4D9QA

Inhibiting alternative pathway complement activation by targeting the exosite on factor d
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
228
structure length
228
Chain Sequence
ILGGREAEAHARPYMASVQVNGEHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVEPGTLCDVAGWGIVSHAGRRPDRLQHVLLPVLDRATCNRRTHHDGAITQRMMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibiting alternative pathway complement activation by targeting the factor d exosite.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Hydrolase/immune system
molecule keywords Factor D
total genus 58
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d9qA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4d9qA01
2BOKA 1AUTC 1ABJH 5DP8A 2QGRA 4WWYA 5E0JA 1IQFA 5GIBA 2SFAA 4CHAC 3M7QA 3H5CB 1C5PA 1ANDA 3AW1A 3TPIZ 2PTCE 2ZF0H 1DFPA 1SR5C 1DSUA 1V2RT 2ZFPH 2WPHS 2ZFQH 4OS2A 4I8JA 3MU1A 4XFQA 5CHAB 1LCYA 1GI2A 2FZZA 1QB1A 1A0JA 1CQQA 1LHEH 4O3UA 3VB3A 5IYTA 2VVUA 2XYAA 4ISLA 3T29A 1ANCA 1BQYA 1KIGH 3PYHA 1F0TA 4TY6A 1BMMH 1MZAA 1FY8E 2F9PA 3KIDU 2QY0B 3E1XB 4CH8B 1W3CA 2ILNA 2VGCC 4YESB 1GMCG 3SUFA 1V2WT 2BHGA 1EKBB 1GGDB 1RTLA 2BD7A 3RXFA 1JRSA 5DP9A 1C4V2 1W0ZU 1UCYE 4WH8A 4MNYA 1HAXB 1KSNA 3QWCH 3U69H 2FODA 4B75A 3SO3A 2OC1A 1FDPA 4LXBH 1GHYH 2J92A 2O8UA 2PTNA 4DIHH 3HK6B 2EA3A 1YPKH 3HK3B 2CMYA 4NGAH 1K1JA 1YCPH 4NWLA 2NU1E 1LHCH 4A7IB 3QN7A 2BVRH 5GCHG 1KDQB 4GHTA 1BOQA 4WH6A 1C1PA 1VJ9U 2ZDLA 3MWIU 3LJOA 1W13U 5AF9H 1AD8H 1WV7H 3NKKA 1K1IA 4CBNA 3T62A 4ASHA 3P70B 3RU4D 1MTSA 1A5IA 4LK4A 1GDNA 3Q3YA 1TGTA 4BTUB 5E2PA 1JWTA 1P2KA 3F68H 1IQMA 2F83A 3A7YA 1HAYB 2GCHG 4IN1A 2GZ7A 3ZZ5A 5A8YA 3A84A 4AGKA 1XVOA 5TCCA 1SQTA 1SBWA 1Y5AT 1V2PT 1GBAA 2ZU1A 4KGAA 3UIRA 1F92A 1HNEE 1YPLH 5C20A 2Z9LA 2G5VA 3BTGE 2Y5GA 4NSVA 3RXDA 4D9QA 4KTCA 2ZPQA 3OSYA 1RTKA 1QBOA 3HGNA 1ZMLA 1AFQC 1MD7A 3GY7A 3BEFB 1ELDE 1LDTT 1P04A 2BXTH 1A2CH 4K2YA 3RXPA 1DX5M 3UOPA 1SFQB 4CRDA 4AZ2B 4FU8A 3ZZ7A 4VGCB 3KL6A 4YLUA 5EQRA 1ZSJA 1UHBA 4MG3A 4ZXXH 3OU0A 5G4BA 4BTIB 4K1TA 1ANBA 3LGVA 4FU9A 1FLEE 1A4WH 3SOSA 1UTLM 1O2HA 3KGPA 3L33A 2PSXA 1UCYH 1O2QA 3SV7A 1QNJA 1OWHA 1SL3A 1G3EA 1XXDA 3A8CA 4WVPE 2FOBA 5DK1A 4OS5A 5A8ZA 2BVXH 1NFXA 4X1PU 1AWHB 3PO1B 5E2OA 1C5LH 4GPGA 3FZZA 1P2MA 3SNDA 2PR3A 1SGYE 1NRPH 1SHYA 1TA2A 1BRBE 3F9HA 4IC6A 1CA0C 4JZDH 1NRRH 3SHCH 1ETRH 2ZQ2A 1V2QT 1IQLA 1GHXH 3QO6A 4U01A 1UTPA 1ACBE 1GHBF 1NRNH 2VH6A 5L6NH 4DOQA 2OCVB 1DWBH 1HV7A 4U30A 5ETXA 2C90B 8GCHG 1EZUC 4Y8ZA 3LGUA 2BY6X 4A1TA 1THRH 1AHTH 1TBZH 1EAXA 2XCNA 3S9AA 3GCTG 2WINI 1O2JA 1Y3VA 1WTHD 4ABBA 2BDHA 1NESE 3BIVH 2R9PA 1GI9B 3DFJA 1GBJA 4ABDA 1JIRA 1EB2A 2PWXA 5F8TA 5DP4A 3E6PH 1FIZA 3SU2A 2D1JA 4JMYA 1ELBA 3F9FA 1YYY1 2IOTA 1BITA 5C1XA 3BTHE 5FX5A 2RA3A 1P11E 1BTHH 1ELGA 8ESTE 1ZLRA 1FN6A 1EZSC 4X2VA 1LHGH 4J1YA 1DANH 3ZVEA 2ZCLP 1TBQH 4GUXA 1BTZA 1ABIH 3QTOH 1SG8B 3BTTE 3PMAB 1EAUA 1L4DA 1DUEA 1ZMNA 1W2KH 1ZZZA 5EXMA 1MU6B 1YBWA 1J15A 1TNIA 2A7JA 2GDDA 3MI4A 4IC5A 3RU4T 1WCZA 3SNCA 2XBVA 1T8OA 2VINA 4F49A 4CRBA 1S5SA 1O39A 4IMZA 4ZKOU 3QUMP 3A8DA 1VITG 2QCYA 2P16A 1BBRK 2BTCE 1HAVA 1RJXB 4J2YB 3BEIB 1ZSLA 1HXEH 2P3FH 3PO1C 2EI8A 1BTPA 1JBUH 3M3VA 1DLEA 1QJ6B 5FBIA 4DG4A 1GMHG 3ESTA 4Z0KA 2YOLA 3BIUH 4I8LA 1Z1JA 1JXPA 1TMBH 4SGAE 1GPZA 1ZRKA 1C2HA 3S7HB 4GAWA 3BTFE 2BD2A 2ASUB 4WMFA 1LHDH 3FP6E 8LPRA 3RXHA 1IHTH 3VB7A 5T3HA 3DT0H 1O3EA 1SGFA 1YPEH 2BVSH 1G3DA 1GI4A 1GBDA 1UO6A 1FPHH 1GI5A 1O3JA 3P95A 3SUDA 2O8TA 4Q80A 1C2FA 1GVKB 2HPPH 4ZKSU 1HFDA 1Z8GA 4X2XA 2CV3A 4K3JA 1K21H 1XVMA 4GCHG 4UONA 5A09A 2W26A 2VVVA 2OQ5A 2Y5HA 5LPFA 1TNJA 2FP7B 3FVFB 1AVWA 3P6ZB 1BMNH 1GBHA 4X0WU 1W14U 2GCTB 1FONA 1GI3A 1EX3A 2BX3A 1HJ9A 2WUCA 1KXDA 5EG4A 1UCYK 4FUIA 2AS9A 2FX4A 5FHTA 1HJAC 6GCHG 3HGPA 1O3OA 3PMJA 1WQSA 1C1UH 3A82A 4CRGA 1LTOA 1ELTA 1B5GH 5IDKA 5ABWA 2FOAA 1UHBB 4DCDA 1LHFH 1J16A 2BDGA 1MUEB 1GCDA 1PQAA 1QHRB 1O34A 1MKWH 1V2NT 3BTWE 1ELVA 2ZGCA 3LC5A 2W7UA 4WJG2 1AVXA 1ZYOA 3C1KA 1C1OA 2ALVA 5DO4H 1Q31A 1O36A 1TRMA 3UPEA 1MKXH 1CBWC 3B9FH 4UFEH 1S6FA 1NN6A 3KQEA 5JB8S 1DVAH 1QA0A 2V6NA 1E35B 2G51A 5B6OA 4XBBA 3PTNA 2AFQB 9ESTA 1FY1A 1P3EA 1SGNE 3URDA 3SHAH 1GG6B 1HXFH 3M3TA 2AEIH 1GBLA 3ZYEA 3SNAA 2GMTC 1AMHA 1UTNA 1BTUA 2D2DA 1TFXA 1W12U 1K1MA 4GVUA 1NROH 3P8OA 1ZTKA 1GJ8B 2FYRA 1QTFA 3GYMA 1O3LA 1GJBB 4CRFA 3T5FH 1ESTA 1CHGA 4JZ1A 1Y3YA 2TGDA 2BLQA 3RXCA 2WYJA 2BZAA 4MPUA 2Y82A 4XE4A 2Z9GA 1RXPA 3TNSA 3ZZ4A 1O2SA 2OBOA 2GT7A 2BQ6B 4Y7BA 1PQ8A 1C2KA 1HGTH 1A5HA 5AVDA 2GZ8A 5EU8A 3PMHB 4M7GA 3ZV8A 2FI5E 3RM0H 2BD8A 3PM3A 1ELEE 2ZU4A 1GHBG 2FESH 4NIVA 3TVJB 4B74A 4JZEH 1XM1A 2ANKH 1C1QA 1EZXC 1GMHF 5EPYA 4MLFB 1HJAB 3U98H 2BD9A 2A4RA 1JMOH 1EUFA 1RIWC 4H42U 1QCPA 1CA8B 2LPRA 3LU9B 4FVBA 1NO9H 1W10U 1MKXK 1DUAA 4D76A 2UUYA 4BOHA 2FEQH 2CHAB 4NG9H 1O5DH 2AMDA 2VIQA 3STIA 1RS0A 5JDUB 5FPYA 1S0QA 1AN1E 1A61H 1TGSZ 1QQUA 1HAZB 1TPAE 1UTMA 1XKBC 2HNTF 1FIWA 1ZPCA 2TRMA 3NUMA 1OKXA 3S7KB 3LH3A 1BUIA 3GY8A 5CE1A 2HALA 2CJIA 2G5NA 1BRCE 4AG1A 2XC0A 3K65B 2XW9A 3MH5A 3LGWA 4YZUA 2STBE 2B0FA 2K1QA 3UWIA 3A7VA 1XUHA 1Z6EA 5ESBA 4NA7A 1ZGVA 1J9CH 1NFUA 3ATIA 4UE7H 2Q6FA 1AU8A 3BN9A 1FN8A 1V2KT 4X6OA 1VGCB 5HMAA 3U8TH 5EGMA 2I6SA 1EOLA 5DJ7A 3ZVGA 1GI7B 1TX7A 1JIMA 4IGDA 1O5BB 3UNQA 1XX9A 2EI6A 4A5TS 2XBWA 1EPTB 1HB0B 1VJAU 3P8GA 4HTCH 1L1JA 1O3BA 5SGAE 1YF4A 3SQEE 5L2ZH 3V0XA 3D49H 2BD5A 1IQJA 3M7UA 1UJ1A 1EJMA 1KXFA 1OPHB 3EA7A 3SUEA 1QFKH 3VB5A 2WPIS 1TQ7B 2NU2E 2UWLA 1BTWA 4Q2KA 1CA0B 2BM2A 4JK5A 4A92A 1GBIA 4OGXA 1V3XA 2SNWA 1N6XA 2P94A 3VXEH 2RCEA 3ZV9A 1SLVB 1AZ8A 2QA9E 3VEQB 3ITIA 5GCHF 1BHXF 4K5ZA 1QBVH 2YNBA 4YOJA 1OWJA 3MMGA 1KXAA 4Q7ZA 1TABE 3UWJH 2BLVA 3K6YA 5FX6A 1C9PA 2SGEE 1SGFG 2O9QA 2V35A 1NFYA 1SI5H 3DHKH 4A6LA 1BCUH 1SMFE 4HI3A 3N7OA 2ZHWH 3MO6A 1K1NA 2ZDKA 1GJCB 3A7XA 1SGTA 3AAVA 2XXLA 3ZVFA 3M5MA 5C5NA 2ZWLH 1GDUA 5EW2H 1N8OC 1A0HB 2XTTB 4GSOA 1O3CA 1K1LA 2ZU3A 2GP9B 1W7GH 1B7XB 1FPCH 2XC5A 4LOYH 1C2LA 1Y5BT 2A0QB 2G81E 1LO6A 2VH0A 1FAKH 1LMWB 1IQKA 4ZH8A 1SHHB 2Z6BD 1P2IA 2PKSB 4Y7AA 1P09A 1O2PA 1RRKA 2G4TA 2HLCA 3QZQA 4E05H 2B7DH 2F3CE 3K6ZA 2G00A 1DE7H 1BMLA 1H1BA 1C5XB 1D4PB 1D3QB 1DITH 1DY8A 1HAHH 3RXBA 1AVGH 1JRTA 2C3SA 4FUHA 3MH4A 4YO9A 2Q6GA 1OWEA 1TBRH 9LPRA 4MPWA 3T27A 1C5RA 5JPMH 4DJZB 2IN2A 2O8MA 4FVDA 1Z8IB 1PPHE 1ZHRA 3RXQA 1DLKB 1O2GH 1MCVA 3SI3H 1GBCA 1ELCA 5EXLA 2EEKA 1UK4A 2Z9KA 1L1GA 4WF8A 3UFAA 1P3CA 2ZTXA 2SGPE 1Z7KA 3UQVA 1O38A 4H6SB 2V3OH 1NU9A 4IW4E 3MFJA 1QQ4A 1WBGB 1LKBA 2BQWB 2FI3E 2ZHQH 1ANEA 3OX7U 1H8DH 2P3UB 2ZFTA 4AFSA 1AB9C 3M61U 1YPHE 2BDBA 2OQUA 1MAYA 3ZZDA 3MU0A 3RU4E 1SLXB 3KQBA 2UUFB 1KDQA 1ZRBA 4GCHF 1BZXE 5CHAC 4CH2B 4DT7B 1EAWA 4X2YA 1O35A 4MNWA 2FYQA 5FPTA 5I25A 1ESBA 1H9IE 1O3IA 1UVUH 2VIWA 3E3TA 2VJ1A 2KAIB 1DT2A 2RDLA 1GBEA 1ID5H 3SU3A 4X1RU 3M36A 1KXEA 1KXCA 4Y10E 2A5KA 1S0RA 2OXSA 4AG2A 4BAHB 3M37A 2QXIA 4ZXYH 3LKWA 3MO3A 2XC4A 2AERH 3SORA 4X6MA 5TJXA 5F8XA 1GBBA 1G3CA 3U9AH 4X8UH 2P59A 3IWMA 3FP8E 3PWCA 1T31A 1K28D 4I7YH 4MTBA 2ZDMA 1YGCH 1ZPBA 3BV9B 1GI1A 1EAIA 2WYGA 3GCTF 4MQAA 3RDZA 2UWPA 3BSQA 2FDAA 4CR9A 3DUXH 1HUTH 3RXJA 1A3EH 1AE8H 2EC9H 1PPGE 2FO9A 3TK6A 1XKAC 2ODYB 1VCPA 3LDXH 2A32A 2ESTE 4ISNA 3BTKE 3PTBA 3SJKA 1D6RA 3UQOA 2HNTC 2ZI2H 1Y8TA 3S69A 1XMNB 2QYIA 1AFEH 3P8NA 4BNRA 2J4IA 5LH8A 2UUKB 3QTVH 2VNTA 4ZROA 2QV1A 2WPMS 2NU3E 2ZO3H 1G37A 4JYUH 4UFGH 5JBTA 2A5IA 1OP0A 2OP9A 3BF6H 2XWAA 4NZQA 4GLYA 2BY5X 1BRUP 2TPIZ 1GBMA 1RFNA 3VB6A 1BMAA 1AY6H 4B76A 4KELA 1SSXA 4FUDA 4E7RG 3EQ0H 4NIXA 1P8VC 1AFQB 1D9IA 4OGYA 1TOCB 2C4FH 1S81A 1TPSA 3OY6U 2BQ7B 1P9UA 1ZMJA 2BY8X 3A81A 3SJ8A 4ISHH 4AX9H 4ESTE 2VWOA 2VIVA 4CREA 4Y76A 2ZNKH 1E38B 2TGPZ 4K8YA 3SGQE 4WXVA 4X2WA 2BXUH 4Y0YE 1GBKA 4AYYB 4NIYA 1BT7A 2F9NA 2ZGHA 3DD2H 1UVTH 4I32A 1BRAA 3SU5A 3VFEA 3LGYA 2DUCA 2EI7A 4ISIH 1LVBA 3MH7A 1TLDA 3RXLA 1GJ4H 4U32A 1XUGA 3IITA 2BY7X 3RXIA 2UWOA 1H9LB 3VGCC 3TJVA 3B8JA 1PPZA 2B8OH 3PB1E 2ZCHP 1OYTH 1AE5A 4E7NA 5JB9S 3V3MA 3V12A 1HDTH 1P03A 3KNXA 4VGCC 5L30H 3BTEE 2OLGA 4ABEA 5LGOA 1SGEE 3RMLH 2ZQ1A 1P0SH 5F8ZA 2BD3A 1C5UA 3EDXB 1A0LA 3GICB 2FM2A 4IMQA 4FUEA 1KLJH 5C1YA 1QRXA 2GKVE 2GX4A 4CBOA 2FOHA 2ZPRA 3RLWH 4Y79A 1Y3XA 2ZGXH 4THNH 2NU0E 2JH5D 1V2ST 2GVFA 2H6MA 2Q1JA 1G2LA 2Z94A 3K2UA 4INKA 3ZVCA 1P2OA 1GWAA 2ZFSA 2ALPA 2BD4A 3M5NA 3SZNA 2WPLS 6GCHF 1HAPH 2JETC 2FMJA 2PFEA 5A8XA 4X6NA 1S82A 1FY3A 3PWBA 2RA0A 3TH3H 2ZHDA 1GI0A 6ESTA 1NY22 4AGJA 5AFYH 1DPOA 1W0YH 2GGVB 1C2IA 1UK3A 1UTKA 1S83A 2AMQA 3RXGA 4H4FA 1YPHC 3SBKA 4YTAA 3JZ2B 3ZZ8A 1TYNA 2DE8A 3MO9A 4D7GA 4XOJA 2WPKS 3SV2H 1C4Y2 4I31A 3D23A 1NFWA 3F6UH 3BTDE 5I46H 1XXFA 3GOVB 1DWCH 5A2MH 4ABFA 2ZA5A 3SN8A 1EXFA 3NZIA 1C1SA 4PROA 3UNSA 3A8BA 2AIPA 1UTOA 1AIXH 3W94A 2ZECA 4KTSA 3NPSA 2C93B 1CHOG 1C5TA 1BA8B 4DURA 1GI6A 5DP6A 7LPRA 2FS9A 1A7SA 1WU1A 3QX5H 1SGPE 2CF9H 1M9UA 3SUGA 4OS1A 3MNSA 3VXFH 3LONA 1XUJA 3PV4A 3C27B 3CP7A 4Y6DA 1LPGB 1CVWH 3S9CA 1J14A 2F91A 1WYKA 2OC7A 4BAMB 2PLXA 1QB6A 1DSTA 4BAQB 2BX4A 3V7TA 1AO5A 1SGDE 1HCGA 1D3PB 4NFFA 2HGTH 1GVZA 3TK9A 3TK5A 2BDCA 3LC3A 1SFIA 3Q3XA 4JK6A 2VIDA 3M35A 1C5WB 1E0FD 1T8MA 3MYWA 1B0FA 1TE0A 1SLUB 1L1NA 4WMDA 1AQ7A 3IG6B 4B2AA 2VIOA 2Z9IA 4BXSA 2C8WB 1YKTA 1D3TB 1O3GA 3UY9A 1AKSB 2J94A 3ATKA 1L2EA 4D8NA 4X8SH 1DWEH 1IQEA 4A1VA 1O2ZA 2ZC9H 1T8LA 1O3KA 1NZQH 1DICA 1EOJA 1SGRE 2P8OC 3RC6A 4TYDA 1OWIA 2A1DB 3ATWA 4JZFH 2H9HA 1LVMA 1O3MA 1YPMH 1WUNH 3ZZ6A 2PW8H 1FV9A 2QC2A 1QR3E 4X8TH 5F03A 1VGCC 3UREA 1VITF 1ZOMA 3MTYA 3GY2A 2PGBB 3HKJB 4AFZA 2SGFE 3NWUA 2AMPA 2R3YA 1INCA 3GYLB 2Y6TA 2IJOB 1OXGA 5E8EH 2R3UA 4X1SU 3S9BA 1P9SA 2ODPA 1QA7A 2XBXA 5DP5A 3TLOA 5EOKA 8GCHF 4BANB 1E36B 1TIOA 1GG6C 1GMCF 4UFDH 5T6GA 1TNLA 1EQ9A 1BJUA 2FLBH 1KLTA 1C4U2 2GDEH 1UK2A 3TGJE 3RXVA 1H4WA 3EA8A 1G30B 2QXGA 2ZU5A 3O8BA 2QIQA 2ZHEH 1AB9B 2A2QH 4XBCA 3RXEA 1TNGA 1QRWA 3OTJE 5PTPA 2BLOA 3EA9A 3EGKH 3ZZ9A 5C5OA 1HBTH 4SGBE 1MBMA 5K7RA 1TONA 5GJ4B 2OINA 2AIQA 3SNEA 2UUJB 3A86A 4X8VH 1GL0E 5DP3A 1BBRH 1P06A 1QURH 2A2XH 3E8LA 1BTYA 3Q77A 5JBCS 4DGJA 2G52A 1P10A 4RN6A 1TQ0B 3GY6A 4O3TA 2XWBI 2GCHF 4FUFA 1AZZA 1FZZA 4E06H 1CGJE 1PPCE 2ANMH 2JKHA 2VU8E 4BTTB 5CMXH 4CRCA 4D7FA 3TIUA 2B9LA 2FX6A 1NTPA 4UD9H 1IQIA 2PV9B 2RG3A 1ELFA 2JH0D 3NXPA 1YLDA 4FUGA 4ZKRU 4NZLA 3A89A 5HM2A 2PUQH 4YT7H 6LPRA 4AB9A 3BTME 1C5QA 1EJNA 1NC6A 1O2KA 5GXPA 3U8OH 1NU7B 1C2EA 4XDEA 1ESAA 1C1TA 1H9HE 3LOXA 1HJ8A 3A80A 1P01A 2TBSA 3KEEA 4KTUA 1AWFH 2H9TH 5E0GA 1SQAA 3UR9A 1F0SA 1MD8A 2BY9X 3RUOA 5FPSA 3LH1A 3I77A 1MTNC 5A0CA 2G55A 4TY7A 1EPTA 1NRQH 4NFEA 1LVYA 1Z71A 3A7WA 5EXNA 1O2MA 3MU4A 3E91A 2A4QA 5LPRA 2BOHB 1G3BA 1B0EA 2W5EA 3QLPH 2Y80A 4MNVA 1HAOH 3BG4B 3TJNA 4X6PA 2AGGX 5GPIB 4O9VA 2R2WU 2AGEX 3I78A 3TJUA 1K1PA 1X7AC 2FXRA 1GJ7B 4FUCA 2O8LA 3SI4H 1IQNA 1O32A 4MPVA 2TGTA 2CF8H 1FNIA 1G2MA 1YPGH 1FQ3A 1TA6A 2ZKSA 1DS2E 3OY5U 1F7ZA 3AW0A 2NU4E 1DXWA 2ZP0H 2VB0A 3SU4A 4RKJB 4B73A 2Q6DA 4Y71A 4IN2A 2XNIA 5EQQA 5HYOA 5DP7A 2GTBA 2P95A 1G36A 1UVSH 5EW1H 1KXBA 4ZUHA 4NSYA 5LPEA 1DXPA 1HAVB 2O8WA 2VGCB 1EP5A 1MAXA 1TMTH 4HFPB 2H1UA 2DE9A 4I8KA 1O5AB 1CT0E 2FOMB 1OYQA 3A87A 4NA8A 1VR1H 5H4IB 2QN5T 1UVPA 2PKSC 1DDJA 1H8IH 2FTLE 2XBYA 3SU6A 1XUIA 3GCNA 5BRRE 1GGDC 3ZZ3A 3ZVBA 3QDZB 1TWXB 1P2JA 3SNBA 1EASA 2G4UA 1IQHA 2AGIX 2C8ZB 4TWWA 4KKDA 3NCLA 1O0DH 1QY6A 1TRNA 1O2WA 3M5LA 3GCHB 7GCHG 1BHXB 4B1TA 4CR5A 1IAUA 3SJ9A 1FJSA 1PPEE 4RSPA 2F9BH 1MTUA 1O5FH 2THFB 1AUJA 4CRAA 3GY3A 4O03A 2V0BA 2TGAA 1YC0A 1HLTH 1BDAA 2W3KA 2A7HA 1C5ZB 1O37A 1GHVH 3T2NA 1Q3XA 1TRYA 4AYVB 1G32B 4AN7A 1OSSA 1O5CB 2PUXB 1GBTA 5J4QA 3KCGH 2ZCKP 3I29A 3F9GA 5EQSA 1BJVA 1TOMH 3ZVDA 4ABAA 3TH4H 1V2VT 1C5YB 1E34B 1O5EH 1YP9A 2OD3B 5DKMA 2W7SA 2OUAA 3FFGA 4ABJA 1J17T 1SLWB 1SOTA 3RC4A 4MVNA 5F6MA 3M7TA 3TGIE 2R0LA 1TNKA 1W7XH 5A0BA 1FXYA 1LQDB 1QL7A 1EB1H 5HGGA 1T4UH 2ULLA 1PFXC 1O3FA 1O2OA 1UTJA 2ZZUH 3ZZAA 1PPFE 2STAE 1QIXB 1ZHPA 1FAXA 2WPJS 1RGQA 4K1SA 4YOIA 2OC8A 1ORFA 3MNBA 1FUJA 1GJ5H 7GCHF 4A1XA 1MBQA 1WSSH 4ZKNU 4Y8YA 1SB1H 3KQDA 4YM9A 1VCQA 2QXHA 4ABGA 4Z6AH 2FLRH 1YM0A 1UVOA 1CGIE 1DY9A 3LGTA 1C5VA 3T28A 4INLA 1CGHA 5L2YH 4UDWH 1YPJH 3TJOA 3EAJA 2FOCA 2FOFA 3MU8A 3RXKA 1ZR0A 1GHWH 2FPZA 4B2CA 4Y11E 2ZIQH 1GJ6A 3DFLA 3M5OA 1CBWB 1JOUB 2A31A 1MTWA 1O2XA 2CGAA 3SGBE 1KLIH 1FY4A 5BPEA 2ZPSA 3MNCA 3QZRA 1V2JT 2SGQE 3CS0A 2F9VA 2A4GA 2ZDVH 1PPBH 1CO7E 1K22H 1ZTLA 1NS3A 1F5RA 5GDSH 3NK8A 1WAYB 2CHAC 3E16B 5FCRA 1HIAB 3PLBA 3RM2H 1O2TA 1TMUH 1SGCA 1P12E 2FOGA 1BB0B 5TCAA 1O2VA 1OWDA 4B71A 2ZG0H 5K0HA 1QJ7B 1NRSH 3L3TA 1C2GA 3P92A 3UNRA 3QGNB 5JBAS 2H5DA 2HOBA 4I33A 4WXIA 1SPJA 1DM4B 2ANYA 3RP2A 1VITH 2R0KA 2J38A 4I8HA 3A85A 3A88A 4BAKB 1GHZA 1L4ZA 3TGKE 5FAHA 3PROA 1FI8A 2BB4A 2ZTZA 1P2NA 1V2OT 3AVZA 3HATH 1QL9A 3O8DA 2G8TA 3FAOA 1FMGA 2ODQA 3Q76A 1ETTH 3SU1A 4HGCA 1GMDF 3S0NA 1KTTB 1T7CA 3V13A 1SOZA 4NWKA 2I6QA 5E0HA 2A4OA 1AKSA 4FUBA 4R0IA 4Q7XA 5FBEA 3PMBB 1F0UA 1C5MD 1K9OE 5C67A 1HAGE 1EJAA 2IPHA 4INHA 1C1NA 5FCKA 5AHGH 1GBFA 2VIPA 2YNAA 4DW2U 4MDSA 1MZDA 6CHAC 1O2LA 1TALA 7ESTE 2HNTE 3UOUA 1O31A 4F4OC 3VGCB 2C8YB 3SV8A 3GCHC 3B23B 1YCPK 2FS8A 2HWLB 1ZJDA 1MMJN 3K9XB 5HM9A 1O30A 1SC8U 1Y5UT 2HPQH 2TIOA 1SVPA 1T4VH 3GY5A 3ODDA 2PKAB 1TX8A 4WMEA 1RTFB 2FI4E 1TPPA 2PGQB 5A0AE 4ZHAA 2F9OA 1U6QA 1Z8JB 1XUKA 2H5CA 4TWYA 1P2QA 1EATA 1WOFA 2W3IA 5EODA 1ARBA 3VB4A 3P8FA 4IBLH 3SJOA 2Z3EA 3U1JB 2Z3DA 1S85A 1GJAB 8KME2 4AFUA 3KF2A 3UR6A 1LVOA 1GHAG 1ARCA 1GMDG 1NPMA 1BTXA 1NT1A 4HZHA 3H7OA 2FIRH 2NWNA 1THSH 1Y3WA 4NIWA 4YOGA 2HRVA 2D26C 3FZDA 2A45B 3HKIB 4UEHH 3CENA 2J2UA 3RLYH 1F5KU 1CU1A 2PHBA 5DGJA 1P05A 2QXJA 3SGAE 2PSYA 4K1EA 1V2UT 3MU5A 1Z6JH 3ATMA 1XUFA 3MOCA 3ATLA 4GHQA 1C1WH 1CT4E 2A7CA 1K1OA 2WV5A 4YT6H 1QBNA 1F2SE 1MTNB 4XBDA 1L0ZA 2A5AA 3H7TA 3LIWA 3ZZCA 4FXGH 1C2JA 2WUBA 1MQ6A 1MU8B 2JETB 1GCTB 2H9EH 4KP0A 2VWLA 2JH6D 1Y59T 4B2BA 1IQGA 3KQCA 1OOKB 3BEUA 4ZHLU 5C2ZA 1C1VH 1C5SA 3RXTA 2FTMA 1EP6A 1SGIB 2C8XB 1NM6A 4ZMAH 4AORA 1P02A 2H2ZA 2GZ9A 3VPKA 3PLPA 1QGFA 2QF3A 2OBQA 3D62A 5DPAA 1E37B 1GHAF 1LPZB 1J8AA 3RXRA 2LNCA 3TH2H 2OC0A 2CN0H 1O2YA 4UFFH 1D6WA 1DOJA 3R3GB 7KMEH 4K69A 3G01A 4MPXA 4LZ4B 3AASA 2P3TB 1C9TA 4LZ1H 2ZEBA 3AAUA 2ZDNA 2Z9JA 4JZIA 5JBBS 3ENSB 1GI8B 1TGBA 1VZQH 2J9NA 3URCA 3MH6A 2FWWA 4NCYA 1SQOA 2XRCA 3F9EA 1A3BH 1Q2WA 2QAAA 3T26A 1Y3UA 1TB6H 1MKWK 2BLWA 3GDUA 2Z3CA 2SGDE 1DWDH 3ELAH 3A7ZA 3A8AA 3OYPA 2GV7A 1O2NA 2ZFRH 2ZHFH 1BBRE 5J4SA 1V2LT 2BDYA 2KAIA 1HAIH 1ZJKA 2B5TB 3O8RA 5GWZA 1KYNA 2ANWA 4OS4A 3F1SB 3U8RH 3RXAA 1CHOF 3GCOA 3SQHE 1GDQA 4XSKU 4FU7A 1C2DA 1O2IA 3E90B 2HVXA 5ESTE 1GJ9B 1SGQE 2QF0A 3RXMA 4ABIA 3WY8A 1MH0A 1VCWA 4ABHA 3O8CA 2SGAA 1OWKA 1N8OB 1LQEA 1HYLA 1QJ1B 5T6DA 3BG8A 1UMAH 2J95A 3E0PB 3FANA 1TPOA 1HPGA 4Q7YA 1V6DA 1ZSKA 2Y81A 3DA9B 3LGIA 3TNTA 1MTVA 1C1RA 4FUJA 4OS7A 4YLQH 2Y7ZA 2ZGBH 4DIIH 2SNVA 1V2MT 3LT3A 5EPNA 3P17H 4ZHMU 1ZGIA 3ZZBA 3UTUH 3M3SA 1O3AA 1A46H 1P57B 2CXVA 3SV6A 2ZTYA 3MHWU 4QT8C 2P93A 1O3NA 1LKAA 2AH4X 2ZGJA 1C5OH 2BDIA 2Y7XA 3CS7A 3HPTB 3RMMH 1PQ7A 4NA9H 1IHSH 1V2TT 1K2I1 1GL1A 2AYWA 4ISOA 5C3NA 1A1RA 5FXLA 3ZVAA 3ZYDA 1A5GH 4OS6A 1ZTJA 1OP2A 1WQVH 4AOQA 2ZFFH 1GJDB 1BIOA 1PJPA 6CHAB 1O3DA 2VWNA 2J34A 4JYVH 1MCTA 4JCNA 2Y5FA 1S6HA 3STJA 4JYTA 3LJJA 2FOEA 1KY9A 1O33A 4CHAB 3SJIA 1D3DB 1QB9A 1AGJA 1C2MA 3RXUA 1CT2E 1PYTC 3RMNH 3U1IB 1UTQA 1N6YA 2GMTB 4WY3A 3T25A 1LPKB 1GVLA 3FP7E 2OTVA 1O3HA 1EPTC 1CE5A 1HRTH 3Q3KA 4TPYA 2VVCA 1EZQA 3QK1A 4AFQA 1FY5A 2XCFA 1ELAA 3RXSA 1F0RA 3SU0A 3KN2A 3RC5A 4TPIZ 3PLKA 2ZDAH 3EE0B 3GY4A 1PYTD 3LPRA 4K8BA 1AI8H 1C5NH 5HXFA 3ODFA 3W95A 4BXWA 4MNXA 4I8GA 3SV9A 2ZU2A 1N1LA 2R2MB 1S84A 2GT8A 3KHVA 1W11U 3BTQE 1W8BH 4X1QU 2GCTC 1QRZA 1TX6A 2GD4B 1TGCA 1O3PB 4DVAU 3SW2B 1O2RA 3EYDA 2WV4A 5JYIA 1O5GH 5AFZH 2M5TA 1O2UA 1THPB 4K60A 4D9RA 3GDVA 1G9IE 4X1NU 3L6PA 3D65E 3GDSA 4U2WA 3UUZA 1OS8A 1T8NA 2Z7FE 2BYAX 2V3HH 3MNXA 1ZPZA 2GV6A 3A7TA 4DY7B 1Z8RA 2PKAA 3R0FA 1RIWB 4BAOB 1TNHA 1YCPM 3QGJA 4Y8XA 1OX1A 1MQ5A 1TAWA 1CSOE 3RXOA 1Z1IA 1ZHMA 1PQ5A 3BG4C 3TITA 2BDAA 3JZ1B 4H6TA 1F5LA 1RD3B 1IOEA 4O97A 3GISB 4ZAEA 1OP8A 1YLCA 3TU7H 3Q00A 4R8TB 4AB8A 4Y0ZE 3E0NB 2F9UA 2BZ6H 2VWMA 3RMOH 1QL8A 5C1UA 2D8WA 1ETSH 1HIAA 5DG6A 2P8OB 2BMGB 3A83A 5T6FA 4RKOB 1C1MA 1TGNA 1T32A 1GCTC 1WTGH 1KTSB 4IS5A
chains in the Genus database with same CATH superfamily
2BOKA 1AUTC 1ABJH 5DP8A 2QGRA 4WWYA 5E0JA 1IQFA 5GIBA 2SFAA 1UW7A 4CHAC 4ZCNA 2HVYB 3M7QA 3H5CB 1C5PA 1ANDA 3AW1A 3TPIZ 2PTCE 2ZF0H 1DFPA 1SR5C 1DSUA 1V2RT 2ZFPH 2WPHS 2ZFQH 4OS2A 4I8JA 3MU1A 4XFQA 5CHAB 1LCYA 1GI2A 2FZZA 1QB1A 1A0JA 1CQQA 1LHEH 4O3UA 3VB3A 1SKYE 5IYTA 2VVUA 2XYAA 4ISLA 3T29A 1ANCA 1BQYA 1KIGH 3PYHA 1F0TA 4TY6A 1BMMH 4ASUD 1MZAA 1FY8E 5EIYA 2F9PA 3KIDU 2QY0B 3E1XB 4CH8B 1W3CA 2ILNA 2VGCC 4YESB 1GMCG 3SUFA 1V2WT 4P00A 2BHGA 1EKBB 1GGDB 1RTLA 2BD7A 2WV9A 3RXFA 1JRSA 5DP9A 1C4V2 1W0ZU 1UCYE 4WH8A 4MNYA 1HAXB 1KSNA 3QWCH 3U69H 2FODA 4B75A 3SO3A 2OC1A 1FDPA 4LXBH 1GHYH 2J92A 2O8UA 2PTNA 4DIHH 3HK6B 2EA3A 1YPKH 3HK3B 2CMYA 4NGAH 1K1JA 1YCPH 4NWLA 2NU1E 1LHCH 4ACBA 4A7IB 3QN7A 2BVRH 5GCHG 1KDQB 4GHTA 1BOQA 4WH6A 1C1PA 1VJ9U 2ZDLA 3MWIU 3LJOA 1W13U 5AF9H 1AD8H 1WV7H 3NKKA 1K1IA 4CBNA 3T62A 4ASHA 3P70B 3RU4D 1MTSA 1A5IA 4LK4A 2F4LA 1GDNA 3Q3YA 1TGTA 4BTUB 5E2PA 1JWTA 1P2KA 3F68H 1IQMA 2F83A 3A7YA 1HAYB 2GCHG 4IN1A 2GZ7A 3ZZ5A 5A8YA 3A84A 4AGKA 1XVOA 5TCCA 1W0JD 1SQTA 1SBWA 1Y5AT 1V2PT 1GBAA 2ZU1A 4KGAA 3UIRA 1F92A 1HNEE 1YPLH 5C20A 2Z9LA 2G5VA 3BTGE 2Y5GA 3FOAA 4NSVA 3RXDA 4D9QA 4KTCA 2ZPQA 3OSYA 1RTKA 1QBOA 3HGNA 1ZMLA 1AFQC 1MD7A 3GY7A 3BEFB 1ELDE 1LDTT 1P04A 2BXTH 1A2CH 2KR7A 4K2YA 3RXPA 1DX5M 3UOPA 1SFQB 4CRDA 4AZ2B 4FU8A 3ZZ7A 4VGCB 3KL6A 2AHME 4YLUA 5EQRA 1ZSJA 2HLDD 1UHBA 2WSSD 4MG3A 4ZXXH 3OU0A 5G4BA 4BTIB 4K1TA 1ANBA 2J98A 3LGVA 4FU9A 1FLEE 1A4WH 3SOSA 1UTLM 1O2HA 3KGPA 3L33A 2PSXA 1UCYH 1O2QA 3SV7A 1QNJA 1OWHA 1SL3A 1G3EA 1XXDA 3A8CA 5FL7D 4WVPE 2FOBA 5DK1A 4OS5A 5A8ZA 4I86A 2BVXH 1NFXA 4X1PU 1AWHB 3PO1B 5E2OA 1C5LH 4GPGA 3FZZA 1P2MA 3SYJA 3SNDA 2PR3A 1SGYE 1NRPH 1SHYA 1TA2A 1BRBE 3F9HA 4IC6A 1CA0C 4JZDH 1NRRH 3SHCH 1ETRH 2ZQ2A 2PP6A 1V2QT 1IQLA 1GHXH 3QO6A 4U01A 1UTPA 1ACBE 1GHBF 1NRNH 2VH6A 5L6NH 4DOQA 2OCVB 1DWBH 1HV7A 4U30A 5ETXA 2C90B 8GCHG 1EZUC 4Y8ZA 3LGUA 2BY6X 4A1TA 1THRH 1AHTH 1TBZH 1EAXA 2XCNA 3S9AA 3GCTG 2WPDD 2WINI 1O2JA 1Y3VA 3U28C 1WTHD 4ABBA 2BDHA 1NESE 3BIVH 2R9PA 1GI9B 3DFJA 1GBJA 4ABDA 1JIRA 2RDEA 1EB2A 2PWXA 5F8TA 5DP4A 3E6PH 1FIZA 3SU2A 2D1JA 3OTPA 4JMYA 1ELBA 3F9FA 1YYY1 2IOTA 1BITA 5C1XA 4DT4A 3BTHE 5FX5A 2RA3A 1P11E 2QF5A 1BTHH 1ELGA 3DSOA 8ESTE 1ZLRA 1FN6A 1EZSC 4X2VA 1LHGH 4J1YA 2KCPA 1DANH 3F0OA 3ZVEA 2ZCLP 3NRLA 1TBQH 4GUXA 1BTZA 1ABIH 3QTOH 1S6LA 1SG8B 3BTTE 3PMAB 1EAUA 1L4DA 1DUEA 4HG6A 1ZMNA 1W2KH 3SZEA 1ZZZA 5EXMA 1MU6B 1YBWA 1J15A 1TNIA 2A7JA 2GDDA 3MI4A 4IC5A 3RU4T 1WCZA 3SNCA 2XBVA 1T8OA 2VINA 4F49A 4CRBA 1S5SA 1O39A 2KM0A 4IMZA 4ZKOU 3QUMP 3A8DA 1VITG 2QCYA 5C94A 2P16A 1BBRK 2BTCE 1HAVA 1RJXB 4J2YB 3BEIB 1ZSLA 1HXEH 2P3FH 3PO1C 2EI8A 1BTPA 1JBUH 3M3VA 4FOUC 1DLEA 1QJ6B 5FBIA 4DG4A 1GMHG 3ESTA 4Z0KA 2YOLA 3BIUH 4I8LA 1Z1JA 1JXPA 1TMBH 4SGAE 1GPZA 1ZRKA 1C2HA 2KFWA 3S7HB 3F2HA 5DSFA 4GAWA 3BTFE 2BD2A 2ASUB 4WMFA 1LHDH 3FP6E 8LPRA 3RXHA 1IHTH 3VB7A 5T3HA 3DT0H 1O3EA 1SGFA 1YPEH 2BVSH 2EQNA 1G3DA 1GI4A 1GBDA 1UO6A 5KECA 1FPHH 1GI5A 1O3JA 3P95A 3SUDA 2O8TA 4Q80A 2XNDD 1C2FA 1GVKB 2HPPH 4ZKSU 1HFDA 1Z8GA 4X2XA 2CV3A 4K3JA 1K21H 1XVMA 4GCHG 4UONA 5A09A 2W26A 2VVVA 2OQ5A 2Y5HA 5LPFA 1TNJA 2FP7B 3FVFB 1AVWA 3P6ZB 5CDFE 1BMNH 2IJD1 1GBHA 4X0WU 1W14U 2GCTB 1FONA 1GI3A 1EX3A 2KCYA 2BX3A 1HJ9A 5HIZA 2WUCA 1KXDA 5EG4A 1YLNA 1UCYK 4FUIA 2AS9A 1QZ8A 2FX4A 5FHTA 1HJAC 6GCHG 3HGPA 1O3OA 3PMJA 1WQSA 1C1UH 3A82A 4CRGA 1LTOA 1ELTA 1B5GH 5IDKA 5ABWA 2FOAA 1UHBB 4DCDA 1LHFH 1J16A 2BDGA 1MUEB 1GCDA 3DSGA 1PQAA 1QHRB 1O34A 1MKWH 1V2NT 2XOKD 3BTWE 1ELVA 2ZGCA 3LC5A 2W7UA 4WJG2 1AVXA 1ZYOA 3C1KA 1C1OA 2ALVA 5DO4H 1Q31A 1O36A 1TRMA 3UPEA 2K8IA 1MKXH 1CBWC 3B9FH 4UFEH 1S6FA 1NN6A 3KQEA 5JB8S 1DVAH 1QA0A 2V6NA 1E35B 2G51A 5B6OA 4XBBA 3PTNA 2AFQB 9ESTA 1FY1A 3OAAD 1P3EA 1SGNE 3URDA 3SHAH 1GG6B 1HXFH 3M3TA 2AEIH 1GBLA 3ZYEA 3SNAA 2GMTC 1AMHA 1UTNA 1BTUA 4Z1MD 2D2DA 1TFXA 1W12U 1K1MA 4GVUA 1NROH 3P8OA 1ZTKA 1GJ8B 2FYRA 1QTFA 3GYMA 4F55A 1O3LA 1GJBB 4CRFA 3T5FH 1ESTA 1CHGA 4JZ1A 1Y3YA 2TGDA 2BLQA 2YMSC 3RXCA 2WYJA 2BZAA 4MPUA 2Y82A 4XE4A 2Z9GA 1RXPA 3TNSA 3ZZ4A 1O2SA 2OBOA 2GT7A 2BQ6B 4Y7BA 1PQ8A 1C2KA 1HGTH 1A5HA 5AVDA 2GZ8A 5EU8A 3PMHB 4M7GA 3ZV8A 2FI5E 3RM0H 2BD8A 3PM3A 1ELEE 2ZU4A 1GHBG 2FESH 4NIVA 3TVJB 4B74A 4JZEH 1XM1A 2ANKH 1C1QA 1EZXC 3CNRA 1GMHF 5EPYA 4MLFB 1HJAB 3U98H 2BD9A 2A4RA 1JMOH 1EUFA 1RIWC 4H42U 1QCPA 1CA8B 2LPRA 3LU9B 4FVBA 1NO9H 1W10U 1MKXK 1DUAA 4D76A 2UUYA 4BOHA 2FEQH 2CHAB 4NG9H 1O5DH 2AMDA 2VIQA 3STIA 1RS0A 5JDUB 5FPYA 1S0QA 1AN1E 1A61H 1TGSZ 1QQUA 1HAZB 1TPAE 1UTMA 1XKBC 2HNTF 1FIWA 1ZPCA 2TRMA 3NUMA 1OKXA 3S7KB 3LH3A 1BUIA 3GY8A 5CE1A 2HALA 2CJIA 2G5NA 1BRCE 4AG1A 2XC0A 3K65B 2XW9A 3MH5A 3LGWA 4YZUA 2STBE 2B0FA 2K1QA 3UWIA 3A7VA 1XUHA 1Z6EA 5ESBA 4NA7A 1ZGVA 1J9CH 1NFUA 3ATIA 4UE7H 2Q6FA 1AU8A 3BN9A 1FN8A 1V2KT 4X6OA 1VGCB 5HMAA 2J97A 3U8TH 5EGMA 2I6SA 3F2GA 1EOLA 2QF4A 5DJ7A 3ZVGA 1GI7B 1TX7A 1JIMA 4IGDA 1O5BB 2L74A 3UNQA 1XX9A 2EI6A 4A5TS 2XBWA 1EPTB 1HB0B 1VJAU 3P8GA 4HTCH 1L1JA 1O3BA 5SGAE 1YF4A 3SQEE 5L2ZH 3V0XA 3D49H 2BD5A 1IQJA 3M7UA 1UJ1A 1EJMA 1KXFA 1OPHB 3EA7A 3SUEA 3UB0A 1QFKH 3VB5A 3W1EA 2WPIS 1TQ7B 2NU2E 2UWLA 1BTWA 4Q2KA 1CA0B 2BM2A 4JK5A 4A92A 1GBIA 3PV5A 1V3XA 4OGXA 2SNWA 1N6XA 2P94A 3VXEH 2RCEA 3ZV9A 2QE7D 1SLVB 1AZ8A 2QA9E 3VEQB 3ITIA 5GCHF 1BHXF 4K5ZA 1QBVH 2YNBA 4YOJA 1OWJA 3MMGA 1KXAA 4Q7ZA 5EJ1A 1TABE 3UWJH 2BLVA 2KCAA 3K6YA 5FX6A 1C9PA 2SGEE 1SGFG 2O9QA 2V35A 1NFYA 1SI5H 3DHKH 4A6LA 1BCUH 1SMFE 1E79D 4HI3A 3N7OA 2IPQX 2ZHWH 3MO6A 4P02A 1K1NA 2ZDKA 1GJCB 3A7XA 1SGTA 3AAVA 2XXLA 3ZVFA 3M5MA 5C5NA 2ZWLH 1GDUA 5EW2H 1N8OC 1A0HB 2XTTB 4GSOA 1O3CA 1K1LA 2ZU3A 2GP9B 1W7GH 1B7XB 1FPCH 2XC5A 4LOYH 1C2LA 1Y5BT 2A0QB 2G81E 1LO6A 2VH0A 1FAKH 1LMWB 1IQKA 3AK5A 4ZH8A 1SHHB 2Z6BD 1P2IA 2PKSB 4Y7AA 1P09A 1O2PA 1RRKA 2G4TA 2HLCA 3QZQA 4E05H 2B7DH 2F3CE 3K6ZA 2G00A 1DE7H 1BMLA 1H1BA 1C5XB 1D4PB 1D3QB 1DITH 1DY8A 1HAHH 3RXBA 1AVGH 1JRTA 1YWUA 2C3SA 4FUHA 3MH4A 4YO9A 2Q6GA 1OWEA 1TBRH 9LPRA 3PRDA 4MPWA 3T27A 1C5RA 5JPMH 4DJZB 2IN2A 2O8MA 4FVDA 1Z8IB 1PPHE 1ZHRA 3RXQA 1DLKB 1H8ED 1O2GH 1MCVA 3SI3H 1GBCA 1ELCA 5EXLA 2EEKA 1UK4A 2Z9KA 1L1GA 3FKSD 4WF8A 3UFAA 1P3CA 2ZTXA 2SGPE 1Z7KA 3UQVA 1O38A 4H6SB 2V3OH 1NU9A 4IW4E 3MFJA 1QQ4A 1WBGB 1LKBA 2BQWB 2FI3E 2ZHQH 5HKKD 1E1QD 1ANEA 3OX7U 1H8DH 2P3UB 2ZFTA 4AFSA 1AB9C 3M61U 1YPHE 2BDBA 2OQUA 1MAYA 3ZZDA 3MU0A 3RU4E 1SLXB 3KQBA 2UUFB 1KDQA 1ZRBA 4GCHF 1BZXE 5CHAC 4CH2B 4DT7B 1EAWA 4X2YA 1O35A 4MNWA 2FYQA 5FPTA 5I25A 1ESBA 1H9IE 1O3IA 1UVUH 2VIWA 3E3TA 2VJ1A 2KAIB 1DT2A 2RDLA 1GBEA 1ID5H 3SU3A 4X1RU 3M36A 1KXEA 1KXCA 4Y10E 2A5KA 1S0RA 2OXSA 4AG2A 4BAHB 3M37A 2QXIA 4ZXYH 3LKWA 3MO3A 2XC4A 2AERH 3SORA 4X6MA 5TJXA 5F8XA 3OEED 1GBBA 1G3CA 3U9AH 2J5UA 2P59A 4X8UH 3IWMA 2VBCA 3FP8E 3PWCA 1T31A 1K28D 4I7YH 4MTBA 2ZDMA 1YGCH 1ZPBA 3BV9B 1GI1A 1EAIA 2WYGA 3GCTF 4MQAA 3RDZA 2UWPA 3BSQA 2FDAA 4CR9A 3DUXH 1HUTH 3RXJA 1A3EH 1AE8H 2EC9H 1PPGE 2FO9A 3TK6A 1XKAC 2ODYB 1VCPA 1W0KD 5DN6D 3LDXH 2A32A 2ESTE 4ISNA 3BTKE 3PTBA 3SJKA 1D6RA 3UQOA 2HNTC 2ZI2H 1Y8TA 3S69A 1XMNB 2QYIA 1AFEH 3P8NA 4BNRA 2J4IA 5LH8A 2UUKB 3QTVH 2VNTA 4ZROA 2QV1A 2WPMS 2NU3E 2ZO3H 1G37A 4JYUH 4UFGH 5JBTA 2A5IA 1OP0A 2OP9A 3BF6H 2XWAA 4NZQA 4B6FA 4GLYA 2BY5X 2TPIZ 1BRUP 1GBMA 1RFNA 5KGOA 1BMAA 1AY6H 3VB6A 4B76A 4KELA 1SSXA 4FUDA 4E7RG 3EQ0H 4NIXA 1P8VC 1AFQB 1D9IA 4OGYA 1TOCB 2C4FH 1S81A 1TPSA 3OY6U 2BQ7B 1P9UA 1ZMJA 2BY8X 3A81A 3WW7A 3SJ8A 4ISHH 4AX9H 4ESTE 2VWOA 2K0QA 2VIVA 4CREA 4Y76A 2ZNKH 1E38B 2TGPZ 4K8YA 3SGQE 4WXVA 4X2WA 2BXUH 4Y0YE 1GBKA 4AYYB 4NIYA 1BT7A 2F9NA 2ZGHA 3DD2H 1UVTH 5B6LA 4I32A 1BRAA 3SU5A 3VFEA 3LGYA 2DUCA 2EI7A 4ISIH 1LVBA 3MH7A 1TLDA 3RXLA 1GJ4H 4U32A 1XUGA 3IITA 2BY7X 3RXIA 2UWOA 1H9LB 3VGCC 3TJVA 3B8JA 1PPZA 2B8OH 3PB1E 2ZCHP 2JIZD 1OYTH 1AE5A 4E7NA 5JB9S 3V3MA 3V12A 1HDTH 1P03A 3KNXA 4VGCC 5L30H 3BTEE 2OLGA 4ABEA 5LGOA 1SGEE 3RMLH 2F43B 2ZQ1A 1P0SH 5F8ZA 2BD3A 1C5UA 3EDXB 1A0LA 3GICB 2FM2A 4IMQA 4FUEA 1KLJH 5C1YA 5EJLA 1QRXA 2J98B 2GKVE 2GX4A 4CBOA 2FOHA 2ZPRA 3RLWH 4Y79A 5KEDA 1Y3XA 2ZGXH 4THNH 2NU0E 2JH5D 1V2ST 2GVFA 2H6MA 2Q1JA 3FO8D 3VG8A 1G2LA 2Z94A 3K2UA 4INKA 3ZVCA 1P2OA 1GWAA 2ZFSA 2ALPA 2BD4A 3M5NA 3SZNA 2WPLS 2M2AA 6GCHF 1HAPH 2JETC 2FMJA 2PFEA 5A8XA 4X6NA 1S82A 3H09A 1FY3A 3PWBA 2RA0A 3TH3H 2ZHDA 1GI0A 6ESTA 1NY22 4AGJA 5AFYH 1DPOA 1W0YH 2GGVB 1C2IA 1UK3A 1UTKA 1S83A 2AMQA 3RXGA 4H4FA 1YPHC 3SBKA 4YTAA 3JZ2B 3ZZ8A 1TYNA 2DE8A 3MO9A 4D7GA 4XOJA 2WPKS 3SV2H 3ZIAD 1C4Y2 4I31A 3D23A 1NFWA 3F6UH 1NBMD 3BTDE 5I46H 1XXFA 3GOVB 1DWCH 5F53A 5A2MH 1COWD 4ABFA 2ZA5A 3SN8A 1EXFA 3NZIA 1C1SA 4PROA 3UNSA 3A8BA 2AIPA 1UTOA 1AIXH 3W94A 2ZECA 4KTSA 2L6OA 3NPSA 2JDID 2C93B 1CHOG 3N7EA 1C5TA 1BA8B 4DURA 1GI6A 5DP6A 7LPRA 2FS9A 1A7SA 1WU1A 3QX5H 1SGPE 2CF9H 1M9UA 3SUGA 4OS1A 3MNSA 3VXFH 3LONA 1XUJA 1BMFD 3PV4A 3C27B 3CP7A 4Y6DA 1LPGB 1CVWH 3S9CA 1J14A 2F91A 1WYKA 2OC7A 4BAMB 1EFRD 2PLXA 4OM9A 3WWBA 1QB6A 1DSTA 4BAQB 2BX4A 3V7TA 1AO5A 1SGDE 1HCGA 1D3PB 4NFFA 2HGTH 1GVZA 3KYGA 3TK9A 4FETA 3TK5A 2BDCA 3LC3A 1SFIA 3Q3XA 4JK6A 2VIDA 3M35A 3UAIC 1C5WB 1E0FD 1E1RD 1T8MA 3MYWA 1B0FA 1TE0A 1SLUB 1L1NA 4WMDA 1AQ7A 3IG6B 4B2AA 2VIOA 2Z9IA 4BXSA 2C8WB 1YKTA 1D3TB 1O3GA 3UY9A 1AKSB 2J94A 3ATKA 3OE7D 1L2EA 4D8NA 4X8SH 1DWEH 1IQEA 4A1VA 1O2ZA 2ZC9H 1T8LA 2KCOA 1O3KA 1NZQH 1DICA 1EOJA 1SGRE 2P8OC 3RC6A 4TYDA 1OWIA 2A1DB 3ATWA 4JZFH 2H9HA 1LVMA 1O3MA 1YPMH 1WUNH 3ZZ6A 2PW8H 1FV9A 1K0HA 2QC2A 1QR3E 4X8TH 5F03A 1VGCC 3UREA 1VITF 1ZOMA 2WZQA 3GY2A 3MTYA 2PGBB 3HKJB 4AFZA 2SGFE 3NWUA 2AMPA 2R3YA 1INCA 3GYLB 2Y6TA 2IJOB 1OXGA 5E8EH 2R3UA 4X1SU 3S9BA 1P9SA 2ODPA 1QA7A 2XBXA 5DP5A 3TLOA 5EOKA 8GCHF 4BANB 1E36B 1TIOA 1GG6C 1GMCF 4UFDH 5T6GA 1TNLA 1EQ9A 4ACAA 1BJUA 2FLBH 1KLTA 1C4U2 2GDEH 3KYFA 1UK2A 3TGJE 3RXVA 1H4WA 3EA8A 1G30B 2QXGA 2ZU5A 3O8BA 2QIQA 2ZHEH 1AB9B 2A2QH 4XBCA 3RXEA 1TNGA 1QRWA 3OTJE 5PTPA 2BLOA 3EA9A 3EGKH 3ZZ9A 5C5OA 1HBTH 4SGBE 1MBMA 1WXRA 5K7RA 1TONA 5GJ4B 2OINA 2AIQA 3SNEA 2UUJB 3A86A 4X8VH 1GL0E 5DP3A 1BBRH 1P06A 1QURH 2A2XH 3E8LA 1BTYA 3Q77A 5JBCS 4DGJA 2G52A 1P10A 2GJGA 1VKYA 4RN6A 4Q63A 1TQ0B 3GY6A 4O3TA 3DSPA 2XWBI 2GCHF 4FUFA 1AZZA 1FZZA 4E06H 1CGJE 1PPCE 2ANMH 2JKHA 2VU8E 4BTTB 5CMXH 4CRCA 5C17A 4D7FA 3TIUA 2B9LA 2FX6A 1NTPA 4UD9H 1IQIA 2PV9B 2RG3A 1ELFA 2JH0D 3NXPA 1YLDA 4FUGA 4ZKRU 4NZLA 3A89A 4RI0A 2PUQH 5HM2A 4YT7H 6LPRA 4AB9A 3BTME 1C5QA 1EJNA 1NC6A 1NBME 1O2KA 5GXPA 3U8OH 1NU7B 1C2EA 4XDEA 3F0PA 1ESAA 5CHBA 1C1TA 1H9HE 3LOXA 1HJ8A 3A80A 1P01A 2TBSA 3KEEA 4KTUA 1AWFH 2H9TH 2JJ2D 5E0GA 1SQAA 3UR9A 1F0SA 1MD8A 2BY9X 3RUOA 4RT0A 3LH1A 5FPSA 3EE7A 3I77A 1MTNC 4XD7D 5A0CA 2G55A 4TT3D 4TY7A 1EPTA 5GNDA 1NRQH 4NFEA 1LVYA 1Z71A 3A7WA 5EXNA 1O2MA 3MU4A 3E91A 2A4QA 5LPRA 2BOHB 1G3BA 1B0EA 2W5EA 3QLPH 2Y80A 4MNVA 1HAOH 3BG4B 3TJNA 4X6PA 2AGGX 5GPIB 4O9VA 2R2WU 2AGEX 2W6JD 3I78A 3TJUA 1K1PA 1X7AC 2KZ4A 2FXRA 1GJ7B 4FUCA 2O8LA 3SI4H 1IQNA 1O32A 4MPVA 2TGTA 2CF8H 1FNIA 1G2MA 1YPGH 1FQ3A 1TA6A 2ZKSA 1DS2E 3OY5U 1F7ZA 3AW0A 2NU4E 1DXWA 2ZP0H 2VB0A 3SU4A 4RKJB 4B73A 2Q6DA 4Y71A 4IN2A 2XNIA 5EQQA 2EY4C 5HYOA 5DP7A 2GTBA 2P95A 1G36A 1UVSH 5EW1H 1KXBA 4ZUHA 4NSYA 5LPEA 1DXPA 1HAVB 2O8WA 3DCLA 2VGCB 1EP5A 1MAXA 1TMTH 4HFPB 2H1UA 2DE9A 4I8KA 1O5AB 1CT0E 2FOMB 1OYQA 3A87A 4NA8A 1VR1H 5H4IB 2QN5T 1UVPA 2PKSC 1DDJA 1H8IH 2FTLE 2XBYA 3SU6A 1XUIA 3GCNA 5BRRE 1GGDC 3ZZ3A 3ZVBA 4YXWD 3QDZB 1TWXB 1P2JA 3SNBA 1EASA 2G4UA 1IQHA 2AGIX 2C8ZB 4TWWA 4KKDA 3NCLA 1O0DH 5C0TA 1QY6A 1TRNA 1O2WA 3M5LA 3GCHB 7GCHG 1BHXB 4B1TA 4CR5A 1IAUA 3SJ9A 1FJSA 1PPEE 4RSPA 2F9BH 1MTUA 1O5FH 2THFB 1AUJA 4CRAA 3GY3A 4O03A 2V0BA 2TGAA 2OK5A 1YC0A 1HLTH 1BDAA 2W3KA 2A7HA 1C5ZB 1O37A 1GHVH 3T2NA 1Q3XA 1TRYA 4AYVB 1G32B 2YMSD 4AN7A 2RFKC 1OSSA 1O5CB 2PUXB 1GBTA 5J4QA 3KCGH 2ZCKP 3I29A 3F9GA 5EQSA 1BJVA 1TOMH 3ZVDA 4ABAA 3TH4H 1V2VT 1C5YB 1E34B 1O5EH 1YP9A 2OD3B 5DKMA 2W7SA 2OUAA 3FFGA 4ABJA 5HIYA 1J17T 1SLWB 1SOTA 3RC4A 4MVNA 5F6MA 3M7TA 3TGIE 2R0LA 1TNKA 1W7XH 5A0BA 1FXYA 1LQDB 1QL7A 1EB1H 5HGGA 1T4UH 2ULLA 1PFXC 1O3FA 1O2OA 1UTJA 2ZZUH 3ZZAA 1PPFE 2STAE 1QIXB 1ZHPA 1FAXA 2WPJS 1RGQA 4K1SA 4YOIA 2OC8A 1ORFA 3MNBA 1FUJA 1GJ5H 7GCHF 4A1XA 1MBQA 1WSSH 4ZKNU 4Y8YA 1SB1H 3KQDA 4YM9A 1VCQA 2QXHA 4ABGA 4Z6AH 2FLRH 1YM0A 4Q4LA 1UVOA 1CGIE 1DY9A 3LGTA 1C5VA 3T28A 4INLA 1CGHA 5L2YH 4UDWH 1YPJH 3TJOA 3EAJA 2FOCA 2FOFA 3MU8A 3RXKA 1ZR0A 1GHWH 2FPZA 4B2CA 4TSFD 4Y11E 2ZIQH 1GJ6A 3DFLA 3M5OA 1CBWB 1JOUB 2A31A 1MTWA 1O2XA 2CGAA 3SGBE 1KLIH 1FY4A 5BPEA 2ZPSA 3MNCA 3QZRA 1V2JT 2SGQE 3CS0A 2F9VA 2A4GA 2ZDVH 1PPBH 1CO7E 2CK3D 1K22H 1ZTLA 1NS3A 1F5RA 5GDSH 3NK8A 1WAYB 2CHAC 3E16B 5FCRA 1HIAB 3PLBA 3RM2H 1O2TA 1TMUH 1SGCA 1P12E 2FOGA 1BB0B 5TCAA 1O2VA 1OWDA 4B71A 2ZG0H 5K0HA 1QJ7B 1NRSH 3L3TA 1C2GA 3P92A 3UNRA 3QGNB 5EJZA 5JBAS 2H5DA 3GS9A 2HOBA 3OEHD 4I33A 4WXIA 1SPJA 1DM4B 2ANYA 3RP2A 1VITH 2R0KA 2J38A 4I8HA 5T1VA 3A85A 3A88A 4BAKB 1GHZA 1L4ZA 3TGKE 5FAHA 3PROA 1FI8A 2BB4A 2ZTZA 1P2NA 1V2OT 3AVZA 3HATH 4XRNA 1QL9A 3O8DA 2G8TA 3FAOA 1FMGA 2ODQA 3Q76A 1ETTH 3SU1A 4HGCA 1GMDF 3S0NA 1KTTB 1T7CA 1YY3A 3V13A 1SOZA 4NWKA 2I6QA 1SQRA 5E0HA 2A4OA 1AKSA 4FUBA 4R0IA 4Q7XA 5FBEA 3PMBB 1F0UA 1C5MD 1K9OE 5C67A 1HAGE 1EJAA 2IPHA 4INHA 1C1NA 5FCKA 5AHGH 1GBFA 2VIPA 2YNAA 4DW2U 4MDSA 1MZDA 6CHAC 1O2LA 1TALA 7ESTE 2HNTE 3UOUA 1O31A 4F4OC 3VGCB 2C8YB 3SV8A 3GCHC 3B23B 1YCPK 2FS8A 2HWLB 1ZJDA 1MMJN 3K9XB 5HM9A 1O30A 1SC8U 1Y5UT 2HPQH 2TIOA 1SVPA 1T4VH 3GY5A 3ODDA 2PKAB 1TX8A 4WMEA 1RTFB 2FI4E 1TPPA 2PGQB 5A0AE 4ZHAA 2F9OA 1U6QA 3PV2A 1Z8JB 1XUKA 2H5CA 4TWYA 1P2QA 1EATA 1WOFA 2W3IA 5EODA 1ARBA 3VB4A 3P8FA 4IBLH 3SJOA 2Z3EA 3U1JB 2Z3DA 1S85A 1GJAB 8KME2 4AFUA 3KF2A 3UR6A 1LVOA 1GHAG 1ARCA 1GMDG 1NPMA 1BTXA 1NT1A 4HZHA 3H7OA 2FIRH 2NWNA 1THSH 1Y3WA 4B6EA 4NIWA 4YOGA 2HRVA 2D26C 3FZDA 2A45B 3HKIB 4UEHH 3CENA 2J2UA 3RLYH 1F5KU 1CU1A 2PHBA 5DGJA 3WWFA 1P05A 2QXJA 3SGAE 2PSYA 4K1EA 1V2UT 3MU5A 1Z6JH 3ATMA 1XUFA 3MOCA 3ATLA 4GHQA 1C1WH 1CT4E 2A7CA 1K1OA 2WV5A 4YT6H 1QBNA 1F2SE 1MTNB 4XBDA 5IK2D 1L0ZA 2A5AA 3H7TA 3LIWA 3ZZCA 4FXGH 1C2JA 2WUBA 1MQ6A 1MU8B 2JETB 1GCTB 2H9EH 4KP0A 2VWLA 2JH6D 1Y59T 4B2BA 1IQGA 3KQCA 1OOKB 3BEUA 4ZHLU 5C2ZA 1C1VH 1C5SA 3RXTA 2FTMA 1EP6A 1SGIB 2C8XB 1NM6A 4ZMAH 4AORA 1P02A 2H2ZA 2GZ9A 3VPKA 3PLPA 1QGFA 2QF3A 2OBQA 3D62A 5DPAA 1E37B 1GHAF 1LPZB 1J8AA 3RXRA 2LNCA 3TH2H 2OC0A 2CN0H 1O2YA 4UFFH 1D6WA 1DOJA 3R3GB 7KMEH 2LP6A 4K69A 3G01A 4MPXA 1KMHB 4LZ4B 3AASA 2P3TB 1C9TA 4LZ1H 2ZEBA 3AAUA 2ZDNA 2Z9JA 4JZIA 5JBBS 3ENSB 1GI8B 1TGBA 1VZQH 2J9NA 3URCA 3MH6A 2FWWA 4NCYA 1SQOA 2XRCA 2YMSB 3F9EA 1A3BH 1Q2WA 2QAAA 3T26A 1Y3UA 1TB6H 1MKWK 2BLWA 3GDUA 2Z3CA 2SGDE 1DWDH 3ELAH 1WDIA 3A7ZA 3A8AA 3OYPA 2GV7A 1O2NA 2ZFRH 2ZHFH 1BBRE 5J4SA 1V2LT 2BDYA 2KAIA 1HAIH 1ZJKA 2B5TB 3O8RA 5GWZA 1KYNA 2ANWA 4OS4A 4AC9A 3F1SB 3U8RH 3RXAA 1CHOF 3GCOA 3SQHE 1GDQA 4XSKU 4FU7A 1C2DA 1O2IA 3E90B 2HVXA 5ESTE 1GJ9B 1SGQE 2KX4A 2QF0A 3RXMA 4ABIA 3WY8A 1MH0A 1VCWA 4ABHA 3O8CA 2SGAA 1OWKA 1N8OB 3KQ5A 1LQEA 1HYLA 1QJ1B 5T6DA 3BG8A 1UMAH 2J95A 3E0PB 3FANA 1TPOA 1HPGA 3MQKC 4Q7YA 1V6DA 1ZSKA 2Y81A 3DA9B 3LGIA 3TNTA 1MTVA 1C1RA 4FUJA 4OS7A 5C0UA 4YLQH 2Y7ZA 2ZGBH 4DIIH 2SNVA 1V2MT 3LT3A 5EPNA 3P17H 4ZHMU 1ZGIA 3ZZBA 3UTUH 3M3SA 1O3AA 1A46H 1P57B 2CXVA 3SV6A 2ZTYA 3MHWU 4QT8C 2P93A 1O3NA 1LKAA 2AH4X 2ZGJA 1C5OH 2BDIA 2Y7XA 3CS7A 3HPTB 3RMMH 1PQ7A 4NA9H 1IHSH 1V2TT 1K2I1 1GL1A 2AYWA 4F48B 4ISOA 5C3NA 1A1RA 5FXLA 3ZVAA 3ZYDA 1A5GH 4OS6A 1ZTJA 1OP2A 1WQVH 4AOQA 2ZFFH 4RT1A 1GJDB 1BIOA 1PJPA 6CHAB 1O3DA 3FN8A 2VWNA 2J34A 4JYVH 1MCTA 4JCNA 2Y5FA 1S6HA 3STJA 2LELA 4JYTA 3LJJA 2V3MA 2FOEA 1KY9A 1O33A 4CHAB 3SJIA 1D3DB 2WHXA 1FX0B 1QB9A 1AGJA 1C2MA 3RXUA 1CT2E 1PYTC 3RMNH 3U1IB 1UTQA 1N6YA 2GMTB 4WY3A 3T25A 1LPKB 1GVLA 3FP7E 2V7QD 2OTVA 1O3HA 1EPTC 1CE5A 1HRTH 2JJ1D 3Q3KA 4TPYA 1H8HD 2VVCA 1EZQA 3QK1A 4AFQA 1FY5A 2XCFA 1ELAA 3RXSA 1F0RA 3SU0A 3KN2A 3RC5A 4TPIZ 3PLKA 2ZDAH 3EE0B 3GY4A 3F2FA 1PYTD 3LPRA 4K8BA 1AI8H 1C5NH 5HXFA 3ODFA 3W95A 2W6ID 4BXWA 3N7DA 4MNXA 4I8GA 3SV9A 2ZU2A 1N1LA 2R2MB 1S84A 2GT8A 3KHVA 1W11U 3BTQE 1W8BH 4X1QU 2GCTC 1QRZA 1TX6A 2GD4B 1TGCA 1MABB 1O3PB 4DVAU 3SW2B 1O2RA 3EYDA 2WV4A 5JYIA 1O5GH 5AFZH 2M5TA 1O2UA 1THPB 4K60A 4D9RA 3GDVA 1G9IE 4X1NU 3L6PA 3D65E 3GDSA 4U2WA 3UUZA 1OS8A 1T8NA 2Z7FE 2BYAX 2V3HH 3MNXA 1ZPZA 2GV6A 3A7TA 4DY7B 1Z8RA 2PKAA 3R0FA 1RIWB 4BAOB 1TNHA 1YCPM 3QGJA 4Y8XA 1OHHD 1OX1A 1MQ5A 1TAWA 3OFND 1CSOE 3RXOA 3PRBA 1Z1IA 1ZHMA 1PQ5A 3BG4C 3TITA 2BDAA 3JZ1B 4H6TA 1F5LA 1RD3B 1IOEA 4O97A 3GISB 4ZAEA 1OP8A 1YLCA 3TU7H 3Q00A 4R8TB 4AB8A 4Y0ZE 3E0NB 3F3BA 2F9UA 2BZ6H 2VWMA 3RMOH 1QL8A 5C1UA 2D8WA 1ETSH 1HIAA 5DG6A 2P8OB 2BMGB 3N99A 3A83A 5T6FA 4RKOB 1C1MA 1TGNA 1T32A 1GCTC 1WTGH 1KTSB 4M9FA 4IS5A
chains in the Genus database with same CATH topology
2BOKA 1AUTC 1ABJH 5DP8A 2QGRA 4WWYA 5E0JA 1IQFA 5GIBA 2SFAA 4CHAC 3M7QA 3H5CB 1C5PA 1ANDA 3AW1A 3TPIZ 2PTCE 2ZF0H 1DFPA 1SR5C 1DSUA 1V2RT 2ZFPH 2WPHS 2ZFQH 4OS2A 4I8JA 3MU1A 4XFQA 5CHAB 1LCYA 1GI2A 2FZZA 1QB1A 1A0JA 1CQQA 1LHEH 4O3UA 3VB3A 5IYTA 2VVUA 2XYAA 4ISLA 3T29A 1ANCA 1BQYA 1KIGH 3PYHA 1F0TA 4TY6A 1BMMH 1MZAA 1FY8E 2F9PA 3KIDU 2QY0B 3E1XB 4CH8B 1W3CA 2ILNA 2VGCC 4YESB 1GMCG 3SUFA 1V2WT 2BHGA 1EKBB 1GGDB 1RTLA 2BD7A 3RXFA 1JRSA 5DP9A 1C4V2 1W0ZU 1UCYE 4WH8A 4MNYA 1HAXB 1KSNA 3QWCH 3U69H 2FODA 4B75A 3SO3A 2OC1A 1FDPA 4LXBH 1GHYH 2J92A 2O8UA 2PTNA 4DIHH 3HK6B 2EA3A 1YPKH 3HK3B 2CMYA 4NGAH 1K1JA 1YCPH 4NWLA 2NU1E 1LHCH 4A7IB 3QN7A 2BVRH 5GCHG 1KDQB 4GHTA 1BOQA 4WH6A 1C1PA 1VJ9U 2ZDLA 3MWIU 3LJOA 1W13U 5AF9H 1AD8H 1WV7H 3NKKA 1K1IA 4CBNA 3T62A 4ASHA 3P70B 3RU4D 1MTSA 1A5IA 4LK4A 1GDNA 3Q3YA 1TGTA 4BTUB 5E2PA 1JWTA 1P2KA 3F68H 1IQMA 2F83A 3A7YA 1HAYB 2GCHG 4IN1A 2GZ7A 3ZZ5A 5A8YA 3A84A 4AGKA 1XVOA 5TCCA 1SQTA 1SBWA 1Y5AT 1V2PT 1GBAA 2ZU1A 4KGAA 3UIRA 1F92A 1HNEE 1YPLH 5C20A 2Z9LA 2G5VA 3BTGE 2Y5GA 4NSVA 3RXDA 4D9QA 4KTCA 2ZPQA 3OSYA 1RTKA 1QBOA 3HGNA 1ZMLA 1AFQC 1MD7A 3GY7A 3BEFB 1ELDE 1LDTT 1P04A 2BXTH 1A2CH 4K2YA 3RXPA 1DX5M 3UOPA 1SFQB 4CRDA 4AZ2B 4FU8A 3ZZ7A 4VGCB 3KL6A 4YLUA 5EQRA 1ZSJA 1UHBA 4MG3A 4ZXXH 3OU0A 5G4BA 4BTIB 4K1TA 1ANBA 3LGVA 4FU9A 1FLEE 1A4WH 3SOSA 1UTLM 1O2HA 3KGPA 3L33A 2PSXA 1UCYH 1O2QA 3SV7A 1QNJA 1OWHA 1SL3A 1G3EA 1XXDA 3A8CA 4WVPE 2FOBA 5DK1A 4OS5A 5A8ZA 2BVXH 1NFXA 4X1PU 1AWHB 3PO1B 5E2OA 1C5LH 4GPGA 3FZZA 1P2MA 3SNDA 2PR3A 1SGYE 1NRPH 1SHYA 1TA2A 1BRBE 3F9HA 4IC6A 1CA0C 4JZDH 1NRRH 3SHCH 1ETRH 2ZQ2A 1V2QT 1IQLA 1GHXH 3QO6A 4U01A 1UTPA 1ACBE 1GHBF 1NRNH 2VH6A 5L6NH 4DOQA 2OCVB 1DWBH 1HV7A 4U30A 5ETXA 2C90B 8GCHG 1EZUC 4Y8ZA 3LGUA 2BY6X 4A1TA 1THRH 1AHTH 1TBZH 1EAXA 2XCNA 3S9AA 3GCTG 2WINI 1O2JA 1Y3VA 1WTHD 4ABBA 2BDHA 1NESE 3BIVH 2R9PA 1GI9B 3DFJA 1GBJA 4ABDA 1JIRA 1EB2A 2PWXA 5F8TA 5DP4A 3E6PH 1FIZA 3SU2A 2D1JA 4JMYA 1ELBA 3F9FA 1YYY1 2IOTA 1BITA 5C1XA 3BTHE 5FX5A 2RA3A 1P11E 1BTHH 1ELGA 8ESTE 1ZLRA 1FN6A 1EZSC 4X2VA 1LHGH 4J1YA 1DANH 3ZVEA 2ZCLP 1TBQH 4GUXA 1BTZA 1ABIH 3QTOH 1SG8B 3BTTE 3PMAB 1EAUA 1L4DA 1DUEA 1ZMNA 1W2KH 1ZZZA 5EXMA 1MU6B 1YBWA 1J15A 1TNIA 2A7JA 2GDDA 3MI4A 4IC5A 3RU4T 1WCZA 3SNCA 2XBVA 1T8OA 2VINA 4F49A 4CRBA 1S5SA 1O39A 4IMZA 4ZKOU 3QUMP 3A8DA 1VITG 2QCYA 2P16A 1BBRK 2BTCE 1HAVA 1RJXB 4J2YB 3BEIB 1ZSLA 1HXEH 2P3FH 3PO1C 2EI8A 1BTPA 1JBUH 3M3VA 1DLEA 1QJ6B 5FBIA 4DG4A 1GMHG 3ESTA 4Z0KA 2YOLA 3BIUH 4I8LA 1Z1JA 1JXPA 1TMBH 4SGAE 1GPZA 1ZRKA 1C2HA 3S7HB 4GAWA 3BTFE 2BD2A 2ASUB 4WMFA 1LHDH 3FP6E 8LPRA 3RXHA 1IHTH 3VB7A 5T3HA 3DT0H 1O3EA 1SGFA 1YPEH 2BVSH 1G3DA 1GI4A 1GBDA 1UO6A 1FPHH 1GI5A 1O3JA 3P95A 3SUDA 2O8TA 4Q80A 1C2FA 1GVKB 2HPPH 4ZKSU 1HFDA 1Z8GA 4X2XA 2CV3A 4K3JA 1K21H 1XVMA 4GCHG 4UONA 5A09A 2W26A 2VVVA 2OQ5A 2Y5HA 5LPFA 1TNJA 2FP7B 3FVFB 1AVWA 3P6ZB 1BMNH 1GBHA 4X0WU 1W14U 2GCTB 1FONA 1GI3A 1EX3A 2BX3A 1HJ9A 2WUCA 1KXDA 5EG4A 1UCYK 4FUIA 2AS9A 2FX4A 5FHTA 1HJAC 6GCHG 3HGPA 1O3OA 3PMJA 1WQSA 1C1UH 3A82A 4CRGA 1LTOA 1ELTA 1B5GH 5IDKA 5ABWA 2FOAA 1UHBB 4DCDA 1LHFH 1J16A 2BDGA 1MUEB 1GCDA 1PQAA 1QHRB 1O34A 1MKWH 1V2NT 3BTWE 1ELVA 2ZGCA 3LC5A 2W7UA 4WJG2 1AVXA 1ZYOA 3C1KA 1C1OA 2ALVA 5DO4H 1Q31A 1O36A 1TRMA 3UPEA 1MKXH 1CBWC 3B9FH 4UFEH 1S6FA 1NN6A 3KQEA 5JB8S 1DVAH 1QA0A 2V6NA 1E35B 2G51A 5B6OA 4XBBA 3PTNA 2AFQB 9ESTA 1FY1A 1P3EA 1SGNE 3URDA 3SHAH 1GG6B 1HXFH 3M3TA 2AEIH 1GBLA 3ZYEA 3SNAA 2GMTC 1AMHA 1UTNA 1BTUA 2D2DA 1TFXA 1W12U 1K1MA 4GVUA 1NROH 3P8OA 1ZTKA 1GJ8B 2FYRA 1QTFA 3GYMA 1O3LA 1GJBB 4CRFA 3T5FH 1ESTA 1CHGA 4JZ1A 1Y3YA 2TGDA 2BLQA 3RXCA 2WYJA 2BZAA 4MPUA 2Y82A 4XE4A 2Z9GA 1RXPA 3TNSA 3ZZ4A 1O2SA 2OBOA 2GT7A 2BQ6B 4Y7BA 1PQ8A 1C2KA 1HGTH 1A5HA 5AVDA 2GZ8A 5EU8A 3PMHB 4M7GA 3ZV8A 2FI5E 3RM0H 2BD8A 3PM3A 1ELEE 2ZU4A 1GHBG 2FESH 4NIVA 3TVJB 4B74A 4JZEH 1XM1A 2ANKH 1C1QA 1EZXC 1GMHF 5EPYA 4MLFB 1HJAB 3U98H 2BD9A 2A4RA 1JMOH 1EUFA 1RIWC 4H42U 1QCPA 1CA8B 2LPRA 3LU9B 4FVBA 1NO9H 1W10U 1MKXK 1DUAA 4D76A 2UUYA 4BOHA 2FEQH 2CHAB 4NG9H 1O5DH 2AMDA 2VIQA 3STIA 1RS0A 5JDUB 5FPYA 1S0QA 1AN1E 1A61H 1TGSZ 1QQUA 1HAZB 1TPAE 1UTMA 1XKBC 2HNTF 1FIWA 1ZPCA 2TRMA 3NUMA 1OKXA 3S7KB 3LH3A 1BUIA 3GY8A 5CE1A 2HALA 2CJIA 2G5NA 1BRCE 4AG1A 2XC0A 3K65B 2XW9A 3MH5A 3LGWA 4YZUA 2STBE 2B0FA 2K1QA 3UWIA 3A7VA 1XUHA 1Z6EA 5ESBA 4NA7A 1ZGVA 1J9CH 1NFUA 3ATIA 4UE7H 2Q6FA 1AU8A 3BN9A 1FN8A 1V2KT 4X6OA 1VGCB 5HMAA 3U8TH 5EGMA 2I6SA 1EOLA 5DJ7A 3ZVGA 1GI7B 1TX7A 1JIMA 4IGDA 1O5BB 3UNQA 1XX9A 2EI6A 4A5TS 2XBWA 1EPTB 1HB0B 1VJAU 3P8GA 4HTCH 1L1JA 1O3BA 5SGAE 1YF4A 3SQEE 5L2ZH 3V0XA 3D49H 2BD5A 1IQJA 3M7UA 1UJ1A 1EJMA 1KXFA 1OPHB 3EA7A 3SUEA 1QFKH 3VB5A 2WPIS 1TQ7B 2NU2E 2UWLA 1BTWA 4Q2KA 1CA0B 2BM2A 4JK5A 4A92A 1GBIA 4OGXA 1V3XA 2SNWA 1N6XA 2P94A 3VXEH 2RCEA 3ZV9A 1SLVB 1AZ8A 2QA9E 3VEQB 3ITIA 5GCHF 1BHXF 4K5ZA 1QBVH 2YNBA 4YOJA 1OWJA 3MMGA 1KXAA 4Q7ZA 1TABE 3UWJH 2BLVA 3K6YA 5FX6A 1C9PA 2SGEE 1SGFG 2O9QA 2V35A 1NFYA 1SI5H 3DHKH 4A6LA 1BCUH 1SMFE 4HI3A 3N7OA 2ZHWH 3MO6A 1K1NA 2ZDKA 1GJCB 3A7XA 1SGTA 3AAVA 2XXLA 3ZVFA 3M5MA 5C5NA 2ZWLH 1GDUA 5EW2H 1N8OC 1A0HB 2XTTB 4GSOA 1O3CA 1K1LA 2ZU3A 2GP9B 1W7GH 1B7XB 1FPCH 2XC5A 4LOYH 1C2LA 1Y5BT 2A0QB 2G81E 1LO6A 2VH0A 1FAKH 1LMWB 1IQKA 4ZH8A 1SHHB 2Z6BD 1P2IA 2PKSB 4Y7AA 1P09A 1O2PA 1RRKA 2G4TA 2HLCA 3QZQA 4E05H 2B7DH 2F3CE 3K6ZA 2G00A 1DE7H 1BMLA 1H1BA 1C5XB 1D4PB 1D3QB 1DITH 1DY8A 1HAHH 3RXBA 1AVGH 1JRTA 2C3SA 4FUHA 3MH4A 4YO9A 2Q6GA 1OWEA 1TBRH 9LPRA 4MPWA 3T27A 1C5RA 5JPMH 4DJZB 2IN2A 2O8MA 4FVDA 1Z8IB 1PPHE 1ZHRA 3RXQA 1DLKB 1O2GH 1MCVA 3SI3H 1GBCA 1ELCA 5EXLA 2EEKA 1UK4A 2Z9KA 1L1GA 4WF8A 3UFAA 1P3CA 2ZTXA 2SGPE 1Z7KA 3UQVA 1O38A 4H6SB 2V3OH 1NU9A 4IW4E 3MFJA 1QQ4A 1WBGB 1LKBA 2BQWB 2FI3E 2ZHQH 1ANEA 3OX7U 1H8DH 2P3UB 2ZFTA 4AFSA 1AB9C 3M61U 1YPHE 2BDBA 2OQUA 1MAYA 3ZZDA 3MU0A 3RU4E 1SLXB 3KQBA 2UUFB 1KDQA 1ZRBA 4GCHF 1BZXE 5CHAC 4CH2B 4DT7B 1EAWA 4X2YA 1O35A 4MNWA 2FYQA 5FPTA 5I25A 1ESBA 1H9IE 1O3IA 1UVUH 2VIWA 3E3TA 2VJ1A 2KAIB 1DT2A 2RDLA 1GBEA 1ID5H 3SU3A 4X1RU 3M36A 1KXEA 1KXCA 4Y10E 2A5KA 1S0RA 2OXSA 4AG2A 4BAHB 3M37A 2QXIA 4ZXYH 3LKWA 3MO3A 2XC4A 2AERH 3SORA 4X6MA 5TJXA 5F8XA 1GBBA 1G3CA 3U9AH 4X8UH 2P59A 3IWMA 3FP8E 3PWCA 1T31A 1K28D 4I7YH 4MTBA 2ZDMA 1YGCH 1ZPBA 3BV9B 1GI1A 1EAIA 2WYGA 3GCTF 4MQAA 3RDZA 2UWPA 3BSQA 2FDAA 4CR9A 3DUXH 1HUTH 3RXJA 1A3EH 1AE8H 2EC9H 1PPGE 2FO9A 3TK6A 1XKAC 2ODYB 1VCPA 3LDXH 2A32A 2ESTE 4ISNA 3BTKE 3PTBA 3SJKA 1D6RA 3UQOA 2HNTC 2ZI2H 1Y8TA 3S69A 1XMNB 2QYIA 1AFEH 3P8NA 4BNRA 2J4IA 5LH8A 2UUKB 3QTVH 2VNTA 4ZROA 2QV1A 2WPMS 2NU3E 2ZO3H 1G37A 4JYUH 4UFGH 5JBTA 2A5IA 1OP0A 2OP9A 3BF6H 2XWAA 4NZQA 4GLYA 2BY5X 1BRUP 2TPIZ 1GBMA 1RFNA 3VB6A 1BMAA 1AY6H 4B76A 4KELA 1SSXA 4FUDA 4E7RG 3EQ0H 4NIXA 1P8VC 1AFQB 1D9IA 4OGYA 1TOCB 2C4FH 1S81A 1TPSA 3OY6U 2BQ7B 1P9UA 1ZMJA 2BY8X 3A81A 3SJ8A 4ISHH 4AX9H 4ESTE 2VWOA 2VIVA 4CREA 4Y76A 2ZNKH 1E38B 2TGPZ 4K8YA 3SGQE 4WXVA 4X2WA 2BXUH 4Y0YE 1GBKA 4AYYB 4NIYA 1BT7A 2F9NA 2ZGHA 3DD2H 1UVTH 4I32A 1BRAA 3SU5A 3VFEA 3LGYA 2DUCA 2EI7A 4ISIH 1LVBA 3MH7A 1TLDA 3RXLA 1GJ4H 4U32A 1XUGA 3IITA 2BY7X 3RXIA 2UWOA 1H9LB 3VGCC 3TJVA 3B8JA 1PPZA 2B8OH 3PB1E 2ZCHP 1OYTH 1AE5A 4E7NA 5JB9S 3V3MA 3V12A 1HDTH 1P03A 3KNXA 4VGCC 5L30H 3BTEE 2OLGA 4ABEA 5LGOA 1SGEE 3RMLH 2ZQ1A 1P0SH 5F8ZA 2BD3A 1C5UA 3EDXB 1A0LA 3GICB 2FM2A 4IMQA 4FUEA 1KLJH 5C1YA 1QRXA 2GKVE 2GX4A 4CBOA 2FOHA 2ZPRA 3RLWH 4Y79A 1Y3XA 2ZGXH 4THNH 2NU0E 2JH5D 1V2ST 2GVFA 2H6MA 2Q1JA 1G2LA 2Z94A 3K2UA 4INKA 3ZVCA 1P2OA 1GWAA 2ZFSA 2ALPA 2BD4A 3M5NA 3SZNA 2WPLS 6GCHF 1HAPH 2JETC 2FMJA 2PFEA 5A8XA 4X6NA 1S82A 1FY3A 3PWBA 2RA0A 3TH3H 2ZHDA 1GI0A 6ESTA 1NY22 4AGJA 5AFYH 1DPOA 1W0YH 2GGVB 1C2IA 1UK3A 1UTKA 1S83A 2AMQA 3RXGA 4H4FA 1YPHC 3SBKA 4YTAA 3JZ2B 3ZZ8A 1TYNA 2DE8A 3MO9A 4D7GA 4XOJA 2WPKS 3SV2H 1C4Y2 4I31A 3D23A 1NFWA 3F6UH 3BTDE 5I46H 1XXFA 3GOVB 1DWCH 5A2MH 4ABFA 2ZA5A