5B6OA

Crystal structure of ms8104
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
310
structure length
310
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title SARS-CoV 3CL protease cleaves its C-terminal autoprocessing site by novel subsite cooperativity
pubmed doi rcsb
source organism Human sars coronavirus
total genus 81
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5b6oA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5b6oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5b6oA02
2O9QA 2ZP0H 2OC8A 5CMXH 1CHGA 3OY5U 3RU4D 4YM9A 2V0BA 3PMAB 4GCHG 1P9SA 1OP0A 4FVBA 1J9CH 1PQ7A 1BMAA 4CR9A 3RXFA 4BTTB 2G4UA 5F8TA 2BX4A 1SLUB 4Y71A 2FEQH 3S7KB 1Z7KA 3T25A 1FDPA 4WH8A 1NZQH 2C3SA 6LPRA 1C5YB 1PYTC 3K2UA 1ZSJA 1O2MA 3K6YA 2H9TH 3LC3A 2WPLS 5E0GA 2BD3A 1PPGE 5JB9S 2J4IA 3MH6A 3UREA 1TGNA 3LGIA 3UOPA 1O39A 2ZDAH 4JZEH 1FAKH 1XXDA 1UJ1A 6CHAB 1ZSKA 3SHCH 4CR5A 2FOGA 2O8UA 1VGCC 1FV9A 2BOKA 3UTUH 2PKAA 1TQ7B 5EQQA 1DANH 3UWJH 7KMEH 4H4FA 4ZUHA 3A86A 1QA7A 5DP7A 7GCHG 1IQFA 1O3KA 1VITF 5H4IB 2VIVA 2STBE 1TRMA 4GUXA 1D9IA 1PPBH 2FO9A 2ZWLH 1WTGH 3NKKA 1C5RA 2QN5T 1CHOG 1Z6JH 1ZMJA 1T4VH 1QFKH 4HTCH 1GI5A 4I33A 2SNVA 2LPRA 1G2LA 1O2RA 2JKHA 2ZDKA 2BZAA 1SHYA 2PKSC 1IQHA 5SGAE 3E6PH 1GMHF 2A31A 1TOMH 1P05A 2K7XA 4TWWA 3F9HA 3RP2A 2Z3CA 1H9HE 4X1PU 4CBNA 4CRCA 1QJ7B 1YPGH 1JBUH 2OTVA 1HIAA 2BDYA 3QTOH 1XVOA 1GJDB 3V13A 3LJOA 2BQ6B 5FCRA 2AGEX 4TY6A 1EAUA 3DT0H 3Q3YA 1HAGE 1EB2A 1JMOH 4MG3A 1O31A 3QO6A 1UO6A 1AUJA 2IJOB 9LPRA 3QDZB 3BSQA 2Z6BD 3TGJE 1D3PB 2NWNA 3EYDA 1QJ6B 1DSTA 3GOVB 3QX5H 2W7SA 1ZOMA 2VGCB 1TPSA 3TJVA 3HATH 3OYPA 2DE8A 2C8YB 4MPUA 3M36A 2A32A 4B74A 2A4RA 1HAHH 1P12E 1K2I1 1SOZA 2G55A 1EB1H 2Z7FE 3S9CA 2O8WA 2ZGHA 1GJCB 1GMDF 2AMPA 1TX6A 3I78A 4X2YA 1WSSH 1SGYE 1RFNA 2NU4E 1YPKH 1S5SA 5A0AE 1AO5A 4NZQA 5C1UA 2BVRH 3M7UA 4LOYH 5GCHG 2VIPA 3AAVA 4JK5A 1SGQE 3A7ZA 1EZUC 2O8LA 1HCGA 1MAYA 2ZQ1A 3RUOA 3V7TA 1O33A 2QA9E 4NWLA 1GBKA 2WPJS 5T6FA 3U8OH 2BY8X 3DFLA 2EI6A 2A0QB 3TK6A 2F9BH 6ESTA 3GY7A 1ZLRA 4DG4A 2SGEE 2VJ1A 1IQMA 2FS9A 5AFYH 1P06A 2NU1E 4LZ1H 4ABFA 1P2IA 1EAXA 3E0NB 4NA8A 1SGIB 2C8XB 2BYAX 3EBNA 2BDAA 3P95A 4OGXA 1GDUA 3RXOA 1C5OH 1GJ4H 5E8EH 3GCOA 3L3TA 1A0JA 2P3UB 3UFAA 1C9TA 1LPKB 2ZHFH 1P2KA 5DP8A 1GI4A 4XOJA 3DUXH 3V0XA 1UVTH 4ZKSU 2BLVA 5ESTE 1NFUA 1HAIH 3PTNA 5A8ZA 3TLOA 2A5AA 3D49H 4ABEA 2XBXA 2D26C 4NA9H 3KIDU 2AYWA 3RXMA 3QUMP 1ESBA 4DURA 3EA7A 2PGQB 1O30A 1TNIA 4K8BA 1C4U2 1ANBA 1B5GH 3T5FH 1TLDA 4JYTA 5JBAS 2BD8A 4NGAH 1O3FA 2QXGA 1RXPA 4HZHA 1FY5A 1WBGB 2THFB 1TYNA 1UMAH 6CHAC 3SJ9A 1HRTH 4WMEA 1AE8H 3VB6A 1CO7E 4WJG2 4OS6A 1QBOA 1AI8H 3DA9B 4KTUA 1O3LA 1CA0B 1O2YA 3RXVA 5A8XA 3BN9A 2XCFA 2ZCLP 1DSUA 1BBRK 2FOMB 1ELVA 1O3EA 3U8RH 5JPMH 2I6SA 3ATKA 1BJUA 3S0NA 1SGFG 8ESTE 4B76A 1E0FD 3U1JB 1A2CH 4WY3A 4XBDA 1C1PA 4X6NA 1E37B 2ZGXH 2BD2A 2ALPA 1INCA 2ZPQA 4OS4A 2ZCHP 1RTFB 5LPRA 2ANMH 2VIDA 4B2CA 5FAHA 4JZ1A 3T27A 4AFSA 2ANYA 1KXCA 2VH6A 1AHTH 2AERH 3HPTB 1GDQA 3H5CB 2PGBB 7LPRA 2TBSA 1P2MA 1O3JA 5CHAB 4ZHLU 1SQTA 1C5TA 1XKBC 2QIQA 3TIUA 2ESTE 5LGOA 1ZYOA 4IMQA 4GAWA 4INKA 2ZEBA 2NU0E 1W12U 5K0HA 4ABHA 3LGTA 1RRKA 1ELAA 1ELBA 2OUAA 3PMJA 3UR6A 4WXIA 3ENSB 4Q7XA 3RXPA 4RSPA 3ZVDA 1LHEH 1Y3WA 5DP6A 1P10A 5A8YA 1O2OA 2F9OA 1O3CA 1BTHH 4XE4A 1C1TA 3H7OA 1Z8JB 4MNXA 3ZVBA 1UTQA 1BHXB 4IMZA 2Y81A 4TY7A 1Z71A 2VGCC 5T3HA 1G3CA 2SNWA 9ESTA 2BY9X 2CN0H 3M37A 2XC0A 5I25A 2XBYA 2F9VA 3EA8A 1D6WA 3ZV8A 1B0EA 3SU3A 1Y5AT 3PROA 5LPFA 2R0KA 1NFXA 4ZROA 3LGVA 4YLUA 2ZA5A 3Q76A 1K9OE 5FPTA 5J4QA 1O2KA 3RXEA 1V2TT 1AN1E 5DPAA 3SU0A 2UUJB 1W2KH 1XXFA 3E8LA 3FP7E 5A0BA 2J94A 3JZ1B 4KTCA 1OP2A 2BDHA 3KHVA 3IITA 2V3HH 4UFFH 2FI3E 2ZDVH 1J17T 1SGDE 2BOHB 4X1SU 1ARBA 3BTHE 3ZZ4A 1KLJH 1W7XH 1FY1A 3FP8E 2AMDA 3BEIB 2SGFE 5EPYA 5FCKA 1A3BH 1D6RA 4FUIA 1QRZA 2TGTA 1DE7H 1QQ4A 1LVYA 1MD7A 5FBIA 3P17H 2ANKH 4NWKA 3SO3A 4B71A 4HI3A 1O2SA 3TK5A 3RXIA 1YPHC 2TGAA 4AGKA 4O9VA 4XDEA 1QY6A 3ZZ3A 2JH6D 2WPMS 1T8LA 2BHGA 4ZKOU 2PV9B 4SGAE 3A87A 1WAYB 2A7HA 4JYVH 1AKSA 2BDCA 2XTTB 3L33A 4BXWA 4X6MA 1G36A 1ZSLA 4X1NU 3SUDA 1P2QA 3P8FA 2D2DA 4A7IB 3KGPA 4U2WA 1P8VC 3RMNH 1O3AA 1BBRH 4FUCA 2W26A 1GI3A 2ZDLA 4NIVA 2ODPA 3ZVFA 1Y5BT 2OC7A 5E0HA 2VWOA 2WINI 3ZYDA 5JBCS 3SU1A 1TX7A 1A61H 3RU4T 1GJ6A 2GGVB 1EPTA 2FP7B 2IPHA 1SHHB 5EW1H 3FZZA 3PLPA 3MO6A 5TCAA 2A1DB 3NZIA 1GI2A 3SV7A 3TVJB 2P16A 4Y6DA 5C2ZA 4MNWA 1DM4B 1HAVB 1TNKA 1O3IA 2EA3A 1THSH 2OBQA 3SGAE 1O5BB 1C5QA 3ESTA 1YPLH 4E7RG 2GCHF 2PHBA 3GCTG 1AQ7A 1JIMA 3BTME 3LJJA 1ZTLA 3RC4A 1DPOA 1W0YH 1C5UA 2ZKSA 1XX9A 2FESH 4DJZB 1UTJA 2VIOA 1IQGA 1O2IA 1K1JA 4Y8XA 3M5MA 1ACBE 3PWBA 2ZPRA 1TNJA 4I7YH 3A8AA 1ID5H 2VVUA 2BVSH 2ZZUH 1C1MA 1EX3A 4LK4A 4ZHAA 1IAUA 1V2ST 1G30B 4NCYA 1SLXB 4I8GA 4ISHH 1BHXF 1FJSA 1GHZA 3FFGA 3UIRA 1P02A 1WYKA 2ZPSA 2OXSA 2ZGCA 3ZZDA 2A5KA 1GHAF 1LKAA 1CSOE 1WOFA 4I32A 4ABDA 3EGKH 4VGCB 1C2EA 1MTUA 3GDUA 4NG9H 1P3CA 3GCTF 2CJIA 4GSOA 3RXDA 3A84A 5A2MH 1JXPA 2JH0D 4WXVA 2GDEH 1G9IE 1GMCG 4J1YA 1RJXB 6GCHF 3M5OA 1BRCE 2FX6A 1FUJA 3OX7U 3RXBA 2ZECA 2FDAA 1RS0A 3OTJE 3RXAA 4D7FA 5L2ZH 4BAMB 1YCPK 3TH3H 3LGYA 4ISOA 4MQAA 2Q6DA 2RA3A 3RLYH 3QTVH 3HK6B 1O37A 5L30H 5L6NH 1O2JA 1F5LA 1W8BH 1O2XA 1U6QA 1HXEH 1M9UA 1WCZA 2G5VA 5F6MA 1G2MA 3BF6H 1O38A 1H8IH 1MTNB 3GY5A 3SV8A 4DW2U 2ZTZA 1IQNA 2P59A 1P01A 1O36A 2XBVA 4X8UH 1ABJH 1EJAA 2R3YA 1LTOA 1DXPA 5GJ4B 3MO3A 4Y8ZA 4AX9H 4B2BA 1NO9H 4ABBA 3ZVGA 3KQCA 1YPJH 3TJNA 1OOKB 2UUYA 2A2XH 3AAUA 5JDUB 4TYDA 3DD2H 4ISLA 5JBTA 5TJXA 2ZHWH 3Q00A 1L1JA 3PLBA 4ABAA 1TFXA 3ZZCA 3GCHB 1SOTA 5AFZH 1EP6A 1C2JA 4RKJB 4Z6AH 3HGPA 1A0LA 1ETRH 1SGNE 3QGJA 4FXGH 1W13U 1Y59T 2XWBI 1KTTB 1N6XA 2FLRH 2B7DH 3SGQE 3M3TA 2HWLB 1C2FA 2HNTF 4K1TA 5BRRE 1TMUH 3UQVA 2P93A 2FOBA 1EOJA 3BTGE 2FODA 4Y0YE 3SORA 1V2KT 2QC2A 2F3CE 1A1RA 4NSVA 5AF9H 2C90B 8GCHF 2HNTC 1GBAA 1KLIH 4XSKU 1ZRKA 3M7QA 1B0FA 1K1LA 1THPB 1F2SE 1SLVB 2QCYA 3P8NA 1GBFA 1MBMA 1KIGH 3GCNA 1WV7H 1BJVA 1O3NA 2KAIA 3SNEA 2HALA 2H6MA 1ETSH 4IGDA 1XVMA 4GCHF 1O5DH 1X7AC 1XUGA 5C20A 2HVXA 1KDQB 3MU4A 5HM2A 3S69A 3BTFE 5DJ7A 1C2LA 1MUEB 3SUGA 1YPMH 4HFPB 4Y0ZE 3LKWA 1P9UA 1XUFA 1QQUA 2OINA 4GPGA 3BG8A 1QL8A 1YPHE 2Z9LA 3U8TH 1VJ9U 1SVPA 3A8BA 3SGBE 1DWDH 3UOUA 3MNXA 1GI8B 1BTZA 4X2WA 1KY9A 1VCPA 1A46H 5ABWA 4F49A 1EAWA 3A89A 4XBBA 1TBQH 2WUCA 5EQSA 2WPKS 4FVDA 1AGJA 1TGTA 5EU8A 4BOHA 1AE5A 1MKWK 1TBRH 3ELAH 1O3HA 1XUHA 1C1VH 2ZFTA 2AMQA 2ZTXA 2STAE 3PM3A 2W3IA 4Z0KA 1SQOA 3Q3XA 1ZHMA 3VGCB 1QGFA 3RXRA 2SGAA 5LH8A 3LU9B 2HPPH 7GCHF 5DO4H 3MHWU 1UTPA 4NFFA 4GVUA 4YZUA 3RXSA 4VGCC 1AY6H 3SI4H 1CHOF 1EQ9A 1UCYK 4AYYB 2BD9A 3MU5A 3O8DA 4AFUA 2RCEA 1NT1A 1FZZA 1MD8A 1YCPH 1O2UA 4YOJA 1AFQC 1C1SA 1Z8GA 1P09A 1ANEA 1WTHD 2BVXH 1QCPA 1Y3YA 2ZFSA 1OYTH 3M5NA 1O0DH 4AYVB 1O3DA 4IS5A 3U69H 1HLTH 4JZIA 1SFIA 2A45B 2W3KA 3FVFB 1HPGA 2R9PA 2BDIA 1TOCB 2Z9KA 3SJOA 2TGPZ 2FMJA 2G51A 2J9NA 5LPEA 1JIRA 3CS7A 3ZV9A 3O8RA 1C1QA 1NY22 3SHAH 4ZKRU 4CH2B 2ZU2A 1THRH 1GWAA 2A4OA 4OS5A 2ZTYA 3MU0A 1QB1A 1BRAA 1GBJA 3ZZ6A 1UK3A 1NRRH 1YGCH 2CF9H 2ZU4A 2OCVB 4WMFA 2Z9GA 3BTQE 1FI8A 4IN2A 3DFJA 1KTSB 4Q80A 1O3GA 1MTNC 3SNAA 1PPCE 1C5PA 1GVKB 1C2HA 1BTUA 1LPZB 2BTCE 4BXSA 5E0JA 5JB8S 2FYRA 3S7HB 1RGQA 1KXEA 1NC6A 1G3DA 4O3TA 2CXVA 2QAAA 1F0RA 1V2LT 1CT0E 3SU2A 1GBHA 2P3TB 3F1SB 1ESAA 3BV9B 5C1YA 3K6ZA 4K8YA 2B5TB 3FZDA 3PYHA 3TH4H 1AD8H 2AIPA 3ZZ7A 5A0CA 4DGJA 3BTWE 3NWUA 1K22H 5EOKA 1T32A 1CGHA 5HMAA 1NFWA 3NK8A 5G4BA 1AFEH 1MH0A 3SU4A 2NU3E 3ITIA 3GCHC 2FI4E 3D65E 2FOFA 1F92A 1MU8B 3MOCA 1C2DA 1E35B 1GG6B 1KXAA 2I6QA 1LQDB 3KF2A 2AGGX 1QHRB 3SUFA 2V6NA 2XWAA 2ZGJA 1D3TB 1V2OT 4QT8C 3LGWA 5GCHF 3MTYA 1JRSA 3PWCA 1F5RA 4GHTA 4Q7YA 1TALA 3K65B 3UNQA 1LHCH 1T8OA 2WUBA 2Z94A 3STJA 3EAJA 4X1QU 2EI7A 2LNCA 4D9QA 1SPJA 3R0FA 3EE0B 3DHKH 1S0RA 1NRQH 2G5NA 1DOJA 4ESTE 5FPYA 1A5GH 5HGGA 5T6GA 5I46H 1GL1A 1SGPE 2Q6GA 1UHBB 3KNXA 4X8SH 2Q1JA 3PO1B 3B23B 1T31A 2G52A 1MAXA 4ZMAH 1GCDA 1T7CA 3NUMA 3ZZBA 2GT8A 4AOQA 3AW0A 3HKJB 4IN1A 1AVXA 3P92A 4X2XA 3URCA 1QTFA 1TPAE 1MZDA 1JRTA 3PLKA 2XC5A 1OYQA 2XCNA 3SBKA 4K5ZA 1T4UH 5FHTA 2FZZA 4AORA 1V2RT 2OC1A 1ESTA 1NRSH 1C2KA 1TIOA 1GJ8B 1P57B 2P94A 5E2OA 1HJ8A 1UCYH 4YT6H 1YBWA 1D3QB 1MCTA 1CBWC 1PQAA 2AS9A 2QXHA 4TPIZ 3RLWH 3VGCC 4GLYA 3NXPA 3U1IB 1BRUP 1D4PB 3TGIE 2HNTE 4ZHMU 2XYAA 4LXBH 3LOXA 5F8ZA 2A4QA 4BAKB 4BAOB 3ODFA 4FUDA 3T62A 1KSNA 4JZDH 3WY8A 1Z6EA 1S83A 1W11U 2PFEA 5TCCA 3RXKA 1J16A 4K1EA 1CT4E 3A80A 3JZ2B 4TWYA 1YYY1 1AZZA 2XBWA 1HJAB 5FXLA 3RXQA 2XW9A 1O35A 2FPZA 3LC5A 2BXUH 3PV4A 2BQWB 4FU7A 2J34A 4UFEH 3SJIA 3C1KA 3QZQA 3ZZ8A 2SGDE 3V12A 3MYWA 4RKOB 1UK4A 4ISIH 4A1XA 2ALVA 1GBIA 3AVZA 1N8OB 3BTDE 4Y8YA 1DWCH 3E0PB 3CENA 1G37A 3U9AH 3T29A 1YKTA 5PTPA 2P8OB 3PB1E 1UVSH 3FP6E 2BY7X 2VWLA 4RN6A 2AGIX 2ZU1A 2CGAA 2PWXA 1QNJA 1GI1A 1JWTA 3ZZ9A 3MI4A 1O3PB 4X8VH 4DCDA 1SQAA 1GBEA 1DWEH 1HBTH 3RXJA 1OWDA 1TNGA 1LMWB 3KQDA 2CF8H 1B7XB 1GG6C 3T2NA 1K1NA 5FBEA 4Y79A 3TU7H 2WYGA 1C2GA 2QXIA 1FN6A 3S9BA 1NU7B 3URDA 4I8KA 1HUTH 1KLTA 4MDSA 1MKXK 4I8LA 3ATIA 4X8TH 1PPHE 1W10U 1LO6A 2AIQA 1NROH 5EODA 1DVAH 3UNSA 1V2VT 1BT7A 3F9GA 1DLKB 2Y7ZA 4DIIH 2OD3B 3G01A 1GHYH 1BIOA 5HM9A 1S6FA 1ORFA 4FUHA 1OSSA 2B9LA 1SGEE 1FNIA 4CRAA 4F4OC 2ZDNA 1IQJA 4D76A 1N6YA 1CE5A 1EXFA 1XMNB 2Y6TA 3RXHA 1TGBA 2ZO3H 1T8MA 5ESBA 1UTOA 1P03A 3TNSA 3TH2H 4E05H 3A7WA 1ELGA 1O3OA 1Y3XA 4FUBA 2CHAB 5DP3A 1FPHH 4CRGA 3PO1C 5JYIA 3KN2A 3MNBA 1BTXA 1IQEA 3VFEA 3VB4A 2P95A 3SNBA 5GWZA 1YCPM 1GI0A 1Y3VA 2SGPE 2FOEA 1O2PA 2SGQE 2LIZA 1Z1JA 1A5HA 3QWCH 2ODQA 1L4DA 1WUNH 2HGTH 3TJOA 4MLFB 3A81A 1V2PT 2H5DA 2O8MA 1GBTA 1K1MA 2BLOA 1C2IA 4NIWA 2Q6FA 1W14U 5JBBS 2GV6A 2WV4A 2GX4A 1LVOA 1GDNA 1OWKA 2FTMA 1WQSA 3EDXB 4B75A 1LHFH 4UD9H 5IDKA 1ZPBA 1TGCA 3HGNA 4UFDH 2FM2A 1C5SA 5EXMA 2ZFRH 3TPIZ 2ZU5A 2CV3A 1CQQA 1IHTH 2PTCE 1S6HA 3F6UH 1DY8A 2GMTB 1GBCA 1CT2E 4Y10E 2BX3A 1TX8A 2F83A 5DP5A 5FPSA 4CHAC 4D7GA 4ZAEA 1O2ZA 2AFQB 2PR3A 2Y80A 1GGDB 2JETB 4Y76A 5EGMA 3A8CA 5T6DA 2BXTH 1AFQB 4H6SB 4KELA 1AVWA 7ESTE 1GPZA 1MQ5A 3ATMA 3T28A 1V2NT 1O2GH 4I31A 1IQLA 1SGCA 5DKMA 1QBNA 4OGYA 1HJAC 3MU8A 5GDSH 2NU2E 1QB9A 2HLCA 1PQ5A 1DLEA 5FX5A 4DIHH 1MMJN 1FAXA 5DGJA 1C5MD 4X0WU 1S84A 2Z3DA 1GHVH 3B9FH 4AFQA 1J15A 1VJAU 2YNAA 1GBDA 1N8OC 1TA2A 2UWOA 1MZAA 1UVUH 4GHQA 4YOIA 1C5NH 2FXRA 1LHGH 4IW4E 2Y5FA 3AASA 3F9FA 2XRCA 3CP7A 2PUXB 3C27B 1TE0A 2P8OC 3MH4A 1G32B 3SOSA 4ISNA 3QK1A 3S9AA 1GMCF 1S81A 4UDWH 3FANA 3A82A 4R0IA 1BA8B 1BZXE 2IN2A 1UTMA 2FI5E 1GBBA 3A83A 1MKXH 1SB1H 5EW2H 2F91A 2ILNA 3TJUA 1W3CA 2BQ7B 2ZCKP 3PTBA 3E90B 4FU9A 2BY6X 2QY0B 3SJ8A 1ZMLA 4FUEA 3I29A 4UE7H 4B1TA 3RMLH 4KTSA 3BEUA 1YP9A 1EP5A 1E36B 1HAYB 1V2QT 2ZIQH 3MFJA 2HRVA 1QL7A 3NPSA 3M3VA 1BBRE 1EUFA 1A5IA 2ZU3A 2Y7XA 4B2AA 1XM1A 1UTKA 1PQ8A 3F9EA 1P3EA 3LGUA 2ASUB 4MNYA 1QR3E 4CBOA 4U01A 1ELFA 1H1BA 2ZF0H 1ELCA 1VITG 2OQ5A 2GZ9A 5GPIB 1QRXA 1O32A 3ZVEA 1P04A 3SJKA 1LHDH 1TBZH 3UUZA 2A2QH 2F9UA 1ANCA 1Y8TA 4FUJA 1EZSC 1BMMH 1GMHG 4AB8A 2RA0A 1K1OA 2AEIH 2CHAC 1H8DH 2A5IA 2GT7A 1OP8A 2Z9JA 1SLWB 4BAQB 4M7GA 2GVFA 3KEEA 4E06H 2ZNKH 1A0HB 3U98H 1O2VA 1XUJA 2TPIZ 3OY6U 3LONA 4I8JA 1NESE 1Q2WA 4U30A 1HAVA 2BLWA 1CGJE 3RXUA 1TGSZ 3GYLB 5EPNA 1BQYA 3OSYA 2ZHDA 1A7SA 1G3EA 1RTLA 4ABIA 2VVCA 2WPIS 1LPGB 1FY3A 4X2VA 4H6TA 4ABJA 1G3BA 1HAPH 3LDXH 5C3NA 1LDTT 2QV1A 1HYLA 3BTKE 2Z9IA 1DWBH 1AWHB 1P2NA 3SZNA 1CBWB 1Y5UT 1ZHPA 1KXFA 2D8WA 1PJPA 1CA8B 2DUCA 1BB0B 1YF4A 2K1QA 4WH6A 2R2WU 1TONA 1OX1A 2FOHA 4Q7ZA 3RXGA 2GMTC 1AIXH 5EG4A 1SSXA 4WMDA 2G4TA 1W0ZU 3GY3A 1TNHA 4MPVA 1O5CB 1GMDG 3BIUH 3PMBB 1GGDC 1O3MA 4PROA 1TA6A 1ELEE 2VIWA 3I77A 3ATWA 2JETC 5GXPA 5DP4A 1EJMA 1F5KU 1ZTKA 1O2QA 3P6ZB 4FUFA 3QN7A 2CMYA 3KQEA 1DUEA 4K2YA 2J95A 4X6PA 4ABGA 3CS0A 4NZLA 4UEHH 1VCQA 4ZKNU 2G00A 4JYUH 3TNTA 1BDAA 4I8HA 4A5TS 2Y5HA 1V2UT 1GHBG 2GTBA 2C8ZB 1FIZA 3F68H 3TK9A 3GY6A 1IHSH 1DXWA 1BTPA 4MPWA 1NPMA 3GICB 1MU6B 1GBMA 1ZR0A 4IBLH 4K1SA 4FUGA 3OU0A 1EJNA 2R3UA 1FXYA 3O8BA 2FTLE 2ANWA 4UONA 1KXBA 1DFPA 1A4WH 2G81E 1L1NA 2ZI2H 1XUKA 1ZJKA 3HK3B 2BMGB 4MNVA 1MQ6A 3QZRA 1O3BA 4HGCA 2SFAA 4NIYA 5EXNA 2H2ZA 3L6PA 3SUEA 3E91A 4A1VA 1UTNA 4K60A 4H42U 1AU8A 1C1UH 5GIBA 1GCTC 1OXGA 1ZMNA 1ZHRA 3E3TA 3A7VA 1SL3A 1GL0E 1QBVH 2ODYB 2A4GA 1VCWA 4MTBA 1AB9B 1O5EH 1C9PA 1VITH 2A7JA 2F9PA 2QF0A 3M3SA 1OPHB 4NSYA 1RIWB 4YTAA 4AFZA 1GHBF 1C5XB 2J92A 1DICA 1V2WT 2ZC9H 1OWJA 4Y11E 1NFYA 2ZFPH 1AWFH 2O8TA 1RD3B 1VZQH 4ZH8A 2GD4B 4J2YB 1K1PA 1XKAC 1K21H 1Z1IA 2B0FA 2B8OH 1BTWA 3BIVH 1AKSB 1IQKA 1BTYA 4CRBA 1DDJA 1ZPZA 1V6DA 1DY9A 2GP9B 1EKBB 1LCYA 3UY9A 1DUAA 3M61U 1L4ZA 1GVLA 1NM6A 3K9XB 4OS7A 2R0LA 2H5CA 1NU9A 3A8DA 1ELTA 2F9NA 4NIXA 4YO9A 1FMGA 2UWLA 1VR1H 4AB9A 3A7YA 3KL6A 1KXDA 1NTPA 5EXLA 1Z8IB 1N1LA 2IOTA 1GVZA 2XNIA 1E38B 4D9RA 1O2TA 2W5EA 3ZZAA 3UPEA 2VIQA 2HPQH 2WYJA 2OC0A 3A7XA 4SGBE 1EAIA 2TRMA 1O34A 3LPRA 3MU1A 1W7GH 3MMGA 4WF8A 1EPTB 5F03A 1DS2E 1GI9B 3ZYEA 1GJ7B 3VEQB 1ETTH 1HB0B 1C1OA 1C1RA 2VH0A 1TABE 2BM2A 1KDQA 2TIOA 2BD5A 1F0SA 1SR5C 1GI6A 1MKWH 8LPRA 1GHXH 3RC5A 2VINA 1EASA 2GCTB 1FONA 4BNRA 4JMYA 3SNDA 1FY8E 1AZ8A 2D1JA 1LQEA 2Y5GA 1D3DB 2VU8E 2ZFFH 3M5LA 3A85A 1ZJDA 2VVVA 1GI7B 1TWXB 3KCGH 4YLQH 5ETXA 1O2NA 3SNCA 1FIWA 4ZXYH 3W94A 4KKDA 1GBLA 4KP0A 4DOQA 2GZ8A 1QA0A 2FIRH 2FOAA 2PTNA 1C5WB 3HKIB 1P2JA 3T26A 4O03A 4AN7A 2ZHEH 4JK6A 1MBQA 2PSYA 2BDBA 2Y82A 2BB4A 5A09A 1ZTJA 5IYTA 3LH1A 4CHAB 3SV2H 1LVBA 4UFGH 1BMNH 3NCLA 4B73A 3GDSA 2RDLA 3P8GA 4OS1A 2AH4X 3ZVAA 3RXTA 2ULLA 3E1XB 2EI8A 1A3EH 3SV9A 3Q77A 1HFDA 3RM2H 1ZGIA 3SI3H 1DT2A 3TGKE 3N7OA 1HGTH 4Q2KA 1Z8RA 1S0QA 1HAOH 1C5LH 1PYTD 4O97A 3VXEH 4Y7AA 4O3UA 2PLXA 1ZPCA 1RTKA 3MO9A 1SGFA 2QF3A 3RMOH 3A7TA 2BY5X 3STIA 3KQBA 1PFXC 3E16B 1MTWA 2FS8A 2PSXA 4U32A 3UNRA 1QURH 1EZQA 2GDDA 3VB5A 2FOCA 1PPZA 3GDVA 4BAHB 3R3GB 1PPFE 3QGNB 2ZQ2A 1TQ0B 1GJAB 4INLA 4K69A 4AG1A 1NN6A 5HXFA 1MTVA 2M5TA 1H9LB 1EZXC 4E7NA 2XC4A 5C5NA 3Q3KA 3SV6A 1CGIE 3VPKA 2V3OH 2BD4A 1YLDA 1GJ5H 1K1IA 1NRNH 3GYMA 4BTUB 1NRPH 1V2MT 3ODDA 3P70B 3O8CA 1O5GH 3BEFB 1AB9C 1ARCA 1YLCA 5EQRA 3SU6A 4CRDA 5B6OA 1RIWC 2EC9H 1DX5M 1AMHA 1NS3A 3W95A 2HOBA 2V35A 2RG3A 4BANB 1QIXB 3B8JA 1FN8A 1SFQB 2XXLA 1UK2A 3M7TA 1P2OA 4YESB 5DK1A 1LKBA 2UUFB 3BG4B 1GHWH 4X1RU 3D62A 1QRWA 2GKVE 3LH3A 4X6OA 2FX4A 1TMBH 1L0ZA 1L2EA 4R8TB 1TRYA 1HXFH 3IWMA 1XUIA 3BTTE 2UWPA 1DITH 4WVPE 3MNSA 1F0UA 1F7ZA 1TPOA 1KYNA 3UR9A 1AVGH 4XFQA 4AGJA 1TB6H 1FPCH 4NA7A 4MVNA 3LIWA 4DY7B 2J2UA 1SGRE 2H1UA 3LT3A 1BUIA 1O2LA 1QJ1B 1P11E 2GCHG 2C4FH 3GY4A 3TITA 1IQIA 3A88A 1HAXB 2EEKA 1HJ9A 1TNLA 5E2PA 4DVAU 2VB0A 5DP9A 1SGTA 1TPPA 4NFEA 3GY2A 1UTLM 1OKXA 1OWEA 3IG6B 2PKAB 2QGRA 2KAIB 4OS2A 2JH5D 3GY8A 1EPTC 1HNEE 1K28D 2YNBA 4AG2A 4D8NA 3QLPH 1ABIH 2QXJA 1SBWA 5AVDA 1EATA 4XBCA 4LZ4B 1SC8U 1UHBA 1Y3UA 2BZ6H 3RDZA 1VGCB 3UQOA 2ZG0H 1CA0C 2ZDMA 3MNCA 5AHGH 1HV7A 1UCYE 3EA9A 2GCTC 2WV5A 1E34B 1MCVA 1MTSA 1GHAG 1WQVH 1AUTC 1S82A 1CU1A 3MH5A 2OP9A 1C1NA 1O5FH 1P0SH 2FWWA 3RMMH 1BITA 1UVPA 4DT7B 3SN8A 1ANDA 1BMLA 3EQ0H 3SW2B 4YOGA 2FYQA 2J38A 1J8AA 4BTIB 1HIAB 2ZGBH 1SI5H 1V2JT 2PKSB 2FLBH 5C5OA 1F0TA 6GCHG 1TAWA 1IOEA 1SMFE 3ZZ5A 1ZGVA 5FX6A 2R2MB 1FY4A 3VB7A 4JZFH 3H7TA 5CHAC 5CE1A 1V3XA 1EOLA 2P3FH 2ZFQH 1JOUB 1O2HA 1HDTH 3ZVCA 2VWNA 1QL9A 1SG8B 4FU8A 5K7RA 1CVWH 1OS8A 2C8WB 2G8TA 2YOLA 4JCNA 1C4V2 1C5ZB 1BRBE 2VWMA 1YM0A 1TMTH 2BDGA 4A92A 3AW1A 1ZZZA 1YPEH 2BLQA 1FQ3A 3MWIU 4KGAA 4WWYA 1Q3XA 1O2WA 2ZHQH 1TRNA 1ZRBA 4IC5A 2Z3EA 4AZ2B 4CREA 2BD7A 4ASHA 1C1WH 4CH8B 1LVMA 4MPXA 2DE9A 3M35A 5C1XA 3RXCA 1GJ9B 1C5VA 1QB6A 3FAOA 3RM0H 1H4WA 4IC6A 1BOQA 3RXLA 4CRFA 4A6LA 2A7CA 1YC0A 3SQHE 1ELDE 2GZ7A 2OLGA 1T8NA 2GV7A 2TGDA 1O5AB 2WPHS 3VB3A 3D23A 3P8OA 4Y7BA 3RC6A 2H9EH 3VXFH 2C93B 1UVOA 4TPYA 2PUQH 1S85A 5DG6A 4ZXXH 1Q31A 8KME2 1L1GA 1GJBB 2OBOA 3GISB 4INHA 1OWIA 3UWIA 2H9HA 1C4Y2 2W7UA 1C2MA 1H9IE 1PPEE 4THNH 1GCTB 2OQUA 3BTEE 3RU4E 2VNTA 2QYIA 5C67A 3SU5A 5L2YH 1WU1A 1HAZB 5BPEA 3ATLA 5HYOA 3V3MA 3PMHB 1BCUH 3MH7A 1J14A 1OWHA 5F8XA 8GCHG 1FLEE 3SQEE 2PW8H 4A1TA 4YT7H 3BG4C 2UUKB 4K3JA 5J4SA
chains in the Genus database with same CATH superfamily
2O9QA 2ZP0H 2OC8A 5CMXH 1CHGA 3OY5U 3RU4D 4YM9A 2V0BA 3PMAB 4GCHG 1P9SA 1OP0A 4FVBA 4Q63A 1J9CH 1PQ7A 1BMAA 4CR9A 3RXFA 4BTTB 2G4UA 5F8TA 2BX4A 1SLUB 4ASUD 4Y71A 2FEQH 3S7KB 1Z7KA 3T25A 1FDPA 4WH8A 1NZQH 3DCLA 2C3SA 4AC9A 6LPRA 1C5YB 1PYTC 3K2UA 1ZSJA 1O2MA 3K6YA 2H9TH 3LC3A 2WPLS 5E0GA 2BD3A 1PPGE 5JB9S 2J4IA 3MH6A 4RI0A 3UREA 1TGNA 3LGIA 3UOPA 1O39A 3PV2A 2ZDAH 4JZEH 1FAKH 1XXDA 1UJ1A 6CHAB 1ZSKA 3FN8A 3SHCH 4CR5A 2FOGA 2O8UA 1VGCC 1FV9A 2BOKA 3UTUH 2PKAA 3OAAD 1TQ7B 5EQQA 1DANH 3UWJH 7KMEH 4H4FA 4ZUHA 3A86A 1QA7A 5DP7A 7GCHG 1IQFA 1O3KA 1VITF 5H4IB 2VIVA 2STBE 1TRMA 4GUXA 1D9IA 1PPBH 2FO9A 2ZWLH 1WTGH 3NKKA 1C5RA 2QN5T 1CHOG 1Z6JH 1ZMJA 1T4VH 1QFKH 4HTCH 1GI5A 4I33A 2SNVA 2LPRA 1G2LA 1O2RA 2JKHA 3NRLA 2ZDKA 2XOKD 2BZAA 1SHYA 2PKSC 1IQHA 5SGAE 3E6PH 1GMHF 2A31A 1TOMH 1P05A 2K7XA 4TWWA 3F9HA 2KZ4A 2Z3CA 1H9HE 3RP2A 4X1PU 4CBNA 4CRCA 1QJ7B 1YPGH 1JBUH 2OTVA 1HIAA 2BDYA 3QTOH 1XVOA 1GJDB 3V13A 3LJOA 2BQ6B 5FCRA 5T1VA 4TT3D 2AGEX 4TY6A 1EAUA 3DT0H 3Q3YA 1HAGE 1EB2A 1JMOH 4MG3A 1O31A 3QO6A 5CHBA 1UO6A 1AUJA 2KR7A 3N99A 2IJOB 9LPRA 3QDZB 3BSQA 2Z6BD 3TGJE 1D3PB 2NWNA 3EYDA 1QJ6B 1DSTA 3GOVB 3QX5H 2W7SA 1ZOMA 2VGCB 1TPSA 3TJVA 3HATH 3OYPA 2DE8A 2C8YB 2J98A 4MPUA 3M36A 2A32A 4B74A 2A4RA 4Z1MD 1HAHH 1P12E 1K2I1 1SOZA 2G55A 1EB1H 2Z7FE 3S9CA 2O8WA 2ZGHA 1GJCB 1GMDF 2AMPA 4OM9A 1TX6A 3I78A 4X2YA 1WSSH 1SGYE 1RFNA 2NU4E 1YPKH 1S5SA 5A0AE 1AO5A 4NZQA 5C1UA 2BVRH 3M7UA 4LOYH 5GCHG 2VIPA 2VBCA 3AAVA 4JK5A 1SGQE 3A7ZA 1EZUC 3EE7A 2O8LA 1HCGA 1MAYA 2ZQ1A 3RUOA 3V7TA 1O33A 2QA9E 4NWLA 1GBKA 2WPJS 3SZEA 5T6FA 3U8OH 2BY8X 3DFLA 2EI6A 2A0QB 3TK6A 2F9BH 6ESTA 3GY7A 1ZLRA 4DG4A 2SGEE 2VJ1A 1IQMA 2FS9A 5AFYH 1P06A 1S6LA 2NU1E 4LZ1H 2YMSD 4ABFA 1P2IA 1EAXA 3E0NB 4NA8A 1SGIB 2C8XB 2BYAX 3EBNA 2BDAA 3P95A 1FX0B 4OGXA 1GDUA 3RXOA 1C5OH 1GJ4H 5E8EH 3GCOA 3L3TA 1A0JA 2P3UB 3WWFA 3UFAA 1C9TA 1LPKB 2ZHFH 1P2KA 5DP8A 1GI4A 4XOJA 3DUXH 1VKYA 3V0XA 1UVTH 4ZKSU 2BLVA 5ESTE 1NFUA 1HAIH 2KCPA 3PTNA 5A8ZA 3TLOA 2A5AA 3D49H 4ABEA 2XBXA 2D26C 4NA9H 3CNRA 1W0KD 3KIDU 2AYWA 3RXMA 3QUMP 1ESBA 4DURA 3EA7A 2PGQB 1O30A 1TNIA 4K8BA 1C4U2 1ANBA 1B5GH 5EJLA 3T5FH 1TLDA 4JYTA 5JBAS 2BD8A 4NGAH 1O3FA 2QXGA 1RXPA 4HZHA 1FY5A 1WBGB 2LP6A 1TYNA 1UMAH 2THFB 4DT4A 6CHAC 3SJ9A 1HRTH 4WMEA 1AE8H 3VB6A 1CO7E 4WJG2 4OS6A 1QBOA 1AI8H 3DA9B 3OFND 4KTUA 4TSFD 1O3LA 1CA0B 1O2YA 3RXVA 1NBMD 3BN9A 5A8XA 2XCFA 2ZCLP 1DSUA 1BBRK 2FOMB 1ELVA 1O3EA 3U8RH 5JPMH 2I6SA 3ATKA 1BJUA 3S0NA 2L74A 2WZQA 1SGFG 8ESTE 4B76A 1E0FD 3U1JB 1A2CH 4WY3A 4XBDA 1C1PA 4X6NA 1E37B 2ZGXH 2BD2A 2ALPA 1INCA 2ZPQA 4OS4A 2ZCHP 1RTFB 5LPRA 2ANMH 2VIDA 4B2CA 5FAHA 4JZ1A 3T27A 4AFSA 2ANYA 1KXCA 2VH6A 1AHTH 2AERH 3HPTB 2YMSB 1GDQA 3H5CB 2PGBB 7LPRA 2TBSA 1P2MA 1O3JA 5CHAB 4ZHLU 1SQTA 1C5TA 1XKBC 2QIQA 3TIUA 2ESTE 5LGOA 1ZYOA 4IMQA 4GAWA 4INKA 2ZEBA 2NU0E 1W12U 5K0HA 4ABHA 3LGTA 1RRKA 1ELAA 1ELBA 2OUAA 3PMJA 3UR6A 4WXIA 3ENSB 4Q7XA 3RXPA 4RSPA 3ZVDA 2JDID 1LHEH 1Y3WA 5DP6A 1P10A 5A8YA 2W6ID 1O2OA 2F9OA 1O3CA 1BTHH 4XE4A 1C1TA 3H7OA 1Z8JB 4MNXA 3ZVBA 2QE7D 1UTQA 1BHXB 4IMZA 2Y81A 4TY7A 1Z71A 2VGCC 5T3HA 1G3CA 2SNWA 9ESTA 2BY9X 2CN0H 3M37A 2XC0A 5I25A 2XBYA 2F9VA 3EA8A 1D6WA 3ZV8A 1B0EA 3SU3A 1Y5AT 3PROA 5LPFA 2R0KA 1NFXA 4ZROA 3LGVA 4YLUA 2ZA5A 1OHHD 3Q76A 1K9OE 5FPTA 5J4QA 1O2KA 3RXEA 1V2TT 1AN1E 5DPAA 3SU0A 2UUJB 1W2KH 1XXFA 3E8LA 3FP7E 5A0BA 2J94A 3JZ1B 4KTCA 1OP2A 2BDHA 3KHVA 3IITA 2V3HH 4UFFH 2FI3E 2ZDVH 1J17T 1SGDE 2CK3D 2BOHB 4X1SU 2KFWA 1ARBA 3FOAA 3BTHE 3ZZ4A 1KLJH 1W7XH 1FY1A 4XRNA 3FP8E 2AMDA 3BEIB 2SGFE 5EPYA 5FCKA 1A3BH 1D6RA 4FUIA 1QRZA 2TGTA 2JJ1D 3GS9A 1DE7H 1QQ4A 1LVYA 1MD7A 5FBIA 3P17H 2ANKH 4NWKA 3SO3A 4B71A 4HI3A 1O2SA 3TK5A 3RXIA 1YPHC 3F3BA 2TGAA 4AGKA 4O9VA 4XDEA 1QY6A 3ZZ3A 2JH6D 2WPMS 1T8LA 2BHGA 3VG8A 4ZKOU 2PV9B 4SGAE 3A87A 1WAYB 2A7HA 5HKKD 4JYVH 1AKSA 2BDCA 2XTTB 3L33A 4BXWA 4X6MA 1G36A 1ZSLA 4X1NU 3SUDA 1P2QA 3P8FA 2D2DA 3W1EA 4A7IB 3KGPA 4U2WA 1P8VC 3RMNH 1O3AA 1BBRH 3UB0A 4FUCA 2W26A 1GI3A 2ZDLA 4NIVA 2ODPA 3ZVFA 1W0JD 1Y5BT 2OC7A 5E0HA 2VWOA 2WINI 3ZYDA 5JBCS 3SU1A 1TX7A 1A61H 3RU4T 1GJ6A 2GGVB 1EPTA 2FP7B 2IPHA 1SHHB 5EW1H 3FZZA 3PLPA 3MO6A 5TCAA 2A1DB 3NZIA 5C94A 1GI2A 3SV7A 3TVJB 2P16A 4Y6DA 5C2ZA 4MNWA 1DM4B 1HAVB 1TNKA 1O3IA 2EA3A 1THSH 2OBQA 3SGAE 1O5BB 1C5QA 3ESTA 1YPLH 4E7RG 2GCHF 2PHBA 3GCTG 1AQ7A 1JIMA 3BTME 3LJJA 1ZTLA 3RC4A 1DPOA 1W0YH 1C5UA 2ZKSA 1XX9A 2FESH 4DJZB 1UTJA 2VIOA 1IQGA 1O2IA 1K1JA 4Y8XA 3M5MA 1ACBE 3PWBA 2ZPRA 1TNJA 4I7YH 3A8AA 1ID5H 2VVUA 2BVSH 2ZZUH 1C1MA 1EX3A 2WV9A 3PRDA 4LK4A 4ZHAA 1IAUA 1V2ST 1G30B 4NCYA 3WW7A 1SLXB 4I8GA 4ISHH 1BHXF 1FJSA 1GHZA 3WWBA 3FFGA 3UIRA 1P02A 1WYKA 2ZPSA 2OXSA 2ZGCA 3ZZDA 2A5KA 1GHAF 1LKAA 1CSOE 1WOFA 4I32A 4ABDA 3DSPA 3EGKH 4VGCB 1C2EA 1MTUA 3GDUA 4NG9H 1P3CA 3GCTF 2CJIA 4GSOA 3RXDA 3A84A 3AK5A 5A2MH 2RDEA 1JXPA 2JH0D 4WXVA 2GDEH 1G9IE 1GMCG 4J1YA 1RJXB 6GCHF 3M5OA 1BRCE 2FX6A 1FUJA 2V7QD 3OE7D 3OX7U 3RXBA 2ZECA 2FDAA 1RS0A 3OTJE 3RXAA 4D7FA 5L2ZH 4BAMB 1YCPK 3TH3H 3LGYA 4ISOA 4MQAA 2Q6DA 2RA3A 3RLYH 1COWD 3QTVH 3HK6B 1O37A 5L30H 5L6NH 1O2JA 3FKSD 1F5LA 1W8BH 1O2XA 1U6QA 4XD7D 1HXEH 1M9UA 3F0PA 1WCZA 2G5VA 5F6MA 1G2MA 3BF6H 2EQNA 1O38A 1H8IH 1MTNB 3GY5A 3SV8A 4DW2U 2ZTZA 1IQNA 2P59A 1P01A 1O36A 2XBVA 4X8UH 1ABJH 1EJAA 2R3YA 1LTOA 1DXPA 5GJ4B 3MO3A 4Y8ZA 4ACAA 4AX9H 4B2BA 1NO9H 4ABBA 3ZVGA 3KQCA 1YPJH 1QZ8A 3TJNA 1OOKB 2UUYA 2A2XH 3AAUA 5JDUB 4TYDA 3DD2H 4ISLA 5JBTA 5TJXA 2ZHWH 3Q00A 1L1JA 3PLBA 4ABAA 1TFXA 3ZZCA 3GCHB 1SOTA 2PP6A 1EP6A 1C2JA 4RKJB 5AFZH 4Z6AH 3HGPA 1A0LA 1ETRH 1SGNE 3QGJA 4FXGH 1W13U 1Y59T 2XWBI 1KTTB 1N6XA 2FLRH 2B7DH 3SGQE 3M3TA 2HWLB 1C2FA 2HNTF 4K1TA 4Q4LA 5BRRE 1TMUH 3UQVA 2P93A 2FOBA 1EOJA 3BTGE 2FODA 4Y0YE 3SORA 1V2KT 2QC2A 2F3CE 1A1RA 4NSVA 5AF9H 2C90B 3N7DA 8GCHF 2HNTC 1GBAA 1KLIH 4XSKU 1ZRKA 3M7QA 1B0FA 1K1LA 1THPB 1F2SE 1SLVB 2QCYA 3P8NA 1GBFA 1MBMA 1KIGH 3GCNA 2QF5A 1WV7H 1BJVA 1O3NA 2KAIA 3SNEA 2HALA 2H6MA 1ETSH 4IGDA 1XVMA 4GCHF 1O5DH 1X7AC 1XUGA 5C20A 2HVXA 1KDQB 3MU4A 5HM2A 3S69A 3BTFE 5DJ7A 1C2LA 1MUEB 2XNDD 3SUGA 1YPMH 4HFPB 4Y0ZE 3LKWA 1P9UA 1XUFA 1QQUA 2OINA 4GPGA 3BG8A 1QL8A 1YPHE 2Z9LA 3U8TH 1VJ9U 1SVPA 3A8BA 3SGBE 1DWDH 3UOUA 3MNXA 1GI8B 1BTZA 4X2WA 1KY9A 1VCPA 1A46H 5ABWA 4F49A 1EAWA 3A89A 4XBBA 1TBQH 2WUCA 5EQSA 2WPKS 2OK5A 4FVDA 1AGJA 2EY4C 1TGTA 5EU8A 4BOHA 1AE5A 1MKWK 1TBRH 3ELAH 1O3HA 1XUHA 1C1VH 2ZFTA 5C0UA 2AMQA 2ZTXA 2STAE 3PM3A 2W3IA 4Z0KA 1SQOA 3Q3XA 1ZHMA 3VGCB 1QGFA 3RXRA 2SGAA 5LH8A 2KCOA 3LU9B 2HPPH 7GCHF 5DO4H 3MHWU 1UTPA 4NFFA 4GVUA 4YZUA 3RXSA 4VGCC 1AY6H 3SI4H 1CHOF 1EQ9A 1UCYK 4AYYB 2BD9A 3MU5A 3O8DA 4AFUA 2RCEA 1NT1A 1FZZA 1MD8A 1YCPH 1O2UA 4YOJA 1AFQC 1C1SA 1Z8GA 1P09A 1ANEA 1WTHD 2BVXH 1QCPA 1Y3YA 2ZFSA 1OYTH 3M5NA 1O0DH 4AYVB 1O3DA 4IS5A 3U69H 1HLTH 4JZIA 1SFIA 1WDIA 2A45B 2W3KA 3FVFB 1HPGA 2R9PA 2BDIA 1TOCB 2Z9KA 3SJOA 2TGPZ 2FMJA 2G51A 2J9NA 5LPEA 1JIRA 3CS7A 3ZV9A 3O8RA 1C1QA 1NY22 3SHAH 2HVYB 4ZKRU 4CH2B 2ZU2A 1THRH 1GWAA 2A4OA 4OS5A 2ZTYA 3MU0A 1QB1A 1BRAA 1GBJA 3ZZ6A 1UK3A 1NRRH 1YGCH 2CF9H 2ZU4A 2OCVB 4WMFA 2Z9GA 5KEDA 3BTQE 1FI8A 4IN2A 3DFJA 3H09A 1KTSB 4Q80A 1O3GA 1MTNC 3SNAA 1PPCE 1C5PA 1GVKB 1C2HA 1BTUA 1LPZB 2BTCE 4BXSA 5E0JA 5JB8S 2FYRA 2F43B 3S7HB 1RGQA 1KXEA 1NC6A 1G3DA 5F53A 4O3TA 2CXVA 2QAAA 5IK2D 1F0RA 1V2LT 1CT0E 3SU2A 1GBHA 2P3TB 3F1SB 5EJZA 1ESAA 3BV9B 5C1YA 3K6ZA 2V3MA 2B5TB 4K8YA 3FZDA 3PYHA 3TH4H 1AD8H 2AIPA 3ZZ7A 5A0CA 4DGJA 3BTWE 3NWUA 1K22H 5EOKA 1T32A 1CGHA 5HMAA 1NFWA 3NK8A 5G4BA 1AFEH 1MH0A 3SU4A 2NU3E 3ITIA 3GCHC 2FI4E 3D65E 2FOFA 1F92A 1MU8B 3MOCA 1C2DA 1E35B 1GG6B 1KXAA 2I6QA 1LQDB 1UW7A 3KF2A 2AGGX 1QHRB 3PV5A 3SUFA 2V6NA 2XWAA 2ZGJA 1D3TB 1V2OT 4QT8C 1H8HD 3LGWA 5GCHF 1NBME 3MTYA 1JRSA 3PWCA 1F5RA 4GHTA 5KGOA 4Q7YA 1TALA 3K65B 3UNQA 1LHCH 1T8OA 2WUBA 2Z94A 3STJA 3EAJA 4X1QU 2EI7A 2LNCA 4D9QA 1SPJA 3R0FA 3EE0B 3DHKH 1S0RA 1NRQH 2G5NA 1DOJA 4ESTE 5FPYA 1A5GH 5HGGA 5T6GA 5I46H 1GL1A 1SGPE 1E1RD 2Q6GA 3F0OA 1UHBB 3KNXA 4X8SH 2Q1JA 3PO1B 3B23B 1T31A 2G52A 1MAXA 4ZMAH 1GCDA 1WXRA 1T7CA 3NUMA 3ZZBA 2GT8A 4AOQA 3AW0A 3HKJB 4IN1A 1AVXA 3P92A 4X2XA 3URCA 1QTFA 1TPAE 1MZDA 1JRTA 3PLKA 2XC5A 1OYQA 2XCNA 3SBKA 4K5ZA 1T4UH 5FHTA 2FZZA 2J5UA 4AORA 1V2RT 2OC1A 1ESTA 1NRSH 1C2KA 1TIOA 1GJ8B 1P57B 2P94A 5E2OA 1HJ8A 1UCYH 4YT6H 1YBWA 1D3QB 1MCTA 1CBWC 1PQAA 2AS9A 2QXHA 1SQRA 4TPIZ 3RLWH 3VGCC 4GLYA 5C17A 3NXPA 3U1IB 3OEHD 1BRUP 1D4PB 3TGIE 2HNTE 4ZHMU 2XYAA 2JJ2D 4LXBH 3LOXA 5F8ZA 2A4QA 4BAKB 4BAOB 3ODFA 4FUDA 3T62A 1KSNA 4JZDH 3WY8A 1Z6EA 1S83A 1W11U 2PFEA 5TCCA 3RXKA 1J16A 4K1EA 1CT4E 3A80A 1E1QD 3JZ2B 4TWYA 1SKYE 1YYY1 2WHXA 1AZZA 2XBWA 1HJAB 5DSFA 5FXLA 3RXQA 2XW9A 1O35A 2FPZA 3LC5A 2BXUH 3PV4A 2BQWB 2KM0A 4FU7A 2J34A 4UFEH 3UAIC 3SJIA 3FO8D 3C1KA 3QZQA 3ZZ8A 2SGDE 3V12A 3MYWA 4RKOB 1UK4A 4ISIH 4A1XA 2ALVA 1GBIA 3AVZA 1N8OB 3BTDE 4Y8YA 1DWCH 3E0PB 3CENA 1G37A 3U9AH 3T29A 1YKTA 5PTPA 2P8OB 3PB1E 1UVSH 3FP6E 2BY7X 2VWLA 4RN6A 2AGIX 2ZU1A 2CGAA 2PWXA 1QNJA 1GI1A 1JWTA 3ZZ9A 3MI4A 1O3PB 1K0HA 4X8VH 4DCDA 1SQAA 1GBEA 1DWEH 1HBTH 3RXJA 1OWDA 1TNGA 1LMWB 3KQDA 2CF8H 1B7XB 1GG6C 3T2NA 1K1NA 5FBEA 4Y79A 5CDFE 3TU7H 2WYGA 1C2GA 2QXIA 1FN6A 3S9BA 1NU7B 3URDA 4I8KA 1HUTH 1KLTA 4MDSA 1MKXK 4I8LA 3ATIA 4X8TH 1PPHE 1W10U 1LO6A 2AIQA 1NROH 5EODA 1DVAH 3UNSA 1V2VT 1BT7A 3F9GA 1DLKB 2Y7ZA 4DIIH 2OD3B 3G01A 1GHYH 1BIOA 5HM9A 1S6FA 1ORFA 4FUHA 1OSSA 2B9LA 1SGEE 1FNIA 4CRAA 4F4OC 2ZDNA 1IQJA 4D76A 1N6YA 1CE5A 1EXFA 1XMNB 2Y6TA 3RXHA 1TGBA 2ZO3H 1T8MA 5ESBA 1UTOA 1P03A 3TNSA 3TH2H 4E05H 3A7WA 1ELGA 1O3OA 1Y3XA 4FUBA 2CHAB 5DP3A 1FPHH 4CRGA 3PO1C 5JYIA 3KN2A 3MNBA 1BTXA 1IQEA 3VFEA 3VB4A 2P95A 3SNBA 5GWZA 1YCPM 1GI0A 1Y3VA 2SGPE 2FOEA 1O2PA 2SGQE 2LIZA 1Z1JA 1A5HA 3QWCH 2ODQA 1L4DA 1WUNH 2HGTH 3TJOA 4MLFB 3A81A 1V2PT 2H5DA 2O8MA 1GBTA 1K1MA 2BLOA 1C2IA 4NIWA 2Q6FA 1W14U 5JBBS 2GV6A 2WV4A 2GX4A 1LVOA 1GDNA 1OWKA 2FTMA 1WQSA 3EDXB 4B75A 1LHFH 4UD9H 3DSGA 5IDKA 1ZPBA 1TGCA 3HGNA 4UFDH 2FM2A 1C5SA 5EXMA 2ZFRH 3TPIZ 2ZU5A 2KX4A 2CV3A 1CQQA 1IHTH 2PTCE 1S6HA 3F6UH 1DY8A 2GMTB 1GBCA 1CT2E 4Y10E 2BX3A 1TX8A 2F83A 5DP5A 5FPSA 4CHAC 4D7GA 4ZAEA 1O2ZA 2AFQB 2PR3A 2Y80A 1GGDB 4F55A 2JETB 4Y76A 5EGMA 3A8CA 5T6DA 2BXTH 1AFQB 4H6SB 4KELA 1AVWA 7ESTE 4FETA 1GPZA 1MQ5A 3ATMA 3T28A 1V2NT 2HLDD 1O2GH 4I31A 1IQLA 1SGCA 5DKMA 1QBNA 4OGYA 1HJAC 3MU8A 5GDSH 2NU2E 1QB9A 2HLCA 1PQ5A 1DLEA 5FX5A 4DIHH 1MMJN 3ZIAD 1FAXA 5DGJA 1C5MD 4X0WU 1S84A 2Z3DA 1GHVH 3B9FH 4AFQA 1J15A 1VJAU 2YNAA 1GBDA 1N8OC 1TA2A 2UWOA 1MZAA 1UVUH 4YXWD 4GHQA 4YOIA 1C5NH 2FXRA 1LHGH 4IW4E 2Y5FA 3AASA 3F9FA 2XRCA 3CP7A 2PUXB 5FL7D 3C27B 1TE0A 2P8OC 3MH4A 1G32B 3SOSA 4ISNA 3QK1A 3S9AA 1GMCF 1S81A 4UDWH 3FANA 3A82A 4R0IA 1BA8B 1BZXE 2IN2A 1UTMA 2FI5E 1GBBA 3A83A 1MKXH 1SB1H 5EW2H 2F91A 2ILNA 3TJUA 1W3CA 3F2GA 2BQ7B 2ZCKP 3PTBA 2LELA 3E90B 4FU9A 2BY6X 2QY0B 3SJ8A 3U28C 1ZMLA 4FUEA 3I29A 4UE7H 4B1TA 3RMLH 4KTSA 3BEUA 1YP9A 1EP5A 1E36B 1HAYB 1V2QT 2ZIQH 3MFJA 2HRVA 1QL7A 3NPSA 3M3VA 1BBRE 1EUFA 1A5IA 2ZU3A 2Y7XA 4B2AA 1XM1A 1UTKA 1PQ8A 3F9EA 1P3EA 3LGUA 2ASUB 4MNYA 1QR3E 4CBOA 4U01A 1ELFA 1H1BA 2ZF0H 1ELCA 1VITG 2OQ5A 2GZ9A 5GPIB 3MQKC 1QRXA 1O32A 3ZVEA 3N7EA 3SYJA 1P04A 3SJKA 1LHDH 1TBZH 3UUZA 1MABB 2A2QH 2F9UA 1ANCA 1Y8TA 5GNDA 4FUJA 1EZSC 1BMMH 1GMHG 4AB8A 2RA0A 1K1OA 2AEIH 2CHAC 1H8DH 2A5IA 2GT7A 1OP8A 2Z9JA 1SLWB 4BAQB 4M7GA 2GVFA 1EFRD 3KEEA 4E06H 2ZNKH 1A0HB 3U98H 4P02A 1O2VA 1XUJA 2TPIZ 3OY6U 3LONA 4I8JA 1NESE 1Q2WA 4U30A 1HAVA 2BLWA 1CGJE 3RXUA 1TGSZ 3GYLB 5EPNA 1BQYA 3OSYA 2ZHDA 1A7SA 1G3EA 1RTLA 4ABIA 2VVCA 2K0QA 1LPGB 1FY3A 2WPIS 4X2VA 4H6TA 4ABJA 1H8ED 1G3BA 1HAPH 3LDXH 5C3NA 1LDTT 2QV1A 1HYLA 3BTKE 2Z9IA 1DWBH 1AWHB 1P2NA 3SZNA 1CBWB 1Y5UT 1ZHPA 1KXFA 2D8WA 1PJPA 1CA8B 2DUCA 1BB0B 1YF4A 2K1QA 2L6OA 4WH6A 2R2WU 1TONA 1OX1A 2FOHA 4Q7ZA 3RXGA 2GMTC 1AIXH 5EG4A 1SSXA 4WMDA 2G4TA 4M9FA 1W0ZU 3GY3A 1TNHA 4MPVA 1O5CB 1GMDG 3BIUH 3PMBB 4ZCNA 1GGDC 1O3MA 4PROA 1TA6A 1ELEE 2VIWA 3I77A 3ATWA 2JETC 5GXPA 5DP4A 1EJMA 1F5KU 1ZTKA 1O2QA 2K8IA 3P6ZB 4FUFA 3QN7A 2CMYA 3KQEA 1DUEA 4K2YA 2J95A 4X6PA 4ABGA 3CS0A 4NZLA 4UEHH 1VCQA 4ZKNU 2G00A 4JYUH 3TNTA 1BDAA 4I8HA 4A5TS 2Y5HA 1V2UT 1GHBG 2GTBA 2C8ZB 1FIZA 3F68H 3OEED 3TK9A 3GY6A 1IHSH 1DXWA 1BTPA 4MPWA 1NPMA 3GICB 1E79D 1MU6B 1GBMA 1ZR0A 4IBLH 4K1SA 4FUGA 3OU0A 1EJNA 2R3UA 1FXYA 3O8BA 2FTLE 2ANWA 4UONA 1KXBA 1DFPA 4RT0A 1A4WH 4HG6A 2G81E 1L1NA 2ZI2H 1XUKA 1ZJKA 3HK3B 2BMGB 4MNVA 1MQ6A 3QZRA 1O3BA 4HGCA 2SFAA 4NIYA 5EXNA 2H2ZA 3L6PA 3SUEA 3E91A 4A1VA 1UTNA 4K60A 4H42U 1AU8A 1C1UH 5GIBA 1GCTC 1OXGA 1ZMNA 1ZHRA 3E3TA 3A7VA 1SL3A 1GL0E 1QBVH 2ODYB 2A4GA 1VCWA 4MTBA 1AB9B 1O5EH 1C9PA 1VITH 2A7JA 2F9PA 2QF0A 3M3SA 1OPHB 4NSYA 1RIWB 4YTAA 4AFZA 1GHBF 1C5XB 2J92A 1DICA 1V2WT 2ZC9H 1OWJA 4Y11E 2QF4A 1NFYA 2ZFPH 1AWFH 2O8TA 1RD3B 1VZQH 4ZH8A 2GD4B 4J2YB 1K1PA 1XKAC 4B6FA 1K21H 1Z1IA 2B0FA 2B8OH 1BTWA 3BIVH 1AKSB 1IQKA 1BTYA 4CRBA 1DDJA 1ZPZA 1V6DA 1DY9A 2GP9B 1EKBB 1LCYA 3UY9A 1DUAA 3M61U 1L4ZA 1GVLA 1NM6A 3K9XB 4OS7A 2R0LA 2H5CA 1NU9A 3A8DA 1ELTA 2F9NA 4NIXA 4YO9A 1FMGA 2UWLA 1VR1H 4AB9A 3A7YA 3KL6A 1KXDA 1NTPA 5EXLA 1Z8IB 5B6LA 1N1LA 2IOTA 1GVZA 2XNIA 1E38B 4D9RA 1O2TA 2W5EA 3ZZAA 3UPEA 2VIQA 2HPQH 2WYJA 2OC0A 4ACBA 3A7XA 4SGBE 1EAIA 2TRMA 1O34A 3LPRA 3MU1A 1W7GH 3MMGA 4WF8A 1EPTB 5F03A 1DS2E 1GI9B 3ZYEA 1GJ7B 3VEQB 1ETTH 1HB0B 1C1OA 1C1RA 2VH0A 1TABE 2BM2A 1KDQA 2TIOA 2BD5A 1F0SA 1SR5C 1GI6A 1MKWH 8LPRA 1GHXH 3RC5A 2VINA 1EASA 2GCTB 1FONA 4BNRA 4JMYA 3SNDA 5HIYA 1FY8E 1AZ8A 2D1JA 1LQEA 2Y5GA 1D3DB 2VU8E 2ZFFH 3M5LA 3A85A 1ZJDA 2VVVA 1GI7B 1TWXB 3KCGH 4YLQH 5ETXA 1O2NA 3SNCA 1FIWA 4ZXYH 3W94A 4KKDA 1GBLA 4KP0A 4DOQA 2GZ8A 1QA0A 2FIRH 2FOAA 2PTNA 1C5WB 3HKIB 2RFKC 1P2JA 4RT1A 3T26A 2M2AA 4O03A 4AN7A 2ZHEH 4JK6A 1MBQA 1YWUA 2PSYA 2BDBA 2Y82A 2BB4A 5A09A 1ZTJA 5IYTA 3LH1A 4CHAB 3SV2H 1LVBA 4UFGH 1BMNH 3NCLA 4B73A 3GDSA 2RDLA 2W6JD 3P8GA 4OS1A 2AH4X 3ZVAA 3RXTA 2ULLA 3E1XB 2EI8A 2IPQX 1A3EH 3SV9A 3Q77A 1HFDA 3RM2H 1ZGIA 3SI3H 1DT2A 3TGKE 3N7OA 1HGTH 4Q2KA 1Z8RA 1S0QA 1HAOH 1C5LH 1PYTD 4O97A 3VXEH 4Y7AA 4O3UA 1YLNA 1YY3A 2PLXA 1ZPCA 1RTKA 3MO9A 1SGFA 2QF3A 3RMOH 3A7TA 2BY5X 3STIA 3KQBA 1PFXC 3E16B 1MTWA 3KQ5A 2FS8A 2PSXA 4U32A 3UNRA 1QURH 1EZQA 2GDDA 3VB5A 2FOCA 1PPZA 3GDVA 4BAHB 3R3GB 1PPFE 3QGNB 2ZQ2A 1TQ0B 1GJAB 4INLA 4K69A 4AG1A 1NN6A 5HXFA 1MTVA 2M5TA 4P00A 1H9LB 1EZXC 4E7NA 2XC4A 5C5NA 3Q3KA 3SV6A 1CGIE 3VPKA 2V3OH 5C0TA 2BD4A 1YLDA 1GJ5H 1K1IA 1NRNH 3GYMA 4BTUB 1NRPH 1V2MT 3ODDA 3P70B 3O8CA 1O5GH 3BEFB 1AB9C 1ARCA 1YLCA 5EQRA 3SU6A 4CRDA 5B6OA 1RIWC 2EC9H 1DX5M 1AMHA 1NS3A 3W95A 2HOBA 2V35A 2RG3A 4BANB 2GJGA 2IJD1 1QIXB 3B8JA 1FN8A 1SFQB 2XXLA 1UK2A 3DSOA 3M7TA 1P2OA 4YESB 5DK1A 1LKBA 2UUFB 3BG4B 2WSSD 1GHWH 4X1RU 3D62A 1QRWA 2GKVE 3LH3A 4X6OA 2FX4A 1TMBH 1L0ZA 1L2EA 4R8TB 1TRYA 1HXFH 3IWMA 1XUIA 3BTTE 2UWPA 1DITH 4WVPE 3MNSA 1F0UA 1F7ZA 1TPOA 1KYNA 2KCYA 1AVGH 3UR9A 4XFQA 4AGJA 1TB6H 1FPCH 4NA7A 4MVNA 3LIWA 4DY7B 2J2UA 5HIZA 1SGRE 2H1UA 3LT3A 1BUIA 1O2LA 1QJ1B 1P11E 2GCHG 2C4FH 3GY4A 3OTPA 3TITA 1IQIA 2AHME 3A88A 1HAXB 2EEKA 1HJ9A 1TNLA 5E2PA 4DVAU 2VB0A 5DP9A 1SGTA 1TPPA 4NFEA 3GY2A 1UTLM 1OKXA 2WPDD 1OWEA 3IG6B 2PKAB 2QGRA 2KAIB 4OS2A 2JH5D 3GY8A 1EPTC 1HNEE 1K28D 2YNBA 4AG2A 4D8NA 3QLPH 1ABIH 2QXJA 1SBWA 5AVDA 1EATA 4XBCA 4LZ4B 1SC8U 1UHBA 1Y3UA 2BZ6H 3RDZA 1VGCB 3UQOA 2ZG0H 1CA0C 2ZDMA 3MNCA 5AHGH 3KYGA 1HV7A 1UCYE 3EA9A 2GCTC 2WV5A 1E34B 1MCVA 1MTSA 1GHAG 1WQVH 1AUTC 1S82A 1CU1A 3MH5A 2OP9A 1C1NA 1O5FH 1P0SH 2FWWA 3RMMH 1BITA 1UVPA 4DT7B 3SN8A 1ANDA 1BMLA 2J97A 3EQ0H 3SW2B 4YOGA 2FYQA 3F2FA 2J38A 1J8AA 4BTIB 1HIAB 4I86A 2ZGBH 1SI5H 1V2JT 3PRBA 2PKSB 2FLBH 5C5OA 1F0TA 2YMSC 3F2HA 6GCHG 1TAWA 1IOEA 1SMFE 3ZZ5A 1ZGVA 5FX6A 2R2MB 1FY4A 3VB7A 4JZFH 3H7TA 5CHAC 5CE1A 1V3XA 1EOLA 2P3FH 2ZFQH 1JOUB 1O2HA 1HDTH 3ZVCA 2VWNA 1QL9A 1SG8B 4FU8A 4B6EA 5K7RA 1CVWH 1OS8A 2C8WB 2G8TA 2YOLA 4JCNA 1C4V2 1C5ZB 1BRBE 2VWMA 1YM0A 2JIZD 1TMTH 2BDGA 4A92A 3AW1A 1ZZZA 1YPEH 2BLQA 3KYFA 1FQ3A 3MWIU 4KGAA 4WWYA 1Q3XA 2J98B 1O2WA 2ZHQH 1TRNA 1ZRBA 4IC5A 2Z3EA 4AZ2B 4CREA 2BD7A 4ASHA 1C1WH 4CH8B 1LVMA 4MPXA 2DE9A 5EJ1A 3M35A 5C1XA 3RXCA 1GJ9B 1C5VA 1QB6A 3FAOA 3RM0H 1H4WA 4IC6A 1BOQA 3RXLA 4CRFA 4A6LA 2A7CA 1YC0A 3SQHE 1ELDE 2GZ7A 2OLGA 1T8NA 2GV7A 2TGDA 1O5AB 2WPHS 3VB3A 4F48B 3D23A 5KECA 3P8OA 4Y7BA 3RC6A 2H9EH 3VXFH 4FOUC 1BMFD 2KCAA 2C93B 1UVOA 4TPYA 2PUQH 1S85A 5DG6A 4ZXXH 1Q31A 2F4LA 8KME2 1L1GA 1GJBB 2OBOA 3GISB 5DN6D 4INHA 1OWIA 3UWIA 2H9HA 1C4Y2 2W7UA 1C2MA 1H9IE 1PPEE 4THNH 1GCTB 2OQUA 3BTEE 3RU4E 2VNTA 2QYIA 5C67A 3SU5A 5L2YH 1WU1A 1HAZB 5BPEA 3ATLA 5HYOA 3V3MA 3PMHB 1BCUH 3MH7A 1J14A 1OWHA 5F8XA 8GCHG 5EIYA 1KMHB 1FLEE 3SQEE 2PW8H 4A1TA 4YT7H 3BG4C 2UUKB 4K3JA 5J4SA
chains in the Genus database with same CATH topology
2O9QA 2ZP0H 2OC8A 5CMXH 1CHGA 3OY5U 3RU4D 4YM9A 2V0BA 3PMAB 4GCHG 1P9SA 1OP0A 4FVBA 1J9CH 1PQ7A 1BMAA 4CR9A 3RXFA 4BTTB 2G4UA 5F8TA 2BX4A 1SLUB 4Y71A 2FEQH 3S7KB 1Z7KA 3T25A 1FDPA 4WH8A 1NZQH 2C3SA 6LPRA 1C5YB 1PYTC 3K2UA 1ZSJA 1O2MA 3K6YA 2H9TH 3LC3A 2WPLS 5E0GA 2BD3A 1PPGE 5JB9S 2J4IA 3MH6A 3UREA 1TGNA 3LGIA 3UOPA 1O39A 2ZDAH 4JZEH 1FAKH 1XXDA 1UJ1A 6CHAB 1ZSKA 3SHCH 4CR5A 2FOGA 2O8UA 1VGCC 1FV9A 2BOKA 3UTUH 2PKAA 1TQ7B 5EQQA 1DANH 3UWJH 7KMEH 4H4FA 4ZUHA 3A86A 1QA7A 5DP7A 7GCHG 1IQFA 1O3KA 1VITF 5H4IB 2VIVA 2STBE 1TRMA 4GUXA 1D9IA 1PPBH 2FO9A 2ZWLH 1WTGH 3NKKA 1C5RA 2QN5T 1CHOG 1Z6JH 1ZMJA 1T4VH 1QFKH 4HTCH 1GI5A 4I33A 2SNVA 2LPRA 1G2LA 1O2RA 2JKHA 2ZDKA 2BZAA 1SHYA 2PKSC 1IQHA 5SGAE 3E6PH 1GMHF 2A31A 1TOMH 1P05A 2K7XA 4TWWA 3F9HA 3RP2A 2Z3CA 1H9HE 4X1PU 4CBNA 4CRCA 1QJ7B 1YPGH 1JBUH 2OTVA 1HIAA 2BDYA 3QTOH 1XVOA 1GJDB 3V13A 3LJOA 2BQ6B 5FCRA 2AGEX 4TY6A 1EAUA 3DT0H 3Q3YA 1HAGE 1EB2A 1JMOH 4MG3A 1O31A 3QO6A 1UO6A 1AUJA 2IJOB 9LPRA 3QDZB 3BSQA 2Z6BD 3TGJE 1D3PB 2NWNA 3EYDA 1QJ6B 1DSTA 3GOVB 3QX5H 2W7SA 1ZOMA 2VGCB 1TPSA 3TJVA 3HATH 3OYPA 2DE8A 2C8YB 4MPUA 3M36A 2A32A 4B74A 2A4RA 1HAHH 1P12E 1K2I1 1SOZA 2G55A 1EB1H 2Z7FE 3S9CA 2O8WA 2ZGHA 1GJCB 1GMDF 2AMPA 1TX6A 3I78A 4X2YA 1WSSH 1SGYE 1RFNA 2NU4E 1YPKH 1S5SA 5A0AE 1AO5A 4NZQA 5C1UA 2BVRH 3M7UA 4LOYH 5GCHG 2VIPA 3AAVA 4JK5A 1SGQE 3A7ZA 1EZUC 2O8LA 1HCGA 1MAYA 2ZQ1A 3RUOA 3V7TA 1O33A 2QA9E 4NWLA 1GBKA 2WPJS 5T6FA 3U8OH 2BY8X 3DFLA 2EI6A 2A0QB 3TK6A 2F9BH 6ESTA 3GY7A 1ZLRA 4DG4A 2SGEE 2VJ1A 1IQMA 2FS9A 5AFYH 1P06A 2NU1E 4LZ1H 4ABFA 1P2IA 1EAXA 3E0NB 4NA8A 1SGIB 2C8XB 2BYAX 3EBNA 2BDAA 3P95A 4OGXA 1GDUA 3RXOA 1C5OH 1GJ4H 5E8EH 3GCOA 3L3TA 1A0JA 2P3UB 3UFAA 1C9TA 1LPKB 2ZHFH 1P2KA 5DP8A 1GI4A 4XOJA 3DUXH 3V0XA 1UVTH 4ZKSU 2BLVA 5ESTE 1NFUA 1HAIH 3PTNA 5A8ZA 3TLOA 2A5AA 3D49H 4ABEA 2XBXA 2D26C 4NA9H 3KIDU 2AYWA 3RXMA 3QUMP 1ESBA 4DURA 3EA7A 2PGQB 1O30A 1TNIA 4K8BA 1C4U2 1ANBA 1B5GH 3T5FH 1TLDA 4JYTA 5JBAS 2BD8A 4NGAH 1O3FA 2QXGA 1RXPA 4HZHA 1FY5A 1WBGB 2THFB 1TYNA 1UMAH 6CHAC 3SJ9A 1HRTH 4WMEA 1AE8H 3VB6A 1CO7E 4WJG2 4OS6A 1QBOA 1AI8H 3DA9B 4KTUA 1O3LA 1CA0B 1O2YA 3RXVA 5A8XA 3BN9A 2XCFA 2ZCLP 1DSUA 1BBRK 2FOMB 1ELVA 1O3EA 3U8RH 5JPMH 2I6SA 3ATKA 1BJUA 3S0NA 1SGFG 8ESTE 4B76A 1E0FD 3U1JB 1A2CH 4WY3A 4XBDA 1C1PA 4X6NA 1E37B 2ZGXH 2BD2A 2ALPA 1INCA 2ZPQA 4OS4A 2ZCHP 1RTFB 5LPRA 2ANMH 2VIDA 4B2CA 5FAHA 4JZ1A 3T27A 4AFSA 2ANYA 1KXCA 2VH6A 1AHTH 2AERH 3HPTB 1GDQA 3H5CB 2PGBB 7LPRA 2TBSA 1P2MA 1O3JA 5CHAB 4ZHLU 1SQTA 1C5TA 1XKBC 2QIQA 3TIUA 2ESTE 5LGOA 1ZYOA 4IMQA 4GAWA 4INKA 2ZEBA 2NU0E 1W12U 5K0HA 4ABHA 3LGTA 1RRKA 1ELAA 1ELBA 2OUAA 3PMJA 3UR6A 4WXIA 3ENSB 4Q7XA 3RXPA 4RSPA 3ZVDA 1LHEH 1Y3WA 5DP6A 1P10A 5A8YA 1O2OA 2F9OA 1O3CA 1BTHH 4XE4A 1C1TA 3H7OA 1Z8JB 4MNXA 3ZVBA 1UTQA 1BHXB 4IMZA 2Y81A 4TY7A 1Z71A 2VGCC 5T3HA 1G3CA 2SNWA 9ESTA 2BY9X 2CN0H 3M37A 2XC0A 5I25A 2XBYA 2F9VA 3EA8A 1D6WA 3ZV8A 1B0EA 3SU3A 1Y5AT 3PROA 5LPFA 2R0KA 1NFXA 4ZROA 3LGVA 4YLUA 2ZA5A 3Q76A 1K9OE 5FPTA 5J4QA 1O2KA 3RXEA 1V2TT 1AN1E 5DPAA 3SU0A 2UUJB 1W2KH 1XXFA 3E8LA 3FP7E 5A0BA 2J94A 3JZ1B 4KTCA 1OP2A 2BDHA 3KHVA 3IITA 2V3HH 4UFFH 2FI3E 2ZDVH 1J17T 1SGDE 2BOHB 4X1SU 1ARBA 3BTHE 3ZZ4A 1KLJH 1W7XH 1FY1A 3FP8E 2AMDA 3BEIB 2SGFE 5EPYA 5FCKA 1A3BH 1D6RA 4FUIA 1QRZA 2TGTA 1DE7H 1QQ4A 1LVYA 1MD7A 5FBIA 3P17H 2ANKH 4NWKA 3SO3A 4B71A 4HI3A 1O2SA 3TK5A 3RXIA 1YPHC 2TGAA 4AGKA 4O9VA 4XDEA 1QY6A 3ZZ3A 2JH6D 2WPMS 1T8LA 2BHGA 4ZKOU 2PV9B 4SGAE 3A87A 1WAYB 2A7HA 4JYVH 1AKSA 2BDCA 2XTTB 3L33A 4BXWA 4X6MA 1G36A 1ZSLA 4X1NU 3SUDA 1P2QA 3P8FA 2D2DA 4A7IB 3KGPA 4U2WA 1P8VC 3RMNH 1O3AA 1BBRH 4FUCA 2W26A 1GI3A 2ZDLA 4NIVA 2ODPA 3ZVFA 1Y5BT 2OC7A 5E0HA 2VWOA 2WINI 3ZYDA 5JBCS 3SU1A 1TX7A 1A61H 3RU4T 1GJ6A 2GGVB 1EPTA 2FP7B 2IPHA 1SHHB 5EW1H 3FZZA 3PLPA 3MO6A 5TCAA 2A1DB 3NZIA 1GI2A 3SV7A 3TVJB 2P16A 4Y6DA 5C2ZA 4MNWA 1DM4B 1HAVB 1TNKA 1O3IA 2EA3A 1THSH 2OBQA 3SGAE 1O5BB 1C5QA 3ESTA 1YPLH 4E7RG 2GCHF 2PHBA 3GCTG 1AQ7A 1JIMA 3BTME 3LJJA 1ZTLA 3RC4A 1DPOA 1W0YH 1C5UA 2ZKSA 1XX9A 2FESH 4DJZB 1UTJA 2VIOA 1IQGA 1O2IA 1K1JA 4Y8XA 3M5MA 1ACBE 3PWBA 2ZPRA 1TNJA 4I7YH 3A8AA 1ID5H 2VVUA 2BVSH 2ZZUH 1C1MA 1EX3A 4LK4A 4ZHAA 1IAUA 1V2ST 1G30B 4NCYA 1SLXB 4I8GA 4ISHH 1BHXF 1FJSA 1GHZA 3FFGA 3UIRA 1P02A 1WYKA 2ZPSA 2OXSA 2ZGCA 3ZZDA 2A5KA 1GHAF 1LKAA 1CSOE 1WOFA 4I32A 4ABDA 3EGKH 4VGCB 1C2EA 1MTUA 3GDUA 4NG9H 1P3CA 3GCTF 2CJIA 4GSOA 3RXDA 3A84A 5A2MH 1JXPA 2JH0D 4WXVA 2GDEH 1G9IE 1GMCG 4J1YA 1RJXB 6GCHF 3M5OA 1BRCE 2FX6A 1FUJA 3OX7U 3RXBA 2ZECA 2FDAA 1RS0A 3OTJE 3RXAA 4D7FA 5L2ZH 4BAMB 1YCPK 3TH3H 3LGYA 4ISOA 4MQAA 2Q6DA 2RA3A 3RLYH 3QTVH 3HK6B 1O37A 5L30H 5L6NH 1O2JA 1F5LA 1W8BH 1O2XA 1U6QA 1HXEH 1M9UA 1WCZA 2G5VA 5F6MA 1G2MA 3BF6H 1O38A 1H8IH 1MTNB 3GY5A 3SV8A 4DW2U 2ZTZA 1IQNA 2P59A 1P01A 1O36A 2XBVA 4X8UH 1ABJH 1EJAA 2R3YA 1LTOA 1DXPA 5GJ4B 3MO3A 4Y8ZA 4AX9H 4B2BA 1NO9H 4ABBA 3ZVGA 3KQCA 1YPJH 3TJNA 1OOKB 2UUYA 2A2XH 3AAUA 5JDUB 4TYDA 3DD2H 4ISLA 5JBTA 5TJXA 2ZHWH 3Q00A 1L1JA 3PLBA 4ABAA 1TFXA 3ZZCA 3GCHB 1SOTA 5AFZH 1EP6A 1C2JA 4RKJB 4Z6AH 3HGPA 1A0LA 1ETRH 1SGNE 3QGJA 4FXGH 1W13U 1Y59T 2XWBI 1KTTB 1N6XA 2FLRH 2B7DH 3SGQE 3M3TA 2HWLB 1C2FA 2HNTF 4K1TA 5BRRE 1TMUH 3UQVA 2P93A 2FOBA 1EOJA 3BTGE 2FODA 4Y0YE 3SORA 1V2KT 2QC2A 2F3CE 1A1RA 4NSVA 5AF9H 2C90B 8GCHF 2HNTC 1GBAA 1KLIH 4XSKU 1ZRKA 3M7QA 1B0FA 1K1LA 1THPB 1F2SE 1SLVB 2QCYA 3P8NA 1GBFA 1MBMA 1KIGH 3GCNA 1WV7H 1BJVA 1O3NA 2KAIA 3SNEA 2HALA 2H6MA 1ETSH 4IGDA 1XVMA 4GCHF 1O5DH 1X7AC 1XUGA 5C20A 2HVXA 1KDQB 3MU4A 5HM2A 3S69A 3BTFE 5DJ7A 1C2LA 1MUEB 3SUGA 1YPMH 4HFPB 4Y0ZE 3LKWA 1P9UA 1XUFA 1QQUA 2OINA 4GPGA 3BG8A 1QL8A 1YPHE 2Z9LA 3U8TH 1VJ9U 1SVPA 3A8BA 3SGBE 1DWDH 3UOUA 3MNXA 1GI8B 1BTZA 4X2WA 1KY9A 1VCPA 1A46H 5ABWA 4F49A 1EAWA 3A89A 4XBBA 1TBQH 2WUCA 5EQSA 2WPKS 4FVDA 1AGJA 1TGTA 5EU8A 4BOHA 1AE5A 1MKWK 1TBRH 3ELAH 1O3HA 1XUHA 1C1VH 2ZFTA 2AMQA 2ZTXA 2STAE 3PM3A 2W3IA 4Z0KA 1SQOA 3Q3XA 1ZHMA 3VGCB 1QGFA 3RXRA 2SGAA 5LH8A 3LU9B 2HPPH 7GCHF 5DO4H 3MHWU 1UTPA 4NFFA 4GVUA 4YZUA 3RXSA 4VGCC 1AY6H 3SI4H 1CHOF 1EQ9A 1UCYK 4AYYB 2BD9A 3MU5A 3O8DA 4AFUA 2RCEA 1NT1A 1FZZA 1MD8A 1YCPH 1O2UA 4YOJA 1AFQC 1C1SA 1Z8GA 1P09A 1ANEA 1WTHD 2BVXH 1QCPA 1Y3YA 2ZFSA 1OYTH 3M5NA 1O0DH 4AYVB 1O3DA 4IS5A 3U69H 1HLTH 4JZIA 1SFIA 2A45B 2W3KA 3FVFB 1HPGA 2R9PA 2BDIA 1TOCB 2Z9KA 3SJOA 2TGPZ 2FMJA 2G51A 2J9NA 5LPEA 1JIRA 3CS7A 3ZV9A 3O8RA 1C1QA 1NY22 3SHAH 4ZKRU 4CH2B 2ZU2A 1THRH 1GWAA 2A4OA 4OS5A 2ZTYA 3MU0A 1QB1A 1BRAA 1GBJA 3ZZ6A 1UK3A 1NRRH 1YGCH 2CF9H 2ZU4A 2OCVB 4WMFA 2Z9GA 3BTQE 1FI8A 4IN2A 3DFJA 1KTSB 4Q80A 1O3GA 1MTNC 3SNAA 1PPCE 1C5PA 1GVKB 1C2HA 1BTUA 1LPZB 2BTCE 4BXSA 5E0JA 5JB8S 2FYRA 3S7HB 1RGQA 1KXEA 1NC6A 1G3DA 4O3TA 2CXVA 2QAAA 1F0RA 1V2LT 1CT0E 3SU2A 1GBHA 2P3TB 3F1SB 1ESAA 3BV9B 5C1YA 3K6ZA 4K8YA 2B5TB 3FZDA 3PYHA 3TH4H 1AD8H 2AIPA 3ZZ7A 5A0CA 4DGJA 3BTWE 3NWUA 1K22H 5EOKA 1T32A 1CGHA 5HMAA 1NFWA 3NK8A 5G4BA 1AFEH 1MH0A 3SU4A 2NU3E 3ITIA 3GCHC 2FI4E 3D65E 2FOFA 1F92A 1MU8B 3MOCA 1C2DA 1E35B 1GG6B 1KXAA 2I6QA 1LQDB 3KF2A 2AGGX 1QHRB 3SUFA 2V6NA 2XWAA 2ZGJA 1D3TB 1V2OT 4QT8C 3LGWA 5GCHF 3MTYA 1JRSA 3PWCA 1F5RA 4GHTA 4Q7YA 1TALA 3K65B 3UNQA 1LHCH 1T8OA 2WUBA 2Z94A 3STJA 3EAJA 4X1QU 2EI7A 2LNCA 4D9QA 1SPJA 3R0FA 3EE0B 3DHKH 1S0RA 1NRQH 2G5NA 1DOJA 4ESTE 5FPYA 1A5GH 5HGGA 5T6GA 5I46H 1GL1A 1SGPE 2Q6GA 1UHBB 3KNXA 4X8SH 2Q1JA 3PO1B 3B23B 1T31A 2G52A 1MAXA 4ZMAH 1GCDA 1T7CA 3NUMA 3ZZBA 2GT8A 4AOQA 3AW0A 3HKJB 4IN1A 1AVXA 3P92A 4X2XA 3URCA 1QTFA 1TPAE 1MZDA 1JRTA 3PLKA 2XC5A 1OYQA 2XCNA 3SBKA 4K5ZA 1T4UH 5FHTA 2FZZA 4AORA 1V2RT 2OC1A 1ESTA 1NRSH 1C2KA 1TIOA 1GJ8B 1P57B 2P94A 5E2OA 1HJ8A 1UCYH 4YT6H 1YBWA 1D3QB 1MCTA 1CBWC 1PQAA 2AS9A 2QXHA 4TPIZ 3RLWH 3VGCC 4GLYA 3NXPA 3U1IB 1BRUP 1D4PB 3TGIE 2HNTE 4ZHMU 2XYAA 4LXBH 3LOXA 5F8ZA 2A4QA 4BAKB 4BAOB 3ODFA 4FUDA 3T62A 1KSNA 4JZDH 3WY8A