2QCYA

Crystal structure of a monomeric form of severe acute respiratory syndrome (sars) 3c-like protease mutant
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Mechanism for controlling the dimer-monomer switch and coupling dimerization to catalysis of the severe acute respiratory syndrome coronavirus 3C-like protease.
pubmed doi rcsb
source organism Sars coronavirus
total genus 83
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2qcyA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qcyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qcyA02
1ZJKA 3LC3A 4BANB 1O3MA 3I78A 2ANYA 3GYLB 1DWEH 3LGUA 1O2JA 1C5UA 1ELGA 2FTMA 1O34A 1KXCA 1A5IA 4GHQA 1RTKA 2OUAA 1EAIA 1GBMA 1KY9A 1GMHG 3M3TA 3P8FA 2A4RA 1SQAA 3RXIA 1ZHRA 1PFXC 2BDCA 2ZHEH 3BN9A 2ILNA 4X8VH 1AB9C 2EI7A 4IN2A 1BQYA 2G5VA 2AIQA 2O8UA 5J4QA 4CHAC 3RXLA 1XVMA 1CO7E 2BD9A 1C5YB 3A81A 4O3TA 1HLTH 5DK1A 1UTLM 2VIWA 1ETRH 1G3DA 1OX1A 1EJNA 1TMBH 3M5MA 1SGPE 2Y5HA 3P6ZB 1O3IA 2R0KA 4FUCA 2SGQE 1V2PT 1NU9A 4LK4A 3ODFA 3SI4H 1AUTC 1C1RA 3RM0H 2H6MA 3A87A 1YPMH 3BEUA 5GCHF 3HK6B 1HV7A 1QJ6B 1PPEE 1C5MD 4U2WA 2BD3A 8LPRA 3ZVCA 3DD2H 1O3JA 1QBVH 4ABIA 1GBTA 1MMJN 3RXFA 1V2KT 1UHBA 5FPYA 2OXSA 4WMEA 1DWCH 1RGQA 1Y3YA 2ZPQA 3KCGH 1AE8H 3MU4A 3SV8A 3RUOA 5CMXH 2ZDAH 5DGJA 4D76A 3D65E 5A0BA 2J38A 3A7VA 4ZHLU 1C9TA 3ZZ6A 3SUGA 3M35A 3BTKE 1JIMA 2ZCHP 4INKA 3A8BA 3S7KB 3RU4D 3T62A 3SNEA 1O2PA 1EP5A 3QX5H 4QT8C 2ZC9H 1O3HA 1TFXA 3GYMA 2SGDE 1GBEA 5C2ZA 1NESE 4K5ZA 5C1XA 1DVAH 4B75A 1OWKA 4B71A 1NRNH 4BXWA 2ANKH 4B2CA 1P2QA 4UFDH 4CBNA 1C2IA 3JZ2B 4JYTA 3UPEA 3SU4A 4BAHB 3BG4C 2AH4X 3GDSA 1C1VH 1OP2A 1UK2A 1Z8GA 3KQCA 1BOQA 3SU2A 2QA9E 3GCNA 3MU8A 1AD8H 3RXHA 1QB9A 3SJOA 3ZZCA 3V3MA 1P05A 5ESTE 3QUMP 1EQ9A 2ZWLH 4IBLH 3E16B 4FU9A 4Y79A 4AZ2B 4Q7XA 3TU7H 2HRVA 2PSXA 3S9CA 2W7UA 1XUJA 2P94A 4OS2A 2BB4A 2HNTF 1LDTT 4R8TB 1N6XA 8GCHG 2TGPZ 1K1OA 1V2MT 3A82A 1QR3E 2VWLA 4FUFA 1A5GH 1O31A 1GI7B 1P3CA 1WTGH 3TJUA 2F9UA 3LGTA 3RMNH 1BITA 1KYNA 1QCPA 1N8OB 4TY7A 3T28A 4DGJA 3UNQA 3ODDA 4AGJA 1DY9A 1T8LA 5GPIB 2D1JA 3MO6A 3MO3A 2A4QA 2ZFFH 1HAHH 3VEQB 1TRYA 4Y10E 5C1YA 4ZHMU 3MTYA 1AQ7A 3E90B 1P8VC 3ZZ8A 1UVOA 1VR1H 5HM9A 2Y6TA 2PGBB 4YO9A 1P01A 4X8SH 5EG4A 1FXYA 5EQQA 1O3BA 1BHXF 1ID5H 5FX5A 2Q6GA 3BIUH 1XKBC 4IMZA 2ZHWH 3U1IB 4R0IA 2F3CE 3TITA 3KGPA 5EPYA 2PKSC 1QBOA 1QRWA 1ZPBA 2FOAA 2HPPH 4OGYA 1SQOA 1QL7A 7GCHF 3BTWE 3STIA 2TGAA 3K2UA 1IQHA 1P09A 2QXHA 5HMAA 4WH8A 2BDGA 1BBRH 2F9OA 1HPGA 3SHCH 4WF8A 2BYAX 4WXIA 2WYGA 2OTVA 1C2GA 3VB4A 1EX3A 1TBZH 4FUIA 5A2MH 2XYAA 3TNTA 3A85A 1FV9A 2ZHFH 1LKAA 2BDHA 1LVYA 1P2NA 1CBWB 4I8KA 5CE1A 1HIAB 1P57B 2XWBI 3VFEA 2W7SA 2AIPA 3HGNA 3TK6A 2GDEH 2YNAA 3M5NA 1NS3A 4CRCA 1C1PA 3PROA 1FJSA 1KLJH 1TGNA 1W10U 3NXPA 1K22H 1TOCB 1GJ9B 1DWBH 4LZ4B 4YOGA 1QRZA 3PLBA 3ZVEA 1O2LA 2ZI2H 2OC7A 2VWMA 5E0HA 1EPTB 3U9AH 1VCWA 2WYJA 4YTAA 1A2CH 2FO9A 2FOCA 5B6OA 4UDWH 1E35B 1D6WA 1NPMA 1HXEH 1O3AA 1P2KA 3Q3YA 1TX8A 1YCPH 5F8XA 1H9HE 2CF9H 2STBE 1UVPA 4WMFA 2AFQB 3HKIB 1ZSKA 2K1QA 1BMMH 1PQAA 3TGIE 2UUJB 1PPFE 1DY8A 1GI1A 4AFZA 1Y3VA 1J16A 1E38B 1YLCA 3PWBA 3ZVAA 3RXDA 5FPSA 2GZ9A 2ZFSA 2Z9LA 2GT8A 2ZU2A 2FPZA 1C1NA 2OCVB 4BAKB 1CA8B 1AWFH 3S9AA 5LPFA 3MNBA 3UUZA 2F91A 1GDNA 1SLVB 4FVBA 2SFAA 3P70B 1GHBF 2FLBH 3V0XA 2ULLA 1YPHE 1KDQA 1GGDC 5I25A 2BZ6H 1RS0A 2TIOA 1FY5A 1NY22 1JBUH 1LPKB 1C5PA 1S82A 1ZMJA 1D3QB 2WPJS 4JZFH 3V13A 3LIWA 4DCDA 1MZDA 1TALA 2TGTA 4ZKNU 3MU0A 3ZZ7A 1OOKB 1GI2A 1G3CA 1MU8B 1F2SE 3RC6A 1ABIH 3PMBB 3NCLA 2ZU3A 5HGGA 1NTPA 5CHAB 2Q6FA 1LO6A 2VIVA 4BOHA 4NIXA 3RXQA 5ETXA 3ZVFA 3TPIZ 3GY4A 1FAXA 3A86A 1OSSA 1GCDA 4HTCH 3U1JB 1O2SA 1V2TT 1Q2WA 1C1QA 3V7TA 4FUEA 1MTSA 4JK5A 1A61H 2SNWA 1PQ8A 3ATLA 1F0SA 1KLIH 2P3TB 5A8XA 3DUXH 1GI5A 4X8TH 1V3XA 1XUGA 1BBRK 3A89A 1ELTA 3ITIA 3W95A 1SGRE 1PPHE 1NFWA 1ANEA 1D9IA 1NRQH 2F9PA 1G36A 2G55A 4E05H 1AIXH 3S0NA 3F68H 1YM0A 2J2UA 1T4VH 4CRDA 1HIAA 4Y0ZE 3VXEH 1BHXB 3MHWU 1GDUA 1GHXH 1JMOH 2ZDNA 1QIXB 4DVAU 2GKVE 4RN6A 1C2HA 2XBYA 4JZIA 1ETSH 2AEIH 1LKBA 1BBRE 1EPTA 4VGCC 1VITH 1P12E 2YNBA 4ISHH 2IN2A 3BF6H 1AN1E 4NZLA 1L2EA 3RC5A 3BTEE 3WY8A 5JB8S 3MH5A 2AMDA 5LH8A 1GHYH 1TGBA 1YCPK 2BDIA 4MNWA 3VGCC 1W13U 4GCHF 1LHDH 1PYTC 3FZDA 2A1DB 1IQNA 3BTHE 1VGCC 1EAUA 3SW2B 3EGKH 2ZTZA 1V2OT 3OY5U 4UFEH 4Y8YA 4D7FA 1CHOF 1SPJA 2C3SA 1TAWA 2ZPSA 1LHEH 3EYDA 3IITA 3FAOA 1BTXA 1PPZA 2BY8X 3SN8A 2NU3E 1UCYH 2ZQ1A 4ZKOU 2GV7A 3LJOA 1GDQA 3M7UA 3GY8A 5F8ZA 2A4GA 1BT7A 3KN2A 1G37A 6LPRA 4ABHA 3B23B 2ESTE 1ZJDA 2FM2A 1C2MA 1PPCE 1ZSJA 4OS4A 1K1JA 1QHRB 3E8LA 1E36B 2ZKSA 5PTPA 1GBAA 1QQUA 5IDKA 2DE9A 3M5OA 4YLQH 3I29A 1AVWA 1O3GA 1O5BB 1VJAU 2A7CA 2PTNA 1LHGH 4AYYB 3RDZA 3ZZ3A 1SGFG 1TNKA 3P8GA 3A7XA 1A3EH 3K65B 3PWCA 3SNAA 1HAPH 1BRUP 2Y5FA 1ARBA 1MTNC 2CGAA 1HDTH 1SVPA 1C4Y2 1LVMA 3SGAE 1XXDA 4GSOA 1TWXB 3DFJA 2QXGA 2QY0B 3K6YA 2G51A 5DP6A 6GCHG 2BTCE 2PSYA 4PROA 1Y3UA 4K1SA 2R2WU 1TA2A 2FODA 1DXWA 5C20A 1GJBB 4Y76A 1HAYB 3E6PH 3RXCA 2BOHB 1HFDA 3M3SA 2AS9A 1K1PA 3A88A 1EP6A 9ESTA 1SOZA 1GI8B 4AFQA 3UOPA 5EW2H 1QRXA 3NZIA 1YCPM 5HXFA 2B0FA 2VGCC 1GMDG 5C5NA 1GPZA 3MU1A 3QWCH 2ZDMA 2V3HH 2UUYA 1K28D 4I8HA 1QB1A 4JCNA 4X2YA 1C1SA 4NFEA 4NA9H 3TK9A 2FOEA 3U8RH 1J17T 1Z1JA 2W3IA 1GVLA 2FX4A 1QJ1B 1DSTA 1GHZA 2G5NA 3RXGA 1INCA 1HAZB 1GG6B 2CMYA 1MUEB 2XTTB 3GCTF 6CHAB 1MQ5A 4GPGA 3Q00A 1NRRH 1KTSB 4DG4A 1BTWA 3RXEA 1Q3XA 1XVOA 1MAYA 4DIHH 4NIVA 1D3TB 2H2ZA 1MTNB 1DOJA 1MTUA 1DDJA 2Z3DA 2GP9B 4O03A 4WJG2 1VITF 3E0NB 5EU8A 3KL6A 5FXLA 1SLWB 2AGIX 4TYDA 5C3NA 4NWKA 3QK1A 2Z3EA 3RXMA 3UWIA 2ZU4A 2RCEA 2ZU1A 3GISB 3HGPA 3GICB 1HAVA 1GJAB 1TQ0B 2FI3E 1SLXB 4ABAA 4I8LA 1FPHH 2O9QA 3LDXH 1O2IA 4K2YA 1CGIE 4XSKU 4UD9H 1AE5A 1UCYK 3UFAA 3QO6A 1EZQA 1IQMA 1TX7A 1W2KH 4SGBE 3O8RA 4CREA 4AB8A 5L30H 1TGTA 1DPOA 1BMAA 3RXKA 4ZROA 4ZAEA 3Q3KA 4FU7A 1O2WA 2ZECA 3RC4A 3D62A 1VJ9U 1UTNA 1NC6A 1AVXA 2BLWA 3GOVB 5JBBS 4BNRA 3MMGA 1Z6EA 2GCHG 4I32A 3RU4T 1WQSA 3KQBA 2RDLA 4X2VA 5GIBA 3ZYEA 4KELA 4ZXYH 1MD8A 1E0FD 4MPUA 1AFQB 2J92A 4AN7A 1C5NH 5C67A 1UCYE 1FY4A 3M3VA 1BIOA 1GI0A 4MNXA 1UTPA 3QTVH 5DP7A 1EOJA 1BRAA 1GBKA 2WPIS 3LGWA 4Y71A 1DSUA 5F8TA 4WY3A 1HBTH 2HPQH 3TH2H 4CBOA 1ANDA 2Z3CA 2C8XB 1BZXE 3SBKA 1S6FA 3S7HB 1EZUC 3GY5A 3QTOH 4LOYH 3FFGA 2J4IA 2WV4A 3H5CB 1CT2E 3QDZB 1CVWH 3PTNA 2NU0E 4XBBA 1O33A 1ORFA 1GHVH 2BXUH 2WPKS 2BQ7B 1GI6A 1O3FA 4BTUB 5JDUB 4UFFH 1NRSH 4WWYA 2H5DA 1FONA 2ZQ2A 3OYPA 3URDA 5EXMA 1O2TA 1O2RA 2JH6D 3KQEA 1G3BA 1DM4B 4K69A 3EQ0H 3M61U 3NK8A 4A1VA 1V2NT 3SJKA 2VJ1A 1AGJA 1ZLRA 2FS9A 2A32A 1C5ZB 3PMJA 1O32A 4GLYA 4AFUA 1GI4A 2EI8A 2WPLS 1ELDE 3SUDA 1A0LA 5EQRA 2Z9KA 1ESAA 2XW9A 1N8OC 2H1UA 3SOSA 3LJJA 1SGEE 5FAHA 3HK3B 3RMMH 4Y0YE 1Z1IA 1PPBH 3BTDE 1CA0B 1E37B 1GHAG 5EXLA 1AFEH 4BAQB 1P9SA 1P2MA 3M5LA 4X1RU 1UVSH 2SGPE 3Q77A 2FESH 4HGCA 5DG6A 1FN8A 1B0FA 5E2OA 1SGTA 1ANCA 1UVUH 1W14U 3E0PB 2J9NA 1ARCA 3SI3H 7LPRA 2EC9H 2BVRH 2GGVB 2ZTYA 3A7TA 4CRFA 1MBMA 1UTQA 2BLVA 1O2QA 2BLOA 4OS1A 3A7WA 1MCVA 1GBHA 4X1QU 3M37A 3EA8A 2Q1JA 4BXSA 4YT7H 2XC4A 8GCHF 1DXPA 1FUJA 2CF8H 2FYQA 3LGYA 1W0ZU 4J2YB 3HKJB 2HWLB 1KXFA 1GBFA 8ESTE 1O3OA 4RKOB 5FCKA 3F6UH 2VH6A 2A31A 1KIGH 4X1NU 4Y8ZA 1MKXH 4UE7H 1P02A 2JH0D 5JBAS 5TJXA 3UIRA 1SGFA 2FYRA 3UWJH 1C5QA 3F1SB 2XXLA 2H9TH 1J8AA 1CBWC 2OD3B 1IQJA 3DA9B 3DHKH 3LPRA 1SC8U 1G30B 2BVXH 4NA7A 2KAIB 3K6ZA 1GBBA 1EXFA 4M7GA 3SGBE 2Q6DA 3TJVA 5C1UA 4HZHA 4IS5A 4TY6A 5LPEA 2AERH 1W7GH 5E0GA 2GCTB 2UWLA 3KEEA 1XUKA 1F0TA 5A09A 2PFEA 1EPTC 3ZVGA 3ZZ5A 1Y5BT 1ZYOA 4AG1A 1EB2A 1P11E 1Y3XA 1QJ7B 1AWHB 3QGNB 1ELVA 1UTKA 1DITH 1WAYB 2NU1E 4B2BA 4ESTE 5EODA 1JRTA 3OX7U 3AW0A 1PQ7A 1Z8RA 2Y82A 1FIZA 5EPNA 1IQIA 5HYOA 1MKWH 3A80A 1OWEA 2CHAB 2BD2A 4MDSA 4K8YA 1FI8A 4JYVH 3RXOA 2K7XA 5JPMH 2UUKB 1K1IA 1YF4A 1J9CH 1ZSLA 3PLKA 4B76A 4DT7B 1A4WH 2XNIA 1TABE 1TX6A 1TNJA 1L4ZA 1TNGA 4BAOB 2FDAA 4NG9H 1HAGE 1YC0A 1L1JA 1Z8IB 2GX4A 3PV4A 5AF9H 3SJ8A 5ABWA 3GY6A 2V0BA 4Q80A 3F9GA 5FBIA 3MNCA 2XWAA 2F9VA 4AG2A 2V35A 2V3OH 2Y7ZA 3JZ1B 1D3DB 1ESTA 2RA3A 2BHGA 1TPAE 2VIQA 1U6QA 4J1YA 1K1LA 2ASUB 3UTUH 3O8DA 5EGMA 1LCYA 1L0ZA 4DIIH 3MO9A 2V6NA 3NWUA 2QV1A 1B0EA 5CHAC 7GCHG 1AKSB 1FY8E 3SZNA 2GV6A 4CH8B 2C8YB 4X0WU 2HNTC 1OKXA 3MFJA 2QF0A 1MBQA 1C2DA 2ZTXA 1HAOH 4ISIH 1D4PB 3KHVA 4K8BA 1MAXA 5AHGH 1DUAA 2UWOA 1O2MA 2PUQH 2PLXA 3MYWA 2THFB 2WPMS 2GVFA 3QZRA 3BTME 3FZZA 1V2RT 4MPVA 1IAUA 2XCFA 2EEKA 2ZCKP 1MKXK 4RSPA 3P8OA 2A2XH 1N1LA 4AGKA 2Z6BD 3VPKA 2ODQA 1Y5UT 1P2IA 4MPXA 3PTBA 2QCYA 5GDSH 1SL3A 1EASA 5GXPA 2KAIA 1T4UH 2R3UA 3CS7A 2ZA5A 1C2EA 2DUCA 1YP9A 3MNXA 1AMHA 5H4IB 2ODPA 2J95A 4E06H 1ZZZA 2ZGXH 2VIDA 1TPPA 3LT3A 4THNH 1O3EA 4B74A 1SHHB 2FWWA 3D49H 3BEIB 1Y3WA 5AVDA 1S84A 1C5OH 1ELBA 1QGFA 1YBWA 1O37A 5A8ZA 1V2ST 3U98H 2FOHA 2BLQA 1UJ1A 2FLRH 4OS6A 1MH0A 3BEFB 1MQ6A 1IQGA 1IQKA 3S9BA 2FMJA 4TWYA 2FX6A 1MKWK 1V2UT 5A0CA 1DT2A 2ZFPH 3EE0B 3KIDU 5L2ZH 2XBVA 3SU1A 5GJ4B 2FXRA 3C1KA 1EJMA 4B73A 1IHSH 2BY7X 1PJPA 1EZXC 5SGAE 5ESBA 1AHTH 2VWOA 3M7QA 1Z8JB 2PW8H 3SUFA 1YPEH 2D8WA 2ZPRA 1NZQH 1QL9A 1FDPA 2QGRA 4X6PA 2Z94A 3ESTA 3CS0A 1TNHA 1EZSC 3MI4A 4ISLA 3H7TA 4K1EA 3MH6A 1GMCF 1TMTH 1F0RA 1F5LA 1A1RA 5F03A 4FUGA 1DS2E 3UR6A 3ZVBA 1L1GA 4U01A 1FQ3A 3P95A 3TH3H 4BAMB 3TJOA 3R0FA 4F4OC 2OLGA 4UFGH 3MH7A 3GY3A 2BD8A 5J4SA 1YKTA 4E7RG 4BTTB 1C2LA 1ELAA 3ELAH 4WH6A 1CU1A 4FU8A 5E0JA 2ZGBH 5JBTA 1W7XH 1EATA 1UO6A 2QIQA 4AOQA 2ZEBA 1C4V2 2QN5T 4KKDA 1A5HA 2FOBA 1FNIA 4H6TA 1E34B 1OWIA 1HCGA 1TPOA 3A83A 1V2VT 3FANA 3RLYH 1BUIA 4Y8XA 2A7JA 1Y8TA 1C1UH 1VZQH 1H4WA 2GZ7A 2FOFA 3LGVA 1LQDB 2P3FH 1V2WT 1SGIB 2WUCA 1LTOA 3SU6A 2AMQA 1O5FH 2FOMB 1BMLA 3MH4A 1ELCA 1UK4A 2BXTH 2I6SA 3NUMA 1OS8A 3SORA 1T8NA 1A0JA 1UTMA 3ENSB 3RXAA 2GDDA 1DUEA 4JZDH 5TCAA 3ATWA 1J14A 1C5LH 1BA8B 1XUHA 1AZ8A 1PQ5A 4HI3A 2PUXB 2ZP0H 1G9IE 1IQFA 2HALA 1C2FA 1GG6C 3T27A 4INLA 1V6DA 1KXDA 6CHAC 3ZYDA 2O8TA 2ZHDA 1OWDA 1V2JT 2FI4E 3SV6A 1P3EA 3BTFE 1T8OA 5L2YH 6GCHF 2ZU5A 1RJXB 1ETTH 2SGAA 4B2AA 3O8CA 1UVTH 3H7OA 4AX9H 3CENA 4CRBA 1QB6A 2C8WB 3D23A 2IPHA 3SU3A 2Z9JA 1GJ5H 2VVCA 1LHCH 1H1BA 1YPLH 2AYWA 1CGHA 3P92A 3UOUA 2IOTA 1OYQA 4GHTA 1ZMNA 2RG3A 1ZRKA 5EXNA 2LPRA 2ZGCA 4YOJA 2FEQH 1TE0A 2XBWA 1PPGE 2EA3A 4FUHA 7ESTE 2XRCA 1L4DA 3EA7A 1FY3A 3ZV8A 1GBJA 2G00A 5FHTA 2GD4B 2SGEE 1Y59T 3L6PA 3ZZAA 4A5TS 4ABJA 2J34A 4IGDA 3NKKA 1CQQA 3F9EA 2HLCA 5DPAA 4D9QA 1CT0E 3B9FH 3L3TA 1BCUH 4MTBA 2VB0A 1EJAA 1AFQC 1DWDH 2A45B 5T6FA 3UY9A 2OP9A 4ABBA 1GL0E 3PM3A 3F9HA 1ELFA 4AORA 1GJ6A 1GBLA 2AGGX 3B8JA 3LU9B 4K3JA 2G4UA 2W5EA 1GJ8B 1F92A 4H4FA 4ISNA 1ZTKA 1SQTA 2CV3A 3GDVA 4AYVB 4IC6A 4KTSA 2OBQA 4A7IB 3RM2H 1BRBE 3RMLH 4CR5A 3NPSA 1O5DH 1K9OE 1UHBB 4MVNA 2QAAA 1L1NA 3GCHB 5T6DA 4CR9A 2WUBA 1A7SA 2XC0A 1GCTB 2JETB 4CRGA 1NO9H 1OWHA 3EBNA 1GJDB 1YPJH 2BD7A 3RXJA 4TPYA 1WUNH 4BTIB 1XX9A 1K1NA 1C5RA 4A92A 5BRRE 1C5SA 3PYHA 3TNSA 3GDUA 2P8OB 1RFNA 2GT7A 3TK5A 1O5GH 1HJAB 4GUXA 4KP0A 3PMAB 4Y7BA 5AFZH 5F6MA 1O3LA 1OP8A 3RLWH 1WU1A 1GMHF 1O36A 1KXBA 1QA0A 4ZXXH 1DICA 1ESBA 1PYTD 1XXFA 2HVXA 1BMNH 3QN7A 3ZZBA 1GHWH 1FY1A 4YT6H 1C5TA 2GMTB 1DLKB 2BVSH 3PO1C 1H8DH 1O38A 1AO5A 2ZZUH 1SGCA 3LH3A 4K1TA 1P0SH 4ABFA 3SV2H 2Y7XA 1C1MA 3U69H 1NROH 2SNVA 2UUFB 4LXBH 1CA0C 2LNCA 2PKAB 4UONA 5LPRA 1JWTA 4X8UH 2G81E 1TRMA 1Z7KA 1O0DH 2VNTA 3ATMA 1GJ7B 3EAJA 3E91A 2B7DH 2TPIZ 1QBNA 5A8YA 2D2DA 2ZCLP 4ZMAH 3T25A 1AUJA 1AU8A 2PGQB 1F5RA 1ZTLA 3A7ZA 2JH5D 5EW1H 4B1TA 1ZGIA 4D7GA 1S5SA 1SGDE 3K9XB 2QXIA 1RIWB 2CN0H 1ABJH 3SHAH 1JIRA 2ZFRH 1SR5C 3UQVA 1SGYE 1OXGA 2G4TA 3SU5A 1W12U 3RP2A 2TRMA 4Z6AH 2H9EH 2GZ8A 2JKHA 5DP4A 3RXUA 3ZZ4A 2BM2A 1WTHD 2BX3A 1G3EA 2OC0A 1P10A 1GHAF 1C9PA 5DO4H 3OY6U 4YESB 5T6GA 2VVVA 4TPIZ 1O39A 4H42U 3KQDA 1X7AC 1MZAA 3PO1B 1FMGA 2P16A 1DLEA 5K0HA 1WQVH 1XMNB 2XBXA 4NFFA 4KTCA 3GY7A 1HXFH 1IHTH 3LH1A 5EQSA 3PLPA 3RXPA 2GCTC 1CGJE 1YYY1 4ABDA 2AMPA 3SV9A 5GCHG 3ATIA 1XKAC 2B8OH 1Z6JH 2NU4E 4DY7B 1ELEE 2B5TB 3ZV9A 1S83A 1JRSA 2BQ6B 2OINA 4ZHAA 2QF3A 1W8BH 1EKBB 1O2KA 2EI6A 2C90B 2BX4A 2BMGB 4XBDA 4XFQA 1KSNA 4H6SB 1KXEA 2Z7FE 1QA7A 1AB9B 1BB0B 3BV9B 1ZPCA 1GWAA 3P8NA 3W94A 3TIUA 1T7CA 1ZOMA 2CHAC 1YGCH 1XUIA 1ZMLA 2A7HA 4CHAB 1QL8A 3Q76A 2Y81A 3A8CA 3IG6B 5FX6A 1UTOA 3TLOA 4YM9A 2DE8A 4MNVA 3PMHB 1K2I1 2ZHQH 3R3GB 3MU5A 1O3CA 2Y5GA 3ZZDA 2OQUA 1SHYA 4O97A 5DKMA 1OWJA 4Y6DA 4RKJB 1WSSH 1ZRBA 4XOJA 1V2LT 1GJ4H 1IQEA 1MU6B 5DP8A 3RXBA 3UNSA 1BRCE 4OGXA 2PKAA 1IOEA 1ANBA 4YOIA 1THSH 1KTTB 3MWIU 3FVFB 1P06A 1FIWA 4YZUA 3M7TA 2FS8A 2A4OA 2BDBA 3UQOA 1GI9B 4X2WA 3T2NA 1KXAA 1QNJA 1RRKA 2F83A 4Q7ZA 3DFLA 1EOLA 3V12A 1RTFB 1IQLA 3TJNA 4NSYA 3SNBA 1TYNA 1G2MA 1F7ZA 1AI8H 1KDQB 2M5TA 3VXFH 2HNTE 1RTLA 1TNLA 3BTTE 3OU0A 4I31A 2ZNKH 1HRTH 1OYTH 5L6NH 2ZFTA 1O2VA 4JZEH 4JZ1A 1S81A 1H9IE 1AZZA 3GY2A 4A1XA 2P3UB 1RD3B 3DT0H 1GBIA 3AASA 3HPTB 3AW1A 4FUJA 3CP7A 4WXVA 3SJ9A 3MOCA 1TQ7B 2PWXA 1GJCB 2OC8A 4XE4A 2R0LA 3RMOH 3LOXA 3E3TA 1SFIA 1N6YA 1C5XB 1LPZB 1KLTA 3BG4B 1BTYA 3G01A 4Y11E 2BY5X 3UR9A 3OTJE 4OS7A 1MD7A 1O3PB 2O8MA 1V2QT 4IMQA 1ACBE 4ABGA 4FXGH 3U8OH 2A5AA 2H9HA 2ZDLA 3IWMA 1QTFA 2F9BH 4GVUA 1LVBA 4LZ1H 3SUEA 1G32B 1S85A 7KMEH 1AVGH 4XBCA 1UTJA 4NZQA 2ZIQH 1HAIH 1H8IH 4ZH8A 3SQEE 1FLEE 1WOFA 1CSOE 3LONA 2BOKA 5FBEA 4NWLA 3MNSA 5C5OA 3SNCA 4X1SU 4JK6A 1YPGH 1DE7H 2P95A 2SGFE 2ANMH 4MG3A 1SB1H 1C5WB 3LKWA 2W26A 3EA9A 1TPSA 1SI5H 4GAWA 3SJIA 2ODYB 4MPWA 1HUTH 4CH2B 4F49A 1WV7H 1K21H 3O8BA 1H9LB 4ABEA 1JOUB 2P93A 1TA6A 5FPTA 3VB3A 2Z9IA 3ZZ9A 2B9LA 3Q3XA 1T8MA 5GWZA 3FP6E 2BQWB 4NCYA 1OP0A 2ALVA 1O3NA 3QZQA 1BDAA 3SU0A 3AVZA 2R2MB 2VU8E 4I7YH 4U32A 1B7XB 1VCQA 2BDAA 4NIWA 1C1WH 2ZGJA 4KGAA 2PKSB 1P03A 3P17H 4JYUH 3SO3A 2CXVA 1NFXA 5EOKA 3PB1E 1BJVA 2F9NA 1CT4E 9LPRA 1TIOA 3GCOA 5AFYH 3FP7E 5DP9A 2ZDVH 4XDEA 2BD4A 1W3CA 4ZUHA 1EAWA 1O2HA 2QYIA 1VCPA 1FZZA 1HJ9A 1A0HB 1ZHPA 4I8JA 1SMFE 1BTUA 1QFKH 1QQ4A 3BSQA 1O2ZA 3TVJB 2YOLA 2FOGA 3FP8E 1GHBG 3BG8A 1HNEE 4FUDA 3RXVA 4AB9A 5LGOA 1B5GH 2WV5A 1GBCA 3UREA 3BTQE 2HOBA 4NSVA 1GL1A 1O5CB 4A1TA 1Y5AT 4MQAA 2A0QB 1DFPA 4FVDA 1HJ8A 5JBCS 2ZFQH 2BY9X 2PTCE 5DP3A 2OBOA 1MCTA 2STAE 1FAKH 1T32A 3KNXA 2QXJA 4Q7YA 1LQEA 4DURA 4X1PU 4ZKSU 4DW2U 1HAXB 1QY6A 3TH4H 5HM2A 1C5VA 3VB5A 2ALPA 3C27B 1M9UA 1P9UA 1C1OA 6ESTA 2XC5A 1UMAH 1TRNA 3VB7A 1TNIA 2R9PA 4AFSA 1P2JA 1AKSA 5A0AE 2A5KA 1AY6H 1YPHC 1DX5M 3U8TH 2FP7B 1TBQH 3T5FH 1O3KA 2PV9B 1THRH 4NIYA 2VWNA 1GGDB 2ZDKA 4YLUA 5JB9S 4IC5A 4MNYA 1O2XA 2C4FH 3BTGE 1O2UA 1BJUA 5G4BA 2C8ZB 1SG8B 1GMCG 2ZF0H 3S69A 1THPB 2FZZA 5DJ7A 2I6QA 1SSXA 2H5CA 1ZGVA 2R3YA 2QC2A 2RA0A 3LC5A 2NU2E 1LHFH 1HB0B 2J94A 3ZVDA 1ZR0A 1WCZA 4Z0KA 4IW4E 1LPGB 3A7YA 1SLUB 1TONA 3E1XB 2VIOA 1FPCH 1CHGA 1ZHMA 2BZAA 2BY6X 1TB6H 2ZGHA 3SV7A 1TOMH 1HAVB 2VVUA 4D8NA 1GI3A 2C93B 4GCHG 1BTZA 2BD5A 1D6RA 1O2NA 1YPKH 2IJOB 1XM1A 3ATKA 1TGSZ 2OC1A 2VH0A 2XCNA 3RU4E 4K60A 2W3KA 1CHOG 4Y7AA 1C1TA 4U30A 1CE5A 1O5AB 4MLFB 5I46H 3N7OA 3SNDA 2TGDA 4DJZB 1J15A 3UNRA 1O2OA 3TGJE 2AGEX 1SGQE 4WMDA 4ASHA 3VB6A 1C2KA 2Z9GA 1EB1H 1BTHH 1W11U 4NGAH 4OS5A 3GCHC 1QURH 1F5KU 1GCTC 2JETC 1GMDF 2HGTH 1SFQB 1ZTJA 3I77A 4VGCB 1TMUH 1BTPA 4NA8A 1GBDA 1NN6A 3AAVA 1NM6A 8KME2 1FN6A 1P2OA 3L33A 3M36A 4X6MA 1C4U2 1WBGB 1JXPA 3EDXB 2P8OC 4INHA 1YLDA 1EAXA 1SOTA 4JMYA 4TWWA 2VINA 1HJAC 1Q31A 1OPHB 3VGCB 4D9RA 2D26C 2G52A 3A8DA 3HATH 3AAUA 1O5EH 5IYTA 3A8AA 1GVZA 3F9FA 1VGCB 4UEHH 1C2JA 4SGAE 2UWPA 4O3UA 4E7NA 1O3DA 2ZO3H 1NRPH 1DANH 1NFYA 2VIPA 3URCA 3A84A 1NFUA 2GMTC 5TCCA 1S6HA 4ZKRU 4Q2KA 2PR3A 4A6LA 1S0QA 3QLPH 1LVOA 1T31A 2A5IA 4I8GA 2TBSA 1O30A 3T29A 1XUFA 1LMWB 3KF2A 3RXTA 2CJIA 2A2QH 1MTVA 1ZPZA 1K1MA 1TGCA 4X2XA 2FIRH 3SGQE 3STJA 1O2YA 3RXRA 3SQHE 2WINI 1NU7B 4WVPE 5BPEA 4X6NA 1HYLA 2ZG0H 3RXSA 1SBWA 2BDYA 5E2PA 2P59A 5DP5A 5FCRA 1G2LA 2GCHF 1F0UA 2O8WA 2NWNA 4IN1A 1NT1A 2PHBA 3OSYA 1RIWC 4I33A 4ISOA 3GCTG 2FI5E 3LGIA 1A3BH 5T3HA 4CRAA 2LIZA 1O35A 5K7RA 1A46H 1UK3A 2G8TA 1TLDA 2ANWA 2O8LA 4X6OA 5JYIA 1W0YH 1GVKB 2Y80A 1P04A 4DOQA 1VITG 1S0RA 2GTBA 4O9VA 1SGNE 2OQ5A 1O2GH 1TBRH 1WYKA 5E8EH 4HFPB 2VGCB 1D3PB 1EUFA 3QGJA 3TGKE 1RXPA 2WPHS 1Z71A 1HGTH 3BIVH 3T26A 4FUBA 1MTWA 4KTUA 2FTLE
chains in the Genus database with same CATH superfamily
1ZJKA 3LC3A 4BANB 1O3MA 3I78A 2ANYA 3GYLB 1DWEH 3LGUA 1O2JA 1C5UA 1ELGA 2FTMA 1O34A 1KXCA 1A5IA 4GHQA 1RTKA 2OUAA 3FKSD 1EAIA 1GBMA 1KY9A 1GMHG 3M3TA 3P8FA 2A4RA 1SQAA 2JIZD 3RXIA 1ZHRA 1PFXC 2BDCA 2ZHEH 3BN9A 3KYGA 2ILNA 4X8VH 1AB9C 3OFND 2EI7A 4IN2A 1BQYA 2G5VA 3PV2A 2AIQA 2O8UA 2WV9A 5J4QA 2W6JD 4CHAC 3RXLA 1XVMA 1CO7E 2BD9A 1C5YB 3A81A 4O3TA 1HLTH 1S6LA 5DK1A 1UTLM 2VIWA 1ETRH 1G3DA 1OX1A 1EJNA 3DSGA 1TMBH 3M5MA 1SGPE 2Y5HA 3P6ZB 1O3IA 2R0KA 5C0TA 4FUCA 2SGQE 1V2PT 1NU9A 4LK4A 3ODFA 3SI4H 1AUTC 1C1RA 3RM0H 2H6MA 3A87A 4F55A 1YPMH 2QF4A 3BEUA 5GCHF 3HK6B 1HV7A 1QJ6B 1PPEE 1C5MD 4U2WA 2BD3A 8LPRA 3ZVCA 3DD2H 1O3JA 1QBVH 4ABIA 1GBTA 1MMJN 3RXFA 1V2KT 1UHBA 5FPYA 2OXSA 4WMEA 1DWCH 1RGQA 1Y3YA 2ZPQA 3KCGH 1AE8H 3MU4A 3SV8A 3RUOA 5CMXH 2ZDAH 5DGJA 4D76A 3D65E 5A0BA 2J38A 3A7VA 4ZHLU 1C9TA 3ZZ6A 3SUGA 3M35A 3BTKE 3W1EA 1JIMA 2ZCHP 4INKA 3A8BA 3S7KB 3RU4D 3T62A 3SNEA 1O2PA 2VBCA 1EP5A 3QX5H 4QT8C 2ZC9H 1O3HA 1TFXA 3GYMA 2SGDE 1GBEA 5C2ZA 1NESE 4K5ZA 2GJGA 5C1XA 1DVAH 4B75A 1OWKA 4B71A 1NRNH 4BXWA 2ANKH 4B2CA 1P2QA 4UFDH 4CBNA 1C2IA 3JZ2B 4JYTA 3UPEA 3SU4A 4BAHB 3BG4C 2AH4X 3GDSA 1C1VH 1OP2A 1UK2A 1Z8GA 3KQCA 1BOQA 3SU2A 2QA9E 3GCNA 3MU8A 1AD8H 3RXHA 1QB9A 3SJOA 3ZZCA 3V3MA 1P05A 5ESTE 5HIZA 3QUMP 1EQ9A 2ZWLH 4IBLH 3E16B 2JJ2D 3PV5A 4FU9A 4Q7XA 4Y79A 3ZIAD 3TU7H 4AZ2B 2HRVA 2PSXA 3S9CA 2W7UA 1XUJA 2P94A 4OS2A 2BB4A 2HNTF 1LDTT 4R8TB 1N6XA 8GCHG 2TGPZ 1K1OA 1V2MT 3A82A 5B6LA 1QR3E 2VWLA 4FUFA 1A5GH 1O31A 1GI7B 1P3CA 1WTGH 3TJUA 2F9UA 3LGTA 3RMNH 1BITA 1KYNA 2HLDD 1QCPA 1N8OB 4TY7A 3T28A 4DGJA 3UNQA 3ODDA 4AGJA 1DY9A 1T8LA 5GPIB 2D1JA 3MO6A 3MO3A 2A4QA 2ZFFH 1HAHH 3VEQB 1TRYA 4Y10E 5C1YA 4ZHMU 3MTYA 1AQ7A 3E90B 2WHXA 1P8VC 3ZZ8A 1UVOA 4FETA 1VR1H 5HM9A 2Y6TA 2PGBB 4YO9A 1P01A 4X8SH 5EG4A 1FXYA 5EQQA 1O3BA 1BHXF 1ID5H 5FX5A 3PRBA 2Q6GA 3BIUH 1XKBC 4IMZA 2ZHWH 3U1IB 4R0IA 2F3CE 3TITA 3KGPA 5EPYA 2PKSC 1QBOA 1QRWA 1ZPBA 2FOAA 2HPPH 4OGYA 1SQOA 1QL7A 7GCHF 3BTWE 3STIA 2TGAA 3K2UA 1IQHA 1P09A 2QXHA 5HMAA 4WH8A 2BDGA 1BBRH 2F9OA 1HPGA 3SHCH 4WF8A 2BYAX 4WXIA 2WYGA 2OTVA 1C2GA 3VB4A 1EX3A 1TBZH 4FUIA 5A2MH 2XYAA 3TNTA 3A85A 1FV9A 2ZHFH 1LKAA 2BDHA 1LVYA 1P2NA 1CBWB 2KFWA 4I8KA 5CE1A 1HIAB 1P57B 2XWBI 3VFEA 3F2FA 2W7SA 2AIPA 3HGNA 3TK6A 2GDEH 2YNAA 3M5NA 1NS3A 4CRCA 1C1PA 3PROA 1FJSA 1KLJH 4RT1A 1TGNA 1W10U 3NXPA 1K22H 1TOCB 1GJ9B 1DWBH 4LZ4B 4YOGA 1QRZA 3PLBA 3ZVEA 1O2LA 2ZI2H 2OC7A 2VWMA 5E0HA 1EPTB 2W6ID 3U9AH 1VCWA 2WYJA 4YTAA 1A2CH 2FO9A 2FOCA 1W0JD 5B6OA 4UDWH 1E35B 1D6WA 1NPMA 1HXEH 1O3AA 1P2KA 3Q3YA 1TX8A 1YCPH 5F8XA 1H9HE 2CF9H 5T1VA 2STBE 1UVPA 4WMFA 2AFQB 3HKIB 1ZSKA 2K1QA 3MQKC 1BMMH 1PQAA 3TGIE 2UUJB 1PPFE 1DY8A 1GI1A 2KCAA 4AFZA 1Y3VA 1J16A 1E38B 1YLCA 3PWBA 3F2HA 3RXDA 3ZVAA 5FPSA 2GZ9A 2ZFSA 2Z9LA 2GT8A 2ZU2A 2FPZA 1C1NA 2OCVB 4BAKB 1CA8B 1AWFH 3S9AA 5LPFA 3MNBA 3UUZA 2F91A 1GDNA 1SLVB 4FVBA 2SFAA 2EY4C 1GHBF 3P70B 2FLBH 3V0XA 2ULLA 1YPHE 1KDQA 1GGDC 5I25A 2BZ6H 1RS0A 2TIOA 1FY5A 1NY22 1JBUH 1LPKB 1C5PA 1S82A 1ZMJA 1D3QB 2WPJS 4JZFH 3V13A 3LIWA 4DCDA 1MZDA 1TALA 5DN6D 2TGTA 4ZKNU 3MU0A 3ZZ7A 1OOKB 1GI2A 1G3CA 1MU8B 1F2SE 3RC6A 1ABIH 3PMBB 3NCLA 2ZU3A 4YXWD 5HGGA 1NTPA 5CHAB 2Q6FA 2YMSC 1LO6A 2VIVA 4BOHA 4NIXA 3RXQA 5ETXA 3ZVFA 3TPIZ 3GY4A 1FAXA 3A86A 1OSSA 1GCDA 4HTCH 3U1JB 1O2SA 1V2TT 1Q2WA 1C1QA 3V7TA 4FUEA 1MTSA 4JK5A 1A61H 2SNWA 1PQ8A 3ATLA 1F0SA 5KECA 1KLIH 2P3TB 5A8XA 3DUXH 1GI5A 4X8TH 1V3XA 1XUGA 1BBRK 3A89A 1ELTA 3ITIA 3W95A 1SGRE 1PPHE 1NFWA 1ANEA 1D9IA 1NRQH 2F9PA 1G36A 2G55A 4E05H 1AIXH 3S0NA 3F68H 1YM0A 2J2UA 1T4VH 4CRDA 1HIAA 4Y0ZE 3VXEH 1BHXB 3MHWU 1GDUA 1GHXH 1JMOH 2ZDNA 1QIXB 4DVAU 2GKVE 4RN6A 1C2HA 2XBYA 4JZIA 1ETSH 2AEIH 1LKBA 1BBRE 1EPTA 4VGCC 1VITH 1P12E 2YNBA 4ISHH 4P02A 2IN2A 3BF6H 1AN1E 4NZLA 1L2EA 3RC5A 3BTEE 3WY8A 5JB8S 3MH5A 2AMDA 5LH8A 1GHYH 1TGBA 1VKYA 1YCPK 2BDIA 4MNWA 3VGCC 1W13U 4GCHF 1LHDH 2AHME 1PYTC 3FZDA 2A1DB 1IQNA 3OAAD 3BTHE 1VGCC 1EAUA 3SW2B 3EGKH 2ZTZA 1V2OT 3OY5U 4HG6A 4UFEH 4Y8YA 2M2AA 1CHOF 4D7FA 1SPJA 2C3SA 1TAWA 2ZPSA 1LHEH 3EYDA 3IITA 1QZ8A 3FAOA 1WDIA 1BTXA 1PPZA 2BY8X 3SN8A 2NU3E 1UCYH 2ZQ1A 4ZKOU 2GV7A 3LJOA 3DSPA 1GDQA 3M7UA 3GY8A 5F8ZA 2A4GA 1BT7A 3KN2A 1G37A 6LPRA 4ABHA 3B23B 2ESTE 1ZJDA 2FM2A 1C2MA 1PPCE 1ZSJA 4OS4A 1K1JA 1QHRB 3E8LA 3NRLA 1E36B 2ZKSA 5PTPA 1GBAA 1QQUA 5IDKA 2DE9A 3M5OA 4YLQH 3I29A 1AVWA 1O3GA 5KEDA 1O5BB 1VJAU 2A7CA 2PTNA 1E1RD 1LHGH 4AYYB 3RDZA 3ZZ3A 1SGFG 1TNKA 3P8GA 3A7XA 1A3EH 3K65B 3PWCA 3SNAA 1HAPH 1BRUP 2Y5FA 1ARBA 1MTNC 2CGAA 1HDTH 1SVPA 5C94A 2WSSD 1C4Y2 1LVMA 3SGAE 1XXDA 4GSOA 1TWXB 3DFJA 5CDFE 2J98A 2QXGA 2QY0B 3K6YA 2G51A 5DP6A 6GCHG 5EJLA 2BTCE 2PSYA 4PROA 1Y3UA 4K1SA 2R2WU 1TA2A 2FODA 1DXWA 2KZ4A 5C20A 1GJBB 4Y76A 1HAYB 3E6PH 3RXCA 2BOHB 1HFDA 3M3SA 2AS9A 1K1PA 3A88A 1EP6A 9ESTA 1SOZA 1GI8B 4AFQA 3UOPA 5EW2H 1QRXA 3NZIA 1YCPM 5HXFA 2B0FA 2VGCC 1GMDG 5C5NA 1GPZA 3MU1A 3QWCH 2ZDMA 2V3HH 2UUYA 1K28D 4XD7D 4I8HA 1QB1A 4JCNA 4X2YA 1C1SA 4NFEA 4NA9H 3TK9A 2FOEA 3U8RH 1J17T 4B6EA 1Z1JA 2W3IA 1GVLA 2FX4A 1QJ1B 1DSTA 1GHZA 2G5NA 3RXGA 1INCA 1HAZB 1GG6B 2CMYA 1MUEB 2XTTB 3GCTF 6CHAB 1MQ5A 4GPGA 3Q00A 1NRRH 1KTSB 4DG4A 1BTWA 3RXEA 1Q3XA 1XVOA 1MAYA 4DIHH 4NIVA 1D3TB 2H2ZA 1MTNB 1DOJA 1MTUA 1DDJA 2Z3DA 2GP9B 4O03A 4WJG2 1VITF 3E0NB 5EU8A 3KL6A 5FXLA 1SLWB 2AGIX 4TYDA 5C3NA 4NWKA 3QK1A 2Z3EA 3RXMA 3UWIA 2ZU4A 2RCEA 2ZU1A 3GISB 3HGPA 3GICB 1HAVA 1GJAB 1TQ0B 2FI3E 1SLXB 4ABAA 4I8LA 1FPHH 1UW7A 2O9QA 3LDXH 1O2IA 4K2YA 1CGIE 2J5UA 4UD9H 4XSKU 1AE5A 1UCYK 3UFAA 3QO6A 1EZQA 1IQMA 1TX7A 1W2KH 4SGBE 3O8RA 4CREA 4AB8A 5L30H 1TGTA 1DPOA 1BMAA 3RXKA 4ZROA 4ZAEA 3Q3KA 4FU7A 1O2WA 2ZECA 3RC4A 3D62A 1VJ9U 1UTNA 1NC6A 1AVXA 2BLWA 3GOVB 5JBBS 4BNRA 3MMGA 1Z6EA 2GCHG 4I32A 3DSOA 4P00A 3RU4T 1WQSA 2KCYA 3KQBA 2RDLA 4X2VA 5GIBA 3ZYEA 4KELA 4ZXYH 1MD8A 1E0FD 4MPUA 1AFQB 2J92A 4AN7A 1C5NH 5C67A 1UCYE 1FY4A 3M3VA 1BIOA 1GI0A 4MNXA 1UTPA 3QTVH 5DP7A 1EOJA 1BRAA 1GBKA 2WPIS 3LGWA 4Y71A 1DSUA 5F8TA 4WY3A 1HBTH 2HPQH 3TH2H 4CBOA 1ANDA 2Z3CA 2C8XB 1BZXE 3SBKA 1S6FA 3S7HB 1EZUC 3GY5A 3QTOH 4LOYH 3FFGA 2J4IA 2WV4A 3H5CB 1CT2E 3QDZB 1CVWH 3PTNA 2NU0E 4XBBA 1O33A 1ORFA 1GHVH 2JDID 2BXUH 2WPKS 2BQ7B 1GI6A 1O3FA 4BTUB 2KM0A 5JDUB 4UFFH 1NRSH 4WWYA 2H5DA 1FONA 5FL7D 2ZQ2A 3OYPA 3URDA 5EXMA 1O2TA 1O2RA 2JH6D 3KQEA 1G3BA 3FO8D 1DM4B 4K69A 3EQ0H 3M61U 3NK8A 4A1VA 1V2NT 2WZQA 3SJKA 1E1QD 2VJ1A 1AGJA 1ZLRA 2FS9A 2A32A 1C5ZB 3PMJA 1O32A 2F43B 4GLYA 4AFUA 1GI4A 2EI8A 2WPLS 1ELDE 3SUDA 1A0LA 5EQRA 2Z9KA 1ESAA 2XW9A 1N8OC 2H1UA 3SOSA 2F4LA 3LJJA 1SGEE 5FAHA 3HK3B 3RMMH 5F53A 4Y0YE 1Z1IA 1PPBH 3BTDE 1CA0B 1E37B 1GHAG 5EXLA 1AFEH 4BAQB 1P9SA 2V7QD 1P2MA 3M5LA 4X1RU 1UVSH 2SGPE 3Q77A 2FESH 4HGCA 5DG6A 1FN8A 1B0FA 5E2OA 1SGTA 1ANCA 1UVUH 1W14U 3E0PB 2J9NA 1ARCA 3SI3H 7LPRA 2EC9H 2BVRH 2GGVB 2ZTYA 3A7TA 4CRFA 1MBMA 1UTQA 2BLVA 1O2QA 3N99A 2BLOA 4OS1A 3A7WA 1MCVA 1GBHA 4X1QU 3M37A 3EA8A 2Q1JA 4BXSA 4YT7H 2XC4A 8GCHF 1DXPA 1FUJA 2CF8H 2FYQA 3LGYA 1W0ZU 4J2YB 3HKJB 2HWLB 1KXFA 1GBFA 8ESTE 1O3OA 4RKOB 5FCKA 3F6UH 2VH6A 2A31A 1KIGH 4X1NU 4Y8ZA 1MKXH 5C17A 4UE7H 1P02A 2JH0D 5JBAS 5TJXA 3UIRA 1SGFA 2FYRA 5DSFA 1C5QA 3F1SB 3UWJH 2XXLA 2H9TH 1J8AA 1CBWC 2OD3B 1IQJA 3DA9B 3DHKH 3LPRA 1SC8U 1G30B 2BVXH 4NA7A 2KAIB 3K6ZA 1GBBA 1EXFA 4M7GA 3SGBE 2Q6DA 3TJVA 5C1UA 4HZHA 4IS5A 4TY6A 5LPEA 2AERH 1W7GH 5E0GA 2GCTB 3OE7D 2UWLA 3KEEA 1XUKA 1F0TA 5A09A 2PFEA 1EPTC 3F3BA 3ZVGA 3ZZ5A 1Y5BT 1ZYOA 4AG1A 1EB2A 1P11E 1Y3XA 1QJ7B 1AWHB 3QGNB 1ELVA 1UTKA 1DITH 1WAYB 2NU1E 4B2BA 4ESTE 5EODA 1JRTA 3OX7U 3AW0A 1PQ7A 1Z8RA 2Y82A 1FIZA 5EPNA 1IQIA 5HYOA 1MKWH 3A80A 1OWEA 2IJD1 2CHAB 2BD2A 4MDSA 4K8YA 1FI8A 4JYVH 3RXOA 2K7XA 5JPMH 2UUKB 1K1IA 1YF4A 1J9CH 1ZSLA 3PLKA 4B76A 4DT7B 1A4WH 2XNIA 1TABE 1TX6A 1TNJA 3N7EA 1L4ZA 1TNGA 4BAOB 2FDAA 4NG9H 1HAGE 1YC0A 1L1JA 1Z8IB 2GX4A 3PV4A 5AF9H 3SJ8A 5ABWA 3GY6A 2V0BA 4Q80A 3F9GA 5FBIA 3MNCA 2XWAA 3F2GA 2F9VA 4AG2A 2V35A 2V3OH 2Y7ZA 3JZ1B 1D3DB 1ESTA 2RA3A 2BHGA 1TPAE 2VIQA 1U6QA 4J1YA 1K1LA 2ASUB 3UTUH 3O8DA 5EGMA 1NBME 1LCYA 1L0ZA 4DIIH 3MO9A 2V6NA 3NWUA 2QV1A 1B0EA 5CHAC 7GCHG 1AKSB 1FY8E 3SZNA 2GV6A 4CH8B 2C8YB 4X0WU 2HNTC 1OKXA 3MFJA 2QF0A 1MBQA 1C2DA 2ZTXA 1HAOH 4ISIH 1D4PB 3KHVA 4K8BA 1MAXA 5AHGH 1DUAA 2UWOA 1O2MA 2PUQH 2PLXA 3MYWA 2THFB 2WPMS 2GVFA 3QZRA 3BTME 4TT3D 3FZZA 1V2RT 4Q4LA 4MPVA 3SYJA 1IAUA 2XCFA 2EEKA 2ZCKP 1MKXK 4RSPA 3P8OA 2A2XH 1N1LA 2K0QA 4AGKA 2Z6BD 3VPKA 2ODQA 1Y5UT 1P2IA 4MPXA 5EJ1A 3PTBA 2QCYA 5GDSH 1SL3A 1EASA 5GXPA 2KAIA 4OM9A 1T4UH 2R3UA 3CS7A 2ZA5A 1C2EA 2DUCA 1YP9A 3MNXA 1AMHA 5H4IB 2ODPA 2J95A 4E06H 1ZZZA 2ZGXH 2VIDA 1TPPA 3LT3A 4THNH 1O3EA 4B74A 1SHHB 2FWWA 3D49H 3BEIB 1Y3WA 5AVDA 1S84A 1C5OH 1ELBA 1QGFA 1YBWA 1O37A 5A8ZA 5GNDA 1V2ST 3U98H 2FOHA 2BLQA 1UJ1A 2FLRH 4OS6A 1MH0A 3BEFB 1MQ6A 1IQGA 1IQKA 3S9BA 2FMJA 4TWYA 2FX6A 1MKWK 1V2UT 5A0CA 1DT2A 2ZFPH 3EE0B 3KIDU 5L2ZH 2XBVA 3SU1A 5GJ4B 2FXRA 3C1KA 1EJMA 4B73A 1IHSH 2BY7X 1PJPA 1EZXC 4ZCNA 5SGAE 5ESBA 1AHTH 2VWOA 3M7QA 1Z8JB 2PW8H 3SUFA 3F0PA 1YPEH 2D8WA 2ZPRA 1NZQH 1QL9A 1FDPA 2QGRA 4X6PA 2Z94A 1E79D 3ESTA 2PP6A 3CS0A 1TNHA 1EZSC 3MI4A 4ISLA 3H7TA 4K1EA 3MH6A 1GMCF 1TMTH 1F0RA 1F5LA 1A1RA 5F03A 1SKYE 4FUGA 1DS2E 3UR6A 3ZVBA 1L1GA 4U01A 1FQ3A 3P95A 3TH3H 4BAMB 3TJOA 3OTPA 3R0FA 4F4OC 2OLGA 4UFGH 3MH7A 3GY3A 2BD8A 5J4SA 1YKTA 4E7RG 4BTTB 1C2LA 1ELAA 3ELAH 4WH6A 1CU1A 4FU8A 5E0JA 2ZGBH 5JBTA 2JJ1D 1W7XH 1EATA 1UO6A 2QIQA 4AOQA 2ZEBA 3N7DA 1C4V2 2QN5T 4KKDA 1A5HA 2FOBA 1FNIA 4H6TA 2QF5A 1E34B 1OWIA 1HCGA 1TPOA 3A83A 1V2VT 3FANA 3RLYH 1BUIA 4Y8XA 2A7JA 1Y8TA 1C1UH 1VZQH 1H4WA 2GZ7A 1YY3A 2FOFA 3LGVA 1LQDB 2P3FH 1V2WT 1SGIB 2WUCA 5CHBA 1LTOA 3SU6A 2AMQA 1O5FH 2FOMB 1BMLA 3MH4A 1ELCA 1UK4A 2BXTH 2I6SA 3NUMA 1OS8A 3SORA 1T8NA 1A0JA 1UTMA 3ENSB 3RXAA 2GDDA 1DUEA 4JZDH 5TCAA 3ATWA 1J14A 1C5LH 1BA8B 1XUHA 1AZ8A 1PQ5A 4HI3A 2PUXB 2ZP0H 1G9IE 1IQFA 2HALA 1C2FA 1GG6C 3T27A 4INLA 1V6DA 1KXDA 6CHAC 3ZYDA 2O8TA 2ZHDA 1OWDA 1V2JT 2FI4E 3SV6A 1P3EA 3BTFE 1T8OA 5L2YH 6GCHF 2ZU5A 1RJXB 1ETTH 2SGAA 4B2AA 3O8CA 1UVTH 3H7OA 4AX9H 3CENA 4CRBA 1QB6A 1MABB 1K0HA 2C8WB 3D23A 2IPHA 3SU3A 2Z9JA 1GJ5H 2VVCA 1LHCH 1H1BA 1YPLH 3OEHD 2AYWA 1CGHA 1W0KD 3P92A 3UOUA 2IOTA 1OYQA 4GHTA 1ZMNA 2RG3A 1ZRKA 5EXNA 2LPRA 2ZGCA 4YOJA 2FEQH 1TE0A 2XBWA 1PPGE 2EA3A 4FUHA 7ESTE 2XRCA 1L4DA 3EA7A 1SQRA 1FY3A 3ZV8A 1GBJA 2G00A 5FHTA 2GD4B 2SGEE 1Y59T 3L6PA 3ZZAA 4A5TS 4ABJA 2J34A 4IGDA 3NKKA 1CQQA 3F9EA 2HLCA 5DPAA 4D9QA 1CT0E 3B9FH 3L3TA 1BCUH 4MTBA 2VB0A 1EJAA 1AFQC 1DWDH 2A45B 5T6FA 3UY9A 2OP9A 2J97A 5IK2D 4ABBA 1GL0E 3PM3A 3F9HA 1ELFA 4AORA 1GJ6A 1GBLA 2AGGX 3B8JA 3LU9B 4K3JA 2G4UA 2W5EA 1GJ8B 2KCOA 1F92A 4H4FA 4ISNA 1ZTKA 1SQTA 2CV3A 3GDVA 4AYVB 4IC6A 4KTSA 2OBQA 4A7IB 3RM2H 1BRBE 3RMLH 4CR5A 3NPSA 1O5DH 1K9OE 1UHBB 4MVNA 2QAAA 1L1NA 3GCHB 5T6DA 4CR9A 2WUBA 1A7SA 2XC0A 1GCTB 2JETB 4CRGA 1NO9H 1OWHA 3EBNA 1GJDB 1YPJH 2BD7A 3RXJA 4TPYA 1WUNH 4BTIB 1XX9A 1K1NA 1C5RA 4A92A 5BRRE 1C5SA 3PYHA 1COWD 3TNSA 3GDUA 2P8OB 1RFNA 2GT7A 3TK5A 1O5GH 1HJAB 4GUXA 4KP0A 1KMHB 3PMAB 4Y7BA 5AFZH 3SZEA 5F6MA 2LP6A 2KR7A 1O3LA 1OP8A 3RLWH 1WU1A 1GMHF 1O36A 1KXBA 1QA0A 2XOKD 4ZXXH 1DICA 1ESBA 1PYTD 1XXFA 2HVXA 1BMNH 3QN7A 3ZZBA 1GHWH 1FY1A 4YT6H 1C5TA 1DLKB 2GMTB 2BVSH 3PO1C 1H8DH 1O38A 1AO5A 2ZZUH 1SGCA 3LH3A 4K1TA 1P0SH 4ABFA 3SV2H 2Y7XA 1C1MA 3U69H 1NROH 2SNVA 2UUFB 4LXBH 1CA0C 2LNCA 1OHHD 2PKAB 4UONA 5LPRA 1JWTA 4X8UH 2G81E 1TRMA 1Z7KA 1O0DH 2VNTA 3ATMA 2L6OA 1GJ7B 3EAJA 3E91A 2B7DH 2TPIZ 1QBNA 5A8YA 2D2DA 2ZCLP 4ZMAH 3T25A 1AUJA 1AU8A 2PGQB 1F5RA 1ZTLA 3A7ZA 2JH5D 5HIYA 1WXRA 2WPDD 5EW1H 4B1TA 1ZGIA 4D7GA 1S5SA 1SGDE 4Z1MD 3K9XB 2QXIA 1RIWB 2CN0H 1ABJH 2LELA 3SHAH 1JIRA 2ZFRH 1SR5C 2K8IA 3UQVA 1SGYE 1OXGA 2G4TA 3SU5A 1W12U 1YLNA 3RP2A 2TRMA 5HKKD 4Z6AH 2H9EH 2GZ8A 2JKHA 5DP4A 3RXUA 3ZZ4A 2BM2A 1WTHD 3U28C 2BX3A 1G3EA 2OC0A 1P10A 1GHAF 1C9PA 5DO4H 3OY6U 4YESB 5T6GA 2VVVA 4TPIZ 1O39A 4H42U 3KQDA 1X7AC 4DT4A 1MZAA 3PO1B 1FMGA 2P16A 1DLEA 5K0HA 1WQVH 1XMNB 2XBXA 4NFFA 4KTCA 3GY7A 1HXFH 1IHTH 3LH1A 5EQSA 3PLPA 3RXPA 2GCTC 1CGJE 1YYY1 4ABDA 2AMPA 3SV9A 5GCHG 3ATIA 1XKAC 2B8OH 1Z6JH 2NU4E 4DY7B 1ELEE 2B5TB 4M9FA 3ZV9A 1S83A 1JRSA 2BQ6B 2OINA 4ZHAA 2QF3A 1W8BH 1EKBB 1O2KA 2EI6A 4I86A 2C90B 2BX4A 2BMGB 4XBDA 4XFQA 4TSFD 1KSNA 4H6SB 1KXEA 2Z7FE 1QA7A 1AB9B 1BB0B 3BV9B 1ZPCA 1GWAA 3P8NA 3W94A 3TIUA 1T7CA 1ZOMA 2CHAC 1YGCH 1XUIA 1ZMLA 2A7HA 4CHAB 1QL8A 3Q76A 4RT0A 2Y81A 3A8CA 3IG6B 4ACAA 5FX6A 1UTOA 3TLOA 4YM9A 2DE8A 4MNVA 3PMHB 1K2I1 2ZHQH 3R3GB 3MU5A 3CNRA 1O3CA 2Y5GA 3ZZDA 2OQUA 1SHYA 4O97A 5DKMA 1OWJA 4Y6DA 4RKJB 1WSSH 1ZRBA 4XOJA 1V2LT 1GJ4H 1IQEA 1MU6B 5DP8A 3RXBA 3UNSA 1BRCE 4OGXA 2PKAA 1IOEA 1ANBA 4YOIA 1THSH 1KTTB 3MWIU 3FVFB 1P06A 1FIWA 4YZUA 3M7TA 2FS8A 2A4OA 2BDBA 3UQOA 2L74A 1GI9B 4X2WA 3T2NA 1KXAA 1QNJA 1RRKA 2F83A 4Q7ZA 3DFLA 1EOLA 3V12A 1RTFB 1IQLA 3TJNA 4NSYA 3SNBA 1TYNA 1G2MA 1F7ZA 1AI8H 1KDQB 2M5TA 3VXFH 2HNTE 1RTLA 1TNLA 3BTTE 3OU0A 4I31A 2ZNKH 1HRTH 1OYTH 5L6NH 2ZFTA 1O2VA 4JZEH 4JZ1A 1S81A 1H9IE 1AZZA 3GY2A 4A1XA 2P3UB 4XRNA 1RD3B 3DT0H 1GBIA 3AASA 3HPTB 3AW1A 4FUJA 3CP7A 4WXVA 3SJ9A 2XNDD 3MOCA 1TQ7B 2PWXA 1GJCB 2OC8A 4XE4A 2R0LA 3RMOH 3LOXA 3E3TA 1SFIA 3WW7A 1N6YA 1C5XB 1LPZB 3VG8A 1KLTA 3BG4B 1BMFD 3WWFA 1BTYA 3G01A 4Y11E 2BY5X 3UR9A 3OTJE 4OS7A 1MD7A 1O3PB 2O8MA 1V2QT 4IMQA 1ACBE 4ABGA 4FXGH 3U8OH 2A5AA 2H9HA 2ZDLA 3IWMA 1QTFA 2F9BH 4GVUA 1LVBA 4LZ1H 3SUEA 1G32B 1S85A 7KMEH 1AVGH 4XBCA 1UTJA 4NZQA 2ZIQH 1HAIH 1H8IH 4ZH8A 3SQEE 1FLEE 1WOFA 1CSOE 5EJZA 3LONA 2BOKA 5FBEA 4NWLA 3MNSA 2KX4A 5C5OA 3FOAA 3SNCA 4X1SU 4JK6A 1YPGH 1DE7H 2P95A 2SGFE 2ANMH 4MG3A 3KYFA 1SB1H 1C5WB 3LKWA 2W26A 3UB0A 3EA9A 1TPSA 1SI5H 4GAWA 3SJIA 2ODYB 4MPWA 1HUTH 4CH2B 4F49A 1FX0B 5KGOA 4AC9A 1WV7H 1K21H 3O8BA 1H9LB 4ABEA 1JOUB 2P93A 1TA6A 5FPTA 5EIYA 3VB3A 2Z9IA 3ZZ9A 2B9LA 3Q3XA 1H8ED 1T8MA 5GWZA 3FP6E 2BQWB 4NCYA 1OP0A 2ALVA 1O3NA 3QZQA 1BDAA 3SU0A 3AVZA 2R2MB 2VU8E 4I7YH 4U32A 1B7XB 1VCQA 2BDAA 4NIWA 1C1WH 2ZGJA 4KGAA 2PKSB 1P03A 3P17H 4JYUH 3SO3A 2CXVA 1NFXA 5EOKA 3PB1E 1BJVA 2F9NA 1CT4E 9LPRA 1TIOA 3GCOA 5AFYH 3FP7E 5DP9A 2ZDVH 4XDEA 2BD4A 1W3CA 4ZUHA 1EAWA 1O2HA 2QYIA 1VCPA 1FZZA 1HJ9A 1A0HB 1ZHPA 4I8JA 1SMFE 1BTUA 1QFKH 1QQ4A 3BSQA 1EFRD 1O2ZA 3TVJB 2YOLA 2FOGA 3FP8E 1GHBG 3BG8A 1HNEE 4FUDA 3RXVA 4AB9A 5LGOA 1B5GH 1YWUA 2WV5A 1GBCA 3KQ5A 3UREA 3BTQE 2HOBA 4NSVA 1GL1A 1O5CB 2EQNA 4Q63A 4A1TA 1Y5AT 4MQAA 2A0QB 1DFPA 4FVDA 1HJ8A 5JBCS 2ZFQH 2BY9X 2PTCE 5DP3A 2OBOA 1MCTA 2STAE 1FAKH 4B6FA 1T32A 3KNXA 2J98B 2QXJA 4Q7YA 1LQEA 4ASUD 4DURA 4X1PU 4ZKSU 4DW2U 1HAXB 1QY6A 3TH4H 5HM2A 1C5VA 3VB5A 2ALPA 3C27B 1M9UA 1P9UA 1C1OA 6ESTA 2XC5A 1UMAH 1TRNA 3VB7A 1TNIA 2R9PA 4AFSA 1P2JA 4ACBA 1AKSA 5A0AE 2A5KA 3UAIC 1AY6H 1YPHC 1DX5M 3U8TH 2FP7B 1TBQH 3T5FH 1O3KA 3AK5A 2PV9B 1THRH 4NIYA 2VWNA 1GGDB 2ZDKA 3GS9A 4YLUA 5JB9S 4IC5A 4MNYA 1O2XA 3PRDA 2C4FH 2V3MA 3BTGE 4RI0A 1O2UA 3WWBA 1BJUA 5G4BA 2C8ZB 1SG8B 1GMCG 2ZF0H 3S69A 1THPB 2FZZA 2RDEA 5DJ7A 2I6QA 1SSXA 2H5CA 1ZGVA 2R3YA 3DCLA 2QC2A 2RA0A 3LC5A 2NU2E 1LHFH 2YMSB 1HB0B 2J94A 3ZVDA 1ZR0A 1WCZA 4Z0KA 5C0UA 4IW4E 1LPGB 3A7YA 1SLUB 2RFKC 1TONA 3E1XB 2VIOA 1FPCH 1CHGA 1ZHMA 2BZAA 2BY6X 1TB6H 2ZGHA 3SV7A 1TOMH 1HAVB 2VVUA 4D8NA 1GI3A 2C93B 4GCHG 1BTZA 2BD5A 1D6RA 1O2NA 1YPKH 2IJOB 2IPQX 3H09A 1XM1A 3ATKA 1TGSZ 2OC1A 2VH0A 2XCNA 3RU4E 4K60A 2W3KA 1CHOG 4Y7AA 1C1TA 4U30A 1CE5A 1O5AB 4MLFB 5I46H 3N7OA 3SNDA 2TGDA 4DJZB 1J15A 3UNRA 1O2OA 3TGJE 2AGEX 1SGQE 4WMDA 4ASHA 3VB6A 1C2KA 2Z9GA 1EB1H 1BTHH 1W11U 3F0OA 3OEED 4NGAH 3GCHC 4OS5A 1QURH 1F5KU 1GCTC 2JETC 1GMDF 2HGTH 1SFQB 4FOUC 1ZTJA 3I77A 4VGCB 1TMUH 1BTPA 4NA8A 1GBDA 1NN6A 3AAVA 1NM6A 8KME2 1FN6A 1P2OA 3L33A 3M36A 1NBMD 4X6MA 1C4U2 1WBGB 1JXPA 3EDXB 2P8OC 3FN8A 4INHA 1YLDA 1EAXA 1SOTA 4JMYA 4TWWA 2VINA 1HJAC 1Q31A 1OPHB 3VGCB 4D9RA 2D26C 2G52A 2YMSD 3A8DA 3HATH 3AAUA 1O5EH 5IYTA 3A8AA 1GVZA 3F9FA 1VGCB 4UEHH 1C2JA 4SGAE 4F48B 2UWPA 4O3UA 4E7NA 1O3DA 2ZO3H 1NRPH 1DANH 1NFYA 2VIPA 3URCA 3A84A 1NFUA 2GMTC 5TCCA 1S6HA 4ZKRU 4Q2KA 2PR3A 4A6LA 1S0QA 2KCPA 3QLPH 1LVOA 1T31A 2A5IA 4I8GA 2TBSA 1O30A 3T29A 1XUFA 1LMWB 3KF2A 3RXTA 2CJIA 2A2QH 1MTVA 1ZPZA 1K1MA 1TGCA 4X2XA 2FIRH 3SGQE 3STJA 1O2YA 3RXRA 3SQHE 2WINI 1NU7B 4WVPE 5BPEA 4X6NA 1HYLA 2ZG0H 3RXSA 1SBWA 2BDYA 5E2PA 2P59A 5DP5A 5FCRA 1G2LA 2GCHF 1F0UA 2O8WA 2NWNA 4IN1A 1NT1A 2PHBA 3OSYA 1RIWC 4I33A 4ISOA 3GCTG 2FI5E 3LGIA 1A3BH 5T3HA 4CRAA 2LIZA 1O35A 5K7RA 1A46H 1H8HD 1UK3A 2G8TA 3EE7A 1TLDA 2ANWA 2O8LA 2OK5A 4X6OA 5JYIA 1W0YH 1GVKB 2Y80A 1P04A 4DOQA 1VITG 1S0RA 2GTBA 4O9VA 1SGNE 2OQ5A 1O2GH 2CK3D 2QE7D 1TBRH 1WYKA 5E8EH 4HFPB 2VGCB 2HVYB 1D3PB 1EUFA 3QGJA 3TGKE 1RXPA 2WPHS 1Z71A 1HGTH 3BIVH 3T26A 4FUBA 1MTWA 4KTUA 2FTLE
chains in the Genus database with same CATH topology
1ZJKA 3LC3A 4BANB 1O3MA 3I78A 2ANYA 3GYLB 1DWEH 3LGUA 1O2JA 1C5UA 1ELGA 2FTMA 1O34A 1KXCA 1A5IA 4GHQA 1RTKA 2OUAA 1EAIA 1GBMA 1KY9A 1GMHG 3M3TA 3P8FA 2A4RA 1SQAA 3RXIA 1ZHRA 1PFXC 2BDCA 2ZHEH 3BN9A 2ILNA 4X8VH 1AB9C 2EI7A 4IN2A 1BQYA 2G5VA 2AIQA 2O8UA 5J4QA 4CHAC 3RXLA 1XVMA 1CO7E 2BD9A 1C5YB 3A81A 4O3TA 1HLTH 5DK1A 1UTLM 2VIWA 1ETRH 1G3DA 1OX1A 1EJNA 1TMBH 3M5MA 1SGPE 2Y5HA 3P6ZB 1O3IA 2R0KA 4FUCA 2SGQE 1V2PT 1NU9A 4LK4A 3ODFA 3SI4H 1AUTC 1C1RA 3RM0H 2H6MA 3A87A 1YPMH 3BEUA 5GCHF 3HK6B 1HV7A 1QJ6B 1PPEE 1C5MD 4U2WA 2BD3A 8LPRA 3ZVCA 3DD2H 1O3JA 1QBVH 4ABIA 1GBTA 1MMJN 3RXFA 1V2KT 1UHBA 5FPYA 2OXSA 4WMEA 1DWCH 1RGQA 1Y3YA 2ZPQA 3KCGH 1AE8H 3MU4A 3SV8A 3RUOA 5CMXH 2ZDAH 5DGJA 4D76A 3D65E 5A0BA 2J38A 3A7VA 4ZHLU 1C9TA 3ZZ6A 3SUGA 3M35A 3BTKE 1JIMA 2ZCHP 4INKA 3A8BA 3S7KB 3RU4D 3T62A 3SNEA 1O2PA 1EP5A 3QX5H 4QT8C 2ZC9H 1O3HA 1TFXA 3GYMA 2SGDE 1GBEA 5C2ZA 1NESE 4K5ZA 5C1XA 1DVAH 4B75A 1OWKA 4B71A 1NRNH 4BXWA 2ANKH 4B2CA 1P2QA 4UFDH 4CBNA 1C2IA 3JZ2B 4JYTA 3UPEA 3SU4A 4BAHB 3BG4C 2AH4X 3GDSA 1C1VH 1OP2A 1UK2A 1Z8GA 3KQCA 1BOQA 3SU2A 2QA9E 3GCNA 3MU8A 1AD8H 3RXHA 1QB9A 3SJOA 3ZZCA 3V3MA 1P05A 5ESTE 3QUMP 1EQ9A 2ZWLH 4IBLH 3E16B 4FU9A 4Y79A 4AZ2B 4Q7XA 3TU7H 2HRVA 2PSXA 3S9CA 2W7UA 1XUJA 2P94A 4OS2A 2BB4A 2HNTF 1LDTT 4R8TB 1N6XA 8GCHG 2TGPZ 1K1OA 1V2MT 3A82A 1QR3E 2VWLA 4FUFA 1A5GH 1O31A 1GI7B 1P3CA 1WTGH 3TJUA 2F9UA 3LGTA 3RMNH 1BITA 1KYNA 1QCPA 1N8OB 4TY7A 3T28A 4DGJA 3UNQA 3ODDA 4AGJA 1DY9A 1T8LA 5GPIB 2D1JA 3MO6A 3MO3A 2A4QA 2ZFFH 1HAHH 3VEQB 1TRYA 4Y10E 5C1YA 4ZHMU 3MTYA 1AQ7A 3E90B 1P8VC 3ZZ8A 1UVOA 1VR1H 5HM9A 2Y6TA 2PGBB 4YO9A 1P01A 4X8SH 5EG4A 1FXYA 5EQQA 1O3BA 1BHXF 1ID5H 5FX5A 2Q6GA 3BIUH 1XKBC 4IMZA 2ZHWH 3U1IB 4R0IA 2F3CE 3TITA 3KGPA 5EPYA 2PKSC 1QBOA 1QRWA 1ZPBA 2FOAA 2HPPH 4OGYA 1SQOA 1QL7A 7GCHF 3BTWE 3STIA 2TGAA 3K2UA 1IQHA 1P09A 2QXHA 5HMAA 4WH8A 2BDGA 1BBRH 2F9OA 1HPGA 3SHCH 4WF8A 2BYAX 4WXIA 2WYGA 2OTVA 1C2GA 3VB4A 1EX3A 1TBZH 4FUIA 5A2MH 2XYAA 3TNTA 3A85A 1FV9A 2ZHFH 1LKAA 2BDHA 1LVYA 1P2NA 1CBWB 4I8KA 5CE1A 1HIAB 1P57B 2XWBI 3VFEA 2W7SA 2AIPA 3HGNA 3TK6A 2GDEH 2YNAA 3M5NA 1NS3A 4CRCA 1C1PA 3PROA 1FJSA 1KLJH 1TGNA 1W10U 3NXPA 1K22H 1TOCB 1GJ9B 1DWBH 4LZ4B 4YOGA 1QRZA 3PLBA 3ZVEA 1O2LA 2ZI2H 2OC7A 2VWMA 5E0HA 1EPTB 3U9AH 1VCWA 2WYJA 4YTAA 1A2CH 2FO9A 2FOCA 5B6OA 4UDWH 1E35B 1D6WA 1NPMA 1HXEH 1O3AA 1P2KA 3Q3YA 1TX8A 1YCPH 5F8XA 1H9HE 2CF9H 2STBE 1UVPA 4WMFA 2AFQB 3HKIB 1ZSKA 2K1QA 1BMMH 1PQAA 3TGIE 2UUJB 1PPFE 1DY8A 1GI1A 4AFZA 1Y3VA 1J16A 1E38B 1YLCA 3PWBA 3ZVAA 3RXDA 5FPSA 2GZ9A 2ZFSA 2Z9LA 2GT8A 2ZU2A 2FPZA 1C1NA 2OCVB 4BAKB 1CA8B 1AWFH 3S9AA 5LPFA 3MNBA 3UUZA 2F91A 1GDNA 1SLVB 4FVBA 2SFAA 3P70B 1GHBF 2FLBH 3V0XA 2ULLA 1YPHE 1KDQA 1GGDC 5I25A 2BZ6H 1RS0A 2TIOA 1FY5A 1NY22 1JBUH 1LPKB 1C5PA 1S82A 1ZMJA 1D3QB 2WPJS 4JZFH 3V13A 3LIWA 4DCDA 1MZDA 1TALA 2TGTA 4ZKNU 3MU0A 3ZZ7A 1OOKB 1GI2A 1G3CA 1MU8B 1F2SE 3RC6A 1ABIH 3PMBB 3NCLA 2ZU3A 5HGGA 1NTPA 5CHAB 2Q6FA 1LO6A 2VIVA 4BOHA 4NIXA 3RXQA 5ETXA 3ZVFA 3TPIZ 3GY4A 1FAXA 3A86A 1OSSA 1GCDA 4HTCH 3U1JB 1O2SA 1V2TT 1Q2WA 1C1QA 3V7TA 4FUEA 1MTSA 4JK5A 1A61H 2SNWA 1PQ8A 3ATLA 1F0SA 1KLIH 2P3TB 5A8XA 3DUXH 1GI5A 4X8TH 1V3XA 1XUGA 1BBRK 3A89A 1ELTA 3ITIA 3W95A 1SGRE 1PPHE 1NFWA 1ANEA 1D9IA 1NRQH 2F9PA 1G36A 2G55A 4E05H 1AIXH 3S0NA 3F68H 1YM0A 2J2UA 1T4VH 4CRDA 1HIAA 4Y0ZE 3VXEH 1BHXB 3MHWU 1GDUA 1GHXH 1JMOH 2ZDNA 1QIXB 4DVAU 2GKVE 4RN6A 1C2HA 2XBYA 4JZIA 1ETSH 2AEIH 1LKBA 1BBRE 1EPTA 4VGCC 1VITH 1P12E 2YNBA 4ISHH 2IN2A 3BF6H 1AN1E 4NZLA 1L2EA 3RC5A 3BTEE 3WY8A 5JB8S 3MH5A 2AMDA 5LH8A 1GHYH 1TGBA 1YCPK 2BDIA 4MNWA 3VGCC 1W13U 4GCHF 1LHDH 1PYTC 3FZDA 2A1DB 1IQNA 3BTHE 1VGCC 1EAUA 3SW2B 3EGKH 2ZTZA 1V2OT 3OY5U 4UFEH 4Y8YA 4D7FA 1CHOF 1SPJA 2C3SA 1TAWA 2ZPSA 1LHEH 3EYDA 3IITA 3FAOA 1BTXA 1PPZA 2BY8X 3SN8A 2NU3E 1UCYH 2ZQ1A 4ZKOU 2GV7A 3LJOA 1GDQA 3M7UA 3GY8A 5F8ZA 2A4GA 1BT7A 3KN2A 1G37A 6LPRA 4ABHA 3B23B 2ESTE 1ZJDA 2FM2A 1C2MA 1PPCE 1ZSJA 4OS4A 1K1JA 1QHRB 3E8LA 1E36B 2ZKSA 5PTPA 1GBAA 1QQUA 5IDKA 2DE9A 3M5OA 4YLQH 3I29A 1AVWA 1O3GA 1O5BB 1VJAU 2A7CA 2PTNA 1LHGH 4AYYB 3RDZA 3ZZ3A 1SGFG 1TNKA 3P8GA 3A7XA 1A3EH 3K65B 3PWCA 3SNAA 1HAPH 1BRUP 2Y5FA 1ARBA 1MTNC 2CGAA 1HDTH 1SVPA 1C4Y2 1LVMA 3SGAE 1XXDA 4GSOA 1TWXB 3DFJA 2QXGA 2QY0B 3K6YA 2G51A 5DP6A 6GCHG 2BTCE 2PSYA 4PROA 1Y3UA 4K1SA 2R2WU 1TA2A 2FODA 1DXWA 5C20A 1GJBB 4Y76A 1HAYB 3E6PH 3RXCA 2BOHB 1HFDA 3M3SA 2AS9A 1K1PA 3A88A 1EP6A 9ESTA 1SOZA 1GI8B 4AFQA 3UOPA 5EW2H 1QRXA 3NZIA 1YCPM 5HXFA 2B0FA 2VGCC 1GMDG 5C5NA 1GPZA 3MU1A 3QWCH 2ZDMA 2V3HH 2UUYA 1K28D 4I8HA 1QB1A 4JCNA 4X2YA 1C1SA 4NFEA 4NA9H 3TK9A 2FOEA 3U8RH 1J17T 1Z1JA 2W3IA 1GVLA 2FX4A 1QJ1B 1DSTA 1GHZA 2G5NA 3RXGA 1INCA 1HAZB 1GG6B 2CMYA 1MUEB 2XTTB 3GCTF 6CHAB 1MQ5A 4GPGA 3Q00A 1NRRH 1KTSB 4DG4A 1BTWA 3RXEA 1Q3XA 1XVOA 1MAYA 4DIHH 4NIVA 1D3TB 2H2ZA 1MTNB 1DOJA 1MTUA 1DDJA 2Z3DA 2GP9B 4O03A 4WJG2 1VITF 3E0NB 5EU8A 3KL6A 5FXLA 1SLWB 2AGIX 4TYDA 5C3NA 4NWKA 3QK1A 2Z3EA 3RXMA 3UWIA 2ZU4A 2RCEA 2ZU1A 3GISB 3HGPA 3GICB 1HAVA 1GJAB 1TQ0B 2FI3E 1SLXB 4ABAA 4I8LA 1FPHH 2O9QA 3LDXH 1O2IA 4K2YA 1CGIE 4XSKU 4UD9H 1AE5A 1UCYK 3UFAA 3QO6A 1EZQA 1IQMA 1TX7A 1W2KH 4SGBE 3O8RA 4CREA 4AB8A 5L30H 1TGTA 1DPOA 1BMAA 3RXKA 4ZROA 4ZAEA 3Q3KA 4FU7A 1O2WA 2ZECA 3RC4A 3D62A 1VJ9U 1UTNA 1NC6A 1AVXA 2BLWA 3GOVB 5JBBS 4BNRA 3MMGA 1Z6EA 2GCHG 4I32A 3RU4T 1WQSA 3KQBA 2RDLA 4X2VA 5GIBA 3ZYEA 4KELA 4ZXYH 1MD8A 1E0FD 4MPUA 1AFQB 2J92A 4AN7A 1C5NH 5C67A 1UCYE 1FY4A 3M3VA 1BIOA 1GI0A 4MNXA 1UTPA 3QTVH 5DP7A 1EOJA 1BRAA 1GBKA 2WPIS 3LGWA 4Y71A 1DSUA 5F8TA 4WY3A 1HBTH 2HPQH 3TH2H 4CBOA 1ANDA 2Z3CA 2C8XB 1BZXE 3SBKA 1S6FA 3S7HB 1EZUC 3GY5A 3QTOH 4LOYH 3FFGA 2J4IA 2WV4A 3H5CB 1CT2E 3QDZB 1CVWH 3PTNA 2NU0E 4XBBA 1O33A 1ORFA 1GHVH 2BXUH 2WPKS 2BQ7B 1GI6A 1O3FA 4BTUB 5JDUB 4UFFH 1NRSH 4WWYA 2H5DA 1FONA 2ZQ2A 3OYPA 3URDA 5EXMA 1O2TA 1O2RA 2JH6D 3KQEA 1G3BA 1DM4B 4K69A 3EQ0H 3M61U 3NK8A 4A1VA 1V2NT 3SJKA 2VJ1A 1AGJA 1ZLRA 2FS9A 2A32A 1C5ZB 3PMJA 1O32A 4GLYA 4AFUA 1GI4A 2EI8A 2WPLS 1ELDE 3SUDA 1A0LA 5EQRA 2Z9KA 1ESAA 2XW9A 1N8OC 2H1UA 3SOSA 3LJJA 1SGEE 5FAHA 3HK3B 3RMMH 4Y0YE 1Z1IA 1PPBH 3BTDE 1CA0B 1E37B 1GHAG 5EXLA 1AFEH 4BAQB 1P9SA 1P2MA 3M5LA 4X1RU 1UVSH 2SGPE 3Q77A 2FESH 4HGCA 5DG6A 1FN8A 1B0FA 5E2OA 1SGTA 1ANCA 1UVUH 1W14U 3E0PB 2J9NA 1ARCA 3SI3H 7LPRA 2EC9H 2BVRH 2GGVB 2ZTYA 3A7TA 4CRFA 1MBMA 1UTQA 2BLVA 1O2QA 2BLOA 4OS1A 3A7WA 1MCVA 1GBHA 4X1QU 3M37A 3EA8A 2Q1JA 4BXSA 4YT7H 2XC4A 8GCHF 1DXPA 1FUJA 2CF8H 2FYQA 3LGYA 1W0ZU 4J2YB 3HKJB 2HWLB 1KXFA 1GBFA 8ESTE 1O3OA 4RKOB 5FCKA 3F6UH 2VH6A 2A31A 1KIGH 4X1NU 4Y8ZA 1MKXH 4UE7H 1P02A 2JH0D 5JBAS 5TJXA 3UIRA 1SGFA 2FYRA 3UWJH 1C5QA 3F1SB 2XXLA 2H9TH 1J8AA 1CBWC 2OD3B 1IQJA 3DA9B 3DHKH 3LPRA 1SC8U 1G30B 2BVXH 4NA7A 2KAIB 3K6ZA 1GBBA 1EXFA 4M7GA 3SGBE 2Q6DA 3TJVA 5C1UA 4HZHA 4IS5A 4TY6A 5LPEA 2AERH 1W7GH 5E0GA 2GCTB 2UWLA 3KEEA 1XUKA 1F0TA 5A09A 2PFEA 1EPTC 3ZVGA 3ZZ5A 1Y5BT 1ZYOA 4AG1A 1EB2A 1P11E 1Y3XA 1QJ7B 1AWHB 3QGNB 1ELVA 1UTKA 1DITH 1WAYB 2NU1E 4B2BA 4ESTE 5EODA 1JRTA 3OX7U 3AW0A 1PQ7A 1Z8RA 2Y82A 1FIZA 5EPNA 1IQIA 5HYOA 1MKWH 3A80A 1OWEA 2CHAB 2BD2A 4MDSA 4K8YA 1FI8A 4JYVH 3RXOA 2K7XA 5JPMH 2UUKB 1K1IA 1YF4A 1J9CH 1ZSLA 3PLKA 4B76A 4DT7B 1A4WH 2XNIA 1TABE 1TX6A 1TNJA 1L4ZA 1TNGA 4BAOB 2FDAA 4NG9H 1HAGE 1YC0A 1L1JA 1Z8IB 2GX4A 3PV4A 5AF9H 3SJ8A 5ABWA 3GY6A 2V0BA 4Q80A 3F9GA 5FBIA 3MNCA 2XWAA 2F9VA 4AG2A 2V35A 2V3OH 2Y7ZA 3JZ1B 1D3DB 1ESTA 2RA3A 2BHGA 1TPAE 2VIQA 1U6QA 4J1YA 1K1LA 2ASUB 3UTUH 3O8DA 5EGMA 1LCYA 1L0ZA 4DIIH 3MO9A 2V6NA 3NWUA 2QV1A 1B0EA 5CHAC 7GCHG 1AKSB 1FY8E 3SZNA 2GV6A 4CH8B 2C8YB 4X0WU 2HNTC 1OKXA 3MFJA 2QF0A 1MBQA 1C2DA 2ZTXA 1HAOH 4ISIH 1D4PB 3KHVA 4K8BA 1MAXA 5AHGH 1DUAA 2UWOA 1O2MA 2PUQH 2PLXA 3MYWA 2THFB 2WPMS 2GVFA 3QZRA 3BTME 3FZZA 1V2RT 4MPVA 1IAUA 2XCFA 2EEKA 2ZCKP 1MKXK 4RSPA 3P8OA 2A2XH 1N1LA 4AGKA 2Z6BD 3VPKA 2ODQA