2QCYA

Crystal structure of a monomeric form of severe acute respiratory syndrome (sars) 3c-like protease mutant
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for controlling the dimer-monomer switch and coupling dimerization to catalysis of the severe acute respiratory syndrome coronavirus 3C-like protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 83
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2qcyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qcyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qcyA02
1P2QA 1AN1E 2P3TB 3RC4A 1YCPM 4WVPE 3IG6B 4AX9H 2I6SA 1UTMA 2ODPA 2FI5E 4X6NA 2LPRA 2WPLS 2WV5A 3TU7H 2BXUH 1VJ9U 1JXPA 1QQUA 1TX7A 1NRPH 3SU1A 3UNRA 1J17T 1B5GH 4X2VA 1HCGA 3I77A 1ELGA 3A7VA 5EGMA 4CRFA 1TGTA 1TQ7B 3NZIA 4KELA 1THRH 4DW2U 1TA6A 4CBOA 1MU6B 3DA9B 3SHAH 2ZGCA 1RTFB 1O2LA 3P8NA 4NSVA 1HIAB 4UD9H 4ABFA 2ZU5A 1ZMJA 3UY9A 3NUMA 4AGJA 3V3MA 3KHVA 2G8TA 3RXEA 4ISHH 2O8MA 1H4WA 1YPHC 3A8CA 3MHWU 4Y7BA 3RXVA 1IQEA 3B9FH 5BRRE 5TJXA 3SBKA 4RKOB 1S84A 1FY5A 3FP6E 1ETRH 1YKTA 3KQBA 5CE1A 1GI0A 1ZR0A 2O8UA 1NM6A 1P04A 2PV9B 2VVVA 3ZZAA 1T8OA 1V2UT 1NFWA 1GMCG 2ILNA 5A8YA 4ABEA 4K1SA 1YPGH 2GMTC 3F6UH 2AS9A 1A7SA 3DUXH 3TLOA 2ALVA 3MI4A 1VR1H 2CF9H 4GHQA 4XBBA 2FM2A 2ZGHA 1FIWA 2ZU4A 4IS5A 2WPJS 1W3CA 3M36A 1WV7H 7ESTE 1BTUA 1Z6JH 1AE5A 1GBMA 2VWNA 3PV4A 2Z9GA 1O2IA 1CQQA 1GJBB 4OS5A 2HNTE 4NWLA 1TA2A 1H1BA 1FJSA 4K5ZA 3SGAE 4CRGA 3V13A 4E7NA 3B8JA 4X2XA 3M7QA 2STBE 1LPKB 1OWJA 4JYVH 1KDQB 3U8TH 4JZDH 1BCUH 2G4UA 3KQEA 2NU0E 1O2TA 1TX6A 2G4TA 5FX6A 3TJUA 2QY0B 4FXGH 2VNTA 2ZFRH 3JZ2B 2W3IA 1IQIA 2Y5GA 3MNBA 4BAMB 5T6GA 1WAYB 1TBQH 2H5DA 1XUIA 5F8TA 2ZCLP 3PO1B 4YESB 1Y5UT 1EB1H 1C1PA 3MMGA 3EGKH 2HVXA 1BRUP 1ABIH 1W10U 2QF0A 1L4ZA 1A1RA 3V7TA 1TNKA 3RUOA 1UCYK 3SV7A 5HXFA 1WYKA 1TOCB 2G5NA 2KAIA 1K1JA 1NZQH 1ANEA 1O5CB 5EOKA 1EXFA 3KCGH 2F9UA 3F9GA 2IJOB 1UVPA 1Y59T 4AFUA 1F0RA 3GDSA 5L30H 2Q6GA 1KXCA 1SL3A 5GJ4B 2ODQA 2BLOA 1ZSKA 1O5BB 3M3SA 2SNWA 4IN1A 4FUCA 1A46H 1MTWA 3QLPH 1FDPA 3E16B 5EXMA 2FYQA 4X8TH 4WJG2 3A7ZA 3TK5A 2B8OH 3I78A 5ESTE 3M37A 1AVXA 2ZFSA 5JYIA 1O2GH 2WPHS 1ZOMA 4FU7A 3MU0A 1GGDC 2NWNA 3RXDA 1SGCA 1LHGH 1S5SA 6LPRA 2ZFFH 1WTHD 3ZYEA 1E37B 5F03A 1GJAB 3PLBA 3RU4D 2ZPQA 5F6MA 1AU8A 2BOKA 3OSYA 1W12U 2ZWLH 4VGCB 3EA7A 2V6NA 3ZZ6A 5AF9H 3KGPA 3RXQA 3URDA 4OS4A 3A82A 1AQ7A 4GSOA 2NU2E 3K65B 3T27A 1J14A 4B2BA 2Y5HA 2QV1A 2BY7X 1QR3E 2TIOA 5EXNA 4ISLA 1IHSH 4GUXA 3BTDE 3U1JB 1FZZA 1BQYA 2H9HA 5I25A 1TMBH 2OXSA 1FAXA 2Q6FA 1AWFH 1BRAA 4JYTA 1XMNB 2SGAA 4ZAEA 1RGQA 2XC0A 5HM2A 1YC0A 4Y0ZE 2QCYA 1GVKB 4O3UA 7LPRA 4CREA 1JRSA 4WXVA 3FZDA 1HUTH 3GCTF 4HI3A 3CP7A 2PKAA 3MFJA 1C2DA 1XUKA 2BLVA 2C3SA 4WWYA 1EUFA 4R0IA 2C8XB 1P2NA 3T28A 2BVXH 1FUJA 2M5TA 1FPHH 3R3GB 5LPFA 1DWEH 2BVSH 5A2MH 1DWBH 1O2HA 1CE5A 3VB7A 3NK8A 4IMQA 3SQHE 1C1OA 1D6WA 3Q00A 9LPRA 1K28D 2ASUB 1LKBA 2XWAA 1HJAC 2ODYB 1KLIH 2XBXA 4CH8B 3DT0H 3QN7A 4Y10E 1VZQH 2FMJA 8GCHF 3UNQA 4ABDA 1Q3XA 2BVRH 4BTUB 1O2YA 5AVDA 2VWOA 3NPSA 3C1KA 3RXLA 1QL9A 3MNXA 3A83A 1FNIA 1JWTA 2ZA5A 3UOPA 2AGEX 1C1TA 3W95A 1MTNC 2UUJB 2Z94A 1GHXH 2W26A 1TRMA 8ESTE 5HYOA 1AVGH 3P8OA 1QFKH 1LVYA 1KY9A 3HKJB 3UFAA 3SJIA 1HFDA 3SUEA 1RD3B 2WPKS 5DP7A 4DY7B 4A5TS 1NRQH 3BF6H 4XOJA 4X8UH 2ZHDA 2BLQA 2FS9A 1L0ZA 1L1NA 2WYJA 1D4PB 4DGJA 4YLUA 4B2CA 6ESTA 1FIZA 1D6RA 2PWXA 1V2RT 2NU1E 4X1PU 3ZZ8A 4FUHA 1YPMH 3URCA 5B6OA 1QL7A 2XW9A 4IC5A 4B2AA 1O32A 2BD5A 2EA3A 3L33A 5DJ7A 3TPIZ 1A0HB 2J34A 3A7WA 3UR6A 5C1UA 3LJJA 3TK6A 2GCTB 3EE0B 4XDEA 1A5HA 1AMHA 1GBLA 1S83A 3TGJE 2A2QH 2K1QA 3VB5A 3NWUA 5DP8A 7GCHF 1C9TA 4B1TA 1GHBF 1GMHF 3A8AA 4NFFA 1FMGA 3IWMA 2ZF0H 1C5MD 1ARBA 1TGCA 1GDNA 1QIXB 4MLFB 3ZVGA 2CHAC 1O3IA 5DP6A 1F2SE 1S81A 3SN8A 1DFPA 1TBZH 1DPOA 2VB0A 1GBTA 1Y3VA 1GPZA 2ULLA 3NCLA 2QXHA 1JIRA 2JKHA 3PLKA 1Q31A 4MPWA 2QXGA 3O8RA 1ZZZA 3AW1A 3MNSA 2Y7ZA 1UK4A 1GJ8B 2ZCHP 3HGNA 6GCHF 1D3TB 2GV7A 1C4Y2 5K0HA 2RA0A 1DX5M 2JH5D 4Q80A 2P93A 1C5LH 2FOGA 2WPIS 1OSSA 3KN2A 3A8DA 3TIUA 5F8XA 1H9LB 5JDUB 1AZ8A 1V2LT 2BDAA 1EP5A 4ISNA 3U69H 1MCTA 3BG4C 2SFAA 3RXCA 1QJ6B 4TPYA 4DT7B 1C5VA 4YTAA 5HM9A 3RXIA 1N8OC 2FOBA 2ZGJA 1C5UA 1SGYE 3A7TA 4X8SH 2FWWA 1INCA 4E7RG 1P0SH 2RCEA 3F9HA 2QAAA 1GMDG 1G2MA 1C5QA 1HIAA 1EJNA 5GCHF 1K1PA 2CJIA 1CBWB 3QUMP 4YOGA 1DSTA 3LONA 1MKXH 3TGKE 1A3EH 1DITH 3MH4A 2IPHA 3SHCH 2EC9H 1HYLA 1G36A 4HTCH 1KXEA 5GDSH 4AYVB 1X7AC 3GDVA 1SFQB 3UUZA 3DD2H 1IQFA 1W11U 1A0LA 3ITIA 1GI6A 2HRVA 2ZPSA 5EQQA 5JBBS 5FBEA 1WTGH 1B0FA 1V2WT 1C1NA 1UTOA 3STJA 2NU4E 2WUBA 2CN0H 3E6PH 1HAZB 1SHHB 2QF3A 2AERH 2PKSB 2XYAA 5CHAB 1AKSB 1WOFA 5E8EH 3RXGA 4UFGH 2PFEA 2PSYA 3T29A 1ELTA 3SZNA 2Y5FA 3ATMA 1O3AA 1EOLA 3E1XB 1HV7A 2AIPA 2VIQA 3P92A 1C2GA 4TWYA 3FZZA 1AFEH 4AORA 1BITA 2J9NA 3QWCH 4Q7XA 2A4QA 4K60A 1XKAC 3V0XA 1XUGA 3SORA 4QT8C 2XXLA 5DGJA 2G81E 2QN5T 2HNTF 4BTIB 4CHAB 1ZTKA 1VGCB 1TYNA 1ZPCA 1ORFA 2J2UA 2VGCB 1L1GA 1O2KA 1MUEB 4THNH 4UE7H 5FPSA 2A45B 2OD3B 1OWDA 2LNCA 4HFPB 2H1UA 3A89A 3RXHA 1ESBA 3A87A 3MWIU 4HGCA 3NKKA 1O0DH 1BHXF 1F5RA 1FY8E 1MMJN 4I32A 2THFB 3MO3A 3OY5U 5EW1H 1E36B 4TY6A 2FPZA 3PB1E 1O3KA 5L2ZH 1G2LA 4IW4E 1Y3UA 4UEHH 4ZMAH 1GHAG 2SGQE 3GCHC 1O33A 3GY7A 3LGVA 1DANH 1EAXA 2A32A 5E0HA 2UWLA 4DCDA 1BMLA 2OUAA 1IQHA 2LIZA 4D7GA 1FY3A 2A7CA 3CS0A 3D23A 3VGCC 2F9OA 1KXBA 4BAHB 1OWHA 4KTCA 1O37A 1GMDF 1YPKH 3ODFA 2OC8A 4U01A 1BJUA 1HRTH 4AGKA 3E3TA 3WY8A 3D62A 2AEIH 1W7XH 1BBRK 5PTPA 4FUBA 1YCPK 1O3DA 3C27B 3OU0A 1IOEA 5EU8A 1O3BA 2CXVA 2OTVA 5AHGH 5A0CA 3GYLB 1EJMA 3UNSA 1Z8RA 2B5TB 1P10A 1AIXH 1JRTA 1NN6A 2Z6BD 1VCWA 3QO6A 1HAXB 1T31A 1K1NA 1LHDH 4K1TA 1QQ4A 5C5NA 1AHTH 1LPGB 3F9EA 3S0NA 3OX7U 1ELEE 1UHBB 1TMTH 1DXWA 1V2MT 1AI8H 5FCRA 5HGGA 5ABWA 2OQ5A 1RRKA 4IMZA 3DFLA 1JBUH 4JZ1A 1UK3A 2PW8H 2XNIA 3PYHA 4O9VA 3SU3A 1EKBB 3SU6A 2GTBA 1PQAA 4Y8ZA 8LPRA 1SMFE 1GG6B 2B7DH 3EA8A 3BG8A 1ZPZA 3ZVBA 3RDZA 1XKBC 1P9SA 4XSKU 1F0UA 3ZZ3A 4MNYA 5TCAA 2R3UA 2A31A 1SLUB 2TGAA 1NC6A 2W3KA 4OS7A 1QTFA 4K8BA 4OS6A 2R0KA 1TNHA 1V2ST 2O8LA 3CENA 1NFXA 1TGNA 1AE8H 2J4IA 2ZGXH 2CMYA 4Y11E 1GHBG 1F5KU 7GCHG 2OBQA 1OYQA 4BOHA 2BYAX 4DG4A 5L2YH 1O3CA 3MU4A 1DVAH 3SU2A 4CBNA 1G3DA 1V2KT 4Y6DA 4O3TA 2ZTZA 4A7IB 3BIUH 2BHGA 2ANKH 5GWZA 2FOHA 1MAXA 2WUCA 2AGIX 1W13U 4O97A 3ZZ7A 3S69A 4AG1A 1AB9B 1C2IA 1GBCA 4X1SU 1GBKA 1RIWC 1W0ZU 3D49H 4MG3A 4GHTA 1QL8A 1XXDA 4JZFH 4KKDA 4Y8XA 1YPHE 3JZ1B 2Q6DA 2P59A 1MH0A 1UTLM 4X1NU 1K2I1 4MNVA 2A4RA 3BTEE 1BJVA 3A88A 2HALA 2OC7A 1CA0C 1IQLA 1EPTC 3UPEA 5C1XA 1O3LA 1W2KH 2DUCA 1QB1A 4UFEH 3PM3A 4FUEA 2CGAA 1B7XB 3GY6A 2C93B 1DM4B 3EA9A 1UVTH 3PLPA 4JCNA 3KIDU 3LC3A 2BOHB 3RM2H 1DY9A 5A0BA 1SLWB 1GI2A 2PGQB 4YT6H 3Q3YA 2P95A 1PQ5A 2VWLA 5DPAA 3VB3A 5EG4A 3GCOA 2HNTC 1LTOA 2BD4A 4B74A 2ZDNA 4CRDA 1W14U 1UTPA 3M7UA 3RXBA 1QRWA 2GKVE 2JETB 2H2ZA 2I6QA 1BMMH 3P17H 4ZKNU 3T5FH 1EAWA 2YNAA 1WSSH 5GXPA 1LMWB 1MKXK 1UMAH 1BA8B 4MNXA 4MVNA 3SV8A 1A61H 4GCHF 4MNWA 1OXGA 5HMAA 3VPKA 5JBCS 1J16A 2FOCA 3SO3A 1IQNA 1YM0A 2ZZUH 1KXDA 1ZHPA 1EAIA 2UUYA 1WQSA 1FPCH 2JH6D 1GGDB 3E0NB 2WYGA 2VJ1A 1GWAA 2BX4A 2QA9E 4TWWA 1V2VT 1GBIA 2ZECA 2F3CE 5E0GA 1Y5BT 4GLYA 1TQ0B 3SNCA 2FX4A 2O9QA 5E2OA 1C5XB 1ESAA 1DLEA 2B9LA 1MD8A 4BANB 2G51A 2F91A 5EW2H 3IITA 1EJAA 3BN9A 2Y6TA 4AZ2B 3ENSB 5H4IB 3N7OA 3U8OH 1GCDA 4XFQA 3RC5A 3RXUA 1O2VA 1LVBA 1ZHMA 1O3PB 1ELCA 2QYIA 4AOQA 1EASA 3S9AA 4NIVA 5G4BA 3B23B 1ELBA 4X8VH 1E35B 1PPBH 4K69A 4I8HA 1DLKB 4LXBH 3SNEA 2A7HA 2C8WB 2V35A 1UCYE 2FEQH 4ZHMU 1PJPA 2BQWB 4X6OA 2WV4A 1SQTA 5AFZH 2A5IA 3MU1A 3TNTA 2FIRH 4FUGA 1SGFA 3PMAB 2BM2A 1WQVH 2ZQ1A 2RA3A 5A8XA 2BDYA 2A0QB 2G55A 1JMOH 2ZGBH 4Q7ZA 4LZ4B 1ZLRA 2O8TA 1Z1JA 3LU9B 1A2CH 4X2WA 1C2EA 1Z8GA 3RXTA 4BAOB 5JBTA 3U1IB 1K21H 1O3MA 1GHZA 3RMLH 4ZHAA 3ZVEA 3LGYA 1SR5C 1ZMNA 1Z7KA 2OC1A 3NXPA 1SGFG 4FU9A 1O2ZA 2R3YA 4I31A 2ZDMA 3LGUA 4BXSA 2W7UA 4IC6A 3QZRA 3UQOA 3VXEH 1T4UH 4HZHA 1TPSA 5EPNA 1C5RA 4FUIA 5DO4H 1GL1A 1VITH 1O34A 2F83A 3KQCA 3ATIA 3O8CA 2AMDA 5EPYA 3I29A 3A84A 2EEKA 3UREA 1FONA 1O2MA 1FQ3A 1T7CA 1C2MA 2ZHWH 2C4FH 1E34B 2Z9KA 1C1MA 3F1SB 3RXJA 4GPGA 1DOJA 3SU4A 1ANCA 1LO6A 1AFQB 1NS3A 1ZTJA 4Y7AA 1SGDE 1SHYA 1P11E 3QX5H 1SC8U 1GI3A 1ZJKA 1GJ9B 3A80A 3BV9B 1OOKB 2ZEBA 3FP8E 2GMTB 2ZU3A 3GCTG 3QZQA 1O2QA 2HPPH 1UVSH 1WUNH 1KIGH 1O2WA 5LGOA 1YLDA 4CRBA 4MTBA 1MBQA 5A0AE 2Z3CA 3GY4A 2OP9A 2VIPA 1EZXC 2WPMS 1ELFA 2EI7A 1GI8B 2ALPA 5IYTA 3A86A 5SGAE 3GY3A 1Z6EA 3ZZ4A 2FXRA 2O8WA 3RXRA 2P8OB 2QC2A 1W7GH 3KF2A 1Y8TA 4JMYA 4PROA 2OCVB 3PMBB 4WF8A 2OLGA 1UCYH 2CHAB 2ZKSA 4B76A 1U6QA 1T8MA 1QGFA 3TJOA 4DVAU 4ZROA 2NU3E 4ABAA 3M7TA 5K7RA 2ZTYA 1EZSC 1GBBA 1YBWA 2A5AA 1G32B 3SNAA 2ZHQH 3Q3KA 1AY6H 2V3OH 1K1OA 1CT2E 1O2UA 1SGTA 3MO9A 1OP8A 3BEUA 1EAUA 1F0TA 3OYPA 2HLCA 3TGIE 4UFDH 5L6NH 1XX9A 1NU7B 1LHCH 1GJCB 3BG4B 2P94A 4A1VA 3UQVA 1WCZA 3PO1C 4UDWH 1SOZA 3M5LA 2F9NA 5FHTA 2D26C 3UOUA 2BB4A 4B73A 1KLTA 3VB6A 1RXPA 1N8OB 4WXIA 1C9PA 1C4U2 2ZCKP 1F0SA 1G3BA 3PROA 1NROH 3LPRA 4K1EA 1EZQA 1O5FH 2W5EA 2R0LA 1Z71A 4FVBA 3RC6A 1W8BH 1NY22 1WBGB 4XBDA 3MTYA 3QGNB 3RXSA 1RS0A 3ZZ5A 2BTCE 3Q3XA 4X2YA 1HDTH 1CBWC 2VIWA 1AWHB 4NG9H 4RKJB 1UTQA 2FO9A 2VINA 4A6LA 4TY7A 1UHBA 1AGJA 1BZXE 3LIWA 3SW2B 2PKAB 1SBWA 3QDZB 1THSH 3RP2A 3ZZBA 2PLXA 5DP9A 1UTNA 4A1TA 2FLBH 1T8NA 4I33A 1ANBA 4ZUHA 1YPLH 2BD8A 2IOTA 3MH5A 2AGGX 3HK3B 3GY2A 4E05H 2PSXA 2ZQ2A 1GBEA 3GY5A 1PFXC 1C5OH 3FAOA 1Z8JB 5CHAC 1ZHRA 1BTZA 1NPMA 1QB9A 5J4SA 3H7OA 2ANYA 3RMMH 1ZYOA 3M5OA 1IHTH 1TOMH 1AVWA 2YNBA 2BQ6B 1TFXA 3Q76A 4MPXA 1YLCA 1BIOA 1OYTH 3A8BA 1KYNA 2V3HH 2QXJA 2ZP0H 3ATLA 1O2OA 1ZJDA 4VGCC 1D3QB 1HXEH 3M5MA 3BTFE 1MBMA 1PPZA 5EODA 3ZZCA 1DE7H 1Z8IB 2GDEH 1OX1A 3EQ0H 1GMCF 1O5EH 2ZFTA 3LGTA 3MU8A 3SU5A 4Q2KA 3ZZ9A 1TIOA 4FU8A 5DP4A 3SUGA 4ABJA 2Z9JA 1GBAA 2A7JA 1PQ7A 4NFEA 1RFNA 3BEFB 3ATWA 2A4GA 4X1RU 5DK1A 2FP7B 5C2ZA 2AYWA 1EPTA 1IQKA 3BTME 3LH1A 1SLVB 1SB1H 2XTTB 1P02A 1SGRE 4D9QA 3M3VA 4NZQA 3K9XB 3M61U 1K1MA 1CSOE 1UK2A 1CHOF 3P70B 4NCYA 4OGXA 1A5GH 5LPRA 3ZVDA 3LOXA 1SSXA 3QK1A 5C3NA 1HLTH 1MAYA 1QHRB 1MKWK 2FS8A 3A81A 4NGAH 2BY9X 4H4FA 5GIBA 1QBOA 2IN2A 4A1XA 1RJXB 1DWCH 1GCTB 4CRAA 1DSUA 1P57B 1BHXB 1TPOA 1SOTA 2FDAA 4RN6A 1C5WB 1HXFH 2TGTA 3R0FA 2FESH 2ZI2H 2PR3A 3SJ8A 2FX6A 1V3XA 3SJOA 2SGFE 1C1WH 3E0PB 7KMEH 1O39A 4I7YH 1THPB 5ESBA 5C1YA 2BX3A 2F9BH 3VXFH 1P2JA 1QURH 1T32A 2D8WA 3QTVH 1JIMA 3S7KB 1BOQA 2GD4B 1ACBE 1PPEE 1SGEE 1MCVA 1FY1A 4WMDA 3SNDA 2V0BA 1A3BH 1PYTD 4R8TB 1TNGA 1F92A 2TRMA 2ZFQH 2G5VA 2FOEA 1LDTT 2B0FA 1VJAU 2FTLE 1OKXA 2R2MB 5EXLA 4FUJA 2QXIA 2PUQH 4ABIA 4FVDA 2PGBB 4AFSA 1GDQA 1C5ZB 1TB6H 3U98H 1TGBA 8GCHG 4ISOA 5CMXH 1P01A 2FTMA 1GJDB 4UONA 3SJKA 3P8GA 3SGBE 3TITA 1PPHE 1AUTC 1QJ7B 2BD9A 1KSNA 2AH4X 4YOJA 2BY5X 2ANWA 1LVOA 1YCPH 2AMQA 4M7GA 2ZTXA 1KXFA 4WH6A 3E90B 2XCFA 4DIHH 2GZ8A 1TAWA 1XUHA 3RLWH 1EZUC 1N6YA 1D9IA 3SI3H 2ZHEH 1C2JA 2GDDA 3T2NA 2FOAA 4J2YB 1TABE 2F9VA 5LH8A 3U9AH 3P8FA 1ID5H 5E0JA 6CHAC 1OWEA 2J95A 1C1UH 4IN2A 2H6MA 3GISB 3SGQE 2Q1JA 1NFUA 1P2IA 2UWOA 1SVPA 5FPTA 3S9BA 3T26A 1G9IE 1UVOA 3SNBA 2A2XH 1G30B 3ZV9A 1DICA 1O2NA 1ABJH 4D76A 4ZH8A 2Y82A 1O2XA 1C1QA 2BZ6H 3FVFB 1IQGA 1YP9A 4OS2A 4KTSA 1O2SA 3LDXH 1P12E 1BT7A 2PTNA 3RXPA 1B0EA 1GHWH 1ETSH 1TBRH 4NA7A 2R9PA 1Z1IA 1VITF 3G01A 1TLDA 1QCPA 1SGNE 3QTOH 5T3HA 1GI4A 1QJ1B 1DWDH 4GVUA 1MTSA 3SV2H 1Y3YA 1ZGIA 1MTUA 4IGDA 3MNCA 1PPFE 1NFYA 1BMNH 1S85A 5FAHA 1FXYA 1IQJA 3KEEA 1YGCH 1EOJA 3GY8A 1NT1A 2H9TH 3T62A 1HAOH 2FODA 1BB0B 1TX8A 3FFGA 1XM1A 3KNXA 1HJ9A 4D7FA 3GICB 4Z6AH 1J9CH 1MTNB 1V6DA 1RTKA 4WMFA 5AFYH 4ZKOU 8KME2 3RXAA 4E06H 4LK4A 1QA0A 1QA7A 3SI4H 2PUXB 1PPCE 4NZLA 4B75A 3E91A 3SUDA 1GL0E 1VCPA 1F5LA 1S6HA 1NRRH 1BUIA 1FAKH 1ANDA 2BXTH 3ZZDA 1QRXA 4INKA 1J15A 3MH7A 3MOCA 3HPTB 1V2PT 2XBVA 3ZVFA 3STIA 1S82A 2P3FH 5J4QA 3BEIB 4CH2B 2BMGB 3SV9A 2Y81A 2VU8E 1UVUH 2Z7FE 4NSYA 3HKIB 5GPIB 1KLJH 1P06A 1O38A 1CT0E 1SI5H 1CGIE 1O35A 4B71A 1QY6A 4K8YA 5EQRA 1K1IA 4K2YA 3BTHE 1O3FA 3QGJA 1BDAA 3SOSA 4A92A 1SQAA 1HAHH 1C2FA 2BD2A 2TPIZ 1ZGVA 2HOBA 3UWIA 1AO5A 2XWBI 3PTBA 1HAIH 5TCCA 3TNSA 5JPMH 3K2UA 1GJ5H 9ESTA 1O5DH 2GZ9A 2H5CA 3P6ZB 1WU1A 2ZNKH 1BBRE 1DUAA 1PQ8A 1K22H 2FI4E 3ATKA 1P9UA 4YLQH 1HAYB 1BTPA 1D3PB 1TMUH 4YO9A 1QNJA 1C5PA 2GP9B 4AG2A 4SGAE 4JYUH 4INLA 1N6XA 2XC4A 3DHKH 1IAUA 1O3NA 2BDHA 2GCHG 2BDIA 1S6FA 5A09A 4F49A 4CRCA 3W94A 2STAE 1SPJA 3GDUA 2RG3A 1GI5A 3TH2H 1UTJA 1XVOA 2BY6X 5I46H 1GI9B 3KL6A 1GJ7B 4H42U 5A8ZA 1V2NT 2BDBA 3GCHB 1NESE 2OC0A 4DJZB 2HWLB 5DG6A 4X0WU 4YOIA 3VGCB 3MYWA 4SGBE 4X1QU 1MQ6A 4BXWA 1A4WH 1O31A 3F9FA 2ESTE 4AFQA 4KGAA 3UWJH 2VVUA 4ASHA 2A4OA 2J38A 1S0RA 3RMNH 4Y71A 3LGIA 1HJ8A 1BTWA 4YT7H 1CO7E 1MTVA 4F4OC 1C5YB 4YZUA 4ABBA 3KQDA 2DE9A 3HATH 3M3TA 4IBLH 4I8KA 1QBVH 1GMHG 1MZAA 1ZPBA 3EYDA 4LOYH 1DXPA 3CS7A 3FP7E 1TGSZ 4MDSA 2QIQA 5T6FA 3T25A 1AFQC 1AD8H 1HBTH 1LPZB 2CF8H 3PMHB 3AAVA 3LH3A 1ESTA 2PKSC 1FV9A 3OY6U 2C8ZB 1O5GH 3DFJA 2ZDKA 4MPVA 1CGHA 1JOUB 1M9UA 1L1JA 4KP0A 1G3CA 4BAKB 4D8NA 2Z9LA 5C5OA 1NU9A 3K6ZA 1OP2A 3RU4T 3BTWE 2HPQH 3O8BA 2RDLA 4KTUA 4DOQA 1PPGE 3VB4A 1P05A 2K7XA 4AYYB 1LVMA 5T6DA 2FZZA 1BRBE 1O3EA 1T4VH 4H6SB 1V2QT 1QBNA 3A7YA 3UIRA 1XUFA 1O3GA 3A85A 1UTKA 5C20A 1O30A 1SQOA 5JB9S 1DS2E 2Y80A 1KTTB 2VGCC 4WMEA 2BD7A 2CV3A 2ZDAH 1VITG 1OWKA 4OS1A 1TONA 1QB6A 5DP5A 2G52A 3H7TA 3GCNA 4JZIA 1E0FD 4FUFA 1CU1A 3M35A 1P2KA 1TRYA 1F7ZA 3BIVH 3MH6A 4ABHA 1BRCE 1BBRH 4U32A 4U2WA 2FYRA 3HGPA 1ARCA 1RIWB 3PWCA 3RLYH 1H8IH 2ANMH 1D3DB 4Q7YA 1BTXA 1OWIA 4X6MA 4I8JA 1P03A 6GCHG 2ZG0H 5FCKA 3GYMA 3SU0A 2Z9IA 3BTTE 4JZEH 5FX5A 2FOMB 1CA0B 3LGWA 1GJ4H 2SGDE 1SGQE 3PWBA 1HJAB 1SLXB 3GOVB 1C5NH 2BQ7B 3RMOH 1OS8A 2EI6A 3RXMA 1LQEA 5DKMA 1EQ9A 1C5SA 1Y3WA 1GI7B 1AZZA 1CA8B 2ZPRA 1FLEE 1YYY1 2TBSA 2A5KA 2GX4A 3ODDA 1Q2WA 1GBHA 4D9RA 2WINI 4J1YA 4JK5A 1GVLA 2VIOA 4ESTE 1SG8B 1O2RA 1FN6A 4Y79A 2VIVA 1C2LA 4NIWA 4TPIZ 1P09A 1ELAA 1LHEH 1NRSH 2KAIB 1NRNH 1EATA 1NO9H 1P3CA 3BTKE 3MU5A 2TGDA 3AASA 1GHAF 5GCHG 2ZIQH 1V2JT 1A5IA 2TGPZ 1EP6A 2ZU1A 3PMJA 4Y8YA 1L2EA 1ZRKA 3ZV8A 1BTHH 5DP3A 2P16A 4Y0YE 2PTCE 1GBFA 3TK9A 2ZO3H 3TH4H 3ZYDA 1P2OA 1C5TA 1PYTC 1QRZA 1GBDA 2VH6A 1O2JA 2XRCA 1XUJA 1YPEH 2PHBA 1SGPE 5ETXA 4DURA 4YM9A 4FUDA 3RXFA 1GG6C 1XVMA 4ZKRU 2SGEE 3AVZA 2H9EH 1O5AB 2ZFPH 1O3HA 3RXKA 1TNJA 2XBYA 5FBIA 2SNVA 1GJ6A 4AB9A 1OP0A 1RTLA 1V2TT 1MU8B 3LJOA 1ZTLA 1Y5AT 1TE0A 2J94A 2BDCA 2GCTC 4AFZA 4RSPA 1C4V2 2ZDLA 1Y3XA 2EI8A 3K6YA 3TVJB 3SUFA 2Z3EA 1NTPA 2BLWA 3H5CB 1FN8A 1C2HA 4NA9H 4BNRA 2GZ7A 1IQMA 3U8RH 1CVWH 4U30A 1HAVB 1DT2A 2OQUA 2GV6A 2J92A 4OGYA 1ELDE 2C8YB 2OBOA 3ELAH 3VEQB 1CT4E 4ZKSU 3TH3H 3RM0H 1DUEA 3F68H 3EDXB 2ZHFH 3LT3A 2ZU2A 1AB9C 1CGJE 2BDGA 1GHVH 2A1DB 4X6PA 1TPPA 1E38B 3RU4E 4BAQB 1H9IE 1K1LA 5LPEA 3AW0A 1HGTH 2ZC9H 4NIYA 1C1SA 2QGRA 3AAUA 4JK6A 3O8DA 1LQDB 1AKSA 3D65E 1BMAA 2D2DA 2AIQA 2XBWA 3S7HB 3PTNA 5F8ZA 1CHGA 1ZSLA 2SGPE 3EBNA 2GT8A 2GCHF 1EPTB 2OINA 4CR5A 2GVFA 1LKAA 5FXLA 1UJ1A 2Z3DA 3E8LA 3LKWA 5EQSA 5JB8S 1GCTC 2JH0D 3RXOA 3EAJA 2UWPA 4MPUA 1GVZA 1L4DA 3HK6B 1MKWH 1T8LA 1FY4A 4LZ1H 2C90B 4TYDA 2DE8A 2VWMA 5E2PA 3UR9A 4CR9A 1MQ5A 1ZRBA 3BTGE 2W7SA 5C67A 1V2OT 3TJVA 1MZDA 1HB0B 1FI8A 1K9OE 1TWXB 1O3OA 4ZXYH 1EB2A 1J8AA 1HAGE 1N1LA 1W0YH 2ZDVH 1OPHB 1YPJH 2FI3E 4ZXXH 2JETC 1A0JA 1UO6A 1SGIB 1TNIA 1KXAA 1ELVA 1ETTH 2XC5A 1GI1A 1TRNA 2G00A 2GGVB 4I8GA 3BSQA 4XBCA 1SFIA 1C2KA 3ZVCA 1XXFA 2BD3A 3P95A 3L3TA 2P3UB 4Y76A 2BZAA 3ZVAA 3OTJE 3ESTA 1P2MA 1H9HE 4BTTB 4NIXA 1C1VH 2D1JA 1S0QA 3SJ9A 4Z0KA 5FPYA 1DDJA 1HAPH 1HAVA 4ABGA 3V12A 5JBAS 1H8DH 1O36A 1VCQA 2VH0A 4ISIH 3UTUH 1P8VC 1TALA 1ZMLA 4O03A 1TPAE 4ZHLU 1CHOG 4WY3A 2Y7XA 3Q77A 1HNEE 3VFEA 2HGTH 2XCNA 1G3EA 4MQAA 4WH8A 4UFFH 2VIDA 1LHFH 1GDUA 2UUKB 1YF4A 4CHAC 3SV6A 1O2PA 1VGCC 2BY8X 4NWKA 3A7XA 1AUJA 1LCYA 1C1RA 6CHAB 2P8OC 3BTQE 3M5NA 3LC5A 4I8LA 1TNLA 3L6PA 3TJNA 1MD7A 4K3JA 2AMPA 4AB8A 1EX3A 3SQEE 4AN7A 1KTSB 2UUFB 2GT7A 1O3JA 3MO6A 4H6TA 2AFQB 2YOLA 1GHYH 4DIIH 5BPEA 2FOFA 5IDKA 4GCHG 4XE4A 2R2WU 4NA8A 2FLRH 1P3EA 1HPGA 2F9PA 1BTYA 1ZSJA 2VVCA 1G37A 4GAWA 1GBJA 1KDQA 4INHA 3S9CA 1DY8A 3FANA
chains in the Genus database with same CATH superfamily
1P2QA 1AN1E 2P3TB 3RC4A 1YCPM 4WVPE 3IG6B 4AX9H 2I6SA 1UTMA 2ODPA 2FI5E 4X6NA 2LPRA 2WPLS 2WV5A 3TU7H 3WW7A 2BXUH 3U28C 1VJ9U 1JXPA 1QQUA 1TX7A 1NRPH 3SU1A 3UNRA 1J17T 1B5GH 4X2VA 1HCGA 3I77A 1ELGA 3A7VA 5EGMA 4CRFA 1TGTA 1TQ7B 5DN6D 3NZIA 4KELA 1THRH 4DW2U 1TA6A 4CBOA 1MU6B 3DA9B 3SHAH 2ZGCA 1RTFB 1O2LA 3P8NA 4NSVA 1HIAB 4UD9H 4ABFA 2ZU5A 1ZMJA 3DSPA 3UY9A 3NUMA 4AGJA 3V3MA 3KHVA 2G8TA 3RXEA 4ISHH 2O8MA 1H4WA 1YPHC 3A8CA 3F0PA 3MHWU 4Y7BA 3RXVA 1IQEA 3B9FH 5BRRE 5TJXA 3SBKA 4RKOB 1S84A 1FY5A 3FP6E 1ETRH 1YKTA 3KQBA 5CE1A 3MQKC 1GI0A 1ZR0A 2O8UA 1NM6A 1P04A 2PV9B 2VVVA 3ZZAA 1T8OA 1V2UT 1NFWA 3FO8D 5C94A 1GMCG 2ILNA 5A8YA 4ABEA 4K1SA 1YPGH 2GMTC 3F6UH 2AS9A 1A7SA 3DUXH 3TLOA 2ALVA 3MI4A 1VR1H 2CF9H 4GHQA 4XBBA 2FM2A 2ZGHA 1FIWA 2ZU4A 4IS5A 2WPJS 2K0QA 1W3CA 3M36A 1WV7H 7ESTE 1BTUA 1Z6JH 1AE5A 1GBMA 2VWNA 3PV4A 2Z9GA 1O2IA 1CQQA 1GJBB 4OS5A 2HNTE 4NWLA 1TA2A 1H1BA 1FJSA 2RDEA 4K5ZA 3SGAE 4CRGA 3V13A 4E7NA 3B8JA 4X2XA 3M7QA 2STBE 1LPKB 1COWD 1OWJA 4JYVH 1KDQB 3U8TH 4JZDH 1BCUH 2G4UA 3KQEA 2NU0E 1O2TA 1TX6A 2G4TA 5FX6A 2J98A 3TJUA 2QY0B 4FXGH 2VNTA 2ZFRH 3JZ2B 2W3IA 1IQIA 2Y5GA 3MNBA 3WWFA 4BAMB 5T6GA 1WAYB 1TBQH 2H5DA 3FN8A 4XRNA 1XUIA 5F8TA 2ZCLP 3PO1B 4YESB 1Y5UT 1EB1H 1C1PA 3MMGA 3EGKH 2HVXA 5T1VA 1BRUP 1ABIH 1W10U 2QF0A 1L4ZA 1A1RA 3V7TA 1TNKA 3RUOA 1UCYK 3SV7A 5HXFA 1WYKA 1TOCB 2G5NA 2KAIA 1K1JA 1NZQH 1ANEA 1SQRA 1O5CB 5EOKA 1EXFA 3KCGH 2F9UA 3F9GA 2IJOB 1UVPA 1Y59T 4AFUA 1F0RA 3GDSA 5L30H 2Q6GA 1KXCA 1SL3A 5GJ4B 2ODQA 2BLOA 1ZSKA 1O5BB 3M3SA 2SNWA 4IN1A 2W6JD 4FUCA 1A46H 3VG8A 1MTWA 3QLPH 1FDPA 3E16B 5EXMA 2FYQA 4X8TH 4WJG2 3A7ZA 3TK5A 2B8OH 3I78A 5ESTE 3M37A 1AVXA 2ZFSA 5JYIA 1O2GH 2WPHS 1ZOMA 4FU7A 3MU0A 1GGDC 2NWNA 3RXDA 1SGCA 1LHGH 1S5SA 6LPRA 2ZFFH 1WTHD 3ZYEA 1E37B 5F03A 3NRLA 1GJAB 3PLBA 3RU4D 2ZPQA 5F6MA 1AU8A 2BOKA 3OSYA 1W12U 2ZWLH 4VGCB 3EA7A 2V6NA 3ZZ6A 5AF9H 3KGPA 3RXQA 3URDA 4OS4A 3A82A 1AQ7A 4GSOA 2NU2E 3K65B 3T27A 3DCLA 1J14A 4B2BA 2Y5HA 2QV1A 2BY7X 1QR3E 3UB0A 2TIOA 5EXNA 4ISLA 1IHSH 4GUXA 3BTDE 3U1JB 1FZZA 1BQYA 2H9HA 5I25A 1TMBH 2OXSA 1FAXA 2Q6FA 1AWFH 1BRAA 4JYTA 1XMNB 2SGAA 4ZAEA 1RGQA 2XC0A 5HM2A 1YC0A 4Y0ZE 2QCYA 1GVKB 4O3UA 7LPRA 4CREA 1JRSA 4WXVA 2JJ2D 3FZDA 1HUTH 3GCTF 4HI3A 3CP7A 2PKAA 3MFJA 1C2DA 1XUKA 2BLVA 2C3SA 4WWYA 1EUFA 4R0IA 2C8XB 1P2NA 3T28A 2BVXH 1FUJA 2M5TA 1FPHH 3R3GB 5LPFA 1DWEH 2BVSH 5A2MH 2WZQA 1DWBH 1O2HA 1E1QD 1CE5A 3VB7A 3NK8A 4IMQA 3SQHE 1C1OA 1D6WA 3Q00A 9LPRA 1K28D 2ASUB 1LKBA 2XWAA 1HJAC 2ODYB 1KLIH 2XBXA 4CH8B 2LP6A 3DT0H 3QN7A 4Y10E 1VZQH 2FMJA 8GCHF 3UNQA 4ABDA 1QZ8A 1Q3XA 2BVRH 4BTUB 1O2YA 5AVDA 2VWOA 3EE7A 3NPSA 3C1KA 3RXLA 1QL9A 3MNXA 3A83A 1FNIA 1JWTA 2ZA5A 3UOPA 2AGEX 1C1TA 3W95A 1MTNC 2UUJB 2Z94A 1GHXH 2W26A 1TRMA 4DT4A 8ESTE 5HYOA 1AVGH 3P8OA 1QFKH 1LVYA 1KY9A 3HKJB 3UFAA 5B6LA 3SJIA 1HFDA 3SUEA 1RD3B 2WPKS 5DP7A 4DY7B 4A5TS 1NRQH 3BF6H 4XOJA 4X8UH 2ZHDA 2BLQA 2FS9A 1L0ZA 1L1NA 2WYJA 1D4PB 4DGJA 4YLUA 4B2CA 6ESTA 1FIZA 1D6RA 2PWXA 1V2RT 2NU1E 2GJGA 4X1PU 3OFND 3ZZ8A 4FUHA 4P00A 1YPMH 3URCA 5B6OA 1QL7A 2XW9A 4IC5A 4B2AA 1O32A 2BD5A 2EA3A 3L33A 5DJ7A 3TPIZ 1A0HB 2J34A 3A7WA 3UR6A 5C1UA 3LJJA 3TK6A 2GCTB 3EE0B 4XDEA 2PP6A 1A5HA 1AMHA 1GBLA 1S83A 3TGJE 2A2QH 2K1QA 3VB5A 3NWUA 3WWBA 5DP8A 7GCHF 1C9TA 4B1TA 1GHBF 1GMHF 3A8AA 4NFFA 1FMGA 3IWMA 2ZF0H 1C5MD 1ARBA 1TGCA 1GDNA 1QIXB 4MLFB 3ZVGA 2CHAC 1O3IA 5DP6A 1F2SE 1S81A 3SN8A 1DFPA 1TBZH 1DPOA 2RFKC 2VB0A 3SZEA 1GBTA 1Y3VA 1GPZA 2ULLA 3NCLA 2QXHA 1JIRA 2JKHA 3OEED 3PLKA 2QF4A 1Q31A 4MPWA 2QXGA 3O8RA 1ZZZA 3AW1A 3MNSA 2Y7ZA 1UK4A 1GJ8B 2ZCHP 3HGNA 6GCHF 1D3TB 2GV7A 1C4Y2 5K0HA 2RA0A 1DX5M 2JH5D 4Q80A 5FL7D 2P93A 1C5LH 2FOGA 2WPIS 1OSSA 3KN2A 3A8DA 3TIUA 5F8XA 1H9LB 5JDUB 1AZ8A 1V2LT 2BDAA 1EP5A 4ISNA 3U69H 1MCTA 3BG4C 2SFAA 3RXCA 5CDFE 1QJ6B 3N7DA 4TPYA 4DT7B 1C5VA 4YTAA 5HM9A 3RXIA 1N8OC 2FOBA 2ZGJA 1C5UA 1SGYE 3A7TA 4X8SH 2FWWA 1INCA 4E7RG 1P0SH 2RCEA 3F9HA 1GMDG 2QAAA 1G2MA 3CNRA 1C5QA 1HIAA 1EJNA 5GCHF 1K1PA 2CJIA 1CBWB 3QUMP 4YOGA 2QF5A 1DSTA 3LONA 1MKXH 3TGKE 1A3EH 1DITH 3MH4A 2IPHA 3SHCH 2EC9H 1HYLA 1G36A 4HTCH 1KXEA 5GDSH 4AYVB 1X7AC 3GDVA 1SFQB 3UUZA 3DD2H 1IQFA 1W11U 1A0LA 3ITIA 1GI6A 2HRVA 2ZPSA 5EQQA 5JBBS 5FBEA 1WTGH 1B0FA 1V2WT 1C1NA 1UTOA 3STJA 2NU4E 2WUBA 4OM9A 2CN0H 3E6PH 1HAZB 1SHHB 2QF3A 2AERH 2PKSB 2XYAA 5CHAB 1AKSB 1WOFA 5E8EH 3RXGA 4UFGH 2PFEA 2PSYA 3T29A 1ELTA 3SZNA 2Y5FA 3ATMA 1O3AA 1EOLA 3E1XB 1HV7A 2AIPA 2HLDD 2VIQA 3P92A 1C2GA 4TWYA 3FZZA 1AFEH 4AORA 1BITA 2J9NA 3QWCH 2QE7D 4Q7XA 2A4QA 4K60A 1XKAC 3V0XA 1XUGA 3SORA 3OTPA 4QT8C 2XXLA 5DGJA 2G81E 2QN5T 2HNTF 4BTIB 4CHAB 1ZTKA 1VGCB 1TYNA 1ZPCA 1ORFA 2J2UA 2VGCB 1L1GA 1O2KA 1MUEB 4THNH 4UE7H 5FPSA 2A45B 2OD3B 1OWDA 2LNCA 4HFPB 2H1UA 3A89A 3RXHA 1ESBA 3A87A 3MWIU 4HGCA 3NKKA 1O0DH 3FOAA 1BHXF 1F5RA 1FY8E 1MMJN 4I32A 2THFB 3MO3A 3OY5U 5EW1H 1E36B 4TY6A 2FPZA 3PB1E 1O3KA 5L2ZH 1G2LA 4IW4E 1Y3UA 4UEHH 4ZMAH 1GHAG 2SGQE 3GCHC 1O33A 2JJ1D 3GY7A 3LGVA 1DANH 1EAXA 2A32A 2IPQX 5E0HA 2UWLA 4DCDA 1BMLA 2OUAA 1IQHA 2LIZA 4D7GA 1FY3A 2A7CA 3CS0A 3D23A 3VGCC 2F9OA 1KXBA 4BAHB 1OWHA 1SKYE 4KTCA 1O37A 1GMDF 1YPKH 3ODFA 2OC8A 4U01A 1BJUA 1HRTH 4AGKA 3E3TA 3WY8A 3D62A 2AEIH 5EJZA 1W7XH 1BBRK 5PTPA 4FUBA 1YCPK 1O3DA 3C27B 3OU0A 1IOEA 5EU8A 1O3BA 2CXVA 2OTVA 5AHGH 5A0CA 3GYLB 1EJMA 3UNSA 1Z8RA 2B5TB 1P10A 1AIXH 1JRTA 1NN6A 2Z6BD 1VCWA 3OEHD 3QO6A 1HAXB 1T31A 1K1NA 1LHDH 4K1TA 1QQ4A 5C5NA 1AHTH 1LPGB 3F9EA 3S0NA 3OX7U 1ELEE 1UHBB 1TMTH 1DXWA 1V2MT 1AI8H 5FCRA 5HGGA 5ABWA 2OQ5A 1RRKA 4IMZA 3DFLA 1JBUH 4JZ1A 1UK3A 2PW8H 2XNIA 3PYHA 4O9VA 3SU3A 1EKBB 3SU6A 2GTBA 1PQAA 4Y8ZA 8LPRA 1SMFE 1GG6B 2B7DH 3EA8A 3BG8A 1ZPZA 3ZVBA 3RDZA 1XKBC 1P9SA 4XSKU 1F0UA 3ZZ3A 4MNYA 5TCAA 2R3UA 2A31A 1SLUB 2TGAA 1NC6A 2W3KA 4OS7A 1QTFA 4K8BA 4OS6A 2R0KA 2OK5A 1TNHA 1V2ST 2O8LA 4ZCNA 3CENA 1NFXA 1TGNA 1AE8H 2J4IA 2ZGXH 2CMYA 4Y11E 1GHBG 1F5KU 7GCHG 2OBQA 1OYQA 4BOHA 2BYAX 4DG4A 5L2YH 1O3CA 3MU4A 1DVAH 3SU2A 4CBNA 1G3DA 1V2KT 4Y6DA 4O3TA 2ZTZA 4A7IB 3BIUH 2BHGA 2ANKH 5GWZA 2FOHA 1MAXA 2KCPA 2WUCA 2AGIX 5F53A 1W13U 4O97A 3ZZ7A 3S69A 4AG1A 1AB9B 1C2IA 1GBCA 4X1SU 1GBKA 1RIWC 1W0ZU 3D49H 4MG3A 4GHTA 1QL8A 1XXDA 4JZFH 4KKDA 4Y8XA 1YPHE 5CHBA 3JZ1B 2Q6DA 2P59A 1MH0A 1UTLM 4X1NU 1K2I1 4MNVA 2A4RA 2CK3D 3BTEE 3KQ5A 1BJVA 3A88A 2OC7A 2HALA 1CA0C 1IQLA 1EPTC 3UPEA 5C1XA 1O3LA 1W2KH 2DUCA 1QB1A 4UFEH 3PM3A 4FUEA 2CGAA 1B7XB 3GY6A 2C93B 1DM4B 3EA9A 1UVTH 3AK5A 3PLPA 4JCNA 3KIDU 3LC3A 2BOHB 3H09A 3RM2H 1DY9A 5A0BA 1SLWB 1GI2A 2PGQB 4YT6H 2W6ID 3Q3YA 2P95A 1PQ5A 2VWLA 5DPAA 3VB3A 5EG4A 3GCOA 1YWUA 2HNTC 2L6OA 1LTOA 2KZ4A 2AHME 2BD4A 4B74A 2ZDNA 4CRDA 1YLNA 1W14U 3UAIC 4B6EA 1UTPA 3M7UA 3RXBA 1QRWA 2GKVE 1WDIA 2JETB 2H2ZA 2I6QA 1BMMH 2J5UA 3P17H 4ZKNU 3T5FH 1EAWA 2YNAA 1WSSH 5GXPA 1LMWB 1MKXK 1UMAH 1BA8B 4MNXA 4MVNA 3SV8A 1A61H 4GCHF 4MNWA 1OXGA 5HMAA 3VPKA 5JBCS 1J16A 1H8ED 2FOCA 3F0OA 3SO3A 1IQNA 1YM0A 2ZZUH 1KXDA 1ZHPA 1EAIA 2UUYA 1WQSA 1FPCH 2JH6D 1GGDB 3E0NB 2WYGA 2VJ1A 1GWAA 2BX4A 2QA9E 4TWWA 1V2VT 1GBIA 2ZECA 2F3CE 1UW7A 1Y5BT 5E0GA 4GLYA 1TQ0B 3SNCA 2FX4A 2O9QA 5E2OA 1C5XB 1ESAA 1DLEA 2B9LA 1MD8A 4BANB 2G51A 2F91A 5EW2H 3IITA 1EJAA 3BN9A 2Y6TA 4AZ2B 3ENSB 5H4IB 3N7OA 3U8OH 1GCDA 4XFQA 3RC5A 3RXUA 1O2VA 1LVBA 1ZHMA 1O3PB 1ELCA 2QYIA 4AOQA 1EASA 3S9AA 4NIVA 5G4BA 3B23B 1ELBA 4X8VH 4B6FA 1E35B 1PPBH 4K69A 4I8HA 1DLKB 4LXBH 3SNEA 2A7HA 2C8WB 2V35A 1UCYE 2FEQH 4ZHMU 1PJPA 2BQWB 4X6OA 2WV4A 5HIYA 1SQTA 5AFZH 2A5IA 5C0UA 3MU1A 3TNTA 2FIRH 4FUGA 1SGFA 3PMAB 2BM2A 1WQVH 2ZQ1A 2RA3A 5A8XA 2BDYA 2A0QB 2G55A 3FKSD 1JMOH 2ZGBH 4Q7ZA 4LZ4B 2O8TA 1ZLRA 1Z1JA 3LU9B 1A2CH 1BMFD 4X2WA 1C2EA 1Z8GA 3RXTA 4BAOB 5JBTA 3U1IB 1K21H 1O3MA 1GHZA 3RMLH 4ZHAA 5GNDA 3ZVEA 3GS9A 2JIZD 3LGYA 1SR5C 1ZMNA 1Z7KA 2OC1A 3NXPA 1SGFG 1H8HD 1O2ZA 2R3YA 4FU9A 4I31A 2ZDMA 3LGUA 4BXSA 2EQNA 2W7UA 4IC6A 2XOKD 3QZRA 3UQOA 3VXEH 4AC9A 1T4UH 4HZHA 1TPSA 5EPNA 1C5RA 1FX0B 4FUIA 5DO4H 1GL1A 1VITH 1O34A 2F83A 3KQCA 3ATIA 3O8CA 2AMDA 5EPYA 3I29A 3A84A 2EEKA 3UREA 1FONA 1O2MA 1FQ3A 1T7CA 1C2MA 2ZHWH 2C4FH 1E34B 2Z9KA 1C1MA 3F1SB 2J98B 4GPGA 3RXJA 1DOJA 3SU4A 1ANCA 1LO6A 1AFQB 1NS3A 1ZTJA 4Y7AA 1SGDE 1SHYA 1P11E 3QX5H 1SC8U 1GI3A 1ZJKA 1GJ9B 3PV5A 3A80A 3BV9B 4HG6A 1OOKB 2ZEBA 2WSSD 2GMTB 3FP8E 2ZU3A 1NBME 3GCTG 3QZQA 1O2QA 2HPPH 1UVSH 1WUNH 1KIGH 1O2WA 5LGOA 1YLDA 4CRBA 2YMSC 4MTBA 1MBQA 1NBMD 5A0AE 2Z3CA 3GY4A 2OP9A 2VIPA 1EZXC 2WPMS 1ELFA 2EI7A 1GI8B 2ALPA 4RT1A 5IYTA 3A86A 5SGAE 3GY3A 1Z6EA 3ZZ4A 2FXRA 2O8WA 2IJD1 3RXRA 1E79D 2P8OB 2QC2A 1W7GH 3KF2A 1Y8TA 4JMYA 4PROA 2OCVB 3PMBB 4WF8A 2OLGA 1UCYH 2CHAB 2ZKSA 4B76A 1U6QA 3PRDA 1T8MA 1QGFA 3TJOA 4DVAU 4ZROA 2NU3E 4ABAA 3M7TA 5K7RA 2ZTYA 1EZSC 1GBBA 1WXRA 1YBWA 2A5AA 1G32B 3SNAA 2ZHQH 3Q3KA 1AY6H 2V3OH 1K1OA 1CT2E 1O2UA 1SGTA 3MO9A 1OP8A 3BEUA 1EAUA 1F0TA 3OYPA 2HLCA 2J97A 4UFDH 5L6NH 1XX9A 3TGIE 2WHXA 1NU7B 1LHCH 1GJCB 3BG4B 2P94A 4A1VA 3UQVA 1WCZA 3PO1C 4UDWH 1SOZA 3M5LA 2F9NA 5FHTA 2D26C 3UOUA 2BB4A 4B73A 1KLTA 3VB6A 1RXPA 1N8OB 4WXIA 1C9PA 4I86A 1C4U2 2ZCKP 1F0SA 1G3BA 3PROA 1NROH 3LPRA 4K1EA 1EZQA 1O5FH 2W5EA 2R0LA 1Z71A 4FVBA 3RC6A 1W8BH 1NY22 1WBGB 4XBDA 5KECA 3MTYA 3QGNB 3RXSA 1RS0A 3ZZ5A 2BTCE 3Q3XA 4X2YA 1HDTH 1CBWC 2VIWA 1AWHB 4NG9H 4RKJB 1UTQA 2FO9A 2VINA 4A6LA 4TY7A 2KX4A 1UHBA 1AGJA 1BZXE 3LIWA 3SW2B 2PKAB 1SBWA 3QDZB 1THSH 3RP2A 3ZZBA 2PLXA 5DP9A 1UTNA 4A1TA 2FLBH 1T8NA 4Q4LA 4I33A 1ANBA 4ZUHA 1YPLH 2BD8A 2IOTA 3MH5A 2AGGX 3HK3B 3GY2A 4E05H 2PSXA 2ZQ2A 1GBEA 3GY5A 1PFXC 1C5OH 3FAOA 1Z8JB 5CHAC 1ZHRA 1BTZA 1NPMA 1QB9A 5J4SA 3H7OA 2ANYA 3RMMH 1ZYOA 3M5OA 1IHTH 1TOMH 1AVWA 2YNBA 2BQ6B 1TFXA 3Q76A 4MPXA 1YLCA 1BIOA 1OYTH 3A8BA 1KYNA 2V3HH 2QXJA 2ZP0H 3ATLA 1O2OA 1ZJDA 4VGCC 1D3QB 3F3BA 1HXEH 3M5MA 3BTFE 1MBMA 1PPZA 5EODA 3ZZCA 1DE7H 1Z8IB 2GDEH 1OX1A 3EQ0H 1GMCF 1O5EH 2ZFTA 3LGTA 3MU8A 3SU5A 4Q2KA 3ZZ9A 1TIOA 4FU8A 5DP4A 3SUGA 4ABJA 4F55A 2Z9JA 1GBAA 2A7JA 1PQ7A 4NFEA 1RFNA 3BEFB 3ATWA 2A4GA 4X1RU 5DK1A 2FP7B 5C2ZA 2AYWA 1EPTA 1IQKA 3BTME 3LH1A 1SLVB 4FOUC 1SB1H 2XTTB 1P02A 1SGRE 4D9QA 3M3VA 3DSOA 4NZQA 3K9XB 3M61U 1K1MA 1CSOE 1UK2A 3F2GA 1CHOF 3P70B 4NCYA 4OGXA 1A5GH 5LPRA 3ZVDA 3LOXA 1SSXA 3QK1A 5C3NA 1HLTH 1MAYA 1QHRB 1MKWK 2FS8A 3A81A 4NGAH 2BY9X 4H4FA 5GIBA 1QBOA 2IN2A 4A1XA 1RJXB 1DWCH 1GCTB 4CRAA 5EJ1A 1DSUA 1P57B 1BHXB 1TPOA 1SOTA 2F43B 2FDAA 4RN6A 1C5WB 1HXFH 2M2AA 2TGTA 3R0FA 2FESH 2ZI2H 2PR3A 3SJ8A 2FX6A 1V3XA 3SJOA 2SGFE 1C1WH 3E0PB 7KMEH 1O39A 4I7YH 1THPB 5ESBA 5C1YA 2BX3A 2F9BH 3VXFH 1P2JA 1QURH 1T32A 2D8WA 3QTVH 1JIMA 3S7KB 1BOQA 2GD4B 1ACBE 1PPEE 1SGEE 1MCVA 1FY1A 4WMDA 3SNDA 2V0BA 1A3BH 1PYTD 4R8TB 1TNGA 1F92A 2TRMA 1E1RD 2ZFQH 2G5VA 2FOEA 1LDTT 2B0FA 1VJAU 2FTLE 1OKXA 2R2MB 5EXLA 4FUJA 2QXIA 2KR7A 2PUQH 4ABIA 4FVDA 2PGBB 4AFSA 1GDQA 1C5ZB 1TB6H 3U98H 1TGBA 8GCHG 4ISOA 5CMXH 1P01A 2FTMA 1GJDB 4UONA 3SJKA 3P8GA 3SGBE 3TITA 1PPHE 1AUTC 1QJ7B 2BD9A 3OAAD 1KSNA 2AH4X 4YOJA 2BY5X 2ANWA 1LVOA 1YCPH 2AMQA 4M7GA 2ZTXA 1KXFA 4WH6A 3E90B 2XCFA 4DIHH 2GZ8A 1TAWA 1XUHA 3RLWH 1EZUC 1N6YA 1D9IA 3SI3H 2ZHEH 1C2JA 2GDDA 3T2NA 2FOAA 4J2YB 1TABE 2F9VA 5DSFA 5LH8A 3U9AH 3P8FA 1ID5H 4RT0A 5E0JA 1OWEA 6CHAC 2J95A 1C1UH 4IN2A 2H6MA 3GISB 3SGQE 2Q1JA 1NFUA 1P2IA 2UWOA 1SVPA 5FPTA 3S9BA 3T26A 1G9IE 1UVOA 3SNBA 2A2XH 1G30B 3ZV9A 1DICA 1O2NA 1ABJH 4D76A 4ZH8A 2Y82A 1O2XA 1C1QA 2KCOA 2BZ6H 3FVFB 1IQGA 1YP9A 4OS2A 4KTSA 1O2SA 1OHHD 1P12E 3LDXH 2PTNA 1BT7A 2LELA 3RXPA 1B0EA 1GHWH 1ETSH 1TBRH 3N7EA 2R9PA 1Z1IA 4NA7A 1VITF 3G01A 1TLDA 1QCPA 1SGNE 3QTOH 5T3HA 1GI4A 1QJ1B 1DWDH 4GVUA 1MTSA 3SV2H 1Y3YA 1ZGIA 4P02A 1MTUA 4IGDA 3MNCA 1PPFE 1NFYA 1BMNH 1S85A 5FAHA 1FXYA 1IQJA 3KEEA 1YGCH 1EOJA 3GY8A 1NT1A 2H9TH 2V7QD 3T62A 1HAOH 2FODA 2KCYA 1BB0B 1TX8A 3FFGA 1XM1A 3KNXA 1HJ9A 4D7FA 3GICB 4Z6AH 1J9CH 1MTNB 1V6DA 4F48B 1RTKA 4WMFA 5AFYH 1K0HA 4ZKOU 2YMSD 8KME2 3RXAA 4E06H 4LK4A 1QA0A 1QA7A 3SI4H 2PUXB 1PPCE 4NZLA 4B75A 3E91A 3SUDA 1GL0E 1VCPA 1F5LA 1S6HA 2L74A 1NRRH 1BUIA 1FAKH 1ANDA 2BXTH 3ZZDA 1QRXA 4INKA 1J15A 3MH7A 3MOCA 3HPTB 1V2PT 2XBVA 3ZVFA 3STIA 1S82A 2P3FH 5J4QA 3BEIB 4CH2B 2BMGB 3F2HA 3SV9A 2Y81A 2VU8E 1UVUH 2Z7FE 4NSYA 3HKIB 5GPIB 1KLJH 1P06A 1O38A 1CT0E 1YY3A 1SI5H 1CGIE 1O35A 4B71A 1MABB 1QY6A 4K8YA 5EQRA 1K1IA 4K2YA 3BTHE 1O3FA 3QGJA 1BDAA 3SOSA 4A92A 1SQAA 1HAHH 1C2FA 2BD2A 2TPIZ 3DSGA 1ZGVA 2HOBA 3UWIA 1AO5A 2XWBI 3PTBA 1HAIH 5TCCA 3TNSA 2WV9A 5JPMH 3K2UA 1GJ5H 3KYGA 9ESTA 1O5DH 2GZ9A 2H5CA 3P6ZB 1WU1A 4RI0A 2ZNKH 1BBRE 1DUAA 1PQ8A 1S6LA 1K22H 2FI4E 3ATKA 1P9UA 4YLQH 1HAYB 1BTPA 1D3PB 1TMUH 4YO9A 1QNJA 1C5PA 2GP9B 4AG2A 4SGAE 4JYUH 4INLA 1N6XA 5HIZA 2XC4A 3DHKH 1IAUA 1O3NA 2BDHA 2GCHG 4ACAA 2BDIA 1S6FA 5A09A 4F49A 4CRCA 3W94A 2STAE 1SPJA 3GDUA 2RG3A 1GI5A 3TH2H 1UTJA 1XVOA 2BY6X 5I46H 1GI9B 3KL6A 1GJ7B 4H42U 5A8ZA 1V2NT 2BDBA 3GCHB 1NESE 2XNDD 2OC0A 4DJZB 2HWLB 5DG6A 2K8IA 4X0WU 4YOIA 3VGCB 3MYWA 4YXWD 5C0TA 4SGBE 4X1QU 1MQ6A 4Z1MD 4BXWA 1A4WH 1O31A 2KFWA 3F9FA 4ASUD 2ESTE 4AFQA 4KGAA 3UWJH 2VVUA 4ASHA 2A4OA 2J38A 1S0RA 3RMNH 4Y71A 3LGIA 1HJ8A 1BTWA 4YT7H 1CO7E 1MTVA 4F4OC 1C5YB 4YZUA 4ABBA 3KQDA 2DE9A 3HATH 3M3TA 4IBLH 4I8KA 1QBVH 1GMHG 1MZAA 1ZPBA 3EYDA 4LOYH 1DXPA 3CS7A 3FP7E 1TGSZ 4MDSA 2QIQA 5T6FA 3T25A 1AFQC 1AD8H 1HBTH 1LPZB 2CF8H 3PMHB 3AAVA 3LH3A 1ESTA 2PKSC 1FV9A 3OY6U 2C8ZB 1O5GH 3DFJA 2ZDKA 4MPVA 1CGHA 1JOUB 1M9UA 1L1JA 4KP0A 1G3CA 4BAKB 4D8NA 2Z9LA 3W1EA 5C5OA 1NU9A 3K6ZA 2HVYB 1OP2A 3RU4T 3BTWE 2HPQH 3O8BA 2RDLA 4KTUA 4DOQA 1PPGE 3VB4A 1P05A 2K7XA 4AYYB 1LVMA 5T6DA 2FZZA 1BRBE 2YMSB 1O3EA 1T4VH 4H6SB 1V2QT 1QBNA 3A7YA 3UIRA 5HKKD 1XUFA 1O3GA 3A85A 1UTKA 5C20A 1O30A 1SQOA 5JB9S 1DS2E 2Y80A 1KTTB 2VGCC 4WMEA 2BD7A 2CV3A 2ZDAH 1VITG 1OWKA 4OS1A 1TONA 1QB6A 5DP5A 2G52A 3H7TA 2KCAA 3GCNA 2F4LA 4JZIA 1E0FD 4FUFA 1CU1A 3M35A 4XD7D 1P2KA 1TRYA 1F7ZA 3BIVH 3MH6A 4ABHA 1BRCE 1BBRH 4U32A 4U2WA 2FYRA 3HGPA 1ARCA 1RIWB 3PWCA 3RLYH 1H8IH 2ANMH 1D3DB 4Q7YA 1BTXA 1OWIA 3PRBA 4X6MA 4I8JA 1P03A 6GCHG 1KMHB 2ZG0H 5FCKA 3GYMA 3SU0A 2Z9IA 3BTTE 4JZEH 5FX5A 2FOMB 1CA0B 3LGWA 5C17A 1GJ4H 1SGQE 2SGDE 3PWBA 1HJAB 1SLXB 3GOVB 1C5NH 2BQ7B 3RMOH 1OS8A 2EI6A 3RXMA 1LQEA 5DKMA 1EQ9A 1C5SA 1Y3WA 1GI7B 1AZZA 1CA8B 2ZPRA 1FLEE 1YYY1 2TBSA 2A5KA 2GX4A 3ODDA 1Q2WA 1GBHA 4D9RA 2WINI 4J1YA 4JK5A 1GVLA 2VIOA 4ESTE 1SG8B 1O2RA 1FN6A 4Y79A 2VIVA 1C2LA 4NIWA 4TPIZ 1P09A 1ELAA 1LHEH 1EFRD 1NRSH 3ZIAD 2KAIB 1NRNH 1EATA 1NO9H 1P3CA 3BTKE 3MU5A 2TGDA 3AASA 1GHAF 5GCHG 2ZIQH 1V2JT 1A5IA 1EP6A 2TGPZ 2ZU1A 3PMJA 4Y8YA 1L2EA 1ZRKA 3ZV8A 1BTHH 5DP3A 2P16A 3PV2A 4Y0YE 2PTCE 1GBFA 3TK9A 4Q63A 2ZO3H 3TH4H 3ZYDA 1P2OA 1C5TA 1PYTC 1QRZA 1GBDA 2VH6A 1O2JA 2XRCA 1XUJA 1YPEH 2PHBA 1SGPE 5ETXA 4DURA 4YM9A 4FUDA 3RXFA 1GG6C 2WPDD 1XVMA 3F2FA 3OE7D 2SGEE 3AVZA 4ZKRU 2H9EH 1O5AB 2ZFPH 1O3HA 3RXKA 1TNJA 2XBYA 5FBIA 2SNVA 1GJ6A 4AB9A 1OP0A 5IK2D 1RTLA 1V2TT 1MU8B 3LJOA 1ZTLA 1Y5AT 1TE0A 2J94A 2BDCA 2GCTC 4AFZA 4RSPA 2VBCA 1C4V2 2ZDLA 1Y3XA 2EI8A 3K6YA 3TVJB 3SUFA 2Z3EA 1NTPA 2BLWA 3H5CB 1FN8A 4ACBA 1C2HA 4NA9H 4BNRA 2GZ7A 1IQMA 3KYFA 1CVWH 3U8RH 4U30A 1HAVB 1DT2A 2OQUA 2GV6A 2J92A 4OGYA 1ELDE 2C8YB 2OBOA 2KM0A 3ELAH 3VEQB 1CT4E 4ZKSU 3TH3H 3RM0H 1DUEA 3F68H 3EDXB 2ZHFH 3LT3A 2ZU2A 1AB9C 1CGJE 2BDGA 1GHVH 2A1DB 4X6PA 1TPPA 1E38B 3RU4E 4BAQB 1H9IE 1K1LA 5LPEA 3AW0A 1HGTH 2ZC9H 4NIYA 1C1SA 2QGRA 3AAUA 4JK6A 3O8DA 1VKYA 1LQDB 1AKSA 3D65E 1BMAA 2D2DA 2AIQA 2XBWA 3S7HB 3PTNA 5F8ZA 1CHGA 1ZSLA 2SGPE 3EBNA 2GT8A 2GCHF 1EPTB 2OINA 4CR5A 2GVFA 1LKAA 5FXLA 1UJ1A 2Z3DA 3E8LA 4TT3D 3LKWA 5EQSA 5JB8S 1GCTC 2JH0D 3RXOA 3EAJA 2UWPA 4MPUA 1GVZA 1L4DA 3HK6B 1MKWH 1T8LA 1FY4A 4LZ1H 2C90B 4TYDA 2DE8A 2VWMA 5E2PA 3UR9A 4CR9A 5KEDA 4FETA 1MQ5A 1ZRBA 3BTGE 2W7SA 5C67A 1V2OT 3TJVA 1MZDA 1HB0B 1FI8A 1K9OE 1TWXB 1O3OA 4ZXYH 1EB2A 1J8AA 1HAGE 1N1LA 1W0YH 2ZDVH 1OPHB 1YPJH 2FI3E 4ZXXH 2EY4C 2JETC 1A0JA 2JDID 1UO6A 2V3MA 4TSFD 1SGIB 1TNIA 1KXAA 5EIYA 1ELVA 1ETTH 2XC5A 1GI1A 1TRNA 2G00A 2GGVB 4I8GA 3BSQA 4XBCA 1SFIA 1C2KA 3ZVCA 5KGOA 1XXFA 2BD3A 3P95A 3L3TA 2P3UB 4Y76A 2BZAA 3ZVAA 3OTJE 3ESTA 1P2MA 1H9HE 3SYJA 4BTTB 4NIXA 1C1VH 1W0JD 2D1JA 1S0QA 3N99A 3SJ9A 4Z0KA 5FPYA 1DDJA 4M9FA 1HAPH 1HAVA 4ABGA 3V12A 5JBAS 1H8DH 1O36A 1VCQA 2VH0A 4ISIH 3UTUH 1P8VC 1TALA 1ZMLA 4O03A 1TPAE 4ZHLU 1CHOG 4WY3A 2Y7XA 1W0KD 3Q77A 1HNEE 3VFEA 2HGTH 2XCNA 1G3EA 4MQAA 4WH8A 4UFFH 2VIDA 1LHFH 1GDUA 2UUKB 1YF4A 4CHAC 3SV6A 2BY8X 1O2PA 1VGCC 4NWKA 3A7XA 1AUJA 1LCYA 1C1RA 6CHAB 2P8OC 3BTQE 3M5NA 3LC5A 4I8LA 1TNLA 3L6PA 3TJNA 1MD7A 4K3JA 2AMPA 4AB8A 1EX3A 3SQEE 4AN7A 1KTSB 2UUFB 2GT7A 1O3JA 3MO6A 4H6TA 2AFQB 2YOLA 1GHYH 4DIIH 5BPEA 2FOFA 5IDKA 4GCHG 4XE4A 2R2WU 4NA8A 2FLRH 5EJLA 1P3EA 1HPGA 2F9PA 1BTYA 1ZSJA 2VVCA 1G37A 4GAWA 1GBJA 1KDQA 4INHA 3S9CA 1DY8A 3FANA
chains in the Genus database with same CATH topology
1P2QA 1AN1E 2P3TB 3RC4A 1YCPM 4WVPE 3IG6B 4AX9H 2I6SA 1UTMA 2ODPA 2FI5E 4X6NA 2LPRA 2WPLS 2WV5A 3TU7H 2BXUH 1VJ9U 1JXPA 1QQUA 1TX7A 1NRPH 3SU1A 3UNRA 1J17T 1B5GH 4X2VA 1HCGA 3I77A 1ELGA 3A7VA 5EGMA 4CRFA 1TGTA 1TQ7B 3NZIA 4KELA 1THRH 4DW2U 1TA6A 4CBOA 1MU6B 3DA9B 3SHAH 2ZGCA 1RTFB 1O2LA 3P8NA 4NSVA 1HIAB 4UD9H 4ABFA 2ZU5A 1ZMJA 3UY9A 3NUMA 4AGJA 3V3MA 3KHVA 2G8TA 3RXEA 4ISHH 2O8MA 1H4WA 1YPHC 3A8CA 3MHWU 4Y7BA 3RXVA 1IQEA 3B9FH 5BRRE 5TJXA 3SBKA 4RKOB 1S84A 1FY5A 3FP6E 1ETRH 1YKTA 3KQBA 5CE1A 1GI0A 1ZR0A 2O8UA 1NM6A 1P04A 2PV9B 2VVVA 3ZZAA 1T8OA 1V2UT 1NFWA 1GMCG 2ILNA 5A8YA 4ABEA 4K1SA 1YPGH 2GMTC 3F6UH 2AS9A 1A7SA 3DUXH 3TLOA 2ALVA 3MI4A 1VR1H 2CF9H 4GHQA 4XBBA 2FM2A 2ZGHA 1FIWA 2ZU4A 4IS5A 2WPJS 1W3CA 3M36A 1WV7H 7ESTE 1BTUA 1Z6JH 1AE5A 1GBMA 2VWNA 3PV4A 2Z9GA 1O2IA 1CQQA 1GJBB 4OS5A 2HNTE 4NWLA 1TA2A 1H1BA 1FJSA 4K5ZA 3SGAE 4CRGA 3V13A 4E7NA 3B8JA 4X2XA 3M7QA 2STBE 1LPKB 1OWJA 4JYVH 1KDQB 3U8TH 4JZDH 1BCUH 2G4UA 3KQEA 2NU0E 1O2TA 1TX6A 2G4TA 5FX6A 3TJUA 2QY0B 4FXGH 2VNTA 2ZFRH 3JZ2B 2W3IA 1IQIA 2Y5GA 3MNBA 4BAMB 5T6GA 1WAYB 1TBQH 2H5DA 1XUIA 5F8TA 2ZCLP 3PO1B 4YESB 1Y5UT 1EB1H 1C1PA 3MMGA 3EGKH 2HVXA 1BRUP 1ABIH 1W10U 2QF0A 1L4ZA 1A1RA 3V7TA 1TNKA 3RUOA 1UCYK 3SV7A 5HXFA 1WYKA 1TOCB 2G5NA 2KAIA 1K1JA 1NZQH 1ANEA 1O5CB 5EOKA 1EXFA 3KCGH 2F9UA 3F9GA 2IJOB 1UVPA 1Y59T 4AFUA 1F0RA 3GDSA 5L30H 2Q6GA 1KXCA 1SL3A 5GJ4B 2ODQA 2BLOA 1ZSKA 1O5BB 3M3SA 2SNWA 4IN1A 4FUCA 1A46H 1MTWA 3QLPH 1FDPA 3E16B 5EXMA 2FYQA 4X8TH 4WJG2 3A7ZA 3TK5A 2B8OH 3I78A 5ESTE 3M37A 1AVXA 2ZFSA 5JYIA 1O2GH 2WPHS 1ZOMA 4FU7A 3MU0A 1GGDC 2NWNA 3RXDA 1SGCA 1LHGH 1S5SA 6LPRA 2ZFFH 1WTHD 3ZYEA 1E37B 5F03A 1GJAB 3PLBA 3RU4D 2ZPQA 5F6MA 1AU8A 2BOKA 3OSYA 1W12U 2ZWLH 4VGCB 3EA7A 2V6NA 3ZZ6A 5AF9H 3KGPA 3RXQA 3URDA 4OS4A 3A82A 1AQ7A 4GSOA 2NU2E 3K65B 3T27A 1J14A 4B2BA 2Y5HA 2QV1A 2BY7X 1QR3E 2TIOA 5EXNA 4ISLA 1IHSH 4GUXA 3BTDE 3U1JB 1FZZA 1BQYA 2H9HA 5I25A 1TMBH 2OXSA 1FAXA 2Q6FA 1AWFH 1BRAA 4JYTA 1XMNB 2SGAA 4ZAEA 1RGQA 2XC0A 5HM2A 1YC0A 4Y0ZE 2QCYA 1GVKB 4O3UA 7LPRA 4CREA 1JRSA 4WXVA 3FZDA 1HUTH 3GCTF 4HI3A 3CP7A 2PKAA 3MFJA 1C2DA 1XUKA 2BLVA 2C3SA 4WWYA 1EUFA 4R0IA 2C8XB 1P2NA 3T28A 2BVXH 1FUJA 2M5TA 1FPHH 3R3GB 5LPFA 1DWEH 2BVSH 5A2MH 1DWBH 1O2HA 1CE5A 3VB7A 3NK8A 4IMQA 3SQHE 1C1OA 1D6WA 3Q00A 9LPRA 1K28D 2ASUB 1LKBA 2XWAA 1HJAC 2ODYB 1KLIH 2XBXA 4CH8B 3DT0H 3QN7A 4Y10E 1VZQH 2FMJA 8GCHF 3UNQA 4ABDA 1Q3XA 2BVRH 4BTUB 1O2YA 5AVDA 2VWOA 3NPSA 3C1KA 3RXLA 1QL9A 3MNXA 3A83A 1FNIA 1JWTA 2ZA5A 3UOPA 2AGEX 1C1TA 3W95A 1MTNC 2UUJB 2Z94A 1GHXH 2W26A 1TRMA 8ESTE 5HYOA 1AVGH 3P8OA 1QFKH 1LVYA 1KY9A 3HKJB 3UFAA 3SJIA 1HFDA 3SUEA 1RD3B 2WPKS 5DP7A 4DY7B 4A5TS 1NRQH 3BF6H 4XOJA 4X8UH 2ZHDA 2BLQA 2FS9A 1L0ZA 1L1NA 2WYJA 1D4PB 4DGJA 4YLUA 4B2CA 6ESTA 1FIZA 1D6RA 2PWXA 1V2RT 2NU1E 4X1PU 3ZZ8A 4FUHA 1YPMH 3URCA 5B6OA 1QL7A 2XW9A 4IC5A 4B2AA 1O32A 2BD5A 2EA3A 3L33A 5DJ7A 3TPIZ 1A0HB 2J34A 3A7WA 3UR6A 5C1UA 3LJJA 3TK6A 2GCTB 3EE0B 4XDEA 1A5HA 1AMHA 1GBLA 1S83A 3TGJE 2A2QH 2K1QA 3VB5A 3NWUA 5DP8A 7GCHF 1C9TA 4B1TA 1GHBF 1GMHF 3A8AA 4NFFA 1FMGA 3IWMA 2ZF0H 1C5MD 1ARBA 1TGCA 1GDNA 1QIXB 4MLFB 3ZVGA 2CHAC 1O3IA 5DP6A 1F2SE 1S81A 3SN8A 1DFPA 1TBZH 1DPOA 2VB0A 1GBTA 1Y3VA 1GPZA 2ULLA 3NCLA 2QXHA 1JIRA 2JKHA 3PLKA 1Q31A 4MPWA 2QXGA 3O8RA 1ZZZA 3AW1A 3MNSA 2Y7ZA 1UK4A 1GJ8B 2ZCHP 3HGNA 6GCHF 1D3TB 2GV7A 1C4Y2 5K0HA 2RA0A 1DX5M 2JH5D 4Q80A 2P93A 1C5LH 2FOGA 2WPIS 1OSSA 3KN2A 3A8DA 3TIUA 5F8XA 1H9LB 5JDUB 1AZ8A 1V2LT 2BDAA 1EP5A 4ISNA 3U69H 1MCTA 3BG4C 2SFAA 3RXCA 1QJ6B 4TPYA 4DT7B 1C5VA 4YTAA 5HM9A 3RXIA 1N8OC 2FOBA 2ZGJA 1C5UA 1SGYE 3A7TA 4X8SH 2FWWA 1INCA 4E7RG 1P0SH 2RCEA 3F9HA 2QAAA 1GMDG 1G2MA 1C5QA 1HIAA 1EJNA 5GCHF 1K1PA 2CJIA 1CBWB 3QUMP 4YOGA 1DSTA 3LONA 1MKXH 3TGKE 1A3EH 1DITH 3MH4A 2IPHA 3SHCH 2EC9H 1HYLA 1G36A 4HTCH 1KXEA 5GDSH 4AYVB 1X7AC 3GDVA 1SFQB 3UUZA 3DD2H 1IQFA 1W11U 1A0LA 3ITIA 1GI6A 2HRVA 2ZPSA 5EQQA 5JBBS 5FBEA 1WTGH 1B0FA 1V2WT 1C1NA 1UTOA 3STJA 2NU4E 2WUBA 2CN0H 3E6PH 1HAZB 1SHHB 2QF3A 2AERH 2PKSB 2XYAA 5CHAB 1AKSB 1WOFA 5E8EH 3RXGA 4UFGH 2PFEA 2PSYA 3T29A 1ELTA 3SZNA 2Y5FA 3ATMA 1O3AA 1EOLA 3E1XB 1HV7A 2AIPA 2VIQA 3P92A 1C2GA 4TWYA 3FZZA 1AFEH 4AORA 1BITA 2J9NA 3QWCH 4Q7XA 2A4QA 4K60A 1XKAC 3V0XA 1XUGA 3SORA 4QT8C 2XXLA 5DGJA 2G81E 2QN5T 2HNTF 4BTIB 4CHAB 1ZTKA 1VGCB 1TYNA 1ZPCA 1ORFA 2J2UA 2VGCB 1L1GA 1O2KA 1MUEB 4THNH 4UE7H 5FPSA 2A45B 2OD3B 1OWDA 2LNCA 4HFPB 2H1UA 3A89A 3RXHA 1ESBA 3A87A 3MWIU 4HGCA 3NKKA 1O0DH 1BHXF 1F5RA 1FY8E 1MMJN 4I32A 2THFB 3MO3A 3OY5U 5EW1H 1E36B 4TY6A 2FPZA 3PB1E 1O3KA 5L2ZH 1G2LA 4IW4E 1Y3UA 4UEHH 4ZMAH 1GHAG 2SGQE 3GCHC 1O33A 3GY7A 3LGVA 1DANH 1EAXA 2A32A 5E0HA 2UWLA 4DCDA 1BMLA 2OUAA 1IQHA 2LIZA 4D7GA 1FY3A 2A7CA 3CS0A 3D23A 3VGCC 2F9OA 1KXBA 4BAHB 1OWHA 4KTCA 1O37A 1GMDF 1YPKH 3ODFA 2OC8A 4U01A 1BJUA 1HRTH 4AGKA 3E3TA 3WY8A 3D62A 2AEIH 1W7XH 1BBRK 5PTPA 4FUBA 1YCPK 1O3DA 3C27B 3OU0A 1IOEA 5EU8A 1O3BA 2CXVA 2OTVA 5AHGH 5A0CA 3GYLB 1EJMA 3UNSA 1Z8RA 2B5TB 1P10A 1AIXH 1JRTA 1NN6A 2Z6BD 1VCWA 3QO6A 1HAXB 1T31A 1K1NA 1LHDH 4K1TA 1QQ4A 5C5NA 1AHTH 1LPGB 3F9EA 3S0NA 3OX7U 1ELEE 1UHBB 1TMTH 1DXWA 1V2MT 1AI8H 5FCRA 5HGGA 5ABWA 2OQ5A 1RRKA 4IMZA 3DFLA 1JBUH 4JZ1A 1UK3A 2PW8H 2XNIA 3PYHA 4O9VA 3SU3A 1EKBB 3SU6A 2GTBA 1PQAA 4Y8ZA 8LPRA 1SMFE 1GG6B 2B7DH 3EA8A 3BG8A 1ZPZA 3ZVBA 3RDZA 1XKBC 1P9SA 4XSKU 1F0UA 3ZZ3A 4MNYA 5TCAA 2R3UA 2A31A 1SLUB 2TGAA 1NC6A 2W3KA 4OS7A 1QTFA 4K8BA 4OS6A 2R0KA 1TNHA 1V2ST 2O8LA 3CENA 1NFXA 1TGNA 1AE8H 2J4IA 2ZGXH 2CMYA 4Y11E 1GHBG 1F5KU 7GCHG 2OBQA 1OYQA 4BOHA 2BYAX 4DG4A 5L2YH 1O3CA 3MU4A 1DVAH 3SU2A 4CBNA 1G3DA 1V2KT 4Y6DA 4O3TA 2ZTZA 4A7IB 3BIUH 2BHGA 2ANKH 5GWZA 2FOHA 1MAXA 2WUCA 2AGIX 1W13U 4O97A 3ZZ7A 3S69A 4AG1A 1AB9B 1C2IA 1GBCA 4X1SU 1GBKA 1RIWC 1W0ZU 3D49H 4MG3A 4GHTA 1QL8A 1XXDA 4JZFH 4KKDA 4Y8XA 1YPHE 3JZ1B 2Q6DA 2P59A 1MH0A 1UTLM 4X1NU 1K2I1 4MNVA 2A4RA 3BTEE 1BJVA 3A88A 2HALA 2OC7A 1CA0C 1IQLA 1EPTC 3UPEA 5C1XA 1O3LA 1W2KH 2DUCA 1QB1A 4UFEH 3PM3A 4FUEA 2CGAA 1B7XB 3GY6A 2C93B 1DM4B 3EA9A 1UVTH 3PLPA 4JCNA 3KIDU 3LC3A 2BOHB 3RM2H 1DY9A 5A0BA 1SLWB 1GI2A 2PGQB 4YT6H 3Q3YA 2P95A 1PQ5A 2VWLA 5DPAA 3VB3A 5EG4A 3GCOA 2HNTC 1LTOA 2BD4A 4B74A 2ZDNA 4CRDA 1W14U 1UTPA 3M7UA 3RXBA 1QRWA 2GKVE 2JETB 2H2ZA 2I6QA 1BMMH 3P17H 4ZKNU 3T5FH 1EAWA 2YNAA 1WSSH 5GXPA 1LMWB 1MKXK 1UMAH 1BA8B 4MNXA 4MVNA 3SV8A 1A61H 4GCHF 4MNWA 1OXGA 5HMAA 3VPKA 5JBCS 1J16A 2FOCA 3SO3A 1IQNA 1YM0A 2ZZUH 1KXDA 1ZHPA 1EAIA 2UUYA 1WQSA 1FPCH 2JH6D 1GGDB 3E0NB 2WYGA 2VJ1A 1GWAA 2BX4A 2QA9E 4TWWA 1V2VT 1GBIA 2ZECA 2F3CE 5E0GA 1Y5BT 4GLYA 1TQ0B 3SNCA 2FX4A 2O9QA 5E2OA 1C5XB 1ESAA 1DLEA 2B9LA 1MD8A 4BANB 2G51A 2F91A 5EW2H 3IITA 1EJAA 3BN9A 2Y6TA 4AZ2B 3ENSB 5H4IB 3N7OA 3U8OH 1GCDA 4XFQA 3RC5A 3RXUA 1O2VA 1LVBA 1ZHMA 1O3PB 1ELCA 2QYIA 4AOQA 1EASA 3S9AA 4NIVA 5G4BA 3B23B 1ELBA 4X8VH 1E35B 1PPBH 4K69A 4I8HA 1DLKB 4LXBH 3SNEA 2A7HA 2C8WB 2V35A 1UCYE 2FEQH 4ZHMU 1PJPA 2BQWB 4X6OA 2WV4A 1SQTA 5AFZH 2A5IA 3MU1A 3TNTA 2FIRH 4FUGA 1SGFA 3PMAB 2BM2A 1WQVH 2ZQ1A 2RA3A 5A8XA 2BDYA 2A0QB 2G55A 1JMOH 2ZGBH 4Q7ZA 4LZ4B 1ZLRA 2O8TA 1Z1JA 3LU9B 1A2CH 4X2WA 1C2EA 1Z8GA 3RXTA 4BAOB 5JBTA 3U1IB 1K21H 1O3MA 1GHZA 3RMLH 4ZHAA 3ZVEA 3LGYA 1SR5C 1ZMNA 1Z7KA 2OC1A 3NXPA 1SGFG 4FU9A 1O2ZA 2R3YA 4I31A 2ZDMA 3LGUA 4BXSA 2W7UA 4IC6A 3QZRA 3UQOA 3VXEH 1T4UH 4HZHA 1TPSA 5EPNA 1C5RA 4FUIA 5DO4H 1GL1A 1VITH 1O34A 2F83A 3KQCA 3ATIA 3O8CA 2AMDA 5EPYA 3I29A 3A84A 2EEKA 3UREA 1FONA 1O2MA 1FQ3A 1T7CA 1C2MA 2ZHWH 2C4FH 1E34B 2Z9KA 1C1MA 3F1SB 3RXJA 4GPGA 1DOJA 3SU4A 1ANCA 1LO6A 1AFQB 1NS3A 1ZTJA 4Y7AA 1SGDE 1SHYA 1P11E 3QX5H 1SC8U 1GI3A 1ZJKA 1GJ9B 3A80A 3BV9B 1OOKB 2ZEBA 3FP8E 2GMTB 2ZU3A 3GCTG 3QZQA 1O2QA 2HPPH 1UVSH 1WUNH 1KIGH 1O2WA 5LGOA 1YLDA 4CRBA 4MTBA 1MBQA 5A0AE 2Z3CA 3GY4A 2OP9A 2VIPA 1EZXC 2WPMS 1ELFA 2EI7A 1GI8B 2ALPA 5IYTA 3A86A 5SGAE 3GY3A 1Z6EA 3ZZ4A 2FXRA 2O8WA</