1O3JA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3jA02
5J4QA 1MAYA 1GHWH 4AG2A 1DWCH 1O3OA 1O5FH 2D26C 3F1SB 8GCHG 3URDA 1GL0E 3RXCA 2FI5E 4BAMB 2ZU5A 1L0ZA 5LPFA 4FUBA 2VWMA 3UOPA 1UVUH 3ZVGA 2ANKH 4FUEA 4K3JA 3U69H 1HCGA 2XBVA 1EX3A 2ZGBH 1GI7B 4NIYA 1BRUP 1KLTA 3UOUA 1Z8RA 1MQ5A 1CBWC 1BMNH 1WTGH 2Q1JA 1BTZA 5ETXA 3ZZ4A 1GMHF 1UCYE 1PPGE 3QO6A 3RXUA 1ZTJA 3UIRA 3E0NB 1TX8A 4CRGA 3SHCH 1FAXA 4X2XA 1BRCE 1O2VA 3TLOA 4KELA 5EXNA 3DD2H 1JBUH 2A31A 3MU5A 3BEIB 1HJ9A 4D9RA 1O2PA 1W11U 4X8TH 2HGTH 3BTWE 3MH7A 1QRXA 3SGBE 2BY8X 1OYTH 3BTEE 3ZZ5A 1O5AB 2F83A 4CR5A 1BT7A 1KDQB 3EE0B 2THFB 5C67A 1DFPA 1TPPA 3KF2A 1YYY1 4JZ1A 3S7KB 3UR6A 1WSSH 1IHSH 1VJAU 1WYKA 1BTPA 3ATIA 1Q3XA 3D49H 3GDVA 3W95A 1FY3A 4MPXA 1V2OT 1ZTKA 1MKXK 4DT7B 1GBFA 2OC7A 2J92A 4TWYA 1OKXA 4E7RG 1GG6C 4ZMAH 4I33A 1BTUA 2ZDVH 4D7GA 1OWIA 4M7GA 3JZ2B 4U01A 4Y0ZE 3SQEE 2A32A 2ZNKH 2C8WB 8LPRA 1D3QB 3BG4B 4B2CA 4FUJA 4DG4A 1ZPCA 2FYRA 4IBLH 5FBIA 3VXFH 4GLYA 3PM3A 1QQUA 2STAE 2XRCA 3GY2A 1O0DH 2TPIZ 2HNTF 5CE1A 1J8AA 1QA7A 2VU8E 2ZHQH 3A8CA 3UQOA 5A8ZA 4JZDH 4BOHA 4NIVA 4ISNA 2W26A 1O2LA 1FDPA 3P8FA 3F9HA 1O3JA 1NROH 3LDXH 3K6YA 4MLFB 2OD3B 2G8TA 2O8LA 1NRNH 1P57B 1C1PA 2AMDA 2VB0A 1JIMA 1E35B 3RXVA 4O3TA 1A3EH 1GBCA 3A7WA 4MPVA 1TNLA 3R3GB 4QT8C 3FANA 2CJIA 1NT1A 3BG8A 4ABGA 1HXEH 2ZFQH 3E16B 2OC8A 1O5BB 4O9VA 1PPEE 1F0RA 3BTQE 3E8LA 2PKAA 2OINA 2HLCA 2P94A 1W13U 1C5TA 1PYTD 1D3TB 2BZ6H 3BTGE 1CGJE 1P05A 1TQ7B 1P02A 1HB0B 1GVLA 1QNJA 2GDDA 1VITF 4K8BA 1HV7A 1G36A 2BX3A 1W10U 3MU0A 2H6MA 2TGDA 1GMDF 1QCPA 1ESAA 1FZZA 2BY6X 1GBLA 2FI4E 3U8OH 2F9PA 5LH8A 4R0IA 1PPHE 1L1GA 3GDSA 2A7CA 1OYQA 4WXVA 1BOQA 3NXPA 1QTFA 1SL3A 1XMNB 3M7QA 2D2DA 4FUDA 1SGTA 1Q31A 1ESTA 4F49A 2FS9A 2GZ9A 3KNXA 1ZHRA 1GDQA 1KDQA 2PGQB 3PLPA 2Z9GA 3L3TA 5C3NA 3QZQA 1XKBC 1C2LA 3VGCB 5DPAA 2UWOA 1HAPH 1AWFH 3MU8A 2A2QH 4IS5A 3DFJA 4NIWA 1D3DB 1OWEA 2ZTYA 3PROA 5C20A 1N8OB 3VB4A 2GTBA 5JBAS 3M7UA 1AY6H 1HGTH 2BLWA 3D62A 2XC5A 1W8BH 1GBHA 1IHTH 1EZUC 2ZIQH 4WMFA 1EXFA 1BHXF 4OS5A 2H5CA 1E36B 1YLCA 2NU3E 1O5DH 3SU0A 2NU4E 1C2FA 4KTCA 5FPTA 2XC0A 4CRBA 1ELBA 1O3EA 4ZHMU 3M3VA 1E37B 4CRDA 3FZDA 4DIIH 1MKWH 1FIZA 4K2YA 2BM2A 2Y6TA 1HFDA 3T62A 2R9PA 1D6WA 3U1IB 2Y82A 1PQAA 1MUEB 1GJ6A 1ZRKA 1K1NA 5DJ7A 1FLEE 4WWYA 1S83A 2BOHB 2HWLB 4D9QA 2TRMA 2RA3A 3FVFB 2XBXA 4Q7ZA 2IJOB 5FX6A 2GDEH 1ZMJA 2ALVA 1IQFA 4I32A 2ZFTA 2G4UA 2Z9LA 1SQAA 2OBQA 2BY5X 4RKOB 2I6QA 3T25A 4BTIB 3SNEA 3EYDA 2Z3CA 3IITA 2QXIA 3RC6A 4FUGA 1K1LA 3TH4H 4DCDA 1WU1A 2FOFA 3DFLA 4WF8A 1TE0A 1V2MT 1DE7H 3Q00A 1ELTA 3PV4A 1VCWA 4FU9A 5A8YA 4INLA 4ZAEA 1G30B 4Y71A 5A0AE 3V13A 1LPGB 1IQHA 3B8JA 2PWXA 2WV4A 5AF9H 1GHVH 3SU6A 4IC6A 1SGPE 1A3BH 4IN2A 5I25A 4J2YB 2IOTA 1GI1A 4FUFA 1ZMLA 5HXFA 1KY9A 4FU8A 3LGTA 2ZDLA 3SHAH 1DS2E 1H4WA 2BDCA 4ZUHA 2VH6A 1VCPA 1MKXH 2EEKA 2RG3A 2CXVA 1FV9A 2R0LA 3URCA 1DX5M 1BTXA 3V0XA 1C2IA 6CHAB 3PMHB 3RMMH 1S6HA 4H4FA 3ELAH 1O3AA 4ISOA 2BY9X 4XBDA 5L6NH 3K6ZA 1T7CA 1CGHA 1HXFH 1EJMA 3A89A 1AD8H 4MVNA 1GVKB 2QCYA 1P2IA 2VIDA 3S9BA 3NKKA 1GDNA 4WH8A 1AFQC 1XVOA 3ZVAA 3ZZ7A 1LVMA 3RXFA 2BDAA 1C2KA 1P03A 1SPJA 1AN1E 2J2UA 4NWLA 2CHAB 2FX4A 1ACBE 5CMXH 3MO3A 3BSQA 1TNKA 4LK4A 3RDZA 1FY4A 5HM9A 3KEEA 1CSOE 1NU7B 3T26A 4CHAB 1P3CA 3PWCA 4U32A 3UTUH 2I6SA 2GP9B 5JYIA 1AU8A 4OGYA 2XC4A 2BD7A 1QFKH 1ZLRA 2Z9KA 2ZFRH 2OP9A 5T6FA 2Y5HA 5FPYA 4CBOA 3SJIA 3CENA 3ZVFA 3MU4A 3PWBA 3SGAE 1MU6B 1F5LA 1ELFA 4X2VA 4TPIZ 1T8NA 3PLBA 3D23A 3MHWU 3TITA 4H42U 3QDZB 3M36A 1D4PB 1ZPBA 2FTLE 2FIRH 5BRRE 4B76A 3HGPA 2GVFA 2A4QA 3F9EA 1CBWB 2R2WU 4NZLA 1GJBB 4Y8YA 1TALA 2BLVA 1PQ5A 1IQGA 1SG8B 1QJ1B 1ZPZA 8ESTE 2ZG0H 3F9GA 1GMHG 2GCHG 2BQ6B 2R0KA 2Z6BD 1LHDH 1WBGB 1GWAA 3RMNH 1L2EA 3SV6A 3GCOA 4IMQA 4Y8ZA 3RXDA 3T2NA 4K1TA 5L30H 1UK4A 3GCNA 1S0QA 7LPRA 2BDHA 3TH3H 5HM2A 3S9CA 1RTFB 2PLXA 4IW4E 2GT7A 1BMAA 4FXGH 1WAYB 1GBBA 2VJ1A 4TPYA 1K1OA 3ATLA 2BVXH 1SMFE 3SU3A 1TOMH 1W14U 2XBWA 3SOSA 1GJAB 1HNEE 1LKAA 1O39A 1SC8U 3NPSA 5FPSA 1QB6A 3SZNA 2P16A 1VITH 1ORFA 5DP9A 1SLXB 3A84A 1MZDA 1QBOA 1GG6B 4UFFH 1GHAF 2ZDAH 5DP3A 1EKBB 2BHGA 3DUXH 2ALPA 5AFYH 2G00A 2GX4A 2CF8H 5A2MH 2H9TH 5DP4A 3EQ0H 1UTNA 1GI2A 1C4V2 1C1RA 3C27B 1O3HA 2Z94A 1GHBF 3AAVA 1ZMNA 3A8DA 4ABDA 1ABJH 1C2HA 3A83A 4F4OC 1IQKA 1VJ9U 2FOHA 2IPHA 1S82A 1HAXB 2ZU3A 3MWIU 1SLWB 1UHBA 3TNTA 2P8OC 4NA7A 3MTYA 1TYNA 2BLOA 3LC5A 1WQVH 1A7SA 1P2NA 5AHGH 2JH0D 2FOEA 4INHA 2H5DA 2ESTE 3A87A 1H8DH 4Y7BA 2VIQA 5TCCA 3S69A 1HAZB 3M5OA 1LVBA 5FXLA 2YOLA 4B74A 4H6TA 2BVSH 4AYVB 2O8MA 2ZTZA 2BDGA 4Y11E 1SGYE 3RXAA 2GZ7A 1O2GH 4AORA 3EA7A 2ZA5A 4B1TA 1O3FA 3GY8A 1Y3YA 4AG1A 1WV7H 2PFEA 3SQHE 5GCHF 1DITH 1SGFG 4FUCA 1ARBA 2VINA 1FXYA 4SGBE 3QLPH 4AB9A 1HDTH 3I29A 1UTLM 3VB3A 1MTWA 5DP5A 1IQNA 2HOBA 2QXGA 1O2NA 4O3UA 2PR3A 1PJPA 3A8AA 1SGEE 3VB5A 1K9OE 3ODFA 1GBJA 2C93B 1Z7KA 4IC5A 1O34A 1V3XA 4NZQA 1G9IE 1TQ0B 1QIXB 1AUTC 2VWNA 2XYAA 1TABE 1TONA 2VWLA 1VITG 5C1XA 3RLYH 3B9FH 1GMDG 1SVPA 1O2MA 1HAVB 1FPCH 4MNXA 2ZDNA 1BDAA 1QL9A 4Y7AA 1M9UA 4ESTE 2CV3A 2FP7B 2LNCA 3T27A 3A7TA 1JOUB 2A5AA 5GXPA 2FESH 1ZRBA 4VGCC 1A0HB 1MAXA 2P95A 1DM4B 4ZXYH 3G01A 1FN8A 1TAWA 4MQAA 4X2YA 2OQUA 4A7IB 1C9TA 1YM0A 2UWLA 1XX9A 3E91A 3ZZAA 3VB6A 1K28D 2Q6DA 1UK3A 5DO4H 5C5NA 1IQJA 4GPGA 2ZEBA 4MPWA 1BMLA 2A5KA 1P3EA 1KXEA 1ANEA 4OS1A 5E8EH 3SUEA 1C1UH 1NESE 1LHEH 3GY5A 2J4IA 2WUBA 4KKDA 1SGFA 1IQMA 2GCHF 1ZSKA 1K1PA 2BDBA 1F2SE 1K21H 4K5ZA 4INKA 1G2MA 1HAOH 3ATMA 2FOBA 1ZHPA 3KN2A 2TGAA 3MO9A 1C5WB 4BANB 3PTNA 2GGVB 1FPHH 2ZGJA 3SNAA 3QTOH 3KL6A 2PUQH 3TNSA 2Q6FA 2CN0H 2V3OH 2M5TA 1K1IA 3M5NA 3MNBA 1YCPH 1MD8A 3SV9A 1ELAA 1TX6A 3RU4E 1ELCA 3ATWA 3U1JB 3B23B 1W7GH 1C2EA 1QBNA 1B0EA 4FVDA 3KHVA 1IQIA 1SHYA 1K22H 4Q7XA 4A6LA 4B73A 4D8NA 1C5ZB 2Y80A 2GKVE 2ZWLH 1J9CH 3U9AH 4B71A 4NG9H 1DWEH 2F9BH 4LOYH 1ZJDA 4ABAA 1J15A 1BIOA 4JYTA 2OBOA 2XWAA 2JETC 1W7XH 1GI3A 1AMHA 1SSXA 2BD2A 3PTBA 1TMUH 4MPUA 1FAKH 3MH4A 3TGJE 1ZGVA 2SGDE 1TBRH 3K2UA 1TNHA 4UFGH 1H8IH 2OTVA 1BBRE 2A7HA 3MNXA 1ZYOA 5GDSH 1GI5A 4RSPA 4X1PU 1O30A 2VIPA 2ZPRA 3CS0A 3ZVDA 4MG3A 1P2JA 1GCTC 3FFGA 4DVAU 2R2MB 5FCKA 3T5FH 1LHCH 1IAUA 3C1KA 4ZHAA 3SI3H 8KME2 2O8UA 4Y79A 4ASHA 3SNBA 4XBBA 1NRSH 1S6FA 4OS6A 2RCEA 3GCHC 1V2VT 1DSUA 4HGCA 1B7XB 4I8KA 5HYOA 1LPKB 1XUHA 2GMTC 2OC0A 4ISLA 1SFIA 2RDLA 2UUFB 4Y10E 2ZCKP 1EOJA 2ZDMA 3QN7A 4BXSA 1HAVA 1XUIA 1TLDA 2OQ5A 4XBCA 1DLKB 1A5IA 1P04A 2QIQA 1O2KA 1ZSJA 5H4IB 3BEUA 4JZIA 5JBBS 5ESBA 4SGAE 4ABJA 1AIXH 3SV2H 1ZGIA 2ZHDA 5EGMA 1DDJA 1TPAE 2JKHA 2ZHFH 5EOKA 3IWMA 1YGCH 1EJNA 1MBMA 2F9NA 1AFQB 1GDUA 2G52A 1A2CH 2QA9E 3K9XB 1QA0A 3M7TA 3ZVBA 2VVUA 1NM6A 1DXWA 1FMGA 2XCFA 4MDSA 4DJZB 5F8TA 2B8OH 1UTMA 1C5QA 3MH5A 3LH1A 4MNVA 1TRNA 5E2OA 1A0JA 4Y8XA 1DUAA 3UWJH 2WUCA 1XXDA 2ZC9H 3BTME 2J9NA 2BX4A 2TBSA 2F9VA 5DKMA 4AYYB 1YCPM 2XXLA 2FLBH 1EASA 2A0QB 2XWBI 1O3KA 2VVCA 1DWBH 1RTLA 2J95A 2WPIS 2QV1A 4X6MA 4DIHH 3ATKA 3TJNA 1GBIA 5T6DA 1BA8B 3I78A 1SHHB 3BV9B 4X0WU 1SGDE 3FP6E 5CHAC 1SLVB 1ZZZA 2H9HA 2BD4A 4MTBA 1GJ7B 2ODQA 2W7UA 7ESTE 1EP6A 1O2IA 1GHXH 1G3CA 1Y8TA 3OX7U 5LGOA 4NFFA 2SNWA 3BTKE 1P01A 2J34A 3VB7A 5JB9S 2ZU4A 2A4GA 1RXPA 5DGJA 1OX1A 3RXLA 3LGWA 4YT7H 2UUKB 4BNRA 2GCTC 1YPJH 1ETSH 3LONA 1KLIH 1C1TA 4K1EA 3TK9A 1XUGA 1U6QA 1WTHD 1Z6JH 1G2LA 4IGDA 3RXHA 1KXDA 1KTTB 4BAQB 1C5VA 4FVBA 1YPHC 3M5MA 1CVWH 4ZKNU 3RXIA 1Z1JA 3A7ZA 1O3GA 1ELGA 1GJ9B 3A7YA 2FTMA 3GY3A 2ZI2H 1BJUA 2FOAA 1RJXB 1LCYA 1BBRH 1C1QA 1QRZA 1EZSC 2F91A 3UQVA 1D9IA 1W3CA 3ZZDA 1N6YA 2Z9IA 2ZTXA 5K7RA 2SGFE 1O32A 1SGNE 4JMYA 3R0FA 2UWPA 5C1YA 2FI3E 1FI8A 1SGRE 1Z71A 1OOKB 1GHAG 1PPFE 4AOQA 1T8OA 4DW2U 3BIUH 4LZ1H 2G5VA 1GVZA 1T4UH 1AVWA 1PYTC 1RD3B 1TRYA 2AGIX 4YM9A 3ZVEA 1GHBG 1Y3VA 5EPNA 1B0FA 2WYJA 3SNCA 1O3LA 4DURA 1V2LT 3BIVH 2P8OB 3V7TA 3A85A 2AH4X 5C5OA 3VEQB 3GY6A 4AFSA 4ABIA 2ZU2A 1GJCB 3LPRA 3LKWA 4KTUA 1GJDB 1G3BA 4OS2A 4HFPB 3CP7A 1V2KT 1LDTT 4YTAA 3EA9A 3LGYA 2JH6D 3RXQA 1VR1H 1O2QA 1EB1H 4BAOB 3TGIE 5JDUB 3TU7H 2JH5D 5F03A 1A1RA 1KLJH 1BCUH 2YNBA 1FY1A 1RS0A 4ABEA 1TBZH 1AQ7A 3HPTB 5JB8S 2BYAX 1O2SA 1ELDE 3M61U 3SV7A 1THRH 3A82A 1EJAA 1JXPA 1V2QT 2ODYB 5GCHG 3A88A 1OP2A 3SNDA 1C5LH 2ZQ1A 1DY8A 1DY9A 1O31A 1Z6EA 4X1SU 1LHFH 5HGGA 1RGQA 3OY5U 3SN8A 3HK3B 2HVXA 4NCYA 1G32B 2BY7X 4YOJA 1P2KA 3QGJA 1SFQB 1N1LA 1AO5A 3NCLA 4K69A 1LTOA 1C5SA 1A0LA 1HBTH 3RU4D 3O8BA 4YLQH 2BOKA 1DICA 2ZECA 1H1BA 4I8JA 3UWIA 3RM0H 2FPZA 3S7HB 2ZCHP 3UUZA 2R3YA 4XFQA 4ZKSU 2QN5T 1EZQA 3AAUA 4ZHLU 1FONA 2EA3A 1UO6A 2C90B 4VGCB 1OSSA 2P3FH 5A09A 4YOGA 1MTVA 3TJVA 1C4Y2 1Z8JB 2F3CE 4X1QU 1F0UA 1TIOA 2C8YB 4GSOA 1GMCF 2PGBB 1SLUB 1TNJA 2IN2A 1XUFA 1C1VH 1FNIA 1UVOA 2R3UA 5JPMH 1O3PB 3RXKA 2DUCA 3U8RH 2ZHEH 1K1JA 1NS3A 2B5TB 2C4FH 1OWJA 1O2ZA 2KAIB 3ZZ6A 5G4BA 1XVMA 2Z3DA 4B2BA 5L2YH 1IOEA 2A7JA 3LH3A 1HAHH 5F8XA 3SUGA 1O36A 1BUIA 1JRTA 2J38A 1QL8A 2H2ZA 1LQEA 1GBAA 1MCTA 2HALA 1CU1A 3TK5A 2EI8A 1V2JT 3GY7A 2OUAA 5TCAA 1JIRA 1L1JA 1V2WT 2VH0A 1C1SA 1HAIH 1EB2A 2ZP0H 1BRBE 4I31A 1Z1IA 4WH6A 4A1VA 1TGTA 1EPTC 1PFXC 1TB6H 1UTJA 3TH2H 2ZGHA 1TX7A 4NWKA 3SJ9A 2G4TA 4A92A 1O3CA 3O8CA 2AGGX 2JETB 1HYLA 9LPRA 4BTUB 4GVUA 1ETTH 3P8OA 2GT8A 1AZ8A 4XSKU 3F9FA 1O2TA 3ZV8A 2GZ8A 1UJ1A 4U30A 1VGCC 3SU1A 4JK5A 3PMAB 1W2KH 3FAOA 2QXJA 3T28A 1SR5C 3GCTF 1KXAA 3GYMA 2QXHA 1NO9H 2FM2A 1GCTB 2RA0A 3RXTA 1F5KU 3SUFA 2QYIA 2DE8A 4AGKA 3A8BA 4OS7A 4GCHF 3ITIA 2A45B 1Y3XA 2BB4A 3S0NA 7GCHF 1TGCA 3PB1E 4GHTA 3GCHB 1C5MD 1C5OH 2BMGB 1O2YA 3LU9B 4KP0A 2GMTB 2W3KA 1AB9C 2FS8A 3Q3KA 3M3TA 4NIXA 1YC0A 1PPCE 1BZXE 1C5YB 1O2RA 1TPOA 2UUYA 5FBEA 3SJKA 2FEQH 1DUEA 1HRTH 1O2XA 5HMAA 3Q77A 2ULLA 4THNH 1CA0C 2FDAA 4CRCA 1Y5AT 2BZAA 1GI8B 4ZXXH 1O2HA 2GV6A 1SGCA 4X6PA 3D65E 1SB1H 3K65B 2K1QA 2PSXA 1SQOA 2AEIH 5A0BA 1E38B 1A61H 1FIWA 5E2PA 5DP8A 3LJOA 2PW8H 3NWUA 4PROA 1MH0A 4E06H 4UE7H 1PPBH 2C3SA 1LQDB 2FLRH 5ABWA 3L6PA 4CBNA 2VNTA 2QF0A 1UCYK 1O37A 5DP6A 4I8GA 1AVXA 1HJAC 1TGSZ 3L33A 3M3SA 3ZZ3A 5A0CA 2CMYA 1C2DA 1A46H 4NSVA 1EQ9A 1O2WA 5L2ZH 2A1DB 5SGAE 4Q7YA 4CR9A 3SGQE 1C5UA 1GBDA 1XM1A 3OU0A 1OWDA 3QK1A 1FY8E 3E1XB 3KQCA 1V2UT 2G5NA 3M35A 1DVAH 1C5RA 2PTNA 3FP8E 2WINI 2NU1E 1UK2A 1F0TA 5CHAB 2ILNA 1CE5A 5K0HA 1BQYA 4UDWH 1D6RA 3OY6U 3CS7A 1EUFA 1S84A 1LO6A 1AE8H 5EPYA 5IYTA 2ZFPH 3FP7E 3ZZCA 5JBCS 1SQTA 3U8TH 1NFXA 3TJOA 3UY9A 2V35A 3KCGH 3OSYA 5E0HA 1GHYH 2BDIA 1MKWK 1Y5UT 1WCZA 1SGIB 1ELEE 2GCTB 1HUTH 2OCVB 3BN9A 1Z8GA 1NRRH 1MBQA 3BTDE 3KQBA 1WUNH 1RRKA 3SU2A 1GI6A 1Y5BT 1CGIE 3ZVCA 4Y0YE 1RFNA 2PKAB 2QAAA 1YP9A 2B9LA 3SU5A 4AFZA 4YZUA 2ZZUH 3I77A 2P93A 3QTVH 3U98H 1FJSA 1FY5A 3N7OA 3BTFE 1P2QA 3P95A 4K60A 5TJXA 1P8VC 5F6MA 1EATA 4JYVH 2ZF0H 3RLWH 4B2AA 3RXSA 3WY8A 3UPEA 4JZFH 1PQ7A 1ZSLA 4X8VH 3KIDU 5F8ZA 2VIOA 3HATH 1J16A 4I7YH 1T32A 1DSTA 1GPZA 1O3NA 3P6ZB 4O97A 3O8RA 2TGTA 4X1RU 3EAJA 2HNTC 3VPKA 2ZKSA 2F9OA 4DGJA 4UONA 1S5SA 4YO9A 1K1MA 5BPEA 3RU4T 1QY6A 1XXFA 4K8YA 3PMJA 3Q76A 1HIAB 5EODA 1O5CB 2PKSC 1P9UA 1DWDH 3W94A 1IQEA 4BTTB 4D76A 2P3UB 5DK1A 1EAIA 5A8XA 1QR3E 1NN6A 2OXSA 2FOMB 4MNWA 3E0PB 1EAXA 1X7AC 1CHOF 5E0GA 1YBWA 4GHQA 2Y5FA 4TY7A 1O2OA 1GL1A 4E05H 5FX5A 2P59A 2BDYA 1AWHB 2AIPA 5J4SA 1ID5H 3SORA 2Z7FE 2BXTH 3E6PH 1ZOMA 1DXPA 1F0SA 2VIVA 4RKJB 3F68H 3LGIA 1V2RT 1XUJA 4TWWA 3ZZBA 1MZAA 2ZGCA 4D7FA 3PYHA 1BB0B 2AS9A 4DOQA 1YLDA 1RIWC 3AVZA 2ZDKA 1VCQA 1S0RA 1FUJA 1D3PB 3MI4A 5FAHA 3E3TA 1EAUA 1DANH 1THPB 4CREA 1S85A 2ANWA 2EC9H 2SGEE 4ISHH 5EW2H 2J94A 2V6NA 5EW1H 1QL7A 1TMBH 1YPEH 1IQLA 4J1YA 3P92A 5EG4A 2XNIA 3HKJB 6GCHF 1J17T 2A4RA 4X1NU 1GGDC 4RN6A 1L4ZA 1KIGH 1P12E 4U2WA 2QC2A 1KXFA 3RC4A 2Z9JA 4ISIH 3RUOA 2Y5GA 4CRAA 1JWTA 3S9AA 4X6OA 3M5LA 1CO7E 2W3IA 1UVTH 3NUMA 2NU0E 1QHRB 4NA8A 2ZHWH 3SO3A 5JBTA 3ZZ9A 3P70B 4Z6AH 1LVOA 4HTCH 2W5EA 1JMOH 3LJJA 2FOGA 3ENSB 1O38A 3PO1C 3QX5H 4AZ2B 1GI4A 1GI0A 1K2I1 3MOCA 3PMBB 2VGCC 3OTJE 3QWCH 1T4VH 1GMCG 3UNRA 1QJ7B 1UVPA 1CHGA 1KXBA 3HK6B 3AW1A 1YF4A 4DY7B 3H7TA 1C1OA 1C2JA 1GCDA 1P0SH 3A7XA 4TY6A 2PUXB 1UCYH 2WYGA 1SBWA 3ZYEA 1LVYA 1MTNC 4XOJA 1C9PA 4WY3A 2BD8A 5B6OA 8GCHF 1OPHB 2W7SA 4CH8B 2QY0B 1TPSA 6ESTA 4YLUA 1AE5A 3TJUA 1HIAA 3QUMP 1NRPH 5DP7A 4Z0KA 2PHBA 5LPEA 2AGEX 3TVJB 4AB8A 2VIWA 3HGNA 4Q80A 1Q2WA 1Z8IB 4X6NA 2ZU1A 2A4OA 1NFUA 2SGPE 3UNQA 3SI4H 4AGJA 1UTKA 2G55A 2D1JA 1F5RA 1EPTB 1F92A 2WPJS 1O3DA 3F6UH 3ZYDA 1C5XB 2HNTE 3FZZA 3Q3XA 2V0BA 1UMAH 1Y59T 1C4U2 4WXIA 3EGKH 3AW0A 5EQRA 1EAWA 5FHTA 4GAWA 4JYUH 3BF6H 2AIQA 4UD9H 4ABFA 2Y7XA 2GV7A 3RMOH 3MNSA 3KQEA 1P09A 1VGCB 2ZQ2A 1NFYA 1CT2E 1NY22 2ZPSA 1HPGA 4X8SH 3LIWA 2VWOA 2AMQA 1DPOA 4XE4A 1ANDA 5EXLA 3NK8A 1ELVA 4ZKRU 1BMMH 2BTCE 3GISB 3RXPA 3GCTG 3PLKA 1O33A 3MYWA 1HJ8A 1FQ3A 1MMJN 2O9QA 4UFEH 4ZROA 4GCHG 2A5IA 1UTPA 4BAKB 5DG6A 1GBMA 3MNCA 7GCHG 3GOVB 2ZGXH 1G37A 1HAYB 2A2XH 1AB9B 2BQWB 1YPKH 5LPRA 1V2NT 3Q3YA 1O3IA 3NZIA 3JZ1B 4Y6DA 3SUDA 4KGAA 1T31A 2PTCE 2FMJA 1CT4E 3UFAA 4LZ4B 1NZQH 2QF3A 3H5CB 3RXOA 1QBVH 1OWHA 2ZFFH 4JK6A 3RXMA 2ODPA 3EA8A 1CA0B 3BG4C 1TA6A 3ESTA 1H9IE 3MO6A 1BTHH 1VZQH 3RXGA 1NTPA 1QB9A 4Y76A 1QJ6B 5I46H 1NFWA 1ANCA 5AVDA 1ANBA 1NU9A 1ABIH 2G81E 4AX9H 1P11E 1A4WH 3A80A 2WV5A 1C2MA 1MTSA 4YESB 4YOIA 2WPMS 1KYNA 2ZPQA 2OLGA 1TBQH 2VVVA 1AGJA 1YPLH 2NWNA 1P9SA 2C8ZB 1A5HA 1TNGA 2FOCA 1P06A 1BITA 1H9HE 1G3EA 3QGNB 5GPIB 1RTKA 1OS8A 1TMTH 4GUXA 1HJAB 2PV9B 4OGXA 2P3TB 1W0ZU 5T3HA 1AKSB 2HPPH 1TGNA 3RXRA 6LPRA 3SW2B 2V3HH 2C8XB 2B0FA 4FUIA 1SGQE 3MFJA 1QB1A 5GJ4B 4NA9H 1V2TT 2FXRA 2ZCLP 1UHBB 4NSYA 3RP2A 1C1NA 1L1NA 2ZFSA 1O5GH 2Y81A 2GD4B 4ZKOU 5C2ZA 1PQ8A 1AFEH 2TGPZ 1F7ZA 1AUJA 1TGBA 3KGPA 2QGRA 3QZRA 3ZV9A 4KTSA 1EPTA 2H1UA 4WMEA 2ZO3H 2O8WA 3DT0H 1ZHMA 4UFDH 3LGUA 2AFQB 2XCNA 3RXEA 1O35A 1GJ4H 4HZHA 1O3BA 2ASUB 5EQQA 3A7VA 1AZZA 1TFXA 2WPLS 1CQQA 3SU4A 1ZR0A 4OS4A 1O2JA 4IN1A 2NU2E 1CA8B 2O8TA 1CT0E 1YCPK 5C1UA 1QGFA 3VFEA 1FN6A 1A5GH 4E7NA 1E34B 1YPHE 2FO9A 1MCVA 3VXEH 4WVPE 1GHZA 2LPRA 1P10A 4HI3A 4CH2B 3RC5A 4AN7A 3RMLH 4A1TA 4JZEH 3VGCC 3GYLB 3BEFB 1BTYA 3BTTE 4A5TS 2BQ7B 2XBYA 2ANYA 1MD7A 1P2OA 3V3MA 1H9LB 5ESTE 1N8OC 2CGAA 2FWWA 2H9EH 2BD3A 1ETRH 1TNIA 1PPZA 5EU8A 1LMWB 1ZTLA 4ZH8A 3P8NA 1YKTA 4JCNA 1ESBA 3RM2H 3V12A 3GICB 2EI6A 2Y7ZA 2WPHS 3TIUA 3OYPA 1ARCA 1MQ6A 4K1SA 1UTQA 4H6SB 4FU7A 1OP8A 1SI5H 2FZZA 2FX6A 1MU8B 1QURH 3MH6A 1DT2A 4LXBH 1HAGE 3RXJA 2PKSB 1TRMA 1W12U 2DE9A 2FODA 5GWZA 3GY4A 2AYWA 1T8LA 1GI9B 1O3MA 1AVGH 1HLTH 4I8LA 1BTWA 2XW9A 1QRWA 2XTTB 4I8HA 5GIBA 1AHTH 4AFQA 5PTPA 5FCRA 1UTOA 2Z3EA 1CHOG 3E90B 3SBKA 1GBTA 1SOZA 1NRQH 2F9UA 1C5NH 3T29A 3UR9A 4X2WA 4A1XA 2AMPA 1AKSA 4O03A 4AFUA 1MTUA 3STIA 2HPQH 3TPIZ 3ODDA 4Q2KA 5T6GA 1LKBA 1RIWB 3IG6B 2OC1A 1WQSA 3GDUA 1INCA 2UUJB 1C2GA 3MMGA 1C1WH 1EZXC 3A81A 3O8DA 4R8TB 3BTHE 2BLQA 1GJ5H 2YNAA 1GBKA 1O5EH 4WJG2 3STJA 1DOJA 1C5PA 2BD5A 1Y3WA 1OP0A 1LPZB 1N6XA 1Y3UA 1XKAC 1BJVA 1YPGH 4NGAH 3HKIB 3LOXA 1KTSB 1NC6A 4B75A 1GGDB 1E0FD 1OWKA 3KQDA 5EXMA 3DHKH 4ABBA 1DLEA 3UREA 3SV8A 3P8GA 1QQ4A 1TWXB 4BAHB 1GBEA 2Q6GA 1T8MA 1KSNA 1NPMA 1P2MA 2B7DH 6GCHG 2FYQA 2SNVA 3DA9B 4XDEA 2EI7A 1KXCA 4FUHA 2G51A 1TA2A 2KAIA 1B5GH 4ABHA 6CHAC 3UNSA 3RXBA 1S81A 1G3DA 1O2UA 9ESTA 3A86A 2AERH 1V2PT 1OXGA 3LGVA 2SGAA 3H7OA 1JRSA 3M37A 3LC3A 4BXWA 1LHGH 2CF9H 3SJOA 1YPMH 1W0YH 2ANMH 3PO1B 4NFEA 2TIOA 5IDKA 2BXUH 2WPKS 4YT6H 1L4DA 4IMZA 5E0JA 1XUKA 2VGCB 4WMDA 3SJ8A 3AASA 3MU1A 3TGKE 1TOCB 1GJ8B 1EP5A 2BD9A 2PSYA 1ZJKA 1BHXB 7KMEH 1BRAA 1WOFA 2HRVA 4MNYA 2CHAC 3ZZ8A 1AI8H 3P17H 1V2ST 1C1MA 1V6DA 4CRFA 2BVRH 2SGQE 1UVSH 1J14A 2STBE 1SOTA 2D8WA 5AFZH 4X8UH 3EDXB 3LT3A 4CHAC 5EQSA 1EOLA 1MTNB 1THSH 3TK6A 4TYDA 1BBRK 4UEHH 2SFAA
chains in the Genus database with same CATH superfamily
5J4QA 1MAYA 1GHWH 4AG2A 1DWCH 1O3OA 1O5FH 2D26C 3F1SB 8GCHG 3URDA 1GL0E 3RXCA 2FI5E 4BAMB 2ZU5A 1L0ZA 5LPFA 4FUBA 2VWMA 3UOPA 1UVUH 3ZVGA 2ANKH 4FUEA 4K3JA 3U69H 1HCGA 2XBVA 1EX3A 2ZGBH 1GI7B 4NIYA 1BRUP 1KLTA 3UOUA 1Z8RA 1MQ5A 3DSOA 1CBWC 1BMNH 1WTGH 2Q1JA 1BTZA 5ETXA 3ZZ4A 1GMHF 1UCYE 1PPGE 3QO6A 3RXUA 1ZTJA 3UIRA 3E0NB 1TX8A 4CRGA 3SHCH 1FAXA 4X2XA 1BRCE 1O2VA 2J97A 4KELA 3TLOA 5EXNA 3DD2H 1JBUH 2A31A 3MU5A 3BEIB 1HJ9A 1COWD 4D9RA 2QF4A 1O2PA 1W11U 4X8TH 2HGTH 3BTWE 3MH7A 1QRXA 3SGBE 2BY8X 1OYTH 3BTEE 3ZZ5A 1O5AB 2QF5A 2F83A 4CR5A 1BT7A 1KDQB 3EE0B 2THFB 5C67A 1DFPA 1TPPA 3KF2A 1YYY1 4JZ1A 3S7KB 3UR6A 1WSSH 1IHSH 1VJAU 4ASUD 1WYKA 1BTPA 3ATIA 1Q3XA 3D49H 3GDVA 2KCOA 3F2FA 1FY3A 4MPXA 3W95A 1V2OT 1ZTKA 1MKXK 4DT7B 1GBFA 2OC7A 5F53A 1OHHD 2RDEA 2J92A 4TWYA 1OKXA 4E7RG 1GG6C 4ZMAH 4I33A 1BTUA 3SYJA 2ZDVH 4D7GA 1OWIA 4M7GA 3JZ2B 4U01A 4Y0ZE 3SQEE 2A32A 2ZNKH 2C8WB 8LPRA 1D3QB 3BG4B 4B2CA 4FUJA 4DG4A 1ZPCA 2FYRA 4IBLH 5FBIA 3VXFH 4GLYA 3PM3A 1QQUA 2STAE 2XRCA 3GY2A 1O0DH 2TPIZ 2HNTF 5CE1A 1J8AA 1QA7A 2VU8E 2ZHQH 3A8CA 3UQOA 5A8ZA 4JZDH 4BOHA 4NIVA 4ISNA 2W26A 1O2LA 1FDPA 3P8FA 1SQRA 5KECA 3F9HA 1O3JA 1NROH 3LDXH 3K6YA 4MLFB 2CK3D 2OD3B 5EJLA 2G8TA 2O8LA 1NRNH 1P57B 1C1PA 2AMDA 2VB0A 1JIMA 1E35B 3RXVA 2GJGA 4O3TA 1A3EH 1BMFD 1GBCA 3A7WA 4MPVA 1TNLA 3R3GB 4QT8C 3FANA 2CJIA 1NT1A 3BG8A 4ABGA 1HXEH 2ZFQH 3E16B 2OC8A 2WHXA 1O5BB 4O9VA 1PPEE 1F0RA 3BTQE 3E8LA 2PKAA 2OINA 3CNRA 2HLCA 2P94A 1W13U 1C5TA 1PYTD 1D3TB 2BZ6H 3BTGE 4AC9A 1CGJE 1P05A 1TQ7B 1P02A 1HB0B 1GVLA 1QNJA 2GDDA 2WSSD 1VITF 4K8BA 1HV7A 1G36A 2BX3A 1W10U 3MU0A 2H6MA 2TGDA 1GMDF 2WV9A 1QCPA 1ESAA 1FZZA 2BY6X 1GBLA 2FI4E 3U8OH 2F9PA 5LH8A 4R0IA 1PPHE 1L1GA 3GDSA 2A7CA 1OYQA 4WXVA 1BOQA 3NXPA 1QTFA 1SL3A 1XMNB 3M7QA 2D2DA 1QZ8A 4FUDA 1SGTA 1Q31A 1ESTA 4F49A 1K0HA 2FS9A 2GZ9A 2LP6A 3KNXA 1ZHRA 1GDQA 2KX4A 1KDQA 2PGQB 3PLPA 2Z9GA 3L3TA 5C3NA 3QZQA 1XKBC 1C2LA 3VGCB 5DPAA 2UWOA 1HAPH 1AWFH 3MU8A 2A2QH 3F2HA 4IS5A 3DFJA 4NIWA 1D3DB 1OWEA 2ZTYA 3PROA 5C20A 1N8OB 3VB4A 2GTBA 5JBAS 3M7UA 1AY6H 3FN8A 1HGTH 2BLWA 3D62A 2XC5A 1W8BH 1GBHA 1IHTH 4Z1MD 1EZUC 2ZIQH 4WMFA 1EXFA 1BHXF 4OS5A 2H5CA 1E36B 1YLCA 2NU3E 1O5DH 3SU0A 2NU4E 1C2FA 4KTCA 5FPTA 2XC0A 4CRBA 1ELBA 1O3EA 4ZHMU 2F43B 3M3VA 2XOKD 4B6EA 1E37B 4CRDA 3FZDA 5DSFA 4DIIH 1MKWH 1FIZA 4K2YA 2BM2A 2Y6TA 1HFDA 3T62A 2R9PA 1D6WA 3U1IB 2Y82A 1PQAA 1MUEB 1GJ6A 4FETA 1ZRKA 1K1NA 5DJ7A 1FLEE 4WWYA 1S83A 2BOHB 2HWLB 4D9QA 2TRMA 2RA3A 3FVFB 2XBXA 4Q7ZA 2IJOB 5FX6A 2GDEH 1ZMJA 2ALVA 1IQFA 4I32A 1WDIA 2ZFTA 2G4UA 2Z9LA 1SQAA 2OBQA 2BY5X 4RKOB 2I6QA 3T25A 4BTIB 3SNEA 3EYDA 2Z3CA 3IITA 2QXIA 4F55A 3RC6A 4FUGA 1K1LA 3TH4H 4DCDA 1WU1A 5B6LA 2FOFA 3DFLA 4WF8A 1TE0A 1V2MT 1DE7H 3Q00A 1ELTA 3PV4A 1VCWA 4FU9A 5A8YA 4INLA 2JJ1D 4ZAEA 1G30B 4Y71A 5A0AE 3V13A 1LPGB 1IQHA 3B8JA 2PWXA 2WV4A 3OEED 5AF9H 1GHVH 3SU6A 4IC6A 4XD7D 1SGPE 1A3BH 4IN2A 5I25A 4J2YB 2IOTA 1GI1A 4FUFA 1ZMLA 5HXFA 1KY9A 4FU8A 3LGTA 2ZDLA 3SHAH 1DS2E 1H4WA 2BDCA 4ZUHA 2VH6A 1VCPA 1MKXH 2EEKA 2RG3A 2CXVA 1FV9A 2R0LA 3URCA 1DX5M 1BTXA 3V0XA 1C2IA 6CHAB 3PMHB 3RMMH 1S6HA 4H4FA 3ELAH 1O3AA 4ISOA 2BY9X 4XBDA 5L6NH 3K6ZA 1T7CA 1CGHA 1HXFH 1EJMA 3A89A 1AD8H 4MVNA 1GVKB 3UAIC 2QCYA 1P2IA 2VIDA 3S9BA 3NKKA 1GDNA 4WH8A 1AFQC 1XVOA 3ZVAA 3ZZ7A 4YXWD 1LVMA 3RXFA 2BDAA 1C2KA 1P03A 1SPJA 5T1VA 1AN1E 1UW7A 2J2UA 4NWLA 2CHAB 2FX4A 1ACBE 1S6LA 4OM9A 5CMXH 3MO3A 3BSQA 1TNKA 4LK4A 3RDZA 1FY4A 5HM9A 3KEEA 1CSOE 1NU7B 3T26A 4CHAB 1P3CA 3PWCA 4U32A 3UTUH 5CDFE 2I6SA 2GP9B 5JYIA 1AU8A 4OGYA 2XC4A 2BD7A 1QFKH 1ZLRA 2Z9KA 2ZFRH 2OP9A 5T6FA 2Y5HA 5FPYA 4CBOA 3SJIA 3CENA 3ZVFA 3MU4A 3PWBA 4P02A 3SGAE 1MU6B 1F5LA 1ELFA 4X2VA 4TPIZ 1T8NA 3PLBA 3D23A 3MHWU 3TITA 4H42U 3QDZB 3M36A 1D4PB 1ZPBA 2FTLE 4ACBA 2FIRH 5BRRE 4B76A 3HGPA 5GNDA 2GVFA 2A4QA 3F9EA 1CBWB 2R2WU 4NZLA 1GJBB 4Y8YA 1TALA 2BLVA 4XRNA 1PQ5A 1IQGA 1SG8B 1QJ1B 1ZPZA 8ESTE 2ZG0H 3F9GA 1GMHG 2GCHG 2BQ6B 2R0KA 2Z6BD 1LHDH 1WBGB 1GWAA 3RMNH 1L2EA 5HIYA 3SV6A 3GCOA 4IMQA 4Y8ZA 3RXDA 3T2NA 4K1TA 5L30H 1UK4A 3GCNA 1S0QA 7LPRA 2BDHA 3TH3H 5HM2A 3S9CA 1RTFB 2PLXA 4IW4E 2GT7A 1BMAA 4FXGH 1WAYB 1GBBA 2VJ1A 4TPYA 1K1OA 3ATLA 2BVXH 1SMFE 4Q63A 3SU3A 1TOMH 1W14U 2XBWA 3SOSA 1GJAB 1HNEE 1LKAA 1O39A 1SC8U 3NPSA 5FPSA 1QB6A 3SZNA 2P16A 1VITH 2IJD1 1ORFA 5DP9A 1SLXB 3A84A 1MZDA 1QBOA 1GG6B 4UFFH 1GHAF 2ZDAH 5DP3A 1EKBB 2BHGA 3DUXH 2ALPA 5AFYH 2G00A 2GX4A 2CF8H 5A2MH 2H9TH 5DP4A 3EQ0H 1UTNA 1GI2A 1C4V2 2YMSC 1C1RA 3C27B 1O3HA 2Z94A 1GHBF 4TSFD 3AAVA 1ZMNA 3A8DA 4ABDA 1ABJH 1C2HA 3A83A 4F4OC 1IQKA 1VJ9U 2FOHA 2IPHA 1S82A 1HAXB 2ZU3A 3MWIU 1SLWB 1UHBA 3TNTA 4RT0A 2P8OC 4NA7A 2PP6A 3MTYA 1TYNA 2BLOA 2L6OA 3LC5A 1WQVH 2QE7D 1A7SA 1P2NA 3AK5A 5AHGH 2JH0D 1E79D 2FOEA 4INHA 2H5DA 2ESTE 3A87A 1H8DH 4Y7BA 2V3MA 2VIQA 5TCCA 3S69A 1HAZB 3M5OA 1LVBA 5FXLA 2YOLA 4B74A 4H6TA 2BVSH 4AYVB 2O8MA 2ZTZA 2BDGA 4Y11E 1SGYE 3RXAA 2GZ7A 1O2GH 4AORA 3EA7A 2ZA5A 4B1TA 1O3FA 3GY8A 1Y3YA 3F0PA 4AG1A 1WV7H 2PFEA 3SQHE 5GCHF 1DITH 1SGFG 4FUCA 1ARBA 2VINA 1FXYA 4SGBE 3QLPH 4AB9A 1HDTH 3I29A 1UTLM 3VB3A 1MTWA 5DP5A 1IQNA 2HOBA 2QXGA 1O2NA 4O3UA 2PR3A 1PJPA 3A8AA 1SGEE 3VB5A 1K9OE 3ODFA 1GBJA 2C93B 1Z7KA 4IC5A 1O34A 1V3XA 4NZQA 1G9IE 1TQ0B 3DCLA 1QIXB 1AUTC 2VWNA 2XYAA 1TABE 1TONA 2VWLA 1VITG 5C1XA 3RLYH 3B9FH 1GMDG 1SVPA 1O2MA 1HAVB 1FPCH 4MNXA 2ZDNA 1BDAA 1QL9A 4Y7AA 1M9UA 4ESTE 2CV3A 2FP7B 3SZEA 2LNCA 3T27A 3A7TA 1JOUB 2A5AA 5GXPA 2FESH 1ZRBA 4VGCC 1A0HB 1MAXA 2P95A 1DM4B 4ZXYH 3G01A 1FN8A 1TAWA 4MQAA 4X2YA 2OQUA 4A7IB 1C9TA 1YM0A 2UWLA 1XX9A 3E91A 3ZZAA 3VB6A 1K28D 2Q6DA 1UK3A 5DO4H 5C5NA 1IQJA 4GPGA 2ZEBA 4MPWA 1BMLA 2A5KA 1P3EA 1KXEA 1ANEA 4OS1A 5E8EH 3SUEA 1C1UH 1NESE 1E1RD 1LHEH 3GY5A 2J4IA 2WUBA 4KKDA 1SGFA 1IQMA 2GCHF 2KR7A 1ZSKA 1K1PA 2BDBA 1F2SE 1K21H 4K5ZA 4INKA 1G2MA 1HAOH 3ATMA 2FOBA 1ZHPA 3KN2A 2TGAA 3MO9A 1C5WB 4BANB 3PTNA 2GGVB 1FPHH 2ZGJA 3SNAA 3QTOH 3KL6A 2PUQH 3TNSA 2Q6FA 1SKYE 2CN0H 5EIYA 2V3OH 2M5TA 1K1IA 3M5NA 3MNBA 1YCPH 1MD8A 3SV9A 1ELAA 1TX6A 3RU4E 1ELCA 3ATWA 3U1JB 3B23B 1W7GH 1C2EA 1QBNA 1B0EA 4FVDA 3KHVA 1IQIA 1SHYA 1K22H 4Q7XA 4A6LA 4B73A 4D8NA 1C5ZB 2Y80A 2GKVE 2ZWLH 1J9CH 3U9AH 4B71A 4NG9H 1DWEH 2F9BH 4LOYH 1ZJDA 4ABAA 1J15A 1BIOA 4JYTA 2OBOA 2XWAA 2JETC 1W7XH 1GI3A 1AMHA 1SSXA 2BD2A 3PTBA 1TMUH 4MPUA 1FAKH 3MH4A 3TGJE 1ZGVA 2SGDE 1TBRH 3K2UA 1TNHA 4UFGH 1H8IH 2OTVA 1BBRE 2A7HA 3MNXA 1ZYOA 5GDSH 1GI5A 4RSPA 4X1PU 1O30A 2VIPA 2ZPRA 3FO8D 3CS0A 3ZVDA 4MG3A 3KYFA 1P2JA 1GCTC 3FFGA 4DVAU 2R2MB 5FCKA 3T5FH 1LHCH 1IAUA 3C1KA 4ZHAA 3SI3H 8KME2 2O8UA 4Y79A 4ASHA 3SNBA 4XBBA 1NRSH 1S6FA 4OS6A 2RCEA 3GCHC 1V2VT 1DSUA 4HGCA 1B7XB 4I8KA 5HYOA 1LPKB 1XUHA 2GMTC 2W6JD 2OC0A 4ISLA 1SFIA 2RDLA 2UUFB 4Y10E 3WWFA 3F0OA 2ZCKP 1EOJA 2ZDMA 3QN7A 4BXSA 1HAVA 1XUIA 1TLDA 2OQ5A 4XBCA 1DLKB 1A5IA 1P04A 2QIQA 2OK5A 1O2KA 1ZSJA 5H4IB 3BEUA 4JZIA 5JBBS 5ESBA 4SGAE 4ABJA 1AIXH 3SV2H 1ZGIA 2ZHDA 5EGMA 1DDJA 5C17A 1TPAE 2JKHA 2ZHFH 5EOKA 3IWMA 1YGCH 1EJNA 1MBMA 2F9NA 1AFQB 1GDUA 2G52A 1A2CH 2QA9E 3K9XB 1QA0A 3M7TA 3ZVBA 2VVUA 1NM6A 1DXWA 1FMGA 2XCFA 4MDSA 4DJZB 5F8TA 2B8OH 1UTMA 1C5QA 3MH5A 3LH1A 4MNVA 1TRNA 1W0KD 5E2OA 1A0JA 4Y8XA 1DUAA 3UWJH 2WUCA 1XXDA 2ZC9H 3BTME 2J9NA 2BX4A 2TBSA 2F9VA 5DKMA 4AYYB 1YCPM 2XXLA 2FLBH 1EASA 2A0QB 2XWBI 1O3KA 2VVCA 1DWBH 1RTLA 2J95A 2RFKC 2WPIS 2QV1A 4X6MA 4DIHH 1EFRD 3ATKA 3TJNA 1GBIA 4F48B 5T6DA 1BA8B 3I78A 1SHHB 3BV9B 4X0WU 1SGDE 3FP6E 5CHAC 1SLVB 1ZZZA 2H9HA 2BD4A 4TT3D 4MTBA 1GJ7B 2ODQA 2W7UA 7ESTE 1EP6A 1O2IA 1GHXH 3W1EA 1G3CA 1Y8TA 3OX7U 5LGOA 4NFFA 2HVYB 2SNWA 3BTKE 1P01A 2J34A 3VB7A 5JB9S 2ZU4A 2A4GA 1RXPA 5DGJA 1OX1A 3RXLA 3LGWA 4YT7H 2UUKB 4BNRA 2GCTC 1YPJH 1ETSH 3LONA 1KLIH 1C1TA 2KCAA 4K1EA 1XUGA 3TK9A 1U6QA 1WTHD 1Z6JH 1G2LA 4IGDA 3RXHA 3H09A 1KXDA 1KTTB 4BAQB 1C5VA 4FVBA 1YPHC 3M5MA 1CVWH 4ZKNU 3RXIA 1Z1JA 3A7ZA 1O3GA 1ELGA 1GJ9B 3A7YA 2FTMA 3GY3A 2ZI2H 1BJUA 2FOAA 1RJXB 1LCYA 1BBRH 1C1QA 1QRZA 1EZSC 2F91A 3UQVA 1D9IA 1W3CA 3ZZDA 1N6YA 3WW7A 2Z9IA 2ZTXA 5K7RA 2SGFE 1O32A 1SGNE 4JMYA 3R0FA 2UWPA 5C1YA 2FI3E 1FI8A 1SGRE 1Z71A 1OOKB 2W6ID 1GHAG 1PPFE 2YMSB 4AOQA 1T8OA 4DW2U 3BIUH 4LZ1H 2G5VA 1GVZA 1T4UH 1AVWA 1PYTC 2KCYA 1RD3B 1TRYA 2AGIX 4YM9A 3ZVEA 1GHBG 1Y3VA 2HLDD 5EPNA 1B0FA 2WYJA 3SNCA 1O3LA 2JDID 4DURA 1V2LT 3BIVH 2P8OB 3V7TA 3A85A 2AH4X 5C5OA 3VEQB 3GY6A 4AFSA 4ABIA 2ZU2A 1GJCB 3LPRA 3LKWA 4KTUA 1GJDB 1G3BA 4OS2A 4HFPB 3CP7A 1V2KT 1LDTT 4YTAA 3EA9A 3LGYA 2JH6D 3RXQA 1VR1H 1O2QA 1EB1H 4BAOB 3TGIE 2KM0A 5JDUB 3TU7H 2JH5D 5F03A 1A1RA 1KLJH 1BCUH 2YNBA 1FY1A 1RS0A 4ABEA 1TBZH 3OFND 1AQ7A 3HPTB 5JB8S 2BYAX 1O2SA 1ELDE 3M61U 3SV7A 1THRH 3A82A 1EJAA 1JXPA 1NBME 1V2QT 2ODYB 5GCHG 3A88A 5FL7D 3MQKC 1OP2A 3SNDA 1C5LH 2ZQ1A 1DY8A 1DY9A 1O31A 1Z6EA 4X1SU 1LHFH 5HGGA 1RGQA 3OY5U 3SN8A 3HK3B 2HVXA 2J98B 4NCYA 1G32B 3PV5A 2BY7X 4YOJA 1P2KA 3QGJA 1SFQB 1N1LA 1AO5A 3GS9A 3NCLA 4K69A 1LTOA 1C5SA 1A0LA 1HBTH 3RU4D 3O8BA 4YLQH 2BOKA 1DICA 2ZECA 1H1BA 4I8JA 3UWIA 2K8IA 2FPZA 3RM0H 3S7HB 2ZCHP 3UUZA 2R3YA 4XFQA 4ZKSU 2QN5T 1EZQA 3AAUA 4ZHLU 1FONA 2EA3A 1UO6A 2C90B 4VGCB 1OSSA 2P3FH 5A09A 4YOGA 1MTVA 3TJVA 1C4Y2 1Z8JB 2F3CE 4X1QU 1F0UA 1TIOA 2C8YB 4GSOA 1GMCF 2PGBB 1SLUB 1TNJA 2IN2A 1XUFA 1C1VH 1FNIA 1UVOA 2R3UA 5JPMH 1O3PB 3RXKA 2DUCA 3U8RH 2ZHEH 1K1JA 1NS3A 2B5TB 2C4FH 1OWJA 2XNDD 1O2ZA 2KAIB 3ZZ6A 2EQNA 5G4BA 1XVMA 2Z3DA 4B2BA 5L2YH 1IOEA 2A7JA 3LH3A 1HAHH 5F8XA 3SUGA 1O36A 1BUIA 1JRTA 2J38A 1QL8A 2KFWA 2H2ZA 1LQEA 1GBAA 1MCTA 2HALA 1CU1A 3TK5A 2EI8A 1V2JT 4I86A 3GY7A 2OUAA 5TCAA 1JIRA 1L1JA 1V2WT 2VH0A 1C1SA 1HAIH 1EB2A 2ZP0H 1BRBE 4I31A 1Z1IA 4WH6A 4A1VA 1TGTA 1EPTC 1PFXC 1TB6H 1UTJA 3TH2H 2ZGHA 1TX7A 4NWKA 3SJ9A 1FX0B 2KZ4A 2G4TA 4A92A 1O3CA 3O8CA 2AGGX 4FOUC 2JETB 1HYLA 9LPRA 4BTUB 4GVUA 1ETTH 3P8OA 2GT8A 1AZ8A 4XSKU 3F9FA 1O2TA 3ZV8A 2GZ8A 1UJ1A 4U30A 3N99A 1VGCC 3SU1A 4JK5A 3PMAB 1W2KH 3FAOA 2QXJA 3T28A 1SR5C 3GCTF 1KXAA 3GYMA 2QXHA 1NO9H 2FM2A 1GCTB 2RA0A 3RXTA 1F5KU 3SUFA 2QYIA 2DE8A 4AGKA 3A8BA 4OS7A 4GCHF 3ITIA 2A45B 1Y3XA 2BB4A 3S0NA 7GCHF 1TGCA 3PB1E 4GHTA 3GCHB 1C5MD 1C5OH 2J98A 2BMGB 1O2YA 3LU9B 4KP0A 2GMTB 2W3KA 1AB9C 2FS8A 3Q3KA 3M3TA 4NIXA 1YC0A 1PPCE 1BZXE 1C5YB 3FOAA 1O2RA 1TPOA 2UUYA 5FBEA 3SJKA 2FEQH 1DUEA 1HRTH 1O2XA 5HMAA 3Q77A 2ULLA 4THNH 1CA0C 2FDAA 4CRCA 1Y5AT 2BZAA 1GI8B 4ZXXH 1O2HA 5HIZA 2GV6A 1SGCA 4X6PA 3D65E 1SB1H 3K65B 2K1QA 2PSXA 1SQOA 2AEIH 5A0BA 1E38B 1A61H 1FIWA 3U28C 5E2PA 5DP8A 3FKSD 3LJOA 2PW8H 3NWUA 4PROA 1MH0A 4E06H 4UE7H 1PPBH 2C3SA 1LQDB 2FLRH 3PV2A 5ABWA 3L6PA 4CBNA 2VNTA 2QF0A 1UCYK 3F2GA 2IPQX 1O37A 2WZQA 5DP6A 4I8GA 1AVXA 1HJAC 1TGSZ 3L33A 3M3SA 3ZZ3A 5A0CA 2CMYA 1C2DA 1A46H 3N7EA 4NSVA 1EQ9A 1O2WA 5L2ZH 2A1DB 5SGAE 4Q7YA 4CR9A 3SGQE 1C5UA 1GBDA 1XM1A 3OU0A 1OWDA 5CHBA 3QK1A 1FY8E 3E1XB 3KQCA 1V2UT 2G5NA 3M35A 1DVAH 1C5RA 2PTNA 3FP8E 2WINI 2NU1E 1UK2A 1F0TA 5CHAB 2ILNA 1CE5A 5K0HA 1BQYA 4UDWH 1D6RA 3OY6U 3CS7A 1EUFA 1S84A 1LO6A 1MABB 1AE8H 5EPYA 5IYTA 2ZFPH 3FP7E 3ZZCA 5JBCS 4RI0A 1SQTA 3U8TH 1NFXA 3TJOA 3UY9A 2V35A 3KCGH 3OSYA 1E1QD 5E0HA 1GHYH 2BDIA 1MKWK 1Y5UT 1WCZA 1SGIB 1ELEE 2GCTB 1HUTH 2OCVB 3BN9A 1Z8GA 1NRRH 1MBQA 3BTDE 3KQBA 1WUNH 1RRKA 3SU2A 1GI6A 1Y5BT 1CGIE 3ZVCA 3UB0A 4Y0YE 1RFNA 2PKAB 2QAAA 1YP9A 2B9LA 3N7DA 3SU5A 4AFZA 4YZUA 2ZZUH 3I77A 2P93A 3QTVH 3U98H 1FJSA 1FY5A 3N7OA 3BTFE 1P2QA 3P95A 4K60A 5TJXA 1P8VC 5F6MA 1EATA 4JYVH 2ZF0H 3RLWH 4B2AA 3RXSA 3WY8A 4P00A 2VBCA 3UPEA 4JZFH 1NBMD 1PQ7A 1ZSLA 4X8VH 3KIDU 5F8ZA 2VIOA 3HATH 1J16A 4I7YH 1T32A 1DSTA 1GPZA 1O3NA 3P6ZB 4O97A 3O8RA 2TGTA 4X1RU 3EAJA 2HNTC 3VPKA 2ZKSA 2F9OA 4DGJA 4UONA 4HG6A 1S5SA 4YO9A 1K1MA 5BPEA 3RU4T 1QY6A 1XXFA 4K8YA 3PMJA 3Q76A 1HIAB 5EODA 1O5CB 2PKSC 1P9UA 1DWDH 3W94A 1IQEA 4BTTB 4D76A 2P3UB 5DK1A 1EAIA 5A8XA 1QR3E 1NN6A 2OXSA 2FOMB 4MNWA 3E0PB 3PRBA 1EAXA 1X7AC 1CHOF 5E0GA 1YBWA 4GHQA 2Y5FA 4TY7A 1O2OA 1GL1A 4E05H 5FX5A 2P59A 2BDYA 4DT4A 1AWHB 2AIPA 5J4SA 1ID5H 3SORA 2Z7FE 2BXTH 3E6PH 1ZOMA 1DXPA 1F0SA 2VIVA 4RKJB 1H8HD 3F68H 3LGIA 1V2RT 1XUJA 4TWWA 3ZZBA 1MZAA 2ZGCA 4D7FA 3PYHA 1BB0B 2AS9A 4DOQA 1YLDA 1RIWC 3AVZA 2ZDKA 1VCQA 1S0RA 1FUJA 5IK2D 1D3PB 3DSPA 3MI4A 5FAHA 3E3TA 1EAUA 4M9FA 1DANH 1THPB 4CREA 1S85A 5C0TA 2ANWA 2EC9H 2SGEE 4ISHH 5EW2H 2J94A 2V6NA 5EW1H 1QL7A 1TMBH 1YPEH 1IQLA 4J1YA 3P92A 5EG4A 2XNIA 3HKJB 6GCHF 1J17T 2A4RA 4X1NU 1GGDC 4RN6A 4B6FA 1L4ZA 1KIGH 1P12E 1W0JD 4U2WA 2QC2A 1KXFA 3RC4A 2KCPA 2Z9JA 4ISIH 3RUOA 2Y5GA 4CRAA 1JWTA 3S9AA 4X6OA 3M5LA 1CO7E 2W3IA 1UVTH 3NUMA 2NU0E 1QHRB 4NA8A 2ZHWH 3SO3A 5JBTA 3ZZ9A 3P70B 4Z6AH 1LVOA 4HTCH 2W5EA 1JMOH 3LJJA 2FOGA 3ENSB 1O38A 3PO1C 3QX5H 4AZ2B 1GI4A 1GI0A 2JJ2D 1WXRA 1K2I1 3MOCA 3PMBB 2VGCC 3OTJE 3QWCH 1T4VH 1GMCG 3UNRA 1QJ7B 1UVPA 1CHGA 1KXBA 3HK6B 3AW1A 1YF4A 4DY7B 3H7TA 1C1OA 1C2JA 1GCDA 1P0SH 3A7XA 2K0QA 4TY6A 2PUXB 1UCYH 2WYGA 1SBWA 3ZYEA 1LVYA 1MTNC 4XOJA 1C9PA 4WY3A 2BD8A 5B6OA 8GCHF 1OPHB 2W7SA 4CH8B 2JIZD 2QY0B 1TPSA 6ESTA 4YLUA 1AE5A 3OTPA 3TJUA 1HIAA 3QUMP 1NRPH 5DP7A 4Z0KA 2PHBA 5LPEA 5EJ1A 2AGEX 3TVJB 4AB8A 2VIWA 3HGNA 4Q80A 1Q2WA 1Z8IB 4X6NA 5EJZA 2ZU1A 2A4OA 1NFUA 2SGPE 3UNQA 3SI4H 4AGJA 1UTKA 2G55A 1YY3A 2D1JA 1F5RA 1EPTB 1F92A 2WPJS 1O3DA 3F6UH 3ZYDA 1C5XB 2HNTE 3FZZA 3OAAD 3Q3XA 2V0BA 1UMAH 1Y59T 1C4U2 4WXIA 3EGKH 3AW0A 5EQRA 1EAWA 3OE7D 5FHTA 4GAWA 4JYUH 3BF6H 2AIQA 4UD9H 4ABFA 2Y7XA 2GV7A 3RMOH 3MNSA 3KQEA 1P09A 1VGCB 2ZQ2A 1NFYA 1CT2E 1NY22 2ZPSA 1HPGA 4X8SH 3LIWA 2VWOA 2AMQA 1DPOA 4XE4A 5KEDA 1ANDA 5EXLA 3NK8A 1ELVA 4ZKRU 1BMMH 2BTCE 3GISB 3RXPA 3GCTG 3PLKA 1O33A 3MYWA 1HJ8A 1FQ3A 1MMJN 2O9QA 4UFEH 4ZROA 4GCHG 2A5IA 1UTPA 4BAKB 5DG6A 1GBMA 3MNCA 7GCHG 3GOVB 2ZGXH 1G37A 1HAYB 2A2XH 1AB9B 2BQWB 1YPKH 5LPRA 1V2NT 3Q3YA 1O3IA 3NZIA 3JZ1B 4Y6DA 3SUDA 3WWBA 4KGAA 1T31A 2PTCE 2FMJA 1CT4E 3UFAA 4LZ4B 1NZQH 2QF3A 3H5CB 3RXOA 1QBVH 3KQ5A 1OWHA 2ZFFH 4JK6A 3RXMA 2ODPA 3EA8A 1CA0B 2M2AA 3BG4C 1TA6A 3ESTA 1H9IE 3MO6A 1BTHH 1VZQH 3RXGA 1NTPA 1QB9A 4Y76A 1QJ6B 5I46H 1NFWA 1ANCA 5AVDA 1ANBA 1NU9A 1ABIH 2G81E 4AX9H 1P11E 1A4WH 3A80A 2WV5A 1C2MA 1MTSA 4YESB 4Q4LA 4YOIA 2WPMS 1KYNA 2ZPQA 2OLGA 1TBQH 2VVVA 1AGJA 1YPLH 2NWNA 1P9SA 2C8ZB 1A5HA 1TNGA 2FOCA 1P06A 4ACAA 1BITA 1H9HE 1G3EA 3QGNB 5GPIB 1RTKA 1OS8A 1TMTH 4GUXA 1HJAB 2PV9B 4OGXA 2P3TB 1W0ZU 5T3HA 1AKSB 2HPPH 1TGNA 3RXRA 6LPRA 3SW2B 2V3HH 2C8XB 2B0FA 4FUIA 1SGQE 3MFJA 1QB1A 5GJ4B 4NA9H 1V2TT 2FXRA 2ZCLP 1UHBB 4NSYA 4RT1A 3RP2A 1C1NA 1L1NA 2WPDD 2YMSD 2ZFSA 1O5GH 2Y81A 2GD4B 4ZKOU 5C2ZA 1PQ8A 1AFEH 2TGPZ 1F7ZA 1AUJA 1TGBA 3KGPA 2QGRA 3QZRA 3ZV9A 4KTSA 1EPTA 2H1UA 4WMEA 2ZO3H 2O8WA 3DT0H 1ZHMA 4UFDH 3LGUA 2AFQB 2XCNA 3RXEA 1O35A 1GJ4H 1VKYA 4HZHA 1O3BA 1YWUA 2ASUB 5EQQA 3A7VA 1AZZA 1TFXA 2WPLS 1CQQA 3SU4A 1ZR0A 4OS4A 2F4LA 1O2JA 4IN1A 2NU2E 1CA8B 2O8TA 1CT0E 1YCPK 5C1UA 1QGFA 3VFEA 1FN6A 1A5GH 4E7NA 1E34B 1YPHE 2FO9A 1MCVA 3VXEH 4WVPE 1GHZA 2LPRA 1P10A 4HI3A 4CH2B 3RC5A 4AN7A 3RMLH 4A1TA 4JZEH 3VGCC 3GYLB 3BEFB 1BTYA 3BTTE 4A5TS 2BQ7B 2XBYA 2ANYA 1MD7A 1P2OA 3V3MA 1H9LB 5ESTE 5DN6D 1N8OC 2CGAA 2FWWA 2H9EH 2BD3A 1ETRH 1TNIA 3DSGA 1PPZA 5EU8A 1LMWB 1ZTLA 4ZH8A 3P8NA 3NRLA 1YKTA 4JCNA 1ESBA 3RM2H 3V12A 3GICB 2EI6A 2Y7ZA 2WPHS 3TIUA 5C94A 3OYPA 3KYGA 1ARCA 1MQ6A 2J5UA 4K1SA 1UTQA 4H6SB 4FU7A 1OP8A 1SI5H 2FZZA 3ZIAD 4ZCNA 2FX6A 1MU8B 1QURH 1KMHB 3MH6A 1DT2A 4LXBH 1HAGE 3RXJA 2PKSB 1TRMA 1W12U 2DE9A 2FODA 5GWZA 3GY4A 2AYWA 1T8LA 1GI9B 1O3MA 1AVGH 2V7QD 1HLTH 4I8LA 5C0UA 1BTWA 2XW9A 1QRWA 2XTTB 4I8HA 5GIBA 1AHTH 4AFQA 5PTPA 5FCRA 1UTOA 2Z3EA 1CHOG 3E90B 3SBKA 1GBTA 1SOZA 1NRQH 2F9UA 1C5NH 3T29A 3UR9A 4X2WA 2LELA 4A1XA 2AMPA 1AKSA 4O03A 4AFUA 1MTUA 1YLNA 3STIA 2HPQH 3TPIZ 3ODDA 4Q2KA 5T6GA 1LKBA 1RIWB 3IG6B 5HKKD 2OC1A 1WQSA 3GDUA 1INCA 2UUJB 1C2GA 3MMGA 1C1WH 3OEHD 1EZXC 3A81A 3O8DA 4R8TB 3BTHE 2BLQA 1GJ5H 2YNAA 3F3BA 1GBKA 1O5EH 4WJG2 5KGOA 3STJA 3PRDA 1DOJA 1C5PA 2BD5A 1Y3WA 1OP0A 1LPZB 1N6XA 1Y3UA 1XKAC 1BJVA 1YPGH 4NGAH 3HKIB 3LOXA 1KTSB 1NC6A 4B75A 1GGDB 1E0FD 1OWKA 3KQDA 5EXMA 3DHKH 4ABBA 1DLEA 3UREA 3SV8A 3P8GA 1QQ4A 1TWXB 4BAHB 1GBEA 2Q6GA 1T8MA 1KSNA 1NPMA 1P2MA 2AHME 2B7DH 2FYQA 6GCHG 2SNVA 3DA9B 4XDEA 2EI7A 1KXCA 4FUHA 2G51A 1TA2A 2KAIA 1B5GH 4ABHA 6CHAC 3UNSA 3RXBA 1S81A 1G3DA 1O2UA 9ESTA 3A86A 2AERH 1V2PT 1OXGA 3LGVA 2SGAA 3H7OA 1JRSA 3M37A 3LC3A 4BXWA 1LHGH 2CF9H 3SJOA 1YPMH 1W0YH 2ANMH 3PO1B 4NFEA 2TIOA 5IDKA 1H8ED 2BXUH 2WPKS 4YT6H 1L4DA 4IMZA 5E0JA 1XUKA 2VGCB 4WMDA 3SJ8A 3AASA 3MU1A 3TGKE 1TOCB 1GJ8B 1EP5A 2BD9A 2PSYA 1ZJKA 1BHXB 7KMEH 1BRAA 1WOFA 2HRVA 4MNYA 2CHAC 3ZZ8A 1AI8H 3P17H 1V2ST 1C1MA 1V6DA 4CRFA 2EY4C 2BVRH 2SGQE 1UVSH 3EE7A 1J14A 3VG8A 2STBE 1SOTA 2D8WA 5AFZH 4X8UH 3EDXB 3LT3A 4CHAC 5EQSA 1EOLA 1MTNB 1THSH 2L74A 4TYDA 3TK6A 1BBRK 4UEHH 2SFAA
chains in the Genus database with same CATH topology
5J4QA 1MAYA 1GHWH 4AG2A 1DWCH 1O3OA 1O5FH 2D26C 3F1SB 8GCHG 3URDA 1GL0E 3RXCA 2FI5E 4BAMB 2ZU5A 1L0ZA 5LPFA 4FUBA 2VWMA 3UOPA 1UVUH 3ZVGA 2ANKH 4FUEA 4K3JA 3U69H 1HCGA 2XBVA 1EX3A 2ZGBH 1GI7B 4NIYA 1BRUP 1KLTA 3UOUA 1Z8RA 1MQ5A 1CBWC 1BMNH 1WTGH 2Q1JA 1BTZA 5ETXA 3ZZ4A 1GMHF 1UCYE 1PPGE 3QO6A 3RXUA 1ZTJA 3UIRA 3E0NB 1TX8A 4CRGA 3SHCH 1FAXA 4X2XA 1BRCE 1O2VA 3TLOA 4KELA 5EXNA 3DD2H 1JBUH 2A31A 3MU5A 3BEIB 1HJ9A 4D9RA 1O2PA 1W11U 4X8TH 2HGTH 3BTWE 3MH7A 1QRXA 3SGBE 2BY8X 1OYTH 3BTEE 3ZZ5A 1O5AB 2F83A 4CR5A 1BT7A 1KDQB 3EE0B 2THFB 5C67A 1DFPA 1TPPA 3KF2A 1YYY1 4JZ1A 3S7KB 3UR6A 1WSSH 1IHSH 1VJAU 1WYKA 1BTPA 3ATIA 1Q3XA 3D49H 3GDVA 3W95A 1FY3A 4MPXA 1V2OT 1ZTKA 1MKXK 4DT7B 1GBFA 2OC7A 2J92A 4TWYA 1OKXA 4E7RG 1GG6C 4ZMAH 4I33A 1BTUA 2ZDVH 4D7GA 1OWIA 4M7GA 3JZ2B 4U01A 4Y0ZE 3SQEE 2A32A 2ZNKH 2C8WB 8LPRA 1D3QB 3BG4B 4B2CA 4FUJA 4DG4A 1ZPCA 2FYRA 4IBLH 5FBIA 3VXFH 4GLYA 3PM3A 1QQUA 2STAE 2XRCA 3GY2A 1O0DH 2TPIZ 2HNTF 5CE1A 1J8AA 1QA7A 2VU8E 2ZHQH 3A8CA 3UQOA 5A8ZA 4JZDH 4BOHA 4NIVA 4ISNA 2W26A 1O2LA 1FDPA 3P8FA 3F9HA 1O3JA 1NROH 3LDXH 3K6YA 4MLFB 2OD3B 2G8TA 2O8LA 1NRNH 1P57B 1C1PA 2AMDA 2VB0A 1JIMA 1E35B 3RXVA 4O3TA 1A3EH 1GBCA 3A7WA 4MPVA 1TNLA 3R3GB 4QT8C 3FANA 2CJIA 1NT1A 3BG8A 4ABGA 1HXEH 2ZFQH 3E16B 2OC8A 1O5BB 4O9VA 1PPEE 1F0RA 3BTQE 3E8LA 2PKAA 2OINA 2HLCA 2P94A 1W13U 1C5TA 1PYTD 1D3TB 2BZ6H 3BTGE 1CGJE 1P05A 1TQ7B 1P02A 1HB0B 1GVLA 1QNJA 2GDDA 1VITF 4K8BA 1HV7A 1G36A 2BX3A 1W10U 3MU0A 2H6MA 2TGDA 1GMDF 1QCPA 1ESAA 1FZZA 2BY6X 1GBLA 2FI4E 3U8OH 2F9PA 5LH8A 4R0IA 1PPHE 1L1GA 3GDSA 2A7CA 1OYQA 4WXVA 1BOQA 3NXPA 1QTFA 1SL3A 1XMNB 3M7QA 2D2DA 4FUDA 1SGTA 1Q31A 1ESTA 4F49A 2FS9A 2GZ9A 3KNXA 1ZHRA 1GDQA 1KDQA 2PGQB 3PLPA 2Z9GA 3L3TA 5C3NA 3QZQA 1XKBC 1C2LA 3VGCB 5DPAA 2UWOA 1HAPH 1AWFH 3MU8A 2A2QH 4IS5A 3DFJA 4NIWA 1D3DB 1OWEA 2ZTYA 3PROA 5C20A 1N8OB 3VB4A 2GTBA 5JBAS 3M7UA 1AY6H 1HGTH 2BLWA 3D62A 2XC5A 1W8BH 1GBHA 1IHTH 1EZUC 2ZIQH 4WMFA 1EXFA 1BHXF 4OS5A 2H5CA 1E36B 1YLCA 2NU3E 1O5DH 3SU0A 2NU4E 1C2FA 4KTCA 5FPTA 2XC0A 4CRBA 1ELBA 1O3EA 4ZHMU 3M3VA 1E37B 4CRDA 3FZDA 4DIIH 1MKWH 1FIZA 4K2YA 2BM2A 2Y6TA 1HFDA 3T62A 2R9PA 1D6WA 3U1IB 2Y82A 1PQAA 1MUEB 1GJ6A 1ZRKA 1K1NA 5DJ7A 1FLEE 4WWYA 1S83A 2BOHB 2HWLB 4D9QA 2TRMA 2RA3A 3FVFB 2XBXA 4Q7ZA 2IJOB 5FX6A 2GDEH 1ZMJA 2ALVA 1IQFA 4I32A 2ZFTA 2G4UA 2Z9LA 1SQAA 2OBQA 2BY5X 4RKOB 2I6QA 3T25A 4BTIB 3SNEA 3EYDA 2Z3CA 3IITA 2QXIA 3RC6A 4FUGA 1K1LA 3TH4H 4DCDA 1WU1A 2FOFA 3DFLA 4WF8A 1TE0A 1V2MT 1DE7H 3Q00A 1ELTA 3PV4A 1VCWA 4FU9A 5A8YA 4INLA 4ZAEA 1G30B 4Y71A 5A0AE 3V13A 1LPGB 1IQHA 3B8JA 2PWXA 2WV4A 5AF9H 1GHVH 3SU6A 4IC6A 1SGPE 1A3BH 4IN2A 5I25A 4J2YB 2IOTA 1GI1A 4FUFA 1ZMLA 5HXFA 1KY9A 4FU8A 3LGTA 2ZDLA 3SHAH 1DS2E 1H4WA 2BDCA 4ZUHA 2VH6A 1VCPA 1MKXH 2EEKA 2RG3A 2CXVA 1FV9A 2R0LA 3URCA 1DX5M 1BTXA 3V0XA 1C2IA 6CHAB 3PMHB 3RMMH 1S6HA 4H4FA 3ELAH 1O3AA 4ISOA 2BY9X 4XBDA 5L6NH 3K6ZA 1T7CA 1CGHA 1HXFH 1EJMA 3A89A 1AD8H 4MVNA 1GVKB 2QCYA 1P2IA 2VIDA 3S9BA 3NKKA 1GDNA 4WH8A 1AFQC 1XVOA 3ZVAA 3ZZ7A 1LVMA 3RXFA 2BDAA 1C2KA 1P03A 1SPJA 1AN1E 2J2UA 4NWLA 2CHAB 2FX4A 1ACBE 5CMXH 3MO3A 3BSQA 1TNKA 4LK4A 3RDZA 1FY4A 5HM9A 3KEEA 1CSOE 1NU7B 3T26A 4CHAB 1P3CA 3PWCA 4U32A 3UTUH 2I6SA 2GP9B 5JYIA 1AU8A 4OGYA 2XC4A 2BD7A 1QFKH 1ZLRA 2Z9KA 2ZFRH 2OP9A 5T6FA 2Y5HA 5FPYA 4CBOA 3SJIA 3CENA 3ZVFA 3MU4A 3PWBA 3SGAE 1MU6B 1F5LA 1ELFA 4X2VA 4TPIZ 1T8NA 3PLBA 3D23A 3MHWU 3TITA 4H42U 3QDZB 3M36A 1D4PB 1ZPBA 2FTLE 2FIRH 5BRRE 4B76A 3HGPA 2GVFA 2A4QA 3F9EA 1CBWB 2R2WU 4NZLA 1GJBB 4Y8YA 1TALA 2BLVA 1PQ5A 1IQGA 1SG8B 1QJ1B 1ZPZA 8ESTE 2ZG0H 3F9GA 1GMHG 2GCHG 2BQ6B 2R0KA 2Z6BD 1LHDH 1WBGB 1GWAA 3RMNH 1L2EA 3SV6A 3GCOA 4IMQA 4Y8ZA 3RXDA 3T2NA 4K1TA 5L30H 1UK4A 3GCNA 1S0QA 7LPRA 2BDHA 3TH3H 5HM2A 3S9CA 1RTFB 2PLXA 4IW4E 2GT7A 1BMAA 4FXGH 1WAYB 1GBBA 2VJ1A 4TPYA 1K1OA 3ATLA 2BVXH 1SMFE 3SU3A 1TOMH 1W14U 2XBWA 3SOSA 1GJAB 1HNEE 1LKAA 1O39A 1SC8U 3NPSA 5FPSA 1QB6A 3SZNA 2P16A 1VITH 1ORFA 5DP9A 1SLXB 3A84A 1MZDA 1QBOA 1GG6B 4UFFH 1GHAF 2ZDAH 5DP3A 1EKBB 2BHGA 3DUXH 2ALPA 5AFYH 2G00A 2GX4A 2CF8H 5A2MH 2H9TH 5DP4A 3EQ0H 1UTNA 1GI2A 1C4V2 1C1RA 3C27B 1O3HA 2Z94A 1GHBF 3AAVA 1ZMNA 3A8DA 4ABDA 1ABJH 1C2HA 3A83A 4F4OC 1IQKA 1VJ9U 2FOHA 2IPHA 1S82A 1HAXB 2ZU3A 3MWIU 1SLWB 1UHBA 3TNTA 2P8OC 4NA7A 3MTYA 1TYNA 2BLOA 3LC5A 1WQVH 1A7SA 1P2NA 5AHGH 2JH0D 2FOEA 4INHA 2H5DA 2ESTE 3A87A 1H8DH 4Y7BA 2VIQA 5TCCA 3S69A 1HAZB 3M5OA 1LVBA 5FXLA 2YOLA 4B74A 4H6TA 2BVSH 4AYVB 2O8MA 2ZTZA 2BDGA 4Y11E 1SGYE 3RXAA 2GZ7A 1O2GH 4AORA 3EA7A 2ZA5A 4B1TA 1O3FA 3GY8A 1Y3YA 4AG1A 1WV7H 2PFEA 3SQHE 5GCHF 1DITH 1SGFG 4FUCA 1ARBA 2VINA 1FXYA 4SGBE 3QLPH 4AB9A 1HDTH 3I29A 1UTLM 3VB3A 1MTWA 5DP5A 1IQNA 2HOBA 2QXGA 1O2NA 4O3UA 2PR3A 1PJPA 3A8AA 1SGEE 3VB5A 1K9OE 3ODFA 1GBJA 2C93B 1Z7KA 4IC5A 1O34A 1V3XA 4NZQA 1G9IE 1TQ0B 1QIXB 1AUTC 2VWNA 2XYAA 1TABE 1TONA 2VWLA 1VITG 5C1XA 3RLYH 3B9FH 1GMDG 1SVPA 1O2MA 1HAVB 1FPCH 4MNXA 2ZDNA 1BDAA 1QL9A 4Y7AA 1M9UA 4ESTE 2CV3A 2FP7B 2LNCA 3T27A 3A7TA 1JOUB 2A5AA 5GXPA 2FESH 1ZRBA 4VGCC 1A0HB 1MAXA 2P95A 1DM4B 4ZXYH 3G01A 1FN8A 1TAWA 4MQAA 4X2YA 2OQUA 4A7IB 1C9TA 1YM0A 2UWLA 1XX9A 3E91A 3ZZAA 3VB6A 1K28D 2Q6DA 1UK3A 5DO4H 5C5NA 1IQJA 4GPGA 2ZEBA 4MPWA 1BMLA 2A5KA 1P3EA 1KXEA 1ANEA 4OS1A 5E8EH 3SUEA 1C1UH 1NESE 1LHEH 3GY5A 2J4IA 2WUBA 4KKDA 1SGFA 1IQMA 2GCHF 1ZSKA 1K1PA 2BDBA 1F2SE 1K21H 4K5ZA 4INKA 1G2MA 1HAOH 3ATMA 2FOBA 1ZHPA 3KN2A 2TGAA 3MO9A 1C5WB 4BANB 3PTNA 2GGVB 1FPHH 2ZGJA 3SNAA 3QTOH 3KL6A 2PUQH 3TNSA 2Q6FA 2CN0H 2V3OH 2M5TA 1K1IA 3M5NA 3MNBA 1YCPH 1MD8A 3SV9A 1ELAA 1TX6A 3RU4E 1ELCA 3ATWA 3U1JB 3B23B 1W7GH 1C2EA 1QBNA 1B0EA 4FVDA 3KHVA 1IQIA 1SHYA 1K22H 4Q7XA 4A6LA 4B73A 4D8NA 1C5ZB 2Y80A 2GKVE 2ZWLH 1J9CH 3U9AH 4B71A 4NG9H 1DWEH 2F9BH 4LOYH 1ZJDA 4ABAA 1J15A 1BIOA 4JYTA 2OBOA 2XWAA 2JETC 1W7XH 1GI3A 1AMHA 1SSXA 2BD2A 3PTBA 1TMUH 4MPUA 1FAKH 3MH4A 3TGJE 1ZGVA 2SGDE 1TBRH 3K2UA 1TNHA 4UFGH 1H8IH 2OTVA 1BBRE 2A7HA 3MNXA 1ZYOA 5GDSH 1GI5A 4RSPA 4X1PU 1O30A 2VIPA 2ZPRA 3CS0A 3ZVDA 4MG3A 1P2JA 1GCTC 3FFGA 4DVAU 2R2MB 5FCKA 3T5FH 1LHCH 1IAUA 3C1KA 4ZHAA 3SI3H 8KME2 2O8UA 4Y79A 4ASHA 3SNBA 4XBBA 1NRSH 1S6FA 4OS6A 2RCEA 3GCHC 1V2VT 1DSUA 4HGCA 1B7XB 4I8KA 5HYOA 1LPKB 1XUHA 2GMTC 2OC0A 4ISLA 1SFIA 2RDLA 2UUFB 4Y10E 2ZCKP 1EOJA 2ZDMA 3QN7A 4BXSA 1HAVA 1XUIA 1TLDA 2OQ5A 4XBCA 1DLKB 1A5IA 1P04A 2QIQA 1O2KA 1ZSJA 5H4IB 3BEUA 4JZIA 5JBBS 5ESBA 4SGAE 4ABJA 1AIXH 3SV2H 1ZGIA 2ZHDA 5EGMA 1DDJA 1TPAE 2JKHA 2ZHFH 5EOKA 3IWMA 1YGCH 1EJNA 1MBMA 2F9NA 1AFQB 1GDUA 2G52A 1A2CH 2QA9E 3K9XB 1QA0A 3M7TA 3ZVBA 2VVUA 1NM6A 1DXWA 1FMGA 2XCFA 4MDSA 4DJZB 5F8TA 2B8OH 1UTMA 1C5QA 3MH5A 3LH1A 4MNVA 1TRNA 5E2OA 1A0JA 4Y8XA 1DUAA 3UWJH 2WUCA 1XXDA 2ZC9H 3BTME 2J9NA 2BX4A 2TBSA 2F9VA 5DKMA 4AYYB 1YCPM 2XXLA 2FLBH 1EASA 2A0QB 2XWBI 1O3KA 2VVCA 1DWBH 1RTLA 2J95A 2WPIS 2QV1A 4X6MA 4DIHH 3ATKA 3TJNA 1GBIA 5T6DA 1BA8B 3I78A 1SHHB 3BV9B 4X0WU 1SGDE 3FP6E 5CHAC 1SLVB 1ZZZA 2H9HA 2BD4A 4MTBA 1GJ7B 2ODQA 2W7UA 7ESTE 1EP6A 1O2IA 1GHXH 1G3CA 1Y8TA 3OX7U 5LGOA 4NFFA 2SNWA 3BTKE 1P01A 2J34A 3VB7A 5JB9S 2ZU4A 2A4GA 1RXPA 5DGJA 1OX1A 3RXLA 3LGWA 4YT7H 2UUKB 4BNRA 2GCTC 1YPJH 1ETSH 3LONA 1KLIH 1C1TA 4K1EA 3TK9A 1XUGA 1U6QA 1WTHD 1Z6JH 1G2LA 4IGDA 3RXHA 1KXDA 1KTTB 4BAQB 1C5VA 4FVBA 1YPHC 3M5MA 1CVWH 4ZKNU 3RXIA 1Z1JA 3A7ZA 1O3GA 1ELGA 1GJ9B 3A7YA 2FTMA 3GY3A 2ZI2H 1BJUA 2FOAA 1RJXB 1LCYA 1BBRH 1C1QA 1QRZA 1EZSC 2F91A 3UQVA 1D9IA 1W3CA 3ZZDA 1N6YA 2Z9IA 2ZTXA 5K7RA 2SGFE 1O32A 1SGNE 4JMYA 3R0FA 2UWPA 5C1YA 2FI3E 1FI8A 1SGRE 1Z71A 1OOKB 1GHAG 1PPFE 4AOQA 1T8OA 4DW2U 3BIUH 4LZ1H 2G5VA 1GVZA 1T4UH 1AVWA 1PYTC 1RD3B 1TRYA 2AGIX 4YM9A 3ZVEA 1GHBG 1Y3VA 5EPNA 1B0FA 2WYJA 3SNCA 1O3LA 4DURA 1V2LT 3BIVH 2P8OB 3V7TA 3A85A 2AH4X 5C5OA 3VEQB 3GY6A 4AFSA 4ABIA 2ZU2A 1GJCB 3LPRA 3LKWA 4KTUA 1GJDB 1G3BA 4OS2A 4HFPB 3CP7A 1V2KT 1LDTT 4YTAA 3EA9A 3LGYA 2JH6D 3RXQA 1VR1H 1O2QA 1EB1H 4BAOB 3TGIE 5JDUB 3TU7H 2JH5D 5F03A 1A1RA 1KLJH