1EAUA 1ZSKA 5CHAC 2EA3A 2VJ1A 1TPAE 2JKHA 3AAUA 1BDAA 1AQ7A 4K1TA 2ALVA 1EP5A 2ALPA 2VINA 1EX3A 3U69H 1Z7KA 2IPHA 2GMTB 1VR1H 2XWBI 3RU4E 2ZGJA 1HB0B 4TWYA 1TOMH 1K21H 1OWKA 4FVDA 1ZTKA 6GCHF 1IQGA 1U6QA 1GBDA 1NESE 1KXEA 2OBQA 1H8IH 3HPTB 3VGCB 4BAQB 3K2UA 2I6QA 1AHTH 3GYMA 4IN2A 3SU2A 1PPBH 2GMTC 4SGAE 2FS9A 1TRMA 2BVSH 1CA8B 4X2WA 3STIA 1JRTA 1DXPA 1AVWA 1O5GH 4VGCB 3RMOH 1CHGA 1P2MA 2D26C 1BMNH 2BVRH 2GGVB 1HCGA 4INHA 1FN6A 1V2LT 1VJAU 3UNSA 3S7HB 2HNTF 1KLJH 2AIQA 1OP8A 2SGAA 3VGCC 4AB9A 2P3UB 4MNYA 4UONA 4F4OC 1TOCB 3TK5A 2CF9H 1HLTH 2J95A 1SLUB 1GJDB 1UK4A 2ZGCA 4BTIB 5ETXA 4FUEA 2ZDNA 1A7SA 1OWJA 5GCHG 3UR6A 5AF9H 2PUXB 1TNHA 1KXFA 4GHQA 1AO5A 1GL1A 3PMHB 4GHTA 3EE0B 4VGCC 2ZU2A 4TYDA 2ZTYA 3P8GA 5DP7A 1GL0E 1GI4A 1YPJH 1EAIA 5H4IB 4ZUHA 1DICA 2WPLS 4CHAB 1FY1A 3TK9A 2CGAA 3GOVB 4ISLA 3VPKA 2OQUA 1IQLA 2ZZUH 3T5FH 2HPPH 3SGQE 3GY4A 1O2KA 2BD5A 1GMDG 2ODYB 4H4FA 5GCHF 1G2LA 2P95A 5FX5A 2XNIA 2BLWA 5J4SA 1Y5BT 1QL9A 4MLFB 1YP9A 3M7UA 1UVOA 1AFEH 2BY9X 3DHKH 4HGCA 3RXGA 1C5OH 4HTCH 2O8TA 4CHAC 3BTGE 1O3KA 1X7AC 1NROH 4I8HA 2H2ZA 1JBUH 3P95A 5C67A 1T4UH 3FANA 2TGAA 1V2KT 2GV7A 3MNBA 4RSPA 1O3JA 4ZAEA 3BV9B 1OX1A 4NIWA 3LKWA 1NPMA 2SGDE 3M5LA 1W7GH 1OYQA 2A31A 1HAHH 3LC5A 3D23A 1KY9A 1BOQA 3BTKE 4WXIA 5JBAS 2STAE 3BTFE 2QIQA 1EQ9A 1GMDF 3GCTG 1OPHB 2GCHG 2GZ9A 3RU4T 1D6WA 3LIWA 2WUCA 1FJSA 1O2ZA 1L1NA 1GGDB 1MUEB 3RXRA 1WQVH 1ELTA 2HRVA 1CBWC 4ABAA 4AGJA 1P2KA 4ZHLU 1EASA 3ZVBA 1KDQB 1XUKA 2PSYA 2I6SA 5C5NA 5TCCA 3SJ8A 1A0HB 1FN8A 1SHHB 3QZQA 3LGIA 3EDXB 4H42U 1T8OA 1QRXA 3GCTF 1GGDC 2NWNA 1UTLM 1P9SA
chains in the Genus database with same CATH superfamily
1FIWA 1WTHD 1DUAA 1DXWA 4RI0A 3FAOA 1GJ7B 1SPJA 3KF2A 1BRCE 4I8GA 1MAXA 2GX4A 1ZTLA 1G2MA 1QY6A 1VCWA 4PROA 2H9TH 2XYAA 5E2OA 5F03A 1FY5A 1GVKB 1LKAA 3F68H 2C8XB 5LPEA 1AKSB 1AWHB 4U30A 2PTNA 4FU8A 1ELVA 3FP7E 3SOSA 2FI5E 1GBFA 3SNBA 4KGAA 1DWCH 1O5EH 1ZPZA 2Y5FA 2ZGXH 3NWUA 1WTGH 1A5HA 3RXFA 1XVOA 1B5GH 4F55A 2WUBA 1KXBA 3RXDA 1O31A 3VFEA 1LVMA 4JYVH 3LGUA 1O3MA 3PWCA 1W0YH 1NBME 4DVAU 2P16A 1TMBH 2RDLA 2F9BH 2L6OA 2P3TB 1P2JA 2D8WA 2STBE 2KR7A 1UMAH 4Q63A 3RLWH 1C2HA 1BRUP 4J1YA 1RS0A 4MG3A 2UUKB 1C1OA 1LHCH 1UHBA 2KCPA 2FYRA 3PMJA 1BRAA 2SNWA 1O0DH 3T27A 1Z1JA 2ZFFH 2A4RA 1CSOE 2OLGA 3RLYH 2NU1E 2CXVA 1QNJA 3U8TH 2BDIA 2P8OB 1WXRA 1A0JA 2BD9A 5TCAA 4IC5A 5DP9A 5LGOA 1EUFA 1Y5UT 4WWYA 3O8RA 3PV2A 2BOKA 1MTNC 3AW0A 3Q77A 1LHFH 3PLBA 4JZEH 4XSKU 1HIAB 2VVCA 2ZPQA 4THNH 3E0PB 1JOUB 1EOJA 2AH4X 1OWEA 3S9BA 4ABDA 2BZ6H 1GMHG 1GJ4H 1HIAA 2G00A 4CH8B 1IOEA 1V2VT 4YZUA 2P8OC 1C1WH 1HBTH 1IQMA 1C1PA 4WMDA 1C1UH 3O8DA 1SL3A 1BRBE 1K9OE 1QA0A 5EPYA 1GVLA 1RIWB 1UJ1A 3BEUA 2BZAA 5EQRA 3KN2A 2Y5GA 3M61U 4WH6A 3A86A 1E38B 4I33A 1EZSC 5C20A 2W6ID 1V2MT 1KYNA 2V3MA 3A7YA 1XMNB 2OK5A 3SUGA 1EOLA 2CMYA 9ESTA 2NU2E 1O3EA 4AG2A 2EI6A 1PPFE 3MU0A 1V6DA 3NCLA 1GMHF 2FPZA 2QF5A 2ZDAH 1W13U 1O2UA 4WVPE 3CENA 1GI0A 2QN5T 5LH8A 4U01A 1AY6H 3RU4D 4X6PA 1Z8RA 1HAVB 1V2NT 5GXPA 3KQCA 1C2EA 2ILNA 4Q80A 5F6MA 1GBMA 2DE8A 1GBBA 3SN8A 3E3TA 3ESTA 2ZDKA 2JH6D 4ASUD 3U8OH 4Y8YA 3I29A 2XWAA 1GI6A 1W0JD 3ODFA 4BNRA 3F9EA 1YKTA 1NU7B 1FY8E 4YLUA 4I8KA 1WBGB 3U1JB 5HIZA 3MQKC 5T6GA 3CNRA 3B23B 3ZYDA 1GBTA 2TGPZ 3NK8A 1KTSB 1J17T 5EU8A 3TH2H 4XBDA 5FPSA 4BXWA 1HV7A 3M3VA 4Y0YE 1GHWH 2G81E 2J9NA 1HGTH 1TX8A 3UQOA 1BBRH 1DDJA 5C94A 6ESTA 2QXJA 1AUTC 1NFWA 2Y5HA 1H9LB 1O2XA 1Z1IA 1XX9A 3UIRA 2BLQA 4YOJA 3V12A 1MCTA 4X1NU 3MH7A 4K69A 2ZDMA 4FXGH 2VIWA 4ZKSU 4Y0ZE 1DWEH 3UAIC 2FOBA 5FCKA 2IN2A 2O8UA 3HK3B 1AWFH 1GJ5H 4E7NA 4TY7A 1OHHD 5C1YA 3KIDU 2GT7A 4MPXA 4OS4A 1AVGH 5IYTA 4AOQA 3A85A 1C1RA 1IQHA 1OOKB 3T2NA 4ABGA 3F9HA 2CK3D 2ZCHP 3ATKA 4Y10E 1LPZB 2BQ6B 4R0IA 3FVFB 2VWLA 3HKJB 2H5CA 5AFZH 1O33A 3SU4A 2VH6A 3K6YA 2Z7FE 3DT0H 3OE7D 2G52A 1W8BH 2G4TA 2GD4B 2ZCKP 1SHYA 3BTME 1C1MA 1CT2E 5FXLA 1P2IA 1OKXA 3QO6A 1DITH 1O2LA 1TPPA 3UTUH 2CN0H 1NRPH 1ZHPA 1BJVA 3M7TA 2OTVA 3PMBB 4ZXXH 3P8OA 1QQ4A 4NIYA 2WHXA 1GJ8B 1GDQA 2FS8A 1DSTA 4INLA 2FOEA 1TNJA 2AS9A 5EGMA 1O2GH 2VIOA 1O2PA 2A45B 3KQBA 2R0KA 4ZKOU 5SGAE 3RXBA 4ZCNA 1FV9A 2BD3A 3ZZCA 4JZDH 1O5CB 5DPAA 3NZIA 3MNCA 2ZHFH 3HATH 1PQ5A 1GI1A 2J94A 1AD8H 4DT4A 5A8ZA 1MCVA 5EJ1A 1ANCA 2KCAA 1AGJA 4AG1A 2ZPSA 3RM0H 3TU7H 3KYFA 1JIRA 2AERH 1QBNA 4BANB 5BRRE 2G51A 1DY8A 2SFAA 1SQOA 2FMJA 2M5TA 1MTWA 4P00A 2V0BA 3ZIAD 1KMHB 2PWXA 3RXQA 1ETRH 1SGDE 1GBKA 1S6LA 4Z6AH 4ABEA 3WW7A 1H8DH 5C1UA 3DSPA 4HZHA 1YPGH 9LPRA 2IJD1 4X1SU 2FXRA 4FUBA 1S0QA 1YY3A 2A5KA 3RM2H 3RXJA 2UWOA 1AUJA 1LO6A 5HYOA 2ZFPH 1SFQB 2FOCA 1V2TT 1FUJA 1QRZA 1D3TB 2QYIA 2ZDVH 4NWLA 2F43B 2O8WA 1QJ6B 5K7RA 1GI5A 1Z8IB 1C5MD 3Q3KA 3SNDA 3MO9A 1AE8H 3MYWA 3VXEH 1BHXB 1B7XB 3T29A 5FAHA 1YF4A 2VNTA 1F5LA 2BD8A 3A89A 3MO3A 4B75A 5JYIA 1UTJA 1H8ED 2C8ZB 1G36A 1GJAB 3QGNB 1IQFA 4X8VH 5E2PA 1SLXB 4O9VA 3OYPA 1C4U2 3EQ0H 4R8TB 3CS7A 2A0QB 1RD3B 1PQAA 2QE7D 3SW2B 1O38A 1Y3UA 2FLRH 3Q00A 1UW7A 2C3SA 5EW2H 1E1RD 2H1UA 1B0EA 4FUCA 1FAXA 1L0ZA 1FI8A 1YLDA 2SGPE 1ZMLA 1J15A 4D7FA 3RC4A 1C5YB 1LPKB 2FZZA 3AVZA 1QB1A 1TNGA 2P94A 4MPVA 3RXCA 2PW8H 2XOKD 3PO1B 1EAXA 1FONA 3SNAA 2J5UA 3QN7A 5DK1A 1QA7A 3OAAD 2QXHA 3BTWE 4JYTA 2ZI2H 2QA9E 1TE0A 1J9CH 5BPEA 1YPMH 1MKWH 3ELAH 3SV7A 1HAPH 1FXYA 5TJXA 5CHBA 2EI7A 1G3BA 3A7VA 2BXUH 4FUGA 3MU4A 4KTSA 1C1NA 1ZSJA 1ZYOA 3E1XB 4B2CA 3GISB 1S6HA 3SI4H 3FP8E 3BSQA 4HI3A 2GZ7A 5EQSA 3MNXA 1TFXA 2WV4A 6GCHG 2ANMH 3UOPA 1ZJKA 5C0TA 3SGBE 1D4PB 2D2DA 4NA7A 1C1TA 5CE1A 5EXLA 1CVWH 2K1QA 4B2BA 1DFPA 5EJLA 2OCVB 4XDEA 3B8JA 1Y3XA 3RXSA 1PQ7A 2CV3A 4NGAH 4GAWA 4AGKA 3I78A 2XBYA 2FESH 2ZHQH 3EA8A 2RA0A 1SGIB 1LHEH 3A80A 4XFQA 4J2YB 1O3DA 2HNTC 3E91A 3BG8A 1TONA 2ANKH 1SOTA 2ZU3A 4K5ZA 4GPGA 3SGAE 1XXDA 3KYGA 2EI8A 2F9UA 2VIVA 2FEQH 5ABWA 5ESBA 2BXTH 1YCPM 1G3CA 2AYWA 2C4FH 2PKAB 4CR9A 1EXFA 2G8TA 5A2MH 4OGYA 4ABFA 4AZ2B 2UWLA 2PKAA 2HALA 2ZA5A 1AVXA 1HUTH 1FQ3A 2ZGBH 3LGTA 3T62A 1GDUA 2QCYA 4XRNA 3ZZ5A 1UVSH 2ZQ1A 1O2NA 2BD2A 3ZZ4A 1HJAB 4DIIH 2C8WB 3QZRA 1SBWA 4ISOA 2XCNA 3A8AA 3FN8A 1GMCG 3PM3A 5HKKD 1GBEA 4X8SH 6CHAB 3ZZ7A 2Z9JA 1YC0A 1HAXB 1EJNA 1UTKA 3UPEA 4TY6A 1PYTD 1LQDB 1DLEA 1QB6A 1NTPA 1BTZA 1MKWK 1ESAA 1SR5C 1HXFH 2GV6A 1MAYA 3DCLA 1CE5A 1QRWA 4KELA 1QBVH 3UWIA 1MBQA 1HJAC 3GY2A 2P93A 2C90B 2W5EA 1GHVH 1K1PA 2ODPA 4X2XA 2Z9GA 1GJBB 5I46H 4X6OA 1C2IA 1GBJA 3GY7A 1A5GH 1J16A 6CHAC 2ZDLA 1E34B 4BAMB 2R0LA 1S81A 3ZZDA 1O2JA 4Y76A 1GMCF 1A5IA 2Y80A 4MDSA 2BY5X 5B6OA 1ELCA 4CRDA 2W6JD 1HJ8A 2XNDD 2ZFSA 1YGCH 4OS7A 1S83A 4YTAA 1TX7A 1O2VA 4O97A 1P11E 3UFAA 2Z3CA 5FX6A 1BB0B 2EEKA 5DP5A 4CREA 2BOHB 3S9AA 1C1QA 3LOXA 1C5RA 3JZ2B 5IDKA 1YWUA 1GCTB 2HOBA 2W3IA 1W3CA 1HNEE 1GPZA 1TBQH 3EYDA 1Q31A 2RG3A 3BEIB 1O30A 1UTPA 2PSXA 1GG6B 2J98A 1ZLRA 1RTKA 3T25A 1S82A 2BDHA 2VWMA 1FY3A 4X2YA 3TJNA 7KMEH 3RDZA 2VWOA 2AHME 1A4WH 1CBWB 2BD7A 2BQ7B 2PLXA 3MH5A 5FBIA 4FOUC 1O5DH 3SUDA 1K22H 1ARBA 4A1XA 2WPDD 5L2YH 3RXIA 1CHOG 3AAVA 1YPHC 1T31A 2XW9A 2ULLA 1EP6A 1GCTC 5T6DA 1WV7H 2DUCA 3RXMA 1DUEA 2J34A 4LZ1H 5C1XA 4JMYA 3SI3H 1BA8B 3NXPA 1PPZA 2FDAA 1C2FA 1E36B 1BTPA 1NN6A 1GG6C 1O2SA 5GJ4B 3UWJH 3KGPA 4A92A 3ATLA 1Y8TA 1TGBA 3H5CB 4BOHA 2ZU5A 1JRSA 3F9FA 4P02A 4LOYH 4K2YA 2PHBA 2ZU4A 1TB6H 4NCYA 1QCPA 1PPEE 3B9FH 2A4OA 4WH8A 1AU8A 1N1LA 3TNTA 1FIZA 1ABIH 4B2AA 2A2XH 5FPYA 2Z6BD 4NZLA 4BAKB 1H9HE 1O3NA 2LP6A 1WU1A 4TPYA 3IITA 1P9UA 1CHOF 5LPFA 2Y6TA 3OTJE 2F3CE 2G5NA 2JIZD 4YT7H 3S69A 1C9TA 1QL7A 1TRNA 2GP9B 1TGNA 3W95A 3R3GB 1THRH 2Q6FA 3BTQE 4OS2A 1RFNA 2PGBB 1GBCA 1ARCA 1DWBH 4FUHA 2FIRH 2JDID 4WMEA 1XKAC 4NA9H 5K0HA 3AASA 3RP2A 2BDCA 2V35A 4NFFA 3MU1A 4YM9A 2B0FA 1O35A 3VB3A 4ACAA 3K65B 8ESTE 1UCYK 3HKIB 3U8RH 1MTSA 2ZHEH 2ZEBA 3EA9A 1FPHH 3EGKH 1EZQA 2W26A 3F9GA 4NIVA 1UTNA 2B9LA 1K1NA 1O3AA 1L4DA 1ANBA 1N6XA 1FNIA 2F83A 4MPUA 4FETA 2R2MB 2VIPA 4SGBE 1EB2A 4DOQA 4HFPB 1ESBA 1FPCH 2C8YB 1T32A 1OYTH 1KLIH 3HGPA 2OQ5A 4WY3A 2JETB 1ZPBA 3A8BA 1UHBB 5B6LA 1MTNB 1AI8H 3A7ZA 3PLPA 4CH2B 2K8IA 4E06H 1S0RA 1F0SA 1L1JA 2TPIZ 1NRSH 2O9QA 3A82A 1O3BA 2F9OA 4NSYA 5JB8S 4A1TA 1GJ9B 3PV5A 3V3MA 1K1IA 3GY6A 1ELAA 1QGFA 4ISHH 3U1IB 1TPSA 4Y79A 1H8HD 5T3HA 1H1BA 1YLNA 1F0UA 2C93B 4OS5A 2XCFA 2JETC 1T8NA 3LU9B 2HWLB 3STJA 1YLCA 1RJXB 1SGEE 4FUIA 3SV2H 1BMAA 2WINI 1P03A 3M35A 2A5AA 4ISNA 2UWPA 1HAZB 1W14U 1NRQH 2ZPRA 1OP2A 1JWTA 4RKJB 2L74A 1NRRH 3KEEA 3A88A 4GUXA 3P17H 2Z9KA 1TLDA 1LVOA 1O2YA 3QUMP 4Y7BA 5E8EH 1AFQB 2ZF0H 2ZO3H 3PRBA 3U98H 3AK5A 1TNKA 1CO7E 2NU3E 2VWNA 3A87A 2DE9A 3LH3A 4U2WA 3JZ1B 1LPGB 5ESTE 2R3YA 4K3JA 1SLVB 1G30B 1A61H 4RT0A 2H6MA 1HXEH 4AB8A 1MBMA 2WYGA 1GBLA 3TGIE 3GCOA 3RXTA 3E16B 2Z94A 5DJ7A 3URCA 1AFQC 1IQIA 1HRTH 3TH3H 1Y59T 1XM1A 5JB9S 2SNVA 1GHZA 4FUJA 1QFKH 5DP4A 3SU5A 1Y5AT 4NWKA 2RDEA 5EXNA 1DT2A 2BHGA 2EY4C 4KKDA 1GI8B 1LKBA 1BUIA 1GBHA 2ZFRH 3F0PA 1ZRBA 2F4LA 2AGEX 1VZQH 1F2SE 4TWWA 2ZGHA 2VB0A 3L6PA 3LDXH 1PPHE 3UREA 3GDVA 1P06A 2A4QA 1KLTA 4Y8ZA 2AFQB 1ZGIA 3R0FA 2F91A 2KCOA 2WPKS 1TBRH 1L4ZA 1SGFA 2AGGX 3V13A 5GPIB 1C4Y2 4AFSA 3BTHE 2Q6DA 1THPB 3VG8A 1H4WA 1LVYA 1QL8A 1UCYE 1ID5H 3TVJB 4D7GA 1O2TA 1Q3XA 1Y3WA 1QBOA 2PP6A 1CA0C 1T7CA 2OUAA 5A0CA 1RXPA 1W2KH 1K1JA 3WY8A 3D65E 1CGIE 4X6NA 4INKA 3A8DA 1SQRA 3CS0A 1O3GA 3SJIA 1SGFG 1A2CH 1SGRE 1XUHA 5DGJA 3F2GA 3KCGH 2V3OH 1O2MA 2J4IA 2OXSA 1UK2A 2WSSD 2BY8X 5A8XA 1HAGE 5T1VA 3F1SB 2O8LA 3LONA 2QGRA 2OC7A 3SU0A 3DFLA 3MH4A 1AB9B 2THFB 1D9IA 1GHYH 5L6NH 5CDFE 1C2MA 1V3XA 1OWIA 1SC8U 1TA6A 1TQ0B 3LGWA 1QZ8A 4JK6A 4CRFA 1NS3A 3SV9A 1LMWB 3F3BA 1DSUA 3QGJA 5JBCS 1Z8GA 1E0FD 4DW2U 3C27B 1A0LA 1F5KU 3F0OA 3SJOA 4AYVB 8LPRA 3QLPH 1FAKH 4UDWH 3OU0A 1AB9C 1M9UA 2GDEH 4XD7D 4Y8XA 4CRGA 1C5XB 3SQEE 3L3TA 1WDIA 2HVXA 2G55A 2CJIA 4D76A 2J38A 4NA8A 1GI9B 1WAYB 2ODQA 3DA9B 3VXFH 1O3CA 1SI5H 1EKBB 1TNIA 3RXVA 5DO4H 1DVAH 5AVDA 2ZP0H 3TIUA 1C1VH 1LQEA 4UFFH 1FX0B 4YESB 2PKSC 1HJ9A 4DT7B 1VITG 4WF8A 2QAAA 1DANH 1SB1H 3PTNA 1RTFB 1ACBE 3GS9A 1K1LA 4JZIA 1SGCA 1SVPA 2LELA 3P92A 4E7RG 2WV5A 3FZZA 1C5PA 2QF4A 1N8OB 1GBIA 3MO6A 5JDUB 3ITIA 4CBNA 3G01A 1DE7H 1C1SA 2PFEA 4O3TA 4X0WU 3UB0A 1ANEA 1HDTH 1UTOA 4ZMAH 2OC0A 3OX7U 5G4BA 3SV8A 1F5RA 2XBWA 5GIBA 1AN1E 3M5MA 3M3TA 3SU1A 1NM6A 2BMGB 1GI2A 1SQTA 1P0SH 1L1GA 3ZVGA 5JBBS 1O2WA 1VITF 1TGSZ 2IOTA 3D49H 4TSFD 1TX6A 1JMOH 1MTVA 4GSOA 4IW4E 4A5TS 1YBWA 3D62A 1N8OC 3PRDA 3LH1A 3TJUA 1FY4A 1EZXC 4F49A 2PV9B 3PB1E 5FCRA 4RKOB 2ZTZA 3RXPA 5GDSH 5CMXH 4ABHA 5F8XA 4B1TA 2HLCA 1ZSLA 1EATA 3M5NA 3LGYA 2HLDD 1LVBA 2ZCLP 4Q7ZA 1EAWA 2GJGA 3BEFB 3MTYA 4DGJA 3FOAA 3ZYEA 3SNEA 4ZKRU 3AW1A 2A7JA 1KIGH 1S84A 2Y7ZA 3QTVH 4OGXA 2J92A 2H9EH 4ESTE 4MPWA 3E8LA 1C5LH 5EW1H 4IGDA 2BLVA 4KTUA 1P04A 1BT7A 1VITH 2K0QA 2BX3A 4D9QA 5I25A 1UK3A 4YO9A 4OM9A 3TNSA 2FM2A 2QXGA 1G32B 3UY9A 1C2LA 1K28D 2BTCE 3FP6E 1PYTC 3A81A 2FWWA 3NKKA 1ESTA 1QTFA 2KFWA 4M7GA 4Y6DA 3S7KB 5FBEA 1MKXK 4LXBH 3A84A 2TGTA 3RUOA 4K60A 3BTEE 4HG6A 2P3FH 1P3CA 1ZGVA 1TMTH 3BIUH 3HGNA 4B73A 1XUJA 1AIXH 2EC9H 1V2QT 3PROA 4NFEA 1HYLA 3ZV8A 1TA2A 2QY0B 2YMSD 3KHVA 2FOFA 1A1RA 1V2ST 5LPRA 7ESTE 1SLWB 1HAYB 1YCPK 3KNXA 3OY6U 2J97A 2YNAA 3M3SA 4I8LA 1O36A 4XOJA 1TALA 1TGCA 3SUEA 4I86A 1O3PB 1F7ZA 1O34A 1ZR0A 1TABE 1P3EA 2BQWB 1K1MA 5F53A 2ZHDA 4WXVA 1NU9A 1AZ8A 5FL7D 3KQDA 3KQEA 3QX5H 2CF8H 4BTUB 1RGQA 2OBOA 4X1RU 4Q7YA 2TGDA 3NPSA 4U32A 1O2IA 5EOKA 4I8JA 4H6SB 3Q3XA 2BLOA 1W11U 2Z3DA 1SOZA 1DM4B 3GDUA 1TWXB 4MNWA 2WPMS 3GDSA 2FOAA 5EQQA 4CBOA 1BMFD 1GHXH 2Z9IA 2G5VA 4ZROA 4A7IB 1GVZA 1BBRE 4WMFA 2R3UA 4FUFA 3P8NA 1LHGH 1O2HA 5J4QA 1V2WT 3LJOA 3GCHB 3VB5A 1V2PT 1ZMJA 4IMZA 5FPTA 4AFZA 1NO9H 1NZQH 4YXWD 1MZDA 1VCQA 1C2DA 2FTMA 3TGJE 3ZZBA 1KTTB 1GHAG 3GYLB 3BG4B 1OWHA 1QURH 2GKVE 1C2KA 2WV9A 4DURA 4BAOB 3BF6H 3T28A 4AFUA 2BM2A 1XUFA 1W12U 2BY6X 1GDNA 5GWZA 1WUNH 3GCHC 1LHDH 1C5TA 1DLKB 1C9PA 1RTLA 3SHCH 1OXGA 2A5IA 4Q2KA 4ABJA 3ATMA 1UCYH 1KSNA 2FYQA 3A83A 2WYJA 3BG4C 2FX4A 2ZU1A 1T8MA 1MU6B 1QB9A 1TGTA 2FOHA 2WPJS 1DX5M 4RT1A 1ELDE 4IMQA 1EPTB 4CRCA 2J98B 2ZTXA 2H9HA 1PJPA 1GHAF 3PV4A 1LDTT 2OC1A 1VKYA 1EPTA 4IS5A 1EB1H 1BQYA 1C5SA 2GZ8A 4Y7AA 3LT3A 3U28C 4B74A 4A6LA 1EZUC 3MFJA 3A7XA 3I77A 1KXDA 3SNCA 3OY5U 3PYHA 1OWDA 4D9RA 4MNVA 3RC5A 3RXEA 1YPEH 1K2I1 2ZNKH 2O8MA 2BDGA 1D3DB 4CRAA 2ZFTA 4K1EA 3DUXH 3SJKA 1EPTC 1A3BH 4OS6A 2ZC9H 1CGJE 3UR9A 3RMLH 5GNDA 1MH0A 3MOCA 1E35B 3P8FA 1DS2E 3O8BA 3T26A 2BDYA 1VCPA 1O3FA 3F2FA 4XBBA 2WZQA 1EJMA 2AMPA 1F92A 1CQQA 3QWCH 2GVFA 8GCHG 3A8CA 2OP9A 1C2GA 1O39A 3W94A 4KP0A 3BIVH 5C17A 1SQAA 1ZHMA 1HFDA 1C5NH 3N7EA 1BCUH 3SBKA 4ZKNU 2J2UA 3RXLA 2H5DA 5KECA 1CT0E 4UE7H 3RXHA 4AYYB 1MD7A 4UEHH 4KTCA 2XBVA 4Q7XA 1C5UA 3P70B 3P6ZB 1GI3A 2F9PA 5HM9A 2OD3B 1KDQA 1BZXE 1MD8A 4UD9H 2FO9A 3ZZAA 5DP8A 1T8LA 4FU7A 5EJZA 1IHTH 2XXLA 1IAUA 3RXOA 3UQVA 2VGCB 3E0NB 2LPRA 4UFDH 8GCHF 1P2NA 3HK6B 2GCHF 2W7UA 1ZRKA 1TNLA 4K8YA 1C2JA 5JPMH 4MNXA 2GT8A 1P12E 2D1JA 2BDAA 3H7TA 3IWMA 1P57B 1P2OA 2QV1A 3BTDE 1ZMNA 4D8NA 2VH0A 1V2UT 2ZKSA 2FTLE 1S5SA 1ANDA 2QF0A 3LJJA 3MNSA 3SU6A 1Y3YA 2RFKC 1D6RA 2FOMB 1YPLH 1O2RA 2CHAB 4BXSA 4QT8C 2VGCC 2R2WU 1ZPCA 4X1QU 4O3UA 4ABIA 3SUFA 1AKSA 1IQNA 2BVXH 1SGNE 1YYY1 2VIQA 3LC3A 5HGGA 3TGKE 1S6FA 2KCYA 4X8UH 3UNRA 3ZZ6A 3ATWA 4JYUH 2GTBA 1BITA 1V2JT 4X8TH 3GY5A 1ZOMA 1XVMA 3OEED 1XXFA 1C5ZB 2CHAC 1INCA 2V6NA 2VIDA 1QQUA 3GICB 4FVBA 3FZDA 2A2QH 2FI3E 4ZH8A 1O37A 3O8CA 2IJOB 3FKSD 4IBLH 2FLBH 3N99A 1MTUA 1NFXA 2HPQH 3TH4H 3GY8A 1V2RT 2Y82A 1GBAA 3NUMA 2Q1JA 1NC6A 2ZFQH 1OP0A 4K1SA 1FZZA 5DP6A 1Z8JB 3TPIZ 3VEQB 2V7QD 2Y81A 2JJ2D 1L2EA 5DSFA 3SORA 1P10A 3SU3A 1ELGA 1COWD 3MU5A 4XBCA 2ANWA 2AEIH 4ISIH 2XC0A 1TRYA 2A7CA 4YLQH 2RCEA 2OC8A 1N6YA 2ZHWH 1SGTA 1CT4E 2V3HH 1W0KD 1FLEE 5T6FA 2PUQH 3DSGA 4ACBA 4CRBA 4NIXA 1K0HA 4Y71A 2VVUA 1DOJA 3K6ZA 4GVUA 1P2QA 4RN6A 2P59A 4NG9H 2W7SA 1C5QA 1J8AA 3PTBA 1O5AB 4O03A 3F6UH 2Z9LA 3RXUA 1SGYE 1ETTH 1VJ9U 1UO6A 1QJ1B 5AHGH 2FOGA 3RMMH 5L2ZH 3SV6A 3RXAA 4K8BA 3C1KA 1O3LA 3UNQA 6LPRA 4FUDA 5C5OA 1IQJA 1Q2WA 5DP3A 2A7HA 5PTPA 1K1OA 4DCDA 1ZHRA 1ZJDA 1NT1A 2BB4A 4ZXYH 4AFQA 1P02A 5C3NA 2A1DB 2WPIS 3LGVA 3H09A 4AC9A 3F2HA 1BTHH 5HXFA 2W3KA 3QTOH 2XC5A 5A8YA 2PTCE 1OS8A 1NRNH 2F9VA 4X6MA 3WWFA 4BTTB 1DWDH 1CA0B 1QIXB 4JCNA 1PQ8A 1RIWC 1GJ6A 5KEDA 3MHWU 4ZHMU 3DD2H 2ZQ2A 3RC6A 3VB7A 1BTUA 2UUJB 1BJUA 3W1EA 1UVPA 2UUFB 1BMMH 4YOIA 5A0AE 3WWBA 4E05H 3ZZ3A 1UTQA 5AFYH 1E37B 3PLKA 3TJVA 4LK4A 1TBZH 1YPKH 4B6EA 1HAVA 5HM2A 1LCYA 1DPOA 1NFYA 3E90B 2FX6A 4UFEH 2QXIA 1V2OT 2BY7X 2RA3A 2XTTB 4BAHB 1NFUA 1O32A 1Z6JH 2LNCA 3ODDA 2JJ1D 2BD4A 2GDDA 1MQ6A 1Z71A 2A32A 3VB6A 1H9IE 1TIOA 2HNTE 2KZ4A 1UVUH 4DY7B 1CGHA 2AMQA 2EQNA 1G3EA 5E0GA 2ANYA 1RRKA 3OSYA 2OINA 2Z3EA 1MZAA 2QC2A 1C4V2 1T4VH 2NU0E 2VBCA 5E0HA 4DIHH 1O3IA 3S0NA 2WPHS 1A3EH 3ZVDA 2B5TB 4A1VA 1ETSH 5HIYA 5EXMA 1AMHA 1G3DA 1BIOA 1XKBC 2ESTE 3SQHE 3TLOA 5DG6A 1P09A 3M7QA 1IHSH 2B7DH 1THSH 1SG8B 4I32A 2FODA 3IG6B 4GLYA 5EPNA 3ATIA 1W0ZU 5JBTA 1SFIA 3M5OA 1SGPE 1ELBA 3ENSB 5IK2D 2YOLA 2VU8E 2BDBA 2R9PA 3KQ5A 4IC6A 5A0BA 1PFXC 3ZZ9A 2YNBA 4NZQA 1MQ5A 4B76A 2PKSB 1NY22 2TIOA 1AZZA 3A7WA 1ZZZA 3A7TA 3Q76A 1GCDA 1TPOA 3BN9A 3OTPA 3N7DA 3ZVAA 2G4UA 4ZHAA 1J14A 3ZZ8A 1EFRD 1XUGA 4X2VA 1FMGA 3M36A 1D3QB 2JH0D 2XBXA 1BTWA 3UUZA 4YOGA 1EJAA 4JZ1A 2JH5D 4DJZB 1W10U 1TQ7B 1VGCB 3TITA 1MKXH 4FU9A 1P8VC 3L33A 4Y11E 4AX9H 2GCTB 3SJ9A 1C5WB 3TK6A 3OFND 1QHRB 2ASUB 1BMLA 1D3PB 1GJCB 4JZFH 1TYNA 2FP7B 1PPCE 2YMSB 2PGQB 1O5BB 2BX4A 3GY3A 1MU8B 1UTMA 2FI4E 1IQKA 1VGCC 3U9AH 1LTOA 1O5FH 1KXCA 4MQAA 1YCPH 1BBRK 3QDZB 2GCTC 3GCNA 4LZ4B 3DFJA 1SGQE 1ABJH 3ZVEA 4OS1A 2HGTH 3SZEA 4YT6H 1PPGE 2ZG0H 2HVYB 1G37A 1MABB 1B0FA 1BTYA 5A09A 3UOUA 1WSSH 3EAJA 1YM0A 4IN1A 1GHBG 1JIMA 4ABBA 1IQEA 1C5VA 2YMSC 4H6TA 1TAWA 3SO3A 3KL6A 2ZIQH 7GCHG 4I31A 1GWAA 3H7OA 5C2ZA 1YPHE 2AMDA 4XE4A 2B8OH 1WOFA 3PWBA 3V7TA 1Y3VA 1FDPA 2AIPA 3ZVFA 3LPRA 2SGFE 3MMGA 1HAOH 1ORFA 2SGEE 1HAIH 1XUIA 1KXAA 3EA7A 3URDA 1Z6EA 3M37A 1G9IE 7LPRA 1QR3E 1WQSA 2TRMA 1E79D 1ZTJA 3MI4A 2A4GA 3QK1A 2QF3A 2M2AA 2VVVA 1GI7B 3ZV9A 3K9XB 3RXKA 1W7XH 3V0XA 3PMAB 4X1PU 1O3HA 5EODA 4GCHG 1SMFE 4AN7A 3FFGA 4NSVA 1GHBF 1A46H 1BTXA 2ZWLH 3E6PH 2PR3A 3VB4A 2Q6GA 3EE7A 3CP7A 1ELEE 1P01A 2TBSA 7GCHF 1QJ7B 5F8ZA 5HMAA 4ASHA 1SSXA 2SGQE 1F0TA 2NU4E 2UUYA 1AE5A 3NRLA 4I7YH 1HPGA 1WYKA 4B71A 1NBMD 1P05A 2XC4A 1O2QA 3Q3YA 1O3OA 3MU8A 4WJG2 1OSSA 1UVTH 4JK5A 4MVNA 2KAIB 4UFGH 5L30H 1WCZA 4MTBA 5FHTA 2F9NA 2Y7XA 4Z1MD 1TMUH 3BTTE 5CHAB 2KAIA 2KX4A 3RMNH 4GCHF 8KME2 1O2OA 5DKMA 1JXPA 5C0UA 4TPIZ 3PO1C 4Z0KA 1BHXF 3S9CA 1ELFA 3ZVCA 3MH6A 4CR5A 2BYAX 4DG4A 5F8TA 2XRCA 2ZECA 1S85A 3MWIU 3TJOA 2AGIX 3SHAH 1F0RA 5E0JA 1MMJN 1CU1A 3OEHD 3N7OA 3SZNA 5EG4A 1DY9A 4AORA 1EAUA 1ZSKA 5CHAC 2EA3A 2VJ1A 1TPAE 2JKHA 4B6FA 3AAUA 4TT3D 1BDAA 1AQ7A 4K1TA 2ALVA 1EP5A 2ALPA 2VINA 1EX3A 3U69H 1Z7KA 2IPHA 2GMTB 1VR1H 2XWBI 3DSOA 3RU4E 2ZGJA 1HB0B 4TWYA 1TOMH 1K21H 1OWKA 4FVDA 1ZTKA 6GCHF 1IQGA 1U6QA 1GBDA 1NESE 1SKYE 1KXEA 2OBQA 1H8IH 3HPTB 3VGCB 4BAQB 3K2UA 2I6QA 1AHTH 3GYMA 4IN2A 3SU2A 1PPBH 2GMTC 4SGAE 2FS9A 1TRMA 2BVSH 1CA8B 4X2WA 3STIA 1JRTA 1DXPA 4M9FA 1AVWA 1O5GH 4VGCB 3RMOH 1CHGA 1P2MA 2D26C 1BMNH 2IPQX 2GGVB 1HCGA 2BVRH 1FN6A 1V2LT 4INHA 1VJAU 4F48B 3UNSA 3S7HB 2HNTF 1KLJH 2AIQA 1OP8A 2SGAA 3VGCC 4AB9A 2P3UB 4MNYA 4UONA 4F4OC 1TOCB 3TK5A 2CF9H 1HLTH 2J95A 1SLUB 1GJDB 1UK4A 2ZGCA 4BTIB 5ETXA 4FUEA 2ZDNA 1A7SA 1OWJA 5GCHG 3UR6A 5AF9H 2PUXB 1TNHA 1KXFA 4GHQA 1AO5A 1GL1A 3PMHB 4GHTA 1E1QD 3EE0B 4VGCC 2ZU2A 4TYDA 2ZTYA 3P8GA 5DP7A 1GL0E 1GI4A 1YPJH 1EAIA 5H4IB 4ZUHA 1DICA 2WPLS 4CHAB 1FY1A 3TK9A 2CGAA 3GOVB 4ISLA 3VPKA 2OQUA 1IQLA 2ZZUH 3T5FH 2HPPH 3SGQE 3GY4A 1O2KA 2BD5A 1GMDG 2ODYB 5KGOA 4H4FA 5GCHF 1G2LA 2P95A 5FX5A 2XNIA 2BLWA 5J4SA 1Y5BT 1QL9A 4MLFB 1YP9A 3M7UA 1UVOA 1AFEH 2BY9X 3DHKH 4HGCA 3RXGA 1C5OH 4HTCH 2O8TA 4CHAC 4Q4LA 3BTGE 1O3KA 5DN6D 1X7AC 1NROH 4I8HA 2H2ZA 1JBUH 3P95A 5C67A 1T4UH 3FANA 2TGAA 1V2KT 2GV7A 3MNBA 4RSPA 1O3JA 4ZAEA 3BV9B 1OX1A 4NIWA 3LKWA 1NPMA 2SGDE 3M5LA 1W7GH 1OYQA 2A31A 1HAHH 3LC5A 3D23A 1KY9A 1BOQA 3BTKE 4WXIA 5JBAS 2STAE 3BTFE 2QIQA 1EQ9A 1GMDF 3GCTG 3FO8D 2KM0A 1OPHB 2GCHG 2GZ9A 3RU4T 1D6WA 3LIWA 2WUCA 1FJSA 1O2ZA 1L1NA 1GGDB 1MUEB 3RXRA 1WQVH 3SYJA 1ELTA 2HRVA 1CBWC 4ABAA 4AGJA 1P2KA 4ZHLU 1EASA 3ZVBA 1KDQB 1XUKA 5EIYA 2PSYA 2I6SA 5C5NA 5TCCA 3SJ8A 1A0HB 1FN8A 1SHHB 3QZQA 3LGIA 3EDXB 4H42U 1T8OA 1QRXA 3GCTF 1GGDC 2NWNA 1UTLM 1P9SA
chains in the Genus database with same CATH topology
1FIWA 1WTHD 1DUAA 1DXWA 3FAOA 1GJ7B 1SPJA 3KF2A 1BRCE 4I8GA 1MAXA 2GX4A 1ZTLA 1G2MA 1QY6A 1VCWA 4PROA 2H9TH 2XYAA 5E2OA 5F03A 1FY5A 1GVKB 1LKAA 3F68H 2C8XB 5LPEA 1AKSB 1AWHB 4U30A 2PTNA 4FU8A 1ELVA 3FP7E 3SOSA 2FI5E 1GBFA 3SNBA 4KGAA 1DWCH 1O5EH 1ZPZA 2Y5FA 2ZGXH 3NWUA 1WTGH 1A5HA 3RXFA 1XVOA 1B5GH 2WUBA 1KXBA 3RXDA 1O31A 3VFEA 1LVMA 4JYVH 3LGUA 1O3MA 3PWCA 1W0YH 4DVAU 2P16A 1TMBH 2RDLA 2F9BH 2P3TB 1P2JA 2D8WA 2STBE 1UMAH 3RLWH 1C2HA 1BRUP 4J1YA 1RS0A 4MG3A 2UUKB 1C1OA 1LHCH 1UHBA 2FYRA 3PMJA 1BRAA 2SNWA 1O0DH 3T27A 1Z1JA 2ZFFH 2A4RA 1CSOE 2OLGA 3RLYH 2NU1E 2CXVA 1QNJA 3U8TH 2BDIA 2P8OB 1A0JA 2BD9A 5TCAA 4IC5A 5DP9A 5LGOA 1EUFA 1Y5UT 4WWYA 3O8RA 2BOKA 1MTNC 3AW0A 3Q77A 1LHFH 3PLBA 4JZEH 4XSKU 1HIAB 2VVCA 2ZPQA 4THNH 3E0PB 1JOUB 1EOJA 2AH4X 1OWEA 3S9BA 4ABDA 2BZ6H 1GMHG 1GJ4H 1HIAA 2G00A 4CH8B 1IOEA 1V2VT 4YZUA 2P8OC 1C1WH 1HBTH 1IQMA 1C1PA 4WMDA 1C1UH 3O8DA 1SL3A 1BRBE 1K9OE 1QA0A 5EPYA 1GVLA 1RIWB 1UJ1A 3BEUA 2BZAA 5EQRA 3KN2A 2Y5GA 3M61U 4WH6A 3A86A 1E38B 4I33A 1EZSC 5C20A 1V2MT 1KYNA 3A7YA 1XMNB 3SUGA 1EOLA 2CMYA 9ESTA 2NU2E 1O3EA 4AG2A 2EI6A 1PPFE 3MU0A 1V6DA 3NCLA 1GMHF 2FPZA 2ZDAH 1W13U 1O2UA 4WVPE 3CENA 1GI0A 2QN5T 5LH8A 4U01A 1AY6H 3RU4D 4X6PA 1Z8RA 1HAVB 1V2NT 5GXPA 3KQCA 1C2EA 2ILNA 4Q80A 5F6MA 1GBMA 2DE8A 1GBBA 3SN8A 3E3TA 3ESTA 2ZDKA 2JH6D 3U8OH 4Y8YA 3I29A 2XWAA 1GI6A 3ODFA 4BNRA 3F9EA 1YKTA 1NU7B 1FY8E 4YLUA 4I8KA 1WBGB 3U1JB 5T6GA 3B23B 3ZYDA 1GBTA 2TGPZ 3NK8A 1KTSB 1J17T 5EU8A 3TH2H 4XBDA 5FPSA 4BXWA 1HV7A 3M3VA 4Y0YE 1GHWH 2G81E 2J9NA 1HGTH 1TX8A 3UQOA 1BBRH 1DDJA 6ESTA 2QXJA 1AUTC 1NFWA 2Y5HA 1H9LB 1O2XA 1Z1IA 1XX9A 3UIRA 2BLQA 4YOJA 3V12A 1MCTA 4X1NU 3MH7A 4K69A 2ZDMA 4FXGH 2VIWA 4ZKSU 4Y0ZE 1DWEH 2FOBA 5FCKA 2IN2A 2O8UA 3HK3B 1AWFH 1GJ5H 4E7NA 4TY7A 5C1YA 3KIDU 2GT7A 4MPXA 4OS4A 1AVGH 5IYTA 4AOQA 3A85A 1C1RA 1IQHA 1OOKB 3T2NA 4ABGA 3F9HA 2ZCHP 3ATKA 4Y10E 1LPZB 2BQ6B 4R0IA 3FVFB 2VWLA 3HKJB 2H5CA 5AFZH 1O33A 3SU4A 2VH6A 3K6YA 2Z7FE 3DT0H 2G52A 1W8BH 2G4TA 2GD4B 2ZCKP 1SHYA 3BTME 1C1MA 1CT2E 5FXLA 1P2IA 1OKXA 3QO6A 1DITH 1O2LA 1TPPA 3UTUH 2CN0H 1NRPH 1ZHPA 1BJVA 3M7TA 2OTVA 3PMBB 4ZXXH 3P8OA 1QQ4A 4NIYA 1GJ8B 1GDQA 2FS8A 1DSTA 4INLA 2FOEA 1TNJA 2AS9A 5EGMA 1O2GH 2VIOA 1O2PA 2A45B 3KQBA 2R0KA 4ZKOU 5SGAE 3RXBA 1FV9A 2BD3A 3ZZCA 4JZDH 1O5CB 5DPAA 3NZIA 3MNCA 2ZHFH 3HATH 1PQ5A 1GI1A 2J94A 1AD8H 5A8ZA 1MCVA 1ANCA 1AGJA 4AG1A 2ZPSA 3RM0H 3TU7H 1JIRA 2AERH 1QBNA 4BANB 5BRRE 2G51A 1DY8A 2SFAA 1SQOA 2FMJA 2M5TA 1MTWA 2V0BA 2PWXA 3RXQA 1ETRH 1SGDE 1GBKA 4Z6AH 4ABEA 1H8DH 5C1UA 4HZHA 1YPGH 9LPRA 4X1SU 2FXRA 4FUBA 1S0QA 2A5KA 3RM2H 3RXJA 2UWOA 1AUJA 1LO6A 5HYOA 2ZFPH 1SFQB 2FOCA 1V2TT 1FUJA 1QRZA 1D3TB 2QYIA 2ZDVH 4NWLA 2O8WA 1QJ6B 5K7RA 1GI5A 1Z8IB 1C5MD 3Q3KA 3SNDA 3MO9A 1AE8H 3MYWA 3VXEH 1BHXB 1B7XB 3T29A 5FAHA 1YF4A 2VNTA 1F5LA 2BD8A 3A89A 3MO3A 4B75A 5JYIA 1UTJA 2C8ZB 1G36A 1GJAB 3QGNB 1IQFA 4X8VH 5E2PA 1SLXB 4O9VA 3OYPA 1C4U2 3EQ0H 4R8TB 3CS7A 2A0QB 1RD3B 1PQAA 3SW2B 1O38A 1Y3UA 2FLRH 3Q00A 2C3SA 5EW2H 2H1UA 1B0EA 4FUCA 1FAXA 1L0ZA 1FI8A 1YLDA 2SGPE 1ZMLA 1J15A 4D7FA 3RC4A 1C5YB 1LPKB 2FZZA 3AVZA 1QB1A 1TNGA 2P94A 4MPVA 3RXCA 2PW8H 3PO1B 1EAXA 1FONA 3SNAA 3QN7A 5DK1A 1QA7A 2QXHA 3BTWE 4JYTA 2ZI2H 2QA9E 1TE0A 1J9CH 5BPEA 1YPMH 1MKWH 3ELAH 3SV7A 1HAPH 1FXYA 5TJXA 2EI7A 1G3BA 3A7VA 2BXUH 4FUGA 3MU4A 4KTSA 1C1NA 1ZSJA 1ZYOA 3E1XB 4B2CA 3GISB 1S6HA 3SI4H 3FP8E 3BSQA 4HI3A 2GZ7A 5EQSA 3MNXA 1TFXA 2WV4A 6GCHG 2ANMH 3UOPA 1ZJKA 3SGBE 1D4PB 2D2DA 4NA7A 1C1TA 5CE1A 5EXLA 1CVWH 2K1QA 4B2BA 1DFPA 2OCVB 4XDEA 3B8JA 1Y3XA 3RXSA 1PQ7A 2CV3A 4NGAH 4GAWA 4AGKA 3I78A 2XBYA 2FESH 2ZHQH 3EA8A 2RA0A 1SGIB 1LHEH 3A80A 4XFQA 4J2YB 1O3DA 2HNTC 3E91A 3BG8A 1TONA 2ANKH 1SOTA 2ZU3A 4K5ZA 4GPGA 3SGAE 1XXDA 2EI8A 2F9UA 2VIVA 2FEQH 5ABWA 5ESBA 2BXTH 1YCPM 1G3CA 2AYWA 2C4FH 2PKAB 4CR9A 1EXFA 2G8TA 5A2MH 4OGYA 4ABFA 4AZ2B 2UWLA 2PKAA 2HALA 2ZA5A 1AVXA 1HUTH 1FQ3A 2ZGBH 3LGTA 3T62A 1GDUA 2QCYA 3ZZ5A 1UVSH 2ZQ1A 1O2NA 2BD2A 3ZZ4A 1HJAB 4DIIH 2C8WB 3QZRA 1SBWA 4ISOA 2XCNA 3A8AA 3PM3A 1GMCG 1GBEA 4X8SH 6CHAB 3ZZ7A 2Z9JA 1YC0A 1HAXB 1EJNA 1UTKA 3UPEA 4TY6A 1PYTD 1LQDB 1DLEA 1QB6A 1NTPA 1BTZA 1MKWK 1ESAA 1SR5C 1HXFH 2GV6A 1MAYA 1CE5A 1QRWA 4KELA 1QBVH 3UWIA 1MBQA 1HJAC 3GY2A 2P93A 2C90B 2W5EA 1GHVH 1K1PA 2ODPA 4X2XA 2Z9GA 1GJBB 5I46H 4X6OA 1C2IA 1GBJA 3GY7A 1A5GH 1J16A 6CHAC 2ZDLA 1E34B 4BAMB 2R0LA 1S81A 3ZZDA 1O2JA 4Y76A 1GMCF 1A5IA 2Y80A 4MDSA 2BY5X 5B6OA 1ELCA 4CRDA 1HJ8A 2ZFSA 1YGCH 4OS7A 1S83A 4YTAA 1TX7A 1O2VA 4O97A 1P11E 3UFAA 2Z3CA 5FX6A 1BB0B 2EEKA 5DP5A 4CREA 2BOHB 3S9AA 1C1QA 3LOXA 1C5RA 3JZ2B 5IDKA 1GCTB 2HOBA 2W3IA 1W3CA 1HNEE 1GPZA 1TBQH 3EYDA 1Q31A 2RG3A 3BEIB 1O30A 1UTPA 2PSXA 1GG6B 1ZLRA 1RTKA 3T25A 1S82A 2BDHA 2VWMA 1FY3A 4X2YA 3TJNA 7KMEH 3RDZA 2VWOA 1A4WH 1CBWB 2BD7A 2BQ7B 2PLXA 3MH5A 5FBIA 1O5DH 3SUDA 1K22H 1ARBA 4A1XA 5L2YH 3RXIA 1CHOG 3AAVA 1YPHC 1T31A 2XW9A 2ULLA 1EP6A 1GCTC 5T6DA 1WV7H 2DUCA 3RXMA 1DUEA 2J34A 4LZ1H 5C1XA 4JMYA 3SI3H 1BA8B 3NXPA 1PPZA 2FDAA 1C2FA 1E36B 1BTPA 1NN6A 1GG6C 1O2SA 5GJ4B 3UWJH 3KGPA 4A92A 3ATLA 1Y8TA 1TGBA 3H5CB 4BOHA 2ZU5A 1JRSA 3F9FA 4LOYH 4K2YA 2PHBA 2ZU4A 1TB6H 4NCYA 1QCPA 1PPEE 3B9FH 2A4OA 4WH8A 1AU8A 1N1LA 3TNTA 1FIZA 1ABIH 4B2AA 2A2XH 5FPYA 2Z6BD 4NZLA 4BAKB 1H9HE 1O3NA 1WU1A 4TPYA 3IITA 1P9UA 1CHOF 5LPFA 2Y6TA 3OTJE 2F3CE 2G5NA 4YT7H 3S69A 1C9TA 1QL7A 1TRNA 2GP9B 1TGNA 3W95A 3R3GB 1THRH 2Q6FA 3BTQE 4OS2A 1RFNA 2PGBB 1GBCA 1ARCA 1DWBH 4FUHA 2FIRH 4WMEA 1XKAC 4NA9H 5K0HA 3AASA 3RP2A 2BDCA 2V35A 4NFFA 3MU1A 4YM9A 2B0FA 1O35A 3VB3A 3K65B 8ESTE 1UCYK 3HKIB 3U8RH 1MTSA 2ZHEH 2ZEBA 3EA9A 1FPHH 3EGKH 1EZQA 2W26A 3F9GA 4NIVA 1UTNA 2B9LA 1K1NA 1O3AA 1L4DA 1ANBA 1N6XA 1FNIA 2F83A 4MPUA 2R2MB 2VIPA 4SGBE 1EB2A 4DOQA 4HFPB 1ESBA 1FPCH 2C8YB 1T32A 1OYTH 1KLIH 3HGPA 2OQ5A 4WY3A 2JETB 1ZPBA 3A8BA 1UHBB 1MTNB 1AI8H 3A7ZA 3PLPA 4CH2B 4E06H 1S0RA 1F0SA 1L1JA 2TPIZ 1NRSH 2O9QA 3A82A 1O3BA 2F9OA 4NSYA 5JB8S 4A1TA 1GJ9B 3V3MA 1K1IA 3GY6A 1ELAA 1QGFA 4ISHH 3U1IB 1TPSA 4Y79A 5T3HA 1H1BA 2C93B 1F0UA 4OS5A 2XCFA 2JETC 1T8NA 3LU9B 2HWLB 3STJA 1YLCA 1RJXB 1SGEE 4FUIA 3SV2H 1BMAA 2WINI 1P03A 3M35A 2A5AA 4ISNA 2UWPA 1HAZB 1W14U 1NRQH 2ZPRA 1OP2A 1JWTA 4RKJB 3KEEA 1NRRH 3A88A 4GUXA 3P17H 2Z9KA 1TLDA 1LVOA 1O2YA 3QUMP 4Y7BA 5E8EH 1AFQB 2ZF0H 2ZO3H 3U98H 1TNKA 1CO7E 2NU3E 2VWNA 3A87A 2DE9A 3LH3A 4U2WA 3JZ1B 1LPGB 5ESTE 2R3YA 4K3JA 1SLVB 1G30B 1A61H 2H6MA 1HXEH 4AB8A 1MBMA 2WYGA 1GBLA 3TGIE 3GCOA 3RXTA 3E16B 2Z94A 5DJ7A 3URCA 1AFQC 1IQIA 1HRTH 3TH3H 1Y59T 1XM1A 5JB9S 2SNVA 1GHZA 4FUJA 1QFKH 5DP4A 3SU5A 1Y5AT 4NWKA 5EXNA 1DT2A 2BHGA 4KKDA 1GI8B 1LKBA 1BUIA 1GBHA 2ZFRH 1ZRBA 2AGEX 1VZQH 1F2SE 4TWWA 2ZGHA 2VB0A 3L6PA 3LDXH 1PPHE 3UREA 3GDVA 1P06A 2A4QA 1KLTA 4Y8ZA 2AFQB 1ZGIA 3R0FA 2F91A 2WPKS 1TBRH 1L4ZA 1SGFA 2AGGX 3V13A 5GPIB 1C4Y2 4AFSA 3BTHE 2Q6DA 1THPB 1H4WA 1LVYA 1QL8A 1UCYE 1ID5H 3TVJB 4D7GA 1O2TA 1Q3XA 1Y3WA 1QBOA 1CA0C 1T7CA 2OUAA 5A0CA 1RXPA 1W2KH 1K1JA 3WY8A 3D65E 1CGIE 4X6NA 4INKA 3A8DA 3CS0A 1O3GA 3SJIA 1SGFG 1A2CH 1SGRE 1XUHA 5DGJA 3KCGH 2V3OH 1O2MA 2J4IA 2OXSA 1UK2A 2BY8X 5A8XA 1HAGE 3F1SB 2O8LA 3LONA 2QGRA 2OC7A 3SU0A 3DFLA 3MH4A 1AB9B 2THFB 1D9IA 1GHYH 5L6NH 1C2MA 1V3XA 1OWIA 1SC8U 1TA6A 1TQ0B 3LGWA 4JK6A 4CRFA 1NS3A 3SV9A 1LMWB 1DSUA 3QGJA 5JBCS 1Z8GA 1E0FD 4DW2U 3C27B 1A0LA 1F5KU 3SJOA 4AYVB 8LPRA 3QLPH 1FAKH 4UDWH 3OU0A 1AB9C 1M9UA 2GDEH 4Y8XA 4CRGA 1C5XB 3SQEE 3L3TA 2HVXA 2G55A 2CJIA 4D76A 2J38A 4NA8A 1GI9B 1WAYB 2ODQA 3DA9B 3VXFH 1O3CA 1SI5H 1EKBB 1TNIA 3RXVA 5DO4H 1DVAH 5AVDA 2ZP0H 3TIUA 1C1VH 1LQEA 4UFFH 4YESB 2PKSC 1HJ9A 4DT7B 1VITG 4WF8A 2QAAA 1DANH 1SB1H 3PTNA 1RTFB 1ACBE 1K1LA 4JZIA 1SGCA 1SVPA 3P92A 4E7RG 2WV5A 3FZZA 1C5PA 1N8OB 1GBIA 3MO6A 5JDUB 3ITIA 4CBNA 3G01A 1DE7H 1C1SA 2PFEA 4O3TA 4X0WU 4ZMAH 1ANEA 1HDTH 1UTOA 2OC0A 3OX7U 5G4BA 3SV8A 1F5RA 2XBWA 5GIBA 1AN1E 3M5MA 3M3TA 3SU1A 1NM6A 2BMGB 1GI2A 1SQTA 1P0SH