1TX8A

Bovine trypsin complexed with amso
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsinogen
publication title Design, synthesis, and evaluation of oxyanion-hole selective inhibitor substituents for the S1 subsite of factor Xa
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tx8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tx8A02
4UD9H 3U9AH 1K1OA 1AWHB 3RXLA 5E0GA 4NA7A 1AKSA 1HAYB 2HWLB 2Y5GA 4NZLA 1GI4A 3P92A 3UPEA 1MQ5A 1O3EA 1ORFA 1GL0E 1EPTB 2Q1JA 1O2WA 4TY6A 4CREA 4XE4A 1ELAA 1G9IE 4WMDA 3SUGA 3DHKH 1D3DB 4NSVA 1J8AA 1VITH 1YCPK 1GBJA 2UWLA 3W94A 1GJAB 1PPFE 3EE0B 1D3QB 2QA9E 2PR3A 4WXVA 1A3EH 1DANH 4AZ2B 2C90B 3TNTA 3KNXA 1P2JA 3WY8A 4YESB 1SGDE 5FX6A 2Y5FA 4FUEA 1ZRBA 4X2WA 3ZYDA 3PMHB 1ELFA 1O3OA 4FUGA 4ABGA 1H9HE 2PV9B 1TNLA 1G32B 4OS4A 1PQ7A 1UHBB 4K1SA 3GY2A 3TNSA 4FUBA 1UMAH 2V0BA 3PTBA 3P95A 2A7JA 3LGUA 4I7YH 3OSYA 4UFDH 1A1RA 1SGYE 1YGCH 1GMDF 2OC8A 2TPIZ 1TOCB 2WPLS 5DP6A 1TLDA 3PV4A 2R0KA 3PMBB 3ODDA 3A7YA 2AS9A 3M5OA 2J95A 2JH5D 1GBDA 1Q2WA 3ATWA 3UQVA 3SNAA 1MCVA 1TRYA 1HUTH 3QN7A 3E0PB 1EASA 2OCVB 5K7RA 4R8TB 1A46H 1SLVB 2Y81A 1NTPA 1F92A 1QJ6B 2ULLA 2ZGCA 5C20A 3MI4A 4YOIA 4CRGA 2BY7X 2BTCE 1S85A 4OS2A 4X2XA 2ANKH 1NESE 5HYOA 2CGAA 1UVPA 1GBLA 1P01A 3LGIA 2OD3B 1YLCA 4H6TA 4K8YA 3LH1A 1EJMA 2H9TH 1LHDH 2ZP0H 3TPIZ 4IMQA 4ISNA 1DSUA 4YOJA 2VVUA 3ZZCA 1SQOA 2PTNA 2BQWB 4X1RU 4FXGH 1C5UA 1C5SA 1AY6H 2CN0H 4X0WU 4ABEA 5LH8A 1BQYA 1RIWB 2Z3CA 1BBRE 1DLEA 3M5MA 1AIXH 1SGIB 3ATLA 1RIWC 3P8FA 1AB9B 1XVOA 2VJ1A 2VIQA 2XCNA 1ZR0A 4D9QA 1O2XA 5AVDA 1AKSB 1UCYH 1LVOA 2ZHFH 4IW4E 1OX1A 2NU0E 1TGNA 1AB9C 1PPGE 1ZOMA 1TNKA 4NIVA 2FMJA 1UTMA 3SNCA 2OQ5A 5A8XA 1K22H 1ZPCA 1EB1H 2BOHB 3SN8A 1HB0B 5EU8A 1ZGIA 1V2OT 2RDLA 3A89A 3TGIE 1IQGA 2XBWA 2O8TA 1S82A 4KELA 4GLYA 4X2YA 3PLKA 1BTPA 4RN6A 3V0XA 2SNWA 1GBCA 1SI5H 1DOJA 1VGCB 1H8IH 5EQQA 3BSQA 4I8KA 1VCWA 1P11E 1MKXK 5A09A 1T4UH 3E90B 1TBZH 1C2HA 1CHGA 1F0TA 3IITA 3ZZ7A 1GMHF 3FAOA 5JPMH 3RLWH 1YPHC 1LDTT 2FZZA 7GCHF 1V2NT 3UUZA 4Q7XA 1UTOA 4XBDA 4YM9A 1S6HA 3GCTG 3SU5A 1C1SA 3RXCA 2JH6D 1PPHE 2OBOA 2BD2A 3PO1B 3UNRA 1C4V2 1UK4A 4Z6AH 1ZSJA 3MNBA 1K9OE 2W3IA 2EA3A 4ZHAA 1W0YH 2ZCLP 1AE5A 2QIQA 1DSTA 1WQVH 5CE1A 4X8UH 1Y3YA 1ZPBA 4LZ4B 1HYLA 1BTXA 4ZMAH 3M5NA 2BLWA 5A0CA 4BNRA 1ZPZA 1MAYA 1WBGB 1HAGE 2VVCA 1W12U 1O5DH 1C1TA 1MTUA 1BB0B 2H5DA 1BHXB 1SQTA 5FPSA 1U6QA 1MKWH 1GHBF 1O35A 3EA7A 3T25A 1HCGA 5HM9A 3V12A 1HAPH 2GV7A 1SGFG 3DFJA 5GWZA 5F03A 3E91A 2ALPA 5IDKA 2VH0A 1NFXA 2FI3E 3D62A 1YKTA 5A0AE 2Q6FA 3U1JB 3MWIU 3M7UA 1D3PB 3KCGH 4I8HA 1DS2E 4CBOA 1O3GA 2ZHEH 1ARBA 4ZHMU 1RTKA 2G4TA 1YM0A 3TJVA 1IHTH 3LGYA 2ZHDA 2ZQ2A 1ELCA 1K1PA 1SGRE 3U8RH 5C5NA 1UVTH 2UWPA 1SMFE 2A4RA 1O2JA 1ZZZA 4I8JA 3SU3A 2VWNA 2BD5A 3S7HB 2I6SA 5DP9A 2ZFFH 1O34A 1C5RA 2PUQH 3ZVAA 2ZU3A 1FY4A 4UFEH 3MHWU 1KXEA 3A83A 4Y7BA 3H7TA 1DFPA 3R0FA 5JDUB 5EQRA 2ZQ1A 2FPZA 1YCPH 3MNSA 2Z9GA 2J34A 1QB6A 1ZMNA 3ZZDA 4CRDA 3ZZ4A 1NY22 1BOQA 5FBEA 1HJ9A 4AX9H 3KF2A 5AF9H 1C5QA 4AN7A 4ASHA 3A86A 3V7TA 3RXQA 1KLJH 3ZZ9A 3KN2A 1MTVA 3O8DA 2VIDA 3T5FH 3UFAA 2A1DB 1LPGB 5DK1A 2WUBA 1MBMA 1W3CA 1SSXA 3SGQE 1B5GH 2GZ8A 2ZU4A 1UTQA 4ABJA 1K1IA 1O2IA 3PROA 4NA8A 2R9PA 1PQ8A 3V13A 1TA2A 3LGWA 1W7XH 6CHAC 1TX7A 3A80A 2Z6BD 2C8WB 2VB0A 1O3FA 1FUJA 3DUXH 2CF9H 4I8GA 1GI0A 4WY3A 2BXUH 2G5VA 2ODQA 3B9FH 1A0JA 1E0FD 1VCPA 3RXHA 1LVYA 3I77A 3DD2H 1Q3XA 2O8LA 3VXFH 3RU4T 3PWCA 4CR9A 3UNSA 3QK1A 3GDSA 3ATIA 4Y8YA 2PGQB 1J17T 4X6PA 1HRTH 1OOKB 2BDGA 1F5RA 5A8ZA 6ESTA 3M3VA 2OINA 2EI8A 1C1UH 1EKBB 1SPJA 2BDCA 5TCCA 1TRNA 1H8DH 1QURH 2XC4A 4AORA 2ANYA 3RC6A 1QGFA 1NU7B 1EZQA 3HK3B 1BA8B 1FIZA 1O5EH 1GJCB 4X8SH 1IQLA 4BAQB 1GHAF 1C4U2 2QXHA 1E38B 3I78A 5LPFA 2FOHA 1Y5BT 3QGJA 3HATH 1YLDA 5I25A 1QQ4A 3SI3H 1RD3B 2BDYA 3LJOA 1QA0A 1BCUH 1C1VH 2NU2E 2Z7FE 4NIYA 1QCPA 2SGAA 2ZU5A 2BVXH 3HKJB 4J1YA 1O2MA 1TYNA 1O33A 2F83A 2BZ6H 2BD4A 3ZVDA 1LMWB 1CT4E 1WQSA 1ZYOA 2OP9A 2VWMA 1TABE 1GJ7B 4X6OA 4WH8A 2Z3DA 4B73A 1C1WH 1AE8H 1C1PA 1PYTD 1YYY1 2ZKSA 1GBMA 2AMDA 2VH6A 1C2KA 1FMGA 4U30A 1O5CB 3F9EA 3MO9A 2B7DH 1V2WT 2ZFRH 1EXFA 4AB9A 3P6ZB 3H7OA 3T29A 3SJ8A 1P05A 1GMHG 1MKXH 1DWBH 2B9LA 4DURA 2FYRA 1HAZB 2XW9A 1KLIH 1NC6A 1ZLRA 7GCHG 1CQQA 1SGFA 2OLGA 3A82A 3F1SB 4ZROA 1SQAA 1GBEA 3RXDA 4R0IA 2AMPA 1GBKA 3BTDE 5G4BA 3RMOH 4MPWA 1GHWH 1B7XB 1N1LA 3QDZB 1CA0B 4DIHH 2P16A 2ZFTA 1P3CA 2FXRA 1ZHPA 2ZDAH 1BT7A 2IN2A 1DUAA 3QO6A 1SB1H 1SHHB 3K65B 1OS8A 2ZPSA 3DFLA 2AGGX 1C2MA 3LOXA 3PMJA 1O2LA 4D7FA 1FY8E 2BQ7B 1HDTH 1GDUA 4BTIB 2NWNA 1W7GH 3M61U 2FLBH 1IOEA 4AB8A 1BBRK 1EAXA 4JK6A 3SQHE 1YP9A 3QTVH 4ZKNU 1TQ0B 4AFSA 3K6YA 3C1KA 1L1JA 2STBE 4TWWA 3MH5A 1F5LA 1GHBG 1J14A 2ZFPH 1TE0A 4HI3A 3ZVCA 3L6PA 5EG4A 2H9EH 2Z3EA 4FUCA 1S81A 1OWDA 4HGCA 3OY6U 3NKKA 1P8VC 4ZKRU 3TK9A 1IQEA 1NFWA 2AYWA 3RXRA 2AEIH 2ZDMA 3SNDA 2WPHS 2FOFA 1P04A 2P94A 3ZVGA 3EYDA 2O8MA 2SGPE 2BMGB 4XFQA 1EOJA 1O3BA 1E35B 1V2RT 2BB4A 1SHYA 4FUDA 4MNWA 2EC9H 3BTME 2V3HH 2UUJB 1TAWA 1QB9A 2BYAX 2LPRA 3D65E 3SORA 1DLKB 1W0ZU 1S0RA 1Z8RA 3KL6A 3SV8A 1CT2E 1CSOE 1YPHE 3LGTA 4BXWA 2FO9A 4DJZB 1O3KA 2TGDA 2JH0D 4XBBA 1EP6A 1QR3E 4XOJA 4Q2KA 3S9CA 2D8WA 5C5OA 4A1XA 1OWIA 5DP4A 4K3JA 3KQEA 3UREA 4OGXA 1TB6H 5L30H 4BAHB 5JBBS 3ZVBA 1BMNH 1YPJH 1NT1A 1ELTA 1EUFA 2TRMA 3A87A 5AFYH 1C1RA 4BTTB 3RXBA 1THSH 1RJXB 2ZDVH 4YZUA 1GBTA 3MH7A 1ETRH 2QGRA 2WUCA 2ASUB 2PFEA 3RXEA 5J4SA 4U32A 1EQ9A 1L1GA 3FVFB 3RXFA 1GBIA 1FLEE 1TPPA 2ANMH 1Z71A 1GMCF 2F9PA 1HAIH 1QA7A 2FOMB 2Q6GA 4K1EA 4Z0KA 3AASA 2BDIA 1QB1A 1TWXB 2W7SA 2HRVA 2XBXA 2XXLA 2ZGBH 2ZHWH 3UWIA 4AOQA 1V2ST 1RXPA 3VB4A 4UFFH 3F68H 2FS9A 5GXPA 3AAVA 1GI5A 2F9OA 2R2MB 2B5TB 1IHSH 1ESBA 4X2VA 2QCYA 4WVPE 1UVUH 2BLVA 1V2TT 4DOQA 1MZDA 1P57B 4NGAH 5E2OA 2HLCA 1O39A 1KDQA 1EOLA 2QN5T 2ZO3H 3MO3A 1AVWA 3STIA 2A4GA 2VVVA 2PKSB 1B0FA 4ZH8A 1O37A 1DITH 2BX3A 1ZSKA 1SGTA 2WPIS 3TU7H 1Z7KA 1SG8B 1AFQB 1AU8A 1NPMA 1KLTA 1TQ7B 2GTBA 1CT0E 1L2EA 2PKSC 4TY7A 1LVMA 4CBNA 4ISOA 1JIRA 1TPAE 2A4OA 1O2UA 5FPYA 1N8OB 2ZIQH 1AFQC 1C5NH 1OP0A 1QRZA 4ABFA 2FODA 2G81E 1Z1JA 2GT8A 2Y80A 3MH6A 2FTLE 4CRCA 3UR9A 1FY1A 1N8OC 4IN2A 1NROH 1GHAG 2OXSA 3VXEH 4YTAA 3V3MA 1UTLM 5GCHF 3MU4A 3TK5A 3TJUA 1WTGH 1C5WB 1O31A 1QL8A 2D1JA 4QT8C 2O9QA 2FIRH 3SU6A 3D23A 1V2KT 3QTOH 4D9RA 1FN6A 4DVAU 1XKAC 4LXBH 3FFGA 2ZECA 5EW2H 1IQFA 1J16A 1MD8A 1QIXB 5DKMA 3OTJE 5GPIB 3M7TA 5PTPA 1H9LB 1UK2A 1IQHA 1QNJA 1GHYH 3ZVEA 8GCHF 1V2LT 4ZKSU 2Y5HA 1KXDA 3RXKA 4YT6H 3KQCA 2ZF0H 2ZC9H 4DG4A 1OYQA 4AGKA 5DP7A 2QYIA 2BQ6B 1P12E 3OYPA 1KXAA 5EOKA 1GJDB 1O0DH 1BIOA 1GI9B 4DT7B 3SW2B 2XNIA 1DPOA 1SR5C 4VGCB 1DE7H 2VINA 1QY6A 2P3FH 1L0ZA 1NU9A 4A1VA 1NN6A 4Y0ZE 2ZGHA 4IS5A 1GI2A 2GKVE 4VGCC 1BRUP 4H4FA 5GDSH 1GI8B 2ZA5A 1GBHA 1EX3A 1O5BB 3JZ1B 2RG3A 2BVSH 1KDQB 3EQ0H 1P06A 1DWEH 9LPRA 1FAXA 1JXPA 2NU4E 3BIUH 2TGAA 1CGJE 2VGCC 2V3OH 2ZHQH 3VB3A 2A7HA 2BLOA 2ODYB 5T6GA 4JK5A 1IQNA 1B0EA 4A5TS 1MH0A 3RP2A 5AHGH 1A5IA 1CVWH 1O3AA 5TCAA 1FPCH 1PFXC 3GY5A 1BBRH 1MTSA 1SGEE 1JBUH 5J4QA 1PQAA 1LTOA 2WPKS 3NPSA 2CHAB 3TGKE 2SNVA 1UTPA 2H2ZA 4TWYA 4ZHLU 1C5LH 2C8XB 4B2BA 3S69A 2CHAC 3TH3H 2STAE 1IQKA 3K2UA 1QL9A 1J9CH 4BXSA 4Y7AA 1PPCE 5FHTA 1SGNE 4YLQH 3URCA 4D7GA 3EGKH 5FPTA 2I6QA 1FI8A 5DP5A 3S7KB 3SJOA 3RXSA 4K8BA 2PHBA 2QY0B 4OS5A 2IOTA 1A0LA 3C27B 1SGCA 2HNTF 3M5LA 1C5ZB 3Q76A 1W13U 1FDPA 4UFGH 3VB6A 3F9HA 2BXTH 5H4IB 5HMAA 1TGBA 1V2PT 1KTSB 2C4FH 3UIRA 4ESTE 1AVXA 1O3NA 1T31A 1VITF 2HNTC 1V2MT 5B6OA 3Q3XA 1YPKH 2HOBA 4INLA 1BTYA 1AQ7A 1O2HA 1Y3XA 4X1QU 3A8CA 1MAXA 3FZDA 3T26A 4D8NA 3SQEE 1ZTLA 4NIXA 3IWMA 1YBWA 2SFAA 2XWBI 4Q80A 4BAKB 3OY5U 1TIOA 1O3CA 3ZV8A 1QFKH 1L4ZA 2PGBB 1Z8IB 2G5NA 1MQ6A 3OX7U 1P2IA 3F9GA 2ZGXH 3VFEA 4E7RG 1QBNA 3T27A 5DG6A 1GMCG 4CH8B 4MTBA 5AFZH 4UONA 2DE9A 4BOHA 4WF8A 1BMAA 1WSSH 1P9UA 1X7AC 1YCPM 1RS0A 1ELBA 1A5HA 4Y11E 5T6DA 4I33A 2D2DA 1EAIA 1C5OH 3PYHA 2ZU1A 4HZHA 1XUFA 3OU0A 3QLPH 2BM2A 1Z8GA 4JZIA 2AGEX 1YC0A 1DUEA 5E0HA 1OWHA 2IJOB 1VJAU 1NS3A 1W14U 5HM2A 5C67A 2GDDA 2RA3A 2Y6TA 5DJ7A 1XUIA 2PWXA 3TITA 1S5SA 1CO7E 3BTTE 3GY3A 2W5EA 1SLUB 4GSOA 1GL1A 1OP2A 4DW2U 4WMEA 3UOUA 2CMYA 4RSPA 3ZZ8A 2A45B 1GVLA 1K21H 1AUJA 1DXWA 4I31A 1Z1IA 2BX4A 4KTCA 3GY6A 1Z6EA 3GICB 4GHQA 3QWCH 1AN1E 1GHVH 1BRBE 1INCA 2J9NA 1T7CA 1H1BA 2Y7ZA 1K1JA 4JZ1A 7KMEH 2PTCE 1LQDB 1C1QA 3QX5H 1DICA 3ZVFA 1XKBC 4OS1A 4RKJB 2WV4A 2ALVA 4NCYA 1HGTH 1C2JA 5GCHG 1DM4B 6CHAB 1G3EA 3K9XB 3EA9A 2H9HA 5F6MA 2DUCA 1OWKA 2YNBA 2FOGA 2R2WU 1F5KU 2QXJA 2GCHF 1S84A 4Y10E 3TVJB 2D26C 3HKIB 3MU5A 1O3LA 1PYTC 3RXAA 1C1MA 1C1NA 2CF8H 3P8OA 5HXFA 1C1OA 1MZAA 3LKWA 2A32A 4BTUB 3VB7A 3LPRA 1J15A 2NU1E 3ODFA 4MPUA 3U98H 3EA8A 3ESTA 1Z8JB 1LHCH 4JYVH 3TH2H 1DDJA 1FXYA 1GBFA 4AFZA 8GCHG 3ITIA 3P8NA 3TJOA 2ZPQA 2UUYA 2EI7A 1ANDA 2B0FA 4ISLA 1WU1A 3SO3A 3PLBA 1WCZA 3KIDU 3UOPA 2A5KA 1NRPH 2FOEA 5FX5A 1NRNH 3P70B 4DGJA 3P17H 1AFEH 3VB5A 1DX5M 1MU8B 1WAYB 3SHCH 3ATMA 1LVBA 1RGQA 2P3TB 1DWDH 1AHTH 1BTUA 2A4QA 2ILNA 1O32A 6GCHG 2Z94A 8ESTE 3RXOA 2R3UA 2ESTE 2RA0A 1P9SA 3CS0A 4M7GA 3TJNA 3VPKA 3LJJA 4UE7H 1TGTA 4FVBA 1JOUB 2BY6X 2QC2A 1K1LA 1SGQE 4JZFH 5ETXA 4B75A 1MTWA 1FPHH 1HAXB 1FY5A 1AD8H 1TMUH 2HGTH 3SUFA 4A92A 1SGPE 3A81A 3MTYA 3KGPA 1UTKA 5JBCS 2FI5E 4KGAA 2R0LA 1GJ6A 2BZAA 1BZXE 1SOZA 2GMTC 3KEEA 4A1TA 1LKAA 3E1XB 4FUHA 1JIMA 1TBRH 1UVSH 2FX4A 4ZXYH 1ZTJA 2V6NA 5DP3A 1HXEH 1K2I1 3SV9A 2BY5X 2KAIA 1A3BH 2FS8A 3LC5A 5L2ZH 5CMXH 1GHZA 1O2RA 1ZTKA 1C2EA 2H5CA 1VJ9U 1ARCA 1BMMH 1EAWA 2XBYA 4NA9H 3RXIA 1XVMA 4CRFA 4BAMB 3LONA 1GI3A 1DY9A 1KIGH 1QRXA 3GCOA 2EEKA 3RDZA 1D6WA 1KXCA 3RXUA 2C8ZB 1XX9A 4MG3A 1ABJH 1YPEH 5JYIA 1S83A 1XUKA 4JMYA 3SGBE 5JB9S 1EZSC 4ABAA 2WPMS 4E05H 1V2QT 1TNIA 3BG8A 1UCYK 2BOKA 1O38A 3URDA 3BG4B 1AMHA 3ZYEA 4O9VA 4NSYA 4PROA 1VITG 2AMQA 4AYYB 1TFXA 1KXBA 4FUJA 2A5IA 5ESBA 1GJ5H 2PKAA 3A7VA 1GCTB 1GVZA 3NUMA 4Q7YA 1MUEB 3BG4C 4NWLA 1OXGA 3QGNB 1JRTA 5LPRA 1F2SE 5EODA 2AGIX 1GCTC 2JETB 1BDAA 4Y71A 3AAUA 3SV7A 3DT0H 1WTHD 2PLXA 2H6MA 3GYLB 3BEFB 4B76A 4I32A 1ESAA 1EPTA 2JETC 4CRBA 1EB2A 1ZMJA 2FOBA 4XBCA 3K6ZA 4ABIA 1KYNA 2ZDLA 4WH6A 3A7ZA 2TIOA 2A5AA 2GGVB 1TNJA 2ZWLH 4Y8ZA 1W10U 3FANA 2ZG0H 3SUDA 3DA9B 4O3UA 1O3DA 3MOCA 5ABWA 4IC6A 1IAUA 2FWWA 4X8VH 1EATA 1MCTA 1SC8U 1FIWA 3RC4A 4CH2B 4B2CA 2SGEE 1IQIA 2HPPH 1TALA 1AO5A 4X6MA 3A85A 4TPIZ 3M36A 2FTMA 1WV7H 1O5FH 2VIWA 3FZZA 1G37A 1P03A 3SOSA 1BRAA 2VWLA 3A7WA 4SGBE 3STJA 1LO6A 1QTFA 2J4IA 2XCFA 2P95A 2CJIA 1EAUA 1TPSA 4FU7A 1XUHA 2BLQA 1ID5H 1RTLA 2KAIB 3LH3A 5EXNA 2OC1A 3F9FA 1FONA 1PJPA 4FU8A 4MNVA 1D9IA 2ZDKA 1N6XA 1BTZA 2BD7A 3S0NA 1NO9H 1D4PB 2CXVA 1XUGA 1V2JT 3EAJA 1ELGA 2ZDNA 1BTWA 2GV6A 3A84A 3HGNA 2SGQE 4U01A 4O3TA 1HXFH 4K60A 3O8BA 4JYTA 2OTVA 3TIUA 3T62A 1T8LA 1C2DA 2OC7A 1YF4A 3UWJH 3NK8A 1HV7A 5TJXA 1EZXC 1F0RA 3O8CA 3AW0A 4K69A 2GCHG 4K5ZA 3LGVA 2GX4A 2PW8H 2PKAB 1GCDA 4F4OC 3NZIA 3FP7E 3RXJA 2XTTB 2ZI2H 3RXVA 4ABDA 1GJ8B 2A31A 5FBIA 2UUKB 4LOYH 7LPRA 2ODPA 3Q00A 5JBAS 2G55A 1CE5A 1P2OA 3RXPA 1A4WH 1Y3WA 1HBTH 5I46H 5BRRE 1MU6B 3PLPA 3SU4A 2BY9X 4GPGA 1EJNA 5FXLA 3VEQB 1JRSA 2XWAA 1YPGH 2P93A 1D6RA 2O8WA 2FOCA 1UO6A 4H42U 3PMAB 1M9UA 3E16B 1Z6JH 1DXPA 1GJ4H 3U8TH 1EPTC 1SLXB 1O2NA 3PWBA 2A0QB 2O8UA 2BDHA 4TPYA 1HLTH 1F0SA 1P3EA 3G01A 2M5TA 1BITA 3MU1A 1DWCH 3R3GB 1NM6A 4KTSA 2FEQH 2PSXA 1T8OA 4GVUA 4WWYA 1HJAB 1D3TB 3LT3A 4IMZA 4X1SU 2GDEH 2PSYA 4JZDH 1UTJA 1L1NA 1WUNH 4Y0YE 1IQJA 2OC0A 2VIPA 1HJAC 3NXPA 4IGDA 3UR6A 2Z9LA 1BMLA 3BEIB 3RXTA 2QAAA 3D49H 2QF0A 6LPRA 3IG6B 2PUXB 2G00A 1CA8B 2BDBA 4B71A 2F9NA 2J2UA 1FJSA 3BTFE 1TNGA 4OS6A 4X8TH 4SGAE 1OPHB 3S9AA 2WYJA 1TRMA 1UCYE 1GGDB 2VWOA 4ZAEA 3BEUA 4Y79A 1H9IE 5DP8A 2ZZUH 1GI1A 1ANBA 1GGDC 1KY9A 2LNCA 6GCHF 3A8DA 3A8BA 2ZU2A 2SGDE 4HTCH 1P02A 1BJVA 1QL7A 3PTNA 3ZZ3A 1LHFH 3M3TA 4FUFA 5C1UA 2A2QH 2UUFB 3RM2H 1TX8A 2VGCB 1O2GH 1HAOH 3M7QA 4FVDA 1K1NA 1TX6A 1S6FA 4MLFB 5DPAA 3QZQA 3E3TA 5FCRA 1G2MA 3LC3A 2GZ9A 2FP7B 1G30B 2ZFSA 4O97A 7ESTE 1LQEA 3SZNA 3MMGA 1WOFA 1ETSH 2G8TA 2GZ7A 3UY9A 1O3JA 3VGCB 1JWTA 3RMMH 3BTEE 5C1XA 5FCKA 3BTWE 1CHOF 1FQ3A 3H5CB 1MTNB 3Q3KA 3BIVH 1DY8A 1N6YA 3PM3A 3VGCC 1O2PA 3MYWA 2ZTZA 3LDXH 2OQUA 4IN1A 5T3HA 3BN9A 1FV9A 1CGHA 3Q77A 4MNYA 1O2YA 3T2NA 1T8NA 1QBVH 1MTNC 4XSKU 2V35A 5F8ZA 3E0NB 3E8LA 3MNXA 3SJIA 3CP7A 1GG6B 3GY8A 3A7TA 2FX6A 1VGCC 1TBQH 2NU3E 3T28A 1NFUA 1O2OA 2AIQA 1F7ZA 3GCHB 3RLYH 3ZZ5A 8LPRA 1GG6C 5C1YA 1O3HA 4E7NA 2WPJS 4BANB 2ZTYA 2THFB 1G3BA 3GCHC 1KTTB 1PPEE 3SHAH 5F8XA 3TH4H 5EPYA 4YOGA 5C3NA 4AFQA 5A0BA 5GJ4B 3N7OA 4WJG2 3MO6A 5LGOA 4A7IB 3PO1C 3AW1A 3MH4A 2ZEBA 3U8OH 1A0HB 2F9UA 1HAHH 1GJBB 4INHA 3BTKE 5DGJA 5E2PA 3SI4H 3SU0A 2FYQA 1VZQH 4O03A 4MVNA 1SFQB 2QXIA 5EXLA 2GP9B 4A6LA 1ESTA 4THNH 1ANEA 1QJ7B 3RU4E 1GBBA 1WYKA 1C5TA 1LPKB 1HJ8A 5GIBA 1MD7A 1UK3A 1BHXF 1T32A 3A88A 1O3PB 1ZSLA 3GYMA 1NRSH 5EGMA 1XMNB 4B2AA 2Z9JA 4DY7B 1TGCA 3CS7A 3AVZA 1HAVA 3SJKA 1O2QA 1XXDA 3HPTB 2HVXA 1E37B 2P59A 3SV2H 1O2SA 2GD4B 1P0SH 1VR1H 3RUOA 2F9BH 1Q31A 3RXGA 1C5VA 1LPZB 1QHRB 1ELDE 1O2TA 1P2NA 1SLWB 4Q7ZA 3TGJE 1C5YB 1C2GA 1P10A 3RXMA 1ACBE 2XC5A 1DT2A 2EI6A 5DO4H 3A8AA 4CRAA 1P2KA 1SBWA 1XUJA 2P8OB 1P2MA 4RKOB 5C2ZA 2BY8X 4U2WA 2Z9IA 1BUIA 1SVPA 2FOAA 1NZQH 2J38A 3FP6E 1YPMH 2P8OC 1ZRKA 4LZ1H 4NIWA 1Y3VA 2VU8E 1THPB 3PB1E 4NFEA 3RM0H 1G3CA 4WMFA 2TBSA 1A2CH 4ISHH 1FNIA 3L33A 4ISIH 1GBAA 3GDUA 4Y8XA 1BTHH 3F6UH 3FP8E 3ZZAA 4ZKOU 1ELVA 1GI7B 4IBLH 1TNHA 1KXFA 2W7UA 1V2UT 1E36B 4K2YA 1E34B 3M37A 4XDEA 3L3TA 4GCHF 1O2VA 1O2KA 4GHTA 5A2MH 3SV6A 1YPLH 2G4UA 3BTQE 4KP0A 5BPEA 3GISB 3GOVB 4WXIA 1HIAA 4OGYA 2C93B 3SBKA 2HALA 4JYUH 1OWEA 2C8YB 1K1MA 2VIVA 2DE8A 9ESTA 2AIPA 1S0QA 1C2LA 1O30A 1GMDG 1V2VT 1HNEE 2G52A 1W8BH 5JB8S 4NG9H 2JKHA 8KME2 1TPOA 1ZJKA 4GUXA 1XM1A 4CHAB 1QJ1B 2GT7A 5CHAB 1OSSA 1QQUA 3MU8A 3RMNH 3HGPA 1AGJA 3W95A 4JCNA 3QUMP 4D76A 4CHAC 1LCYA 5CHAC 5HGGA 5L2YH 4I8LA 2FESH 1OYTH 3JZ2B 1EJAA 3I29A 3GY4A 1EZUC 1HAVB 2CV3A 1PPBH 1TONA 1RTFB 1GI6A 2FDAA 5EXMA 3ZZ6A 2WV5A 2F3CE 3ZV9A 1Y59T 2W3KA 1C4Y2 3M3SA 1G3DA 1RFNA 1C2IA 1AI8H 1RRKA 1EP5A 1V6DA 4HFPB 1QRWA 1AVGH 2A2XH 4OS7A 2H1UA 3EDXB 4YT7H 3SNEA 1C9PA 2P3UB 1DVAH 1JMOH 2BD8A 5JBTA 2BHGA 3M35A 1ZHRA 3UTUH 1ZJDA 3U69H 1LKBA 1AZ8A 1CBWB 3BV9B 2QF3A 3LU9B 2AFQB 1GWAA 1O2ZA 2GMTB 1P2QA 1SFIA 2FM2A 1O5GH 4UEHH 1C5XB 1CBWC 5EQSA 4UDWH 4IC5A 4ZUHA 4KTUA 4MNXA 1A7SA 1O36A 1L4DA 3RMLH 1CU1A 5EPNA 3ATKA 5F8TA 1LHEH 4X6NA 1CHOG 1TGSZ 1CGIE 1OKXA 4CR5A 1PPZA 2ZPRA 2AERH 1ZHMA 1SOTA 3UQOA 3TK6A 4H6SB 1OP8A 4BAOB 3S9BA 2BVRH 2C3SA 4X1NU 1HFDA 2AH4X 3GCNA 2GCTB 1Y3UA 3U1IB 1T8MA 4MQAA 1BRCE 1HIAB 1F0UA 4J2YB 1BJUA 2B8OH 3KQBA 5ESTE 1UJ1A 2GCTC 4F49A 1MBQA 2F91A 2ZGJA 5A8YA 1ZGVA 3SU1A 1P09A 2F9VA 1TMBH 2VIOA 2UWOA 3SJ9A 1O3IA 3LIWA 1V3XA 2IPHA 1G36A 2G51A 4AYVB 1ABIH 3GDVA 3SU2A 5L6NH 1XXFA 2BDAA 1GVKB 3A7XA 2HPQH 1CA0C 1Y5AT 1W11U 3KHVA 1KSNA 4GAWA 1GDNA 1FN8A 1K28D 2ZCKP 4Y76A 3ENSB 1W2KH 2Y82A 3P8GA 4AFUA 4ABBA 1AZZA 1ANCA 1VCQA 1HPGA 2J92A 1A61H 4DIIH 1C2FA 1GHXH 5E0JA 4DCDA 5FAHA 2ZTXA 2OBQA 4ABHA 1TMTH 1O5AB 4MPVA 2FLRH 3KQDA 4ZXXH 2QXGA 1NFYA 4Y6DA 1UVOA 3BF6H 1UTNA 3CENA 5E8EH 2R3YA 4AG1A 1NRRH 2Q6DA 1ETTH 3GCTF 1AWFH 3MNCA 3NCLA 2WYGA 3O8RA 1SL3A 1A5GH 5IYTA 2WINI 2YOLA 4TYDA 3TLOA 4B1TA 1T4VH 1IQMA 3B8JA 3MU0A 2ZFQH 3SGAE 1LHGH 4NWKA 1C5MD 4MDSA 1UHBA 1Y8TA 2OUAA 4INKA 4AG2A 1MMJN 2K1QA 4X1PU 3HK6B 2XC0A 5T6FA 5LPEA 2ZNKH 3QZRA 1GPZA 2Z9KA 4YLUA 2ANWA 1AUTC 4YO9A 2QV1A 4LK4A 4E06H 1O3MA 1ZMLA 2SGFE 2TGPZ 3RU4D 3RC5A 3MFJA 1OWJA 2XRCA 2BD3A 4AGJA 3ELAH 1PQ5A 4MPXA 4NFFA 1MKWK 2XBVA 3SUEA 4FUIA 2Y7XA 2A7CA 3GY7A 4JZEH 2HNTE 2TGTA 4KKDA 1THRH 3BTGE 1C9TA 1H4WA 5K0HA 1GJ9B 1FY3A 2VNTA 3BTHE 1C5PA 4K1TA 3SNBA 3E6PH 3ZZBA 4GCHG 1G2LA 1TA6A 3Q3YA 1TOMH 2FI4E 4FU9A 1NRQH 2XYAA 1GDQA 2YNAA 2RCEA 1ELEE 2J94A 1QBOA 4B74A 4NZQA 3B23B 2ZCHP 1FZZA 1Y5UT 5SGAE 5EW1H 1FAKH 2GVFA 3NWUA 2BD9A 3UNQA 2W26A
chains in the Genus database with same CATH superfamily
4UD9H 3U9AH 1K1OA 1AWHB 3RXLA 5E0GA 4NA7A 1AKSA 1HAYB 2HWLB 2Y5GA 4NZLA 1GI4A 3P92A 3UPEA 1MQ5A 1O3EA 1ORFA 1GL0E 1EPTB 2Q1JA 1O2WA 4TY6A 4CREA 4XE4A 1ELAA 1G9IE 4WMDA 3SUGA 3DHKH 1D3DB 4NSVA 1J8AA 1VITH 1YCPK 1GBJA 2UWLA 3W94A 1GJAB 1PPFE 3EE0B 1D3QB 2QA9E 2PR3A 4WXVA 1A3EH 1DANH 4AZ2B 2C90B 3TNTA 3KNXA 4P02A 1P2JA 3WY8A 4YESB 1SGDE 5FX6A 2Y5FA 4FUEA 1ZRBA 4X2WA 3ZYDA 3PMHB 1ELFA 1O3OA 4FUGA 4ABGA 1H9HE 2PV9B 1TNLA 1G32B 2LELA 1PQ7A 1UHBB 4K1SA 4OS4A 1SKYE 3GY2A 3TNSA 4FUBA 1UMAH 2V0BA 3PTBA 3P95A 2A7JA 3LGUA 4I7YH 3OSYA 4UFDH 1A1RA 1SGYE 1YGCH 1GMDF 2OC8A 2TPIZ 3CNRA 1TOCB 3H09A 2WPLS 5DP6A 1TLDA 3PV4A 2R0KA 3PMBB 3ODDA 3A7YA 2AS9A 3M5OA 2J95A 2JH5D 1GBDA 1Q2WA 3ATWA 3UQVA 3SNAA 1MCVA 1TRYA 3F3BA 1HUTH 3QN7A 3E0PB 1EASA 2OCVB 5K7RA 4R8TB 1A46H 1SLVB 2Y81A 1NTPA 1H8HD 5HKKD 1F92A 3F0OA 1QJ6B 2ULLA 2ZGCA 5C20A 2JJ1D 3MI4A 4YOIA 4CRGA 2BY7X 2QF4A 2BTCE 1S85A 4OS2A 4X2XA 2ANKH 2K0QA 1NESE 5HYOA 2CGAA 1UVPA 2YMSB 1GBLA 1P01A 3LGIA 2OD3B 1YLCA 4H6TA 4K8YA 2EQNA 1EJMA 3LH1A 2H9TH 1LHDH 2ZP0H 3TPIZ 4IMQA 4ISNA 1DSUA 4YOJA 2VVUA 1E1QD 3ZZCA 3DSPA 1SQOA 5KECA 2PTNA 2BQWB 4X1RU 4FXGH 1C5UA 1C5SA 1AY6H 2CN0H 4X0WU 4ABEA 5LH8A 1BQYA 1RIWB 2Z3CA 2KCYA 1BBRE 1DLEA 3M5MA 1AIXH 1SGIB 3ATLA 1RIWC 3P8FA 1AB9B 1XVOA 2VJ1A 2VIQA 2XCNA 1ZR0A 4D9QA 1O2XA 5AVDA 1AKSB 1UCYH 1LVOA 2ZHFH 4IW4E 1OX1A 1TGNA 2NU0E 1AB9C 1PPGE 1ZOMA 1TNKA 4NIVA 2FMJA 1UTMA 3SNCA 2OQ5A 5A8XA 1K22H 1ZPCA 1EB1H 2BOHB 3SN8A 1HB0B 5EU8A 1ZGIA 1V2OT 2RDLA 3A89A 3TGIE 1IQGA 2XBWA 2O8TA 1S82A 4KELA 4GLYA 4X2YA 3PLKA 1BTPA 4RN6A 3V0XA 2SNWA 1GBCA 1SI5H 1DOJA 1VGCB 1H8IH 5EQQA 3BSQA 4I8KA 2KM0A 1VCWA 1P11E 4ACBA 1MKXK 2IJD1 5A09A 1T4UH 3E90B 1TBZH 1C2HA 1CHGA 1F0TA 3IITA 3ZZ7A 1GMHF 3FAOA 5JPMH 3RLWH 1YPHC 1LDTT 2FZZA 7GCHF 1V2NT 3UUZA 4Q7XA 1UTOA 4XBDA 4YM9A 1S6HA 3GCTG 3SU5A 1C1SA 3RXCA 2JH6D 1PPHE 2OBOA 2BD2A 3PO1B 3UNRA 1C4V2 3SYJA 1UK4A 4Z6AH 1ZSJA 3MNBA 1K9OE 1NBMD 2W3IA 2EA3A 4ZHAA 2JDID 1W0YH 2ZCLP 1AE5A 2QIQA 1DSTA 1WQVH 5CE1A 4X8UH 1Y3YA 1ZPBA 4LZ4B 1HYLA 1BTXA 4ZMAH 3M5NA 2BLWA 5A0CA 4BNRA 1ZPZA 2WV9A 1MAYA 1WBGB 1HAGE 2VVCA 1W12U 1O5DH 1C1TA 1MTUA 1BB0B 2H5DA 1BHXB 1SQTA 5FPSA 1U6QA 1MKWH 1GHBF 1O35A 2J97A 3EA7A 3T25A 1HCGA 5HM9A 3V12A 1HAPH 2GV7A 1SGFG 3DFJA 5GWZA 5F03A 3E91A 3WW7A 2ALPA 2V7QD 5IDKA 2VH0A 1NFXA 2FI3E 3D62A 1YKTA 5A0AE 2Q6FA 3U1JB 2KCOA 3MWIU 3M7UA 1D3PB 3KCGH 4I8HA 1DS2E 4CBOA 1O3GA 2ZHEH 1ARBA 4ZHMU 1RTKA 2G4TA 1YM0A 3TJVA 1IHTH 3LGYA 3PRDA 2ZHDA 2ZQ2A 1ELCA 1K1PA 1SGRE 3U8RH 2RFKC 5C5NA 1WDIA 1UVTH 2UWPA 1SMFE 2A4RA 1O2JA 1ZZZA 4I8JA 3SU3A 4DT4A 2VWNA 2BD5A 3S7HB 2I6SA 5DP9A 2ZFFH 1O34A 1C5RA 2PUQH 3ZVAA 2ZU3A 1FY4A 4UFEH 3MHWU 1KXEA 3A83A 4Y7BA 3H7TA 1DFPA 3R0FA 5JDUB 5EQRA 2ZQ1A 2FPZA 1YCPH 3MNSA 2Z9GA 2J34A 1QB6A 2KR7A 1ZMNA 3OTPA 3ZZDA 4CRDA 3ZZ4A 1NY22 1YWUA 1BOQA 3AK5A 5FBEA 5C94A 1HJ9A 4AX9H 3KF2A 3PV2A 5AF9H 1C5QA 4AN7A 4ASHA 3A86A 3V7TA 3RXQA 1KLJH 3ZZ9A 5EIYA 3KN2A 1MTVA 3O8DA 2VIDA 3T5FH 3UFAA 2A1DB 1LPGB 5DK1A 2WUBA 1MBMA 1W3CA 1SSXA 3SGQE 1B5GH 2GZ8A 2ZU4A 1UTQA 4ABJA 3WWFA 1K1IA 1O2IA 3PROA 4NA8A 2R9PA 1PQ8A 3V13A 1TA2A 3LGWA 1E79D 1W7XH 6CHAC 1TX7A 3A80A 2Z6BD 2C8WB 2VB0A 1O3FA 1FUJA 3DUXH 2CF9H 4I8GA 1GI0A 4WY3A 2BXUH 2G5VA 2ODQA 3B9FH 1A0JA 1E0FD 1VCPA 3RXHA 1LVYA 3I77A 3DD2H 1Q3XA 2O8LA 3VXFH 3RU4T 3PWCA 4CR9A 3UNSA 3QK1A 3GDSA 3ATIA 4Y8YA 2PGQB 1J17T 4X6PA 3ZIAD 1HRTH 1OOKB 2BDGA 1F5RA 5A8ZA 6ESTA 3M3VA 2EI8A 2OINA 1C1UH 1EKBB 1SPJA 2BDCA 5TCCA 1TRNA 1H8DH 1QURH 2XC4A 4AORA 2ANYA 3RC6A 1QGFA 1NU7B 1EZQA 3HK3B 1BA8B 3VG8A 1FIZA 1O5EH 2F43B 1GJCB 4X8SH 1IQLA 4BAQB 1GHAF 1C4U2 2QXHA 1E38B 3I78A 5LPFA 2FOHA 1Y5BT 3QGJA 4F55A 3HATH 1YLDA 5I25A 1QQ4A 3SI3H 1RD3B 4FOUC 2BDYA 3LJOA 1QA0A 1BCUH 1C1VH 2NU2E 2Z7FE 4NIYA 1QCPA 2SGAA 2ZU5A 2BVXH 3HKJB 4J1YA 1O2MA 1TYNA 1O33A 2F83A 2BZ6H 2BD4A 3ZVDA 1LMWB 1CT4E 1EFRD 1WQSA 1ZYOA 2OP9A 2VWMA 1TABE 1GJ7B 2EY4C 4X6OA 4WH8A 2Z3DA 4B73A 1C1WH 1AE8H 1C1PA 1PYTD 1YYY1 2ZKSA 1GBMA 2AMDA 2VH6A 1C2KA 1FMGA 4U30A 1O5CB 3F9EA 3MO9A 2B7DH 1V2WT 2ZFRH 1EXFA 4AB9A 3P6ZB 3H7OA 3T29A 3SJ8A 1P05A 1GMHG 1MKXH 1DWBH 2B9LA 4DURA 2FYRA 1HAZB 2XW9A 1KLIH 1NC6A 1ZLRA 7GCHG 1CQQA 1SGFA 3KYGA 4B6EA 3N7DA 2OLGA 3A82A 3F1SB 4ZROA 1SQAA 1GBEA 3RXDA 4R0IA 2AMPA 1GBKA 3BTDE 5G4BA 3RMOH 4MPWA 1GHWH 1B7XB 1N1LA 3QDZB 1CA0B 4DIHH 2P16A 2ZFTA 1P3CA 2FXRA 1ZHPA 2ZDAH 1BT7A 2IN2A 1DUAA 3QO6A 1SB1H 1SHHB 2WPDD 3K65B 1OS8A 2ZPSA 3DFLA 2AGGX 1C2MA 3LOXA 3PMJA 1O2LA 4D7FA 1FY8E 2BQ7B 1HDTH 1GDUA 4BTIB 2NWNA 1W7GH 3M61U 2FLBH 1IOEA 4AB8A 1BBRK 1EAXA 4JK6A 3SQHE 1YP9A 3QTVH 4ZKNU 1TQ0B 4AFSA 3K6YA 3C1KA 3DSOA 1L1JA 2STBE 4TWWA 3MH5A 1F5LA 1GHBG 1J14A 2ZFPH 1TE0A 4HI3A 3ZVCA 3L6PA 5EG4A 1MABB 2H9EH 2Z3EA 4FUCA 1S81A 1OWDA 4HGCA 3OY6U 3NKKA 1P8VC 4ZKRU 3TK9A 1IQEA 1NFWA 2AYWA 3RXRA 2AEIH 2ZDMA 3SNDA 2KFWA 2WPHS 2FOFA 1P04A 2P94A 3ZVGA 3EYDA 2O8MA 2SGPE 2BMGB 4XFQA 1EOJA 1O3BA 1E35B 1V2RT 2BB4A 1SHYA 4FUDA 4MNWA 2EC9H 3BTME 2V3HH 2UUJB 1TAWA 1QB9A 2BYAX 2LPRA 3D65E 3SORA 1DLKB 1W0ZU 1S0RA 1Z8RA 3KL6A 3SV8A 1CT2E 1CSOE 1YPHE 3LGTA 1SQRA 2FO9A 4BXWA 4DJZB 1O3KA 2TGDA 2JH0D 4XBBA 1EP6A 1QR3E 4XOJA 4Q2KA 3S9CA 1KMHB 2D8WA 5C5OA 4A1XA 1OWIA 5DP4A 4K3JA 5CHBA 3KQEA 3UREA 4OGXA 1TB6H 5L30H 2AHME 4BAHB 5JBBS 3ZVBA 1BMNH 1YPJH 1NT1A 1ELTA 1EUFA 2TRMA 3A87A 5AFYH 1C1RA 4BTTB 3RXBA 1THSH 1RJXB 2ZDVH 4YZUA 1GBTA 3MH7A 1ETRH 2QGRA 2WUCA 2ASUB 2PFEA 3RXEA 5J4SA 4U32A 1EQ9A 1L1GA 3FVFB 3RXFA 1GBIA 1FLEE 1TPPA 2ANMH 1Z71A 1GMCF 2F9PA 1HAIH 1QA7A 2FOMB 2Q6GA 4K1EA 4Z0KA 3AASA 2BDIA 1QB1A 1TWXB 2W7SA 2HRVA 2XBXA 2XXLA 2ZGBH 2ZHWH 3UWIA 4AOQA 1V2ST 1OHHD 1RXPA 3VB4A 4UFFH 3F68H 2FS9A 5GXPA 3AAVA 1GI5A 2F9OA 4OM9A 2R2MB 2B5TB 1IHSH 1ESBA 4X2VA 5B6LA 2QCYA 4WVPE 1UVUH 2BLVA 1V2TT 4DOQA 1MZDA 1P57B 4NGAH 4RI0A 5E2OA 2HLCA 1O39A 1KDQA 1EOLA 2QN5T 2ZO3H 3MO3A 1AVWA 3STIA 2A4GA 2VVVA 2PKSB 3F2GA 1B0FA 4ZH8A 1O37A 1DITH 2BX3A 1ZSKA 1SGTA 2WPIS 3TU7H 1Z7KA 1SG8B 1AFQB 1AU8A 1NPMA 1KLTA 1TQ7B 2GTBA 1CT0E 1L2EA 2PKSC 4TY7A 1LVMA 4CBNA 4ISOA 1JIRA 1TPAE 2A4OA 1O2UA 5FPYA 1N8OB 2ZIQH 1W0JD 1AFQC 1C5NH 1OP0A 1QRZA 4ABFA 2FODA 2G81E 1Z1JA 2GT8A 2Y80A 3F0PA 3MH6A 2FTLE 4CRCA 3UR9A 1FY1A 1N8OC 4IN2A 1NROH 1GHAG 2OXSA 3VXEH 4YTAA 3V3MA 1UTLM 5GCHF 3MU4A 3TK5A 3TJUA 1WTGH 1C5WB 1O31A 1QL8A 2D1JA 4QT8C 2O9QA 2FIRH 3SU6A 3D23A 1V2KT 3QTOH 4D9RA 1FN6A 4DVAU 1XKAC 3GS9A 4LXBH 3FFGA 2ZECA 5EW2H 1IQFA 1J16A 1MD8A 1QIXB 5DKMA 3OTJE 5GPIB 3M7TA 5PTPA 1H9LB 1UK2A 1IQHA 1QNJA 1GHYH 3ZVEA 8GCHF 1V2LT 4ZKSU 2Y5HA 1KXDA 3RXKA 2QE7D 4YT6H 3KQCA 2ZF0H 2ZC9H 4DG4A 2WZQA 1OYQA 4AGKA 5DP7A 2QYIA 2BQ6B 1P12E 3OYPA 1KXAA 5EOKA 1GJDB 1O0DH 1BIOA 1GI9B 4DT7B 3SW2B 2V3MA 2XNIA 1DPOA 5C17A 1SR5C 4VGCB 2KCPA 1DE7H 4RT0A 2VINA 1QY6A 2P3FH 1L0ZA 1NU9A 4A1VA 1NN6A 2CK3D 4Y0ZE 2ZGHA 4IS5A 1GI2A 2GKVE 4VGCC 2M2AA 2RDEA 4B6FA 1BRUP 4H4FA 5GDSH 1GI8B 2ZA5A 1GBHA 1EX3A 1O5BB 3JZ1B 2RG3A 2BVSH 1KDQB 3EQ0H 1P06A 1DWEH 9LPRA 1FAXA 1JXPA 2NU4E 3BIUH 2TGAA 1CGJE 2VGCC 2V3OH 2ZHQH 3VB3A 2A7HA 2BLOA 2ODYB 5T6GA 4JK5A 1IQNA 1B0EA 4A5TS 1MH0A 3RP2A 5AHGH 1A5IA 1CVWH 1O3AA 5TCAA 1FPCH 1PFXC 3GY5A 1BBRH 1MTSA 1SGEE 1JBUH 5J4QA 1PQAA 1LTOA 2WPKS 3NPSA 2CHAB 3TGKE 2SNVA 1UTPA 2H2ZA 4TWYA 2W6JD 4ZHLU 1C5LH 2C8XB 4B2BA 2JIZD 1WXRA 3S69A 2CHAC 3TH3H 2STAE 1IQKA 3K2UA 1QL9A 1J9CH 4BXSA 4Y7AA 1PPCE 5FHTA 1SGNE 4YLQH 3URCA 4D7GA 3EGKH 5FPTA 2I6QA 1FI8A 5DP5A 3S7KB 3SJOA 3RXSA 4K8BA 2PHBA 2QY0B 4OS5A 2IOTA 1A0LA 3C27B 1SGCA 2HNTF 2YMSD 3M5LA 1C5ZB 3Q76A 1W13U 1FDPA 4UFGH 3VB6A 3F9HA 2BXTH 1H8ED 5H4IB 4Q63A 5HMAA 1TGBA 1V2PT 3U28C 1KTSB 2C4FH 3UIRA 4ESTE 1AVXA 1O3NA 1T31A 3UAIC 1VITF 2HNTC 1V2MT 5B6OA 3Q3XA 1YPKH 2HOBA 4INLA 5HIYA 1BTYA 1AQ7A 5F53A 1VKYA 1O2HA 1Y3XA 4X1QU 3A8CA 1MAXA 3FZDA 3T26A 4D8NA 3SQEE 1ZTLA 4NIXA 3IWMA 2L74A 1YBWA 2SFAA 2XWBI 4Q80A 4BAKB 3OY5U 1TIOA 1O3CA 3ZV8A 1QFKH 1L4ZA 2PGBB 1Z8IB 2G5NA 1MQ6A 3OX7U 1P2IA 1W0KD 3F9GA 2ZGXH 3VFEA 4E7RG 1QBNA 3T27A 5DG6A 1GMCG 4CH8B 4MTBA 5AFZH 4UONA 2DE9A 4BOHA 4WF8A 1BMAA 1WSSH 1P9UA 1X7AC 1YCPM 1RS0A 1ELBA 1A5HA 4Y11E 5T6DA 4I33A 2D2DA 1EAIA 1C5OH 3PYHA 2ZU1A 4HZHA 1XUFA 3OU0A 3QLPH 2BM2A 1Z8GA 4JZIA 2AGEX 1YC0A 1DUEA 5E0HA 1OWHA 2IJOB 1VJAU 1NS3A 1W14U 2F4LA 5HM2A 5C67A 2GDDA 2RA3A 2Y6TA 5DJ7A 1XUIA 2PWXA 3TITA 1S5SA 1CO7E 3BTTE 3GY3A 2W5EA 1SLUB 4GSOA 1GL1A 1OP2A 2GJGA 4DW2U 1K0HA 4WMEA 3UOUA 2CMYA 4RSPA 3ZZ8A 2A45B 1GVLA 1K21H 1AUJA 1DXWA 4I31A 1Z1IA 2BX4A 4KTCA 3GY6A 1Z6EA 3GICB 4GHQA 3QWCH 1AN1E 2PP6A 1GHVH 1BRBE 1INCA 2J9NA 1T7CA 1H1BA 2Y7ZA 1K1JA 4JZ1A 4P00A 7KMEH 2PTCE 1LQDB 1C1QA 3QX5H 1DICA 3ZVFA 1XKBC 4OS1A 4RKJB 2WV4A 2ALVA 4NCYA 1HGTH 1C2JA 5GCHG 1DM4B 6CHAB 1G3EA 3K9XB 3EA9A 2H9HA 5F6MA 2DUCA 1OWKA 2YNBA 2FOGA 2KCAA 2R2WU 1F5KU 2QXJA 2GCHF 1S84A 4Y10E 3TVJB 2D26C 3HKIB 3MU5A 1O3LA 1PYTC 3RXAA 1C1MA 1C1NA 2CF8H 3P8OA 5HXFA 3SZEA 1C1OA 1MZAA 3LKWA 2A32A 4BTUB 3VB7A 3LPRA 1J15A 2NU1E 3ODFA 4MPUA 3U98H 3EA8A 3ESTA 1Z8JB 1LHCH 4JYVH 3TH2H 1DDJA 1FXYA 1GBFA 4AFZA 8GCHG 3ITIA 3P8NA 3TJOA 2ZPQA 2UUYA 2EI7A 1ANDA 2B0FA 4ISLA 1WU1A 3SO3A 3PLBA 1WCZA 3KIDU 3UOPA 2A5KA 1NRPH 2FOEA 5FX5A 1NRNH 3P70B 4DGJA 3P17H 1AFEH 3VB5A 1DX5M 1MU8B 1WAYB 3SHCH 3ATMA 1LVBA 1RGQA 2P3TB 1DWDH 1AHTH 1BTUA 2A4QA 2ILNA 1O32A 4ASUD 6GCHG 2Z94A 8ESTE 3RXOA 2R3UA 2ESTE 2RA0A 1P9SA 3CS0A 4M7GA 3TJNA 3VPKA 1UW7A 3LJJA 4UE7H 1TGTA 4FVBA 1JOUB 2BY6X 2QC2A 1K1LA 1SGQE 4JZFH 5ETXA 4ZCNA 3PRBA 1MTWA 4B75A 1FPHH 1HAXB 1FY5A 1AD8H 1TMUH 2HGTH 3SUFA 2XNDD 3UB0A 4A92A 1SGPE 3A81A 3MTYA 3KGPA 1UTKA 5JBCS 2FI5E 4KGAA 2R0LA 1GJ6A 2BZAA 1BZXE 1SOZA 2GMTC 3KEEA 5GNDA 4A1TA 1LKAA 3E1XB 4FUHA 1JIMA 1TBRH 1UVSH 2FX4A 4ZXYH 1ZTJA 2V6NA 5DP3A 5HIZA 1HXEH 1K2I1 3SV9A 2BY5X 2KAIA 1A3BH 2FS8A 3LC5A 5L2ZH 5CMXH 1GHZA 1O2RA 1ZTKA 1C2EA 2H5CA 1VJ9U 1ARCA 1BMMH 1EAWA 2XBYA 4NA9H 3OEED 3RXIA 1XVMA 4CRFA 4BAMB 3LONA 1GI3A 4Z1MD 1DY9A 1KIGH 1QRXA 3GCOA 2EEKA 3RDZA 2OK5A 1D6WA 1KXCA 3RXUA 2C8ZB 1XX9A 4MG3A 1ABJH 1YPEH 5JYIA 1S83A 1XUKA 4JMYA 3SGBE 4XD7D 5JB9S 1EZSC 4ABAA 2WPMS 5FL7D 4E05H 1V2QT 1TNIA 3BG8A 1UCYK 2BOKA 1O38A 3URDA 3BG4B 4XRNA 1AMHA 3ZYEA 4O9VA 4NSYA 4PROA 1VITG 2AMQA 4AYYB 1TFXA 1KXBA 4FUJA 2A5IA 5ESBA 1GJ5H 2PKAA 3A7VA 1GCTB 1GVZA 3NUMA 4Q7YA 1MUEB 3BG4C 4NWLA 1OXGA 3QGNB 1JRTA 5LPRA 5T1VA 1F2SE 5EODA 2AGIX 1YY3A 1GCTC 2JETB 1BDAA 4Y71A 3AAUA 3SV7A 3DT0H 1WTHD 2PLXA 2H6MA 3GYLB 3BEFB 4B76A 4I32A 1ESAA 1EPTA 2JETC 4CRBA 1EB2A 1ZMJA 2FOBA 4XBCA 3K6ZA 4ABIA 1KYNA 2ZDLA 4WH6A 3A7ZA 2TIOA 2A5AA 2GGVB 1TNJA 2ZWLH 4Y8ZA 1W10U 3FANA 2ZG0H 3SUDA 3DA9B 4O3UA 1O3DA 3MOCA 5ABWA 4IC6A 1IAUA 2FWWA 4X8VH 1EATA 1MCTA 1SC8U 1FIWA 3RC4A 4CH2B 4B2CA 2SGEE 1IQIA 2HPPH 1TALA 1AO5A 4X6MA 3A85A 4TPIZ 3M36A 2FTMA 1WV7H 1O5FH 2VIWA 3FZZA 1G37A 3FN8A 1P03A 3SOSA 1BRAA 2VWLA 3A7WA 4SGBE 3STJA 1LO6A 1QTFA 2J4IA 2XCFA 2P95A 2CJIA 1EAUA 1TPSA 4FU7A 1XUHA 2BLQA 1ID5H 1RTLA 2KAIB 3LH3A 5EXNA 2OC1A 3F9FA 1FONA 1PJPA 4FU8A 4MNVA 2LP6A 1D9IA 2ZDKA 1N6XA 1BTZA 2BD7A 2J5UA 3S0NA 1NO9H 1D4PB 2CXVA 1XUGA 1V2JT 3EAJA 1ELGA 2ZDNA 1BTWA 2GV6A 2KZ4A 3A84A 3HGNA 2SGQE 4U01A 5IK2D 4O3TA 1HXFH 4K60A 3O8BA 4JYTA 2OTVA 3TIUA 3T62A 1T8LA 1C2DA 2OC7A 1YF4A 3UWJH 3NK8A 1HV7A 5TJXA 1EZXC 1F0RA 3O8CA 3AW0A 4K69A 2GCHG 4K5ZA 4HG6A 3LGVA 2GX4A 2PW8H 2KX4A 2PKAB 1GCDA 4F4OC 3NZIA 3FP7E 3RXJA 2XTTB 2ZI2H 3RXVA 4ABDA 1GJ8B 2HVYB 2A31A 5FBIA 2UUKB 4LOYH 7LPRA 2HLDD 2ODPA 4AC9A 3Q00A 5JBAS 2G55A 1CE5A 1P2OA 3RXPA 1A4WH 1Y3WA 1HBTH 3OFND 5I46H 5BRRE 1MU6B 3PLPA 3SU4A 2BY9X 4GPGA 1EJNA 1QZ8A 5FXLA 3VEQB 1JRSA 2XWAA 1YPGH 2P93A 1D6RA 2O8WA 2FOCA 1UO6A 4H42U 3PMAB 1M9UA 3E16B 1Z6JH 1DXPA 1GJ4H 3F2FA 3U8TH 1EPTC 1SLXB 1O2NA 3PWBA 2A0QB 2O8UA 2BDHA 4TPYA 1HLTH 1F0SA 1P3EA 3G01A 2M5TA 2W6ID 1BITA 3MU1A 1DWCH 3EE7A 3R3GB 1NM6A 4KTSA 2FEQH 2PSXA 3MQKC 1T8OA 4GVUA 4WWYA 1HJAB 1D3TB 3LT3A 4IMZA 4X1SU 2GDEH 4ACAA 2PSYA 4JZDH 1UTJA 1L1NA 1WUNH 4Y0YE 1IQJA 2OC0A 2VIPA 1HJAC 3NXPA 4IGDA 3UR6A 2Z9LA 4TSFD 1BMLA 2WHXA 3BEIB 3RXTA 2QAAA 3D49H 2QF0A 6LPRA 3IG6B 2PUXB 2G00A 1CA8B 2BDBA 4B71A 2F9NA 2J2UA 1FJSA 3BTFE 1TNGA 4OS6A 4X8TH 4SGAE 1OPHB 3S9AA 2WYJA 1TRMA 1UCYE 1GGDB 2VWOA 4ZAEA 3KQ5A 3BEUA 4Y79A 1H9IE 5DP8A 2ZZUH 1GI1A 1ANBA 1GGDC 1KY9A 2LNCA 6GCHF 3A8DA 2J98A 3A8BA 2ZU2A 2SGDE 2YMSC 4HTCH 1P02A 1BJVA 1QL7A 3PTNA 3ZZ3A 1LHFH 3M3TA 3OE7D 4FUFA 5C1UA 2A2QH 2UUFB 3RM2H 1TX8A 2VGCB 1O2GH 1HAOH 3M7QA 4FVDA 1K1NA 1TX6A 1S6FA 4MLFB 5DPAA 3QZQA 3E3TA 5FCRA 3KYFA 1G2MA 3LC3A 2GZ9A 2FP7B 1G30B 2ZFSA 4O97A 7ESTE 1LQEA 3SZNA 3MMGA 1WOFA 1ETSH 2G8TA 2GZ7A 3UY9A 1O3JA 3VGCB 1JWTA 3RMMH 3BTEE 5C1XA 5FCKA 3BTWE 1CHOF 1FQ3A 3H5CB 1MTNB 3Q3KA 3BIVH 1DY8A 1N6YA 5KEDA 3PM3A 3VGCC 1O2PA 3MYWA 2ZTZA 3LDXH 2OQUA 4IN1A 5T3HA 3W1EA 3BN9A 1FV9A 1CGHA 3Q77A 4MNYA 1O2YA 3T2NA 1T8NA 1QBVH 1MTNC 4XSKU 2V35A 5F8ZA 3E0NB 3E8LA 3MNXA 3SJIA 3CP7A 1GG6B 3GY8A 3A7TA 2FX6A 1VGCC 1TBQH 2NU3E 3T28A 1NFUA 1O2OA 2AIQA 1F7ZA 3GCHB 3RLYH 3ZZ5A 8LPRA 1GG6C 5C1YA 1O3HA 4E7NA 2WPJS 5EJZA 4BANB 2ZTYA 2K8IA 2THFB 3OAAD 3OEHD 1G3BA 3GCHC 1KTTB 1PPEE 3SHAH 5F8XA 3TH4H 5EPYA 4YOGA 5C3NA 4AFQA 4YXWD 5A0BA 5GJ4B 3N7OA 4WJG2 3WWBA 3MO6A 5LGOA 4A7IB 2QF5A 3PO1C 3AW1A 3MH4A 2ZEBA 3U8OH 1A0HB 2F9UA 1HAHH 1GJBB 4INHA 3BTKE 5DGJA 5E2PA 3SI4H 3SU0A 2FYQA 1VZQH 4O03A 4MVNA 1SFQB 2QXIA 5EXLA 2WSSD 2GP9B 4A6LA 1ESTA 4TT3D 4THNH 1ANEA 1QJ7B 3RU4E 1GBBA 1WYKA 1C5TA 1LPKB 1HJ8A 5GIBA 1MD7A 1UK3A 2J98B 1BHXF 1T32A 3A88A 1O3PB 1ZSLA 3GYMA 1NRSH 5EGMA 1XMNB 4B2AA 2Z9JA 4DY7B 1TGCA 3CS7A 3AVZA 1HAVA 3SJKA 1O2QA 1XXDA 3HPTB 2HVXA 1E37B 2P59A 3SV2H 1O2SA 2GD4B 1P0SH 1VR1H 3RUOA 2F9BH 1Q31A 3F2HA 1C5VA 3RXGA 1LPZB 1QHRB 1ELDE 4FETA 1O2TA 1P2NA 1SLWB 4Q7ZA 3TGJE 3NRLA 1C5YB 1C2GA 1P10A 3RXMA 1ACBE 2XC5A 1DT2A 2EI6A 3FOAA 5DO4H 3A8AA 3DSGA 4CRAA 1P2KA 1SBWA 1XUJA 2P8OB 1P2MA 4RKOB 5C2ZA 5CDFE 2BY8X 4U2WA 2Z9IA 1BUIA 1SVPA 2FOAA 1NZQH 2J38A 3FP6E 1YPMH 2P8OC 1ZRKA 4LZ1H 4NIWA 1Y3VA 2VU8E 1THPB 3PB1E 4NFEA 3RM0H 1G3CA 3PV5A 4WMFA 2TBSA 1A2CH 4ISHH 1FNIA 3L33A 4ISIH 1GBAA 3GDUA 4Y8XA 1BTHH 3F6UH 3FP8E 3ZZAA 4ZKOU 1ELVA 1GI7B 4IBLH 1TNHA 1KXFA 2W7UA 1V2UT 1E36B 4K2YA 1E34B 3M37A 4XDEA 3L3TA 4GCHF 1O2VA 1O2KA 4GHTA 5A2MH 3SV6A 1YPLH 2G4UA 3BTQE 4KP0A 5BPEA 3GISB 3GOVB 4WXIA 1HIAA 4OGYA 2C93B 3SBKA 2HALA 4JYUH 4I86A 1OWEA 2C8YB 1K1MA 2VIVA 2DE8A 9ESTA 2AIPA 1S0QA 1C2LA 1O30A 1GMDG 2L6OA 1V2VT 1HNEE 2G52A 1W8BH 5JB8S 4NG9H 2JKHA 8KME2 1TPOA 1ZJKA 4GUXA 1XM1A 4CHAB 1QJ1B 2GT7A 5CHAB 1OSSA 1QQUA 3MU8A 3RMNH 3HGPA 1AGJA 3W95A 4JCNA 3QUMP 4D76A 4CHAC 1LCYA 5CHAC 5HGGA 5L2YH 3DCLA 4I8LA 2FESH 1OYTH 3JZ2B 1EJAA 3I29A 3GY4A 1EZUC 1HAVB 2CV3A 1PPBH 1TONA 1RTFB 1GI6A 2FDAA 5EXMA 3ZZ6A 2WV5A 2F3CE 3ZV9A 1Y59T 2W3KA 1C4Y2 3M3SA 1G3DA 1RFNA 1C2IA 1AI8H 1RRKA 1EP5A 1V6DA 4HFPB 1QRWA 1AVGH 2A2XH 4OS7A 2H1UA 3EDXB 3N99A 4YT7H 3SNEA 1C9PA 3FKSD 2P3UB 1DVAH 1JMOH 2BD8A 5JBTA 2BHGA 3M35A 1ZHRA 3UTUH 1ZJDA 3U69H 1LKBA 1AZ8A 1CBWB 4Q4LA 3BV9B 2QF3A 3LU9B 2AFQB 1GWAA 1O2ZA 2GMTB 1P2QA 1SFIA 2FM2A 1O5GH 4UEHH 1C5XB 1CBWC 5EQSA 1YLNA 4UDWH 4IC5A 4ZUHA 4KTUA 4MNXA 1A7SA 1O36A 1L4DA 3RMLH 1CU1A 5EPNA 3ATKA 5F8TA 1LHEH 4X6NA 1CHOG 1TGSZ 1CGIE 1OKXA 4CR5A 1PPZA 2ZPRA 2AERH 1ZHMA 1SOTA 3UQOA 3TK6A 4H6SB 1OP8A 4BAOB 3S9BA 2BVRH 2C3SA 4X1NU 1HFDA 1S6LA 2XOKD 4M9FA 2AH4X 2IPQX 3GCNA 2GCTB 1Y3UA 3U1IB 1T8MA 4MQAA 1BRCE 1HIAB 1F0UA 5DSFA 4J2YB 1BJUA 2B8OH 3KQBA 5ESTE 5DN6D 1UJ1A 2GCTC 4F49A 5C0UA 1MBQA 2F91A 2ZGJA 5A8YA 1ZGVA 3SU1A 1P09A 2F9VA 1TMBH 2VIOA 2UWOA 1COWD 1E1RD 3SJ9A 1O3IA 3LIWA 1V3XA 2IPHA 1G36A 2G51A 3N7EA 4AYVB 1ABIH 3GDVA 3SU2A 5L6NH 1XXFA 2BDAA 1GVKB 3A7XA 2HPQH 1CA0C 1Y5AT 1W11U 3KHVA 1KSNA 4GAWA 1GDNA 1NBME 1FN8A 1K28D 2ZCKP 4Y76A 3ENSB 1W2KH 2Y82A 3P8GA 4AFUA 4ABBA 5EJ1A 1AZZA 1ANCA 1VCQA 1HPGA 2J92A 1A61H 4DIIH 1C2FA 1GHXH 5E0JA 4DCDA 5FAHA 2ZTXA 1FX0B 2OBQA 4ABHA 1TMTH 1O5AB 4MPVA 2FLRH 3KQDA 4ZXXH 2QXGA 1NFYA 4Y6DA 1UVOA 3BF6H 1UTNA 3CENA 5E8EH 2VBCA 2R3YA 4RT1A 4AG1A 1NRRH 2Q6DA 1ETTH 3GCTF 1AWFH 3MNCA 3NCLA 2WYGA 3O8RA 1SL3A 1A5GH 5IYTA 2WINI 2YOLA 4TYDA 3TLOA 4B1TA 1T4VH 1IQMA 3B8JA 3MU0A 2ZFQH 3SGAE 1LHGH 5EJLA 4NWKA 1C5MD 4MDSA 1UHBA 1Y8TA 2OUAA 4INKA 4AG2A 1MMJN 2K1QA 4X1PU 2JJ2D 3HK6B 2XC0A 5T6FA 5LPEA 2ZNKH 3QZRA 1GPZA 1BMFD 2Z9KA 3FO8D 4YLUA 2ANWA 1AUTC 4YO9A 2QV1A 4LK4A 4E06H 1O3MA 1ZMLA 2SGFE 2TGPZ 3RU4D 3RC5A 4F48B 3MFJA 1OWJA 2XRCA 2BD3A 4AGJA 3ELAH 1PQ5A 4MPXA 4NFFA 1MKWK 2XBVA 3SUEA 4FUIA 2Y7XA 2A7CA 3GY7A 4JZEH 2HNTE 2TGTA 4KKDA 1THRH 3BTGE 1C9TA 1H4WA 5K0HA 1GJ9B 1FY3A 2VNTA 3BTHE 1C5PA 4K1TA 3SNBA 3E6PH 3ZZBA 4GCHG 1G2LA 1TA6A 3Q3YA 1TOMH 2FI4E 4FU9A 1NRQH 5KGOA 2XYAA 1GDQA 2YNAA 2RCEA 1ELEE 5C0TA 2J94A 1QBOA 4B74A 4NZQA 3B23B 2ZCHP 1FZZA 1Y5UT 5SGAE 5EW1H 1FAKH 2GVFA 3NWUA 2BD9A 3UNQA 2W26A
chains in the Genus database with same CATH topology
4UD9H 3U9AH 1K1OA 1AWHB 3RXLA 5E0GA 4NA7A 1AKSA 1HAYB 2HWLB 2Y5GA 4NZLA 1GI4A 3P92A 3UPEA 1MQ5A 1O3EA 1ORFA 1GL0E 1EPTB 2Q1JA 1O2WA 4TY6A 4CREA 4XE4A 1ELAA 1G9IE 4WMDA 3SUGA 3DHKH 1D3DB 4NSVA 1J8AA 1VITH 1YCPK 1GBJA 2UWLA 3W94A 1GJAB 1PPFE 3EE0B 1D3QB 2QA9E 2PR3A 4WXVA 1A3EH 1DANH 4AZ2B 2C90B 3TNTA 3KNXA 1P2JA 3WY8A 4YESB 1SGDE 5FX6A 2Y5FA 4FUEA 1ZRBA 4X2WA 3ZYDA 3PMHB 1ELFA 1O3OA 4FUGA 4ABGA 1H9HE 2PV9B 1TNLA 1G32B 4OS4A 1PQ7A 1UHBB 4K1SA 3GY2A 3TNSA 4FUBA 1UMAH 2V0BA 3PTBA 3P95A 2A7JA 3LGUA 4I7YH 3OSYA 4UFDH 1A1RA 1SGYE 1YGCH 1GMDF 2OC8A 2TPIZ 1TOCB 2WPLS 5DP6A 1TLDA 3PV4A 2R0KA 3PMBB 3ODDA 3A7YA 2AS9A 3M5OA 2J95A 2JH5D 1GBDA 1Q2WA 3ATWA 3UQVA 3SNAA 1MCVA 1TRYA 1HUTH 3QN7A 3E0PB 1EASA 2OCVB 5K7RA 4R8TB 1A46H 1SLVB 2Y81A 1NTPA 1F92A 1QJ6B 2ULLA 2ZGCA 5C20A 3MI4A 4YOIA 4CRGA 2BY7X 2BTCE 1S85A 4OS2A 4X2XA 2ANKH 1NESE 5HYOA 2CGAA 1UVPA 1GBLA 1P01A 3LGIA 2OD3B 1YLCA 4H6TA 4K8YA 3LH1A 1EJMA 2H9TH 1LHDH 2ZP0H 3TPIZ 4IMQA 4ISNA 1DSUA 4YOJA 2VVUA 3ZZCA 1SQOA 2PTNA 2BQWB 4X1RU 4FXGH 1C5UA 1C5SA 1AY6H 2CN0H 4X0WU 4ABEA 5LH8A 1BQYA 1RIWB 2Z3CA 1BBRE 1DLEA 3M5MA 1AIXH 1SGIB 3ATLA 1RIWC 3P8FA 1AB9B 1XVOA 2VJ1A 2VIQA 2XCNA 1ZR0A 4D9QA 1O2XA 5AVDA 1AKSB 1UCYH 1LVOA 2ZHFH 4IW4E 1OX1A 2NU0E 1TGNA 1AB9C 1PPGE 1ZOMA 1TNKA 4NIVA 2FMJA 1UTMA 3SNCA 2OQ5A 5A8XA 1K22H 1ZPCA 1EB1H 2BOHB 3SN8A 1HB0B 5EU8A 1ZGIA 1V2OT 2RDLA 3A89A 3TGIE 1IQGA 2XBWA 2O8TA 1S82A 4KELA 4GLYA 4X2YA 3PLKA 1BTPA 4RN6A 3V0XA 2SNWA 1GBCA 1SI5H 1DOJA 1VGCB 1H8IH 5EQQA 3BSQA 4I8KA 1VCWA 1P11E 1MKXK 5A09A 1T4UH 3E90B 1TBZH 1C2HA 1CHGA 1F0TA 3IITA 3ZZ7A 1GMHF 3FAOA 5JPMH 3RLWH 1YPHC 1LDTT 2FZZA 7GCHF 1V2NT 3UUZA 4Q7XA 1UTOA 4XBDA 4YM9A 1S6HA 3GCTG 3SU5A 1C1SA 3RXCA 2JH6D 1PPHE 2OBOA 2BD2A 3PO1B 3UNRA 1C4V2 1UK4A 4Z6AH 1ZSJA 3MNBA 1K9OE 2W3IA 2EA3A 4ZHAA 1W0YH 2ZCLP 1AE5A 2QIQA 1DSTA 1WQVH 5CE1A 4X8UH 1Y3YA 1ZPBA 4LZ4B 1HYLA 1BTXA 4ZMAH 3M5NA 2BLWA 5A0CA 4BNRA 1ZPZA 1MAYA 1WBGB 1HAGE 2VVCA 1W12U 1O5DH 1C1TA 1MTUA 1BB0B 2H5DA 1BHXB 1SQTA 5FPSA 1U6QA 1MKWH 1GHBF 1O35A 3EA7A 3T25A 1HCGA 5HM9A 3V12A 1HAPH 2GV7A 1SGFG 3DFJA 5GWZA 5F03A 3E91A 2ALPA 5IDKA 2VH0A 1NFXA 2FI3E 3D62A 1YKTA 5A0AE 2Q6FA 3U1JB 3MWIU 3M7UA 1D3PB 3KCGH 4I8HA 1DS2E 4CBOA 1O3GA 2ZHEH 1ARBA 4ZHMU 1RTKA 2G4TA 1YM0A 3TJVA 1IHTH 3LGYA 2ZHDA 2ZQ2A 1ELCA 1K1PA 1SGRE 3U8RH 5C5NA 1UVTH 2UWPA 1SMFE 2A4RA 1O2JA 1ZZZA 4I8JA 3SU3A 2VWNA 2BD5A 3S7HB 2I6SA 5DP9A 2ZFFH 1O34A 1C5RA 2PUQH 3ZVAA 2ZU3A 1FY4A 4UFEH 3MHWU 1KXEA 3A83A 4Y7BA 3H7TA 1DFPA 3R0FA 5JDUB 5EQRA 2ZQ1A 2FPZA 1YCPH 3MNSA 2Z9GA 2J34A 1QB6A 1ZMNA 3ZZDA 4CRDA 3ZZ4A 1NY22 1BOQA 5FBEA 1HJ9A 4AX9H 3KF2A 5AF9H 1C5QA 4AN7A 4ASHA 3A86A 3V7TA 3RXQA 1KLJH 3ZZ9A 3KN2A 1MTVA 3O8DA 2VIDA 3T5FH 3UFAA 2A1DB 1LPGB 5DK1A 2WUBA 1MBMA 1W3CA 1SSXA 3SGQE 1B5GH 2GZ8A 2ZU4A 1UTQA 4ABJA 1K1IA 1O2IA 3PROA 4NA8A 2R9PA 1PQ8A 3V13A 1TA2A 3LGWA 1W7XH 6CHAC 1TX7A 3A80A 2Z6BD 2C8WB 2VB0A 1O3FA 1FUJA 3DUXH 2CF9H 4I8GA 1GI0A 4WY3A 2BXUH 2G5VA 2ODQA 3B9FH 1A0JA 1E0FD 1VCPA 3RXHA 1LVYA 3I77A 3DD2H 1Q3XA 2O8LA 3VXFH 3RU4T 3PWCA 4CR9A 3UNSA 3QK1A 3GDSA 3ATIA 4Y8YA 2PGQB 1J17T 4X6PA 1HRTH 1OOKB 2BDGA 1F5RA 5A8ZA 6ESTA 3M3VA 2OINA 2EI8A 1C1UH 1EKBB 1SPJA 2BDCA 5TCCA 1TRNA 1H8DH 1QURH 2XC4A 4AORA 2ANYA 3RC6A 1QGFA 1NU7B 1EZQA 3HK3B 1BA8B 1FIZA 1O5EH 1GJCB 4X8SH 1IQLA 4BAQB 1GHAF 1C4U2 2QXHA 1E38B 3I78A 5LPFA 2FOHA 1Y5BT 3QGJA 3HATH 1YLDA 5I25A 1QQ4A 3SI3H 1RD3B 2BDYA 3LJOA 1QA0A 1BCUH 1C1VH 2NU2E 2Z7FE 4NIYA 1QCPA 2SGAA 2ZU5A 2BVXH 3HKJB 4J1YA 1O2MA 1TYNA 1O33A 2F83A 2BZ6H 2BD4A 3ZVDA 1LMWB 1CT4E 1WQSA 1ZYOA 2OP9A 2VWMA 1TABE 1GJ7B 4X6OA 4WH8A 2Z3DA 4B73A 1C1WH 1AE8H 1C1PA 1PYTD 1YYY1 2ZKSA 1GBMA 2AMDA 2VH6A 1C2KA 1FMGA 4U30A 1O5CB 3F9EA 3MO9A 2B7DH 1V2WT 2ZFRH 1EXFA 4AB9A 3P6ZB 3H7OA 3T29A 3SJ8A 1P05A 1GMHG 1MKXH 1DWBH 2B9LA 4DURA 2FYRA 1HAZB 2XW9A 1KLIH 1NC6A 1ZLRA 7GCHG 1CQQA 1SGFA 2OLGA 3A82A 3F1SB 4ZROA 1SQAA 1GBEA 3RXDA 4R0IA 2AMPA 1GBKA 3BTDE 5G4BA 3RMOH 4MPWA 1GHWH 1B7XB 1N1LA 3QDZB 1CA0B 4DIHH 2P16A 2ZFTA 1P3CA 2FXRA 1ZHPA 2ZDAH 1BT7A 2IN2A 1DUAA 3QO6A 1SB1H 1SHHB 3K65B 1OS8A 2ZPSA 3DFLA 2AGGX 1C2MA 3LOXA 3PMJA 1O2LA 4D7FA 1FY8E 2BQ7B 1HDTH 1GDUA 4BTIB 2NWNA 1W7GH 3M61U 2FLBH 1IOEA 4AB8A 1BBRK 1EAXA 4JK6A 3SQHE 1YP9A 3QTVH 4ZKNU 1TQ0B 4AFSA 3K6YA 3C1KA 1L1JA 2STBE 4TWWA 3MH5A 1F5LA 1GHBG 1J14A 2ZFPH 1TE0A 4HI3A 3ZVCA 3L6PA 5EG4A 2H9EH 2Z3EA 4FUCA 1S81A 1OWDA 4HGCA 3OY6U 3NKKA 1P8VC 4ZKRU 3TK9A 1IQEA 1NFWA 2AYWA 3RXRA 2AEIH 2ZDMA 3SNDA 2WPHS 2FOFA 1P04A 2P94A 3ZVGA 3EYDA 2O8MA 2SGPE 2BMGB 4XFQA 1EOJA 1O3BA 1E35B 1V2RT 2BB4A 1SHYA 4FUDA 4MNWA 2EC9H 3BTME 2V3HH 2UUJB 1TAWA 1QB9A 2BYAX 2LPRA 3D65E 3SORA 1DLKB 1W0ZU 1S0RA 1Z8RA 3KL6A 3SV8A 1CT2E 1CSOE 1YPHE 3LGTA 4BXWA 2FO9A 4DJZB 1O3KA 2TGDA 2JH0D 4XBBA 1EP6A 1QR3E 4XOJA 4Q2KA 3S9CA 2D8WA 5C5OA 4A1XA 1OWIA 5DP4A 4K3JA 3KQEA 3UREA 4OGXA 1TB6H 5L30H 4BAHB 5JBBS 3ZVBA 1BMNH 1YPJH 1NT1A 1ELTA 1EUFA 2TRMA 3A87A 5AFYH 1C1RA 4BTTB 3RXBA 1THSH 1RJXB 2ZDVH 4YZUA 1GBTA 3MH7A 1ETRH 2QGRA 2WUCA 2ASUB 2PFEA 3RXEA 5J4SA 4U32A 1EQ9A 1L1GA 3FVFB 3RXFA 1GBIA 1FLEE 1TPPA 2ANMH 1Z71A 1GMCF 2F9PA 1HAIH 1QA7A 2FOMB 2Q6GA 4K1EA 4Z0KA 3AASA 2BDIA 1QB1A 1TWXB 2W7SA 2HRVA 2XBXA 2XXLA 2ZGBH 2ZHWH 3UWIA 4AOQA 1V2ST 1RXPA 3VB4A 4UFFH 3F68H 2FS9A 5GXPA 3AAVA 1GI5A 2F9OA 2R2MB 2B5TB 1IHSH 1ESBA 4X2VA 2QCYA 4WVPE 1UVUH 2BLVA 1V2TT 4DOQA 1MZDA 1P57B 4NGAH 5E2OA 2HLCA 1O39A 1KDQA 1EOLA 2QN5T 2ZO3H 3MO3A 1AVWA 3STIA 2A4GA 2VVVA 2PKSB 1B0FA 4ZH8A 1O37A 1DITH 2BX3A 1ZSKA 1SGTA 2WPIS 3TU7H 1Z7KA 1SG8B 1AFQB 1AU8A 1NPMA 1KLTA 1TQ7B 2GTBA 1CT0E 1L2EA 2PKSC 4TY7A 1LVMA 4CBNA 4ISOA 1JIRA 1TPAE 2A4OA 1O2UA 5FPYA 1N8OB 2ZIQH 1AFQC 1C5NH 1OP0A 1QRZA 4ABFA 2FODA 2G81E 1Z1JA 2GT8A 2Y80A 3MH6A 2FTLE 4CRCA 3UR9A 1FY1A 1N8OC 4IN2A 1NROH 1GHAG 2OXSA 3VXEH 4YTAA 3V3MA 1UTLM 5GCHF 3MU4A 3TK5A 3TJUA 1WTGH 1C5WB 1O31A 1QL8A 2D1JA 4QT8C 2O9QA 2FIRH 3SU6A 3D23A 1V2KT 3QTOH 4D9RA 1FN6A 4DVAU 1XKAC 4LXBH 3FFGA 2ZECA 5EW2H 1IQFA 1J16A 1MD8A 1QIXB 5DKMA 3OTJE 5GPIB 3M7TA 5PTPA 1H9LB 1UK2A 1IQHA 1QNJA 1GHYH 3ZVEA 8GCHF 1V2LT 4ZKSU 2Y5HA 1KXDA 3RXKA 4YT6H 3KQCA 2ZF0H 2ZC9H 4DG4A 1OYQA 4AGKA 5DP7A 2QYIA 2BQ6B 1P12E 3OYPA 1KXAA 5EOKA 1GJDB 1O0DH 1BIOA 1GI9B 4DT7B 3SW2B 2XNIA 1DPOA 1SR5C 4VGCB 1DE7H 2VINA 1QY6A 2P3FH 1L0ZA 1NU9A 4A1VA 1NN6A 4Y0ZE 2ZGHA 4IS5A 1GI2A 2GKVE 4VGCC 1BRUP 4H4FA 5GDSH 1GI8B 2ZA5A 1GBHA 1EX3A 1O5BB 3JZ1B 2RG3A 2BVSH 1KDQB 3EQ0H 1P06A 1DWEH 9LPRA 1FAXA 1JXPA 2NU4E 3BIUH 2TGAA 1CGJE 2VGCC 2V3OH 2ZHQH 3VB3A 2A7HA 2BLOA 2ODYB 5T6GA 4JK5A 1IQNA 1B0EA 4A5TS 1MH0A 3RP2A 5AHGH 1A5IA 1CVWH 1O3AA 5TCAA 1FPCH 1PFXC 3GY5A 1BBRH 1MTSA 1SGEE 1JBUH 5J4QA 1PQAA 1LTOA 2WPKS 3NPSA 2CHAB 3TGKE 2SNVA 1UTPA 2H2ZA 4TWYA 4ZHLU 1C5LH 2C8XB 4B2BA 3S69A 2CHAC 3TH3H 2STAE 1IQKA 3K2UA 1QL9A 1J9CH 4BXSA 4Y7AA 1PPCE 5FHTA 1SGNE 4YLQH 3URCA 4D7GA 3EGKH 5FPTA 2I6QA 1FI8A 5DP5A 3S7KB 3SJOA 3RXSA 4K8BA 2PHBA 2QY0B 4OS5A 2IOTA 1A0LA 3C27B 1SGCA 2HNTF 3M5LA 1C5ZB 3Q76A 1W13U 1FDPA 4UFGH 3VB6A 3F9HA 2BXTH 5H4IB 5HMAA 1TGBA 1V2PT 1KTSB 2C4FH 3UIRA 4ESTE 1AVXA 1O3NA 1T31A 1VITF 2HNTC 1V2MT 5B6OA 3Q3XA 1YPKH 2HOBA 4INLA 1BTYA 1AQ7A 1O2HA 1Y3XA 4X1QU 3A8CA 1MAXA 3FZDA 3T26A 4D8NA 3SQEE 1ZTLA 4NIXA 3IWMA 1YBWA 2SFAA 2XWBI 4Q80A 4BAKB 3OY5U 1TIOA 1O3CA 3ZV8A 1QFKH 1L4ZA 2PGBB 1Z8IB 2G5NA 1MQ6A 3OX7U 1P2IA 3F9GA 2ZGXH 3VFEA 4E7RG 1QBNA 3T27A 5DG6A 1GMCG 4CH8B 4MTBA 5AFZH 4UONA 2DE9A 4BOHA 4WF8A 1BMAA 1WSSH 1P9UA 1X7AC 1YCPM 1RS0A 1ELBA 1A5HA 4Y11E 5T6DA 4I33A 2D2DA 1EAIA 1C5OH 3PYHA 2ZU1A 4HZHA 1XUFA 3OU0A 3QLPH 2BM2A 1Z8GA 4JZIA 2AGEX 1YC0A 1DUEA 5E0HA 1OWHA 2IJOB 1VJAU 1NS3A 1W14U 5HM2A 5C67A 2GDDA 2RA3A 2Y6TA 5DJ7A 1XUIA 2PWXA 3TITA 1S5SA 1CO7E 3BTTE 3GY3A 2W5EA 1SLUB 4GSOA 1GL1A 1OP2A 4DW2U 4WMEA 3UOUA 2CMYA 4RSPA 3ZZ8A 2A45B 1GVLA 1K21H 1AUJA 1DXWA 4I31A 1Z1IA 2BX4A 4KTCA 3GY6A 1Z6EA 3GICB 4GHQA 3QWCH 1AN1E 1GHVH 1BRBE 1INCA 2J9NA 1T7CA 1H1BA 2Y7ZA 1K1JA 4JZ1A 7KMEH