2QCYA

Crystal structure of a monomeric form of severe acute respiratory syndrome (sars) 3c-like protease mutant
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for controlling the dimer-monomer switch and coupling dimerization to catalysis of the severe acute respiratory syndrome coronavirus 3C-like protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 83
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2qcyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qcyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qcyA02
1P0SH 1OWIA 3M3VA 1PYTC 3B9FH 1NZQH 1B0EA 1ETTH 4MQAA 1B0FA 1XKAC 8GCHF 2AMDA 4FUBA 2HNTF 1XUJA 2I6QA 1QB9A 4CH8B 5C1XA 3E0PB 2GGVB 4K2YA 3BTME 1SOTA 4CH2B 1PPEE 1A4WH 1TLDA 2B8OH 1NESE 2HVXA 1F5LA 3T2NA 2HOBA 1EJAA 1ZLRA 1ZPZA 1HAZB 5F6MA 1DDJA 2BY7X 2GVFA 2ZECA 1AWFH 3KF2A 3R0FA 2PGBB 4ABHA 1SSXA 3HKJB 1K1JA 6CHAC 2VIWA 4ZHAA 3SZNA 1AB9B 1FV9A 1P3CA 2PLXA 1E35B 5A2MH 1ZTLA 2ZU5A 3RU4E 1MUEB 1UCYE 3SU2A 2FOAA 1TX7A 1S5SA 3EA9A 3RXTA 4NA9H 4ESTE 2ZGXH 3RXMA 4CBNA 5E2PA 3BTTE 5C3NA 2D1JA 1C2KA 4CREA 2Q1JA 4JZIA 2NWNA 1GBMA 1C2FA 3KGPA 4KTSA 2PFEA 2AEIH 4YT6H 2TGDA 3T5FH 3SJ8A 1L4ZA 4Q80A 2VIVA 3F9HA 4K60A 1V2LT 1Z8IB 3SV9A 2BYAX 3U8RH 3UUZA 1ZGIA 1DX5M 3ZZ3A 2XBYA 1O3AA 1HJAC 1ANCA 1HAVA 2RA0A 3ZYDA 1TGCA 3VB3A 4OGYA 1J15A 2XBVA 4JZFH 1VJAU 3T25A 4Y10E 3MU0A 1AKSA 3ZYEA 3GYLB 1N6XA 4K3JA 2PSXA 1LPKB 2ZGJA 1AHTH 4IN2A 4ISIH 4Z0KA 1G9IE 4OS5A 2JETB 2Z9LA 1EJNA 3O8BA 1IQGA 3STIA 8ESTE 1X7AC 1XUGA 1ELEE 4AGJA 3RU4D 1H9LB 4DIHH 4PROA 3TVJB 3FP7E 1J16A 4I8LA 1DLEA 1XM1A 1TNGA 1ZJKA 1SL3A 2ZKSA 1C1RA 1OSSA 3DA9B 3QDZB 4DW2U 1HNEE 1HXFH 1EASA 1HAIH 1Y3XA 4K8YA 1MTVA 4ABIA 3KHVA 4GLYA 1MZDA 2WUCA 1IOEA 1PPCE 2A4OA 1YLDA 4VGCB 5CMXH 3SNBA 1ZRBA 1GBTA 5C67A 2GDEH 4TWYA 2P8OC 4AFQA 3RXVA 3KQEA 1S6HA 4TYDA 3BTHE 1HLTH 1GHBF 1QR3E 1ZPCA 4WMDA 1RTLA 1MKXH 4CR9A 1O2SA 3UIRA 4B2BA 2GTBA 4WH6A 5LH8A 1UHBB 2P59A 1IQMA 3M5MA 1TNIA 2H6MA 4YLUA 1EPTB 1DICA 3SNEA 1DS2E 2QIQA 2J4IA 1T8OA 4MNWA 3GISB 1DWDH 1Z8JB 2QF3A 3A8AA 4I31A 1BTZA 4LXBH 3F9EA 4CRAA 2TRMA 3B23B 3SJKA 1TOCB 4GCHF 1HV7A 1D4PB 1HCGA 4XBBA 1UO6A 3RC6A 2D2DA 1W7GH 1SQAA 1T32A 3CENA 5FX6A 1C2IA 3ZVGA 1O3OA 1S83A 2ZU2A 2FI4E 2SFAA 1FN8A 3PV4A 3QGJA 1ZOMA 2JKHA 1BJUA 1FY4A 4D7FA 1NU7B 1QURH 2FLBH 1EAUA 3O8DA 4CHAB 2B7DH 4IGDA 3RMMH 3S9BA 1S82A 4GPGA 2A7HA 4MG3A 1RTKA 3A81A 1T4VH 4SGBE 1AUJA 2ZG0H 1Y3YA 1P12E 3O8CA 1BRCE 1O30A 2XC0A 1ABIH 4INKA 2C8XB 1EXFA 1EZXC 4Y6DA 2XYAA 4YLQH 1O5GH 3A7TA 1IQFA 3BIVH 4U32A 3EDXB 7GCHG 5C5NA 3I77A 4D9RA 3A80A 3CS7A 5I46H 1GJ6A 3UWIA 1MQ6A 3MO9A 5HMAA 3OY5U 5ESBA 4X1PU 1A0JA 1JRSA 3EAJA 1SGTA 2H9TH 4BTIB 4FUJA 4ISOA 1P2KA 3SNAA 1C5NH 2Y7ZA 5DGJA 2OC1A 1O3BA 3HATH 1EKBB 4Y7AA 3SJOA 1TONA 1C5VA 2Z3CA 1BHXF 1YGCH 1GI4A 1O2MA 5ETXA 3UNRA 1V2JT 1K1OA 3LOXA 2GT8A 1UCYK 9LPRA 2FOHA 2ZCKP 1RXPA 1FY5A 1S0RA 4AN7A 1NM6A 3PLKA 3GY5A 2ZU1A 3URCA 2P3UB 5JBTA 1ID5H 3MH5A 2BDGA 3U8OH 3MNCA 3EQ0H 2Q6GA 3SGQE 4X8TH 1Z1IA 1GJ4H 2H2ZA 2H1UA 2G52A 5JDUB 2A31A 2HLCA 1SFIA 2A7CA 3V3MA 3I29A 2K7XA 2XW9A 1UTLM 1SGQE 1C1TA 5A0AE 3SO3A 4BAOB 3E16B 3PO1C 2TGPZ 2PR3A 3RXIA 4ABBA 1EP5A 3VB5A 2BY8X 1EAIA 3PMJA 2ZDAH 1LPZB 2FI3E 1GI7B 4Y79A 2V3OH 1SG8B 1CA0C 1DUAA 1FJSA 4AB9A 1CA0B 1E37B 1ELDE 1P04A 1GJBB 1XUKA 3MU1A 1DWBH 4MVNA 1W0ZU 2BVRH 1RIWC 4JZEH 1O5BB 1WU1A 3VB6A 3MWIU 3QTOH 1B5GH 1C9TA 1K1LA 3P70B 5EQRA 4GCHG 4I8HA 4A7IB 3RUOA 4ZXXH 2GKVE 3TPIZ 1A61H 2G4TA 2VIQA 1AMHA 4UDWH 3QZRA 4X1RU 1GBIA 2ZCLP 1O2HA 4KP0A 4MNYA 2FEQH 1LVOA 1W8BH 1Z71A 2J95A 3F9GA 1GG6C 1O5FH 6GCHF 5EXMA 1QA0A 1CO7E 5EG4A 3Q3KA 3ZZBA 5JPMH 3RU4T 1HIAA 4MPUA 4I8JA 3TITA 1ELTA 1EOJA 3UNQA 1SGPE 1SQOA 1CT0E 1AVXA 2XC4A 3SNDA 2J38A 1GBLA 1OXGA 1ZYOA 5L30H 4X6OA 3TJOA 2WV4A 1G32B 1KYNA 3PROA 3SI4H 1QB1A 1SGYE 4FU9A 1VCWA 1H8DH 4NWKA 2SGQE 2F9BH 2PSYA 2ANYA 1ZTJA 1WUNH 4AYVB 3U8TH 2O9QA 1JWTA 1YBWA 1DANH 3ZVCA 3P17H 1DFPA 3W95A 1RIWB 5T6DA 3ZZAA 3FZZA 2R9PA 1AIXH 3ELAH 1J14A 1HDTH 2ZC9H 1YPHC 1ZMNA 4HGCA 1QBVH 1TGBA 1IQIA 2PW8H 5FX5A 3TK6A 1AO5A 2AGIX 1G2LA 2BMGB 4IMZA 4IMQA 3PMBB 1JOUB 1K22H 2ALVA 1MTWA 2GD4B 1OKXA 2ZHWH 1HAXB 2BZAA 1THRH 5FCRA 2J34A 3K6YA 1BRAA 3U1JB 1OPHB 1F7ZA 4LK4A 1M9UA 2QY0B 3HK3B 3M5NA 3ESTA 4I8KA 1J9CH 2CGAA 1SGCA 4RKJB 4UONA 1HJAB 3OSYA 3DFLA 1FY1A 1GMHF 2QGRA 1GMDF 2ODPA 2VWMA 5HXFA 1V2OT 1O2LA 3ZZ7A 4WMEA 3AAVA 4AFUA 4O97A 3CP7A 3HK6B 2FYRA 1GHYH 2HWLB 2ZU3A 1F0UA 4BANB 1O3EA 3SUDA 2ZHEH 3PYHA 1XUFA 1KDQB 3P95A 1FDPA 1QNJA 1BMLA 2Z94A 1PQ5A 5C1YA 3D49H 1AWHB 1CSOE 1OWKA 5JYIA 3TIUA 1EAWA 1TRYA 1PPHE 3M36A 1WBGB 1C5TA 4GAWA 1GJ5H 1ESTA 1O2PA 1AQ7A 3P8FA 3K2UA 4WWYA 1W12U 4ISHH 3UOPA 3MHWU 4A92A 4IS5A 4JK6A 3S9CA 2G4UA 5EXNA 3UPEA 3QUMP 2BVXH 4H6TA 3IITA 3VPKA 2XWAA 1O2XA 2Y80A 3LGVA 3RC5A 1YP9A 2TBSA 3LJJA 1EATA 3NKKA 4IC5A 1TQ0B 3SQHE 5F03A 1UHBA 2V35A 4RN6A 2SGFE 3A7WA 1CU1A 1ELFA 3S0NA 2ZPSA 2VH6A 2OC7A 2XCFA 5DO4H 4F4OC 2A4QA 4CHAC 3RDZA 4X1SU 1TPAE 3ODDA 4NA7A 1TNJA 5AVDA 1QL9A 1DT2A 1FIWA 3F1SB 3EBNA 2VJ1A 1GI8B 2Y5GA 2XXLA 1O32A 2FIRH 2HPQH 3BTDE 5L2YH 2WPHS 1C2LA 4I32A 4B2CA 1IQEA 4NGAH 1ARBA 2G8TA 4FU7A 8GCHG 5JBAS 4GVUA 1HAPH 2OC0A 2ZDVH 3QN7A 1O37A 2STAE 2Z9JA 2OUAA 4UE7H 3H7TA 4D9QA 2HNTE 2Y82A 2W26A 1QTFA 3IG6B 1F5RA 1HGTH 1TA6A 3SUEA 2YNAA 1L1GA 5FAHA 1ELBA 3BV9B 1T31A 1TBQH 1QRXA 1NPMA 2TGAA 3ZZDA 1GHXH 3MOCA 1O2OA 4KTCA 2P93A 5F8XA 4F49A 4MNXA 1Y3VA 1YF4A 1HAVB 1VITG 1GDQA 1O31A 1DXPA 1UTNA 1G3CA 1YM0A 2C90B 4Q7ZA 1DXWA 5C2ZA 5E0JA 5L2ZH 2BDAA 1NY22 3ZV8A 1K1MA 4R0IA 2ZQ1A 5BRRE 1GHAG 2BD7A 5FBEA 3RXDA 1GJ7B 3SJ9A 1O5AB 2ZPRA 1A0LA 2ZGCA 1HAYB 1P2JA 3SU3A 1RFNA 1C1SA 2BZ6H 3VGCB 2OD3B 4U01A 3ODFA 1BQYA 1OYTH 1IQHA 1Y5UT 1LHEH 3RM0H 1V6DA 1MKXK 2FOCA 3U1IB 4OS1A 3U69H 1O3GA 4X8SH 1O3JA 3PO1B 3U98H 4DY7B 1XUHA 1C2JA 4B1TA 1O39A 1GCTC 1A5HA 1O34A 6GCHG 2O8LA 4Y71A 1T4UH 1HAHH 1V2TT 5EXLA 3ZVFA 1C5YB 2XCNA 1FONA 4FVDA 3AASA 3SOSA 3TNTA 1DPOA 1MU8B 3RXRA 1PQ7A 3GDUA 3MH7A 3N7OA 3UOUA 2PHBA 1JXPA 1LKBA 3LGWA 4O3TA 3SV8A 4ISLA 4FUFA 5EW1H 4MPXA 4B71A 1BTWA 3GCOA 2O8UA 1ORFA 1YPJH 1DSTA 3KNXA 1Q3XA 1GVLA 5K0HA 4AG2A 2OBOA 2LIZA 1ZJDA 2QA9E 1GBEA 3RXHA 3NWUA 4TPIZ 4A1XA 4AB8A 2Y5HA 1BBRE 2Z9GA 5HGGA 5E8EH 2ZFQH 3Q3XA 4UFGH 1W11U 3ATLA 1C5RA 2EC9H 5F8ZA 2BXTH 1CHOG 1ELVA 3LC3A 2H5DA 3E90B 3QWCH 8KME2 3E6PH 2ZQ2A 5GCHG 1GBJA 2AH4X 1F2SE 3RXBA 7LPRA 4HZHA 4E05H 2ZTXA 2J94A 1Z6EA 1LPGB 1EZSC 5A09A 2RDLA 4H6SB 1UTPA 1EPTA 1BT7A 1XUIA 2OBQA 3RXJA 2OTVA 3EGKH 2FI5E 1GPZA 1QY6A 1ANBA 2QV1A 4K1TA 1D3TB 1CT4E 3DUXH 1CHOF 1D6WA 1HPGA 1D6RA 2GCHG 4XFQA 1TMTH 2I6SA 1E0FD 1GBHA 1SGNE 4LZ4B 1OWDA 3ENSB 1GHWH 9ESTA 1AN1E 1DOJA 1TNKA 2UWPA 4XBDA 3U9AH 1SLUB 4AFZA 5AF9H 3SUGA 5DP4A 1O2RA 2FOFA 1GGDB 1V2WT 2F9NA 5E0GA 2H9EH 1Y59T 4BAQB 3RXKA 2Z9KA 2VIOA 3KL6A 3HGNA 4DGJA 5DPAA 2Q6FA 2BY9X 2AIPA 4E06H 2FLRH 1D3DB 3A86A 1BRUP 1B7XB 3SJIA 2BD9A 2ZU4A 3NXPA 1O3PB 2SGPE 2QCYA 3FANA 2NU1E 4ABDA 2BM2A 2RG3A 5IDKA 1LQEA 1TB6H 2G00A 1TNHA 2QXIA 2BY6X 1EJMA 1HB0B 3K65B 1KXCA 2ODYB 4NFEA 2G55A 4X1QU 2FESH 2ZZUH 2BLOA 2XWBI 1SGFG 1DM4B 1O2YA 3MI4A 1BCUH 5FHTA 3ZZ9A 2C3SA 1LCYA 1NFXA 1P2IA 4MNVA 4X6PA 3BN9A 2WPJS 1W14U 3VXEH 2YNBA 1QBNA 1T8LA 2NU3E 3LC5A 1C5WB 4IW4E 2A2QH 2WPMS 1V2ST 2VGCB 1P2QA 3ITIA 3B8JA 2FWWA 1GBAA 3ZVBA 3M37A 3SN8A 1VGCB 3GY6A 4Y8ZA 5H4IB 3A85A 3BEFB 4BOHA 1TQ7B 3A87A 1O2ZA 1SFQB 1HJ8A 3T28A 1KSNA 5LPRA 4MLFB 2PKAB 1GMCG 3OU0A 3RC4A 3WY8A 3EE0B 3HKIB 2OLGA 1BMNH 1QB6A 1O2UA 2BOHB 2CJIA 1P05A 1CHGA 3GCNA 3R3GB 3AAUA 1P2MA 3FAOA 1EZUC 5GXPA 2CXVA 3MU4A 3RXQA 4DURA 4YESB 4Y8YA 2JH5D 1MKWH 1H9HE 2PGQB 4YO9A 1CVWH 4ZKRU 2IJOB 2SGDE 1ZPBA 1BITA 4MDSA 1VZQH 1GHBG 1AB9C 1W2KH 1FPHH 2ASUB 3FVFB 5EOKA 1WSSH 1AZZA 2BLQA 1C5MD 1BBRH 2WYJA 2WV5A 2EA3A 4WJG2 5GJ4B 1C1PA 1ETSH 2BLVA 2ZHDA 2AS9A 2F9VA 1EX3A 3SUFA 1MAYA 2PKSB 2FODA 3RLYH 1LHDH 4BNRA 1PYTD 4Y76A 3VB7A 4B74A 5EODA 1VJ9U 1CA8B 1QRZA 1W10U 1AE8H 1K21H 2WPIS 1C5ZB 4HTCH 2FXRA 2G5NA 1NRQH 4ZROA 1FMGA 2P94A 1K9OE 1WYKA 2PKAA 4O3UA 1GBFA 3ZZ4A 1LVBA 4WY3A 3PWCA 1UK4A 3SBKA 1LMWB 1G3EA 1G30B 1TFXA 1V2UT 4DOQA 4RKOB 1MZAA 3MYWA 5GWZA 4CR5A 5EPYA 1OP2A 4X1NU 2H5CA 3SI3H 3BTEE 5TCAA 1OWJA 1C4U2 1C5XB 1XMNB 1QCPA 1XX9A 1DY8A 6ESTA 2QN5T 4XSKU 1MD8A 2AYWA 1FPCH 1P09A 5LGOA 4Z6AH 1NFWA 1FY8E 1FY3A 2UUFB 1MAXA 3KCGH 4FVBA 2CN0H 4GHTA 1Y3WA 5HM9A 4U30A 2A2XH 3QZQA 1NTPA 1KLJH 2F83A 3VB4A 2A0QB 1GMDG 3E0NB 3TH4H 4YM9A 3NCLA 5HYOA 1GJDB 1GMHG 5LPFA 4ABAA 2GCTB 3ZVAA 4AFSA 2BD4A 3RMOH 2VINA 1TYNA 1TRNA 4X0WU 4ZKOU 4WMFA 3SV6A 1TA2A 1BDAA 2FYQA 2FTLE 3RXAA 1BHXB 1GHVH 3Q77A 1ZHMA 2TPIZ 3EYDA 3SQEE 1BTYA 3RXLA 4AG1A 4RSPA 1GHZA 5EQSA 3K9XB 3TK9A 1CT2E 3SORA 1N8OB 2GZ8A 3QO6A 3LPRA 2HRVA 4OGXA 1SLVB 2P95A 4TY6A 1O3CA 3DHKH 3PLPA 4KKDA 1KXFA 4HFPB 1NN6A 1TPSA 3JZ2B 1SOZA 1F0SA 1V2VT 1HIAB 4NSVA 2A4RA 2RCEA 4NIYA 1EP6A 3TJNA 3H7OA 3ATWA 1AI8H 5GPIB 3SGBE 4CBOA 2DUCA 2GT7A 1MU6B 1GG6B 2BLWA 2HNTC 1FZZA 3SU1A 5A8ZA 1GWAA 4YZUA 1O2NA 3V7TA 3LGTA 3T62A 5SGAE 1TGNA 3AVZA 1LQDB 1CGHA 3PLBA 1ESBA 3A7YA 4AYYB 1A5IA 1ZRKA 3A7XA 3HGPA 3MO3A 5AFZH 4OS2A 2BQ6B 1P02A 2QC2A 4JZ1A 3A8CA 3LU9B 1INCA 3ZV9A 2PV9B 1K1IA 1O3KA 1OYQA 3VFEA 1LHCH 5FBIA 5EPNA 1RTFB 1GDUA 4BTTB 2VIDA 1W0YH 1IQKA 1FIZA 1GCTB 1DUEA 2WUBA 1O36A 2ZFSA 3SU6A 2OQ5A 3V13A 4NSYA 3TJUA 2BD2A 2A32A 2VB0A 1BTUA 3V12A 4UFEH 2B5TB 1KY9A 1LO6A 1LVYA 2ZI2H 5DP7A 1Y3UA 4JZDH 1GMCF 2ZFTA 1L2EA 2ZTYA 2SNWA 3GY7A 3GY8A 2O8WA 4UEHH 1E36B 1PPGE 2XNIA 1OS8A 3F68H 3A8DA 2BHGA 5C5OA 2NU0E 3D23A 4IBLH 4A6LA 3GCTF 3M7UA 4TPYA 2W7UA 1FLEE 1NC6A 2FX4A 4AZ2B 1GVZA 1C2EA 3MNXA 1L1JA 1PPFE 3E1XB 3P92A 8LPRA 4H4FA 4AX9H 4ZKNU 5J4QA 3M61U 4K1EA 2ZPQA 1TMUH 2BB4A 4Q7YA 2AGEX 1P9SA 1DWCH 1Z8RA 3G01A 3GY2A 1K2I1 1A2CH 3A7ZA 2P8OB 1KXDA 1Q2WA 1WV7H 5DG6A 1LKAA 4DCDA 1ANEA 1SMFE 1BMMH 3SU4A 1QGFA 3KQBA 1ELAA 1ZGVA 2BD8A 2ILNA 4JCNA 1OOKB 4ZHLU 2K1QA 1OP0A 1FXYA 1C2GA 2R0KA 1OX1A 2SGAA 3ATMA 2Y7XA 1V2RT 3BF6H 4YT7H 4YOGA 1SC8U 1TPOA 1F0TA 1HBTH 1XKBC 3T26A 3BG4C 4WF8A 2H9HA 4BAKB 3NZIA 4CRFA 3MFJA 1UTMA 3A7VA 2W3IA 2TGTA 1A3EH 2QXHA 5CHAC 3F6UH 4E7RG 1GI3A 4ZKSU 1OWEA 3RLWH 2W3KA 1O2JA 4I8GA 3MO6A 1UK3A 2GZ7A 4NG9H 5FXLA 1C5SA 1UMAH 3BTWE 1KDQA 3ZVDA 2STBE 2GV6A 3QGNB 3VGCC 4XDEA 1SR5C 2FTMA 2GCHF 4KELA 1MTSA 2V6NA 2BD5A 2ULLA 4DT7B 5F8TA 1TBRH 3PMAB 1A46H 4YTAA 1EOLA 1IHTH 1BB0B 1O3MA 4LZ1H 3D65E 1NRSH 1H9IE 2ZFPH 2G51A 3GDSA 3ZZCA 3ATKA 4B73A 3ZZ5A 2SNVA 1YC0A 3MMGA 1G2MA 5A0CA 1NS3A 4DIIH 4FUIA 1LHFH 1YYY1 1UCYH 3DFJA 1C1QA 4X2WA 1C1UH 1DITH 3BTGE 2V0BA 4NA8A 2HPPH 4BTUB 2AFQB 3S69A 1TIOA 3E3TA 4K5ZA 5E2OA 5DJ7A 1WAYB 2O8MA 1G37A 2FPZA 3M35A 5EU8A 2Q6DA 2Y81A 1SLWB 2VWOA 1TWXB 1GGDC 3MNBA 3DD2H 3LJOA 4H42U 4O03A 2C8WB 2PKSC 4XBCA 1BIOA 1MTUA 1O3HA 4X6MA 1G36A 1SHHB 3E91A 2G5VA 5CE1A 2D26C 3RP2A 4ISNA 2A5AA 4XOJA 3SV2H 4INLA 2PTCE 1TBZH 1EAXA 3MTYA 5GDSH 5C20A 1W7XH 2PTNA 1O2QA 3ZZ8A 1EUFA 1O2KA 2GMTB 1QHRB 1MD7A 1MCTA 1ELGA 1VITH 3RXOA 1UTOA 1KXEA 1QRWA 5EQQA 2ZCHP 1IQJA 5DP6A 1UVPA 1NT1A 1O35A 1CGIE 1A1RA 2ZHFH 1TOMH 1AU8A 3M7TA 4BXSA 4ASHA 3PWBA 1TE0A 1S81A 2XRCA 1GI9B 1WTGH 3UTUH 2V3HH 5AFYH 2BDIA 2BDBA 3K6ZA 1H8IH 1BJVA 3RXSA 1SBWA 1C5QA 1NRRH 2XC5A 2DE9A 3UR6A 4WXIA 1P8VC 2BX4A 2UWOA 3S7HB 3MH4A 4MPVA 1MBQA 1C4V2 1NRPH 2AMQA 1UJ1A 1GHAF 2WYGA 1T8MA 3RXGA 1GBCA 4DJZB 3LGYA 1P06A 2FS8A 1SQTA 2BD3A 3NK8A 2FDAA 3A89A 2NU4E 2Z7FE 1F92A 1AZ8A 5GCHF 3GY3A 4IN1A 4Y8XA 1NFUA 2HGTH 5TCCA 4M7GA 1MBMA 5C1UA 4NIXA 4WXVA 1KIGH 1ZSLA 3BTKE 3BG8A 2A7JA 4GHQA 4Q2KA 1GI5A 2W5EA 2C4FH 1HAGE 3RXEA 1S6FA 2AERH 1SGDE 3SV7A 5FCKA 3EA7A 1QQUA 2UUJB 3L33A 4R8TB 4ABGA 4X8VH 1PJPA 3MH6A 2ZDNA 1XXFA 4OS4A 1JRTA 3STJA 1C2DA 1ZHPA 1CGJE 1ZTKA 3TJVA 1O2IA 3KN2A 4J2YB 1UTQA 2OCVB 1U6QA 1UVSH 1FAKH 1A0HB 1DWEH 2KAIA 1GI1A 5E0HA 4Y11E 1DE7H 1DSUA 1UTJA 4ZXYH 1GJ9B 3GCTG 1P10A 2BX3A 1O3LA 1BTPA 1TX8A 3RXFA 4BXWA 3P6ZB 1O5CB 2BXUH 1P03A 2UWLA 5TJXA 4X2XA 4AORA 4THNH 3FP6E 3TK5A 1LTOA 5BPEA 1IQNA 3LGUA 3KEEA 3RXCA 3PM3A 5L6NH 4BAHB 1W13U 3UWJH 2Y6TA 2OQUA 2ZF0H 2ZDMA 4NZQA 2A4GA 1PFXC 3SW2B 5JBCS 2ZO3H 4LOYH 1GI6A 1YLCA 2P3TB 2WPLS 3VEQB 4Q7XA 1PQ8A 1H4WA 3RM2H 2ANKH 1ANDA 2ZNKH 3GICB 1IAUA 2QAAA 2VNTA 1SGRE 4JYUH 1P01A 3I78A 4X8UH 1MH0A 3OTJE 1JIMA 2ZFRH 4DG4A 1HFDA 2ESTE 1EB2A 1MQ5A 2ZTZA 4X6NA 4ABFA 1G3DA 1DVAH 4XE4A 2CHAB 1YKTA 2EI8A 2VWNA 1NROH 1C4Y2 1V2NT 5DP9A 1THPB 2LPRA 5DK1A 4I7YH 4ABEA 1S84A 1WTHD 2W7SA 1PPZA 3QTVH 1GDNA 3TGJE 4BAMB 4AGKA 2FOGA 4UFFH 4B76A 4HI3A 4DVAU 5PTPA 1Q31A 2VVVA 3ATIA 1F5KU 4FUHA 2A5KA 3OX7U 1V3XA 3M5OA 1UVTH 2WPKS 2ZWLH 5ABWA 2BQWB 2GV7A 1SLXB 2P16A 2J2UA 1TPPA 1W3CA 1TALA 3UR9A 3LIWA 1FUJA 3TGIE 2FOBA 3BTFE 1QBOA 1TGSZ 1CBWB 4WVPE 3FZDA 1O3IA 5J4SA 3C27B 1VCPA 1KTSB 1ACBE 4CRBA 5T6FA 1JIRA 3T27A 1QFKH 2BDCA 2DE8A 2ZFFH 1LDTT 1GL0E 1SB1H 3RXPA 3PMHB 4CRCA 1YPEH 3A8BA 4MPWA 4VGCC 5K7RA 1TNLA 2XBXA 2SGEE 5DP3A 1PQAA 3QX5H 1SGFA 1ZSKA 5LPEA 1DY9A 3UY9A 1O2TA 1O5DH 1HXEH 3KQCA 3PTBA 3PTNA 4ZUHA 1XVMA 2BOKA 2Z9IA 1V2QT 5FPSA 3S7KB 1MTNC 2VVUA 2ODQA 1SGEE 2FOEA 1QA7A 3OYPA 3M5LA 2PUQH 2FS9A 1GCDA 5DP8A 1YCPH 6CHAB 3FFGA 2JH0D 4NWLA 1WQSA 2CV3A 4NZLA 4UD9H 3KIDU 1MCVA 3RMLH 1DLKB 1ZHRA 2J92A 5I25A 1C9PA 1L1NA 1IQLA 1MMJN 3Q3YA 1D3QB 1UVOA 1C1NA 2HALA 1VR1H 3CS0A 5G4BA 1KXBA 1SVPA 3SU5A 1A3BH 3T29A 4FUEA 2ZGBH 1KTTB 1OP8A 2CF9H 3BTQE 1Y8TA 4JYVH 5JB9S 1Z8GA 3E8LA 1P2NA 3SHCH 4D8NA 2PWXA 4NCYA 2UUYA 1ARCA 2IOTA 1XXDA 1A5GH 2A1DB 2BQ7B 2EEKA 1ZZZA 1GVKB 2QYIA 1O0DH 1YPLH 2ALPA 4ZHMU 3QLPH 1LVMA 1AE5A 1ETRH 2FO9A 1SI5H 1MTNB 6LPRA 1V2PT 1K1PA 1C5PA 2ZHQH 3LKWA 1C2HA 3GOVB 4J1YA 1G3BA 1O38A 3GY4A 3A82A 3TH3H 4ZH8A 1OWHA 3TNSA 1PPBH 2C93B 2WINI 5FPYA 1SPJA 1Z7KA 1FAXA 3NPSA 2A45B 5JB8S 1NFYA 1VCQA 1TMBH 1Z1JA 3DT0H 1O3FA 2ZGHA 2GDDA 2KAIB 2QF0A 1E34B 2J9NA 1QIXB 2LNCA 1C5UA 4A1VA 2C8YB 1P3EA 1EPTC 1GBKA 4KTUA 3GCHC 1VGCC 3AW0A 1C1MA 1TAWA 3A88A 1P11E 1WOFA 2F9PA 4YOJA 1H1BA 2TIOA 2GCTC 4JYTA 1C1WH 2RA3A 5DKMA 1EB1H 1IHSH 4JK5A 1HUTH 3A83A 1UVUH 3M3SA 2Y5FA 3URDA 4ABJA 2G81E 4E7NA 7GCHF 1EZQA 1SGIB 2D8WA 2FP7B 1O5EH 1AFEH 4K69A 1N6YA 1TABE 3O8RA 1O3DA 1C1VH 2JH6D 1GBDA 3ZZ6A 3BSQA 3SNCA 3A84A 3MU5A 2R2WU 1E38B 1RD3B 1AY6H 1YPHE 2BTCE 2VIPA 1QL7A 2VWLA 1AVWA 4YOIA 3GYMA 2Z3EA 2QXJA 4CRDA 2XBWA 2C8ZB 3BIUH 2AMPA 1AUTC 5JBBS 3LH3A 2ZIQH 3QK1A 1S0QA 1FQ3A 1P9UA 5B6OA 1C5LH 1HRTH 2PUXB 3L6PA 3MNSA 4TY7A 3AW1A 4UFDH 1P2OA 1TGTA 3NUMA 2ZDKA 2BY5X 2NU2E 4D7GA 1C2MA 2ZEBA 1YCPM 1BTXA 1ZSJA 3TGKE 3TLOA 3PB1E 1HAOH 1GJAB 2ZA5A 2VGCC 2XTTB 4NIWA 1QL8A 5FPTA 1ZMLA 3F9FA 4NFFA 1CBWC 2R0LA 2FOMB 5GIBA 3OY6U 5EGMA 2BDHA 1GI2A 2Z6BD 4WH8A 1AGJA 1BZXE 1WCZA 1GJCB 5CHAB 2UUKB 1UK2A 1LHGH 3SGAE 1L0ZA 3BG4B 1D9IA 1F0RA 2EI6A 1N8OC 4A5TS 1EQ9A 1AVGH 1Z6JH 3M7QA 4A1TA 4CRGA 1NO9H 3UFAA 3LDXH 2GZ9A 2AGGX 5A8XA 1CQQA 2YOLA 2P3FH 1AD8H 1FI8A 3BEUA 3LH1A 2OC8A 1RGQA 2A5IA 4Y0ZE 1RS0A 3S9AA 3Q76A 1RRKA 3C1KA 1BMAA 2B9LA 2R3UA 3UNSA 1XVOA 5IYTA 1KLTA 1JMOH 1O3NA 4FUDA 1C5OH 1VITF 1GJ8B 1TX6A 2ZDLA 1D3PB 2F9OA 1RJXB 2GP9B 1TRMA 4B2AA 2CHAC 1KLIH 1YCPK 1FNIA 3IWMA 1QJ6B 1QJ1B 2GX4A 2JETC 5EW2H 2F3CE 1HJ9A 3VXFH 4ZAEA 2OXSA 5HM2A 1UTKA 3D62A 1K28D 1ZR0A 1JBUH 2F9UA 3UQVA 2B0FA 2OINA 3BEIB 1BBRK 4IC6A 1T7CA 5A0BA 1A7SA 1BA8B 3GCHB 2AIQA 3H5CB 4INHA 4JMYA 1ESAA 1K1NA 2ZP0H 2CF8H 2ANWA 2THFB 1YPMH 4SGAE 4MTBA 2QXGA 1V2MT 2O8TA 3V0XA 1HYLA 3L3TA 2CMYA 2F91A 2VH0A 1KXAA 4U2WA 1V2KT 4Y7BA 3P8NA 3RMNH 1YPGH 1J17T 2FZZA 4FUGA 3GDVA 5T3HA 4D76A 5A8YA 4FUCA 4GSOA 2FM2A 3HPTB 1O2WA 3UREA 1GBBA 4TWWA 1ABJH 3M3TA 1GI0A 3TH2H 2FX6A 3KQDA 1O33A 1GL1A 1P57B 1Y5BT 1C1OA 2VU8E 7KMEH 1FN6A 1WQVH 3LT3A 1BUIA 3MU8A 3EA8A 1N1LA 4KGAA 1SHYA 1NRNH 1S85A 1BOQA 2FMJA 4OS6A 4X2YA 5DP5A 2GMTC 2Z3DA 2BVSH 4NIVA 1J8AA 4K1SA 4FU8A 3FP8E 1AFQB 1NU9A 4AOQA 2IN2A 4GUXA 1AFQC 3P8GA 5ESTE 4FXGH 4B75A 2R2MB 1QQ4A 2BDYA 3SHAH 2ANMH 1QJ7B 3Q00A 3LGIA 4X2VA 4I33A 4Y0YE 1THSH 4ZMAH 2VVCA 5T6GA 1O2VA 1T8NA 2OP9A 1ZMJA 3SU0A 3UQOA 3LONA 3ZVEA 1ELCA 1MKWK 1YPKH 3P8OA 7ESTE 4QT8C 2M5TA 1O2GH 1CE5A 1BTHH 3RXUA 4OS7A 3W94A 2IPHA 2R3YA 2EI7A 3TU7H 5AHGH 4O9VA 4K8BA 3JZ1B 1BRBE 1L4DA 1AKSB 1Y5AT
chains in the Genus database with same CATH superfamily
1P0SH 1OWIA 3M3VA 1PYTC 3B9FH 1NZQH 1B0EA 1ETTH 4MQAA 1B0FA 1XKAC 8GCHF 2AMDA 4FUBA 2HNTF 1XUJA 2I6QA 1QB9A 4CH8B 5C1XA 3E0PB 2GGVB 4K2YA 3BTME 1SOTA 4CH2B 1PPEE 1A4WH 1TLDA 2B8OH 1NESE 2HVXA 1F5LA 3T2NA 2HOBA 1EJAA 1ZLRA 1ZPZA 1HAZB 5F6MA 1DDJA 2BY7X 2GVFA 2ZECA 1AWFH 3KF2A 3R0FA 2PGBB 4ABHA 1SSXA 3HKJB 1K1JA 6CHAC 2VIWA 1KMHB 4ZHAA 3SZNA 1AB9B 1FV9A 1P3CA 2PLXA 1E35B 5A2MH 1ZTLA 2ZU5A 3RU4E 1MUEB 1UCYE 3SU2A 2FOAA 1TX7A 1S5SA 3EA9A 2JJ1D 3RXTA 4NA9H 4ESTE 2ZGXH 3RXMA 4CBNA 5E2PA 3BTTE 5C3NA 4RT0A 2D1JA 1C2KA 4CREA 2Q1JA 4JZIA 2NWNA 1GBMA 1C2FA 3KGPA 4KTSA 2PFEA 2AEIH 4YT6H 2TGDA 3T5FH 3SJ8A 1L4ZA 4Q80A 2VIVA 3F9HA 4K60A 3FO8D 5KGOA 1V2LT 1Z8IB 3SV9A 2BYAX 3U8RH 3UUZA 1ZGIA 1DX5M 3ZZ3A 2XBYA 1O3AA 1HJAC 1ANCA 1HAVA 2RA0A 3ZYDA 1TGCA 3VB3A 4OGYA 1J15A 2XBVA 2M2AA 4JZFH 1VJAU 3T25A 4Y10E 3MU0A 1AKSA 3ZYEA 3GYLB 1N6XA 4K3JA 2PSXA 1LPKB 4B6EA 2ZGJA 1AHTH 4IN2A 4ISIH 4Z0KA 1G9IE 4OS5A 2JETB 2Z9LA 1EJNA 3O8BA 1IQGA 3STIA 8ESTE 1X7AC 1XUGA 2WPDD 1ELEE 4AGJA 3RU4D 2KZ4A 1H9LB 4DIHH 4PROA 3TVJB 3FP7E 1J16A 4I8LA 1DLEA 1XM1A 1TNGA 1ZJKA 1SL3A 2ZKSA 1C1RA 3VG8A 1OSSA 3DA9B 3QDZB 4DW2U 1HNEE 1HXFH 1EASA 1HAIH 4OM9A 1Y3XA 4K8YA 1MTVA 1H8ED 4ABIA 3KHVA 4GLYA 1MZDA 2WUCA 1IOEA 1PPCE 2A4OA 1YLDA 4VGCB 5CMXH 3SNBA 1ZRBA 3DCLA 1GBTA 5C67A 2GDEH 4TWYA 2P8OC 4AFQA 3RXVA 3KQEA 1S6HA 4TYDA 3W1EA 3BTHE 1HLTH 1GHBF 1QR3E 3AK5A 3OE7D 1ZPCA 4WMDA 1RTLA 1MKXH 4CR9A 1O2SA 3UIRA 4B2BA 2GTBA 4WH6A 5LH8A 1UHBB 4ZCNA 2P59A 1IQMA 3M5MA 1TNIA 2H6MA 4YLUA 1EPTB 1DICA 3SNEA 1DS2E 2QIQA 2J4IA 1T8OA 4MNWA 3GISB 1DWDH 1Z8JB 2QF3A 3A8AA 4I31A 1BTZA 4LXBH 3F9EA 4CRAA 2TRMA 3B23B 2V3MA 3SJKA 1TOCB 4GCHF 1HV7A 1D4PB 1HCGA 4XBBA 1UO6A 3RC6A 2D2DA 1W7GH 1SQAA 1T32A 1EFRD 3CENA 5FX6A 4RT1A 1C2IA 3ZVGA 1O3OA 1S83A 2ZU2A 2FI4E 2SFAA 1FN8A 3PV4A 3QGJA 1ZOMA 2JKHA 1BJUA 1FY4A 4D7FA 1NU7B 1QURH 2FLBH 1EAUA 3F2FA 3O8DA 4CHAB 2B7DH 4IGDA 3RMMH 2KCPA 3SZEA 3S9BA 1S82A 4GPGA 2A7HA 4MG3A 1RTKA 3A81A 1T4VH 4SGBE 1AUJA 2ZG0H 1Y3YA 1P12E 3O8CA 3FKSD 1BRCE 1O30A 2XC0A 1ABIH 4INKA 1K0HA 2C8XB 3PV5A 1EXFA 1EZXC 4Y6DA 2XYAA 4YLQH 1O5GH 3A7TA 4P00A 1IQFA 3BIVH 4U32A 3EDXB 7GCHG 5C5NA 3I77A 4D9RA 2W6ID 3A80A 3CS7A 5I46H 1GJ6A 3UWIA 1MQ6A 3MO9A 4DT4A 5HMAA 3OY5U 5ESBA 4X1PU 1A0JA 1JRSA 3EAJA 1SGTA 2H9TH 4BTIB 4FUJA 4ISOA 1P2KA 3SNAA 1C5NH 2Y7ZA 5HKKD 5DGJA 2OC1A 1O3BA 3HATH 1EKBB 4Y7AA 3SJOA 1TONA 1C5VA 4ACBA 2Z3CA 1BHXF 1YGCH 1GI4A 1O2MA 5ETXA 3UNRA 1V2JT 1K1OA 3LOXA 2GT8A 3DSOA 1UCYK 9LPRA 2FOHA 2ZCKP 1RXPA 1FY5A 1S0RA 4AN7A 1NM6A 3PLKA 3GY5A 2ZU1A 3URCA 2P3UB 5JBTA 1ID5H 3MH5A 2BDGA 3U8OH 3MNCA 3EQ0H 2Q6GA 3SGQE 4X8TH 1Z1IA 1GJ4H 2H2ZA 2H1UA 2G52A 2WHXA 5JDUB 2A31A 2HLCA 1SFIA 2A7CA 3V3MA 3I29A 2K7XA 2XW9A 1UTLM 1SGQE 1C1TA 5A0AE 3SO3A 4BAOB 3E16B 3PO1C 2TGPZ 2PR3A 3RXIA 4ABBA 1EP5A 3VB5A 2BY8X 1EAIA 3PMJA 3WW7A 2ZDAH 1LPZB 2FI3E 1GI7B 4Y79A 2V3OH 1SG8B 1CA0C 1DUAA 1FJSA 4AB9A 2V7QD 1CA0B 1E37B 1ELDE 1P04A 1GJBB 1XUKA 3MU1A 1DWBH 4MVNA 1W0ZU 2BVRH 1RIWC 4JZEH 1O5BB 1WU1A 3VB6A 3MWIU 3QTOH 1B5GH 1C9TA 1K1LA 3P70B 5EQRA 4GCHG 4I8HA 4A7IB 3RUOA 4ZXXH 2GKVE 3TPIZ 3U28C 1A61H 2G4TA 2VIQA 1AMHA 4UDWH 3QZRA 4X1RU 1GBIA 3N99A 2ZCLP 1O2HA 4KP0A 4MNYA 2FEQH 1LVOA 1OHHD 1W8BH 1Z71A 2J95A 3F9GA 1NBME 1GG6C 1O5FH 6GCHF 5EXMA 1QA0A 1CO7E 5EG4A 3Q3KA 3ZZBA 5JPMH 3RU4T 1HIAA 4MPUA 4I8JA 3TITA 1ELTA 2EY4C 1EOJA 3UNQA 2KCOA 1SGPE 1SQOA 3WWBA 1CT0E 1AVXA 2XC4A 3SNDA 2J97A 2J38A 1GBLA 1OXGA 1ZYOA 3FN8A 5L30H 4X6OA 3TJOA 2WV4A 1G32B 1KYNA 3PROA 3SI4H 1QB1A 1SGYE 4FU9A 1VCWA 1H8DH 4NWKA 3F2GA 2SGQE 2F9BH 2PSYA 2ANYA 2WZQA 1ZTJA 1WUNH 4AYVB 3U8TH 2O9QA 1JWTA 1YBWA 1DANH 3ZVCA 3P17H 1DFPA 3W95A 1RIWB 5T6DA 3ZZAA 3FZZA 2R9PA 1AIXH 3ELAH 1J14A 1HDTH 2ZC9H 1YPHC 1ZMNA 4HGCA 1QBVH 1TGBA 1IQIA 2PW8H 5FX5A 3TK6A 1AO5A 2AGIX 1G2LA 2BMGB 4IMZA 4IMQA 3PMBB 1JOUB 1K22H 2ALVA 1MTWA 2GD4B 1OKXA 2ZHWH 1HAXB 2BZAA 1THRH 5F53A 5FCRA 2J34A 3K6YA 1BRAA 3MQKC 3U1JB 1OPHB 1F7ZA 4LK4A 1M9UA 2QY0B 3HK3B 3M5NA 2YMSB 3ESTA 4I8KA 1J9CH 2CGAA 1SGCA 4RKJB 4UONA 1HJAB 3OSYA 3DFLA 1FY1A 1GMHF 2QGRA 1GMDF 2ODPA 2VWMA 5HXFA 1V2OT 1O2LA 3ZZ7A 4WMEA 3AAVA 4AFUA 4O97A 3CP7A 2AHME 3HK6B 2FYRA 1GHYH 2HWLB 2ZU3A 4TSFD 1F0UA 4BANB 1O3EA 3SUDA 2ZHEH 3PYHA 1XUFA 1KDQB 3P95A 1FDPA 1QNJA 1BMLA 2Z94A 1PQ5A 5C1YA 3D49H 1AWHB 1CSOE 1OWKA 5JYIA 3TIUA 1EAWA 1TRYA 1PPHE 3M36A 1WBGB 1C5TA 2J98A 4GAWA 1GJ5H 1ESTA 1O2PA 1AQ7A 3P8FA 3K2UA 4WWYA 1W12U 4ISHH 3UOPA 3MHWU 4A92A 4IS5A 4JK6A 3S9CA 2G4UA 5EXNA 3UPEA 3QUMP 2BVXH 4H6TA 3IITA 3VPKA 2XWAA 1O2XA 2Y80A 3LGVA 3RC5A 1YP9A 2TBSA 3LJJA 1EATA 3NKKA 4IC5A 1TQ0B 3SQHE 5F03A 1UHBA 2V35A 4RN6A 2SGFE 3A7WA 1CU1A 1ELFA 3S0NA 2ZPSA 2VH6A 2OC7A 2XCFA 5EJLA 5KECA 4F4OC 5DO4H 2A4QA 4CHAC 3RDZA 4X1SU 1TPAE 2YMSD 3ODDA 4NA7A 1TNJA 5AVDA 1QL9A 1DT2A 1FIWA 3F1SB 3EBNA 2VJ1A 1GI8B 2Y5GA 2XXLA 1O32A 2FIRH 2HPQH 3BTDE 5L2YH 2WPHS 1C2LA 4I32A 4B2CA 1IQEA 4NGAH 1ARBA 2G8TA 4FU7A 8GCHG 5JBAS 4GVUA 1HAPH 2OC0A 2ZDVH 3QN7A 1O37A 2STAE 2Z9JA 2OUAA 4UE7H 3H7TA 4D9QA 2HNTE 2Y82A 2W26A 1QTFA 3IG6B 1F5RA 1HGTH 1TA6A 3SUEA 2YNAA 1L1GA 5FAHA 1ELBA 3BV9B 1T31A 1TBQH 1QRXA 1NPMA 2TGAA 3ZZDA 1GHXH 3MOCA 1O2OA 1UW7A 4KTCA 2P93A 5F8XA 4F49A 4MNXA 3OFND 1Y3VA 1YF4A 1HAVB 1VITG 5C17A 1GDQA 1O31A 1DXPA 1UTNA 1G3CA 1YM0A 2C90B 4Q7ZA 1DXWA 5C2ZA 5E0JA 5L2ZH 2BDAA 1NY22 3ZV8A 1K1MA 4R0IA 2ZQ1A 5BRRE 1GHAG 2BD7A 3N7EA 5FBEA 3RXDA 1GJ7B 3SJ9A 1O5AB 2ZPRA 1A0LA 2ZGCA 1E1RD 1HAYB 1P2JA 3SU3A 1RFNA 2OK5A 1C1SA 2BZ6H 3VGCB 2OD3B 4U01A 3ODFA 1BQYA 1OYTH 1IQHA 1Y5UT 1LHEH 5EJZA 3RM0H 3F0PA 1V6DA 1MKXK 2FOCA 3U1IB 4OS1A 3U69H 1O3GA 4X8SH 1O3JA 3PO1B 1NBMD 3U98H 4DY7B 1XUHA 1C2JA 4B1TA 1O39A 4Z1MD 1GCTC 1A5HA 1O34A 6GCHG 2O8LA 4Y71A 1T4UH 1HAHH 1FX0B 1V2TT 5EXLA 3ZVFA 1C5YB 2XCNA 1FONA 3F2HA 4FVDA 3AASA 3SOSA 3TNTA 1DPOA 1MU8B 3RXRA 1PQ7A 3GDUA 3MH7A 3N7OA 4I86A 3UOUA 2PHBA 1JXPA 1LKBA 3OTPA 3LGWA 4O3TA 3SV8A 4ISLA 4FUFA 5EW1H 4MPXA 4B71A 1BTWA 3GCOA 2O8UA 1ORFA 1YPJH 1WXRA 1DSTA 3KNXA 1Q3XA 1GVLA 5K0HA 4AG2A 2OBOA 2LIZA 1ZJDA 1W0JD 2QA9E 2F4LA 1GBEA 3RXHA 3NWUA 4TPIZ 4A1XA 4AB8A 2Y5HA 1BBRE 2Z9GA 5HGGA 5E8EH 2ZFQH 3Q3XA 4UFGH 1W11U 3ATLA 1C5RA 2EC9H 5F8ZA 2BXTH 1CHOG 1ELVA 3LC3A 2H5DA 3E90B 3QWCH 8KME2 3E6PH 2ZQ2A 5GCHG 1GBJA 2AH4X 1F2SE 3RXBA 3ZIAD 7LPRA 4HZHA 4E05H 2ZTXA 2J94A 1Z6EA 4XD7D 1LPGB 1EZSC 5A09A 2RDLA 4H6SB 1UTPA 1EPTA 1BT7A 1XUIA 2OBQA 3RXJA 2OTVA 3EGKH 2FI5E 2XOKD 1GPZA 1QY6A 1ANBA 2QV1A 3PRDA 4K1TA 1D3TB 1CT4E 4M9FA 3DUXH 1CHOF 1D6WA 1HPGA 1D6RA 2GCHG 4XFQA 1TMTH 2I6SA 1E0FD 1GBHA 1SGNE 4LZ4B 1OWDA 3ENSB 1GHWH 9ESTA 1AN1E 1DOJA 1TNKA 2UWPA 4XBDA 3U9AH 1SLUB 4AFZA 5AF9H 3SUGA 5DP4A 1O2RA 2FOFA 1GGDB 1V2WT 2F9NA 5E0GA 2H9EH 1Y59T 4BAQB 3RXKA 2Z9KA 2VIOA 3KL6A 3HGNA 4DGJA 5DPAA 2Q6FA 2BY9X 2AIPA 4E06H 2FLRH 1D3DB 3A86A 1BRUP 1B7XB 3SJIA 2BD9A 2ZU4A 3NXPA 1O3PB 2QCYA 2SGPE 3FANA 2NU1E 4ABDA 4YXWD 2BM2A 2RG3A 5IDKA 1LQEA 1TB6H 2G00A 1TNHA 2QXIA 2BY6X 1EJMA 1HB0B 3K65B 1KXCA 2ODYB 4NFEA 2G55A 4X1QU 2FESH 2JDID 2ZZUH 2BLOA 2XWBI 1SGFG 1DM4B 1O2YA 3MI4A 2XNDD 1BCUH 5FHTA 3ZZ9A 2C3SA 1LCYA 1NFXA 1P2IA 4MNVA 4X6PA 3BN9A 2WPJS 1W14U 3VXEH 2YNBA 1QBNA 1T8LA 2NU3E 5DN6D 3LC5A 1C5WB 4IW4E 2A2QH 2WPMS 1V2ST 2VGCB 1P2QA 3ITIA 3B8JA 2FWWA 1GBAA 3ZVBA 3M37A 3SN8A 1VGCB 3GY6A 4Y8ZA 5H4IB 3A85A 3BEFB 4BOHA 1TQ7B 3A87A 1O2ZA 1SFQB 1HJ8A 3T28A 1KSNA 5LPRA 4MLFB 2PKAB 1GMCG 3OU0A 3RC4A 3WY8A 3EE0B 3HKIB 1VKYA 4P02A 2OLGA 1BMNH 1QB6A 1O2UA 2BOHB 2CJIA 1P05A 1CHGA 3GCNA 3R3GB 3AAUA 1P2MA 3FAOA 1EZUC 3OEHD 5GXPA 2CXVA 3MU4A 3RXQA 4DURA 4YESB 4Y8YA 2JH5D 1MKWH 1H9HE 2PGQB 4YO9A 1CVWH 4ZKRU 2IJOB 2SGDE 1ZPBA 1BITA 4MDSA 1VZQH 1GHBG 1AB9C 1W2KH 1FPHH 2ASUB 3FVFB 5EOKA 1WSSH 1AZZA 2BLQA 1C5MD 1BBRH 2WYJA 5T1VA 2WV5A 2EA3A 4WJG2 5GJ4B 1C1PA 1ETSH 2BLVA 2ZHDA 2AS9A 2F9VA 1EX3A 2J98B 3SUFA 1MAYA 2PKSB 2FODA 3RLYH 1LHDH 4BNRA 1PYTD 4Y76A 3VB7A 4B74A 5EODA 1VJ9U 1CA8B 1QRZA 1W10U 1AE8H 1K21H 2WPIS 1C5ZB 4HTCH 2FXRA 2G5NA 1NRQH 4ZROA 1FMGA 2P94A 1K9OE 2WSSD 1WYKA 2PKAA 2QF4A 3NRLA 4O3UA 1GBFA 3ZZ4A 1LVBA 4WY3A 3PWCA 3OEED 1UK4A 3SBKA 1LMWB 1G3EA 3N7DA 1G30B 1TFXA 1V2UT 4DOQA 4RKOB 1MZAA 3MYWA 5GWZA 4CR5A 1S6LA 1MABB 5EPYA 1OP2A 4X1NU 2H5CA 3SI3H 3BTEE 5TCAA 1OWJA 1C4U2 1C5XB 1XMNB 1QCPA 5EIYA 1XX9A 1DY8A 6ESTA 2QN5T 4XSKU 1MD8A 2AYWA 1FPCH 1P09A 5LGOA 4Z6AH 1NFWA 1FY8E 1FY3A 2UUFB 1MAXA 3KCGH 4FVBA 2KR7A 2CN0H 4GHTA 1Y3WA 5HM9A 4U30A 2A2XH 3QZQA 1NTPA 1KLJH 2F83A 3VB4A 2A0QB 1GMDG 3E0NB 3TH4H 4YM9A 3NCLA 5HYOA 1GJDB 1GMHG 5LPFA 4ABAA 2GCTB 2CK3D 3ZVAA 2QE7D 4AFSA 2BD4A 3RMOH 2VINA 1TYNA 1TRNA 2LP6A 4X0WU 4ZKOU 5IK2D 4WMFA 3SV6A 1TA2A 1BDAA 2FYQA 2FTLE 3RXAA 1BHXB 1GHVH 3Q77A 1ZHMA 2TPIZ 3EYDA 3SQEE 1BTYA 3RXLA 4AG1A 4RSPA 1GHZA 5EQSA 3K9XB 1YWUA 3TK9A 1CT2E 3SORA 1N8OB 2GZ8A 3QO6A 3LPRA 2HRVA 4OGXA 1SLVB 2P95A 4TY6A 1O3CA 3DHKH 3PLPA 4KKDA 1KXFA 4HFPB 1NN6A 1TPSA 3JZ2B 1SOZA 1F0SA 1V2VT 1HIAB 4NSVA 2A4RA 2RCEA 4NIYA 1EP6A 3TJNA 3H7OA 3ATWA 1AI8H 5GPIB 3SGBE 4CBOA 2DUCA 2GT7A 1MU6B 1GG6B 2BLWA 2HNTC 1FZZA 3SU1A 5A8ZA 1GWAA 4YZUA 1O2NA 3SYJA 3V7TA 3LGTA 3T62A 5SGAE 1TGNA 3AVZA 1LQDB 1CGHA 3PLBA 1ESBA 3A7YA 2F43B 4AYYB 1A5IA 1ZRKA 3A7XA 3HGPA 3MO3A 5AFZH 4OS2A 2BQ6B 1P02A 2QC2A 4JZ1A 3A8CA 3LU9B 1INCA 3ZV9A 2PV9B 1K1IA 1O3KA 1OYQA 3VFEA 1LHCH 5FBIA 5EPNA 1RTFB 1GDUA 4BTTB 2VIDA 1W0YH 1IQKA 1FIZA 1GCTB 1DUEA 2WUBA 1O36A 4TT3D 2ZFSA 3SU6A 2OQ5A 3V13A 3H09A 4NSYA 3TJUA 2BD2A 2J5UA 2A32A 2VB0A 1BTUA 3V12A 4UFEH 2B5TB 1KY9A 2GJGA 1LO6A 1LVYA 2ZI2H 5DP7A 1Y3UA 4JZDH 1GMCF 2ZFTA 1L2EA 2ZTYA 2SNWA 3GY7A 3GY8A 2KX4A 2RDEA 2O8WA 4UEHH 1E36B 1PPGE 2XNIA 1OS8A 3F68H 3A8DA 2BHGA 5C5OA 2NU0E 3D23A 4IBLH 4A6LA 3GCTF 3M7UA 4TPYA 2W7UA 2HVYB 1FLEE 1NC6A 2FX4A 4AZ2B 1GVZA 1C2EA 3MNXA 1L1JA 1PPFE 3E1XB 3P92A 8LPRA 4H4FA 4AX9H 4ZKNU 5J4QA 3M61U 4K1EA 2ZPQA 1TMUH 2BB4A 4Q7YA 2AGEX 1P9SA 1DWCH 1Z8RA 3G01A 3GY2A 5CHBA 1K2I1 1A2CH 3A7ZA 2P8OB 1KXDA 1Q2WA 1WV7H 5DG6A 1LKAA 4DCDA 1ANEA 1SMFE 1BMMH 3SU4A 1QGFA 3KQBA 1ELAA 1ZGVA 2BD8A 2ILNA 3FOAA 4JCNA 1OOKB 4ZHLU 2K1QA 1OP0A 1FXYA 1C2GA 2R0KA 1OX1A 2SGAA 3ATMA 2Y7XA 1V2RT 3BF6H 4YT7H 4YOGA 1SC8U 1TPOA 2WV9A 1F0TA 1HBTH 1XKBC 5GNDA 3T26A 3BG4C 4WF8A 2H9HA 4BAKB 3NZIA 4CRFA 3MFJA 1UTMA 3A7VA 5C0UA 3UB0A 2W3IA 2TGTA 1A3EH 2QXHA 5CHAC 3F6UH 4E7RG 1GI3A 1SQRA 4ZKSU 1OWEA 3RLWH 2W3KA 5C0TA 1O2JA 4I8GA 3MO6A 1UK3A 2GZ7A 4NG9H 5FXLA 1C5SA 1UMAH 3BTWE 1KDQA 3ZVDA 2STBE 2GV6A 3QGNB 3VGCC 2W6JD 4XDEA 1SR5C 2FTMA 2GCHF 4FETA 4KELA 1MTSA 2YMSC 2V6NA 2BD5A 2ULLA 2JIZD 4DT7B 5F8TA 1TBRH 3PMAB 1A46H 4YTAA 1EOLA 1IHTH 1BB0B 1O3MA 4LZ1H 3D65E 1NRSH 1H9IE 2ZFPH 2G51A 3GDSA 3EE7A 3ZZCA 4XRNA 3ATKA 4B73A 3ZZ5A 2SNVA 1YC0A 3MMGA 1G2MA 5A0CA 1NS3A 4DIIH 4FUIA 1LHFH 1YYY1 1UCYH 3DFJA 1C1QA 4X2WA 1C1UH 1DITH 3BTGE 2V0BA 4NA8A 2HPPH 4BTUB 2AFQB 3S69A 1TIOA 3E3TA 4K5ZA 5E2OA 5DJ7A 1WAYB 2O8MA 1G37A 2FPZA 3M35A 5EU8A 2Q6DA 2Y81A 1SLWB 2VWOA 1TWXB 4F48B 2EQNA 1GGDC 3MNBA 3DD2H 3LJOA 4H42U 4O03A 2C8WB 2PKSC 2KFWA 4XBCA 1BIOA 1MTUA 1O3HA 2KCAA 2KCYA 4X6MA 1G36A 1SHHB 3E91A 2G5VA 5CE1A 2D26C 3RP2A 4ISNA 2A5AA 4XOJA 3SV2H 4INLA 2PTCE 1TBZH 1EAXA 3MTYA 5GDSH 5C20A 1W7XH 2PTNA 1O2QA 4ACAA 3ZZ8A 5HIYA 1EUFA 1O2KA 2GMTB 1QHRB 5EJ1A 1MD7A 1MCTA 1ELGA 1VITH 3RXOA 1E1QD 1KXEA 1UTOA 1QRWA 5EQQA 2ZCHP 1IQJA 5DP6A 1UVPA 1NT1A 1O35A 1CGIE 1A1RA 2ZHFH 1TOMH 1AU8A 3M7TA 4BXSA 4ASHA 3PWBA 1TE0A 1S81A 2XRCA 1GI9B 1WTGH 3UTUH 2V3HH 5AFYH 2BDIA 2BDBA 3K6ZA 1H8IH 1BJVA 3RXSA 1SBWA 1C5QA 1NRRH 2XC5A 2DE9A 3UR6A 4WXIA 1P8VC 2BX4A 2UWOA 3S7HB 4B6FA 3MH4A 4MPVA 1MBQA 1C4V2 3WWFA 1NRPH 2AMQA 1UJ1A 1GHAF 2WYGA 1T8MA 3RXGA 1GBCA 4DJZB 3LGYA 1P06A 5KEDA 2FS8A 1SQTA 2BD3A 3NK8A 2FDAA 3A89A 2NU4E 2Z7FE 1F92A 1AZ8A 5GCHF 3GY3A 4IN1A 4Y8XA 1NFUA 2HGTH 5TCCA 4M7GA 1MBMA 5C1UA 4NIXA 4WXVA 1KIGH 1ZSLA 3BTKE 3BG8A 2A7JA 4GHQA 4Q2KA 1GI5A 2W5EA 2C4FH 1HAGE 3RXEA 1S6FA 2AERH 1SGDE 3SV7A 5FCKA 3EA7A 1QQUA 2UUJB 3L33A 4R8TB 4ABGA 4X8VH 1PJPA 3MH6A 2ZDNA 1XXFA 4OS4A 1JRTA 3STJA 1C2DA 1ZHPA 1CGJE 1ZTKA 3TJVA 1O2IA 3KN2A 4J2YB 1UTQA 2OCVB 1U6QA 1UVSH 1FAKH 1A0HB 1DWEH 2KAIA 1GI1A 5E0HA 4Y11E 1DE7H 1DSUA 1UTJA 4ZXYH 1GJ9B 3GCTG 1P10A 2BX3A 1O3LA 1BTPA 1TX8A 3RXFA 4BXWA 3P6ZB 1O5CB 2BXUH 1P03A 2UWLA 5TJXA 4X2XA 4HG6A 4AORA 4THNH 3FP6E 3TK5A 1LTOA 5BPEA 4ASUD 1IQNA 3LGUA 3KEEA 3RXCA 5DSFA 3PM3A 5L6NH 4BAHB 1W13U 3UWJH 2Y6TA 2OQUA 2ZF0H 2ZDMA 4NZQA 2A4GA 1PFXC 3SW2B 5JBCS 2ZO3H 4LOYH 1GI6A 4RI0A 1YLCA 2P3TB 2WPLS 3VEQB 4Q7XA 1BMFD 1PQ8A 1H4WA 3PRBA 3RM2H 2ANKH 1ANDA 2ZNKH 3GICB 1IAUA 2QAAA 2VNTA 1SGRE 4JYUH 1P01A 3I78A 4X8UH 1MH0A 3OTJE 1JIMA 2ZFRH 4DG4A 1HFDA 2ESTE 2HLDD 1EB2A 1MQ5A 2ZTZA 4X6NA 4ABFA 1G3DA 1DVAH 4XE4A 2CHAB 1YLNA 1YKTA 2EI8A 2VWNA 1NROH 1C4Y2 1V2NT 5DP9A 1WDIA 1THPB 2LPRA 5DK1A 4I7YH 4ABEA 1S84A 1WTHD 2W7SA 1PPZA 3QTVH 1GDNA 3TGJE 4BAMB 4AGKA 2FOGA 4UFFH 4B76A 4HI3A 4DVAU 5PTPA 1Q31A 2VVVA 3ATIA 1F5KU 4FUHA 2A5KA 3OX7U 1V3XA 3M5OA 1UVTH 2WPKS 2ZWLH 5ABWA 2BQWB 2GV7A 1SLXB 2P16A 2J2UA 1TPPA 1W3CA 1TALA 3UR9A 3LIWA 1FUJA 3TGIE 2JJ2D 2FOBA 3BTFE 1QBOA 1TGSZ 2LELA 1CBWB 4WVPE 3FZDA 1O3IA 3GS9A 5J4SA 2K8IA 3C27B 1VCPA 3UAIC 1KTSB 1ACBE 4CRBA 5T6FA 4Q63A 1JIRA 3T27A 1QFKH 2BDCA 2DE8A 2ZFFH 1LDTT 1GL0E 1SB1H 3RXPA 3PMHB 4CRCA 1YPEH 3A8BA 4MPWA 4VGCC 5K7RA 1TNLA 2XBXA 2SGEE 5DP3A 1PQAA 3QX5H 1SGFA 1ZSKA 5LPEA 1DY9A 3UY9A 1O2TA 1O5DH 1HXEH 3KQCA 3PTBA 3PTNA 4ZUHA 1XVMA 2BOKA 1QZ8A 3CNRA 2Z9IA 1V2QT 5FPSA 3S7KB 1MTNC 2VVUA 2ODQA 1SGEE 2FOEA 1QA7A 3OYPA 3M5LA 2PUQH 2FS9A 2L6OA 4F55A 1GCDA 5DP8A 1YCPH 6CHAB 1YY3A 3FFGA 2JH0D 4NWLA 3KQ5A 1WQSA 2CV3A 4NZLA 4UD9H 3KIDU 3KYGA 1MCVA 3RMLH 1DLKB 1ZHRA 2J92A 5I25A 1C9PA 1L1NA 1IQLA 1MMJN 3Q3YA 1D3QB 1UVOA 1C1NA 2HALA 1VR1H 3CS0A 5G4BA 1KXBA 1SVPA 3SU5A 1A3BH 3T29A 4FUEA 2ZGBH 1KTTB 1OP8A 2CF9H 3BTQE 1Y8TA 4JYVH 5JB9S 1Z8GA 3E8LA 1P2NA 3SHCH 4D8NA 2PWXA 4NCYA 2UUYA 1ARCA 2IOTA 1XXDA 1A5GH 2A1DB 2BQ7B 2EEKA 1ZZZA 1GVKB 2QYIA 1O0DH 1YPLH 2ALPA 4ZHMU 3QLPH 1LVMA 1AE5A 1ETRH 2FO9A 1SI5H 1MTNB 6LPRA 1V2PT 1K1PA 1C5PA 2ZHQH 3LKWA 1C2HA 3GOVB 4J1YA 2VBCA 1G3BA 1O38A 3GY4A 3A82A 5HIZA 3TH3H 5B6LA 4ZH8A 1OWHA 3TNSA 1PPBH 2C93B 2WINI 5FPYA 1SPJA 1Z7KA 1FAXA 3NPSA 2A45B 5JB8S 1NFYA 1VCQA 1TMBH 1Z1JA 3DT0H 1O3FA 2ZGHA 2GDDA 2KAIB 2J9NA 1E34B 2LNCA 1QIXB 2QF0A 1C5UA 4A1VA 2C8YB 1P3EA 1EPTC 2RFKC 1GBKA 4KTUA 3GCHC 1VGCC 3AW0A 1C1MA 1TAWA 3A88A 1P11E 1WOFA 2F9PA 4YOJA 1H1BA 2TIOA 2GCTC 4JYTA 1C1WH 2RA3A 5DKMA 1EB1H 1IHSH 4JK5A 1HUTH 3A83A 1UVUH 3M3SA 2Y5FA 3URDA 4ABJA 2G81E 4E7NA 7GCHF 1EZQA 1SGIB 2D8WA 2FP7B 1O5EH 1AFEH 4K69A 1N6YA 1TABE 3O8RA 1O3DA 1C1VH 2JH6D 1GBDA 3ZZ6A 3BSQA 3SNCA 3A84A 3MU5A 2R2WU 1E38B 1RD3B 1AY6H 1YPHE 2BTCE 2VIPA 1QL7A 2VWLA 1AVWA 4YOIA 3GYMA 2Z3EA 2IJD1 2QXJA 4CRDA 2XBWA 2C8ZB 3BIUH 2AMPA 1AUTC 5JBBS 3LH3A 2ZIQH 3QK1A 1S0QA 1FQ3A 1P9UA 5B6OA 1C5LH 1HRTH 2PUXB 3L6PA 3MNSA 4TY7A 3AW1A 4UFDH 5CDFE 1P2OA 1TGTA 3NUMA 2K0QA 2ZDKA 2BY5X 2NU2E 4D7GA 1C2MA 2ZEBA 1YCPM 1BTXA 1ZSJA 3TGKE 3TLOA 3PB1E 1HAOH 1GJAB 2ZA5A 2VGCC 2XTTB 4NIWA 1QL8A 5FPTA 3DSPA 1ZMLA 3F9FA 4NFFA 1CBWC 2R0LA 2FOMB 5GIBA 2PP6A 3OY6U 3F0OA 5EGMA 2BDHA 1GI2A 2Z6BD 4WH8A 1AGJA 1BZXE 1WCZA 1GJCB 5CHAB 2UUKB 1UK2A 1LHGH 3OAAD 3SGAE 1L0ZA 5C94A 3BG4B 1E79D 1D9IA 1F0RA 2EI6A 1N8OC 4A5TS 1EQ9A 1AVGH 1Z6JH 3M7QA 4A1TA 4CRGA 1NO9H 3UFAA 3LDXH 2GZ9A 2AGGX 5A8XA 1CQQA 2YOLA 2P3FH 1AD8H 1FI8A 3BEUA 1COWD 3LH1A 2OC8A 1RGQA 2A5IA 4Y0ZE 1RS0A 3S9AA 3Q76A 1RRKA 3C1KA 1BMAA 2B9LA 2R3UA 3UNSA 1XVOA 5IYTA 1KLTA 1JMOH 1O3NA 4FUDA 1C5OH 1VITF 1GJ8B 1TX6A 2ZDLA 1D3PB 2F9OA 1RJXB 2GP9B 1TRMA 4B2AA 2CHAC 1KLIH 1YCPK 1FNIA 3IWMA 1QJ6B 1QJ1B 2GX4A 2JETC 5EW2H 2F3CE 1HJ9A 3VXFH 4ZAEA 2OXSA 5HM2A 1UTKA 3D62A 1K28D 1ZR0A 1JBUH 2F9UA 3UQVA 2B0FA 2OINA 3BEIB 1W0KD 1BBRK 4IC6A 1T7CA 5A0BA 4AC9A 1A7SA 1BA8B 3GCHB 2AIQA 3H5CB 4INHA 4JMYA 1ESAA 1K1NA 2ZP0H 2CF8H 2ANWA 2THFB 1YPMH 4SGAE 4MTBA 2QXGA 1V2MT 2O8TA 3V0XA 1HYLA 3L3TA 2CMYA 2F91A 2VH0A 1KXAA 4U2WA 1V2KT 4Y7BA 3P8NA 3RMNH 1YPGH 1J17T 2FZZA 4FUGA 3GDVA 5T3HA 4D76A 5A8YA 4FUCA 4GSOA 4FOUC 2FM2A 3HPTB 1O2WA 3UREA 1GBBA 4TWWA 1ABJH 3M3TA 1GI0A 3TH2H 2FX6A 3KQDA 1O33A 1GL1A 1P57B 1Y5BT 1C1OA 2VU8E 7KMEH 1FN6A 1WQVH 3LT3A 1BUIA 3MU8A 3EA8A 1N1LA 4KGAA 1SHYA 1NRNH 1S85A 1BOQA 2FMJA 4OS6A 4X2YA 5DP5A 2GMTC 3F3BA 3KYFA 2Z3DA 2BVSH 2IPQX 4NIVA 5FL7D 1J8AA 4K1SA 4FU8A 3FP8E 1AFQB 2KM0A 1NU9A 4AOQA 2IN2A 4GUXA 1AFQC 3P8GA 5ESTE 3PV2A 4FXGH 4B75A 1SKYE 1QQ4A 2BDYA 2R2MB 3SHAH 2ANMH 1QJ7B 4Q4LA 3Q00A 1H8HD 3LGIA 4X2VA 4I33A 4Y0YE 1THSH 4ZMAH 2VVCA 5T6GA 1O2VA 1T8NA 2OP9A 1ZMJA 3SU0A 3UQOA 3LONA 3ZVEA 2L74A 1ELCA 1MKWK 1YPKH 3P8OA 7ESTE 4QT8C 2M5TA 1O2GH 1CE5A 1BTHH 3RXUA 4OS7A 2QF5A 3W94A 2IPHA 2R3YA 2EI7A 3TU7H 5AHGH 4O9VA 4K8BA 3JZ1B 1BRBE 1L4DA 1AKSB 1Y5AT 3DSGA
chains in the Genus database with same CATH topology
1P0SH 1OWIA 3M3VA 1PYTC 3B9FH 1NZQH 1B0EA 1ETTH 4MQAA 1B0FA 1XKAC 8GCHF 2AMDA 4FUBA 2HNTF 1XUJA 2I6QA 1QB9A 4CH8B 5C1XA 3E0PB 2GGVB 4K2YA 3BTME 1SOTA 4CH2B 1PPEE 1A4WH 1TLDA 2B8OH 1NESE 2HVXA 1F5LA 3T2NA 2HOBA 1EJAA 1ZLRA 1ZPZA 1HAZB 5F6MA 1DDJA 2BY7X 2GVFA 2ZECA 1AWFH 3KF2A 3R0FA 2PGBB 4ABHA 1SSXA 3HKJB 1K1JA 6CHAC 2VIWA 4ZHAA 3SZNA 1AB9B 1FV9A 1P3CA 2PLXA 1E35B 5A2MH 1ZTLA 2ZU5A 3RU4E 1MUEB 1UCYE 3SU2A 2FOAA 1TX7A 1S5SA 3EA9A 3RXTA 4NA9H 4ESTE 2ZGXH 3RXMA 4CBNA 5E2PA 3BTTE 5C3NA 2D1JA 1C2KA 4CREA 2Q1JA 4JZIA 2NWNA 1GBMA 1C2FA 3KGPA 4KTSA 2PFEA 2AEIH 4YT6H 2TGDA 3T5FH 3SJ8A 1L4ZA 4Q80A 2VIVA 3F9HA 4K60A 1V2LT 1Z8IB 3SV9A 2BYAX 3U8RH 3UUZA 1ZGIA 1DX5M 3ZZ3A 2XBYA 1O3AA 1HJAC 1ANCA 1HAVA 2RA0A 3ZYDA 1TGCA 3VB3A 4OGYA 1J15A 2XBVA 4JZFH 1VJAU 3T25A 4Y10E 3MU0A 1AKSA 3ZYEA 3GYLB 1N6XA 4K3JA 2PSXA 1LPKB 2ZGJA 1AHTH 4IN2A 4ISIH 4Z0KA 1G9IE 4OS5A 2JETB 2Z9LA 1EJNA 3O8BA 1IQGA 3STIA 8ESTE 1X7AC 1XUGA 1ELEE 4AGJA 3RU4D 1H9LB 4DIHH 4PROA 3TVJB 3FP7E 1J16A 4I8LA 1DLEA 1XM1A 1TNGA 1ZJKA 1SL3A 2ZKSA 1C1RA 1OSSA 3DA9B 3QDZB 4DW2U 1HNEE 1HXFH 1EASA 1HAIH 1Y3XA 4K8YA 1MTVA 4ABIA 3KHVA 4GLYA 1MZDA 2WUCA 1IOEA 1PPCE 2A4OA 1YLDA 4VGCB 5CMXH 3SNBA 1ZRBA 1GBTA 5C67A 2GDEH 4TWYA 2P8OC 4AFQA 3RXVA 3KQEA 1S6HA 4TYDA 3BTHE 1HLTH 1GHBF 1QR3E 1ZPCA 4WMDA 1RTLA 1MKXH 4CR9A 1O2SA 3UIRA 4B2BA 2GTBA 4WH6A 5LH8A 1UHBB 2P59A 1IQMA 3M5MA 1TNIA 2H6MA 4YLUA 1EPTB 1DICA 3SNEA 1DS2E 2QIQA 2J4IA 1T8OA 4MNWA 3GISB 1DWDH 1Z8JB 2QF3A 3A8AA 4I31A 1BTZA 4LXBH 3F9EA 4CRAA 2TRMA 3B23B 3SJKA 1TOCB 4GCHF 1HV7A 1D4PB 1HCGA 4XBBA 1UO6A 3RC6A 2D2DA 1W7GH 1SQAA 1T32A 3CENA 5FX6A 1C2IA 3ZVGA 1O3OA 1S83A 2ZU2A 2FI4E 2SFAA 1FN8A 3PV4A 3QGJA 1ZOMA 2JKHA 1BJUA 1FY4A 4D7FA 1NU7B 1QURH 2FLBH 1EAUA 3O8DA 4CHAB 2B7DH 4IGDA 3RMMH 3S9BA 1S82A 4GPGA 2A7HA 4MG3A 1RTKA 3A81A 1T4VH 4SGBE 1AUJA 2ZG0H 1Y3YA 1P12E 3O8CA 1BRCE 1O30A 2XC0A 1ABIH 4INKA 2C8XB 1EXFA 1EZXC 4Y6DA 2XYAA 4YLQH 1O5GH 3A7TA 1IQFA 3BIVH 4U32A 3EDXB 7GCHG 5C5NA 3I77A 4D9RA 3A80A 3CS7A 5I46H 1GJ6A 3UWIA 1MQ6A 3MO9A 5HMAA 3OY5U 5ESBA 4X1PU 1A0JA 1JRSA 3EAJA 1SGTA 2H9TH 4BTIB 4FUJA 4ISOA 1P2KA 3SNAA 1C5NH 2Y7ZA 5DGJA 2OC1A 1O3BA 3HATH 1EKBB 4Y7AA 3SJOA 1TONA 1C5VA 2Z3CA 1BHXF 1YGCH 1GI4A 1O2MA 5ETXA 3UNRA 1V2JT 1K1OA 3LOXA 2GT8A 1UCYK 9LPRA 2FOHA 2ZCKP 1RXPA 1FY5A 1S0RA 4AN7A 1NM6A 3PLKA 3GY5A 2ZU1A 3URCA 2P3UB 5JBTA 1ID5H 3MH5A 2BDGA 3U8OH 3MNCA 3EQ0H 2Q6GA 3SGQE 4X8TH 1Z1IA 1GJ4H 2H2ZA 2H1UA 2G52A 5JDUB 2A31A 2HLCA 1SFIA 2A7CA 3V3MA 3I29A 2K7XA 2XW9A 1UTLM 1SGQE 1C1TA 5A0AE 3SO3A 4BAOB 3E16B 3PO1C 2TGPZ 2PR3A 3RXIA 4ABBA 1EP5A 3VB5A 2BY8X 1EAIA 3PMJA 2ZDAH 1LPZB 2FI3E 1GI7B 4Y79A 2V3OH 1SG8B 1CA0C 1DUAA 1FJSA 4AB9A 1CA0B 1E37B 1ELDE 1P04A 1GJBB 1XUKA 3MU1A 1DWBH 4MVNA 1W0ZU 2BVRH 1RIWC 4JZEH 1O5BB 1WU1A 3VB6A 3MWIU 3QTOH 1B5GH 1C9TA 1K1LA 3P70B 5EQRA 4GCHG 4I8HA 4A7IB 3RUOA 4ZXXH 2GKVE 3TPIZ 1A61H 2G4TA 2VIQA 1AMHA 4UDWH 3QZRA 4X1RU 1GBIA 2ZCLP 1O2HA 4KP0A 4MNYA 2FEQH 1LVOA 1W8BH 1Z71A 2J95A 3F9GA 1GG6C 1O5FH 6GCHF 5EXMA 1QA0A 1CO7E 5EG4A 3Q3KA 3ZZBA 5JPMH 3RU4T 1HIAA 4MPUA 4I8JA 3TITA 1ELTA 1EOJA 3UNQA 1SGPE 1SQOA 1CT0E 1AVXA 2XC4A 3SNDA 2J38A 1GBLA 1OXGA 1ZYOA 5L30H 4X6OA 3TJOA 2WV4A 1G32B 1KYNA 3PROA 3SI4H 1QB1A 1SGYE 4FU9A 1VCWA 1H8DH 4NWKA 2SGQE 2F9BH 2PSYA 2ANYA 1ZTJA 1WUNH 4AYVB 3U8TH 2O9QA 1JWTA 1YBWA 1DANH 3ZVCA 3P17H 1DFPA 3W95A 1RIWB 5T6DA 3ZZAA 3FZZA 2R9PA 1AIXH 3ELAH 1J14A 1HDTH 2ZC9H 1YPHC 1ZMNA 4HGCA 1QBVH 1TGBA 1IQIA 2PW8H 5FX5A 3TK6A 1AO5A 2AGIX 1G2LA 2BMGB 4IMZA 4IMQA 3PMBB 1JOUB 1K22H 2ALVA 1MTWA 2GD4B 1OKXA 2ZHWH 1HAXB 2BZAA 1THRH 5FCRA 2J34A 3K6YA 1BRAA 3U1JB 1OPHB 1F7ZA 4LK4A 1M9UA 2QY0B 3HK3B 3M5NA 3ESTA 4I8KA 1J9CH 2CGAA 1SGCA 4RKJB 4UONA 1HJAB 3OSYA 3DFLA 1FY1A 1GMHF 2QGRA 1GMDF 2ODPA 2VWMA 5HXFA 1V2OT 1O2LA 3ZZ7A 4WMEA 3AAVA 4AFUA 4O97A 3CP7A 3HK6B 2FYRA 1GHYH 2HWLB 2ZU3A 1F0UA 4BANB 1O3EA 3SUDA 2ZHEH 3PYHA 1XUFA 1KDQB 3P95A 1FDPA 1QNJA 1BMLA 2Z94A 1PQ5A 5C1YA 3D49H 1AWHB 1CSOE 1OWKA 5JYIA 3TIUA 1EAWA 1TRYA 1PPHE 3M36A 1WBGB 1C5TA 4GAWA 1GJ5H 1ESTA 1O2PA 1AQ7A 3P8FA 3K2UA 4WWYA 1W12U 4ISHH 3UOPA 3MHWU 4A92A 4IS5A 4JK6A 3S9CA 2G4UA 5EXNA 3UPEA 3QUMP 2BVXH 4H6TA 3IITA 3VPKA 2XWAA 1O2XA 2Y80A 3LGVA 3RC5A 1YP9A 2TBSA 3LJJA 1EATA 3NKKA 4IC5A 1TQ0B 3SQHE 5F03A 1UHBA 2V35A 4RN6A 2SGFE 3A7WA 1CU1A 1ELFA 3S0NA 2ZPSA 2VH6A 2OC7A 2XCFA 5DO4H 4F4OC 2A4QA 4CHAC 3RDZA 4X1SU 1TPAE 3ODDA 4NA7A 1TNJA 5AVDA 1QL9A 1DT2A 1FIWA 3F1SB 3EBNA 2VJ1A 1GI8B 2Y5GA 2XXLA 1O32A 2FIRH 2HPQH 3BTDE 5L2YH 2WPHS 1C2LA 4I32A 4B2CA 1IQEA 4NGAH 1ARBA 2G8TA 4FU7A 8GCHG 5JBAS 4GVUA 1HAPH 2OC0A 2ZDVH 3QN7A 1O37A 2STAE 2Z9JA 2OUAA 4UE7H 3H7TA 4D9QA 2HNTE 2Y82A 2W26A 1QTFA 3IG6B 1F5RA 1HGTH 1TA6A 3SUEA 2YNAA 1L1GA 5FAHA 1ELBA 3BV9B 1T31A 1TBQH 1QRXA 1NPMA 2TGAA 3ZZDA 1GHXH 3MOCA 1O2OA 4KTCA 2P93A 5F8XA 4F49A 4MNXA 1Y3VA 1YF4A 1HAVB 1VITG 1GDQA 1O31A 1DXPA 1UTNA 1G3CA 1YM0A 2C90B 4Q7ZA 1DXWA 5C2ZA 5E0JA 5L2ZH 2BDAA 1NY22 3ZV8A 1K1MA 4R0IA 2ZQ1A 5BRRE 1GHAG 2BD7A 5FBEA 3RXDA 1GJ7B 3SJ9A 1O5AB 2ZPRA 1A0LA 2ZGCA 1HAYB 1P2JA 3SU3A 1RFNA 1C1SA 2BZ6H 3VGCB 2OD3B 4U01A 3ODFA 1BQYA 1OYTH 1IQHA 1Y5UT 1LHEH 3RM0H 1V6DA 1MKXK 2FOCA 3U1IB 4OS1A 3U69H 1O3GA 4X8SH 1O3JA 3PO1B 3U98H 4DY7B 1XUHA 1C2JA 4B1TA 1O39A 1GCTC 1A5HA 1O34A 6GCHG 2O8LA 4Y71A 1T4UH 1HAHH 1V2TT 5EXLA 3ZVFA 1C5YB 2XCNA 1FONA 4FVDA 3AASA 3SOSA 3TNTA 1DPOA 1MU8B 3RXRA 1PQ7A 3GDUA 3MH7A 3N7OA 3UOUA 2PHBA 1JXPA 1LKBA 3LGWA 4O3TA 3SV8A 4ISLA 4FUFA 5EW1H 4MPXA 4B71A 1BTWA 3GCOA 2O8UA 1ORFA 1YPJH 1DSTA 3KNXA 1Q3XA 1GVLA 5K0HA 4AG2A 2OBOA 2LIZA 1ZJDA 2QA9E 1GBEA 3RXHA 3NWUA 4TPIZ 4A1XA 4AB8A 2Y5HA 1BBRE 2Z9GA 5HGGA 5E8EH 2ZFQH 3Q3XA 4UFGH 1W11U 3ATLA 1C5RA 2EC9H 5F8ZA 2BXTH 1CHOG 1ELVA 3LC3A 2H5DA 3E90B 3QWCH 8KME2 3E6PH 2ZQ2A 5GCHG 1GBJA 2AH4X 1F2SE 3RXBA 7LPRA 4HZHA 4E05H 2ZTXA 2J94A 1Z6EA 1LPGB 1EZSC 5A09A 2RDLA 4H6SB 1UTPA 1EPTA 1BT7A 1XUIA 2OBQA 3RXJA 2OTVA 3EGKH 2FI5E 1GPZA 1QY6A 1ANBA 2QV1A 4K1TA 1D3TB 1CT4E 3DUXH 1CHOF 1D6WA 1HPGA 1D6RA 2GCHG 4XFQA 1TMTH 2I6SA 1E0FD 1GBHA 1SGNE 4LZ4B 1OWDA 3ENSB 1GHWH 9ESTA 1AN1E 1DOJA 1TNKA 2UWPA 4XBDA 3U9AH 1SLUB 4AFZA 5AF9H 3SUGA 5DP4A 1O2RA 2FOFA 1GGDB 1V2WT 2F9NA 5E0GA 2H9EH 1Y59T 4BAQB 3RXKA 2Z9KA 2VIOA 3KL6A 3HGNA 4DGJA 5DPAA 2Q6FA 2BY9X 2AIPA 4E06H 2FLRH 1D3DB 3A86A 1BRUP 1B7XB 3SJIA 2BD9A 2ZU4A 3NXPA 1O3PB 2SGPE 2QCYA 3FANA 2NU1E 4ABDA 2BM2A 2RG3A 5IDKA 1LQEA 1TB6H 2G00A 1TNHA 2QXIA 2BY6X 1EJMA 1HB0B 3K65B 1KXCA 2ODYB 4NFEA 2G55A 4X1QU 2FESH 2ZZUH 2BLOA 2XWBI 1SGFG 1DM4B 1O2YA 3MI4A 1BCUH 5FHTA 3ZZ9A 2C3SA 1LCYA 1NFXA 1P2IA 4MNVA 4X6PA 3BN9A 2WPJS 1W14U 3VXEH 2YNBA 1QBNA 1T8LA 2NU3E 3LC5A 1C5WB 4IW4E 2A2QH 2WPMS 1V2ST 2VGCB 1P2QA 3ITIA 3B8JA 2FWWA 1GBAA 3ZVBA 3M37A 3SN8A 1VGCB 3GY6A 4Y8ZA 5H4IB 3A85A 3BEFB 4BOHA 1TQ7B 3A87A 1O2ZA 1SFQB 1HJ8A 3T28A 1KSNA 5LPRA 4MLFB 2PKAB 1GMCG 3OU0A 3RC4A 3WY8A 3EE0B 3HKIB 2OLGA 1BMNH 1QB6A 1O2UA 2BOHB 2CJIA 1P05A 1CHGA 3GCNA 3R3GB 3AAUA 1P2MA 3FAOA 1EZUC 5GXPA 2CXVA 3MU4A 3RXQA 4DURA 4YESB 4Y8YA 2JH5D 1MKWH 1H9HE 2PGQB 4YO9A 1CVWH 4ZKRU 2IJOB 2SGDE 1ZPBA 1BITA 4MDSA 1VZQH 1GHBG 1AB9C 1W2KH 1FPHH 2ASUB 3FVFB 5EOKA 1WSSH 1AZZA 2BLQA 1C5MD 1BBRH 2WYJA 2WV5A 2EA3A 4WJG2 5GJ4B 1C1PA 1ETSH 2BLVA 2ZHDA 2AS9A 2F9VA 1EX3A 3SUFA 1MAYA 2PKSB 2FODA 3RLYH 1LHDH 4BNRA 1PYTD 4Y76A 3VB7A 4B74A 5EODA 1VJ9U 1CA8B 1QRZA 1W10U 1AE8H 1K21H 2WPIS 1C5ZB 4HTCH 2FXRA 2G5NA 1NRQH 4ZROA 1FMGA 2P94A 1K9OE 1WYKA 2PKAA 4O3UA 1GBFA 3ZZ4A 1LVBA 4WY3A 3PWCA 1UK4A 3SBKA 1LMWB 1G3EA 1G30B 1TFXA 1V2UT 4DOQA 4RKOB 1MZAA 3MYWA 5GWZA 4CR5A 5EPYA 1OP2A 4X1NU 2H5CA 3SI3H 3BTEE 5TCAA 1OWJA 1C4U2 1C5XB 1XMNB 1QCPA 1XX9A 1DY8A 6ESTA 2QN5T 4XSKU 1MD8A 2AYWA 1FPCH 1P09A 5LGOA 4Z6AH 1NFWA 1FY8E 1FY3A 2UUFB 1MAXA 3KCGH 4FVBA 2CN0H 4GHTA 1Y3WA 5HM9A 4U30A 2A2XH 3QZQA 1NTPA 1KLJH 2F83A 3VB4A 2A0QB 1GMDG 3E0NB 3TH4H 4YM9A 3NCLA 5HYOA 1GJDB 1GMHG 5LPFA</