4D9QA

Inhibiting alternative pathway complement activation by targeting the exosite on factor d
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
228
structure length
228
Chain Sequence
ILGGREAEAHARPYMASVQVNGEHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVEPGTLCDVAGWGIVSHAGRRPDRLQHVLLPVLDRATCNRRTHHDGAITQRMMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor D
publication title Inhibiting alternative pathway complement activation by targeting the factor d exosite.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Hydrolase/immune system
total genus 58
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d9qA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d9qA01
1XUHA 1KLJH 3B9FH 2FI4E 1GI4A 1XM1A 3F6UH 4AORA 1IOEA 2SFAA 1A0LA 1TPPA 1G3CA 3L3TA 1TYNA 5HYOA 2XBVA 1Z6JH 1SGRE 4MPUA 5G4BA 2FYRA 3LGWA 1DXPA 1GJCB 3F9HA 3TPIZ 4JK5A 1P05A 1O5AB 2BOHB 2AFQB 3W94A 3O8DA 4TWYA 2G5VA 1DVAH 1EPTA 1BTXA 2D2DA 1LVOA 1C2HA 8LPRA 5DP5A 1NT1A 1HNEE 3B8JA 3GCNA 3RXDA 1YKTA 2HRVA 2F83A 4K1EA 2ZEBA 4INHA 1E34B 1TNIA 1GVLA 3BTEE 3S69A 3PO1B 2QXGA 1AU8A 4MLFB 1GCDA 3TITA 1GJBB 1MQ6A 4A1XA 1L1JA 2M5TA 2WPMS 1UO6A 2HGTH 1EZQA 1YCPK 4IGDA 1ELBA 3VXFH 2WPLS 3URDA 1L1NA 4FUIA 4Y7AA 3GY7A 3Q76A 1GJ8B 1RRKA 4BAOB 1YP9A 3U1IB 1AWFH 1KSNA 4CRDA 2FS9A 3UR6A 1QQUA 3K2UA 2B7DH 1V2WT 3M61U 1QJ7B 4CBNA 2ZGJA 3MU5A 1MKWK 1CA8B 1EJMA 1O5EH 3HGNA 1OP0A 3PLPA 3UOPA 1YCPM 3C1KA 1TOCB 2OLGA 2FP7B 3BEIB 5L6NH 3BTME 3LGIA 1EB1H 1MZDA 2ZNKH 2CV3A 3ITIA 1G2MA 4WF8A 1QRXA 1ZSLA 3RXTA 4KKDA 4ASHA 1FUJA 1RTKA 1G30B 1ELDE 3GY8A 4D8NA 1B7XB 1EAXA 4TPIZ 1X7AC 1AUJA 2OBOA 6LPRA 5C1XA 3AASA 3U8OH 2CF9H 3UWJH 4DVAU 1YPGH 1P0SH 1CGJE 2BZ6H 2Z3DA 1MU6B 1ZJDA 3P6ZB 4FU9A 1FY8E 2O8WA 3BN9A 1ZYOA 3ENSB 4ABIA 1QB9A 1XVOA 5JB9S 2BQWB 3FZDA 2W7UA 2BY7X 1CO7E 4VGCC 3DFJA 3AAVA 1A4WH 2P3TB 2F9OA 1NN6A 2A4QA 3PO1C 3RLWH 3SUGA 2ZU2A 1ID5H 1EUFA 5FX5A 3SQHE 5PTPA 3GISB 5DGJA 3I77A 2JH5D 1RIWC 4B2BA 3ZZAA 1D6WA 1S0RA 2FS8A 1S6FA 3HK6B 3FVFB 3AAUA 1WU1A 2R0LA 1AUTC 3A8DA 5L2YH 3OSYA 1HB0B 5C1UA 2WV5A 1WBGB 1O2HA 1HJ9A 1ZMLA 2Q6GA 2BM2A 1AFQB 1UCYK 3LDXH 1O2MA 1IQMA 1TGTA 4GAWA 4WXVA 3RC4A 4AB8A 1PPBH 1Y8TA 4HFPB 3LKWA 2ZF0H 2BY9X 4NFFA 1AB9C 1QBVH 1C2DA 1AI8H 4WMFA 3RXGA 1IQLA 5E0JA 3ZZ6A 4BAQB 1QHRB 1PYTC 2ZHDA 1OWJA 4AOQA 1YPEH 1ELEE 4TY6A 2B9LA 1T31A 3EGKH 3BSQA 1DT2A 1KYNA 4ZKSU 5HGGA 4X6PA 1AZZA 1UTNA 2G4UA 1C2IA 3MH7A 1AY6H 1UK3A 3SJ9A 2XW9A 2QXIA 1BMNH 2HNTE 2RA3A 1TQ0B 3PMAB 4MDSA 5EQQA 3BF6H 3VB7A 3ZVGA 2CF8H 1TGBA 1ANDA 1MTWA 1Y3UA 4JMYA 1OWKA 5DP6A 1OWHA 1O3FA 3RXJA 3U8RH 5JBAS 1C2GA 1V2MT 1S84A 1WV7H 1ACBE 2FOMB 4D76A 1GI1A 2AGIX 1LTOA 4INLA 1QA0A 3N7OA 3M7UA 2CHAB 3RXIA 1C2KA 4WXIA 2FLBH 1BTWA 3DFLA 1P01A 2BY6X 1HJAB 1O3LA 1IAUA 1HRTH 4Q7XA 3RXCA 5JBCS 2PUXB 1SQOA 2BD5A 5FX6A 2CXVA 1A1RA 2PKAB 1CT4E 1T8NA 4HGCA 1AVXA 2VIVA 3RXKA 1SHHB 4X1SU 3EA7A 5JBTA 5DK1A 5JYIA 5EG4A 1PJPA 2PUQH 1O2RA 3FZZA 1T32A 2RCEA 1Y59T 1FY3A 2TBSA 5A0BA 3IWMA 1OSSA 1WCZA 3GOVB 4Y79A 3RXSA 2Y81A 2D1JA 2PTNA 4TWWA 3MI4A 2RDLA 3M5LA 2P59A 1O3MA 2BQ7B 2BVRH 1S6HA 1OOKB 3GY3A 2ASUB 2ZFQH 5C3NA 2SGPE 1OP2A 1O31A 1KIGH 5IYTA 2GKVE 1HUTH 5TCAA 2FTLE 3EA9A 4GUXA 1PQ7A 3ZZ9A 1QNJA 2QGRA 1IQIA 3MU0A 4H42U 4BXWA 1HDTH 1GI5A 1TALA 1HV7A 3A81A 3VB5A 4ESTE 4Z6AH 1GI7B 3M7QA 4ABJA 3ATKA 1DICA 1GG6B 4FUCA 3GDSA 4E06H 1UK4A 3O8RA 3MH6A 2PFEA 2Z9GA 1NS3A 1O2TA 1A7SA 4TYDA 5HMAA 4AB9A 1P2QA 3ZZ3A 2Z9JA 5BRRE 3TVJB 2AS9A 2HPPH 1K28D 4I8KA 1GCTB 4F49A 5BPEA 4K3JA 4HTCH 4F4OC 5JDUB 1NTPA 3ATMA 4NGAH 1A3EH 1SVPA 3M3VA 3RXVA 1K2I1 2Z7FE 2I6QA 1F5KU 4X0WU 5SGAE 3KQBA 2HOBA 4AFZA 2ILNA 2FO9A 4NWLA 4U01A 1BB0B 2BMGB 3R3GB 1P10A 3RUOA 1GMCF 3QGJA 1LKAA 1GPZA 1O2SA 2A4GA 1W12U 2BDCA 3SO3A 3KCGH 4AFSA 2BLVA 2WV4A 4M7GA 1IQGA 1BHXB 3CS7A 1JRTA 2YOLA 3PLKA 1VCWA 3SHCH 1DXWA 1HAIH 2EI7A 3UNQA 4WH6A 4AFQA 1THRH 1HJ8A 2GX4A 3LGTA 2QY0B 4R8TB 4U32A 3ATWA 1ETRH 3MNCA 1QR3E 3GCHB 1GMCG 1Z7KA 3F9GA 2VGCB 4ZAEA 2HLCA 1W11U 1ANEA 1AKSB 4ZHMU 5F6MA 2Y7XA 3TJVA 3A7TA 2PV9B 2NU4E 5C67A 4XE4A 3T29A 2QIQA 4O3UA 1G37A 1T8MA 2GV6A 1D3PB 5T6GA 2XBXA 2ZHQH 1MMJN 4Y0ZE 1YPHC 4Q7ZA 2XNIA 2OCVB 2ZCLP 1EX3A 4UFGH 4K8YA 1Z1IA 1O34A 5GDSH 1SGQE 2BTCE 1GG6C 2ANYA 2TGAA 3BTGE 3V3MA 4FVDA 3NWUA 4OGXA 1QA7A 1PFXC 1C4V2 3KGPA 1LVMA 2AIPA 1LPGB 4A92A 1K1PA 2O8LA 4BAKB 1FPCH 2F9VA 1VJAU 1KXBA 2ZQ1A 2UUYA 1CA0B 1QL8A 3S9BA 3LOXA 1FNIA 1TOMH 1O3EA 4KTCA 1XUJA 3H7TA 4D9QA 1NFUA 2C3SA 1S83A 1WAYB 1N8OC 4ZKOU 2QA9E 3TH4H 2H2ZA 1ELGA 1RD3B 1V2UT 2GZ9A 2OC7A 4Y76A 3ZZDA 1SOZA 1O2UA 1MD8A 2XYAA 3KF2A 3QO6A 1KLIH 1ZLRA 1TNLA 5A0AE 2UWPA 3E1XB 1ANBA 4D9RA 1TA6A 1JRSA 1DY8A 4X2WA 3ZVCA 3D23A 4ABAA 2H6MA 1HPGA 2R3YA 1AVWA 1DX5M 2J38A 1GJ5H 2A2XH 1O2YA 5ESTE 3U1JB 3H5CB 3RXBA 1NRQH 2GVFA 1CVWH 1HAOH 4ZHAA 1W7XH 1P2NA 1WTGH 2V0BA 4CRAA 1VR1H 1O3JA 2TGTA 3GCHC 1LCYA 4MVNA 1FQ3A 1SGTA 3HKIB 1XMNB 1ZHPA 2BHGA 1C5YB 4B1TA 1C2EA 1J9CH 1V2ST 2P8OB 1KXEA 2CGAA 2Z3EA 3FFGA 5DKMA 2VIQA 2ALPA 1DM4B 3P95A 4X2XA 2C93B 4IC5A 3KQCA 4YOJA 2PWXA 2ZWLH 4WVPE 5FAHA 1HBTH 1J17T 4KTUA 1G3EA 2FTMA 4HI3A 2PW8H 1K9OE 3SJOA 3TJOA 1P8VC 1SL3A 1GJ9B 1IHSH 2ZPQA 1UTLM 3G01A 4KTSA 1FJSA 3SU5A 4AN7A 1T7CA 3MYWA 2ALVA 1XUGA 1RJXB 5B6OA 1ELAA 4BTIB 4DURA 5HXFA 4FUBA 1GGDC 3CENA 3URCA 2XC5A 1BA8B 3SV7A 4K69A 1SPJA 1LHCH 1O3CA 4CR9A 1EOJA 3STIA 2FOCA 2ZDMA 4MG3A 1HIAB 1CA0C 4UFFH 2WYGA 2Z9KA 1YPMH 1H8IH 2CJIA 4AZ2B 4JZIA 5ETXA 1GBTA 1Z8RA 3SOSA 4UDWH 1W13U 1LO6A 5JPMH 1C1WH 2OP9A 5AVDA 4OS7A 1YPKH 4H6TA 2ZHFH 1ETSH 5K7RA 1YPJH 4CH2B 4DT7B 3QGNB 1TX6A 5LH8A 3UQOA 6GCHF 3RXQA 1W0ZU 2IPHA 3TIUA 1HXEH 2W3KA 3A84A 3P8GA 1MBQA 1MTVA 1SGPE 2BD9A 1Z8IB 2R3UA 2ZC9H 1HAVB 4GLYA 4JYTA 2HALA 1GDUA 2P93A 2F3CE 2ZG0H 2F91A 6GCHG 2Y7ZA 4NSVA 2PKAA 1O5CB 1UVUH 4Y0YE 3BEUA 3T25A 1MD7A 5LPRA 2AH4X 2AMPA 1BRBE 1H9LB 2Y5HA 2ZU5A 1IQNA 2FIRH 4FUGA 2G81E 2XBWA 2ZPSA 3ELAH 1AMHA 1CHOF 2SNWA 4FU8A 5TJXA 2FOBA 2VWLA 1E36B 1AIXH 2G52A 1C1UH 8GCHG 3E91A 5EGMA 1NO9H 2J95A 1HCGA 3SNDA 1QTFA 4K5ZA 4K60A 2F9PA 3LC3A 3A7VA 3SJIA 3SNEA 1CHGA 1EZXC 1HGTH 1RFNA 1O2OA 1TIOA 3GY4A 1HYLA 3UNRA 1C1SA 1DOJA 4VGCB 1UMAH 1YYY1 1CHOG 4D7FA 1Z8JB 2ANKH 2PTCE 3GY6A 5LGOA 2EC9H 3A82A 4BAMB 1E0FD 2BQ6B 2BX4A 3Q3XA 2FOFA 3TLOA 2ESTE 1ORFA 1LVBA 2VH0A 2ZIQH 3RC5A 1ESAA 3BEFB 4WMEA 1CSOE 1RIWB 3M35A 1HAXB 4JZEH 4NZQA 5EXLA 4B74A 1A3BH 2P16A 1C5TA 5EODA 1C2JA 3SN8A 2GZ7A 4UD9H 1CBWC 1UJ1A 4BTTB 1L4DA 3OY6U 3F9FA 1HXFH 2OXSA 4GCHF 5EW1H 3VFEA 2ZFRH 1O30A 4AYYB 1K1MA 1AB9B 1W2KH 1DITH 1TX8A 1NU9A 1WOFA 1TPAE 2F9NA 4TPYA 1O35A 1QURH 1SQAA 2W26A 3SGAE 4DOQA 2QF0A 3TNTA 2SGAA 2ZECA 1UCYH 4GCHG 1PPGE 3BIVH 3PM3A 4ABHA 1S85A 3RU4E 3Q3YA 3VPKA 1SMFE 1KDQB 1KTTB 2ZO3H 1QY6A 1JBUH 2YNBA 4JZ1A 3UUZA 1ESTA 2GD4B 1EZSC 2C8WB 3B23B 1KXAA 1UTPA 1GJAB 3O8BA 1VZQH 2A4OA 3SNAA 2A5IA 4UFEH 2QN5T 3SU1A 4MQAA 1IQJA 3K6ZA 2XBYA 2FPZA 4IBLH 4I31A 3U8TH 1MCTA 7ESTE 3SUEA 1C5ZB 3GY2A 1CE5A 5T3HA 3U9AH 3TNSA 3QDZB 4O3TA 4Y8XA 1THSH 1QJ6B 4XBCA 2JH0D 2B8OH 1B5GH 3LU9B 1SLVB 3NXPA 2VJ1A 4NSYA 5AHGH 3D49H 4NZLA 5C5OA 3GICB 1TMBH 1ZRKA 1E35B 4Q2KA 1TPSA 1J14A 3UY9A 1DPOA 3NK8A 1UVTH 4B76A 1SLXB 3ZZ5A 1NPMA 1EZUC 1UCYE 4CRCA 2C90B 2B0FA 2J9NA 1FPHH 4NIVA 1CT0E 1DSUA 1F0RA 1RS0A 2R9PA 4CREA 5EU8A 1WSSH 3RXEA 3NUMA 3BG4C 3QTVH 1O5BB 5ABWA 1CU1A 1OWEA 4K1SA 3RXFA 9LPRA 3DA9B 2KAIA 2BB4A 3ODFA 1XVMA 2GDEH 3GYMA 1BJVA 1Y5UT 3M5OA 4IS5A 4WJG2 2FWWA 1BRUP 1KLTA 5H4IB 1C2FA 4A7IB 1NFWA 2BD3A 3KL6A 1P3CA 3VB3A 2A45B 1PPCE 3SJKA 3S9CA 2IOTA 1A5GH 2BDGA 4Y6DA 1Y3YA 1XXDA 3QWCH 5DPAA 1ZMNA 1Y5AT 1AZ8A 3MFJA 1RTLA 3SU4A 3A86A 1HFDA 1YC0A 3BIUH 5FPSA 2ZP0H 1ZJKA 2W3IA 2VIPA 4I7YH 1SBWA 1EAIA 3BTTE 1MAXA 5GXPA 1GHVH 1BRCE 3VGCC 2Q1JA 3ZZBA 3M5NA 5GCHF 3Q00A 1L1GA 3S7KB 4KP0A 5JBBS 5F8XA 3MU4A 1ARBA 4UFDH 3D65E 3DD2H 2BX3A 1SQTA 3T26A 2UUKB 4MPXA 3ZV8A 5CMXH 1DUEA 2XXLA 3UTUH 2BLWA 2ANWA 1GBBA 1ZOMA 6ESTA 3ZZ7A 3GY5A 1MKXH 2HNTF 5GCHG 3RXRA 3DT0H 2AIQA 3UOUA 3A80A 1SSXA 1O2WA 4CHAB 2ZFSA 1F7ZA 3FP7E 1AHTH 1O3NA 3KIDU 1VITH 2K1QA 5LPEA 3P8NA 1LQDB 4FUJA 3T27A 3WY8A 3BTHE 1BIOA 4FXGH 1O2XA 3BTDE 4YTAA 4X1QU 1QL7A 1TBRH 5ESBA 1GMDF 1QBNA 1GJ6A 3PMHB 4NIXA 3LJJA 1T8LA 4AG1A 1HAYB 1P06A 3QLPH 1C4U2 3ZYDA 5DP7A 1WUNH 1GBLA 3GDUA 4MNXA 1O33A 1UHBB 1YBWA 5EXNA 1K1JA 1QB6A 4D7GA 4XBBA 1NROH 1F5RA 3RMLH 1FAXA 3SI3H 3JZ2B 2C8ZB 4Y8ZA 2AGGX 3IG6B 2PSYA 2EI6A 1DDJA 1BOQA 4Z0KA 4A6LA 1VCPA 1GHAF 1O36A 3ZYEA 3GCTF 3A7ZA 1A5HA 1GBMA 4E05H 1TE0A 1BQYA 4BTUB 1CQQA 3TGIE 2ZA5A 1FAKH 1TBQH 5EW2H 1KXDA 4ISLA 1O0DH 3ZVAA 5K0HA 1GHAG 1LKBA 1GI9B 3GCTG 2G55A 1LHDH 3TGKE 1C5VA 3Q77A 1TA2A 5DJ7A 2V35A 2H5DA 2AMDA 1ZZZA 4XOJA 4PROA 5GIBA 1N8OB 4CHAC 4Y7BA 2BD8A 3NPSA 1F5LA 4AYVB 3M37A 4Q80A 2GMTC 2HWLB 2NU0E 2EEKA 2IJOB 3LT3A 4THNH 4CRGA 5F03A 1WQVH 1SGCA 1LPZB 1PQ5A 2VIOA 2R2MB 4I8HA 1C1TA 1LPKB 4FUHA 5J4SA 2VVCA 4DJZB 2JH6D 2BDAA 2NU2E 3RU4T 3TGJE 1SGEE 4UE7H 4X8SH 1W0YH 1KTSB 3UREA 2OTVA 1P12E 1FI8A 4Y10E 1AN1E 4RKOB 2W5EA 4DW2U 4MTBA 5A8YA 1IQKA 2ZI2H 2WUCA 3NKKA 5FBEA 1ZTKA 2GGVB 2VH6A 5LPFA 3LH3A 1GBAA 1MZAA 2P95A 3UIRA 1BTPA 2SNVA 4ZUHA 1OWDA 1NU7B 4U2WA 1BZXE 1EPTC 2UUJB 1ESBA 1L4ZA 3VEQB 3A7YA 1HAPH 4OS4A 1Y3WA 5L30H 3PWBA 1O2LA 3S7HB 1SB1H 1KDQA 2OD3B 1E38B 1Z1JA 5DP4A 1DWBH 4JYVH 1TAWA 1GGDB 3A83A 1DY9A 3QZQA 2ZFTA 1H9HE 3SZNA 1K1NA 1JMOH 1W3CA 2AERH 3M3SA 1F0UA 3I78A 1C5NH 1P9SA 3TK5A 3A8CA 1P03A 4GHQA 4AGJA 2G51A 1A0HB 1QFKH 5FBIA 2BDYA 1C5PA 1ANCA 3TH3H 1O2QA 1MH0A 2Y80A 3T2NA 2OC0A 5TCCA 1MTUA 3IITA 3P92A 2G5NA 1EXFA 3RMNH 1BUIA 3OYPA 3VB6A 1MTNC 1DFPA 1ZHMA 4H4FA 1P04A 2Q6DA 1D3QB 5GJ4B 1YPHE 3RP2A 1K1IA 1BBRH 1GJDB 1AE8H 2FOHA 1J8AA 2R2WU 2JKHA 4B2CA 3E0PB 3PTNA 1P3EA 4X1NU 4YOGA 3A7WA 4ZXXH 2PGBB 1SC8U 2A31A 2Y6TA 5T6DA 2BDHA 2GZ8A 1QJ1B 4FUEA 1C2LA 1P2MA 4MPWA 1W7GH 2C8XB 3MH5A 3PROA 1Y3VA 2SGFE 3RXPA 1J16A 2TPIZ 1Z8GA 1XKBC 2GT8A 4O97A 2OINA 1E37B 3SUDA 4YESB 3P70B 2V3OH 2CMYA 1QRWA 2SGDE 4AX9H 4ABEA 5A8XA 3SNCA 3SV8A 4B73A 2ZCHP 1GMHF 2FMJA 2FOGA 3R0FA 1JOUB 2FOAA 3PTBA 3E3TA 3QX5H 2HPQH 4MNYA 4LZ1H 2DE8A 3M5MA 1SGDE 1O2VA 2SGEE 1O2KA 1VGCB 1UTQA 3BTQE 3P8FA 1PPZA 3ZV9A 1IHTH 2PKSC 2QV1A 1GMHG 1SGYE 3MWIU 1V2NT 4ISHH 4NA9H 3SORA 3RM0H 4I8GA 1TQ7B 1W14U 3MNBA 5FXLA 3F68H 1FIWA 2VWMA 2ZFPH 1BBRE 3EAJA 2J92A 4DGJA 5CE1A 1GBCA 2ZU4A 1V2QT 1EJNA 4XFQA 5EXMA 4UONA 1GHWH 2ZDAH 2VIWA 3QUMP 1QQ4A 4JYUH 1CBWB 5DP3A 1A0JA 3UFAA 2OQ5A 1O2IA 1NY22 2FM2A 2P3UB 1ELVA 1GBJA 3ZZCA 1BHXF 4XDEA 1GBHA 2WPHS 1A61H 2O8MA 4LXBH 1GBIA 3EDXB 1V2TT 1YCPH 1IQHA 2ZDVH 3SNBA 1D3TB 2Q6FA 2OUAA 3I29A 5I25A 2FI3E 1FDPA 5EOKA 1TMUH 2ZCKP 1T4UH 1SR5C 5FPTA 3FAOA 1PQ8A 2ZZUH 1ABJH 1FN6A 1THPB 1AO5A 4X8VH 1WQSA 2FESH 1MKWH 1C9TA 3A85A 4DCDA 1VJ9U 4FVBA 2BZAA 1INCA 3QN7A 1N6YA 3MHWU 2BLQA 1BTUA 2FI5E 2PGQB 3A89A 3T62A 4ZXYH 4IMQA 5EPNA 5EPYA 5FHTA 2BD7A 3OU0A 1C1MA 4A1VA 1VGCC 4ZROA 1EB2A 2RG3A 3E90B 3C27B 3GYLB 3KN2A 2AYWA 4IW4E 1C1NA 2FX6A 1LHGH 3LGYA 1AVGH 1RGQA 2WYJA 3GCOA 1GVKB 1GBEA 2A5AA 2NWNA 4X2YA 2VVVA 4Y71A 1SGFA 2WUBA 1NFXA 1O32A 2GTBA 1GDQA 3A87A 4Y11E 3ZVDA 1S0QA 3ZVBA 1HAZB 4RSPA 1P2OA 3ODDA 1C4Y2 1UTJA 2ZU1A 1QCPA 3BG8A 1ZGIA 1ZR0A 1RTFB 4OS5A 4I33A 3E6PH 3L33A 4BNRA 2XWBI 1GL1A 1NFYA 2NU1E 1O5GH 1TABE 1YF4A 1AE5A 1DWEH 1JIRA 3SI4H 2O8TA 2BY8X 3MTYA 1ETTH 3RXHA 3A8AA 3BG4B 2H9HA 3UNSA 3SHAH 3UQVA 5E0HA 1LQEA 2F9UA 4LZ4B 3LGUA 2RA0A 1ZMJA 3MNXA 3SU2A 3UPEA 2V6NA 1H1BA 1O5DH 2FEQH 4IC6A 2STAE 2UUFB 2P94A 3LONA 2VWOA 1D9IA 1V2LT 1H4WA 1TGCA 4WH8A 2A7HA 5JB8S 1P02A 3EQ0H 1EAUA 1C5SA 4IMZA 1TRYA 4I8JA 1BTYA 3V13A 1N6XA 2J34A 1OP8A 1FN8A 1B0FA 4K2YA 3UWIA 1ZPBA 3LGVA 3STJA 2FZZA 3TH2H 2J4IA 1DS2E 3VGCB 1FONA 1V2JT 3W95A 2PHBA 2ULLA 2LNCA 8ESTE 3UR9A 1AKSA 1DLKB 4DIHH 4DG4A 2WPJS 3MMGA 3V7TA 3PV4A 2ZHEH 3D62A 1C5QA 5A09A 3E16B 1ARCA 1YLCA 5AF9H 1A5IA 4NG9H 1GWAA 3TJNA 2J94A 3PMJA 4OS2A 1K22H 3HK3B 1NRRH 1O2PA 1TPOA 1F0TA 2C8YB 4ISNA 4NIYA 4YOIA 2NU3E 5E2OA 3RMMH 4CRFA 2QXJA 2EA3A 1P9UA 3ZZ4A 1DLEA 1O2JA 1C1QA 3HPTB 1Q3XA 1O3IA 1PPEE 1NRSH 4ZMAH 1YGCH 2VU8E 2HNTC 2G8TA 1IQFA 1MBMA 3RU4D 2QCYA 1LMWB 1JXPA 3LC5A 4CR5A 2Y82A 1BTHH 3JZ1B 2XRCA 1NESE 1EASA 1SI5H 1GHBF 1O3GA 2R0KA 2A0QB 4KGAA 2OBQA 3CS0A 4NWKA 1ZTLA 3A8BA 4AGKA 1P2IA 4OS1A 4UEHH 5A2MH 2C4FH 3SU0A 1D4PB 1GBKA 4FUDA 2FOEA 2FXRA 1UTMA 2BD4A 1ELTA 1C5RA 2G4TA 1C1VH 2FLRH 1O37A 1GHBG 2WINI 2ZKSA 1Y3XA 1XX9A 2QXHA 4LK4A 1C1PA 5GPIB 1OXGA 1FMGA 4MPVA 1HLTH 2ZPRA 3A88A 2QYIA 1C1RA 1FZZA 2A5KA 2XTTB 3VXEH 5AFYH 2TGPZ 1MQ5A 4I32A 3HATH 3F9EA 2ZHWH 2FODA 1GVZA 1C5WB 1YPLH 2B5TB 5F8TA 4DY7B 8KME2 1P2JA 1Q31A 1KXCA 2Y5GA 1FV9A 3RXMA 3SU3A 3O8CA 1PPFE 1TNGA 3QTOH 2ZGXH 2ZGHA 4MNVA 2VVUA 1V6DA 1P09A 3MNSA 1FXYA 2F9BH 3PMBB 2W7SA 3ZVFA 2J2UA 2VWNA 1G32B 2BDIA 3RXLA 1V2VT 3ZVEA 2BD2A 2TRMA 2ZGCA 3MO9A 2GMTB 1V2PT 5EQRA 1O3PB 1VCQA 1M9UA 1O3BA 1U6QA 1XXFA 1JWTA 2BYAX 1NM6A 3HKJB 1GBFA 1NC6A 2QC2A 2Y5FA 2H9EH 5I46H 1HIAA 2ODQA 1O3HA 1OKXA 1YM0A 1RXPA 2XCNA 5A8ZA 1O38A 7KMEH 2D26C 1Z71A 3AVZA 3TU7H 1SFQB 2BOKA 4AG2A 2PR3A 3SQEE 1WYKA 1Z6EA 5E8EH 3LH1A 2STBE 4X8UH 1TRNA 3RXOA 1J15A 1ZSKA 1G3DA 1AFQC 3V0XA 4ZKRU 4MNWA 1HAGE 1DUAA 2JETB 4YM9A 2H1UA 4ABBA 4SGAE 1P11E 1SGIB 3LPRA 4R0IA 2GDDA 2XWAA 1UTKA 5DO4H 2WPKS 1GBDA 1GMDG 1G2LA 2A4RA 3SV6A 1GHZA 4ZHLU 1BRAA 3K6YA 4GVUA 4YT6H 3SUFA 1A46H 1DWDH 1GL0E 2A7CA 3S9AA 4ABFA 1TNHA 3K65B 3M36A 4GSOA 1HAVA 4ZKNU 3SJ8A 4AFUA 2ZTXA 1K1LA 4IN1A 3V12A 2GCTB 1TNKA 5CHAB 1T8OA 1L0ZA 1ZTJA 2ZDNA 1BDAA 1TWXB 3CP7A 5FCRA 2V3HH 2H5CA 1EPTB 1OPHB 3U98H 1ZSJA 4CRBA 1ZRBA 3P17H 3M7TA 4NA7A 2OC8A 1PYTD 1SLUB 2EI8A 4IN2A 3KNXA 1C2MA 4LOYH 1GI0A 1DSTA 1SFIA 1CGHA 1O3AA 2TIOA 4CBOA 1IQEA 1MAYA 4E7RG 1V2RT 2VINA 3S0NA 1K21H 1GI2A 3FANA 1QRZA 2O9QA 3Q3KA 1QL9A 4JK6A 4OS6A 3RXAA 5FCKA 5AFZH 5FPYA 4OGYA 2A7JA 3P8OA 1MKXK 4X6OA 3LIWA 1O3OA 1LHFH 4KELA 1EQ9A 1EP5A 2VNTA 4B2AA 2ZQ2A 3BTKE 1OYQA 1W8BH 4X2VA 2DE9A 1GDNA 1TB6H 1JIMA 1OWIA 3A7XA 3OX7U 1W10U 4I8LA 1BMMH 1S5SA 2CHAC 3KQEA 4XBDA 3K9XB 1D6RA 1MTNB 2BY5X 3PYHA 4O03A 3RC6A 3T28A 1HJAC 1SGNE 3E8LA 2I6SA 1A2CH 3HGPA 5DP9A 1VITF 1ABIH 1ZPZA 4WY3A 1UTOA 5IDKA 1FIZA 4JCNA 3NZIA 1YLDA 1MCVA 1FY1A 1TNJA 1C5LH 1LDTT 3SV9A 1DANH 1FY5A 3BTFE 3TK9A 2JETC 3AW0A 4K1TA 3SV2H 4O9VA 4TY7A 1GHYH 3NCLA 4H6SB 1VITG 3OTJE 3ATIA 1UVOA 4ABDA 1UVSH 4GPGA 5EQSA 3TJUA 1BTZA 3H7OA 4NA8A 1GHXH 3BV9B 2P3FH 5HM9A 1ELCA 1Q2WA 1AFEH 1TRMA 2GCTC 5CHAC 1C5UA 1BCUH 1OX1A 1UK2A 2XCFA 2TGDA 1QGFA 3DUXH 4X6MA 1PPHE 3DHKH 1GJ7B 1O39A 2IN2A 2ODYB 2YNAA 3KQDA 4WMDA 3RMOH 2ANMH 5C20A 1V2KT 2BLOA 3SGQE 3SBKA 1NRNH 3MH4A 1SHYA 2Z3CA 2PKSB 1SLWB 1XUFA 4YLUA 1GJ4H 3ATLA 2FYQA 1EJAA 2A2QH 2ZU3A 1GI8B 2OC1A 3MU8A 4U30A 1UVPA 3RDZA 7GCHF 2ZGBH 4X1PU 3FP6E 3E0NB 4XSKU 2Z9LA 3PB1E 2Z94A 2ZTYA 1DE7H 1XUIA 1C5MD 3EYDA 1PQAA 2QF3A 1ZHRA 3RXUA 7LPRA 1P57B 1TGNA 4JZFH 5E2PA 1K1OA 2A1DB 4QT8C 1GCTC 1N1LA 3F1SB 3PWCA 1MU8B 2SGQE 7GCHG 1TX7A 3TK6A 1G3BA 2BXUH 2BXTH 3KEEA 2CN0H 4RN6A 4FU7A 6CHAB 1GI3A 1C9PA 2WPIS 4A1TA 3MU1A 2ZTZA 4ZH8A 3ZZ8A 1Y5BT 2ODPA 1CGIE 2KAIB 5A0CA 2VIDA 4HZHA 4JZDH 4X1RU 1AQ7A 5DG6A 4ISOA 2D8WA 3LJOA 4NIWA 4RKJB 2ZFFH 5C5NA 4YO9A 5C2ZA 2VB0A 2GCHF 3BTWE 2UWLA 1ELFA 1F0SA 1KXFA 1C5XB 3EA8A 1DWCH 4NFEA 1FLEE 2GT7A 1CT2E 1AD8H 5C1YA 1H8DH 1B0EA 3U69H 1EKBB 5T6FA 3PLBA 1O5FH 3T5FH 2AGEX 1EAWA 1D3DB 1QB1A 3ESTA 1TONA 1L2EA 2GCHG 2HVXA 1TFXA 1LHEH 2THFB 5GWZA 4Y8YA 2ZDKA 3RM2H 4YZUA 2VGCC 1C5OH 4B71A 1OYTH 4BANB 1NRPH 1GI6A 1SGFG 1G9IE 4B75A 4WWYA 1XUKA 1TMTH 1G36A 1O3KA 4J1YA 3KHVA 3GDVA 4DIIH 3OY5U 9ESTA 1AWHB 1BT7A 3VB4A 2XC4A 4BAHB 3MOCA 1LVYA 3MO3A 2LPRA 4NCYA 1KY9A 1TLDA 1S81A 2OQUA 1S82A 5DP8A 3SU6A 3M3TA 2G00A 4ABGA 1BITA 2FX4A 2BDBA 4GHTA 4K8BA 2PLXA 1SG8B 1O3DA 1BMAA 1H9IE 1C1OA 1F2SE 4YT7H 1ZGVA 4A5TS 1V2OT 1BBRK 1QBOA 2AEIH 2DUCA 2O8UA 3EE0B 4ISIH 4J2YB 2GV7A 2ZDLA 4INKA 5E0GA 6CHAC 1HAHH 1O2ZA 1EP6A 3FP8E 2H9TH 5F8ZA 3SGBE 1TGSZ 1EATA 1EOLA 4FUFA 4CH8B 1OS8A 1BJUA 2UWOA 1F92A 4BXSA 1XKAC 1QIXB 2A32A 4YLQH 1ZPCA 3QZRA 1SOTA 4BOHA 2Z9IA 1AGJA 2XC0A 2Z6BD 4SGBE 1TBZH 4E7NA 3RLYH 2AMQA 2QAAA 1O2GH 1WTHD 2FDAA 2BVXH 4Q7YA 5L2ZH 1MUEB 5HM2A 3AW1A 8GCHF 3L6PA 1MTSA 1NZQH 4X8TH 1BMLA 2BVSH 2PSXA 5J4QA 1T4VH 1V3XA 3QK1A 4X6NA 3SW2B 1O2NA 1UHBA 1FY4A 1P2KA 2P8OC 2GP9B 3MO6A
chains in the Genus database with same CATH superfamily
1XUHA 1KLJH 3B9FH 2FI4E 1GI4A 1XM1A 3F6UH 4AORA 1IOEA 2SFAA 1A0LA 1TPPA 1G3CA 3L3TA 1TYNA 5HYOA 2XBVA 1Z6JH 1SGRE 4MPUA 5G4BA 2FYRA 3LGWA 1DXPA 1GJCB 3F9HA 3TPIZ 4JK5A 1P05A 1O5AB 2BOHB 2AFQB 3W94A 3O8DA 4TWYA 2G5VA 1DVAH 1EPTA 1BTXA 2D2DA 1LVOA 1C2HA 8LPRA 5DP5A 1NT1A 1HNEE 3B8JA 3GCNA 3RXDA 1YKTA 2HRVA 5EJ1A 2F83A 4K1EA 2ZEBA 4INHA 1E34B 3EE7A 1TNIA 1GVLA 3BTEE 3S69A 3PO1B 2QXGA 1AU8A 4MLFB 1GCDA 3TITA 1GJBB 1MQ6A 4A1XA 1L1JA 2M5TA 2WPMS 1UO6A 2HGTH 1EZQA 1YCPK 4IGDA 1ELBA 3VXFH 2WPLS 3URDA 1L1NA 4FUIA 4Y7AA 3GY7A 3Q76A 1GJ8B 1RRKA 4BAOB 1YP9A 3U1IB 1AWFH 1KSNA 4CRDA 2FS9A 3UR6A 1QQUA 3K2UA 2B7DH 4RT1A 1V2WT 3M61U 1QJ7B 4CBNA 2ZGJA 3MU5A 1MKWK 1CA8B 1EJMA 1O5EH 3HGNA 1OP0A 3PLPA 3UOPA 1YCPM 3C1KA 1TOCB 2OLGA 4TSFD 2FP7B 3BEIB 3DSGA 5L6NH 3BTME 3MQKC 3LGIA 1EB1H 1MZDA 2ZNKH 2CV3A 3ITIA 1G2MA 4WF8A 1QRXA 1ZSLA 3RXTA 4KKDA 4ASHA 1FUJA 1RTKA 1G30B 1ELDE 3GY8A 4D8NA 1B7XB 1EAXA 4TPIZ 1X7AC 1AUJA 2OBOA 6LPRA 5C1XA 3AASA 3U8OH 2CF9H 3UWJH 4DVAU 1YPGH 1P0SH 2KCPA 1CGJE 2BZ6H 2Z3DA 1MU6B 1ZJDA 3P6ZB 4FU9A 1FY8E 2O8WA 3BN9A 1ZYOA 3ENSB 4ABIA 3PV2A 1QB9A 1XVOA 5JB9S 2BQWB 3FZDA 2W7UA 2BY7X 1CO7E 4VGCC 3KYGA 3DFJA 3AAVA 1A4WH 2P3TB 2F9OA 5KEDA 1NN6A 2A4QA 3PO1C 3RLWH 3SUGA 2ZU2A 1ID5H 1EUFA 5FX5A 3SQHE 5PTPA 3F3BA 3GISB 5DGJA 3I77A 2JH5D 1RIWC 4B2BA 3ZZAA 1D6WA 1S0RA 2FS8A 1S6FA 3HK6B 3FVFB 3AAUA 1WU1A 2R0LA 1AUTC 3A8DA 5L2YH 3OSYA 1HB0B 5C1UA 2WV5A 1WBGB 1O2HA 1HJ9A 1ZMLA 2Q6GA 2BM2A 1AFQB 1UCYK 3LDXH 3F2FA 1O2MA 1IQMA 4DT4A 1TGTA 4GAWA 4WXVA 3RC4A 4AB8A 1PPBH 1Y8TA 4HFPB 3LKWA 2ZF0H 2BY9X 4NFFA 1AB9C 1QBVH 1C2DA 1AI8H 4WMFA 3RXGA 1IQLA 5E0JA 3ZZ6A 4BAQB 1QHRB 1PYTC 2ZHDA 1OWJA 5T1VA 4AOQA 1YPEH 1ELEE 4TY6A 2B9LA 1T31A 3EGKH 3BSQA 1DT2A 1KYNA 4ZKSU 5HGGA 4X6PA 1AZZA 1UTNA 2G4UA 1C2IA 2YMSC 3MH7A 1AY6H 1UK3A 3SJ9A 2XW9A 2QXIA 1BMNH 4ASUD 2HNTE 2RA3A 1TQ0B 3PMAB 4MDSA 2F4LA 5EQQA 3BF6H 3VB7A 3ZVGA 2CF8H 1TGBA 1ANDA 1MTWA 1Y3UA 4JMYA 1OWKA 5DP6A 1OWHA 1O3FA 3RXJA 3U8RH 5JBAS 1C2GA 1V2MT 1S84A 1WV7H 1ACBE 2FOMB 4D76A 1GI1A 2AGIX 1LTOA 4INLA 1QA0A 3N7OA 3M7UA 2CHAB 3RXIA 1C2KA 4WXIA 2FLBH 1BTWA 3DFLA 1P01A 2BY6X 1HJAB 1O3LA 1IAUA 1HRTH 4Q7XA 2M2AA 3RXCA 2KCAA 5JBCS 2PUXB 1H8HD 1SQOA 2BD5A 5FX6A 2CXVA 1A1RA 2PKAB 1CT4E 1T8NA 4HGCA 1AVXA 2VIVA 3RXKA 1SHHB 4X1SU 3EA7A 5JBTA 5DK1A 5JYIA 5EG4A 1PJPA 2PUQH 1O2RA 3F2GA 3FZZA 1T32A 1EFRD 1Y59T 2RCEA 1FY3A 2TBSA 5A0BA 3IWMA 1OSSA 1WCZA 3GOVB 4Y79A 3RXSA 2HVYB 2Y81A 2D1JA 2PTNA 4TWWA 3MI4A 2RDLA 3M5LA 2P59A 1O3MA 2BQ7B 2BVRH 1S6HA 1OOKB 1E1QD 3GY3A 2ASUB 2ZFQH 5C3NA 2SGPE 1OP2A 1O31A 1KIGH 5IYTA 3PV5A 2GKVE 2QE7D 1HUTH 5TCAA 2FTLE 3EA9A 4GUXA 1PQ7A 3ZZ9A 5EIYA 1QNJA 2QGRA 1IQIA 3MU0A 4H42U 4BXWA 1HDTH 1GI5A 1TALA 1HV7A 3A81A 3VB5A 4ESTE 4Z6AH 1GI7B 3M7QA 2OK5A 4ABJA 3ATKA 3F0PA 1DICA 1GG6B 2YMSD 4FUCA 3GDSA 4E06H 1UK4A 5CHBA 3MH6A 2PFEA 2Z9GA 1NS3A 1O2TA 1A7SA 4TYDA 5HMAA 4AB9A 1P2QA 3ZZ3A 2Z9JA 5BRRE 3TVJB 2AS9A 2HPPH 1K28D 4I8KA 4Q4LA 1GCTB 4F49A 5BPEA 4K3JA 4HTCH 4F4OC 5JDUB 1NTPA 3ATMA 4NGAH 1A3EH 1SVPA 3M3VA 3RXVA 1K2I1 2Z7FE 2I6QA 1F5KU 4B6FA 4X0WU 5SGAE 3KQBA 2HOBA 4AFZA 2ILNA 3N7DA 2FO9A 4NWLA 4U01A 1BB0B 2BMGB 3R3GB 1P10A 3RUOA 2VBCA 1GMCF 3QGJA 1LKAA 1GPZA 1O2SA 2A4GA 1W12U 2BDCA 3SO3A 3KCGH 4AFSA 2BLVA 2WV4A 4M7GA 1IQGA 1BHXB 3CS7A 1JRTA 2YOLA 3PLKA 1VCWA 1KMHB 3SHCH 1DXWA 3OFND 1HAIH 2EI7A 3UNQA 4WH6A 4AFQA 1THRH 1HJ8A 2GX4A 3LGTA 2QY0B 4R8TB 4U32A 3ATWA 1ETRH 3MNCA 1QR3E 3GCHB 3DCLA 1GMCG 1Z7KA 3F9GA 2VGCB 4ZAEA 2HLCA 1W11U 1ANEA 1AKSB 4ZHMU 5F6MA 2Y7XA 3TJVA 3A7TA 2PV9B 2NU4E 5C67A 4XE4A 3T29A 2QIQA 4O3UA 1G37A 1T8MA 2GV6A 1D3PB 5T6GA 2XBXA 2ZHQH 3F2HA 1MMJN 4Y0ZE 1YPHC 4Q7ZA 2XNIA 2OCVB 2ZCLP 1EX3A 4UFGH 4K8YA 1Z1IA 1O34A 5GDSH 1SGQE 2BTCE 1GG6C 2ANYA 2TGAA 3BTGE 3V3MA 1YY3A 4FVDA 3NWUA 4OGXA 1QA7A 1PFXC 1C4V2 3KGPA 1LVMA 2AIPA 1LPGB 4A92A 1K1PA 2O8LA 4BAKB 1FPCH 2F9VA 1VJAU 1KXBA 2ZQ1A 2UUYA 1CA0B 1QL8A 3S9BA 3LOXA 1FNIA 1TOMH 1O3EA 4KTCA 1XUJA 3H7TA 4D9QA 1NFUA 2C3SA 1S83A 1WAYB 1N8OC 4ZKOU 2QA9E 3TH4H 2H2ZA 1ELGA 1RD3B 1V2UT 2GZ9A 2OC7A 4Y76A 3ZZDA 1SOZA 1O2UA 1MD8A 2XYAA 3KF2A 3QO6A 1KLIH 1ZLRA 1TNLA 5A0AE 2UWPA 3E1XB 1ANBA 4D9RA 1TA6A 1JRSA 1DY8A 4X2WA 3ZVCA 3D23A 4ABAA 2H6MA 3SYJA 1HPGA 2R3YA 1AVWA 1DX5M 2J38A 1GJ5H 2A2XH 1O2YA 5ESTE 3U1JB 3H5CB 3RXBA 1NRQH 2GVFA 1CVWH 1HAOH 4ZHAA 1W7XH 1P2NA 1WTGH 2V0BA 4CRAA 1VR1H 1O3JA 2TGTA 3GCHC 1LCYA 4MVNA 1FQ3A 1SGTA 3HKIB 1XMNB 1ZHPA 2BHGA 1C5YB 4B1TA 1C2EA 1J9CH 1V2ST 2P8OB 1KXEA 2CGAA 2Z3EA 3FFGA 5DKMA 1SQRA 2ALPA 2VIQA 1DM4B 3P95A 4X2XA 2C93B 4IC5A 3KQCA 4YOJA 2PWXA 2ZWLH 4WVPE 5FAHA 1WXRA 1HBTH 1J17T 4KTUA 1G3EA 1H8ED 2FTMA 4HI3A 2PW8H 1K9OE 3SJOA 3TJOA 1P8VC 1SL3A 1GJ9B 1IHSH 2ZPQA 1UTLM 3G01A 4KTSA 1FJSA 3SU5A 4AN7A 1T7CA 3MYWA 2ALVA 1XUGA 1RJXB 5B6OA 1ELAA 4BTIB 4DURA 5HXFA 4FUBA 1GGDC 3CENA 3URCA 2XC5A 1BA8B 3SV7A 4K69A 1SPJA 1LHCH 1O3CA 4CR9A 1EOJA 3STIA 2FOCA 2ZDMA 4MG3A 1HIAB 1CA0C 4UFFH 2WYGA 2Z9KA 1YPMH 1H8IH 2CJIA 4AZ2B 4JZIA 5ETXA 1GBTA 1Z8RA 3SOSA 1BMFD 4UDWH 1W13U 1LO6A 5JPMH 1C1WH 2OP9A 5AVDA 4OS7A 5DN6D 1YPKH 4H6TA 2ZHFH 2J97A 1ETSH 3CNRA 1YPJH 4CH2B 5K7RA 4DT7B 3QGNB 1TX6A 5LH8A 3UQOA 6GCHF 3RXQA 1W0ZU 2IPHA 3TIUA 1HXEH 2W3KA 3A84A 3P8GA 1MBQA 1MTVA 1SGPE 2BD9A 1Z8IB 2R3UA 2ZC9H 1HAVB 3FOAA 4GLYA 4JYTA 2HALA 1OHHD 1GDUA 2P93A 2F3CE 2ZG0H 2F91A 6GCHG 2Y7ZA 4NSVA 2PKAA 1O5CB 1UVUH 4Y0YE 3BEUA 3T25A 1MD7A 5LPRA 2AH4X 2AMPA 1BRBE 1H9LB 2Y5HA 2ZU5A 1IQNA 2FIRH 4FUGA 2G81E 2XBWA 2ZPSA 3ELAH 1AMHA 1CHOF 2SNWA 4FU8A 5TJXA 2FOBA 2VWLA 1E36B 1AIXH 2G52A 1C1UH 8GCHG 3E91A 5EGMA 1NO9H 2J95A 3WW7A 1HCGA 3SNDA 1QTFA 2KZ4A 4K5ZA 1E1RD 4K60A 2F9PA 3LC3A 3A7VA 3SJIA 3SNEA 1CHGA 1EZXC 1WDIA 1HGTH 1RFNA 1O2OA 1TIOA 3GY4A 1HYLA 3UNRA 1C1SA 1DOJA 4VGCB 1UMAH 1YYY1 1CHOG 4D7FA 1NBME 1Z8JB 2ANKH 2PTCE 3GY6A 2PP6A 5LGOA 2EC9H 3A82A 2J98B 4BAMB 1E0FD 2BQ6B 2BX4A 3Q3XA 2FOFA 3TLOA 2ESTE 1ORFA 1LVBA 2VH0A 2ZIQH 3RC5A 1ESAA 3BEFB 4WMEA 1CSOE 1RIWB 3M35A 1HAXB 2L6OA 4JZEH 4NZQA 5EXLA 4B74A 1A3BH 2P16A 1C5TA 5EODA 1C2JA 3SN8A 2GZ7A 2IPQX 4UD9H 1CBWC 1UJ1A 4BTTB 1L4DA 1S6LA 3OY6U 3F9FA 1HXFH 1MABB 2OXSA 4GCHF 5EW1H 3VFEA 2ZFRH 1O30A 4AYYB 1K1MA 4HG6A 4ACBA 1AB9B 1W2KH 1DITH 1TX8A 1NU9A 1WOFA 1TPAE 2F9NA 2KR7A 4TPYA 1O35A 1QURH 1SQAA 2W26A 3SGAE 4DOQA 2QF0A 3TNTA 2SGAA 2ZECA 3W1EA 1UCYH 4GCHG 1PPGE 3BIVH 3PM3A 4ABHA 1S85A 3RU4E 3Q3YA 3VPKA 1SMFE 1KDQB 1KTTB 2ZO3H 1QY6A 1JBUH 2YNBA 4JZ1A 3UUZA 1ESTA 2GD4B 1EZSC 2YMSB 2C8WB 2JIZD 3B23B 1KXAA 1UTPA 1GJAB 3O8BA 1VZQH 2A4OA 3SNAA 2A5IA 2KFWA 2QN5T 4UFEH 4I86A 3SU1A 4MQAA 1IQJA 3K6ZA 2XBYA 2FPZA 4IBLH 4I31A 3UB0A 3U8TH 1MCTA 7ESTE 3SUEA 1C5ZB 3GY2A 1CE5A 5T3HA 3U9AH 3TNSA 3QDZB 4O3TA 4Y8XA 1THSH 2JJ1D 1QJ6B 4XBCA 2JH0D 2B8OH 1B5GH 3LU9B 1SLVB 3NXPA 2VJ1A 4NSYA 5AHGH 3D49H 4NZLA 5C5OA 3GICB 1TMBH 1ZRKA 1E35B 2V3MA 4Q2KA 1TPSA 1J14A 3UY9A 1DPOA 3NK8A 1UVTH 4B76A 1SLXB 3ZZ5A 1NPMA 1EZUC 1UCYE 4CRCA 2C90B 2B0FA 2J9NA 1FPHH 4NIVA 3U28C 1CT0E 1DSUA 1F0RA 1RS0A 2R9PA 4CREA 5EU8A 1WSSH 3RXEA 3NUMA 3BG4C 3QTVH 1O5BB 5ABWA 1CU1A 1OWEA 4K1SA 3RXFA 9LPRA 3DA9B 2KAIA 2BB4A 3ODFA 1XVMA 2GDEH 3GYMA 1BJVA 1Y5UT 3M5OA 4IS5A 4WJG2 2FWWA 1BRUP 1KLTA 5H4IB 1C2FA 4A7IB 1NFWA 2BD3A 3KL6A 1P3CA 3VB3A 2A45B 1PPCE 3SJKA 3S9CA 2IOTA 1A5GH 2BDGA 4Y6DA 1Y3YA 1XXDA 3QWCH 5DPAA 1ZMNA 1Y5AT 1AZ8A 3MFJA 4FETA 1RTLA 3SU4A 3OTPA 3A86A 3WWFA 3OEED 1HFDA 1YC0A 3BIUH 5FPSA 2ZP0H 1ZJKA 2W3IA 2VIPA 4I7YH 1SBWA 5IK2D 1EAIA 3BTTE 5EJZA 1MAXA 5GXPA 1GHVH 1BRCE 3VGCC 2Q1JA 3ZZBA 3M5NA 5GCHF 5C0UA 3Q00A 1L1GA 3S7KB 4KP0A 5JBBS 5F8XA 3MU4A 1ARBA 4UFDH 3D65E 3DD2H 4P02A 2BX3A 1SQTA 3T26A 2UUKB 4MPXA 3ZV8A 5CMXH 1DUEA 2XXLA 3UTUH 2BLWA 2ANWA 1GBBA 1ZOMA 6ESTA 3ZZ7A 3GY5A 1MKXH 2HNTF 5GCHG 3RXRA 3DT0H 2AIQA 3UOUA 3A80A 1SSXA 1O2WA 4CHAB 2ZFSA 1F7ZA 3FP7E 3F0OA 1YWUA 1AHTH 1O3NA 3KIDU 1VITH 2K1QA 5LPEA 3P8NA 1LQDB 4FUJA 3T27A 2KCYA 3WY8A 3BTHE 1BIOA 4FXGH 1O2XA 3PRBA 3BTDE 4YTAA 4X1QU 1QL7A 1TBRH 5ESBA 1GMDF 1QBNA 1GJ6A 3PMHB 4NIXA 3LJJA 1T8LA 4AG1A 1HAYB 3AK5A 1P06A 3QLPH 1C4U2 3ZYDA 5DP7A 1WUNH 1GBLA 3GDUA 4MNXA 1O33A 1UHBB 1YBWA 2KX4A 5EXNA 1K1JA 1QB6A 4D7GA 4XBBA 1NROH 4F48B 3O8RA 1F5RA 3RMLH 1FAXA 3SI3H 3JZ2B 2C8ZB 4Y8ZA 2AGGX 3IG6B 2PSYA 2EI6A 1DDJA 1BOQA 4Z0KA 4A6LA 1VCPA 1GHAF 1O36A 3ZYEA 3GCTF 3FN8A 2RFKC 3A7ZA 1A5HA 2JDID 1GBMA 3ZIAD 1TE0A 4E05H 1BQYA 4BTUB 1CQQA 3TGIE 2ZA5A 5KECA 1FAKH 1TBQH 5EW2H 1KXDA 4ISLA 1O0DH 3ZVAA 5K0HA 1GHAG 1LKBA 4XRNA 1GI9B 3GCTG 2G55A 1LHDH 3TGKE 1C5VA 3Q77A 1TA2A 5DJ7A 2V35A 2H5DA 2AMDA 1ZZZA 4XOJA 4PROA 5GIBA 1N8OB 4CHAC 4Y7BA 2L74A 2BD8A 3NPSA 1F5LA 4AYVB 3M37A 4Q80A 2GMTC 2HWLB 2NU0E 2EEKA 2IJOB 3LT3A 4THNH 4CRGA 5F03A 1WQVH 2J98A 1SGCA 1LPZB 1PQ5A 2VIOA 2R2MB 4I8HA 1C1TA 1LPKB 2J5UA 4FUHA 5J4SA 2VVCA 4DJZB 2JH6D 2BDAA 2NU2E 3RU4T 3TGJE 1SGEE 2GJGA 4UE7H 4X8SH 1W0YH 1KTSB 2WSSD 3UREA 2OTVA 1P12E 1FI8A 4Y10E 3VG8A 1AN1E 4RKOB 2W5EA 4DW2U 4MTBA 5A8YA 1IQKA 2ZI2H 2WUCA 3NKKA 2LP6A 5FBEA 1ZTKA 2GGVB 2VH6A 5LPFA 3LH3A 1GBAA 1MZAA 2P95A 3UIRA 1BTPA 2SNVA 4ZUHA 1OWDA 1NU7B 4U2WA 1BZXE 1EPTC 2UUJB 2WPDD 1ESBA 1L4ZA 3VEQB 3A7YA 1HAPH 4OS4A 1Y3WA 5L30H 3PWBA 1O2LA 3S7HB 1SB1H 1KDQA 2OD3B 1E38B 1Z1JA 5DP4A 1DWBH 4JYVH 1TAWA 1GGDB 3A83A 1DY9A 3QZQA 2ZFTA 1H9HE 3SZNA 1K1NA 1JMOH 1W3CA 2AERH 3M3SA 1F0UA 3I78A 1C5NH 1P9SA 3TK5A 3A8CA 3GS9A 1P03A 4GHQA 4AGJA 2G51A 1A0HB 1QFKH 5FBIA 2BDYA 1C5PA 1ANCA 3TH3H 1O2QA 1MH0A 2Y80A 3T2NA 2OC0A 5TCCA 1MTUA 3IITA 3P92A 2G5NA 1EXFA 5HKKD 3RMNH 4ZCNA 1BUIA 3OYPA 3VB6A 1MTNC 1DFPA 1ZHMA 4H4FA 1P04A 2Q6DA 1D3QB 5GJ4B 1YPHE 3RP2A 1K1IA 1BBRH 1GJDB 5FL7D 1AE8H 2FOHA 1J8AA 2R2WU 2JKHA 4B2CA 3E0PB 3PTNA 1P3EA 4X1NU 4YOGA 3A7WA 4ZXXH 2PGBB 1SC8U 2A31A 2Y6TA 5T6DA 2BDHA 2F43B 2GZ8A 1QJ1B 4FUEA 1C2LA 1P2MA 4MPWA 1W7GH 2C8XB 3MH5A 3PROA 1Y3VA 2SGFE 3RXPA 1J16A 2TPIZ 1Z8GA 1XKBC 2GT8A 4O97A 2OINA 1E37B 3SUDA 4YESB 3P70B 2V3OH 2CMYA 1QRWA 2SGDE 4AX9H 2EY4C 4ABEA 5A8XA 3SNCA 3SV8A 4B73A 2IJD1 2ZCHP 1GMHF 2FMJA 2FOGA 3R0FA 1JOUB 2FOAA 3PTBA 3E3TA 3QX5H 2HPQH 4MNYA 4LZ1H 2DE8A 3M5MA 1SGDE 1O2VA 2SGEE 1O2KA 1VGCB 1UTQA 3BTQE 3P8FA 1PPZA 3ZV9A 5C94A 1IHTH 2PKSC 2QV1A 1GMHG 1SGYE 3MWIU 1V2NT 4ISHH 4NA9H 3SORA 5HIYA 3RM0H 4I8GA 1TQ7B 1W14U 3MNBA 5FXLA 3F68H 1FIWA 2VWMA 2ZFPH 1BBRE 3EAJA 2J92A 4DGJA 5CE1A 1GBCA 2ZU4A 1V2QT 1EJNA 4XFQA 5EXMA 4UONA 1GHWH 2ZDAH 2VIWA 3QUMP 1QQ4A 4JYUH 1CBWB 5DP3A 1A0JA 3UFAA 2OQ5A 1O2IA 1NY22 2FM2A 2P3UB 1ELVA 1GBJA 3ZZCA 1BHXF 4XDEA 1GBHA 2WPHS 1A61H 2O8MA 4LXBH 1GBIA 3EDXB 1V2TT 1YCPH 1IQHA 2ZDVH 3SNBA 1D3TB 2Q6FA 2OUAA 3I29A 5I25A 2FI3E 1FDPA 5EOKA 1TMUH 2ZCKP 1T4UH 1SR5C 5FPTA 3FAOA 1PQ8A 2ZZUH 1ABJH 1FN6A 1THPB 1AO5A 4X8VH 1WQSA 4P00A 2FESH 1MKWH 1C9TA 3A85A 4DCDA 2WV9A 1VJ9U 4FVBA 2BZAA 1INCA 3QN7A 1N6YA 3MHWU 2BLQA 1BTUA 2FI5E 2PGQB 3A89A 3T62A 4ZXYH 4IMQA 5EPNA 5EPYA 5FHTA 2BD7A 3OU0A 1C1MA 3N7EA 4A1VA 1VGCC 4ZROA 2QF5A 1EB2A 2RG3A 3E90B 3C27B 3GYLB 3KN2A 2AYWA 4IW4E 1C1NA 2FX6A 1LHGH 1YLNA 3LGYA 1AVGH 1RGQA 2WYJA 3GCOA 1GVKB 1GBEA 2A5AA 2NWNA 4X2YA 2VVVA 4Y71A 3FO8D 1SGFA 2WUBA 1NFXA 1O32A 2GTBA 1GDQA 3A87A 4Y11E 3ZVDA 1S0QA 3ZVBA 1HAZB 4RSPA 1P2OA 3ODDA 1C4Y2 1UTJA 2ZU1A 1QCPA 3BG8A 1ZGIA 1ZR0A 1RTFB 4OS5A 4I33A 3E6PH 3L33A 4BNRA 2XWBI 1GL1A 1NFYA 2NU1E 1O5GH 1TABE 1YF4A 1AE5A 1DWEH 1JIRA 3SI4H 2O8TA 2BY8X 3MTYA 1ETTH 3RXHA 3A8AA 3BG4B 2H9HA 3UNSA 3SHAH 3UQVA 5E0HA 1LQEA 2F9UA 4LZ4B 3LGUA 2RA0A 3H09A 1ZMJA 3MNXA 3SU2A 3UPEA 1W0KD 2V6NA 1H1BA 1O5DH 2FEQH 4IC6A 2STAE 2UUFB 2P94A 3LONA 2VWOA 1D9IA 1V2LT 1H4WA 2WHXA 1TGCA 3FKSD 4WH8A 2A7HA 5JB8S 1P02A 3EQ0H 1EAUA 1C5SA 4IMZA 5GNDA 1TRYA 4I8JA 1K0HA 1BTYA 3V13A 1N6XA 2J34A 1OP8A 2RDEA 1FN8A 1B0FA 4K2YA 3UWIA 1ZPBA 1NBMD 3DSOA 3LGVA 3STJA 2FZZA 3TH2H 2J4IA 5EJLA 1DS2E 3VGCB 1FONA 1V2JT 2V7QD 3W95A 2PHBA 2ULLA 2LNCA 8ESTE 3UR9A 1AKSA 1DLKB 4DIHH 4DG4A 2WPJS 3MMGA 3V7TA 3PV4A 2ZHEH 3D62A 1C5QA 5A09A 3E16B 1ARCA 1YLCA 1VKYA 5AF9H 1A5IA 1UW7A 1GWAA 4NG9H 3TJNA 2J94A 3PMJA 4OS2A 1K22H 3HK3B 1NRRH 2QF4A 1O2PA 1TPOA 1F0TA 2C8YB 4ISNA 4NIYA 4YOIA 5KGOA 2NU3E 5E2OA 3RMMH 4CRFA 2QXJA 2EA3A 1P9UA 3ZZ4A 1DLEA 1O2JA 1C1QA 3HPTB 1Q3XA 1O3IA 4TT3D 1PPEE 1NRSH 4ZMAH 1YGCH 2VU8E 2HNTC 2G8TA 1IQFA 1MBMA 3RU4D 2QCYA 1LMWB 1JXPA 3LC5A 4CR5A 2Y82A 1BTHH 3JZ1B 2XRCA 1NESE 1EASA 1SI5H 1GHBF 1O3GA 2R0KA 2W6JD 2A0QB 4KGAA 2OBQA 3CS0A 4NWKA 1ZTLA 3A8BA 4AGKA 3KQ5A 1P2IA 4OS1A 4UEHH 5A2MH 2C4FH 3SU0A 1D4PB 1GBKA 4FUDA 2FOEA 2FXRA 1UTMA 2BD4A 1ELTA 1C5RA 2G4TA 1C1VH 2FLRH 1O37A 4M9FA 1GHBG 2WINI 2ZKSA 1Y3XA 1XX9A 2QXHA 4LK4A 1C1PA 5GPIB 1OXGA 1FMGA 4MPVA 1HLTH 2ZPRA 3A88A 2QYIA 1C1RA 1FZZA 2A5KA 2XTTB 3VXEH 5AFYH 2TGPZ 1MQ5A 4I32A 3HATH 3F9EA 2ZHWH 4B6EA 2FODA 1GVZA 1C5WB 1YPLH 2B5TB 5F8TA 4DY7B 8KME2 1P2JA 1Q31A 1KXCA 2Y5GA 1FV9A 3RXMA 2XOKD 3SU3A 3O8CA 1PPFE 1TNGA 3QTOH 2ZGXH 2ZGHA 4MNVA 4YXWD 2VVUA 1V6DA 1FX0B 2LELA 1P09A 3MNSA 1FXYA 2F9BH 3PMBB 2W7SA 3WWBA 3ZVFA 2J2UA 2VWNA 1G32B 2BDIA 3RXLA 2XNDD 1V2VT 3ZVEA 2BD2A 2TRMA 2ZGCA 3MO9A 2GMTB 1V2PT 5EQRA 1O3PB 1VCQA 1M9UA 1O3BA 1U6QA 1XXFA 1JWTA 2BYAX 1NM6A 3HKJB 1GBFA 1NC6A 2QC2A 3OEHD 2Y5FA 5C17A 2H9EH 4RT0A 3SZEA 5I46H 1HIAA 2ODQA 1O3HA 1OKXA 1YM0A 1RXPA 2XCNA 5A8ZA 1O38A 7KMEH 2D26C 1Z71A 3AVZA 3TU7H 1SFQB 2BOKA 4AG2A 2PR3A 3SQEE 1WYKA 1Z6EA 5E8EH 3LH1A 2STBE 4X8UH 1TRNA 3RXOA 1J15A 1ZSKA 1G3DA 1AFQC 2K0QA 3V0XA 4ZKRU 4ACAA 4MNWA 1HAGE 1DUAA 2JETB 4YM9A 2H1UA 4ABBA 4SGAE 1P11E 1SGIB 3LPRA 4R0IA 4AC9A 2GDDA 2XWAA 1UTKA 5DO4H 2WPKS 1GBDA 1GMDG 1G2LA 2A4RA 3SV6A 1SKYE 1GHZA 4ZHLU 3OAAD 1BRAA 3K6YA 4GVUA 4YT6H 3SUFA 1A46H 1DWDH 3DSPA 1GL0E 2A7CA 3S9AA 4XD7D 4ABFA 1TNHA 3K65B 3M36A 4GSOA 1HAVA 4ZKNU 3SJ8A 4AFUA 2ZTXA 1K1LA 4IN1A 3V12A 2GCTB 1TNKA 5CHAB 1T8OA 1L0ZA 1ZTJA 2ZDNA 1BDAA 1TWXB 3CP7A 5FCRA 2V3HH 2H5CA 1EPTB 1OPHB 3U98H 1ZSJA 3NRLA 4CRBA 1ZRBA 3P17H 3M7TA 4NA7A 1PYTD 1SLUB 2OC8A 2EI8A 4IN2A 3KNXA 1C2MA 4LOYH 1GI0A 1DSTA 1SFIA 5CDFE 1CGHA 1O3AA 2TIOA 4CBOA 1IQEA 1MAYA 4E7RG 1V2RT 2VINA 3S0NA 1K21H 1GI2A 3FANA 1QRZA 2O9QA 3Q3KA 1QL9A 4JK6A 4OS6A 3RXAA 5FCKA 5AFZH 5FPYA 4OGYA 2A7JA 3P8OA 1MKXK 4X6OA 3LIWA 1O3OA 1LHFH 4KELA 1EQ9A 1EP5A 2VNTA 4B2AA 2ZQ2A 3BTKE 1OYQA 1W8BH 4X2VA 2DE9A 1GDNA 1TB6H 1JIMA 1OWIA 3A7XA 3OX7U 1W10U 4I8LA 1BMMH 1S5SA 2CHAC 3KQEA 4XBDA 3K9XB 1D6RA 5DSFA 1MTNB 2BY5X 3PYHA 4O03A 3RC6A 3T28A 5C0TA 1HJAC 1SGNE 3E8LA 2I6SA 1A2CH 3HGPA 5DP9A 1VITF 1ABIH 1ZPZA 4WY3A 1UTOA 5IDKA 5F53A 1FIZA 4JCNA 3NZIA 1YLDA 1MCVA 1FY1A 1TNJA 1C5LH 1LDTT 3SV9A 1DANH 1FY5A 3BTFE 3TK9A 2JETC 3AW0A 4K1TA 3SV2H 4O9VA 4TY7A 1GHYH 3NCLA 4H6SB 1VITG 2WZQA 3OTJE 3ATIA 1UVOA 4ABDA 1UVSH 4GPGA 5EQSA 3TJUA 1BTZA 3H7OA 4NA8A 1GHXH 3BV9B 2P3FH 4Q63A 5HM9A 1ELCA 1Q2WA 1AFEH 1TRMA 2GCTC 4RI0A 1C5UA 1BCUH 5CHAC 1OX1A 1UK2A 2XCFA 2TGDA 1QGFA 3DUXH 4X6MA 1PPHE 3DHKH 1GJ7B 1O39A 2IN2A 2ODYB 2YNAA 3KQDA 4WMDA 3RMOH 2ANMH 5C20A 1V2KT 2BLOA 3SGQE 3SBKA 1NRNH 3MH4A 1SHYA 2Z3CA 2PKSB 1SLWB 1XUFA 4YLUA 1GJ4H 3ATLA 2FYQA 3N99A 2AHME 1EJAA 2A2QH 2ZU3A 1GI8B 2OC1A 3MU8A 4U30A 1UVPA 3RDZA 7GCHF 2ZGBH 4X1PU 3FP6E 3E0NB 4XSKU 2Z9LA 3PB1E 2Z94A 2ZTYA 1DE7H 1XUIA 1C5MD 3EYDA 1PQAA 3KYFA 2QF3A 1ZHRA 3RXUA 3UAIC 7LPRA 1P57B 1TGNA 4JZFH 5E2PA 1K1OA 2A1DB 4QT8C 1GCTC 1N1LA 3F1SB 3PWCA 1MU8B 2SGQE 7GCHG 1TX7A 3TK6A 1G3BA 2BXUH 2BXTH 3KEEA 2CN0H 4RN6A 4FU7A 6CHAB 1GI3A 1C9PA 2WPIS 4A1TA 2CK3D 3MU1A 2ZTZA 4ZH8A 3ZZ8A 1Y5BT 2ODPA 1CGIE 2KAIB 5A0CA 2VIDA 4HZHA 4JZDH 4X1RU 1AQ7A 5DG6A 4ISOA 4FOUC 2D8WA 3LJOA 4NIWA 4RKJB 2ZFFH 5C5NA 4YO9A 5C2ZA 4OM9A 2VB0A 2GCHF 3BTWE 2UWLA 4F55A 1ELFA 1F0SA 1KXFA 1C5XB 3EA8A 1DWCH 4NFEA 1FLEE 2GT7A 1CT2E 1AD8H 5C1YA 1H8DH 1B0EA 3U69H 1EKBB 5T6FA 3PLBA 1O5FH 3T5FH 2AGEX 1EAWA 1D3DB 1QB1A 3ESTA 1TONA 1L2EA 2GCHG 2HVXA 1TFXA 1LHEH 2THFB 3PRDA 5GWZA 4Y8YA 2ZDKA 3RM2H 4YZUA 2VGCC 1C5OH 4B71A 1OYTH 2K8IA 4Z1MD 4BANB 5B6LA 1NRPH 1GI6A 1SGFG 1G9IE 4B75A 4WWYA 1E79D 1XUKA 1W0JD 1TMTH 1G36A 1O3KA 4J1YA 3KHVA 3GDVA 4DIIH 3OY5U 5HIZA 9ESTA 1AWHB 1BT7A 3VB4A 2XC4A 4BAHB 3MOCA 1LVYA 3MO3A 2LPRA 2W6ID 4NCYA 1KY9A 1TLDA 1S81A 2OQUA 2KCOA 1S82A 5DP8A 3SU6A 1COWD 3M3TA 2G00A 4ABGA 1BITA 2FX4A 2BDBA 4GHTA 4K8BA 2PLXA 1SG8B 2EQNA 1O3DA 1BMAA 1H9IE 1C1OA 1F2SE 4YT7H 1ZGVA 4A5TS 1V2OT 1BBRK 1QBOA 2AEIH 1QZ8A 2DUCA 2O8UA 3EE0B 4ISIH 2GV7A 4J2YB 2ZDLA 4INKA 5E0GA 6CHAC 1HAHH 1O2ZA 1EP6A 3FP8E 2H9TH 5F8ZA 3SGBE 1TGSZ 1EATA 1EOLA 4FUFA 4CH8B 1OS8A 1BJUA 2UWOA 1F92A 4BXSA 1XKAC 1QIXB 2A32A 4YLQH 1ZPCA 3QZRA 1SOTA 4BOHA 2Z9IA 3OE7D 1AGJA 2XC0A 2Z6BD 4SGBE 1TBZH 4E7NA 3RLYH 2HLDD 2AMQA 2QAAA 1O2GH 1WTHD 2FDAA 2BVXH 4Q7YA 5L2ZH 1MUEB 5HM2A 3AW1A 8GCHF 3L6PA 1MTSA 1NZQH 4X8TH 1BMLA 2BVSH 2PSXA 5J4QA 1T4VH 1V3XA 3QK1A 4X6NA 3SW2B 1O2NA 1UHBA 2JJ2D 1FY4A 1P2KA 2P8OC 2KM0A 2GP9B 3MO6A
chains in the Genus database with same CATH topology
1XUHA 1KLJH 3B9FH 2FI4E 1GI4A 1XM1A 3F6UH 4AORA 1IOEA 2SFAA 1A0LA 1TPPA 1G3CA 3L3TA 1TYNA 5HYOA 2XBVA 1Z6JH 1SGRE 4MPUA 5G4BA 2FYRA 3LGWA 1DXPA 1GJCB 3F9HA 3TPIZ 4JK5A 1P05A 1O5AB 2BOHB 2AFQB 3W94A 3O8DA 4TWYA 2G5VA 1DVAH 1EPTA 1BTXA 2D2DA 1LVOA 1C2HA 8LPRA 5DP5A 1NT1A 1HNEE 3B8JA 3GCNA 3RXDA 1YKTA 2HRVA 2F83A 4K1EA 2ZEBA 4INHA 1E34B 1TNIA 1GVLA 3BTEE 3S69A 3PO1B 2QXGA 1AU8A 4MLFB 1GCDA 3TITA 1GJBB 1MQ6A 4A1XA 1L1JA 2M5TA 2WPMS 1UO6A 2HGTH 1EZQA 1YCPK 4IGDA 1ELBA 3VXFH 2WPLS 3URDA 1L1NA 4FUIA 4Y7AA 3GY7A 3Q76A 1GJ8B 1RRKA 4BAOB 1YP9A 3U1IB 1AWFH 1KSNA 4CRDA 2FS9A 3UR6A 1QQUA 3K2UA 2B7DH 1V2WT 3M61U 1QJ7B 4CBNA 2ZGJA 3MU5A 1MKWK 1CA8B 1EJMA 1O5EH 3HGNA 1OP0A 3PLPA 3UOPA 1YCPM 3C1KA 1TOCB 2OLGA 2FP7B 3BEIB 5L6NH 3BTME 3LGIA 1EB1H 1MZDA 2ZNKH 2CV3A 3ITIA 1G2MA 4WF8A 1QRXA 1ZSLA 3RXTA 4KKDA 4ASHA 1FUJA 1RTKA 1G30B 1ELDE 3GY8A 4D8NA 1B7XB 1EAXA 4TPIZ 1X7AC 1AUJA 2OBOA 6LPRA 5C1XA 3AASA 3U8OH 2CF9H 3UWJH 4DVAU 1YPGH 1P0SH 1CGJE 2BZ6H 2Z3DA 1MU6B 1ZJDA 3P6ZB 4FU9A 1FY8E 2O8WA 3BN9A 1ZYOA 3ENSB 4ABIA 1QB9A 1XVOA 5JB9S 2BQWB 3FZDA 2W7UA 2BY7X 1CO7E 4VGCC 3DFJA 3AAVA 1A4WH 2P3TB 2F9OA 1NN6A 2A4QA 3PO1C 3RLWH 3SUGA 2ZU2A 1ID5H 1EUFA 5FX5A 3SQHE 5PTPA 3GISB 5DGJA 3I77A 2JH5D 1RIWC 4B2BA 3ZZAA 1D6WA 1S0RA 2FS8A 1S6FA 3HK6B 3FVFB 3AAUA 1WU1A 2R0LA 1AUTC 3A8DA 5L2YH 3OSYA 1HB0B 5C1UA 2WV5A 1WBGB 1O2HA 1HJ9A 1ZMLA 2Q6GA 2BM2A 1AFQB 1UCYK 3LDXH 1O2MA 1IQMA 1TGTA 4GAWA 4WXVA 3RC4A 4AB8A 1PPBH 1Y8TA 4HFPB 3LKWA 2ZF0H 2BY9X 4NFFA 1AB9C 1QBVH 1C2DA 1AI8H 4WMFA 3RXGA 1IQLA 5E0JA 3ZZ6A 4BAQB 1QHRB 1PYTC 2ZHDA 1OWJA 4AOQA 1YPEH 1ELEE 4TY6A 2B9LA 1T31A 3EGKH 3BSQA 1DT2A 1KYNA 4ZKSU 5HGGA 4X6PA 1AZZA 1UTNA 2G4UA 1C2IA 3MH7A 1AY6H 1UK3A 3SJ9A 2XW9A 2QXIA 1BMNH 2HNTE 2RA3A 1TQ0B 3PMAB 4MDSA 5EQQA 3BF6H 3VB7A 3ZVGA 2CF8H 1TGBA 1ANDA 1MTWA 1Y3UA 4JMYA 1OWKA 5DP6A 1OWHA 1O3FA 3RXJA 3U8RH 5JBAS 1C2GA 1V2MT 1S84A 1WV7H 1ACBE 2FOMB 4D76A 1GI1A 2AGIX 1LTOA 4INLA 1QA0A 3N7OA 3M7UA 2CHAB 3RXIA 1C2KA 4WXIA 2FLBH 1BTWA 3DFLA 1P01A 2BY6X 1HJAB 1O3LA 1IAUA 1HRTH 4Q7XA 3RXCA 5JBCS 2PUXB 1SQOA 2BD5A 5FX6A 2CXVA 1A1RA 2PKAB 1CT4E 1T8NA 4HGCA 1AVXA 2VIVA 3RXKA 1SHHB 4X1SU 3EA7A 5JBTA 5DK1A 5JYIA 5EG4A 1PJPA 2PUQH 1O2RA 3FZZA 1T32A 2RCEA 1Y59T 1FY3A 2TBSA 5A0BA 3IWMA 1OSSA 1WCZA 3GOVB 4Y79A 3RXSA 2Y81A 2D1JA 2PTNA 4TWWA 3MI4A 2RDLA 3M5LA 2P59A 1O3MA 2BQ7B 2BVRH 1S6HA 1OOKB 3GY3A 2ASUB 2ZFQH 5C3NA 2SGPE 1OP2A 1O31A 1KIGH 5IYTA 2GKVE 1HUTH 5TCAA 2FTLE 3EA9A 4GUXA 1PQ7A 3ZZ9A 1QNJA 2QGRA 1IQIA 3MU0A 4H42U 4BXWA 1HDTH 1GI5A 1TALA 1HV7A 3A81A 3VB5A 4ESTE 4Z6AH 1GI7B 3M7QA 4ABJA 3ATKA 1DICA 1GG6B 4FUCA 3GDSA 4E06H 1UK4A 3O8RA 3MH6A 2PFEA 2Z9GA 1NS3A 1O2TA 1A7SA 4TYDA 5HMAA 4AB9A 1P2QA 3ZZ3A 2Z9JA 5BRRE 3TVJB 2AS9A 2HPPH 1K28D 4I8KA 1GCTB 4F49A 5BPEA 4K3JA 4HTCH 4F4OC 5JDUB 1NTPA 3ATMA 4NGAH 1A3EH 1SVPA 3M3VA 3RXVA 1K2I1 2Z7FE 2I6QA 1F5KU 4X0WU 5SGAE 3KQBA 2HOBA 4AFZA 2ILNA 2FO9A 4NWLA 4U01A 1BB0B 2BMGB 3R3GB 1P10A 3RUOA 1GMCF 3QGJA 1LKAA 1GPZA 1O2SA 2A4GA 1W12U 2BDCA 3SO3A 3KCGH 4AFSA 2BLVA 2WV4A 4M7GA 1IQGA 1BHXB 3CS7A 1JRTA 2YOLA 3PLKA 1VCWA 3SHCH 1DXWA 1HAIH 2EI7A 3UNQA 4WH6A 4AFQA 1THRH 1HJ8A 2GX4A 3LGTA 2QY0B 4R8TB 4U32A 3ATWA 1ETRH 3MNCA 1QR3E 3GCHB 1GMCG 1Z7KA 3F9GA 2VGCB 4ZAEA 2HLCA 1W11U 1ANEA 1AKSB 4ZHMU 5F6MA 2Y7XA 3TJVA 3A7TA 2PV9B 2NU4E 5C67A 4XE4A 3T29A 2QIQA 4O3UA 1G37A 1T8MA 2GV6A 1D3PB 5T6GA 2XBXA 2ZHQH 1MMJN 4Y0ZE 1YPHC 4Q7ZA 2XNIA 2OCVB 2ZCLP 1EX3A 4UFGH 4K8YA 1Z1IA 1O34A 5GDSH 1SGQE 2BTCE 1GG6C 2ANYA 2TGAA 3BTGE 3V3MA 4FVDA 3NWUA 4OGXA 1QA7A 1PFXC 1C4V2 3KGPA 1LVMA 2AIPA 1LPGB 4A92A 1K1PA 2O8LA 4BAKB 1FPCH 2F9VA 1VJAU 1KXBA 2ZQ1A 2UUYA 1CA0B 1QL8A 3S9BA 3LOXA 1FNIA 1TOMH 1O3EA 4KTCA 1XUJA 3H7TA 4D9QA 1NFUA 2C3SA 1S83A 1WAYB 1N8OC 4ZKOU 2QA9E 3TH4H 2H2ZA 1ELGA 1RD3B 1V2UT 2GZ9A 2OC7A 4Y76A 3ZZDA 1SOZA 1O2UA 1MD8A 2XYAA 3KF2A 3QO6A 1KLIH 1ZLRA 1TNLA 5A0AE 2UWPA 3E1XB 1ANBA 4D9RA 1TA6A 1JRSA 1DY8A 4X2WA 3ZVCA 3D23A 4ABAA 2H6MA 1HPGA 2R3YA 1AVWA 1DX5M 2J38A 1GJ5H 2A2XH 1O2YA 5ESTE 3U1JB 3H5CB 3RXBA 1NRQH 2GVFA 1CVWH 1HAOH 4ZHAA 1W7XH 1P2NA 1WTGH 2V0BA 4CRAA 1VR1H 1O3JA 2TGTA 3GCHC 1LCYA 4MVNA 1FQ3A 1SGTA 3HKIB 1XMNB 1ZHPA 2BHGA 1C5YB 4B1TA 1C2EA 1J9CH 1V2ST 2P8OB 1KXEA 2CGAA 2Z3EA 3FFGA 5DKMA 2VIQA 2ALPA 1DM4B 3P95A 4X2XA 2C93B 4IC5A 3KQCA 4YOJA 2PWXA 2ZWLH 4WVPE 5FAHA 1HBTH 1J17T 4KTUA 1G3EA 2FTMA 4HI3A 2PW8H 1K9OE 3SJOA 3TJOA 1P8VC 1SL3A 1GJ9B 1IHSH 2ZPQA 1UTLM 3G01A 4KTSA 1FJSA 3SU5A 4AN7A 1T7CA 3MYWA 2ALVA 1XUGA 1RJXB 5B6OA 1ELAA 4BTIB 4DURA 5HXFA 4FUBA 1GGDC 3CENA 3URCA 2XC5A 1BA8B 3SV7A 4K69A 1SPJA 1LHCH 1O3CA 4CR9A 1EOJA 3STIA 2FOCA 2ZDMA 4MG3A 1HIAB 1CA0C 4UFFH 2WYGA 2Z9KA 1YPMH 1H8IH 2CJIA 4AZ2B 4JZIA 5ETXA 1GBTA 1Z8RA 3SOSA 4UDWH 1W13U 1LO6A 5JPMH 1C1WH 2OP9A 5AVDA 4OS7A 1YPKH 4H6TA 2ZHFH 1ETSH 5K7RA 1YPJH 4CH2B 4DT7B 3QGNB 1TX6A 5LH8A 3UQOA 6GCHF 3RXQA 1W0ZU 2IPHA 3TIUA 1HXEH 2W3KA 3A84A 3P8GA 1MBQA 1MTVA 1SGPE 2BD9A 1Z8IB 2R3UA 2ZC9H 1HAVB 4GLYA 4JYTA 2HALA 1GDUA 2P93A 2F3CE 2ZG0H 2F91A 6GCHG 2Y7ZA 4NSVA 2PKAA 1O5CB 1UVUH 4Y0YE 3BEUA 3T25A 1MD7A 5LPRA 2AH4X 2AMPA 1BRBE 1H9LB 2Y5HA 2ZU5A 1IQNA 2FIRH 4FUGA 2G81E 2XBWA 2ZPSA 3ELAH 1AMHA 1CHOF 2SNWA 4FU8A 5TJXA 2FOBA 2VWLA 1E36B 1AIXH 2G52A 1C1UH 8GCHG 3E91A 5EGMA 1NO9H 2J95A 1HCGA 3SNDA 1QTFA 4K5ZA 4K60A 2F9PA 3LC3A 3A7VA 3SJIA 3SNEA 1CHGA 1EZXC 1HGTH 1RFNA 1O2OA 1TIOA 3GY4A 1HYLA 3UNRA 1C1SA 1DOJA 4VGCB 1UMAH 1YYY1 1CHOG 4D7FA 1Z8JB 2ANKH 2PTCE 3GY6A 5LGOA 2EC9H 3A82A 4BAMB 1E0FD 2BQ6B 2BX4A 3Q3XA 2FOFA 3TLOA 2ESTE 1ORFA 1LVBA 2VH0A 2ZIQH 3RC5A 1ESAA 3BEFB 4WMEA 1CSOE 1RIWB 3M35A 1HAXB 4JZEH 4NZQA 5EXLA 4B74A 1A3BH 2P16A 1C5TA 5EODA 1C2JA 3SN8A 2GZ7A 4UD9H 1CBWC 1UJ1A 4BTTB 1L4DA 3OY6U 3F9FA 1HXFH 2OXSA 4GCHF 5EW1H 3VFEA 2ZFRH 1O30A 4AYYB 1K1MA 1AB9B 1W2KH 1DITH 1TX8A 1NU9A 1WOFA 1TPAE 2F9NA 4TPYA 1O35A 1QURH 1SQAA 2W26A 3SGAE 4DOQA 2QF0A 3TNTA 2SGAA 2ZECA 1UCYH 4GCHG 1PPGE 3BIVH 3PM3A 4ABHA 1S85A 3RU4E 3Q3YA 3VPKA 1SMFE 1KDQB 1KTTB 2ZO3H 1QY6A 1JBUH 2YNBA 4JZ1A 3UUZA 1ESTA 2GD4B 1EZSC 2C8WB 3B23B 1KXAA 1UTPA 1GJAB 3O8BA 1VZQH 2A4OA 3SNAA 2A5IA 4UFEH 2QN5T 3SU1A 4MQAA 1IQJA 3K6ZA 2XBYA 2FPZA 4IBLH 4I31A 3U8TH 1MCTA 7ESTE 3SUEA 1C5ZB 3GY2A 1CE5A 5T3HA 3U9AH 3TNSA 3QDZB 4O3TA 4Y8XA 1THSH 1QJ6B 4XBCA 2JH0D 2B8OH 1B5GH 3LU9B 1SLVB 3NXPA 2VJ1A 4NSYA 5AHGH 3D49H 4NZLA 5C5OA 3GICB 1TMBH 1ZRKA 1E35B 4Q2KA 1TPSA 1J14A 3UY9A 1DPOA 3NK8A 1UVTH 4B76A 1SLXB 3ZZ5A 1NPMA 1EZUC 1UCYE 4CRCA 2C90B 2B0FA 2J9NA 1FPHH 4NIVA 1CT0E 1DSUA 1F0RA 1RS0A 2R9PA 4CREA 5EU8A 1WSSH 3RXEA 3NUMA 3BG4C 3QTVH 1O5BB 5ABWA 1CU1A 1OWEA 4K1SA 3RXFA 9LPRA 3DA9B 2KAIA 2BB4A 3ODFA 1XVMA 2GDEH 3GYMA 1BJVA 1Y5UT 3M5OA 4IS5A 4WJG2 2FWWA 1BRUP 1KLTA 5H4IB 1C2FA 4A7IB 1NFWA 2BD3A 3KL6A 1P3CA 3VB3A 2A45B 1PPCE 3SJKA 3S9CA 2IOTA 1A5GH 2BDGA 4Y6DA 1Y3YA 1XXDA 3QWCH 5DPAA 1ZMNA 1Y5AT 1AZ8A 3MFJA 1RTLA 3SU4A 3A86A 1HFDA 1YC0A 3BIUH 5FPSA 2ZP0H 1ZJKA 2W3IA 2VIPA 4I7YH 1SBWA 1EAIA 3BTTE 1MAXA 5GXPA 1GHVH 1BRCE 3VGCC 2Q1JA 3ZZBA 3M5NA 5GCHF 3Q00A 1L1GA 3S7KB 4KP0A 5JBBS 5F8XA 3MU4A 1ARBA 4UFDH 3D65E 3DD2H 2BX3A 1SQTA 3T26A 2UUKB 4MPXA 3ZV8A 5CMXH 1DUEA 2XXLA 3UTUH 2BLWA 2ANWA 1GBBA 1ZOMA 6ESTA 3ZZ7A 3GY5A 1MKXH 2HNTF 5GCHG 3RXRA 3DT0H 2AIQA 3UOUA 3A80A 1SSXA 1O2WA 4CHAB 2ZFSA 1F7ZA 3FP7E 1AHTH 1O3NA 3KIDU 1VITH 2K1QA 5LPEA 3P8NA 1LQDB 4FUJA 3T27A 3WY8A 3BTHE 1BIOA 4FXGH 1O2XA 3BTDE 4YTAA 4X1QU 1QL7A 1TBRH 5ESBA 1GMDF 1QBNA 1GJ6A 3PMHB 4NIXA 3LJJA 1T8LA 4AG1A 1HAYB 1P06A 3QLPH 1C4U2 3ZYDA 5DP7A 1WUNH 1GBLA 3GDUA 4MNXA 1O33A 1UHBB 1YBWA 5EXNA 1K1JA 1QB6A 4D7GA 4XBBA 1NROH 1F5RA 3RMLH 1FAXA 3SI3H 3JZ2B 2C8ZB 4Y8ZA 2AGGX 3IG6B 2PSYA 2EI6A 1DDJA 1BOQA 4Z0KA 4A6LA 1VCPA 1GHAF 1O36A 3ZYEA 3GCTF 3A7ZA 1A5HA 1GBMA 4E05H 1TE0A 1BQYA 4BTUB 1CQQA 3TGIE 2ZA5A 1FAKH 1TBQH 5EW2H 1KXDA 4ISLA 1O0DH 3ZVAA 5K0HA 1GHAG 1LKBA 1GI9B 3GCTG 2G55A 1LHDH 3TGKE 1C5VA 3Q77A 1TA2A 5DJ7A 2V35A 2H5DA </