1O3JA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3jA02
2ZGBH 1IQLA 1VITH 2P8OC 4Y10E 1O5DH 1O3DA 4WMFA 1DS2E 2AFQB 2GMTB 3T28A 3M7TA 4AFUA 4CH2B 3SNCA 1TNKA 1QBVH 3PLBA 2BXTH 1HJ9A 4K5ZA 3WY8A 1E34B 1IHTH 4JZEH 7KMEH 3ZVBA 1H9IE 1YCPK 1C1RA 1NT1A 1MAXA 1OP0A 3RUOA 3NZIA 6GCHF 1JIRA 2DUCA 5T3HA 2FDAA 3GDSA 4LK4A 2FOAA 3GY7A 1P10A 1J14A 1K1LA 3UOPA 4ZHLU 1O31A 2Z9IA 3T2NA 3MTYA 1J17T 1A5IA 2BDYA 1BQYA 3I77A 1XMNB 4ISOA 1AKSB 5DP3A 3T62A 1J16A 3A88A 3LGVA 1K1JA 1BCUH 3C27B 5A2MH 5A8ZA 2BZ6H 1ZRKA 3L6PA 1A46H 1K1MA 1ZTLA 1P2OA 3F6UH 3A7XA 5A8YA 1FIWA 1D3DB 1GHBG 2P95A 3M5MA 2H5CA 2ZTYA 3SGBE 1HRTH 1QNJA 4JYVH 1AFEH 3EGKH 4INKA 1EZQA 4E05H 2AS9A 1P2MA 3RMOH 2BZAA 2J95A 3A8CA 1V2VT 1C5MD 1P57B 3GOVB 4RKJB 2PKAA 3P8OA 1LPGB 1BT7A 3A7TA 2OC7A 2F83A 1Z8JB 1LMWB 5JDUB 2GZ9A 1SMFE 2ZC9H 3QUMP 2F9VA 3OY6U 4ISNA 2Q6GA 2VJ1A 1YM0A 1ZGVA 1LVBA 1PQ7A 1FV9A 2XXLA 4UDWH 1KDQA 2CF9H 4FUCA 3TJUA 3ZZ3A 2PKSB 3BG4B 1FY4A 5AHGH 1S0QA 1RIWB 1YPKH 5BRRE 1H8DH 1SL3A 1N8OB 1ESTA 2G5NA 1CT4E 4Y0YE 3SJ8A 1EJMA 1P3CA 1SB1H 2CV3A 1C1MA 1CE5A 1GBTA 1O3MA 5EXNA 3PMJA 1P03A 1LO6A 3OTJE 3HATH 4ABDA 5GJ4B 1KXEA 1KXFA 7LPRA 1G2LA 4D9QA 1WTHD 1K22H 1GHZA 2R0LA 4OGYA 1W8BH 3A80A 4IS5A 4CBNA 2BY5X 2AYWA 1Y8TA 4YO9A 1C5SA 1EAXA 3HGNA 2XRCA 3LH1A 4TY7A 1F7ZA 2ZKSA 2Q6DA 2XBXA 1B0EA 1G3EA 5FXLA 1BIOA 2BDCA 3RXSA 5LPFA 1YPGH 2AIPA 3IG6B 1DWCH 2GZ7A 2HGTH 3M7UA 1BTZA 1Q31A 1P9UA 3E16B 1FI8A 1YLCA 1H9LB 4LZ1H 1GL0E 1SGRE 3MU5A 3MH4A 3VEQB 2JKHA 4I8JA 1ZSKA 1IQNA 3GY4A 1GHAF 2ZZUH 2CN0H 1W10U 4K1EA 2EI8A 3GCHC 2CGAA 3BTWE 3TGJE 1OOKB 3H5CB 1GI9B 1O0DH 4WXVA 3N7OA 2BQ6B 5DG6A 2A4RA 2TIOA 3SU6A 1TGNA 1ABIH 2R0KA 2PTCE 2VWLA 2ESTE 2HWLB 2Z6BD 2W3KA 1GI4A 1HV7A 4TYDA 1O3IA 3U1IB 1ETRH 4HGCA 2ZFSA 3KL6A 4HI3A 2HLCA 1CO7E 3BV9B 1YPJH 2Y7ZA 1O2JA 3UNSA 3OSYA 3A8DA 1MUEB 3RLYH 4D7FA 3I78A 1FIZA 2BD2A 1GWAA 4AFZA 3A85A 1Z8GA 5L30H 2NU1E 3C1KA 3PM3A 4X2XA 1QRZA 1C1NA 1DFPA 3HKJB 3RXJA 4BAHB 1Y3WA 3SNDA 1DPOA 1GI1A 2D8WA 1W7GH 2ANKH 1AVWA 4CRBA 2O9QA 4AZ2B 1RTKA 1D9IA 2A2XH 1G3BA 1QIXB 3GCNA 1Q2WA 1Z1JA 2Z9LA 1UTQA 3QZRA 1GJ4H 3UUZA 1D3TB 2FP7B 3ODDA 1TGBA 2J38A 2BD5A 4Q7ZA 1AWFH 2BLVA 4MG3A 2ZCKP 1XX9A 2I6QA 1OS8A 1Z71A 1EPTC 1ZZZA 1MKWK 3SV2H 3A86A 1IAUA 4FUJA 4MNYA 1ELVA 1GMDG 4YLQH 1O35A 1HDTH 2A7CA 3KQDA 1TMUH 1JOUB 2PHBA 5FBEA 1C1OA 1O2RA 5JBAS 5GCHG 3KIDU 1SHYA 1AVXA 1GVKB 2GT7A 3SU0A 2QIQA 1GCTC 2ANYA 3HK6B 2Q1JA 1Z6EA 1C2FA 3O8BA 3A82A 2UWLA 2SGFE 2ODYB 2GDDA 1O32A 3E3TA 2TGTA 2ZGXH 3QTOH 1VCWA 2PLXA 1V2JT 1IQHA 5EPYA 1EAUA 1AFQC 3W94A 1C2EA 1C2GA 1UVPA 1DDJA 3PMHB 3E8LA 2ZECA 2FIRH 1C2HA 3S0NA 3MH6A 1CHOG 1ZOMA 5TCCA 3BTEE 1C5QA 2PV9B 2CHAB 2FWWA 2ZPRA 1W13U 1C1PA 4BAMB 1ETTH 3FAOA 3CENA 3EE0B 4THNH 1HAZB 1SQTA 2O8LA 3LJJA 4O9VA 4Z6AH 1FZZA 1LPKB 4ABHA 2D26C 4YZUA 4KGAA 2JETC 3E0PB 3SBKA 1H8IH 3QK1A 5DJ7A 4CBOA 1OPHB 1W3CA 1GVZA 1XUGA 5AFYH 3RC5A 1OYQA 3ATIA 1V3XA 1SGPE 2PTNA 4FVBA 3T29A 3M3TA 3URCA 1OWKA 3MO9A 4GPGA 1AQ7A 1GI3A 3SN8A 2PW8H 1CA0C 2VB0A 1MMJN 4FVDA 4AX9H 1UTNA 4CR5A 1P02A 1V2UT 2O8UA 3RXRA 1O2XA 1IQMA 3AVZA 2H9EH 4Y8ZA 1AY6H 3DHKH 2ZPSA 3VXFH 1L4ZA 1D6WA 5DPAA 1SC8U 2BOKA 2G52A 3SU4A 1BMMH 3A83A 1BRAA 3RXBA 1HUTH 3CS0A 1YP9A 2A2QH 1O2ZA 1A0HB 1RJXB 1CU1A 2TGAA 2UUKB 3L3TA 1AWHB 3S7KB 3S9BA 1ELBA 1SQAA 1TBRH 1W0YH 3ZVCA 4A92A 1HAIH 3KQBA 1C5ZB 5DP7A 1ZR0A 1C5XB 2OP9A 1ID5H 2Z3DA 1C5NH 3F1SB 4DY7B 4ISIH 4XBBA 1FY1A 3QN7A 3F68H 1XKBC 3M36A 1P04A 4ZMAH 3PV4A 2ZHFH 1J15A 1K28D 4TY6A 7GCHF 2ZHWH 3EA9A 1L1GA 5EPNA 5C20A 1FUJA 5AVDA 1AE5A 3PTNA 5IDKA 3SV9A 4NIXA 2GMTC 2XBYA 4DIHH 4X6OA 4AORA 2ZNKH 3TPIZ 1H9HE 5FCRA 3LC5A 1C1UH 1ZPZA 4GHQA 2OTVA 1E0FD 1BTPA 1OWDA 3GISB 4XSKU 4HTCH 1W12U 3ZVFA 1GGDB 1BJVA 2STBE 1O3PB 1SGFA 1EATA 3VPKA 1HAHH 4Q80A 3GY2A 2ZWLH 2G81E 1BJUA 3EQ0H 4ABEA 1AHTH 2W3IA 1S81A 2EI7A 4IBLH 1H4WA 1LVMA 2P94A 3U8OH 1QR3E 1BITA 3A81A 4NA9H 1RRKA 3SNEA 1OWJA 3ODFA 1YPEH 3ZVAA 4FU7A 4GCHG 1LDTT 1JXPA 4ABGA 2A1DB 3VFEA 3GYLB 3SUDA 1TFXA 5LGOA 1N1LA 3SJIA 1EB2A 2IOTA 3E1XB 4IN1A 2XWAA 1KY9A 1HNEE 3SV7A 1GBIA 3M3VA 1W14U 2H9HA 2EI6A 1C9PA 2W26A 2CJIA 4WH8A 3SV6A 1UK2A 4JZDH 4Y0ZE 2BDHA 1T31A 3VB4A 3U1JB 3T25A 1NY22 3SU5A 4LXBH 1TQ0B 1L0ZA 1QB9A 1WYKA 1DY9A 2P3UB 2Y5FA 1BOQA 2LNCA 1KXDA 2BLWA 3ZZ8A 3OX7U 3ZV8A 5JPMH 4I31A 1F0SA 4NCYA 2ZDMA 1O2QA 3BTDE 2ULLA 2Y81A 1XVOA 2C8WB 3RXIA 3DFLA 3PLKA 2AMDA 5LH8A 3LJOA 5DGJA 2SGAA 1J9CH 3BTHE 1MD7A 3SGQE 4BTTB 1TOCB 5I25A 4FUFA 2ZTXA 1DUEA 2PKSC 3BG4C 3OY5U 2YNBA 1SBWA 3SU1A 2NU3E 1RIWC 1PQAA 4AGKA 3ZZ7A 1SGCA 3MO3A 1N8OC 1RGQA 3TJOA 4K60A 4NA8A 1KLIH 2J9NA 1ZHPA 3V0XA 1SI5H 1K9OE 2C8YB 2C3SA 1LHGH 2OXSA 1GBFA 3P17H 1NFXA 3Q3KA 2O8TA 2OBQA 1DX5M 2ODPA 4M7GA 1UMAH 2CF8H 1T7CA 3ZYEA 1C4U2 4IC5A 1HLTH 1BHXF 4GVUA 3PYHA 1YKTA 3K6YA 2VH6A 1TBQH 1HCGA 1GHAG 2BDGA 2J94A 2OC1A 4NSVA 2WPJS 4MNXA 2P93A 1IQFA 1VCPA 1O2PA 4H6TA 3RDZA 4O3UA 4Y8XA 2XYAA 2KAIB 3UR9A 1P0SH 1WCZA 4X1SU 2UWPA 3GCOA 3D23A 1IQJA 1AUJA 1Y5UT 1DSUA 4FUHA 1QBNA 1SGTA 2SGEE 3BTGE 1BBRH 5JYIA 2PFEA 4A1VA 1MTSA 2CMYA 5AF9H 4GLYA 4B75A 3NUMA 4XFQA 2XCNA 3MU4A 4Q2KA 1C2MA 1UVUH 1C2IA 3NKKA 3BEUA 2Z3CA 4TPIZ 1ORFA 1NN6A 4Y7AA 1O2KA 2BVSH 2BX4A 2VIDA 1HPGA 1D6RA 1ZPCA 4X1RU 2BB4A 4TWYA 5HM9A 1C5OH 1MD8A 1W11U 3PMBB 2JH0D 3MHWU 3RXPA 3MI4A 5FAHA 4XOJA 3MU1A 5EW2H 2BD7A 3MNSA 3A7ZA 1XKAC 3R0FA 3K2UA 5C67A 1SSXA 5DP9A 2QF3A 1JBUH 1EOJA 2HPQH 3M5OA 4CHAB 1P09A 2UWOA 4UFFH 1C2JA 5LPEA 3RU4T 1SGIB 1A3BH 2AH4X 1SR5C 4QT8C 1HAPH 3ATLA 2ZGCA 5ESTE 3GCTF 3ATWA 1P05A 2FM2A 1MH0A 2HRVA 2UUJB 1HIAA 3RU4D 3QO6A 1DXWA 1O36A 3NPSA 1NRSH 5HYOA 1BRCE 4KKDA 5TCAA 2JH6D 1Z6JH 4WXIA 3ATMA 4CRGA 3RMNH 1W7XH 4F49A 2QN5T 1BZXE 3SV8A 3SJ9A 4CRAA 1KLJH 2FO9A 5DP5A 1A1RA 1TAWA 5E2PA 2A31A 1NRPH 3QX5H 4Z0KA 1HAGE 3TJNA 1SOTA 5FHTA 2A4OA 2I6SA 3PB1E 1GG6B 1VR1H 1BRBE 1B5GH 5JBCS 1C5UA 1GJAB 1UJ1A 2VIVA 1FAKH 1SVPA 3BSQA 5J4QA 2FXRA 4CRDA 3S9CA 2FS8A 1TYNA 1AKSA 4YT7H 1SGQE 1JWTA 1LHFH 1ANDA 2F3CE 1WSSH 2OQ5A 1DOJA 1BBRE 4I7YH 1MTUA 1NRRH 3KQCA 2B0FA 1PJPA 2QXHA 3Q00A 4UFDH 3EA8A 1NRNH 4OS7A 5FBIA 2A7JA 1FLEE 1GDQA 3SHAH 3PO1C 3KGPA 2HNTE 3LH3A 3SU2A 4OS5A 2GP9B 1ZJKA 4IW4E 1GMCF 4BOHA 1NROH 1EUFA 1S84A 2VH0A 1F5KU 1GBEA 2CHAC 2ZQ1A 1BMLA 4IN2A 4MDSA 1CBWB 1CA8B 3LOXA 1SLUB 1TRNA 1O5BB 1G32B 3RM2H 4NWKA 2FOHA 1O3NA 5E0GA 1EZUC 1C5TA 1O3AA 2VNTA 1FY8E 3Q3YA 3UR6A 3ESTA 1O2LA 3JZ2B 4AYVB 5GPIB 1TPPA 4X8TH 1BMNH 1G30B 2TRMA 4DURA 1TNHA 2IPHA 1O3FA 4BXWA 1E36B 1LHDH 2ZU3A 5C1XA 4IMZA 2BQ7B 1O2IA 4X8SH 4GUXA 2A5IA 5JB8S 1K1IA 2BY8X 3VGCB 1MTNB 1MU6B 1O2WA 4ABIA 1BA8B 1GI7B 1MCTA 4K3JA 3SJKA 3SUEA 1EP5A 3SHCH 3TK9A 1FY3A 2AGEX 3NWUA 2D2DA 1TRMA 3KF2A 4R0IA 5A0BA 4WMDA 3UPEA 4I32A 4NIWA 2BYAX 7GCHG 4ZHAA 3U9AH 1NU7B 1TPOA 5C5NA 1NTPA 2BLOA 3MMGA 1Y3XA 1Y59T 2PGBB 1A5HA 3A8AA 2HOBA 2P59A 3LIWA 4ZKNU 1KXCA 4OGXA 2WUCA 2A0QB 3TNTA 2ZU4A 4I8HA 1UTPA 1BHXB 1EZSC 4FUGA 1DVAH 2J4IA 4O03A 4I8GA 4X6NA 1WAYB 3D62A 2PWXA 4K1SA 4H42U 1SGEE 2Z9JA 2XW9A 3A89A 1C5RA 3P8FA 3DT0H 1TOMH 1AZZA 1BTWA 1NC6A 2QCYA 2ZU5A 3HK3B 5BPEA 2AIQA 3E0NB 5I46H 1G37A 4NIYA 1QJ6B 2F9PA 2BD9A 4BXSA 1PPZA 5K7RA 1TBZH 2HNTC 3AW1A 1T32A 1ZJDA 1IQIA 4CREA 2VINA 2WINI 2Y82A 4CRCA 1OXGA 1K1OA 1GGDC 4K2YA 1XUFA 1DT2A 1WOFA 3P95A 2AERH 1ARBA 1KYNA 4UE7H 1UVSH 2QYIA 3ITIA 2XBVA 1ESAA 2AGGX 1B0FA 1P2KA 2B8OH 3GY8A 5AFZH 3UTUH 1ZMNA 3SW2B 4AN7A 4WVPE 4KP0A 1FY5A 1TQ7B 2WPMS 1K21H 1MKXK 1GJ8B 1UK4A 2EC9H 1SLXB 3A8BA 1F5RA 1L2EA 1TE0A 1CQQA 1C4Y2 5EXLA 8GCHF 2VIPA 1GJ5H 2FTLE 1DICA 2VIQA 3RM0H 1ELEE 3BTQE 1G3CA 2GCHF 3MYWA 4FUEA 1GBKA 1GJ6A 3GY5A 4ISLA 3VB5A 1A4WH 5L2ZH 1C5PA 1TALA 4INHA 1YCPH 1QQUA 1HJAB 2R3UA 2BVXH 3RXOA 1F0RA 5FPYA 4D8NA 1O3CA 4YTAA 2BD3A 1V6DA 1C2LA 3SU3A 2A4GA 1LVYA 3HKIB 4BNRA 1HXFH 1QFKH 2RA3A 3SQHE 1AB9C 1MU8B 3BTME 1MTVA 4NIVA 3SI3H 5JBBS 4XBDA 3ZZBA 1OWIA 3CS7A 3D49H 1NRQH 1DWDH 1L4DA 1V2MT 2BY6X 3STIA 1GBDA 1A3EH 2NU0E 3A84A 1KXBA 3GDUA 3ZYDA 3DUXH 1TNLA 1ACBE 2TPIZ 4DVAU 3TK5A 8KME2 1GDUA 2R9PA 5F6MA 2ZIQH 4GAWA 2FYRA 2WV4A 1DLEA 4O3TA 4JK6A 2GCTC 1VGCB 3Q3XA 1Z8IB 3B9FH 3ZZAA 1D4PB 2ZA5A 2FEQH 3FZZA 4DIIH 1N6YA 2ZO3H 3KHVA 4DCDA 3R3GB 4ABAA 2B5TB 3LDXH 3BTTE 1BBRK 2EEKA 3RC6A 1BB0B 2HALA 1TGSZ 3LGTA 4BTIB 1WV7H 1ZGIA 2F91A 2R3YA 4FUBA 4CH8B 4YOGA 3SZNA 1IQKA 3NK8A 1H1BA 2ZTZA 1GBJA 9LPRA 1UTMA 1AZ8A 1UK3A 1YLDA 5CHAB 1SHHB 1FPCH 1GBHA 1TNGA 2ZDAH 3ZZ9A 1OWHA 2A32A 3ZZCA 2G5VA 3UNRA 2OUAA 5FX6A 5T6DA 3FVFB 5EXMA 4ZKOU 1Y5BT 1HAVB 5C1UA 1EJAA 1ZMJA 5K0HA 1ZTJA 4WJG2 4AFQA 1KIGH 1S85A 1UHBB 3P8NA 4RKOB 3ZZDA 1W2KH 2RCEA 3MH7A 4K1TA 1L1JA 2PR3A 4B73A 2SNWA 1OKXA 2XC0A 2VVCA 1MZDA 1ZMLA 2ZFTA 1BUIA 3GCTG 4R8TB 2H1UA 3UOUA 4KELA 6GCHG 1ELAA 2VU8E 2XBWA 1GI2A 4U2WA 4B2AA 3ZZ5A 1VJAU 1AD8H 1PPHE 3KCGH 2K1QA 3IWMA 1TLDA 3RMMH 4CHAC 1FMGA 3QGNB 1EXFA 1QTFA 4K69A 1O30A 1EAIA 4MTBA 1O38A 1EP6A 1O3OA 2WYJA 5FPSA 1A7SA 1QB1A 2H5DA 5A0CA 2FPZA 3RXCA 2H6MA 5HGGA 1K1PA 2GT8A 4MQAA 4I8LA 4YLUA 3PMAB 1NM6A 1BTXA 5CMXH 2ZCHP 1O2YA 3UIRA 3A7WA 1YBWA 4F4OC 1AU8A 1P9SA 3OYPA 4B76A 4DJZB 1PYTC 3GY3A 2G8TA 1SGNE 2ILNA 3EDXB 5DK1A 4AYYB 3RXTA 1ABJH 1C2DA 1HB0B 4GHTA 1DWBH 1UVTH 1GBMA 1LVOA 1O33A 1XUIA 2OBOA 1GBAA 2ZGJA 3FP6E 5E8EH 5ETXA 3A7VA 4ABJA 1GG6C 2ZF0H 4IGDA 1A5GH 1MCVA 3BTFE 4NFEA 4OS1A 1QQ4A 2FOBA 2D1JA 4IMQA 1AN1E 4U30A 1D3PB 1DITH 2VIOA 1BTUA 1GVLA 2AEIH 5DKMA 5H4IB 1TMBH 3ZVEA 1EPTB 1Y3YA 3TGKE 1NZQH 5PTPA 5FPTA 5FX5A 4D76A 5GWZA 1Z8RA 3RXUA 1EASA 3Q76A 1XUHA 5DP4A 3QDZB 3V3MA 2Z94A 1TABE 2J92A 2ODQA 1S6HA 1EJNA 5FCKA 4X0WU 2JH5D 4AOQA 2OC8A 3P70B 4ZHMU 1C1VH 5TJXA 2VWOA 1Y3UA 4MPVA 1OYTH 1CBWC 2QGRA 1LQEA 2GV6A 3RC4A 1GJDB 1MKWH 2FTMA 1C1TA 1G2MA 2YNAA 3MU0A 2A7HA 5LPRA 5C5OA 4LZ4B 2F9OA 4NGAH 2FLRH 1G3DA 3BEIB 4FUDA 3QZQA 1YPHE 4JZFH 1EZXC 4A6LA 3FFGA 3JZ1B 2NU4E 3UFAA 2QF0A 2TGPZ 5GCHF 2QXIA 4AFSA 1SPJA 6ESTA 1OP8A 4Q7XA 2G55A 2V3HH 3PTBA 1A0JA 3AASA 3AAVA 3EA7A 3QGJA 1ZPBA 1P2QA 1PPFE 3I29A 1TNJA 2O8WA 3K9XB 2F9NA 3SGAE 1A2CH 2FOEA 2LPRA 2QV1A 4FU8A 1O2NA 1X7AC 2GD4B 5EGMA 2BMGB 4I33A 3RP2A 1ANCA 2HPPH 1O5CB 5C3NA 1P3EA 1SGFG 2XC5A 2C4FH 7ESTE 3S7HB 2Y80A 1N6XA 2VWMA 3RXHA 1NS3A 1WQVH 1O5AB 1S0RA 3LC3A 3MOCA 1FDPA 1FN8A 5EODA 1KSNA 2WPHS 2ZCLP 2DE8A 5F8TA 4NWLA 2Z9GA 1PPEE 1SLWB 1AVGH 4RN6A 3UWIA 2KAIA 3ZV9A 1O3KA 2C8XB 1L1NA 1QCPA 4TWWA 1DWEH 1SLVB 2SFAA 2WPKS 3LT3A 3UNQA 2G4UA 1MZAA 3NCLA 1MAYA 2J34A 1C9TA 4WY3A 3RXQA 3LU9B 2ZHDA 1BMAA 4A7IB 3P8GA 3LGIA 4J2YB 1DUAA 1CHGA 1DANH 2VGCB 1GJBB 1M9UA 1HGTH 1P8VC 4Y8YA 1DXPA 3L33A 2G51A 1KLTA 1GHVH 3TJVA 3DA9B 3UY9A 1PQ5A 2QA9E 1SOZA 1FPHH 2P3FH 2BDBA 8GCHG 4XE4A 2OCVB 1MTWA 4HFPB 1EX3A 1YPHC 4X1QU 1HIAB 3RXFA 1FN6A 2FOMB 1GJ7B 2GCHG 1NFWA 1GHYH 2HVXA 5C1YA 2WYGA 2FOCA 2XC4A 2ALPA 1O3GA 2QXJA 2R2WU 3AAUA 3B23B 4NZLA 1UCYH 6CHAB 3VB7A 5L6NH 1O2UA 3TITA 2RA0A 2B9LA 2ZEBA 2NWNA 4Q7YA 2O8MA 1O3EA 1RTFB 3TU7H 3ZVDA 2XNIA 9ESTA 2FODA 1KXAA 2ZHEH 4KTSA 1DM4B 3RMLH 1C4V2 3PLPA 3RXDA 1V2RT 1WQSA 3W95A 1PPGE 4J1YA 2Z9KA 5ABWA 1GMHF 2V0BA 3DD2H 1F5LA 2W7SA 1TRYA 3SQEE 1HJAC 1HAYB 2BLQA 2FOFA 1YGCH 5ESBA 3RXEA 3BIUH 1TIOA 4E7NA 1ESBA 4X2WA 1PYTD 1GI0A 1QJ1B 1O5FH 3K6ZA 1T8OA 2FLBH 5F8XA 3M35A 1C1SA 2BY9X 3B8JA 1XXFA 1HAXB 1HYLA 1XM1A 2PKAB 1JMOH 1RTLA 2GZ8A 3FANA 2WPLS 4LOYH 4GCHF 2FESH 3TNSA 1E35B 1WU1A 1GBLA 2ALVA 2BDIA 2ZDNA 3O8DA 1OX1A 1UTLM 4AG2A 1TNIA 2EA3A 4CRFA 1KDQB 1HAOH 4X6PA 1AMHA 4E7RG 4B74A 1UO6A 1WBGB 2GDEH 1VGCC 4E06H 4H6SB 1TMTH 5E0JA 4UFEH 1WTGH 1EAWA 2VVUA 3K65B 1CGIE 3M61U 3U8RH 3M5NA 1EB1H 1THRH 2Q6FA 5A09A 2GX4A 1SQOA 3RXLA 1O2MA 3ZZ6A 1O2OA 1O37A 1JRTA 3U8TH 1AE8H 5L2YH 3OU0A 4OS4A 4Y79A 4WWYA 1C2KA 1UCYE 2XCFA 1O3BA 4ZROA 1TONA 1GJ9B 3F9GA 2ZG0H 5DP8A 1ETSH 2FI4E 5CHAC 3BF6H 1Q3XA 2THFB 2YOLA 1LHEH 1EKBB 1O2TA 1CGJE 1MBQA 1T8LA 3UWJH 4Y71A 2C93B 5EG4A 1O3LA 1O2HA 4YOJA 1ZTKA 2OC0A 4JK5A 1CGHA 1DSTA 2A5AA 2FYQA 2Y5GA 1YCPM 4NSYA 3ZZ4A 4ZKSU 2AMQA 2ZU2A 3PWCA 1ANEA 2J2UA 2SGQE 4Y7BA 1AO5A 3CP7A 1SGDE 3TGIE 5A8XA 2ZFRH 1GL1A 2BY7X 4BTUB 1O2GH 2HNTF 2P16A 2P3TB 4OS2A 1CVWH 2Z7FE 2A45B 5DO4H 5T6FA 1NESE 4VGCB 3LONA 1O5EH 1QL9A 2ZHQH 2GGVB 1VITF 3BEFB 4X1PU 3SORA 1TA6A 1PFXC 1T8MA 1YPLH 4JZ1A 3AW0A 1DY8A 1UVOA 2GTBA 5JB9S 4IC6A 1ELFA 4Y11E 2V6NA 2FX6A 3UQVA 2BHGA 2NU2E 3U98H 4K8YA 2RDLA 1NO9H 5CE1A 2WUBA 4BAQB 4NFFA 4MLFB 2H2ZA 1YC0A 2P8OB 2TGDA 3P6ZB 3RXGA 3ELAH 4HZHA 4MPXA 4JCNA 1P12E 1C5VA 3MNBA 2AGIX 2ZI2H 3S69A 1QRXA 1PPCE 1FQ3A 1OP2A 1HBTH 4U32A 4Y76A 2BDAA 4MNWA 1UTKA 2ZU1A 3RXKA 5GDSH 3Q77A 1LQDB 3SJOA 1RD3B 1THPB 4TPYA 1AUTC 4X6MA 2QAAA 1FAXA 1QURH 3MFJA 4B2CA 4KTCA 2VIWA 3V13A 1OWEA 1GDNA 4B2BA 3V7TA 2QXGA 3O8CA 3URDA 1IOEA 3KQEA 4JYTA 1LTOA 3RLWH 3MNCA 3FP8E 2A5KA 1YPMH 3SNAA 4BANB 1S5SA 1B7XB 1S6FA 2BX3A 4FU9A 1P2NA 5HMAA 1QJ7B 2B7DH 4SGAE 1T8NA 4AG1A 5EQQA 2ZPQA 3LKWA 1JRSA 1QL7A 2FMJA 2W7UA 2W5EA 1QL8A 1RXPA 1S83A 1ZRBA 3E91A 1AIXH 1P01A 3MH5A 4JZIA 4MVNA 1ZSJA 4OS6A 3VXEH 1IQEA 2ZFQH 1EQ9A 1CSOE 3RU4E 1CT2E 1KTTB 4RSPA 4BAKB 5J4SA 5B6OA 1V2NT 2BXUH 1E38B 3NXPA 4U01A 1SFQB 1P06A 1FNIA 1TX6A 1V2KT 5F03A 2SNVA 3PO1B 3F9HA 1KTSB 4B71A 1O3JA 1TPSA 2XTTB 1T4UH 1A0LA 1GHBF 3T5FH 5EOKA 4YT6H 3SI4H 2Y7XA 1GI6A 4INLA 4Y6DA 1UTJA 2IJOB 4A1TA 1QGFA 1O39A 1QHRB 3M7QA 4YM9A 8LPRA 2C90B 3LGUA 1INCA 3KNXA 4CR9A 4AB8A 4ESTE 4ISHH 4X8UH 4O97A 2PUXB 1PPBH 1TB6H 2PGQB 2BM2A 5SGAE 1HJ8A 4XDEA 1FJSA 1THSH 1JIMA 1F0UA 3F9EA 1TX7A 1O3HA 2BVRH 1VZQH 1ZHRA 2ZDLA 5C2ZA 3GY6A 3HPTB 1ZYOA 1V2QT 2Y5HA 1GI5A 2M5TA 1IQGA 1DLKB 1LKAA 3F9FA 1BRUP 2ANMH 2ZGHA 4X1NU 1XUKA 3GYMA 1ZLRA 2WV5A 3T26A 3GICB 4NA7A 1ARCA 4XBCA 3BTKE 2F9BH 2FI3E 1Z7KA 1GPZA 3MNXA 4ZKRU 1XVMA 4UFGH 4AB9A 3QLPH 3T27A 1HAVA 4MNVA 4B1TA 5GIBA 4D9RA 3VB6A 1K1NA 3BIVH 5F8ZA 1ELCA 2ZDVH 1UHBA 3PWBA 2BQWB 3LGYA 2G00A 4FXGH 1ELGA 1QA0A 3STJA 2OINA 2VGCC 3GCHB 1F2SE 1QB6A 1ANBA 1VJ9U 2FX4A 3SO3A 4ZXXH 4A5TS 5DP6A 4JMYA 2ZDKA 3TH4H 3EYDA 4MPUA 1ELDE 2RG3A 3ATKA 1YF4A 1C1WH 1GHWH 4ZUHA 4AGJA 1UCYK 1LCYA 2DE9A 1PQ8A 2OLGA 3E90B 4SGBE 1AI8H 1IHSH 3MO6A 2PSYA 2UUYA 2ZFFH 3MWIU 2OQUA 3BN9A 5GXPA 1MQ5A 1YYY1 5E0HA 2V3OH 3O8RA 1FXYA 4FUIA 1NFYA 3HGPA 5EU8A 1NPMA 1BTHH 1MBMA 4ZXYH 1GBBA 1GMHG 3RXMA 3TH2H 2ZP0H 6CHAC 5HXFA 1U6QA 3MU8A 2VVVA 1MQ6A 3LGWA 2ZQ2A 3SUGA 1GBCA 1GCDA 3TK6A 1V2WT 3FP7E 3M37A 1AGJA 3GDVA 5EQRA 2C8ZB 1BTYA 2A4QA 8ESTE 2TBSA 3KEEA 4BAOB 1P11E 2Z3EA 1V2PT 3ZVGA 3D65E 3FZDA 4UONA 1GMCG 1RS0A 1QY6A 1GJCB 1UTOA 2FZZA 1TPAE 3A87A 3UQOA 4KTUA 1ZHMA 1GHXH 4WH6A 1P2JA 4DW2U 5IYTA 1O5GH 3KN2A 3QTVH 1TGCA 1LHCH 5G4BA 3V12A 1HFDA 2GVFA 1QBOA 2FI5E 1BDAA 4ABFA 3QWCH 1EPTA 1O34A 5EW1H 1O2SA 3M5LA 1MKXH 3TIUA 5A0AE 1V2LT 1F0TA 1GCTB 3RXVA 3VB3A 3SNBA 3PROA 3E6PH 1TGTA 1SFIA 4X2YA 4DGJA 2PSXA 1A61H 1LPZB 1GMDF 3U69H 2F9UA 1AFQB 4ABBA 4YESB 1K2I1 3IITA 2BTCE 1EOLA 2BD4A 4UEHH 1AB9B 3M3SA 4DT7B 1NFUA 1C5LH 2AMPA 3TVJB 5HM2A 4ZAEA 1J8AA 1GI8B 2STAE 2QY0B 1SGYE 1Y3VA 1XUJA 1T4VH 4PROA 2VWNA 3H7OA 2GKVE 2V35A 1C5WB 1C5YB 1O2VA 2BOHB 2BD8A 3VGCC 1MTNC 3LPRA 3ENSB 1RFNA 1NU9A 1XXDA 2JETB 2FS9A 3SOSA 3P92A 1D3QB 5EQSA 4WMEA 1CHOF 1QRWA 3TH3H 1LKBA 2ANWA 2G4TA 1OSSA 2GCTB 4DOQA 1DE7H 4ASHA 1ELTA 3A7YA 4I8KA 1P2IA 2IN2A 3DFJA 1V2ST 1VCQA 1WUNH 2XWBI 4DG4A 1Z1IA 1FONA 4GSOA 1F92A 1CA0B 1E37B 2R2MB 2PUQH 2FOGA 3SUFA 2H9TH 3TLOA 1G36A 1CT0E 6LPRA 3S9AA 1VITG 4UD9H 4X8VH 1S82A 3G01A 1ZSLA 4NZQA 4MPWA 4WF8A 3UREA 3H7TA 4NG9H 2QC2A 5T6GA 3EAJA 1V2TT 1TA2A 2WPIS 4K8BA 4VGCC 5E2OA 1SG8B 1TWXB 1C1QA 5JBTA 1QA7A 2SGDE 1V2OT 4JYUH 3RXAA 4ZH8A 3BG8A 2GV7A 4H4FA 1HXEH 4A1XA 4X2VA 1TX8A 1W0ZU 1G9IE 2ZFPH 1Y5AT 2ASUB 2OD3B 2SGPE 2CXVA 4YOIA 2UUFB 2Y6TA 4D7GA
chains in the Genus database with same CATH superfamily
2ZGBH 1IQLA 1VITH 2P8OC 4Y10E 1O5DH 1O3DA 4WMFA 1DS2E 2AFQB 2GMTB 3T28A 3M7TA 4AFUA 4CH2B 3SNCA 1TNKA 1QBVH 3PLBA 4Z1MD 2BXTH 1HJ9A 4K5ZA 3WY8A 1E34B 1IHTH 4JZEH 7KMEH 3ZVBA 1H9IE 1YCPK 4FOUC 1C1RA 1NT1A 1MAXA 1OP0A 3RUOA 3NZIA 5KECA 6GCHF 3SYJA 1JIRA 2DUCA 5T3HA 2FDAA 3GDSA 4LK4A 1EFRD 2FOAA 3FO8D 3GY7A 1P10A 1J14A 2K0QA 1K1LA 3UOPA 1FX0B 4ZHLU 1O31A 2Z9IA 3T2NA 3MTYA 1J17T 1A5IA 2BDYA 1BQYA 3I77A 1XMNB 4ISOA 1AKSB 2WZQA 5DP3A 3T62A 1J16A 3A88A 3LGVA 1K1JA 1BCUH 3C27B 5A2MH 5A8ZA 2BZ6H 1ZRKA 3L6PA 1A46H 1K1MA 1ZTLA 1P2OA 3F6UH 3A7XA 5A8YA 1FIWA 1D3DB 2M2AA 1GHBG 2P95A 3M5MA 2H5CA 2ZTYA 3SGBE 1HRTH 1QNJA 4JYVH 1AFEH 3EGKH 4INKA 1EZQA 4E05H 2AS9A 1P2MA 3RMOH 2BZAA 2J95A 3A8CA 1V2VT 1C5MD 2HLDD 1P57B 3GOVB 4RKJB 2PKAA 3P8OA 1LPGB 1BT7A 3A7TA 2OC7A 2F83A 1Z8JB 1LMWB 5JDUB 2GZ9A 1SMFE 2ZC9H 3QUMP 2F9VA 3OY6U 4ISNA 2Q6GA 2K8IA 2VJ1A 1YM0A 3F3BA 1ZGVA 1LVBA 1PQ7A 1FV9A 2XXLA 4UDWH 1KDQA 1W0JD 2CF9H 4FUCA 3TJUA 3ZZ3A 2PKSB 3BG4B 1FY4A 5AHGH 1S0QA 1RIWB 1YPKH 5BRRE 1H8DH 1SL3A 1N8OB 1ESTA 2G5NA 1CT4E 4Y0YE 3SJ8A 1EJMA 1P3CA 1SB1H 2CV3A 1C1MA 1CE5A 1GBTA 1O3MA 5EXNA 3PMJA 1P03A 1LO6A 3OTJE 3HATH 4ABDA 5GJ4B 1KXEA 1KXFA 7LPRA 1G2LA 4D9QA 1WTHD 1K22H 1GHZA 2R0LA 4OGYA 1W8BH 3A80A 4IS5A 4CBNA 2BY5X 2AYWA 1Y8TA 4YO9A 1C5SA 5T1VA 1EAXA 3HGNA 2XRCA 3LH1A 4TY7A 1F7ZA 2ZKSA 4FETA 2Q6DA 2XBXA 1B0EA 1G3EA 5FXLA 1BIOA 2BDCA 3RXSA 5LPFA 1YPGH 2AIPA 3IG6B 1DWCH 2GZ7A 2HGTH 3M7UA 1BTZA 1Q31A 1P9UA 3KYFA 3E16B 1FI8A 1YLCA 1H9LB 4LZ1H 1GL0E 1SGRE 3MU5A 3MH4A 3VEQB 4DT4A 2JKHA 4I8JA 1ZSKA 1IQNA 3GY4A 1GHAF 2ZZUH 2CN0H 1W10U 2IJD1 4K1EA 2EI8A 3GCHC 2CGAA 3BTWE 3TGJE 1OOKB 3H5CB 1GI9B 1O0DH 4WXVA 3N7OA 2BQ6B 5DG6A 2A4RA 2TIOA 3SU6A 4ACAA 1TGNA 1ABIH 2R0KA 2PTCE 2VWLA 2ESTE 2HWLB 2Z6BD 2W3KA 1GI4A 1HV7A 4TYDA 1O3IA 3U1IB 1ETRH 4HGCA 2ZFSA 3KL6A 4HI3A 2HLCA 1CO7E 3BV9B 1YPJH 2J98B 2Y7ZA 1O2JA 3UNSA 3OSYA 3A8DA 1MUEB 3RLYH 4D7FA 3I78A 1FIZA 2BD2A 1GWAA 4AFZA 3A85A 1Z8GA 5L30H 2NU1E 3C1KA 3PM3A 4X2XA 1QRZA 1C1NA 3OEED 1DFPA 3HKJB 3RXJA 4BAHB 1Y3WA 3SNDA 1DPOA 2EQNA 1GI1A 2D8WA 1W7GH 2ANKH 1AVWA 4CRBA 2O9QA 4AZ2B 1RTKA 1D9IA 2V3MA 2A2XH 1G3BA 1QIXB 3GCNA 1Q2WA 1Z1JA 2Z9LA 3N7EA 1UTQA 3QZRA 1GJ4H 3UUZA 1D3TB 2FP7B 3ODDA 1TGBA 2J38A 2BD5A 4Q7ZA 1AWFH 2BLVA 4MG3A 2ZCKP 1XX9A 2I6QA 1OS8A 1Z71A 1EPTC 1SQRA 1MKWK 1ZZZA 3SV2H 3A86A 2QF5A 3CNRA 1IAUA 4FUJA 4MNYA 1ELVA 1GMDG 3MQKC 4YLQH 1O35A 1HDTH 2A7CA 3KQDA 1TMUH 1JOUB 2PHBA 5FBEA 1C1OA 1O2RA 5JBAS 5GCHG 3KIDU 1SHYA 1AVXA 1GVKB 2GT7A 3SU0A 2QIQA 1GCTC 2ANYA 3HK6B 2Q1JA 1Z6EA 1C2FA 3O8BA 3A82A 2UWLA 2SGFE 2ODYB 2GDDA 1O32A 3E3TA 3OE7D 2TGTA 2ZGXH 3QTOH 1VCWA 2PLXA 1V2JT 5C17A 1IQHA 5EPYA 1EAUA 1AFQC 3W94A 1C2EA 1C2GA 1UVPA 1DDJA 3PMHB 3E8LA 2ZECA 2FIRH 1C2HA 3S0NA 3MH6A 1CHOG 1ZOMA 5TCCA 3BTEE 1C5QA 2PV9B 2CHAB 2FWWA 2ZPRA 1W13U 1C1PA 1SKYE 3H09A 4BAMB 1ETTH 5B6LA 3FAOA 3CENA 3EE0B 4THNH 1HAZB 1SQTA 2O8LA 3LJJA 4O9VA 5HIYA 4Z6AH 1FZZA 1LPKB 4ABHA 2W6JD 2D26C 4YZUA 4KGAA 2JETC 1UW7A 3E0PB 3SBKA 1H8IH 3QK1A 5DJ7A 4CBOA 1OPHB 1W3CA 1GVZA 1XUGA 5AFYH 3RC5A 1OYQA 3ATIA 1V3XA 1SGPE 2PTNA 4FVBA 3T29A 3M3TA 3URCA 4F48B 1OWKA 3MO9A 4GPGA 4HG6A 1AQ7A 1GI3A 3SN8A 2PW8H 1CA0C 2VB0A 1MMJN 4FVDA 4AX9H 1UTNA 4CR5A 1P02A 1V2UT 2O8UA 3RXRA 1O2XA 1IQMA 3AVZA 2H9EH 4Y8ZA 1AY6H 3DHKH 2ZPSA 3VXFH 3UB0A 1L4ZA 1D6WA 5DPAA 1SC8U 2BOKA 2G52A 3SU4A 1BMMH 3A83A 1BRAA 3RXBA 1HUTH 3CS0A 1YP9A 2A2QH 1O2ZA 1A0HB 1RJXB 1CU1A 2TGAA 2UUKB 3L3TA 1AWHB 3S7KB 3S9BA 1ELBA 1SQAA 1E1QD 1TBRH 1W0YH 3ZVCA 1HAIH 4A92A 3KQBA 1C5ZB 5DP7A 1ZR0A 1C5XB 2OP9A 1ID5H 2Z3DA 1C5NH 3F1SB 4DY7B 4ISIH 4XBBA 1FY1A 3QN7A 3F68H 1XKBC 3M36A 1P04A 4ZMAH 3PV4A 2ZHFH 1J15A 1K28D 4TY6A 7GCHF 2ZHWH 3EA9A 1L1GA 5EPNA 5C20A 4ACBA 1FUJA 3FKSD 5AVDA 1AE5A 3PTNA 5IDKA 3SV9A 4NIXA 2GMTC 2XBYA 4DIHH 4X6OA 4AORA 2ZNKH 3F0OA 3TPIZ 1H9HE 5FCRA 3LC5A 1C1UH 1ZPZA 4GHQA 2OTVA 1E0FD 1BTPA 1OWDA 3GISB 4XSKU 4HTCH 2WHXA 5IK2D 1W12U 3ZVFA 1GGDB 1BJVA 2STBE 1O3PB 1SGFA 1EATA 3VPKA 1HAHH 4Q80A 3GY2A 2ZWLH 2G81E 1BJUA 3EQ0H 4ABEA 1AHTH 2W3IA 1S81A 2EI7A 4IBLH 1H4WA 1LVMA 2P94A 3U8OH 1QR3E 3SZEA 1BITA 3A81A 4NA9H 1RRKA 3SNEA 1OWJA 3ODFA 1YPEH 3ZVAA 4FU7A 4GCHG 1LDTT 1JXPA 4ABGA 2A1DB 3VFEA 3GYLB 3SUDA 4OM9A 1TFXA 5LGOA 1N1LA 3SJIA 1EB2A 2IOTA 3E1XB 3WWFA 4IN1A 2XWAA 1KY9A 1HNEE 3SV7A 1GBIA 3M3VA 1W14U 2H9HA 2EI6A 1C9PA 2W26A 2CJIA 4WH8A 3SV6A 1UK2A 4JZDH 4Y0ZE 2BDHA 1T31A 3VB4A 3U1JB 3T25A 4XRNA 1NY22 3SU5A 4LXBH 1TQ0B 1L0ZA 1QB9A 1WYKA 1DY9A 2P3UB 2Y5FA 5EJZA 1BOQA 2LNCA 1KXDA 2BLWA 3ZZ8A 3OX7U 3ZV8A 5JPMH 4I31A 1F0SA 4NCYA 2ZDMA 1O2QA 3BTDE 2ULLA 2Y81A 1XVOA 2C8WB 3RXIA 3DFLA 3PLKA 2AMDA 5LH8A 3LJOA 5DGJA 2SGAA 1J9CH 3BTHE 1MD7A 4ZCNA 3SGQE 4BTTB 1TOCB 5I25A 4FUFA 2ZTXA 1DUEA 2PKSC 3BG4C 3OY5U 2YNBA 1SBWA 3SU1A 2NU3E 1RIWC 1PQAA 4AGKA 3ZZ7A 1SGCA 3MO3A 1N8OC 1RGQA 3TJOA 4K60A 4NA8A 1KLIH 2J9NA 1ZHPA 3V0XA 1SI5H 1K9OE 2C8YB 2C3SA 1LHGH 2OXSA 1GBFA 3P17H 1NFXA 3Q3KA 5CDFE 2O8TA 2OBQA 1DX5M 2ODPA 1QZ8A 4M7GA 1UMAH 2CF8H 1T7CA 3ZYEA 1C4U2 4IC5A 1HLTH 1BHXF 4GVUA 3PYHA 1YKTA 3K6YA 2VH6A 1TBQH 1HCGA 1GHAG 5HKKD 2BDGA 2J94A 2OC1A 4NSVA 2WPJS 4MNXA 2P93A 1IQFA 1VCPA 1O2PA 4H6TA 3RDZA 4O3UA 4Y8XA 2XYAA 3VG8A 2KAIB 3UR9A 1P0SH 1WCZA 4X1SU 2UWPA 3GCOA 3D23A 1IQJA 1AUJA 1Y5UT 1DSUA 4FUHA 1QBNA 1SGTA 2SGEE 3BTGE 1BBRH 5JYIA 2PFEA 4A1VA 1MTSA 2CMYA 5AF9H 4GLYA 4B75A 3NUMA 4XFQA 2XCNA 3MU4A 4Q2KA 1C2MA 1UVUH 1C2IA 3NKKA 3BEUA 2Z3CA 4TPIZ 1ORFA 1NN6A 4Y7AA 1O2KA 2BVSH 2BX4A 2VIDA 1HPGA 1D6RA 1ZPCA 4X1RU 2BB4A 4TWYA 5HM9A 1C5OH 1MD8A 2YMSD 1W11U 3PMBB 2JH0D 3MHWU 3RXPA 3MI4A 5FAHA 4XOJA 3MU1A 5EW2H 2BD7A 3MNSA 3A7ZA 1XKAC 5FL7D 3R0FA 3DSOA 3K2UA 5C67A 1SSXA 5DP9A 2QF3A 1JBUH 1EOJA 2HPQH 3M5OA 4CHAB 1P09A 2UWOA 5KGOA 4UFFH 1C2JA 5LPEA 3RU4T 1SGIB 1A3BH 2AH4X 1SR5C 4QT8C 1HAPH 3ATLA 2ZGCA 5ESTE 3GCTF 3ATWA 1P05A 2FM2A 1MH0A 2HRVA 2UUJB 1HIAA 3RU4D 3F2FA 3QO6A 1DXWA 1O36A 3NPSA 1NRSH 5HYOA 1BRCE 4KKDA 5TCAA 2JH6D 1Z6JH 4WXIA 3ATMA 4CRGA 3RMNH 1W7XH 4F49A 2QN5T 4Q4LA 1BZXE 3SV8A 3SJ9A 4CRAA 1KLJH 2FO9A 5DP5A 1A1RA 1TAWA 5E2PA 2A31A 1NRPH 3QX5H 4Z0KA 1HAGE 3TJNA 1SOTA 5FHTA 2A4OA 2I6SA 3PB1E 1GG6B 1VR1H 1BRBE 1B5GH 5JBCS 1C5UA 1GJAB 1UJ1A 2VIVA 1FAKH 1SVPA 3BSQA 5J4QA 2FXRA 4CRDA 3S9CA 2FS8A 1TYNA 1AKSA 4YT7H 1SGQE 1JWTA 1LHFH 1ANDA 2F3CE 1WSSH 2LP6A 2OQ5A 1DOJA 1BBRE 4I7YH 1MTUA 1NRRH 3KQCA 2B0FA 1PJPA 2QE7D 2QXHA 3Q00A 4UFDH 3EA8A 1NRNH 4OS7A 5FBIA 2A7JA 1FLEE 1GDQA 3SHAH 3PO1C 3KGPA 2HNTE 2GJGA 3LH3A 3SU2A 4OS5A 2GP9B 1ZJKA 4IW4E 1GMCF 4TSFD 1NROH 1EUFA 1S84A 2VH0A 1F5KU 1GBEA 2CHAC 2ZQ1A 1BMLA 4IN2A 4MDSA 1CBWB 1CA8B 3LOXA 1SLUB 1TRNA 1O5BB 1G32B 3RM2H 4NWKA 2FOHA 1O3NA 5E0GA 1EZUC 1C5TA 1O3AA 2VNTA 1FY8E 3Q3YA 3UR6A 3ESTA 3UAIC 1O2LA 3JZ2B 4AYVB 5GPIB 1TPPA 4X8TH 1BMNH 1G30B 2TRMA 4DURA 1TNHA 2IPHA 1O3FA 4BXWA 1E36B 1LHDH 2ZU3A 5C1XA 4IMZA 2BQ7B 1O2IA 2J5UA 4X8SH 4GUXA 2A5IA 5JB8S 1K1IA 2BY8X 3VGCB 1MTNB 1MU6B 1O2WA 4ABIA 1BA8B 3GS9A 1GI7B 1MCTA 4K3JA 3SJKA 3SUEA 1EP5A 3SHCH 3TK9A 1FY3A 2AGEX 3NWUA 2D2DA 1TRMA 3KF2A 4R0IA 5A0BA 4WMDA 3UPEA 4I32A 4NIWA 2BYAX 7GCHG 2KR7A 4ZHAA 3U9AH 1NU7B 1TPOA 5C5NA 1NTPA 2BLOA 3MMGA 1Y3XA 1Y59T 2PGBB 1A5HA 3A8AA 2HOBA 2P59A 3LIWA 4ZKNU 1KXCA 4OGXA 2WUCA 2A0QB 3TNTA 2ZU4A 4I8HA 1UTPA 1BHXB 1EZSC 4FUGA 1DVAH 2J4IA 4O03A 4I8GA 4X6NA 1WAYB 3D62A 2PWXA 4K1SA 4H42U 1SGEE 2JIZD 2Z9JA 2XW9A 3A89A 1C5RA 3P8FA 3DT0H 1TOMH 1AZZA 1BTWA 1NC6A 5C94A 2QCYA 2ZU5A 3HK3B 5BPEA 2AIQA 2LELA 3E0NB 5I46H 1G37A 4NIYA 3F2HA 1QJ6B 2F9PA 2BD9A 4BXSA 1PPZA 5K7RA 1TBZH 2HNTC 3EE7A 3OAAD 3AW1A 1T32A 1ZJDA 1IQIA 4BOHA 4CREA 2W6ID 2VINA 2WINI 2Y82A 4CRCA 1OXGA 1K1OA 1GGDC 4K2YA 1XUFA 2J98A 1DT2A 4Q63A 1WOFA 3P95A 2AERH 1ARBA 1KYNA 4UE7H 1UVSH 2QYIA 2V7QD 3ITIA 2XBVA 1ESAA 2AGGX 1B0FA 1P2KA 2B8OH 3GY8A 3NRLA 5AFZH 3UTUH 1ZMNA 3SW2B 4AN7A 4WVPE 4KP0A 1FY5A 1TQ7B 2WPMS 1K21H 1MKXK 1GJ8B 1UK4A 2EC9H 1SLXB 3A8BA 1F5RA 1L2EA 1TE0A 1CQQA 1C4Y2 5EXLA 8GCHF 2VIPA 1GJ5H 2FTLE 1DICA 2VIQA 3RM0H 1ELEE 3BTQE 1G3CA 5EJLA 2GCHF 3MYWA 4FUEA 1GBKA 1GJ6A 3GY5A 4ISLA 3VB5A 1A4WH 5L2ZH 1C5PA 1TALA 3PRBA 4INHA 4I86A 1YCPH 5HIZA 1QQUA 1HJAB 2F43B 2R3UA 2BVXH 3OTPA 3RXOA 1F0RA 5FPYA 3N7DA 4D8NA 1O3CA 4YTAA 2BD3A 1V6DA 1C2LA 3SU3A 2A4GA 1LVYA 3HKIB 4BNRA 1HXFH 1QFKH 2RA3A 3SQHE 1AB9C 1MU8B 3BTME 1MTVA 4NIVA 3SI3H 5JBBS 4XBDA 3ZZBA 1OWIA 3CS7A 3D49H 1NRQH 1DWDH 1L4DA 1V2MT 2BY6X 3STIA 1GBDA 1A3EH 1YY3A 2NU0E 3A84A 1KXBA 3GDUA 3ZYDA 3DUXH 1TNLA 1ACBE 2TPIZ 4DVAU 3TK5A 8KME2 1GDUA 2R9PA 5F6MA 3U28C 2ZIQH 4GAWA 2FYRA 2WV4A 1DLEA 4O3TA 2VBCA 4JK6A 2GCTC 1VGCB 3Q3XA 1Z8IB 3B9FH 3ZZAA 1D4PB 2ZA5A 2FEQH 4F55A 3FZZA 4DIIH 1N6YA 2ZO3H 3KHVA 4DCDA 3R3GB 4ABAA 2B5TB 3LDXH 3BTTE 1BBRK 2EEKA 3RC6A 2OK5A 1BB0B 2HALA 1TGSZ 3LGTA 4BTIB 1WV7H 1ZGIA 2F91A 2R3YA 4FUBA 4CH8B 4YOGA 3SZNA 1IQKA 3NK8A 1H1BA 2ZTZA 1GBJA 9LPRA 1UTMA 1AZ8A 1UK3A 1YLDA 5CHAB 1SHHB 1FPCH 1GBHA 2KX4A 1TNGA 2ZDAH 3ZZ9A 1OWHA 2A32A 3ZZCA 1S6LA 2G5VA 2KM0A 3UNRA 2OUAA 5FX6A 2WPDD 5T6DA 5EIYA 3FVFB 5EXMA 4ZKOU 1Y5BT 1HAVB 5C1UA 1EJAA 1ZMJA 5K0HA 1ZTJA 4WJG2 4AFQA 1KIGH 1S85A 1UHBB 3P8NA 4RKOB 3ZZDA 1W2KH 2RCEA 3MH7A 4K1TA 1L1JA 2PR3A 4B73A 2SNWA 1OKXA 2XC0A 2VVCA 1MZDA 1ZMLA 2ZFTA 1BUIA 3GCTG 4R8TB 2H1UA 3UOUA 4KELA 6GCHG 1ELAA 2VU8E 2XBWA 1GI2A 4U2WA 4B2AA 3ZZ5A 1VJAU 1AD8H 1PPHE 3DSGA 3KCGH 2K1QA 3IWMA 2RDEA 1TLDA 3RMMH 4CHAC 1FMGA 3QGNB 1EXFA 1QTFA 4K69A 1O30A 1EAIA 4MTBA 1O38A 1EP6A 1O3OA 2WYJA 5FPSA 1A7SA 1QB1A 2H5DA 5A0CA 2FPZA 3RXCA 2H6MA 5HGGA 1K1PA 2GT8A 4MQAA 3N99A 4I8LA 4YLUA 3PMAB 1NM6A 1BTXA 5CMXH 2ZCHP 1O2YA 3UIRA 3A7WA 1YBWA 4F4OC 1AU8A 1P9SA 3OYPA 4B76A 4DJZB 1PYTC 3GY3A 2G8TA 1SGNE 2ILNA 3EDXB 5DK1A 4AYYB 3RXTA 1ABJH 1C2DA 1HB0B 4GHTA 1DWBH 1UVTH 1GBMA 1LVOA 1O33A 1XUIA 2OBOA 1GBAA 2ZGJA 3FP6E 5E8EH 5ETXA 3A7VA 4ABJA 1GG6C 2ZF0H 4IGDA 1A5GH 1MCVA 3BTFE 4NFEA 4OS1A 1QQ4A 2FOBA 2D1JA 4IMQA 1AN1E 4U30A 1D3PB 1DITH 2VIOA 1BTUA 1GVLA 2AEIH 5DKMA 5H4IB 1TMBH 3ZVEA 1EPTB 1Y3YA 3TGKE 1NZQH 5PTPA 5FPTA 5FX5A 4D76A 5GWZA 1Z8RA 3RXUA 1EASA 3Q76A 1XUHA 5DP4A 3QDZB 3V3MA 2Z94A 1TABE 2J92A 2ODQA 1S6HA 1EJNA 5FCKA 4X0WU 2JH5D 4AOQA 2OC8A 1E1RD 3P70B 4ZHMU 3WW7A 1C1VH 5TJXA 3PRDA 2VWOA 1Y3UA 4MPVA 1OYTH 1CBWC 2QGRA 1LQEA 2GV6A 3RC4A 1GJDB 1MKWH 2FTMA 1C1TA 1G2MA 2YNAA 1YLNA 2A7HA 3MU0A 5LPRA 5C5OA 4LZ4B 2F9OA 4NGAH 2FLRH 1G3DA 3BEIB 4FUDA 3QZQA 1YPHE 4JZFH 1EZXC 4A6LA 3FFGA 2KFWA 3JZ1B 2NU4E 3UFAA 2QF0A 2TGPZ 5GCHF 4B6EA 2QXIA 4AFSA 1SPJA 6ESTA 1OP8A 4Q7XA 2G55A 2V3HH 2L6OA 3PTBA 1A0JA 3AASA 3AAVA 3EA7A 2J97A 3QGJA 1ZPBA 1P2QA 3FN8A 1PPFE 3I29A 1TNJA 5C0UA 2O8WA 3K9XB 2F9NA 3SGAE 1A2CH 2FOEA 2LPRA 2QV1A 4FU8A 1O2NA 1X7AC 2GD4B 5EGMA 2BMGB 4I33A 3RP2A 1ANCA 2HPPH 1O5CB 5C3NA 1P3EA 1SGFG 2XC5A 1WDIA 2C4FH 7ESTE 3S7HB 2Y80A 1N6XA 2VWMA 3RXHA 1NS3A 1WQVH 1O5AB 1S0RA 3LC3A 2HVYB 3MOCA 1FDPA 1FN8A 5EODA 1KSNA 4ASUD 2WPHS 2ZCLP 2DE8A 5F8TA 4NWLA 2Z9GA 1PPEE 1SLWB 1AVGH 4RN6A 2YMSB 3UWIA 2KAIA 2KCPA 3F2GA 3ZV9A 1O3KA 2C8XB 1L1NA 1QCPA 4TWWA 1DWEH 1SLVB 2SFAA 2WPKS 3LT3A 3UNQA 2G4UA 1MZAA 3NCLA 1MAYA 2J34A 1C9TA 4WY3A 3RXQA 3LU9B 2ZHDA 1BMAA 4A7IB 3P8GA 3LGIA 4J2YB 1DUAA 1CHGA 1DANH 2VGCB 3AK5A 1GJBB 1M9UA 1HGTH 1P8VC 2QF4A 4Y8YA 1DXPA 3L33A 2G51A 1KLTA 2JDID 1GHVH 3TJVA 3DA9B 3UY9A 1PQ5A 2QA9E 1SOZA 1FPHH 2P3FH 2BDBA 8GCHG 4XE4A 2OCVB 1MTWA 4HFPB 1EX3A 1YPHC 4X1QU 1HIAB 3RXFA 1FN6A 2JJ2D 2FOMB 1GJ7B 2GCHG 1NFWA 1GHYH 2HVXA 5C1YA 2WYGA 2FOCA 2XC4A 2ALPA 1O3GA 2QXJA 2R2WU 3AAUA 3B23B 4NZLA 1UCYH 6CHAB 3VB7A 5L6NH 1O2UA 3TITA 2RA0A 2B9LA 2ZEBA 2NWNA 2AHME 4Q7YA 3ZIAD 2O8MA 1O3EA 1RTFB 3TU7H 3ZVDA 2XNIA 9ESTA 5F53A 2FODA 1KXAA 2ZHEH 4KTSA 1DM4B 3RMLH 1C4V2 3PLPA 3RXDA 1V2RT 1WQSA 3W95A 1PPGE 4J1YA 2Z9KA 5ABWA 1GMHF 2V0BA 3DD2H 1F5LA 2W7SA 1TRYA 3SQEE 1HJAC 1HAYB 2BLQA 2FOFA 1YGCH 5ESBA 3RXEA 3BIUH 3FOAA 1TIOA 4E7NA 1ESBA 4X2WA 1PYTD 1GI0A 1QJ1B 1O5FH 3K6ZA 1T8OA 2FLBH 5F8XA 3M35A 1C1SA 2BY9X 1KMHB 3B8JA 1XXFA 1HAXB 1BMFD 1HYLA 1XM1A 1JMOH 1RTLA 2GZ8A 2PKAB 3FANA 2WPLS 4LOYH 4GCHF 2FESH 3TNSA 1E35B 1WU1A 1GBLA 1OHHD 2ALVA 2BDIA 2ZDNA 3O8DA 1OX1A 3DSPA 1UTLM 4AG2A 1TNIA 2EA3A 4CRFA 2XOKD 1KDQB 1HAOH 4X6PA 1AMHA 4E7RG 4B74A 1UO6A 1WBGB 2GDEH 1VGCC 4E06H 4H6SB 1W0KD 2KCYA 1TMTH 5E0JA 4UFEH 1WTGH 1EAWA 2VVUA 3K65B 1CGIE 3M61U 3U8RH 3M5NA 1EB1H 1THRH 2Q6FA 5A09A 2GX4A 1SQOA 3RXLA 1O2MA 3ZZ6A 1O2OA 1O37A 1JRTA 3U8TH 1AE8H 5L2YH 3OU0A 4OS4A 4Y79A 4WWYA 1C2KA 1UCYE 2XCFA 1O3BA 4ZROA 1TONA 2EY4C 1GJ9B 3F9GA 2ZG0H 5DP8A 1ETSH 2FI4E 5CHAC 3BF6H 1Q3XA 2THFB 2YOLA 1LHEH 1EKBB 1O2TA 1CGJE 1MBQA 1T8LA 3DCLA 3UWJH 4Y71A 2C93B 5EG4A 1O3LA 1O2HA 4YOJA 1ZTKA 2OC0A 4JK5A 1CGHA 1DSTA 2A5AA 2FYQA 2Y5GA 1YCPM 4NSYA 3ZZ4A 4ZKSU 2AMQA 2ZU2A 4P00A 3PWCA 1ANEA 2J2UA 2SGQE 4Y7BA 1AO5A 3CP7A 1SGDE 3TGIE 1VKYA 5A8XA 2ZFRH 1GL1A 2BY7X 4BTUB 1O2GH 2HNTF 2P16A 2P3TB 4OS2A 1CVWH 2Z7FE 2A45B 5DO4H 5T6FA 1NESE 4VGCB 3LONA 1O5EH 1QL9A 2ZHQH 2GGVB 1VITF 3BEFB 4X1PU 3SORA 1TA6A 1PFXC 1T8MA 1YPLH 4JZ1A 3AW0A 1DY8A 1UVOA 2GTBA 1WXRA 5JB9S 4IC6A 1ELFA 4Y11E 2V6NA 2FX6A 3UQVA 2BHGA 2NU2E 3U98H 4K8YA 2RDLA 1NO9H 5CE1A 2WUBA 4BAQB 2XNDD 4NFFA 4MLFB 2H2ZA 1YC0A 2P8OB 2TGDA 3P6ZB 3RXGA 3ELAH 4HZHA 4MPXA 4JCNA 1P12E 1C5VA 3MNBA 2AGIX 2ZI2H 3S69A 1QRXA 3KQ5A 5CHBA 1PPCE 1FQ3A 2WV9A 1OP2A 1HBTH 4U32A 4Y76A 5DSFA 2BDAA 4MNWA 1UTKA 2ZU1A 3RXKA 5GDSH 3Q77A 3WWBA 1LQDB 3SJOA 1RD3B 1THPB 4TPYA 1AUTC 4X6MA 3PV2A 2QAAA 1FAXA 1QURH 3MFJA 4B2CA 2KCOA 4KTCA 2VIWA 3V13A 1OWEA 1GDNA 4B2BA 3V7TA 2QXGA 3O8CA 3URDA 1IOEA 3KQEA 4JYTA 1LTOA 3RLWH 3MNCA 2KZ4A 3FP8E 2A5KA 1YPMH 3SNAA 4BANB 1S5SA 1B7XB 1S6FA 1E79D 2BX3A 4FU9A 1P2NA 5HMAA 1QJ7B 2B7DH 4SGAE 1T8NA 4AG1A 5EQQA 2ZPQA 3LKWA 1JRSA 1QL7A 2FMJA 2W7UA 2W5EA 1QL8A 1RXPA 1S83A 1ZRBA 3E91A 1AIXH 1P01A 3MH5A 4JZIA 4MVNA 1ZSJA 4OS6A 3VXEH 1IQEA 2ZFQH 1EQ9A 1CSOE 3RU4E 1CT2E 1KTTB 3F0PA 4RSPA 4BAKB 5J4SA 5B6OA 1V2NT 2BXUH 1E38B 3NXPA 4U01A 1SFQB 1P06A 1FNIA 1TX6A 1V2KT 5F03A 2SNVA 5C0TA 3PO1B 3F9HA 1KTSB 4B71A 1O3JA 1TPSA 2XTTB 1NBMD 1T4UH 1A0LA 1GHBF 3T5FH 5EOKA 4YT6H 3SI4H 2Y7XA 1GI6A 4INLA 2KCAA 4Y6DA 1UTJA 2IJOB 4A1TA 1QGFA 1O39A 1QHRB 3M7QA 4YM9A 8LPRA 2C90B 3LGUA 1INCA 3KNXA 4CR9A 4AB8A 4ESTE 2F4LA 4ISHH 4X8UH 3KYGA 4O97A 2PUXB 5GNDA 1PPBH 1TB6H 2PGQB 2BM2A 5SGAE 1HJ8A 4XDEA 1FJSA 1THSH 1JIMA 1F0UA 3F9EA 1TX7A 1O3HA 2BVRH 1VZQH 1ZHRA 2ZDLA 5C2ZA 3GY6A 3HPTB 1ZYOA 4XD7D 1V2QT 4YXWD 2Y5HA 1GI5A 2M5TA 1IQGA 1DLKB 1LKAA 3F9FA 1BRUP 2ANMH 2ZGHA 4X1NU 1XUKA 3GYMA 1ZLRA 2WV5A 2YMSC 1H8ED 3T26A 3GICB 4NA7A 1ARCA 4XBCA 3BTKE 2F9BH 5EJ1A 2FI3E 3OFND 1Z7KA 1GPZA 3MNXA 4ZKRU 1XVMA 4UFGH 4AB9A 3QLPH 3T27A 1HAVA 4MNVA 4RT1A 4B1TA 5GIBA 4D9RA 4RT0A 3VB6A 1K1NA 3BIVH 5F8ZA 1ELCA 2ZDVH 1UHBA 3PWBA 2BQWB 3LGYA 2G00A 4FXGH 1ELGA 1QA0A 3STJA 2OINA 2VGCC 3GCHB 1K0HA 1F2SE 1QB6A 1ANBA 1VJ9U 2FX4A 3SO3A 4ZXXH 4A5TS 5DP6A 4JMYA 2ZDKA 3TH4H 3EYDA 4MPUA 1ELDE 2RG3A 3ATKA 2RFKC 1YF4A 1C1WH 1GHWH 4ZUHA 4AGJA 1UCYK 1LCYA 2DE9A 1PQ8A 2OLGA 3E90B 4SGBE 1AI8H 1IHSH 3MO6A 2PSYA 2UUYA 2ZFFH 3MWIU 2OQUA 3BN9A 5GXPA 1MQ5A 1YYY1 5E0HA 2V3OH 3O8RA 1FXYA 4FUIA 1NFYA 3HGPA 5EU8A 1NPMA 1BTHH 1MBMA 4ZXYH 1GBBA 1GMHG 3RXMA 3TH2H 2ZP0H 6CHAC 5HXFA 4RI0A 1U6QA 4AC9A 3MU8A 2VVVA 1MQ6A 3LGWA 2ZQ2A 3SUGA 1GBCA 1GCDA 3TK6A 1V2WT 3FP7E 3M37A 1AGJA 3GDVA 5EQRA 2C8ZB 1BTYA 2A4QA 1H8HD 2TBSA 8ESTE 3KEEA 4BAOB 1P11E 2Z3EA 1V2PT 3ZVGA 3D65E 3FZDA 4UONA 1COWD 1GMCG 1RS0A 1QY6A 1GJCB 1UTOA 4P02A 2FZZA 1TPAE 3A87A 3UQOA 2L74A 4KTUA 1ZHMA 1GHXH 4M9FA 4WH6A 1P2JA 4DW2U 5IYTA 1O5GH 3KN2A 3QTVH 1TGCA 2IPQX 1LHCH 5G4BA 3V12A 1HFDA 2GVFA 1QBOA 2FI5E 1BDAA 4ABFA 3QWCH 1EPTA 1O34A 5EW1H 1O2SA 3M5LA 1MKXH 3TIUA 5A0AE 1V2LT 1F0TA 1GCTB 3RXVA 3VB3A 3SNBA 3PROA 3E6PH 1TGTA 1SFIA 4X2YA 4DGJA 2PSXA 3PV5A 1A61H 1LPZB 1GMDF 1YWUA 3U69H 2F9UA 1AFQB 4ABBA 4YESB 1K2I1 3IITA 2BTCE 1EOLA 2BD4A 4UEHH 1AB9B 3M3SA 4DT7B 1NFUA 1C5LH 2AMPA 3TVJB 5HM2A 4ZAEA 1J8AA 1GI8B 2STAE 2QY0B 1SGYE 1Y3VA 1XUJA 1T4VH 4PROA 2VWNA 3H7OA 2GKVE 2V35A 1C5WB 1C5YB 1O2VA 2BOHB 2BD8A 3VGCC 1MTNC 3LPRA 3ENSB 1RFNA 1NU9A 1XXDA 2JETB 2FS9A 3SOSA 3P92A 1D3QB 5EQSA 4WMEA 1CHOF 1QRWA 3TH3H 1LKBA 2ANWA 2G4TA 1OSSA 2GCTB 4DOQA 1DE7H 4ASHA 1ELTA 3A7YA 4I8KA 1P2IA 2IN2A 3DFJA 1V2ST 1VCQA 1WUNH 2XWBI 4DG4A 1Z1IA 1FONA 4GSOA 1F92A 1CA0B 1E37B 2R2MB 2PUQH 2FOGA 3SUFA 2H9TH 3TLOA 1G36A 1CT0E 6LPRA 3S9AA 1VITG 2CK3D 4UD9H 4X8VH 1S82A 3G01A 1MABB 1ZSLA 4NZQA 4MPWA 1NBME 4WF8A 3UREA 3H7TA 4NG9H 2QC2A 4TT3D 5T6GA 3EAJA 1V2TT 4B6FA 1TA2A 2WPIS 4K8BA 4VGCC 5E2OA 1SG8B 1TWXB 3W1EA 1C1QA 5JBTA 1QA7A 2SGDE 1V2OT 4JYUH 3RXAA 4ZH8A 3BG8A 2GV7A 2PP6A 4H4FA 1HXEH 4A1XA 4X2VA 1TX8A 1W0ZU 2WSSD 3OEHD 1G9IE 2ZFPH 1Y5AT 2ASUB 2OD3B 2JJ1D 2SGPE 2CXVA 4YOIA 5DN6D 5KEDA 2UUFB 2Y6TA 4D7GA
chains in the Genus database with same CATH topology
2ZGBH 1IQLA 1VITH 2P8OC 4Y10E 1O5DH 1O3DA 4WMFA 1DS2E 2AFQB 2GMTB 3T28A 3M7TA 4AFUA 4CH2B 3SNCA 1TNKA 1QBVH 3PLBA 2BXTH 1HJ9A 4K5ZA 3WY8A 1E34B 1IHTH 4JZEH 7KMEH 3ZVBA 1H9IE 1YCPK 1C1RA 1NT1A 1MAXA 1OP0A 3RUOA 3NZIA 6GCHF 1JIRA 2DUCA 5T3HA 2FDAA 3GDSA 4LK4A 2FOAA 3GY7A 1P10A 1J14A 1K1LA 3UOPA 4ZHLU 1O31A 2Z9IA 3T2NA 3MTYA 1J17T 1A5IA 2BDYA 1BQYA 3I77A 1XMNB 4ISOA 1AKSB 5DP3A 3T62A 1J16A 3A88A 3LGVA 1K1JA 1BCUH 3C27B 5A2MH 5A8ZA 2BZ6H 1ZRKA 3L6PA 1A46H 1K1MA 1ZTLA 1P2OA 3F6UH 3A7XA 5A8YA 1FIWA 1D3DB 1GHBG 2P95A 3M5MA 2H5CA 2ZTYA 3SGBE 1HRTH 1QNJA 4JYVH 1AFEH 3EGKH 4INKA 1EZQA 4E05H 2AS9A 1P2MA 3RMOH 2BZAA 2J95A 3A8CA 1V2VT 1C5MD 1P57B 3GOVB 4RKJB 2PKAA 3P8OA 1LPGB 1BT7A 3A7TA 2OC7A 2F83A 1Z8JB 1LMWB 5JDUB 2GZ9A 1SMFE 2ZC9H 3QUMP 2F9VA 3OY6U 4ISNA 2Q6GA 2VJ1A 1YM0A 1ZGVA 1LVBA 1PQ7A 1FV9A 2XXLA 4UDWH 1KDQA 2CF9H 4FUCA 3TJUA 3ZZ3A 2PKSB 3BG4B 1FY4A 5AHGH 1S0QA 1RIWB 1YPKH 5BRRE 1H8DH 1SL3A 1N8OB 1ESTA 2G5NA 1CT4E 4Y0YE 3SJ8A 1EJMA 1P3CA 1SB1H 2CV3A 1C1MA 1CE5A 1GBTA 1O3MA 5EXNA 3PMJA 1P03A 1LO6A 3OTJE 3HATH 4ABDA 5GJ4B 1KXEA 1KXFA 7LPRA 1G2LA 4D9QA 1WTHD 1K22H 1GHZA 2R0LA 4OGYA 1W8BH 3A80A 4IS5A 4CBNA 2BY5X 2AYWA 1Y8TA 4YO9A 1C5SA 1EAXA 3HGNA 2XRCA 3LH1A 4TY7A 1F7ZA 2ZKSA 2Q6DA 2XBXA 1B0EA 1G3EA 5FXLA 1BIOA 2BDCA 3RXSA 5LPFA 1YPGH 2AIPA 3IG6B 1DWCH 2GZ7A 2HGTH 3M7UA 1BTZA 1Q31A 1P9UA 3E16B 1FI8A 1YLCA 1H9LB 4LZ1H 1GL0E 1SGRE 3MU5A 3MH4A 3VEQB 2JKHA 4I8JA 1ZSKA 1IQNA 3GY4A 1GHAF 2ZZUH 2CN0H 1W10U 4K1EA 2EI8A 3GCHC 2CGAA 3BTWE 3TGJE 1OOKB 3H5CB 1GI9B 1O0DH 4WXVA 3N7OA 2BQ6B 5DG6A 2A4RA 2TIOA 3SU6A 1TGNA 1ABIH 2R0KA 2PTCE 2VWLA 2ESTE 2HWLB 2Z6BD 2W3KA 1GI4A 1HV7A 4TYDA 1O3IA 3U1IB 1ETRH 4HGCA 2ZFSA 3KL6A 4HI3A 2HLCA 1CO7E 3BV9B 1YPJH 2Y7ZA 1O2JA 3UNSA 3OSYA 3A8DA 1MUEB 3RLYH 4D7FA 3I78A 1FIZA 2BD2A 1GWAA 4AFZA 3A85A 1Z8GA 5L30H 2NU1E 3C1KA 3PM3A 4X2XA 1QRZA 1C1NA 1DFPA 3HKJB 3RXJA 4BAHB 1Y3WA 3SNDA 1DPOA 1GI1A 2D8WA 1W7GH 2ANKH 1AVWA 4CRBA 2O9QA 4AZ2B 1RTKA 1D9IA 2A2XH 1G3BA 1QIXB 3GCNA 1Q2WA 1Z1JA 2Z9LA 1UTQA 3QZRA 1GJ4H 3UUZA 1D3TB 2FP7B 3ODDA 1TGBA 2J38A 2BD5A 4Q7ZA 1AWFH 2BLVA 4MG3A 2ZCKP 1XX9A 2I6QA 1OS8A 1Z71A 1EPTC 1ZZZA 1MKWK 3SV2H 3A86A 1IAUA 4FUJA 4MNYA 1ELVA 1GMDG 4YLQH 1O35A 1HDTH 2A7CA 3KQDA 1TMUH 1JOUB 2PHBA 5FBEA 1C1OA 1O2RA 5JBAS 5GCHG 3KIDU 1SHYA 1AVXA 1GVKB 2GT7A 3SU0A 2QIQA 1GCTC 2ANYA 3HK6B 2Q1JA 1Z6EA 1C2FA 3O8BA 3A82A 2UWLA 2SGFE 2ODYB 2GDDA 1O32A 3E3TA 2TGTA 2ZGXH 3QTOH 1VCWA 2PLXA 1V2JT 1IQHA 5EPYA 1EAUA 1AFQC 3W94A 1C2EA 1C2GA 1UVPA 1DDJA 3PMHB 3E8LA 2ZECA 2FIRH 1C2HA 3S0NA 3MH6A 1CHOG 1ZOMA 5TCCA 3BTEE 1C5QA 2PV9B 2CHAB 2FWWA 2ZPRA 1W13U 1C1PA 4BAMB 1ETTH 3FAOA 3CENA 3EE0B 4THNH 1HAZB 1SQTA 2O8LA 3LJJA 4O9VA 4Z6AH 1FZZA 1LPKB 4ABHA 2D26C 4YZUA 4KGAA 2JETC 3E0PB 3SBKA 1H8IH 3QK1A 5DJ7A 4CBOA 1OPHB 1W3CA 1GVZA 1XUGA 5AFYH 3RC5A 1OYQA 3ATIA 1V3XA 1SGPE 2PTNA 4FVBA 3T29A 3M3TA 3URCA 1OWKA 3MO9A 4GPGA 1AQ7A 1GI3A 3SN8A 2PW8H 1CA0C 2VB0A 1MMJN 4FVDA 4AX9H 1UTNA 4CR5A 1P02A 1V2UT 2O8UA 3RXRA 1O2XA 1IQMA 3AVZA 2H9EH 4Y8ZA 1AY6H 3DHKH 2ZPSA 3VXFH 1L4ZA 1D6WA 5DPAA 1SC8U 2BOKA 2G52A 3SU4A 1BMMH 3A83A 1BRAA 3RXBA 1HUTH 3CS0A 1YP9A 2A2QH 1O2ZA 1A0HB 1RJXB 1CU1A 2TGAA 2UUKB 3L3TA 1AWHB 3S7KB 3S9BA 1ELBA 1SQAA 1TBRH 1W0YH 3ZVCA 4A92A 1HAIH 3KQBA 1C5ZB 5DP7A 1ZR0A 1C5XB 2OP9A 1ID5H 2Z3DA 1C5NH 3F1SB 4DY7B 4ISIH 4XBBA 1FY1A 3QN7A 3F68H 1XKBC 3M36A 1P04A 4ZMAH 3PV4A 2ZHFH 1J15A 1K28D 4TY6A 7GCHF 2ZHWH 3EA9A 1L1GA 5EPNA 5C20A 1FUJA 5AVDA 1AE5A 3PTNA 5IDKA 3SV9A 4NIXA 2GMTC 2XBYA 4DIHH 4X6OA 4AORA 2ZNKH 3TPIZ 1H9HE 5FCRA 3LC5A 1C1UH 1ZPZA 4GHQA 2OTVA 1E0FD 1BTPA 1OWDA 3GISB 4XSKU 4HTCH 1W12U 3ZVFA 1GGDB 1BJVA 2STBE 1O3PB 1SGFA 1EATA 3VPKA 1HAHH 4Q80A 3GY2A 2ZWLH 2G81E 1BJUA 3EQ0H 4ABEA 1AHTH 2W3IA 1S81A 2EI7A 4IBLH 1H4WA 1LVMA 2P94A 3U8OH 1QR3E 1BITA 3A81A 4NA9H 1RRKA 3SNEA 1OWJA 3ODFA 1YPEH 3ZVAA 4FU7A 4GCHG 1LDTT 1JXPA 4ABGA 2A1DB 3VFEA 3GYLB 3SUDA 1TFXA 5LGOA 1N1LA 3SJIA 1EB2A 2IOTA 3E1XB 4IN1A 2XWAA 1KY9A 1HNEE 3SV7A 1GBIA 3M3VA 1W14U 2H9HA 2EI6A 1C9PA 2W26A 2CJIA 4WH8A 3SV6A 1UK2A 4JZDH 4Y0ZE 2BDHA 1T31A 3VB4A 3U1JB 3T25A 1NY22 3SU5A 4LXBH 1TQ0B 1L0ZA 1QB9A 1WYKA 1DY9A 2P3UB 2Y5FA 1BOQA 2LNCA 1KXDA 2BLWA 3ZZ8A 3OX7U 3ZV8A 5JPMH 4I31A 1F0SA 4NCYA 2ZDMA 1O2QA 3BTDE 2ULLA 2Y81A 1XVOA 2C8WB 3RXIA 3DFLA 3PLKA 2AMDA 5LH8A 3LJOA 5DGJA 2SGAA 1J9CH 3BTHE 1MD7A 3SGQE 4BTTB 1TOCB 5I25A 4FUFA 2ZTXA 1DUEA 2PKSC 3BG4C 3OY5U 2YNBA 1SBWA 3SU1A 2NU3E 1RIWC 1PQAA 4AGKA 3ZZ7A 1SGCA 3MO3A 1N8OC 1RGQA 3TJOA 4K60A 4NA8A 1KLIH 2J9NA 1ZHPA 3V0XA 1SI5H 1K9OE 2C8YB 2C3SA 1LHGH 2OXSA 1GBFA 3P17H 1NFXA 3Q3KA 2O8TA 2OBQA 1DX5M 2ODPA 4M7GA 1UMAH 2CF8H 1T7CA 3ZYEA 1C4U2 4IC5A 1HLTH 1BHXF 4GVUA 3PYHA 1YKTA 3K6YA 2VH6A 1TBQH 1HCGA 1GHAG 2BDGA 2J94A 2OC1A 4NSVA 2WPJS 4MNXA 2P93A 1IQFA 1VCPA 1O2PA 4H6TA 3RDZA 4O3UA 4Y8XA 2XYAA 2KAIB 3UR9A 1P0SH 1WCZA 4X1SU 2UWPA 3GCOA 3D23A 1IQJA 1AUJA 1Y5UT 1DSUA 4FUHA 1QBNA 1SGTA 2SGEE 3BTGE 1BBRH 5JYIA 2PFEA 4A1VA 1MTSA 2CMYA 5AF9H 4GLYA 4B75A 3NUMA 4XFQA 2XCNA 3MU4A 4Q2KA 1C2MA 1UVUH 1C2IA 3NKKA 3BEUA 2Z3CA 4TPIZ 1ORFA 1NN6A 4Y7AA 1O2KA 2BVSH 2BX4A 2VIDA 1HPGA 1D6RA 1ZPCA 4X1RU 2BB4A 4TWYA 5HM9A 1C5OH 1MD8A 1W11U 3PMBB 2JH0D 3MHWU 3RXPA 3MI4A 5FAHA 4XOJA 3MU1A 5EW2H 2BD7A 3MNSA 3A7ZA 1XKAC 3R0FA 3K2UA 5C67A 1SSXA 5DP9A 2QF3A 1JBUH 1EOJA 2HPQH 3M5OA 4CHAB 1P09A 2UWOA 4UFFH 1C2JA 5LPEA 3RU4T 1SGIB 1A3BH 2AH4X 1SR5C 4QT8C 1HAPH 3ATLA 2ZGCA 5ESTE 3GCTF 3ATWA 1P05A 2FM2A 1MH0A 2HRVA 2UUJB 1HIAA 3RU4D 3QO6A 1DXWA 1O36A 3NPSA 1NRSH 5HYOA 1BRCE 4KKDA 5TCAA 2JH6D 1Z6JH 4WXIA 3ATMA 4CRGA 3RMNH 1W7XH 4F49A 2QN5T 1BZXE 3SV8A 3SJ9A 4CRAA 1KLJH 2FO9A 5DP5A 1A1RA 1TAWA 5E2PA 2A31A 1NRPH 3QX5H 4Z0KA 1HAGE 3TJNA 1SOTA 5FHTA 2A4OA 2I6SA 3PB1E 1GG6B 1VR1H 1BRBE 1B5GH 5JBCS 1C5UA 1GJAB 1UJ1A 2VIVA 1FAKH 1SVPA 3BSQA 5J4QA 2FXRA 4CRDA 3S9CA 2FS8A 1TYNA 1AKSA 4YT7H 1SGQE 1JWTA 1LHFH 1ANDA 2F3CE 1WSSH 2OQ5A 1DOJA 1BBRE 4I7YH 1MTUA 1NRRH 3KQCA 2B0FA 1PJPA 2QXHA 3Q00A 4UFDH 3EA8A 1NRNH 4OS7A 5FBIA 2A7JA 1FLEE 1GDQA 3SHAH 3PO1C 3KGPA 2HNTE 3LH3A 3SU2A 4OS5A 2GP9B 1ZJKA 4IW4E 1GMCF 4BOHA 1NROH 1EUFA 1S84A 2VH0A 1F5KU 1GBEA 2CHAC 2ZQ1A 1BMLA 4IN2A 4MDSA 1CBWB 1CA8B 3LOXA 1SLUB 1TRNA 1O5BB 1G32B 3RM2H 4NWKA 2FOHA 1O3NA 5E0GA 1EZUC 1C5TA 1O3AA 2VNTA 1FY8E 3Q3YA 3UR6A 3ESTA 1O2LA 3JZ2B 4AYVB 5GPIB 1TPPA 4X8TH 1BMNH 1G30B 2TRMA 4DURA 1TNHA 2IPHA 1O3FA 4BXWA 1E36B 1LHDH 2ZU3A 5C1XA 4IMZA 2BQ7B 1O2IA 4X8SH 4GUXA 2A5IA 5JB8S 1K1IA 2BY8X 3VGCB 1MTNB 1MU6B 1O2WA 4ABIA 1BA8B 1GI7B 1MCTA 4K3JA 3SJKA 3SUEA 1EP5A 3SHCH 3TK9A 1FY3A 2AGEX 3NWUA 2D2DA 1TRMA 3KF2A 4R0IA 5A0BA 4WMDA 3UPEA 4I32A 4NIWA 2BYAX 7GCHG 4ZHAA 3U9AH 1NU7B 1TPOA 5C5NA 1NTPA 2BLOA 3MMGA 1Y3XA 1Y59T 2PGBB 1A5HA 3A8AA 2HOBA 2P59A 3LIWA 4ZKNU 1KXCA 4OGXA 2WUCA 2A0QB 3TNTA 2ZU4A 4I8HA 1UTPA 1BHXB 1EZSC 4FUGA 1DVAH 2J4IA 4O03A 4I8GA 4X6NA 1WAYB 3D62A 2PWXA 4K1SA 4H42U 1SGEE 2Z9JA 2XW9A 3A89A 1C5RA 3P8FA 3DT0H 1TOMH 1AZZA 1BTWA 1NC6A 2QCYA 2ZU5A 3HK3B 5BPEA 2AIQA 3E0NB 5I46H 1G37A 4NIYA 1QJ6B 2F9PA 2BD9A 4BXSA 1PPZA 5K7RA 1TBZH 2HNTC 3AW1A 1T32A 1ZJDA 1IQIA 4CREA 2VINA 2WINI 2Y82A 4CRCA 1OXGA 1K1OA 1GGDC 4K2YA 1XUFA 1DT2A 1WOFA 3P95A 2AERH 1ARBA 1KYNA 4UE7H 1UVSH 2QYIA 3ITIA 2XBVA 1ESAA 2AGGX 1B0FA 1P2KA 2B8OH 3GY8A 5AFZH 3UTUH 1ZMNA 3SW2B 4AN7A 4WVPE 4KP0A 1FY5A 1TQ7B 2WPMS 1K21H 1MKXK 1GJ8B 1UK4A 2EC9H 1SLXB 3A8BA 1F5RA 1L2EA 1TE0A 1CQQA 1C4Y2 5EXLA 8GCHF 2VIPA 1GJ5H 2FTLE 1DICA 2VIQA 3RM0H 1ELEE 3BTQE 1G3CA 2GCHF 3MYWA 4FUEA 1GBKA 1GJ6A 3GY5A 4ISLA 3VB5A 1A4WH 5L2ZH 1C5PA 1TALA 4INHA 1YCPH 1QQUA 1HJAB 2R3UA 2BVXH 3RXOA 1F0RA 5FPYA 4D8NA 1O3CA 4YTAA 2BD3A 1V6DA 1C2LA 3SU3A 2A4GA 1LVYA 3HKIB 4BNRA 1HXFH 1QFKH 2RA3A 3SQHE 1AB9C 1MU8B 3BTME 1MTVA 4NIVA 3SI3H 5JBBS 4XBDA 3ZZBA 1OWIA 3CS7A 3D49H 1NRQH 1DWDH 1L4DA 1V2MT 2BY6X 3STIA 1GBDA 1A3EH 2NU0E 3A84A 1KXBA 3GDUA 3ZYDA 3DUXH 1TNLA 1ACBE 2TPIZ 4DVAU 3TK5A 8KME2 1GDUA 2R9PA 5F6MA 2ZIQH