2QCYA

Crystal structure of a monomeric form of severe acute respiratory syndrome (sars) 3c-like protease mutant
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Mechanism for controlling the dimer-monomer switch and coupling dimerization to catalysis of the severe acute respiratory syndrome coronavirus 3C-like protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 83
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2qcyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qcyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qcyA02
4X8UH 3KGPA 2EI8A 2A5KA 5DK1A 1O2HA 1HXEH 3KQEA 1W0YH 1AVXA 3EAJA 1OWHA 5FHTA 3SU1A 3I29A 5DG6A 5SGAE 3RDZA 3LKWA 2GV6A 2BD2A 3HGNA 3T27A 3PWBA 1T4UH 4D7GA 3DFJA 3V0XA 3SV6A 1TALA 2Z9LA 4F49A 1TQ7B 2QXHA 5E2PA 1GJCB 2RDLA 3SQEE 1Y5UT 2BY6X 4H42U 3U8TH 4CRCA 2I6QA 1V2WT 1LDTT 1FIZA 4DCDA 2G5NA 1YM0A 2HNTC 2F9BH 1BITA 3GCNA 2O8LA 3PO1C 1C5XB 1V2TT 2PSYA 1KIGH 4JK6A 1BA8B 2J2UA 4K2YA 3ZVAA 3SO3A 1TIOA 1V2NT 4Y11E 3C1KA 4FUCA 1ESTA 1OX1A 1P3EA 2BDBA 4ZROA 2LPRA 1A0JA 2ZU3A 1PPGE 1A3BH 1BCUH 1BMNH 1NU7B 3RUOA 4FXGH 2A4OA 2ANYA 2BD8A 1O2MA 1BHXB 3LT3A 4JYVH 5FX6A 4D8NA 1NFWA 1AUTC 4OS2A 2V0BA 2AERH 2BVSH 1EQ9A 1WYKA 1P09A 1O2ZA 2OCVB 3BTDE 3LGTA 2BX3A 1BMLA 1C2GA 4PROA 3D62A 1LHFH 2F9NA 2XBVA 5C20A 1K2I1 1DUEA 3GY2A 4BTUB 4TYDA 1KXEA 2BXTH 1FY4A 3B9FH 2ZGXH 4GUXA 3ZVGA 1UTOA 1TOMH 2A4GA 1GWAA 3MU5A 1PPBH 4BTIB 1FI8A 3L33A 1BRUP 4Y8YA 4X8VH 1O2IA 4GSOA 1Z1JA 2SGDE 2ZGCA 3M3SA 2W5EA 4KELA 4AGJA 2AGEX 2F9PA 3LPRA 2FM2A 1C2IA 1DSTA 3NCLA 2BYAX 1U6QA 2CV3A 1WCZA 2CGAA 2PTNA 3NZIA 1ABIH 1O2XA 1C2EA 3MHWU 3O8BA 1P2NA 3RU4E 4YT6H 1Y3WA 1P9SA 1NC6A 3A7VA 4FUHA 3RXRA 3UWJH 5LGOA 3GCTG 4DW2U 1ELTA 1TRMA 4RKOB 1SLXB 2PKSC 1LQEA 1OOKB 3SU2A 2FESH 1Y3YA 1A5IA 4YLQH 1AVGH 3P8NA 5LH8A 2A2XH 3MO6A 1KLJH 1SGFA 4IBLH 2TGDA 1A61H 1UVTH 1QB1A 2GZ9A 1QCPA 1Y5BT 3EYDA 3GCHB 2P3UB 1UHBB 3SUEA 3DHKH 2Q6GA 2ZGHA 2Y81A 1AI8H 3P8FA 2H5CA 2ZU4A 2XNIA 3BSQA 2ODPA 7ESTE 2HVXA 4GLYA 3STJA 3SJ9A 1VR1H 1QL7A 1O2JA 3KL6A 5T6DA 1VGCC 3GY3A 2ANWA 5C67A 3P8GA 2R0KA 1NM6A 3RXLA 1ANCA 4NIXA 1TPPA 1RIWC 2P95A 2AMPA 1EOLA 3DT0H 1AVWA 4Y79A 3RXFA 4E05H 4NG9H 1T32A 1J16A 3M7TA 1ARBA 3R3GB 2G00A 3GY7A 3SGQE 3M61U 1A0LA 1ZHRA 2WV5A 1FZZA 2TIOA 3ODDA 3TGKE 1NROH 1AKSA 1L0ZA 2AIPA 2C93B 4FUEA 3SU6A 2G4TA 1EOJA 3E6PH 1ZLRA 2OTVA 3BTHE 1V2OT 3CP7A 1AY6H 4WMDA 1FY8E 1AFEH 1FMGA 1YPHE 4X6NA 3MO9A 4AZ2B 1KXCA 1O2KA 3UY9A 3G01A 1GVKB 2NU3E 5FX5A 1LTOA 3RU4D 1O5AB 3ZVDA 3M5OA 1V2KT 5IYTA 2PR3A 1NY22 2P8OC 2IJOB 1V2RT 1YYY1 1GCTB 1RFNA 2FTMA 3F6UH 4HZHA 2QF0A 5K7RA 3U69H 1O3IA 1ZOMA 1FY1A 1CE5A 1ELVA 1LKAA 1W12U 3UIRA 1J8AA 5EG4A 4O3UA 1EPTC 2JH0D 2ZFSA 4MPVA 4WMFA 1JOUB 3ATLA 1BT7A 1C4U2 5FCKA 2ZWLH 3UR9A 2GDEH 1K22H 7KMEH 1SGRE 3TH4H 4DOQA 1QRWA 1GL1A 3FP6E 4WY3A 2UUKB 2V6NA 1F5LA 1TYNA 3A8CA 5E0JA 1HB0B 3EDXB 4GAWA 5GIBA 2J34A 3LJJA 4I8GA 1DSUA 1Z1IA 1TPAE 3EA9A 4INLA 2G52A 3PTNA 2ANMH 3E3TA 2VJ1A 3HPTB 2BTCE 1C9TA 1OWEA 5FBIA 5BPEA 5GJ4B 1GBTA 1O39A 1H9IE 1V2VT 1SQAA 2GKVE 3SBKA 4JZEH 1SGCA 2P3FH 2ZFFH 1GG6B 4CR9A 3BTKE 1PPZA 1HAOH 4XBBA 1BMMH 2BDCA 1ZR0A 1C5RA 4WVPE 7GCHG 2WPIS 2ZQ2A 2BD4A 1C5MD 1QTFA 2XW9A 3SNBA 1IQLA 4B71A 1GHBF 2SGQE 4M7GA 2ZCHP 3VXEH 3MNBA 1CBWB 1GJ8B 4YTAA 1GI1A 1TNGA 3ZZDA 4AB8A 5GWZA 1Z8RA 1IQKA 3RMLH 1ELCA 1FAXA 1ID5H 1O5EH 1NRRH 2Y82A 5T3HA 4X2YA 4GVUA 2YNAA 3B8JA 1HDTH 1EB1H 4Q80A 1C2DA 1QA0A 3PV4A 1E0FD 3SU5A 4JYUH 2VGCC 1GHYH 2GT7A 2G81E 4DY7B 3VGCB 2FS9A 4B75A 1OKXA 2XTTB 4XFQA 3TJUA 2B5TB 3RXEA 3BF6H 4MPWA 1C5TA 3R0FA 1O3LA 1HAPH 1Z8IB 5GCHF 2KAIA 5JB8S 3IITA 2GDDA 1M9UA 4YOJA 2QAAA 1TGTA 1NO9H 4A1XA 2AEIH 1C2LA 2OINA 3LGIA 1BTHH 3BTGE 3A84A 3P8OA 3Q3XA 2PSXA 1G37A 2BXUH 3A82A 2A7HA 1BIOA 4ZUHA 3S9AA 4K69A 3URCA 1C5YB 1G3CA 4Y8XA 5FAHA 3KIDU 1AGJA 3TH2H 1A3EH 4FVBA 2CXVA 4FU9A 1JIMA 2R9PA 3L3TA 1B5GH 3EA7A 1RGQA 4OS7A 5HM9A 1TX6A 4UDWH 2HGTH 2GX4A 2A5IA 3F9EA 4YESB 3LH1A 3BTEE 3AAVA 2R3YA 3UWIA 1A46H 1AE8H 1BRCE 1TX8A 1XVOA 4ZKSU 1MQ6A 1RXPA 1Y5AT 5DP3A 1P04A 4CHAC 1TRNA 1NT1A 3ELAH 1AMHA 5DKMA 3E0NB 3HKJB 3SJKA 4WH6A 1RTKA 1QA7A 1KXDA 3GISB 2FOMB 1JWTA 2A7CA 2Y6TA 3KHVA 1WAYB 2PFEA 3GYLB 4NA9H 3UNSA 2VIVA 1OP2A 1XKAC 2BX4A 1O32A 5CHAB 1L4ZA 1NN6A 2ZCLP 1KYNA 1O34A 1SGTA 3T5FH 2BDIA 4Y7BA 1TNHA 4I32A 1O3FA 1YPEH 1QBVH 2XYAA 1O36A 1TGNA 1O5BB 3V7TA 1GBAA 5JBCS 3H7TA 2PV9B 3TH3H 5GXPA 2JETB 1KTTB 3AW1A 1W14U 1EAXA 1O2SA 1T4VH 3ZZ8A 3ZZ9A 2QXIA 2ZO3H 4RSPA 2QY0B 2QXJA 4SGAE 2CMYA 1IHTH 2SGPE 2K7XA 1J9CH 3ZZBA 3TK9A 2BZAA 1DANH 4UD9H 3GY6A 4NSYA 5F03A 2BVXH 3QN7A 1EZXC 1DDJA 3FAOA 1QR3E 1LPKB 4ZHAA 4I8JA 2ZU5A 3UR6A 2JKHA 2BOKA 1GHWH 1Y3XA 3P95A 1SQOA 1EKBB 2WPMS 4UFFH 1GJDB 2HRVA 2Z9GA 2WUBA 3T26A 1ZTKA 1KTSB 1ZRBA 2SGAA 3CENA 4ESTE 4VGCB 1UVSH 5L30H 1ZSKA 3PMJA 2HNTF 4LXBH 4KP0A 2UWPA 4LOYH 3EA8A 3S9CA 2BDGA 2R3UA 2FIRH 2Z94A 2FOFA 1HNEE 5AF9H 2YOLA 4TWYA 1MMJN 2GGVB 5PTPA 4NIWA 3PMBB 1GBEA 1GJ5H 3SGAE 1K1PA 3SNDA 4FUBA 1ETTH 2PGQB 3GCTF 3T25A 3FZZA 3SV2H 5J4QA 1MTNB 2WUCA 1S84A 1TNLA 2FXRA 1RTLA 3KQBA 3MNXA 2PW8H 3WY8A 3PLPA 3LGVA 1GBCA 1EZUC 1MBQA 2GMTC 1YPHC 3EQ0H 3U1IB 3TITA 3GYMA 1FN8A 3A7XA 3HGPA 2J92A 1O2PA 1Q31A 1GGDB 1SVPA 3C27B 1B7XB 1HPGA 2BB4A 2ZHWH 2ZC9H 4B2BA 2PHBA 1C2MA 4NFEA 2XC5A 2ALPA 1DE7H 3RLWH 2Q6FA 1SFQB 3SGBE 2QYIA 2PKSB 2ZIQH 3MU4A 3M36A 1K1LA 1KDQA 4ZHLU 2ZDLA 1QGFA 2I6SA 2C8YB 3IG6B 5DP8A 2FOGA 1O2RA 3V12A 3TJOA 4MG3A 1WQSA 5TJXA 1Z6JH 1EP5A 5E8EH 1SHYA 1AWHB 1LKBA 1DOJA 3QGJA 4HFPB 4ABDA 3BEUA 1A2CH 6GCHF 1NPMA 1HXFH 4NA7A 4GCHF 4AGKA 5B6OA 1YC0A 2C3SA 2BHGA 3BG4C 1QL9A 3ZVBA 1Z7KA 1TRYA 1Z71A 4CRDA 3DA9B 1N1LA 5C5OA 1ELGA 4R0IA 5BRRE 2F9VA 5IDKA 4XDEA 3HKIB 1O2WA 2BQWB 4U2WA 3RXAA 2F91A 2CHAB 2ZDNA 2FI5E 2VVCA 1B0EA 1MKWH 2ZFQH 3MNSA 4TPIZ 2OXSA 2BM2A 4UFGH 2BLQA 1Y59T 1S6FA 1PPEE 1C1NA 2WYGA 1E34B 1EZQA 1TFXA 1C5NH 1HJ9A 3TPIZ 4WF8A 2A2QH 4UONA 1CA0B 3GDSA 3A7WA 4CH2B 4Y71A 5JB9S 4HGCA 8GCHF 1ZGVA 1GJ4H 4X2WA 2ZU1A 5L2YH 1GDNA 2ZZUH 4OGXA 1O3AA 1K9OE 2SNVA 2QGRA 1AKSB 1FONA 2R2WU 2ZGBH 2A5AA 1E37B 2W7SA 3SOSA 3TNSA 1G32B 4IC5A 3ZZ5A 4AYVB 2OC1A 3UREA 3AW0A 1MU6B 3TNTA 2R2MB 5JBTA 4BAHB 4A6LA 1HAGE 1NZQH 1UTLM 3MFJA 3UOUA 2STBE 3HK6B 1P12E 2Z3DA 2VINA 1NU9A 4X1PU 4HI3A 3UNQA 4IN2A 3W95A 5C1XA 1UTKA 2JH5D 4KTSA 1TLDA 2FOAA 1G2LA 1O2VA 1EXFA 5FBEA 1W11U 1BOQA 5EGMA 5EU8A 2G55A 1O3BA 7GCHF 2SGFE 4OS4A 4O03A 1ARCA 2SGEE 4F4OC 2WYJA 1CHOG 1FNIA 5DP5A 1UCYE 2VWOA 1O3HA 3A86A 2BZ6H 1BZXE 1CU1A 4OS5A 4ABIA 4K1EA 3U98H 1QIXB 1EAUA 3SUDA 1P03A 1JXPA 1HJAB 3I77A 3KQCA 1SPJA 1P05A 4UEHH 1ZTLA 1Z8GA 4I8LA 1LVMA 1C5SA 1CQQA 2V35A 3F9GA 1C4V2 2HPPH 2VNTA 1EZSC 1OWKA 1B0FA 4ABAA 1GL0E 4ZKNU 4K60A 3SN8A 2GCTB 1YLDA 3LC5A 5LPRA 2QXGA 3QZRA 4KTUA 5JYIA 2TGPZ 3LOXA 3RXVA 1ZJKA 1EP6A 4NCYA 5A8YA 1BMAA 5F6MA 1NESE 2Z3EA 1BUIA 2ZF0H 3TVJB 2SFAA 3SU4A 4B73A 1DS2E 4UFEH 1XUIA 5FPTA 1YBWA 1C5PA 1TPOA 4D7FA 2OC7A 2BDAA 2XBXA 1WTHD 1X7AC 1MH0A 1XUJA 2A4QA 3PTBA 4AFUA 2O8MA 4A1TA 2XCNA 1C5ZB 3NPSA 1J15A 4DJZB 4KKDA 1JIRA 3RXIA 3NWUA 3QK1A 1C1OA 4ABBA 4A7IB 1T8OA 1AZ8A 1MZDA 3M5MA 2PGBB 1E36B 2PWXA 4X2XA 2ZDMA 4NIYA 1O3MA 4UE7H 3ZZ7A 1S81A 1OWIA 3SQHE 4NWLA 3RP2A 5DP9A 1L2EA 3OYPA 1QNJA 1H9LB 1SGIB 1TA6A 3BTWE 2KAIB 2VIPA 1FLEE 1GVZA 3PLBA 3U9AH 1CGIE 1RS0A 2QA9E 5HYOA 1HLTH 1GMDG 3E8LA 2QCYA 1EATA 2RG3A 3K6ZA 1UTJA 2BQ7B 3M37A 5LPFA 1IHSH 4FUFA 3T29A 4ABEA 1FDPA 1N6XA 3CS0A 3ZVCA 3P70B 1AE5A 5DP4A 4CRAA 2ODQA 3RXPA 5F8TA 1GBJA 4LZ4B 2F3CE 1P06A 5C2ZA 4RKJB 1S83A 2Y80A 5C1YA 4B1TA 3TLOA 1A1RA 1SGDE 3RXDA 1BTYA 1SQTA 2OQ5A 4ZH8A 1KLIH 5EW1H 1LHEH 5H4IB 1GBLA 3RMOH 1V2ST 3BN9A 5E0GA 2TGAA 3OY6U 2ZHQH 4ZXYH 1EPTA 2FYQA 5HXFA 3V3MA 4MVNA 1WSSH 2FOCA 2GZ7A 1ZPZA 2ZHEH 1SI5H 3PYHA 1C1TA 5E0HA 3Q76A 1V2QT 2A4RA 1W0ZU 2BDHA 3FP7E 5GDSH 2VIQA 3NXPA 3SI3H 1ELAA 3QDZB 6CHAC 1OPHB 8LPRA 3EGKH 1GBDA 2H5DA 4X8TH 3M5LA 3U8RH 2ZFPH 5EPNA 1ETSH 1GI0A 2ZI2H 1L1GA 3K2UA 3ZZ3A 2A32A 3SUFA 2HOBA 4YO9A 1INCA 1DWBH 1UCYK 4AFQA 4X1SU 1H4WA 2BMGB 1GJ7B 3ZV8A 1KXBA 1V2PT 2EC9H 2VH0A 4ISOA 2ZHDA 1LO6A 1VJAU 3HATH 5F8XA 2IN2A 3QX5H 3UQOA 1N8OB 2Y5HA 3FVFB 2NU1E 3RXQA 1T8MA 1O2GH 5TCCA 2HWLB 2Z3CA 4I8HA 3U8OH 5L2ZH 4ASHA 1LQDB 3TIUA 4A92A 3A83A 4WWYA 3ESTA 4AORA 1PQ7A 1G36A 5J4SA 2ZFTA 3K6YA 1V2MT 1DY8A 5TCAA 1THPB 1UMAH 4LK4A 2XXLA 3SV7A 2ZTYA 1Y3UA 5ESBA 1NFUA 2VWLA 1FQ3A 1BTXA 1EJMA 3F68H 1GI9B 3RXCA 1P01A 1EX3A 2VH6A 4ZXXH 3RM0H 4OS6A 2Y5GA 1QQUA 5EXMA 1L4DA 2BLOA 1KXAA 4FUGA 3UQVA 1SLUB 1OWJA 2EI6A 3SW2B 1G9IE 5EXLA 1MAYA 1PYTD 6LPRA 2B8OH 4BAKB 3GCHC 3K65B 4K5ZA 3A7ZA 1TWXB 1V2UT 1DLEA 4U32A 1ELBA 2AH4X 2G4UA 1SHHB 2PUXB 4JZ1A 2V3HH 1SGQE 4AN7A 4B2AA 3TGIE 1VCQA 1ZZZA 1HIAB 1SSXA 3TJNA 3TJVA 1GMCG 3D49H 1BQYA 2GTBA 1BDAA 1C1PA 1SGNE 1VCWA 1UJ1A 1GI3A 1TNKA 1A5GH 1CSOE 1P10A 1GDQA 1RTFB 1ANBA 3RXBA 4X1RU 1FXYA 9LPRA 1HAXB 3ZYDA 4GHTA 1GJBB 1MTWA 2F9UA 4YLUA 4MNWA 4B76A 3EBNA 2DE8A 1FN6A 1TMBH 2P16A 1O3JA 1AUJA 2QIQA 1O5GH 1ESAA 5A0BA 2Z7FE 4HTCH 2F9OA 1KXFA 2BDYA 2CJIA 1UVOA 2C90B 4WH8A 5FXLA 1W13U 2FDAA 3LH3A 1TE0A 2XBYA 3BG8A 2C8XB 1C5VA 1AWFH 3GY4A 4I7YH 1H8IH 1YKTA 1BTZA 1G2MA 1KSNA 1LCYA 3P92A 3S0NA 1JRTA 2PUQH 3ATWA 2HALA 1O5FH 4MDSA 2XC4A 2FLRH 1TABE 3MO3A 1O2QA 1GMHG 1KDQB 1O3EA 3O8DA 3ZZ4A 3NKKA 1TA2A 1EJNA 1LHGH 1GCTC 2GD4B 2ZP0H 4FU8A 5EQRA 3BTFE 2VB0A 2JH6D 2AIQA 1C1WH 3ENSB 4B2CA 3N7OA 1ELDE 1TBZH 1WTGH 3VPKA 3MTYA 3T2NA 5DP7A 3URDA 3D65E 1N6YA 4B74A 2WPLS 5CE1A 2ZDAH 3TGJE 1VITG 1P02A 3IWMA 1GJ6A 3MMGA 3MOCA 4R8TB 1MKXK 3RXSA 1LVBA 8KME2 1SOTA 3M5NA 3M3TA 2BLVA 4GPGA 1DXPA 3SU3A 1V2LT 3Q3KA 2ZU2A 1C2FA 1IQEA 2FEQH 3PO1B 4ZAEA 3EE0B 5A8XA 1GBMA 1THRH 3GY8A 2BLWA 3PM3A 1GVLA 1UTQA 1W3CA 4MNYA 4Y6DA 2FP7B 2A0QB 1HUTH 1SBWA 3SJIA 3RMMH 1L1NA 1ZJDA 4Q2KA 3UUZA 1SLWB 1XVMA 1GG6C 1C1MA 1F0SA 2ZEBA 2Z9IA 3RMNH 1CGJE 1DX5M 1O2UA 1QHRB 1XUHA 4UFDH 1Y8TA 1A5HA 4Q7YA 1UK3A 4Q7XA 1ZPCA 1TNIA 3PWCA 4LZ1H 2FODA 1SL3A 3JZ1B 3A88A 1CBWC 4K8BA 4K3JA 3SNCA 2J9NA 2OD3B 2C8WB 1IQGA 1CHOF 3TU7H 3K9XB 5A0AE 3VB5A 4YOGA 1W7XH 1YPGH 2PKAA 2Z6BD 1DPOA 2UUFB 3QUMP 4NSVA 1HIAA 1AQ7A 1O37A 1C5QA 1GBHA 2FWWA 1D3TB 5A2MH 5EODA 5EXNA 1QJ7B 4A5TS 2BQ6B 2XC0A 3RC6A 1S85A 2NU2E 2QF3A 3GDUA 1YCPK 4ISHH 4ABJA 1DY9A 3S9BA 4BNRA 2ZGJA 1CT4E 3ZYEA 4TPYA 3LC3A 2OC0A 2VVVA 1GHVH 3SORA 1GHAG 4MTBA 1O3PB 1HYLA 1BB0B 1O2TA 2ASUB 1IQJA 1CT2E 3MYWA 3PMHB 2BD9A 1QQ4A 3RXKA 4MPUA 3NK8A 3E0PB 3SJ8A 1CGHA 3RU4T 5EQQA 4AX9H 4CRBA 1LHDH 2G8TA 3MWIU 1MAXA 2B9LA 2STAE 1ZHPA 1C9PA 1DICA 4YT7H 3A8DA 1PYTC 3ATIA 3GICB 4NFFA 2BVRH 1Z8JB 3SU0A 3F9HA 1K28D 1T31A 1KY9A 1AB9C 2PTCE 4MLFB 1C4Y2 1GJ9B 2F83A 5EOKA 1YCPM 2BY9X 1MD7A 4IS5A 1C1SA 1F2SE 3BV9B 1SG8B 1P0SH 1XM1A 2UUYA 2ZPQA 5FPSA 4DT7B 3FFGA 1SB1H 2ZTXA 3A81A 1VJ9U 2GVFA 1O2OA 1XXFA 2FO9A 1MKXH 1TPSA 1TMUH 1ELFA 2CF9H 1C5OH 2WV4A 1UK4A 1FPCH 4O3TA 1VCPA 3SHCH 2ZPSA 4IMZA 1GMDF 1GHXH 1ZSJA 2D8WA 4A1VA 2A45B 3A80A 1C1RA 4H4FA 2GZ8A 2EI7A 3JZ2B 4JCNA 4SGBE 4K8YA 4JZDH 2FOHA 5CHAC 1GI6A 2FMJA 1VGCB 4JZIA 4D9RA 4E06H 3PB1E 1EUFA 1BJUA 4NZLA 1O2LA 1O3DA 1RIWB 1P8VC 2UWOA 2GT8A 1PQAA 4DVAU 3E91A 1SMFE 4JZFH 2D2DA 1HBTH 2JETC 4Y76A 4DG4A 2NU4E 1SGPE 4CBNA 3QTVH 2GCHG 1IQNA 1FAKH 1YPJH 2GP9B 3E16B 4AG2A 3UOPA 3UFAA 5FPYA 2H9EH 1AO5A 2OQUA 1DWCH 2Z9JA 1A7SA 4AFZA 4IMQA 2UWLA 1AFQC 4NWKA 1ZRKA 3RXTA 1O2NA 1BJVA 4H6TA 3H7OA 1K1JA 4ABGA 3ATMA 1W7GH 1DWEH 1BTPA 2XWBI 4BOHA 1P2QA 2ZDVH 1HAIH 2BY8X 1AD8H 1YCPH 1NS3A 2P8OB 2ZHFH 4X2VA 4IN1A 3ZZCA 3SHAH 2TBSA 3ITIA 4ZHMU 4FU7A 2Y5FA 3ZZ6A 1C5LH 2XWAA 4CRGA 1TQ0B 1QFKH 5A8ZA 3U1JB 4VGCC 1EPTB 1MTUA 3KF2A 3W94A 2AMDA 1O3OA 1QJ1B 2O8UA 1SGEE 1P2OA 2BY7X 1D3DB 2QC2A 4X0WU 4JYTA 4X6OA 6CHAB 1ZMNA 1THSH 1K1MA 3AASA 1XXDA 2O9QA 1DLKB 2OLGA 1W2KH 1YP9A 3MU1A 1UTNA 1GBFA 1HCGA 1H8DH 2H1UA 1NTPA 2HPQH 1OS8A 1H9HE 1G3DA 1BHXF 2FPZA 3OTJE 2FS8A 1MTNC 1Q3XA 3BIUH 1D6RA 3RXOA 3Q77A 5ABWA 1W10U 1EJAA 1QBOA 3B23B 3CS7A 1F5RA 1DT2A 1LHCH 4D76A 1HV7A 2VWNA 3ODFA 2AGIX 2VIOA 2O8WA 4O9VA 5FCRA 1IQMA 1GGDC 1Y3VA 3VB6A 4FUJA 3M7UA 1OSSA 3LIWA 4AG1A 4BANB 2ALVA 1Z6EA 1BBRE 2BOHB 1O5CB 2FOEA 2ZG0H 5JBBS 5T6FA 2BD7A 1D4PB 1FPHH 1YPLH 1O33A 1CO7E 1F0UA 1FV9A 3GCOA 2P94A 1XUKA 2ZCKP 1GMCF 1ABJH 1C2HA 1XX9A 4DGJA 1AIXH 3L6PA 3NUMA 5JBAS 1L1JA 1GHZA 1DXWA 1LVOA 1UVUH 2VGCB 1OP8A 4XOJA 3MU8A 2ODYB 5HGGA 3AAUA 2O8TA 3F9FA 1QJ6B 3O8RA 1WV7H 1C5UA 3BTQE 3ZVFA 3PMAB 4YOIA 1FIWA 2P59A 5AFZH 1CHGA 4MNVA 1TGSZ 1QB6A 2D26C 2FX6A 5F8ZA 1O3CA 1GCDA 2W3KA 1ELEE 5ETXA 3I78A 4WMEA 1Q2WA 1V6DA 2VIDA 4DURA 3MH5A 4ZKRU 3KCGH 2ZA5A 3BTME 4X8SH 2CHAC 1C1UH 4J2YB 5ESTE 3RXJA 2ZNKH 1H1BA 1GJAB 1JBUH 4H6SB 2H6MA 4J1YA 1MUEB 5EPYA 2ZFRH 1UK2A 2QN5T 4I31A 2VVUA 3MNCA 1GMHF 1PPFE 1SC8U 3LU9B 1S0RA 5HMAA 2DUCA 4BAMB 1GI2A 4KGAA 6GCHG 4YZUA 2ZDKA 1ESBA 4FUIA 2UUJB 2V3OH 4GCHG 1CA0C 3QWCH 2G5VA 2H9TH 2D1JA 3MH7A 4KTCA 4CHAB 2ZPRA 5G4BA 5DJ7A 2ZTZA 2B0FA 3OSYA 1S6HA 2AGGX 3FP8E 3HK3B 1F0TA 1WQVH 1VITF 2WPKS 1IAUA 3P17H 1TBQH 3VB3A 2QV1A 2WPHS 2C4FH 2FOBA 5C5NA 3FZDA 1C5WB 1TX7A 2P3TB 3A85A 4IGDA 5C3NA 1O2YA 2AYWA 1ACBE 1SGFG 1QY6A 2NU0E 3UNRA 1UTPA 4FUDA 4Z0KA 5DP6A 1DWDH 4JMYA 4YM9A 2C8ZB 4D9QA 8GCHG 1GI4A 1P11E 1MCTA 1ZYOA 3STIA 5EW2H 4MQAA 2W7UA 1T7CA 3LONA 2OUAA 3Q00A 1K21H 1O5DH 1S0QA 3UPEA 2TRMA 3P6ZB 1YF4A 2OBQA 1P2JA 2XRCA 1RRKA 2TGTA 1D6WA 9ESTA 1IOEA 4AB9A 3VB7A 2M5TA 3QLPH 1MBMA 3T62A 1FY3A 3VFEA 3S7HB 1OYTH 2B7DH 2H9HA 5A09A 3E90B 2YNBA 1HAVB 1HJAC 1P2KA 2FTLE 4BXSA 3BEIB 1TB6H 4FVDA 3SV8A 2ULLA 4U01A 4DIIH 3RC4A 2W26A 5L6NH 4NA8A 1MQ5A 1O3NA 1SLVB 3VB4A 1AZZA 1JMOH 3LDXH 4Y8ZA 2FYRA 3T28A 3Q3YA 1DM4B 2THFB 1AU8A 5T6GA 1EAIA 2FI3E 1MCVA 1NRSH 2HNTE 2GCTC 4NGAH 4XBDA 2PLXA 3PLKA 2ZQ1A 1BBRK 2WPJS 1D3QB 4CR5A 4ABHA 1A4WH 2VWMA 1ANEA 1F7ZA 4Y7AA 3TK5A 5CMXH 4AFSA 3QTOH 5HM2A 1ANDA 1O3KA 5GPIB 1TNJA 1GHAF 1UHBA 1SFIA 2TPIZ 3SI4H 3A8AA 2XCFA 1WUNH 3GOVB 3BTTE 3LGWA 3MH6A 5AVDA 4ISNA 2PKAB 2OBOA 4CH8B 4Y10E 1UO6A 3H5CB 1VITH 3VEQB 2EEKA 1MTSA 4X6MA 1YGCH 1QBNA 1QL8A 3A7YA 2XBWA 4AYYB 4THNH 1GI7B 1ORFA 1ETRH 3LGYA 1W8BH 2WINI 1GBKA 4TWWA 1V3XA 3M3VA 4WXIA 4BXWA 2J38A 3SNAA 3M35A 2GMTB 3ZZAA 3GDVA 5DGJA 3RM2H 3RC5A 1PPCE 1TGCA 3AVZA 1LVYA 2HLCA 1BRBE 3FANA 4Y0YE 4CBOA 4X1QU 3SV9A 2ANKH 2CN0H 1O30A 2OP9A 3E1XB 5C1UA 3DFLA 4MNXA 4TY7A 1RD3B 3KEEA 2VU8E 1AB9B 4BAOB 2P93A 1F92A 1XUFA 4WXVA 1TMTH 1K1OA 3A87A 1DUAA 2H2ZA 1GBIA 4OGYA 7LPRA 1GI8B 4XSKU 1O38A 2A7JA 1CVWH 2IOTA 1SGYE 1SOZA 1F5KU 1QB9A 3A7TA 1UCYH 4BAQB 1BTWA 4ISIH 2LIZA 1CT0E 3LJOA 3RXGA 1EASA 1QRZA 4E7NA 1UVPA 1RJXB 2GCHF 1FY5A 1P9UA 5A0CA 2IPHA 2RA0A 1NFYA 2OC8A 1TBRH 2Y7XA 3BG4B 1NRPH 4CRFA 1PPHE 4ABFA 3S7KB 4K1TA 4O97A 1PQ8A 1V2JT 4Y0ZE 3KN2A 1YPKH 3DUXH 1HJ8A 1OWDA 3ZV9A 1FJSA 1T8NA 2FZZA 2BD5A 4MPXA 1HAVA 1LPGB 3KQDA 2ESTE 4XE4A 3OU0A 4ZMAH 1GDUA 1KLTA 2SNWA 1G3EA 1HRTH 1BBRH 3BEFB 1BRAA 4XBCA 1XKBC 5JPMH 1MU8B 1DFPA 2J95A 2BD3A 1J14A 1PJPA 5EQSA 4IC6A 1J17T 5DPAA 3ZVEA 1TAWA 6ESTA 1UTMA 1O35A 1NFXA 5AFYH 1OXGA 1N8OC 1O0DH 4TY6A 1AN1E 1SR5C 1T8LA 1LMWB 2GV7A 2RA3A 4OS1A 1AFQB 5JDUB 3OX7U 3SNEA 1HFDA 4RN6A 5LPEA 1P57B 1EB2A 2R0LA 1QRXA 1GBBA 4BTTB 1D9IA 1HAZB 4X1NU 2Z9KA 1P2IA 2J94A 5I46H 1GPZA 3RLYH 2J4IA 4E7RG 1MKWK 3QO6A 2LNCA 1C1QA 3O8CA 2A1DB 3F1SB 3MH4A 4DIHH 4JK5A 4WJG2 1S5SA 1ZMLA 4I33A 4INHA 1ZMJA 2DE9A 1ZPBA 2FI4E 2K1QA 4INKA 1E35B 2ZECA 1HAHH 1GI5A 1TGBA 4ISLA 1XMNB 1F0RA 5E2OA 1IQFA 1PQ5A 1GHBG 3OY5U 3VGCC 1HGTH 1ZSLA 1YLCA 4CREA 3DD2H 1WOFA 5I25A 3VXFH 3RXHA 1D3PB 5AHGH 1FUJA 1G30B 2Q6DA 1TONA 1C2KA 1EAWA 4I8KA 1YPMH 2Q1JA 3MU0A 1E38B 1O3GA 3UTUH 3A89A 1C2JA 4NIVA 2A31A 5DO4H 4X6PA 1BTUA 3SZNA 1DITH 1ZTJA 3A8BA 4K1SA 4Q7ZA 1XUGA 1JRSA 1NRQH 1IQIA 3RXUA 2BY5X 1WBGB 2AMQA 2G51A 1VZQH 2Y7ZA 1MZAA 2W3IA 1LPZB 1A0HB 2NWNA 3RXMA 3D23A 4NZQA 3SJOA 1ZHMA 3SUGA 2FX4A 2AFQB 1O31A 4GHQA 4ZKOU 1MD8A 3PROA 2CF8H 1P2MA 3MI4A 5GCHG 4AOQA 4Z6AH 3ATKA 5K0HA 3QGNB 8ESTE 4IW4E 2ILNA 3QZQA 4QT8C 1QURH 2RCEA 2FLBH 1AHTH 1IQHA 1NRNH 2AS9A 1K1IA 3S69A 2EA3A 1G3BA 1DVAH 1C1VH 1MTVA 1HAYB 3BIVH 1CA8B 3M7QA 2ZKSA 1PFXC 1P3CA 1WU1A 1OP0A 1ZGIA 3TK6A 1TOCB 1K1NA 3KNXA 3V13A 1S82A 3LGUA 4U30A 1OYQA 2VIWA 3GY5A
chains in the Genus database with same CATH superfamily
4X8UH 3KGPA 2EI8A 2A5KA 5DK1A 1O2HA 1HXEH 3KQEA 1W0YH 1AVXA 3EAJA 1OWHA 1YLNA 5FHTA 3SU1A 3I29A 2KR7A 5DG6A 5SGAE 3RDZA 3LKWA 2GV6A 2BD2A 3HGNA 3T27A 3PWBA 1T4UH 4D7GA 3DFJA 3V0XA 3SV6A 1TALA 2Z9LA 4F49A 1TQ7B 2QXHA 5E2PA 1GJCB 2RDLA 3SQEE 1Y5UT 2BY6X 4H42U 2XNDD 3U8TH 4CRCA 2I6QA 1V2WT 1LDTT 1FIZA 4DCDA 2G5NA 1YM0A 2HNTC 2F9BH 1BITA 3GCNA 2O8LA 3PO1C 1C5XB 1V2TT 2PSYA 1KIGH 4JK6A 1BA8B 2J2UA 4K2YA 3ZVAA 3SO3A 1TIOA 1V2NT 4Y11E 3C1KA 4FUCA 1ESTA 1OX1A 1P3EA 2BDBA 4ZROA 2LPRA 1A0JA 2ZU3A 1PPGE 1A3BH 1BCUH 1BMNH 1NU7B 3RUOA 4FXGH 2A4OA 2ANYA 2BD8A 1O2MA 1BHXB 3LT3A 4JYVH 5FX6A 4D8NA 1NFWA 1AUTC 4OS2A 2V0BA 2AERH 2BVSH 1EFRD 1EQ9A 1WYKA 1P09A 1O2ZA 2OCVB 3BTDE 3LGTA 2BX3A 1BMLA 1C2GA 4PROA 3D62A 1LHFH 2F9NA 2XBVA 5C20A 4ACAA 1K2I1 1DUEA 3GY2A 4BTUB 4TYDA 1KXEA 2BXTH 1FY4A 3B9FH 2ZGXH 4GUXA 3ZVGA 1UTOA 1TOMH 2YMSD 2A4GA 1GWAA 3MU5A 1PPBH 4BTIB 1FI8A 3L33A 1BRUP 4Y8YA 4X8VH 1O2IA 4GSOA 1Z1JA 2SGDE 2ZGCA 3M3SA 2W5EA 4KELA 4AGJA 2AGEX 2F9PA 3LPRA 2FM2A 1C2IA 1DSTA 5DSFA 3NCLA 2BYAX 1U6QA 2CV3A 1WCZA 2CGAA 2PTNA 3NZIA 1ABIH 1O2XA 1C2EA 3MHWU 3O8BA 1P2NA 3RU4E 4YT6H 1Y3WA 1P9SA 1NC6A 3A7VA 4FUHA 3RXRA 1OHHD 3UWJH 5LGOA 3GCTG 4DW2U 1ELTA 1TRMA 4RKOB 1SLXB 2PKSC 1LQEA 1OOKB 3SU2A 2WSSD 2FESH 1Y3YA 1A5IA 4YLQH 1AVGH 3P8NA 5LH8A 2A2XH 3MO6A 1KLJH 2KX4A 1SGFA 4IBLH 2TGDA 1A61H 1UVTH 1QB1A 2GZ9A 1QCPA 1Y5BT 3EYDA 3GCHB 2P3UB 1UHBB 3SUEA 3DHKH 2Q6GA 2ZGHA 2F4LA 2Y81A 1AI8H 3P8FA 4I86A 2H5CA 2ZU4A 2XNIA 3BSQA 2ODPA 7ESTE 2HVXA 4GLYA 3STJA 3F0OA 3SJ9A 1VR1H 1QL7A 1O2JA 3KL6A 5T6DA 1VGCC 3GY3A 2ANWA 5C67A 3P8GA 2R0KA 3WWBA 1NM6A 2WZQA 3RXLA 1ANCA 4NIXA 1TPPA 1RIWC 2P95A 2AMPA 1EOLA 3DT0H 1AVWA 4Y79A 3OAAD 3RXFA 4NG9H 4E05H 1T32A 1J16A 2KZ4A 3M7TA 1ARBA 3R3GB 2G00A 3GY7A 3SGQE 3M61U 1A0LA 1ZHRA 2WV5A 1FZZA 2TIOA 3ODDA 3TGKE 1NROH 1AKSA 1L0ZA 2AIPA 2C93B 3FOAA 4FUEA 3SU6A 2G4TA 1EOJA 3E6PH 1ZLRA 2OTVA 3F3BA 3BTHE 4P02A 1V2OT 3CP7A 1AY6H 4WMDA 1FY8E 1AFEH 1FMGA 1YPHE 4X6NA 3MO9A 4AZ2B 1KXCA 2KFWA 1O2KA 3UY9A 3G01A 1GVKB 2NU3E 5FX5A 1LTOA 3RU4D 1O5AB 3ZVDA 3M5OA 1V2KT 5IYTA 2PR3A 1NY22 2P8OC 2IJOB 1V2RT 1YYY1 1GCTB 1RFNA 2FTMA 1E1RD 3F6UH 4HZHA 2QF0A 5K7RA 3U69H 1O3IA 1ZOMA 1FY1A 1CE5A 1ELVA 1LKAA 1W12U 3UIRA 2KM0A 1J8AA 5EG4A 4O3UA 1EPTC 2JH0D 2ZFSA 4MPVA 4WMFA 1JOUB 3ATLA 1BT7A 1C4U2 5FCKA 3CNRA 2ZWLH 3UR9A 2GDEH 1K22H 7KMEH 1SGRE 3TH4H 4DOQA 1QRWA 1GL1A 3FP6E 4WY3A 2UUKB 2V6NA 1F5LA 1TYNA 3A8CA 5E0JA 1HB0B 3EDXB 4GAWA 5GIBA 2J34A 3LJJA 4I8GA 1DSUA 1Z1IA 1TPAE 3EA9A 4INLA 2G52A 3PTNA 2ANMH 3E3TA 3FO8D 2VJ1A 3HPTB 2BTCE 1C9TA 1OWEA 5FBIA 5BPEA 5GJ4B 1GBTA 1O39A 1H9IE 1V2VT 1SQAA 2GKVE 3SBKA 4JZEH 1SGCA 2P3FH 2ZFFH 1GG6B 4CR9A 3BTKE 1PPZA 1HAOH 4XBBA 1BMMH 2BDCA 1ZR0A 1C5RA 4WVPE 7GCHG 2WPIS 2ZQ2A 2BD4A 1C5MD 1QTFA 2XW9A 3SNBA 1IQLA 4B71A 1GHBF 2SGQE 4M7GA 2ZCHP 3VXEH 3MNBA 1CBWB 1GJ8B 2YMSC 4YTAA 1GI1A 1TNGA 3ZZDA 4AB8A 5GWZA 1Z8RA 1IQKA 3RMLH 1ELCA 1FAXA 1ID5H 1O5EH 1NRRH 2Y82A 5T3HA 4X2YA 4GVUA 2YNAA 3B8JA 1HDTH 4TSFD 2F43B 1EB1H 4Q80A 1C2DA 1QA0A 1FX0B 3PV4A 1E0FD 3SU5A 4JYUH 3GS9A 2VGCC 1GHYH 2GT7A 2G81E 4DY7B 3VGCB 2FS9A 4RT0A 1OKXA 4B75A 5C17A 2XTTB 4XFQA 3TJUA 2B5TB 3RXEA 3BF6H 4MPWA 1C5TA 3R0FA 1O3LA 1HAPH 1Z8IB 5GCHF 2KAIA 5JB8S 3IITA 2GDDA 1M9UA 4YOJA 2QAAA 1TGTA 1NO9H 4A1XA 2AEIH 1C2LA 2OINA 3LGIA 4XD7D 1BTHH 3BTGE 3A84A 3P8OA 3Q3XA 2PSXA 5HIZA 1G37A 2BXUH 3A82A 2A7HA 1BIOA 4ZUHA 3S9AA 4K69A 3URCA 1C5YB 1G3CA 4Y8XA 5FAHA 3KIDU 1AGJA 3TH2H 1A3EH 4FVBA 2CXVA 4FU9A 1JIMA 2R9PA 3L3TA 3DSPA 1B5GH 3EA7A 1RGQA 4OS7A 5HM9A 1TX6A 4UDWH 2HGTH 2GX4A 2A5IA 3F9EA 4YESB 3LH1A 3BTEE 3AAVA 2R3YA 3UWIA 1A46H 1AE8H 1BRCE 1TX8A 1XVOA 4XRNA 4ZKSU 1MQ6A 1RXPA 1Y5AT 5DP3A 1P04A 4CHAC 1TRNA 1NT1A 3ELAH 1AMHA 5DKMA 3E0NB 3HKJB 3SJKA 4WH6A 1RTKA 1QA7A 1KXDA 3GISB 2FOMB 1JWTA 2A7CA 2KCYA 2Y6TA 3KHVA 1WAYB 2PFEA 2IPQX 3GYLB 4NA9H 3UNSA 2VIVA 1OP2A 1XKAC 2BX4A 1O32A 5CHAB 1L4ZA 1NN6A 2ZCLP 1KYNA 1O34A 1WXRA 2LELA 1SGTA 3T5FH 2BDIA 4Y7BA 1TNHA 4I32A 1O3FA 1YPEH 1QBVH 2XYAA 1O36A 2LP6A 1TGNA 1O5BB 3V7TA 1GBAA 5JBCS 3H7TA 2PV9B 3TH3H 5GXPA 2JETB 1KTTB 3AW1A 1W14U 3OTPA 1EAXA 1O2SA 1T4VH 3ZZ8A 3ZZ9A 2QXIA 2ZO3H 4RSPA 2XOKD 2QY0B 2QXJA 4SGAE 2CMYA 1IHTH 2SGPE 2K7XA 1J9CH 3ZZBA 3TK9A 2BZAA 1DANH 4UD9H 3GY6A 4NSYA 5F03A 2BVXH 3QN7A 1EZXC 2GJGA 1DDJA 3FAOA 1QR3E 1LPKB 4ZHAA 5EIYA 4I8JA 2ZU5A 3UR6A 2JKHA 2BOKA 3U28C 1GHWH 5HKKD 1Y3XA 1WDIA 3P95A 1SQOA 1EKBB 2WPMS 4UFFH 1GJDB 2HRVA 2Z9GA 2WUBA 3T26A 1ZTKA 1KTSB 1ZRBA 2SGAA 3CENA 4ESTE 4VGCB 1UVSH 5L30H 1ZSKA 3PMJA 2HNTF 4LXBH 4KP0A 2UWPA 4LOYH 3EA8A 3S9CA 2BDGA 2R3UA 2FIRH 2Z94A 2FOFA 1HNEE 5AF9H 2YOLA 3N99A 4TWYA 1MMJN 2GGVB 5DN6D 5PTPA 5KGOA 4NIWA 3PMBB 1GBEA 1GJ5H 3SGAE 1K1PA 3SNDA 4FUBA 1K0HA 1ETTH 2PGQB 3GCTF 3T25A 3FZZA 3OEHD 3SV2H 1MTNB 5J4QA 2WUCA 1S84A 1TNLA 2FXRA 1RTLA 1E79D 3KQBA 3MNXA 2PW8H 3WY8A 3PLPA 3LGVA 1GBCA 1EZUC 1MBQA 2GMTC 1YPHC 3EQ0H 3U1IB 3TITA 3GYMA 1FN8A 3A7XA 3HGPA 2J92A 1O2PA 1Q31A 1GGDB 1SVPA 3C27B 1B7XB 1HPGA 2BB4A 2ZHWH 1W0KD 2ZC9H 4B2BA 2PHBA 1C2MA 4NFEA 2XC5A 2ALPA 1DE7H 3RLWH 2Q6FA 1SFQB 3SGBE 2QYIA 2PKSB 2ZIQH 3MU4A 3M36A 1K1LA 1KDQA 4ZHLU 4DT4A 2ZDLA 1QGFA 2I6SA 2C8YB 3IG6B 5DP8A 2FOGA 1O2RA 5T1VA 3V12A 2WV9A 3TJOA 4MG3A 1WQSA 5TJXA 1Z6JH 1EP5A 5E8EH 1SHYA 1AWHB 1LKBA 1DOJA 3MQKC 3QGJA 4HFPB 4ABDA 3BEUA 1A2CH 6GCHF 1NPMA 1HXFH 4NA7A 4GCHF 4AGKA 5B6OA 1YC0A 2C3SA 2BHGA 3BG4C 1QL9A 3ZVBA 1Z7KA 1TRYA 1Z71A 4CRDA 3DA9B 1N1LA 5C5OA 1ELGA 3PV5A 4R0IA 5BRRE 2F9VA 5IDKA 4XDEA 3HKIB 1O2WA 2BQWB 4U2WA 3RXAA 4ACBA 2F91A 2CHAB 2ZDNA 2FI5E 2VVCA 1B0EA 1MKWH 2ZFQH 3MNSA 4TPIZ 2OXSA 4B6FA 2BM2A 4UFGH 2BLQA 1Y59T 1S6FA 1PPEE 1C1NA 2WYGA 1E34B 1EZQA 1TFXA 1C5NH 1HJ9A 3TPIZ 4WF8A 2A2QH 4UONA 1CA0B 3GDSA 3A7WA 4CH2B 4Y71A 5JB9S 4HGCA 8GCHF 1ZGVA 1GJ4H 4X2WA 2ZU1A 5L2YH 3AK5A 1GDNA 2ZZUH 4OGXA 1O3AA 1K9OE 2SNVA 2QGRA 1AKSB 2RDEA 1FONA 2R2WU 5GNDA 2ZGBH 2A5AA 1E37B 2EQNA 3SZEA 2W7SA 3SOSA 3TNSA 1G32B 1MABB 4IC5A 3ZZ5A 4AYVB 3KYFA 2OC1A 3UREA 3AW0A 1MU6B 3TNTA 2R2MB 5JBTA 4BAHB 4A6LA 1HAGE 1NZQH 1UTLM 3MFJA 3UOUA 2STBE 3HK6B 1P12E 2Z3DA 2VINA 1NU9A 4X1PU 4HI3A 3UNQA 2M2AA 4IN2A 3W95A 5C1XA 1UTKA 2JH5D 4KTSA 1TLDA 2FOAA 1G2LA 4B6EA 1O2VA 1EXFA 5FBEA 1W11U 1BOQA 5EGMA 5EU8A 2G55A 1O3BA 7GCHF 2SGFE 4OS4A 4O03A 1ARCA 2SGEE 4F4OC 2WYJA 1CHOG 1FNIA 5DP5A 1UCYE 2EY4C 2VWOA 1O3HA 3A86A 2BZ6H 1BZXE 1CU1A 4OS5A 4ABIA 4K1EA 3U98H 1QIXB 1EAUA 3SUDA 1P03A 1JXPA 1HJAB 3I77A 3KQCA 1SPJA 1P05A 4UEHH 1ZTLA 1Z8GA 4I8LA 1LVMA 1C5SA 1CQQA 2V35A 3F9GA 3N7DA 1C4V2 2HPPH 2VNTA 1EZSC 1OWKA 4HG6A 1B0FA 5EJLA 4ABAA 1GL0E 4ZKNU 4K60A 3SN8A 2GCTB 1YLDA 3LC5A 5LPRA 2QXGA 3QZRA 4KTUA 5JYIA 2TGPZ 3LOXA 3RXVA 1ZJKA 1EP6A 4NCYA 5A8YA 1BMAA 5F6MA 1NESE 2Z3EA 1BUIA 2ZF0H 3TVJB 2SFAA 3SU4A 4B73A 1DS2E 4UFEH 1XUIA 5FPTA 3OE7D 1YBWA 1C5PA 1TPOA 4D7FA 2OC7A 2BDAA 4RI0A 3SYJA 2XBXA 1WTHD 1X7AC 1MH0A 1XUJA 2A4QA 3PTBA 4AFUA 2O8MA 4A1TA 2XCNA 1C5ZB 3NPSA 1J15A 4DJZB 4KKDA 1JIRA 3RXIA 3NWUA 3QK1A 1C1OA 4ABBA 4A7IB 1T8OA 1AZ8A 1MZDA 3M5MA 2PGBB 1E36B 5B6LA 2PWXA 4X2XA 2ZDMA 4NIYA 1O3MA 4UE7H 3ZZ7A 1S81A 1OWIA 3SQHE 4NWLA 3RP2A 5DP9A 1L2EA 3OYPA 1QNJA 2JIZD 1H9LB 1SGIB 1TA6A 3BTWE 2KAIB 4RT1A 2VIPA 1FLEE 1GVZA 3PLBA 3U9AH 1CGIE 1RS0A 2QA9E 5HYOA 1HLTH 1GMDG 3E8LA 2QCYA 1EATA 2RG3A 3K6ZA 1UTJA 2BQ7B 3M37A 5LPFA 1IHSH 4FUFA 3T29A 4ABEA 1FDPA 1N6XA 3CS0A 3ZVCA 3P70B 1AE5A 5DP4A 4CRAA 2ODQA 3RXPA 3W1EA 5F8TA 1GBJA 4LZ4B 2F3CE 1P06A 5C2ZA 4RKJB 1S83A 2Y80A 5C1YA 4B1TA 3TLOA 1A1RA 1SGDE 1UW7A 3RXDA 1BTYA 3PRBA 1SQTA 2OQ5A 4ZH8A 1KLIH 5EW1H 1LHEH 5H4IB 4M9FA 1GBLA 3RMOH 1V2ST 3BN9A 5E0GA 1NBME 2TGAA 3OY6U 2ZHQH 4ZXYH 1EPTA 2FYQA 5HXFA 2QF5A 3V3MA 4MVNA 1WSSH 2FOCA 2GZ7A 1ZPZA 2ZHEH 1SI5H 3PYHA 1C1TA 5E0HA 3Q76A 1V2QT 2A4RA 1W0ZU 2BDHA 3FP7E 4OM9A 5GDSH 2VIQA 3NXPA 3SI3H 1ELAA 3VG8A 4F48B 3QDZB 6CHAC 1OPHB 8LPRA 3EGKH 1GBDA 2H5DA 4X8TH 3M5LA 3U8RH 2L6OA 2ZFPH 3KYGA 5EPNA 1ETSH 1GI0A 2ZI2H 1L1GA 3K2UA 3ZZ3A 2A32A 3SUFA 2W6ID 2HOBA 4YO9A 1INCA 1DWBH 1UCYK 4AFQA 3DSGA 4X1SU 1H4WA 3WWFA 2BMGB 1GJ7B 3ZV8A 1KXBA 1V2PT 2EC9H 2VH0A 4ISOA 2ZHDA 1LO6A 1VJAU 3HATH 1SKYE 5F8XA 2IN2A 3QX5H 3UQOA 1N8OB 2Y5HA 3FVFB 2NU1E 3RXQA 1T8MA 1O2GH 5TCCA 2HWLB 2Z3CA 4I8HA 3U8OH 5L2ZH 4ASHA 1LQDB 3TIUA 4A92A 3A83A 4WWYA 4Q63A 3ESTA 4AORA 1PQ7A 1G36A 5J4SA 2ZFTA 3K6YA 1V2MT 1DY8A 5TCAA 1THPB 1UMAH 4LK4A 2XXLA 3SV7A 2ZTYA 1Y3UA 5ESBA 1NFUA 2VWLA 1FQ3A 1BTXA 1EJMA 3F68H 1GI9B 3RXCA 1P01A 1EX3A 2VH6A 4ZXXH 3RM0H 4OS6A 4FOUC 2Y5GA 1QQUA 5EXMA 1L4DA 2BLOA 1KXAA 4FUGA 3UQVA 1SLUB 1OWJA 2EI6A 3SW2B 1G9IE 5EXLA 1MAYA 1PYTD 6LPRA 2B8OH 5CHBA 3FN8A 1NBMD 4BAKB 3GCHC 3K65B 4K5ZA 3A7ZA 1TWXB 1V2UT 1DLEA 4U32A 1ELBA 2AH4X 2G4UA 1SHHB 2PUXB 2J98A 4JZ1A 2V3HH 1SGQE 4AN7A 4B2AA 3TGIE 1VCQA 1ZZZA 1HIAB 1SSXA 3TJNA 3TJVA 1GMCG 3D49H 1BQYA 2GTBA 1BDAA 1C1PA 1SGNE 1VCWA 1UJ1A 1GI3A 1TNKA 1A5GH 1CSOE 1P10A 1GDQA 1RTFB 1ANBA 3RXBA 4X1RU 1FXYA 9LPRA 1HAXB 3ZYDA 4GHTA 4AC9A 1GJBB 1MTWA 2F9UA 4YLUA 4MNWA 4B76A 3EBNA 2DE8A 1FN6A 1TMBH 2P16A 1O3JA 1AUJA 3EE7A 2QIQA 1O5GH 1ESAA 5A0BA 2Z7FE 1BMFD 4HTCH 2F9OA 1KXFA 2BDYA 2CJIA 1UVOA 1VKYA 2C90B 4WH8A 5FXLA 2J97A 1W13U 2FDAA 3LH3A 1TE0A 2XBYA 3BG8A 2C8XB 1C5VA 1AWFH 3GY4A 4I7YH 1H8IH 1YKTA 1BTZA 1G2MA 1KSNA 1LCYA 3P92A 3S0NA 4Z1MD 1JRTA 2PUQH 3ATWA 2HALA 1O5FH 4MDSA 2XC4A 2FLRH 1TABE 3MO3A 1O2QA 1GMHG 1KDQB 1O3EA 3O8DA 3ZZ4A 3NKKA 1TA2A 1EJNA 1LHGH 3OEED 1GCTC 2GD4B 2ZP0H 4FU8A 5EQRA 3BTFE 2VB0A 2JH6D 2AIQA 5HIYA 1C1WH 3ENSB 4B2CA 3N7OA 1ELDE 1TBZH 1WTGH 3VPKA 3MTYA 3T2NA 5DP7A 3URDA 3D65E 1N6YA 4B74A 2WPLS 5CE1A 2ZDAH 3TGJE 1VITG 3F2FA 1P02A 3IWMA 1GJ6A 3MMGA 3MOCA 4R8TB 1MKXK 3RXSA 1LVBA 8KME2 1SOTA 3M5NA 3M3TA 2BLVA 4GPGA 1DXPA 3SU3A 1V2LT 2KCOA 3Q3KA 2ZU2A 1C2FA 1IQEA 2FEQH 3PO1B 4ZAEA 3EE0B 5A8XA 1GBMA 1THRH 3GY8A 2BLWA 3PM3A 1GVLA 1UTQA 1W3CA 4MNYA 4Y6DA 2FP7B 2A0QB 1HUTH 1SBWA 3SJIA 3RMMH 1L1NA 2K8IA 1ZJDA 4Q2KA 3UUZA 1SLWB 1XVMA 1GG6C 1C1MA 1F0SA 2ZEBA 2Z9IA 3RMNH 1CGJE 1DX5M 1O2UA 1QHRB 1XUHA 4UFDH 5C0UA 1Y8TA 1A5HA 4Q7YA 1UK3A 4Q7XA 1ZPCA 1TNIA 3PWCA 4LZ1H 2FODA 1SL3A 3JZ1B 3A88A 1CBWC 4K8BA 4K3JA 3SNCA 2J9NA 2OD3B 2C8WB 2KCPA 1IQGA 1CHOF 3TU7H 3K9XB 5A0AE 3VB5A 4YOGA 1W7XH 1YPGH 2PKAA 2Z6BD 1DPOA 2UUFB 3QUMP 4NSVA 1HIAA 1AQ7A 1O37A 1C5QA 1GBHA 1YWUA 2FWWA 1D3TB 5A2MH 5EODA 3F2HA 5EXNA 1QJ7B 4A5TS 2BQ6B 2XC0A 2AHME 3RC6A 1S85A 2NU2E 2QF3A 3GDUA 1YCPK 4ISHH 4ABJA 2HLDD 1DY9A 3S9BA 4BNRA 2ZGJA 1CT4E 3ZYEA 4TPYA 3LC3A 3NRLA 2OC0A 4ZCNA 2VVVA 1GHVH 3SORA 1GHAG 4MTBA 1O3PB 1HYLA 1BB0B 1O2TA 2ASUB 1IQJA 1CT2E 3MYWA 3PMHB 2BD9A 1QQ4A 3RXKA 4MPUA 3NK8A 3E0PB 3SJ8A 1CGHA 3RU4T 5EQQA 4AX9H 4CRBA 1LHDH 2G8TA 3MWIU 1MAXA 2B9LA 2STAE 1ZHPA 5C94A 1C9PA 1DICA 4YT7H 3A8DA 1PYTC 3ATIA 3GICB 4NFFA 2BVRH 1Z8JB 3SU0A 3F9HA 1K28D 1T31A 1KY9A 1AB9C 2PTCE 4MLFB 1C4Y2 1GJ9B 2F83A 5EOKA 5F53A 1YCPM 2BY9X 1MD7A 4IS5A 1C1SA 1F2SE 3BV9B 1SG8B 1P0SH 1XM1A 2UUYA 2ZPQA 5FPSA 4DT7B 3FFGA 1SB1H 2ZTXA 3A81A 1VJ9U 2GVFA 1O2OA 1XXFA 2FO9A 1MKXH 1TPSA 1H8HD 1TMUH 1ELFA 2CF9H 1C5OH 2WV4A 1UK4A 1FPCH 4O3TA 1VCPA 3SHCH 2ZPSA 4IMZA 1GMDF 1GHXH 1ZSJA 2D8WA 4A1VA 2A45B 3A80A 2L74A 1C1RA 4H4FA 4FETA 4P00A 2GZ8A 2EI7A 3JZ2B 4JCNA 4SGBE 4K8YA 4JZDH 2FOHA 5CHAC 1GI6A 2FMJA 1VGCB 4JZIA 4D9RA 4E06H 3PB1E 1EUFA 1BJUA 4NZLA 1O2LA 1O3DA 1RIWB 1P8VC 2UWOA 2GT8A 1PQAA 4DVAU 3E91A 1SMFE 4JZFH 2D2DA 1HBTH 2JETC 4Y76A 4DG4A 2NU4E 2JJ2D 1SGPE 4CBNA 3QTVH 2GCHG 1IQNA 1FAKH 1YPJH 2GP9B 3E16B 4AG2A 3UOPA 3UFAA 5FPYA 2H9EH 1AO5A 2OQUA 1DWCH 2Z9JA 1A7SA 4AFZA 4IMQA 2UWLA 1AFQC 4NWKA 1ZRKA 3RXTA 1O2NA 1BJVA 4H6TA 3H7OA 1K1JA 4ABGA 3ATMA 1W7GH 1DWEH 1BTPA 3ZIAD 2XWBI 4BOHA 1P2QA 2ZDVH 1HAIH 2BY8X 1AD8H 1YCPH 1NS3A 2P8OB 2ZHFH 4X2VA 4IN1A 3ZZCA 3SHAH 2TBSA 3ITIA 4ZHMU 4FU7A 2Y5FA 3ZZ6A 1C5LH 2XWAA 4CRGA 1TQ0B 1QFKH 5A8ZA 3U1JB 4VGCC 1EPTB 1MTUA 3KF2A 3W94A 2AMDA 1O3OA 1QJ1B 2O8UA 1SGEE 1P2OA 2BY7X 1D3DB 2QC2A 4X0WU 4JYTA 4X6OA 6CHAB 1ZMNA 5C0TA 1THSH 1K1MA 3AASA 1XXDA 2O9QA 1DLKB 2OLGA 5EJ1A 1E1QD 1W2KH 1YP9A 3MU1A 1UTNA 1GBFA 1HCGA 1H8DH 2H1UA 1NTPA 2HPQH 1OS8A 1H9HE 1G3DA 1BHXF 2FPZA 3OTJE 2FS8A 1MTNC 1Q3XA 3BIUH 1D6RA 3RXOA 3Q77A 5ABWA 1W10U 1EJAA 1QBOA 3B23B 3CS7A 1F5RA 1DT2A 1LHCH 4D76A 1HV7A 2VWNA 3ODFA 2AGIX 2VIOA 2O8WA 4O9VA 5FCRA 1IQMA 1GGDC 1Y3VA 3VB6A 4FUJA 3M7UA 1OSSA 3LIWA 4AG1A 5CDFE 4BANB 2ALVA 1Z6EA 1BBRE 2BOHB 1O5CB 2FOEA 2YMSB 1S6LA 2ZG0H 2OK5A 5JBBS 5T6FA 2BD7A 1D4PB 1FPHH 1YPLH 1O33A 2K0QA 1CO7E 1F0UA 1FV9A 3GCOA 2P94A 1XUKA 2ZCKP 1GMCF 1ABJH 1C2HA 1XX9A 4DGJA 1AIXH 3L6PA 3NUMA 5FL7D 5JBAS 1L1JA 1GHZA 1DXWA 1LVOA 4TT3D 1UVUH 2VGCB 1OP8A 4XOJA 3MU8A 2ODYB 5HGGA 3AAUA 2O8TA 3F9FA 1QJ6B 3O8RA 1WV7H 1C5UA 3BTQE 3ZVFA 3PMAB 4YOIA 1FIWA 2P59A 5AFZH 1CHGA 4MNVA 1TGSZ 1QB6A 4YXWD 2D26C 2FX6A 5F8ZA 5KECA 1O3CA 1GCDA 2W3KA 2J98B 1ELEE 5ETXA 3I78A 4WMEA 1Q2WA 1V6DA 2VIDA 4DURA 3MH5A 4ZKRU 3KCGH 2ZA5A 3BTME 4X8SH 2CHAC 1C1UH 4J2YB 5ESTE 3RXJA 2ZNKH 1H1BA 1GJAB 1JBUH 4H6SB 2H6MA 4J1YA 1MUEB 5EPYA 2ZFRH 1UK2A 2QN5T 2JJ1D 4I31A 2VVUA 3MNCA 3PRDA 1GMHF 1PPFE 1SC8U 3LU9B 1S0RA 5HMAA 2DUCA 4BAMB 1GI2A 4KGAA 6GCHG 4YZUA 2ZDKA 1ESBA 4FUIA 2UUJB 3UAIC 2V3OH 3KQ5A 4GCHG 1CA0C 3QWCH 2G5VA 2H9TH 2D1JA 3MH7A 4KTCA 4CHAB 2ZPRA 5G4BA 2PP6A 5DJ7A 2ZTZA 2B0FA 3OSYA 1S6HA 2AGGX 3FP8E 3HK3B 1F0TA 5EJZA 1WQVH 1VITF 2WPKS 1IAUA 3P17H 1TBQH 3VB3A 2QV1A 2WPHS 2C4FH 2FOBA 5C5NA 3FZDA 1C5WB 1TX7A 2P3TB 3A85A 4IGDA 5C3NA 1O2YA 2AYWA 3F2GA 1ACBE 1SGFG 1COWD 1QY6A 2NU0E 3UNRA 1UTPA 2KCAA 4FUDA 3DCLA 4Z0KA 5DP6A 1DWDH 4JMYA 4YM9A 2C8ZB 4D9QA 8GCHG 1GI4A 1P11E 1MCTA 1ZYOA 3STIA 5EW2H 4MQAA 2W7UA 1T7CA 3LONA 2OUAA 3Q00A 1K21H 1O5DH 2J5UA 1S0QA 2QF4A 3UPEA 2TRMA 3P6ZB 1YF4A 2OBQA 1P2JA 2XRCA 1RRKA 2TGTA 1D6WA 9ESTA 1IOEA 4AB9A 3VB7A 2M5TA 3QLPH 1MBMA 3T62A 1FY3A 3VFEA 3S7HB 3FKSD 1OYTH 2B7DH 2H9HA 5A09A 3E90B 2YNBA 1HAVB 1HJAC 1P2KA 2FTLE 3DSOA 4BXSA 3BEIB 1TB6H 4FVDA 3SV8A 2ULLA 4U01A 4DIIH 3RC4A 2W26A 5L6NH 4NA8A 1MQ5A 1O3NA 1SLVB 3VB4A 1AZZA 1JMOH 3LDXH 4Y8ZA 2FYRA 3T28A 3Q3YA 1DM4B 2THFB 1AU8A 5T6GA 1EAIA 2FI3E 1MCVA 1NRSH 2HNTE 2GCTC 4NGAH 4XBDA 4ASUD 2PLXA 3PLKA 2ZQ1A 1BBRK 2WPJS 1D3QB 4CR5A 4ABHA 1A4WH 2VWMA 1ANEA 1F7ZA 4Y7AA 3TK5A 5CMXH 4AFSA 3QTOH 5HM2A 2V3MA 1ANDA 1O3KA 5GPIB 1TNJA 1GHAF 1UHBA 1SFIA 2TPIZ 3SI4H 3A8AA 2XCFA 1WUNH 3GOVB 3BTTE 3LGWA 3MH6A 5AVDA 2V7QD 4ISNA 2PKAB 2OBOA 4CH8B 4Y10E 1UO6A 3H5CB 1VITH 3VEQB 2EEKA 1MTSA 4X6MA 1YGCH 1QBNA 1QL8A 3A7YA 2XBWA 4AYYB 4THNH 3OFND 1GI7B 1ORFA 3F0PA 1ETRH 3LGYA 2HVYB 1W8BH 2WINI 1GBKA 4TWWA 1V3XA 3M3VA 4WXIA 3WW7A 4BXWA 2J38A 3SNAA 3M35A 2GMTB 3ZZAA 3GDVA 2IJD1 5DGJA 3RM2H 3RC5A 1PPCE 1TGCA 3AVZA 1LVYA 2HLCA 1BRBE 3FANA 4Y0YE 4F55A 4CBOA 4X1QU 3SV9A 2ANKH 2CN0H 1O30A 2JDID 2OP9A 3E1XB 5C1UA 3DFLA 4MNXA 4TY7A 1RD3B 3KEEA 2VU8E 1AB9B 4BAOB 1SQRA 2P93A 2W6JD 1F92A 1XUFA 4WXVA 1TMTH 1K1OA 3A87A 1DUAA 2H2ZA 1GBIA 4OGYA 7LPRA 1GI8B 4XSKU 1O38A 2A7JA 1CVWH 2IOTA 1SGYE 1SOZA 1F5KU 1QB9A 3A7TA 1UCYH 4BAQB 1BTWA 2CK3D 4ISIH 2LIZA 1CT0E 3LJOA 3RXGA 1EASA 1QRZA 5IK2D 4E7NA 1UVPA 1RJXB 2GCHF 1FY5A 1P9UA 5A0CA 2IPHA 2RA0A 1NFYA 2OC8A 1TBRH 2Y7XA 3BG4B 1NRPH 4CRFA 1PPHE 4ABFA 3S7KB 4K1TA 5KEDA 4O97A 1PQ8A 1V2JT 4Y0ZE 3KN2A 1YPKH 3DUXH 1HJ8A 1OWDA 3ZV9A 1FJSA 1T8NA 2FZZA 2BD5A 4MPXA 1HAVA 1LPGB 3KQDA 2ESTE 4XE4A 3OU0A 4ZMAH 3N7EA 1GDUA 1KLTA 2SNWA 1G3EA 1HRTH 1BBRH 3BEFB 1BRAA 4XBCA 1XKBC 5JPMH 1MU8B 1DFPA 2J95A 2BD3A 1J14A 1PJPA 5EQSA 1KMHB 4IC6A 1J17T 5DPAA 3ZVEA 1TAWA 6ESTA 1UTMA 1O35A 1NFXA 5AFYH 1OXGA 1N8OC 1O0DH 4TY6A 1AN1E 1SR5C 1T8LA 1LMWB 2GV7A 2RA3A 3UB0A 4OS1A 1AFQB 5JDUB 3OX7U 3SNEA 1HFDA 4RN6A 5LPEA 1P57B 1EB2A 1H8ED 2R0LA 1QRXA 1GBBA 4BTTB 1D9IA 1HAZB 4X1NU 2Z9KA 1P2IA 2J94A 5I46H 1GPZA 3RLYH 2J4IA 4E7RG 1MKWK 3QO6A 2LNCA 1C1QA 3O8CA 2A1DB 3F1SB 3MH4A 4DIHH 4JK5A 4WJG2 1S5SA 1ZMLA 4I33A 4INHA 1ZMJA 2DE9A 1ZPBA 2FI4E 2K1QA 4INKA 1E35B 2ZECA 1HAHH 1GI5A 2QE7D 1TGBA 4ISLA 1XMNB 1F0RA 5E2OA 1IQFA 1PQ5A 3PV2A 1GHBG 3OY5U 3VGCC 1HGTH 1ZSLA 1YLCA 4CREA 3DD2H 1WOFA 5I25A 1QZ8A 3VXFH 3RXHA 1D3PB 5AHGH 1FUJA 1G30B 2Q6DA 1TONA 1C2KA 1EAWA 4I8KA 1YPMH 2Q1JA 2RFKC 3MU0A 1E38B 1O3GA 1YY3A 3UTUH 3A89A 1C2JA 4NIVA 2A31A 5DO4H 4X6PA 1BTUA 3SZNA 1DITH 1ZTJA 3A8BA 4K1SA 2WPDD 4Q7ZA 1XUGA 1JRSA 1NRQH 1IQIA 3RXUA 2BY5X 1WBGB 2AMQA 2G51A 1VZQH 2Y7ZA 1MZAA 2W3IA 1LPZB 1A0HB 2NWNA 3RXMA 3D23A 4NZQA 3SJOA 1ZHMA 1W0JD 2FX4A 3SUGA 2AFQB 1O31A 4GHQA 4ZKOU 1MD8A 3PROA 2CF8H 1P2MA 3MI4A 4Q4LA 5GCHG 4AOQA 4Z6AH 3ATKA 5K0HA 2WHXA 3QGNB 8ESTE 4IW4E 2ILNA 3QZQA 4QT8C 1QURH 2RCEA 2FLBH 1AHTH 1IQHA 1NRNH 2AS9A 1K1IA 3S69A 2EA3A 1G3BA 1DVAH 1C1VH 1MTVA 1HAYB 3BIVH 1CA8B 3M7QA 2ZKSA 2VBCA 1PFXC 1P3CA 1WU1A 1OP0A 3H09A 1ZGIA 3TK6A 1TOCB 1K1NA 3KNXA 3V13A 1S82A 3LGUA 4U30A 1OYQA 2VIWA 3GY5A
chains in the Genus database with same CATH topology
4X8UH 3KGPA 2EI8A 2A5KA 5DK1A 1O2HA 1HXEH 3KQEA 1W0YH 1AVXA 3EAJA 1OWHA 5FHTA 3SU1A 3I29A 5DG6A 5SGAE 3RDZA 3LKWA 2GV6A 2BD2A 3HGNA 3T27A 3PWBA 1T4UH 4D7GA 3DFJA 3V0XA 3SV6A 1TALA 2Z9LA 4F49A 1TQ7B 2QXHA 5E2PA 1GJCB 2RDLA 3SQEE 1Y5UT 2BY6X 4H42U 3U8TH 4CRCA 2I6QA 1V2WT 1LDTT 1FIZA 4DCDA 2G5NA 1YM0A 2HNTC 2F9BH 1BITA 3GCNA 2O8LA 3PO1C 1C5XB 1V2TT 2PSYA 1KIGH 4JK6A 1BA8B 2J2UA 4K2YA 3ZVAA 3SO3A 1TIOA 1V2NT 4Y11E 3C1KA 4FUCA 1ESTA 1OX1A 1P3EA 2BDBA 4ZROA 2LPRA 1A0JA 2ZU3A 1PPGE 1A3BH 1BCUH 1BMNH 1NU7B 3RUOA 4FXGH 2A4OA 2ANYA 2BD8A 1O2MA 1BHXB 3LT3A 4JYVH 5FX6A 4D8NA 1NFWA 1AUTC 4OS2A 2V0BA 2AERH 2BVSH 1EQ9A 1WYKA 1P09A 1O2ZA 2OCVB 3BTDE 3LGTA 2BX3A 1BMLA 1C2GA 4PROA 3D62A 1LHFH 2F9NA 2XBVA 5C20A 1K2I1 1DUEA 3GY2A 4BTUB 4TYDA 1KXEA 2BXTH 1FY4A 3B9FH 2ZGXH 4GUXA 3ZVGA 1UTOA 1TOMH 2A4GA 1GWAA 3MU5A 1PPBH 4BTIB 1FI8A 3L33A 1BRUP 4Y8YA 4X8VH 1O2IA 4GSOA 1Z1JA 2SGDE 2ZGCA 3M3SA 2W5EA 4KELA 4AGJA 2AGEX 2F9PA 3LPRA 2FM2A 1C2IA 1DSTA 3NCLA 2BYAX 1U6QA 2CV3A 1WCZA 2CGAA 2PTNA 3NZIA 1ABIH 1O2XA 1C2EA 3MHWU 3O8BA 1P2NA 3RU4E 4YT6H 1Y3WA 1P9SA 1NC6A 3A7VA 4FUHA 3RXRA 3UWJH 5LGOA 3GCTG 4DW2U 1ELTA 1TRMA 4RKOB 1SLXB 2PKSC 1LQEA 1OOKB 3SU2A 2FESH 1Y3YA 1A5IA 4YLQH 1AVGH 3P8NA 5LH8A 2A2XH 3MO6A 1KLJH 1SGFA 4IBLH 2TGDA 1A61H 1UVTH 1QB1A 2GZ9A 1QCPA 1Y5BT 3EYDA 3GCHB 2P3UB 1UHBB 3SUEA 3DHKH 2Q6GA 2ZGHA 2Y81A 1AI8H 3P8FA 2H5CA 2ZU4A 2XNIA 3BSQA 2ODPA 7ESTE 2HVXA 4GLYA 3STJA 3SJ9A 1VR1H 1QL7A 1O2JA 3KL6A 5T6DA 1VGCC 3GY3A 2ANWA 5C67A 3P8GA 2R0KA 1NM6A 3RXLA 1ANCA 4NIXA 1TPPA 1RIWC 2P95A 2AMPA 1EOLA 3DT0H 1AVWA 4Y79A 3RXFA 4E05H 4NG9H 1T32A 1J16A 3M7TA 1ARBA 3R3GB 2G00A 3GY7A 3SGQE 3M61U 1A0LA 1ZHRA 2WV5A 1FZZA 2TIOA 3ODDA 3TGKE 1NROH 1AKSA 1L0ZA 2AIPA 2C93B 4FUEA 3SU6A 2G4TA 1EOJA 3E6PH 1ZLRA 2OTVA 3BTHE 1V2OT 3CP7A 1AY6H 4WMDA 1FY8E 1AFEH 1FMGA 1YPHE 4X6NA 3MO9A 4AZ2B 1KXCA 1O2KA 3UY9A 3G01A 1GVKB 2NU3E 5FX5A 1LTOA 3RU4D 1O5AB 3ZVDA 3M5OA 1V2KT 5IYTA 2PR3A 1NY22 2P8OC 2IJOB 1V2RT 1YYY1 1GCTB 1RFNA 2FTMA 3F6UH 4HZHA 2QF0A 5K7RA 3U69H 1O3IA 1ZOMA 1FY1A 1CE5A 1ELVA 1LKAA 1W12U 3UIRA 1J8AA 5EG4A 4O3UA 1EPTC 2JH0D 2ZFSA 4MPVA 4WMFA 1JOUB 3ATLA 1BT7A 1C4U2 5FCKA 2ZWLH 3UR9A 2GDEH 1K22H 7KMEH 1SGRE 3TH4H 4DOQA 1QRWA 1GL1A 3FP6E 4WY3A 2UUKB 2V6NA 1F5LA 1TYNA 3A8CA 5E0JA 1HB0B 3EDXB 4GAWA 5GIBA 2J34A 3LJJA 4I8GA 1DSUA 1Z1IA 1TPAE 3EA9A 4INLA 2G52A 3PTNA 2ANMH 3E3TA 2VJ1A 3HPTB 2BTCE 1C9TA 1OWEA 5FBIA 5BPEA 5GJ4B 1GBTA 1O39A 1H9IE 1V2VT 1SQAA 2GKVE 3SBKA 4JZEH 1SGCA 2P3FH 2ZFFH 1GG6B 4CR9A 3BTKE 1PPZA 1HAOH 4XBBA 1BMMH 2BDCA 1ZR0A 1C5RA 4WVPE 7GCHG 2WPIS 2ZQ2A 2BD4A 1C5MD 1QTFA 2XW9A 3SNBA 1IQLA 4B71A 1GHBF 2SGQE 4M7GA 2ZCHP 3VXEH 3MNBA 1CBWB 1GJ8B 4YTAA 1GI1A 1TNGA 3ZZDA 4AB8A 5GWZA 1Z8RA 1IQKA 3RMLH 1ELCA 1FAXA 1ID5H 1O5EH 1NRRH 2Y82A 5T3HA 4X2YA 4GVUA 2YNAA 3B8JA 1HDTH 1EB1H 4Q80A 1C2DA 1QA0A 3PV4A 1E0FD 3SU5A 4JYUH 2VGCC 1GHYH 2GT7A 2G81E 4DY7B 3VGCB 2FS9A 4B75A 1OKXA 2XTTB 4XFQA 3TJUA 2B5TB 3RXEA 3BF6H 4MPWA 1C5TA 3R0FA 1O3LA 1HAPH 1Z8IB 5GCHF 2KAIA 5JB8S 3IITA 2GDDA 1M9UA 4YOJA 2QAAA 1TGTA 1NO9H 4A1XA 2AEIH 1C2LA 2OINA 3LGIA 1BTHH 3BTGE 3A84A 3P8OA 3Q3XA 2PSXA 1G37A 2BXUH 3A82A 2A7HA 1BIOA 4ZUHA 3S9AA 4K69A 3URCA 1C5YB 1G3CA 4Y8XA 5FAHA 3KIDU 1AGJA 3TH2H 1A3EH 4FVBA 2CXVA 4FU9A 1JIMA 2R9PA 3L3TA 1B5GH 3EA7A 1RGQA 4OS7A 5HM9A 1TX6A 4UDWH 2HGTH 2GX4A 2A5IA 3F9EA 4YESB 3LH1A 3BTEE 3AAVA 2R3YA 3UWIA 1A46H 1AE8H 1BRCE 1TX8A 1XVOA 4ZKSU 1MQ6A 1RXPA 1Y5AT 5DP3A 1P04A 4CHAC 1TRNA 1NT1A 3ELAH 1AMHA 5DKMA 3E0NB 3HKJB 3SJKA 4WH6A 1RTKA 1QA7A 1KXDA 3GISB 2FOMB 1JWTA 2A7CA 2Y6TA 3KHVA 1WAYB 2PFEA 3GYLB 4NA9H 3UNSA 2VIVA 1OP2A 1XKAC 2BX4A 1O32A 5CHAB 1L4ZA 1NN6A 2ZCLP 1KYNA 1O34A 1SGTA 3T5FH 2BDIA 4Y7BA 1TNHA 4I32A 1O3FA 1YPEH 1QBVH 2XYAA 1O36A 1TGNA 1O5BB 3V7TA 1GBAA 5JBCS 3H7TA 2PV9B 3TH3H 5GXPA 2JETB 1KTTB 3AW1A 1W14U 1EAXA 1O2SA 1T4VH 3ZZ8A 3ZZ9A 2QXIA 2ZO3H 4RSPA 2QY0B 2QXJA 4SGAE 2CMYA 1IHTH 2SGPE 2K7XA 1J9CH 3ZZBA 3TK9A 2BZAA 1DANH 4UD9H 3GY6A 4NSYA 5F03A 2BVXH 3QN7A 1EZXC 1DDJA 3FAOA 1QR3E 1LPKB 4ZHAA 4I8JA 2ZU5A 3UR6A 2JKHA 2BOKA 1GHWH 1Y3XA 3P95A 1SQOA 1EKBB 2WPMS 4UFFH 1GJDB 2HRVA 2Z9GA 2WUBA 3T26A 1ZTKA 1KTSB 1ZRBA 2SGAA 3CENA 4ESTE 4VGCB 1UVSH 5L30H 1ZSKA 3PMJA 2HNTF 4LXBH 4KP0A 2UWPA 4LOYH 3EA8A 3S9CA 2BDGA 2R3UA 2FIRH 2Z94A 2FOFA 1HNEE 5AF9H 2YOLA 4TWYA 1MMJN 2GGVB 5PTPA 4NIWA 3PMBB 1GBEA 1GJ5H 3SGAE 1K1PA 3SNDA 4FUBA 1ETTH 2PGQB 3GCTF 3T25A 3FZZA 3SV2H 5J4QA 1MTNB 2WUCA 1S84A 1TNLA 2FXRA 1RTLA 3KQBA 3MNXA 2PW8H 3WY8A 3PLPA 3LGVA 1GBCA 1EZUC 1MBQA 2GMTC 1YPHC 3EQ0H 3U1IB 3TITA 3GYMA 1FN8A 3A7XA 3HGPA 2J92A 1O2PA 1Q31A 1GGDB 1SVPA 3C27B 1B7XB 1HPGA 2BB4A 2ZHWH 2ZC9H 4B2BA 2PHBA 1C2MA 4NFEA 2XC5A 2ALPA 1DE7H 3RLWH 2Q6FA 1SFQB 3SGBE 2QYIA 2PKSB 2ZIQH 3MU4A 3M36A 1K1LA 1KDQA 4ZHLU 2ZDLA 1QGFA 2I6SA 2C8YB 3IG6B 5DP8A 2FOGA 1O2RA 3V12A 3TJOA 4MG3A 1WQSA 5TJXA 1Z6JH 1EP5A 5E8EH 1SHYA 1AWHB 1LKBA 1DOJA 3QGJA 4HFPB 4ABDA 3BEUA 1A2CH 6GCHF 1NPMA 1HXFH 4NA7A 4GCHF 4AGKA 5B6OA 1YC0A 2C3SA 2BHGA 3BG4C 1QL9A 3ZVBA 1Z7KA 1TRYA 1Z71A 4CRDA 3DA9B 1N1LA 5C5OA 1ELGA 4R0IA 5BRRE 2F9VA 5IDKA 4XDEA 3HKIB 1O2WA 2BQWB 4U2WA 3RXAA 2F91A 2CHAB 2ZDNA 2FI5E 2VVCA 1B0EA 1MKWH 2ZFQH 3MNSA 4TPIZ 2OXSA 2BM2A 4UFGH 2BLQA 1Y59T 1S6FA 1PPEE 1C1NA 2WYGA 1E34B 1EZQA 1TFXA 1C5NH 1HJ9A 3TPIZ 4WF8A 2A2QH 4UONA 1CA0B 3GDSA 3A7WA 4CH2B 4Y71A 5JB9S 4HGCA 8GCHF 1ZGVA 1GJ4H 4X2WA 2ZU1A 5L2YH 1GDNA 2ZZUH 4OGXA 1O3AA 1K9OE 2SNVA 2QGRA 1AKSB 1FONA 2R2WU 2ZGBH 2A5AA 1E37B 2W7SA 3SOSA 3TNSA 1G32B 4IC5A 3ZZ5A 4AYVB 2OC1A 3UREA 3AW0A 1MU6B 3TNTA 2R2MB 5JBTA 4BAHB 4A6LA 1HAGE 1NZQH 1UTLM 3MFJA 3UOUA 2STBE 3HK6B 1P12E 2Z3DA 2VINA 1NU9A 4X1PU 4HI3A 3UNQA 4IN2A 3W95A 5C1XA 1UTKA 2JH5D 4KTSA 1TLDA 2FOAA 1G2LA 1O2VA 1EXFA 5FBEA 1W11U 1BOQA 5EGMA 5EU8A 2G55A 1O3BA 7GCHF 2SGFE 4OS4A 4O03A 1ARCA 2SGEE 4F4OC 2WYJA 1CHOG 1FNIA 5DP5A 1UCYE 2VWOA 1O3HA 3A86A 2BZ6H 1BZXE 1CU1A 4OS5A 4ABIA 4K1EA 3U98H 1QIXB 1EAUA 3SUDA 1P03A 1JXPA 1HJAB 3I77A 3KQCA 1SPJA 1P05A 4UEHH 1ZTLA 1Z8GA 4I8LA 1LVMA 1C5SA 1CQQA 2V35A 3F9GA 1C4V2 2HPPH 2VNTA 1EZSC 1OWKA 1B0FA 4ABAA 1GL0E 4ZKNU 4K60A 3SN8A 2GCTB 1YLDA 3LC5A 5LPRA 2QXGA 3QZRA 4KTUA 5JYIA 2TGPZ 3LOXA 3RXVA 1ZJKA 1EP6A 4NCYA 5A8YA 1BMAA 5F6MA 1NESE 2Z3EA 1BUIA 2ZF0H 3TVJB 2SFAA 3SU4A 4B73A 1DS2E 4UFEH 1XUIA 5FPTA 1YBWA 1C5PA 1TPOA 4D7FA 2OC7A 2BDAA 2XBXA 1WTHD 1X7AC 1MH0A 1XUJA 2A4QA 3PTBA 4AFUA 2O8MA 4A1TA 2XCNA 1C5ZB 3NPSA 1J15A 4DJZB 4KKDA 1JIRA 3RXIA 3NWUA 3QK1A 1C1OA 4ABBA 4A7IB 1T8OA 1AZ8A 1MZDA 3M5MA 2PGBB 1E36B 2PWXA 4X2XA 2ZDMA 4NIYA 1O3MA 4UE7H 3ZZ7A 1S81A 1OWIA 3SQHE 4NWLA 3RP2A 5DP9A 1L2EA 3OYPA 1QNJA 1H9LB 1SGIB 1TA6A 3BTWE 2KAIB 2VIPA 1FLEE 1GVZA 3PLBA 3U9AH 1CGIE 1RS0A 2QA9E 5HYOA 1HLTH 1GMDG 3E8LA 2QCYA 1EATA 2RG3A 3K6ZA 1UTJA 2BQ7B 3M37A 5LPFA 1IHSH 4FUFA 3T29A 4ABEA 1FDPA 1N6XA 3CS0A 3ZVCA 3P70B 1AE5A 5DP4A 4CRAA 2ODQA 3RXPA 5F8TA 1GBJA 4LZ4B 2F3CE 1P06A 5C2ZA 4RKJB 1S83A 2Y80A 5C1YA 4B1TA 3TLOA 1A1RA 1SGDE 3RXDA 1BTYA 1SQTA 2OQ5A 4ZH8A 1KLIH 5EW1H 1LHEH 5H4IB 1GBLA 3RMOH 1V2ST 3BN9A 5E0GA 2TGAA 3OY6U 2ZHQH 4ZXYH 1EPTA 2FYQA 5HXFA 3V3MA 4MVNA 1WSSH 2FOCA 2GZ7A 1ZPZA 2ZHEH 1SI5H 3PYHA 1C1TA 5E0HA 3Q76A 1V2QT 2A4RA 1W0ZU 2BDHA 3FP7E 5GDSH 2VIQA 3NXPA 3SI3H 1ELAA 3QDZB 6CHAC 1OPHB 8LPRA 3EGKH 1GBDA 2H5DA 4X8TH 3M5LA 3U8RH 2ZFPH 5EPNA 1ETSH 1GI0A 2ZI2H 1L1GA 3K2UA 3ZZ3A 2A32A 3SUFA 2HOBA 4YO9A 1INCA 1DWBH 1UCYK 4AFQA 4X1SU 1H4WA 2BMGB 1GJ7B 3ZV8A 1KXBA 1V2PT 2EC9H 2VH0A 4ISOA 2ZHDA 1LO6A 1VJAU 3HATH 5F8XA 2IN2A 3QX5H 3UQOA 1N8OB 2Y5HA 3FVFB 2NU1E 3RXQA 1T8MA 1O2GH 5TCCA 2HWLB 2Z3CA 4I8HA 3U8OH 5L2ZH 4ASHA 1LQDB 3TIUA 4A92A 3A83A 4WWYA 3ESTA 4AORA 1PQ7A 1G36A 5J4SA 2ZFTA 3K6YA 1V2MT 1DY8A 5TCAA 1THPB 1UMAH 4LK4A 2XXLA 3SV7A 2ZTYA 1Y3UA 5ESBA 1NFUA 2VWLA 1FQ3A 1BTXA 1EJMA 3F68H 1GI9B 3RXCA 1P01A 1EX3A 2VH6A 4ZXXH 3RM0H 4OS6A 2Y5GA 1QQUA 5EXMA 1L4DA 2BLOA